3QWQB

Crystal structure of the extracellular domain of the epidermal growth factor receptor in complex with an adnectin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
b'DVPRDLEVVAATPTSLLISWDSGRGSYQYYRITYGETGGNSPVQEFTVPGPVHTATISGLKPGVDYTITVYAVTDHKPHADGPHTYHESPISINYRTEID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor
publication title Structures of adnectin/protein complexes reveal an expanded binding footprint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwqB00
1WSST 1FO0A 4WVRA 5JW4M 4NFCA 4OIAA 1OF2B 2YK1H 4WUUB 3HLAB 1TXKA 1J9CT 5DMGD 1B0RA 5DFTA 4E0RB 2DICA 1MHHA 4I5BB 4TPRL 4YHPA 2JELH 43C9B 4JQXC 3NCFB 5C8JA 2AK4E 3AB0B 3MRJB 5F1OB 1JGLL 5JTWA 3LRSA 1A6ZB 1MCPH 1A4KB 1IM9A 2W91A 3CPLB 3F62A 2BCKA 4JB9L 1PKQA 4PGZA 5IVZB 3UAJC 1XIWC 3BDYL 3PL6D 2O5XL 4NUGL 5DHYB 3MRRB 4JFZL 3MRGB 2AJUL 1QBBA 1LP9B 3SGJA 1OARL 1RVFH 2RFXB 1Q0YH 3LKPA 1E4WH 1P84K 2UY7A 1ZSDB 4PLNC 4PP2B 1HHHB 4OFVA 5J3HD 5EU6E 5CMAB 1S7VA 1R5IB 1WWWX 5IB1A 3NTCL 2FLRT 1I75A 4XPAH 1CGSL 2GITB 4WUUE 3TBVA 4RFEB 5T1KB 5CEYB 4PJFF 5H94A 1U8OA 3SDCC 3IDXH 4P3DA 2J5LC 4XCCH 4PBWD 4IMKC 3TIDA 3IB4A 3CZFA 1FN4A 3EFFB 3FQTB 2YZ8A 1GAFH 1JFQH 1YY8B 2IBBA 2Y5EA 2XFXB 4M3KB 1ZXQA 2UZXB 3D18B 1BQHG 5LKNA 1YJDC 2YD9A 2H2SD 5C0EB 2HJLA 3I6KB 3TO4C 1KTKE 4MAYD 1NFKA 5CJOH 3GMQB 2UVEA 1T3FB 3FT3B 1XGPA 2H32H 4FN0A 1ZANH 2AJZA 4ZXBB 4Y5YA 1I1CA 2PYFA 3EO1A 5CSGA 1K2DA 1NMAH 3E2HC 1T7YA 4JKKA 5I8EA 3KPLA 4YE4L 2UYLB 4RRPA 1D5BA 4LLAA 4R7DB 4I0PA 3KPTA 3IS1X 4DKEL 4LSQH 1NLBL 1T4KB 1P5VA 1VGEL 2OZ4H 5INDB 4LGRB 2J8HA 3KS0J 5ESAB 2EDJA 5C3LD 3KPRD 3PQYD 4HWEL 4Z7QF 1F4YH 1H3XA 2MOVA 1PJ9A 1MCOH 4V1DB 2HKHH 3MACL 4HKBA 4NQXB 3U4EA 3FFDA 3WIHA 1P4IL 1D5ZA 1CFVL 2NY1B 3H9SB 5JUEL 3U0WH 1DBAH 3FB6B 4JDVA 1T1WB 4OUUB 1Z3GL 2VLKE 4WENB 4F9LA 4PJEA 3I6GB 3B8YA 1YYML 4XI5D 5E8EB 4XC1H 4LFHD 2EDTA 4XNUL 2DJUA 5JHDD 4UILH 1XF2B 3V4VL 3KLHD 2Q76A 5F97E 3T0EA 1T20A 4HKJB 1ROWA 4PJ7A 4PUBL 5J1SC 2A0LD 4CVXA 2KUTA 1U93A 2NY7L 3QEHB 5T3ZD 4V1DE 4EDWL 2DQUL 1VSCA 4GW1B 4WI5A 2GKIA 2WUCH 2YUZA 4P3CH 1TETL 4EOWH 2F58H 4XMKH 5EORH 4OJFL 4PJ9B 3KJ4B 4UUJB 3MV8E 3M1BA 2NW3B 3PABB 2R0LL 2XIDA 4XPFL 1A6VL 15C8H 1S3KH 2PCPA 1A22B 3RWIB 4JRXD 2CQVA 3IDMB 1FFPA 4P2YA 4AG4H 2OS7A 1DEDA 3MRLB 1KFAH 4NWUL 3MCG1 1NC4A 3UJTL 1TJGL 4ODUB 3VE0A 3PIQA 1VEOA 1ORQA 1S5HA 2Y7QA 2HFFA 4HV8B 1DBJL 4F7PB 3MV9D 4KKCC 1H5BC 4XMPH 2ZOLB 4JFFB 4GBXD 3FZUC 4P9HC 4HIEB 4K3EL 3L3DB 1S7XB 5I1LB 3IDJA 4KK6C 4OB5H 4D0CB 3NH7L 3ARED 4FP8L 3U36A 3QCVH 4J4PD 5B3NA 3AS1A 3BKCL 5KSUB 5LG1A 5GHWL 1AGFB 4GFTB 4NZTH 1QO3B 3W82A 1X5KA 4POZC 3VRJA 3WE6B 3OWEA 3V0WL 2E7MA 2QKIB 1NEZA 4G8IA 5D71L 4H26A 1G7QB 3WO3B 4PFEA 3WUWA 5FYLH 1G9MH 2FYYB 4PJAB 3PXHA 4JDTH 1N6UA 1OP3H 4HUNB 4GAYB 4PRPB 1B2WH 4NWTH 1HHIB 1FFNB 1KJVB 3CH1B 5GGRB 4NYLB 1VEPA 2FSEA 3VFTA 5E9DB 1BHGA 2LQRA 3C6SA 5JQHC 4G7YH 2DTSA 4HQQL 4X6EB 1HKLL 3PWPB 5FCUH 1T2QL 2PXYC 3KYMA 5B38A 2R2HA 4LNRA 4JANA 4XNXH 1BIIA 5EU5B 2XN9A 4HWBL 2WINA 3BUTA 3KYOB 3BPNB 4ALAL 3ULUC 4CMHC 5BS0A 3S4SA 4PRBA 1WT5C 3O6FA 4GLRH 4H88L 1A9EA 2CLZB 5E00B 2DJ4A 3LPGA 2BSTA 2GW5A 4O2CB 1J0KA 3DX9A 5CGTA 5I18H 1N3NA 4K71C 1ZWIB 1X4ZA 1MRDH 3BGFC 1KPUB 4BH7B 3QFJD 4KZEL 4HAGA 1FH5L 1CFTB 4LBEA 3S7GA 1WZMA 4YAQB 4KHXH 5DQ9A 3DYPA 3V7AG 1FNLA 1S8DB 2ICCA 3IDUA 3MROA 4JQVC 5F9DC 2E7LA 3OB0K 2R2CA 2H26B 1NAKH 2ZWLT 1UZ6F 3VD5A 4XP1L 3ULSA 3S3JA 3DV4B 5AAMA 1ZLWK 4NO0D 1EK3A 2DB8A 2IPUG 2IPTH 2MCPH 4MSWA 3FOLB 1UZ8B 2DQEH 5L2JB 1ZVSB 3U79A 3IAQA 4U1JB 4YDKL 3LS5L 3MJ7A 4PGDB 3VFOA 3T65A 5TH2A 4GRLD 3EIFA 1W2KT 5KAQF 3C8KB 2ITCB 3IXAA 1XF1A 2LABA 3DVNA 4H0HB 5J13B 2HMID 1HSAA 1DDHA 3ZKSD 3B2UC 2XWJA 2VXUL 5J4MA 4EUPH 5KSBF 2AXFA 4C58B 2R4SH 4KPHL 2VAAA 4NQDD 5CIPA 1KACB 2KQNA 3JWNC 2VXQL 3GGWA 4XAWH 2ADJA 1CGWA 5GXBB 4M1GH 4FG6C 2V2TB 1FL5B 3WKNA 3P4MA 4M1CD 1S9XA 1PEWA 2R2EA 3JTSA 1I9EA 2WNGA 5DRZA 5KJRH 4IJ3C 2I9LA 4NJAH 3RWCB 4N9OB 4U1GB 4YNYA 1OAUH 4YPJA 1P2CB 1U8IB 2XXCB 3HZKB 1EHNA 5FDYA 3KXFB 3R06B 4WY7H 1AI1L 5A3ID 1A0QL 5C86A 4FQJL 1NBZA 2F53B 5TQ2H 4MQTB 3P2TA 3PXJA 1IQWL 4CJ1A 4CNIB 2VISB 1RZGB 4GG6E 1IAIM 4OD1H 2HT2C 2YPLA 3SY0A 1ND0A 3WKMH 4UT7L 4P0DA 5GRJH 3ZDYE 2R39A 5HYJB 1J7VR 4JO4L 3TV3H 1I1RA 4DFIA 3ULVL 4X6BA 4U7SA 1OW0C 1D5MA 1NAMA 3G5ZB 2VDRH 2YD1A 4I18B 3RVXD 3IKKA 3I9GH 2XPGB 1LE9A 2JB5L 2SEBB 2OR8A 1UB6B 4EUPG 3GK8H 4RCAA 3RJQB 3MFFA 2CDGA 4TTGA 2BNQB 4YXKL 2IPKA 3FRUB 2F5BH 4JJHA 3QBTB 4NCC2 4NO5A 2EIDA 4YH6A 2GFBA 2F53E 4LVNB 5SWSD 1MEXL 1KLUB 4XB7A 3GM0A 5IROA 3VFRB 1PAMA 1T04B 1ZMYA 5KG9A 3I50H 3NMEA 1XR9A 4QRPA 1GPOH 4JQIH 3TWCH 3WLBA 1Q0XL 5FA4A 4OAWA 2GAZB 5C0CB 4QY8A 1CWVA 1IC7L 3QIUA 2DI7A 3NVQA 1IGYA 5EC1B 4K7PH 5GRVK 1YMHB 3IFPB 1IAOA 1PKQE 3O9WD 2R69H 3MV7A 2BNQE 1KPVA 1M7XA 4X6DE 5T3ZL 1KTDB 4HFUL 4PRDB 1VGKB 4QRRA 1FZMB 3OAZH 2IEPA 3HAEA 3P73B 4KQ3H 4ETYA 3QUMB 1XZ0A 4OI9A 1G0YR 5HD8C 3TC9A 4Y4KD 3NACL 3VFUB 4PIRF 5EZIH 4NBZB 3QIBB 3VRIB 1WCQA 5I71B 3JWOL 3DRQA 4PP1C 4CU6A 3S3PA 1FNSL 4OLWL 1JI1A 5HDBE 3ARVA 3SO5A 2WLYA 1HQ4B 2VITA 1A5FL 1D9KC 4N8CH 3IJSB 4Y2DB 5EO1A 5F96L 2NXZC 4LLWB 3GBMH 2DD8L 4MD4A 1Y0LA 2P46B 5FKAA 3L9RA 4M61B 1IM3B 5E70A 5C07A 1ADQL 2ZNWA 4X5WA 5GGQL 5L88H 1NC2D 3C60B 3PWJA 5F21B 3L6FB 4P9HH 2F74A 2NY6C 4C83A 1U3JA 1AGCB 3HKFA 4IRSD 2HN7A 4AY0A 3FB5A 1SBSL 4WV1B 1INQA 4N8VB 4HJ0C 3P4NB 3UDWC 4QXTB 1LEKA 1FIEA 2C7UA 5ADOL 1EEZA 1FNEA 1KELL 1J8HA 4YXLL 4M6OH 3HE6A 3QDMB 3U9PH 5GISL 2EXYC 3TLRA 5AD0A 3A0OA 4AENB 2H8PB 2EECA 4KAQL 4U1KA 4HC1A 4Q9CA 3F6IA 4JO1H 3VXSD 3ZTNL 2VL5A 1NFDF 1CDCA 5I66B 2R15A 4KTEL 4R3SB 4X4YA 2VZ3A 5DZOA 5I8OL 5F7NC 4L4TD 3SEPA 3MV11 5IB2A 2XQYK 1UGNA 1UWGL 3CGTA 3D85B 2EO1A 3HS0B 2CKBL 4KJYA 4GKNA 3FT4A 4Z76B 4Z6AT 4WWKC 4MCZB 3ULUH 2PTTB 2HT4D 2J7LA 4WIQA 1G0XA 2CMRH 4UIMB 5DUMH 3A6BL 5EOCH 3EYQC 3UBXG 3QDME 1F90H 5AYUL 2CK2A 5TE4L 1MHEB 4P2OB 3I75B 4PJGB 1J88A 2V2XB 4NJ9L 3U46A 4Y4FB 2X89A 1A1OB 3WD5H 2W0FA 5FGCE 5BZWA 3I2CL 3STZA 3DROB 4ZO8A 4E41D 7FABH 4Y5VA 4EIZC 4GRWH 3MLSH 3RWDA 1S9KC 2PO6D 4P4KA 4NQTA 3KPOB 2D2OA 5C0BD 1WWBX 3LKRB 2QADD 3WS6A 3W5MA 1I1AA 1VFAA 3TZVC 3GMPB 1BZ7A 3D39E 3QI9D 4NOFA 5D7JB 5E5UB 4BQCA 2L4OA 2JB6A 4LASL 4AH2A 4JZJA 1YEGH 3CLEL 4Z95H 5KOMC 1W72L 1NCAH 4O4YL 5IFJA 5FUZH 4GAGL 3L3HB 5EZOL 1KC5H 1BVKB 4AQOA 1VB9A 2M26A 4LCCA 3RGVC 4D9LH 2VSCA 5D1ZD 5C0DA 1XF4A 2XQBH 3ARUA 1J0IA 1ZOXA 3RNKB 4NBXB 1T80A 2FR4A 3MRNA 2NY3B 1OB1B 3RL2B 4WUKH 2IANA 2DQFB 5DRWA 1N2RA 1YQVH 5FCSH 3FT2B 4NPYB 1YEKH 3AAZA 3W0WD 5ICZB 4PYGA 3S34L 4XAKD 1WIPA 2VWEE 4MJ5A 4LLQA 3OXSA 5DA4A 5HGBA 2J8UB 3E1F1 5KVGH 2Z35B 3NCCB 4OT1L 4XPHL 2BY2A 5IK3A 2DYPA 1CFNB 4FQQB 1YEHL 4P49A 2QJDA 4LSDA 4AT6B 5F3BA 3PP4H 4GQPH 3D2UB 3OJVC 3VXOB 3CD4A 5EU7E 2J12B 2CKNA 2LU3A 4G8GE 3TBTA 2OR9H 1ODAA 3VGFA 2YR3A 4QT5B 4JHAH 1T83C 1IC4L 2J88L 4PJBA 3HI6H 5IKCA 2VDPH 1HINH 3G6DL 4AM0A 3D0LB 1IL1B 1JTTA 2VIRB 5JPNB 3WN5A 2C26A 3QUZB 1Q72H 1FRGL 4IDJH 1I85A 2X7LA 4U1SB 4Z8FH 2XN9E 4BZ1H 5JW4R 1EA9C 1Z9LA 2ZG3A 3GB7B 4N1EA 2OCFD 4U1MA 4UDUA 2AJ3B 2J8UE 1AP2A 3FCTB 1MLBB 2YXFA 2X4NA 5GGVH 1E6JH 4JM2D 2DQHH 3BGMA 4Y1AD 4LARL 2VABA 5ALBL 3OZ9L 2LTQB 2VC2H 1OAZH 1RIHH 2CLRB 4JHWH 4M5YH 4RWHA 1EZVY 3O8XB 2CSPA 1XCTA 4RGOL 4E0RA 1DVFD 5JQ6L 3QG7L 1HQRB 3CFDA 43C9A 4F58L 1CD1A 3UROR 3ARBC 1F2XK 2MKLC 1KB5B 4ONGL 4BSJA 4XNMA 1N0LA 2VH5L 3DMMD 1CLOL 5BZDB 3W81A 4FA8A 1A6ZA 5K33A 1A4KA 3BZFB 3EJJX 3N9GL 5IVZA 4KJPD 4NQEB 3MRRA 3MRGA 3U9UB 4JPIB 4CBPA 1LP9A 5FM8A 2YA0A 4LHJB 1A7BA 1KYOJ 4DGIH 1SY6A 1ZSDA 3GMNB 4JFQB 4OZFH 4ZDHB 1R3HB 5CMAA 1R5IA 1YY9D 3QUXC 4ZUWB 3IFLH 5F6HJ 5IQ7H 1R24B 2NZ9C 3A6CL 5IHZB 1RUAL 1Y6KR 2XZQL 3QPQC 2ZCKH 4PY8I 3HG1D 2GITA 4JO2H 2DIBA 5T1KA 1HOCA 3CFBA 4HK3N 1FG9C 4HW6A 5D2NC 4QRQB 4ZODA 2CDEB 3T4AA 4HH9A 2C3VB 3HC4L 3LMJH 4I48B 1NBVH 5JOPE 3BZDA 3FQTA 3EFFA 2NW2B 2IAMD 2GK2A 5JZ7D 1YY8A 1MFNA 2X40A 4D9QD 1C5CH 2E27H 3SGKA 2VZUA 1OSPH 1OTSC 2VRAA 5IJKA 1RULH 4NQEE 3D18A 4ETQB 5C0EA 1CL7L 3ARDA 3I6KA 1LP9F 3KAAA 2DLTA 1T3FA 5IIEA 2NY4B 1MH5B 4ZXBA 3X13B 1ONQB 4WW1B 3OAYH 2BFVL 4BQ9A 2UYLA 2BVPB 4X7EC 4FQLL 3GMOA 1RMFH 4IRJC 4FZEH 4HG4J 3DETD 4MCYB 1GC1L 1T4KA 1J18A 1DQDL 2GI7A 5INDA 5ESAA 4EI6B 2VXSL 1QSEB 2MPAL 5LBSL 3HNVH 1MFBL 1MHPL 3EZJB 3IDYB 2YRZA 4KUCD 2E7CA 3ZYOA 1G84A 1DQJB 1WV7T 1I3GL 3CH8A 4U1LB 3VWKB 4NQXA 3QQ9C 3D5OF 2R29L 4M7LT 1G7HA 4AMKL 1C5BL 3GSNA 4ONOA 3SDDB 2I9TB 2OJEA 3SGDH 3V5KB 1MJJB 5DVOA 3QCUH 4CN4A 1T1WA 3TBYA 4OUUA 4UINL 5FYLD 5DLML 3BT2H 2NY2B 1JPSL 5E8EA 1MCSA 4S1RH 3ZO0A 5AAWA 5DD3L 4LSPH 3W9EB 5D93B 4WW2F 2D03L 3H8NA 4EVNA 4W4OA 1XF2A 4EN3D 4XVUD 4HKJA 4IOFC 1RZ7H 4P23D 4LPCA 3TEUA 4LDEB 1MFAL 3GI9L 2YKLH 4JVUA 2Z8SA 3CMOH 5E95B 3QEHA 4M48L 5DA0B 5AZEL 2DQDH 4GW1A 2QQLL 2BY3A 3GIZL 4M00A 1A9BB 1KULA 5I1JH 3CSPA 5GGSB 4MJ4A 1FYHB 5T5FH 1F5WA 4KHTH 1L7TH 5HY9B 5DXWA 1PG7L 5C0ND 2APTA 3VGAC 2ED9A 3T2NL 4PJ9A 4HJGB 3P9WB 4KRPD 4UUJA 4ZYKB 5IR1B 3RWEB 4PJIB 4YUEL 1VADB 2DTML 3F6LA 4ZFZB 5GRUH 1QP1A 3VFWB 5MHSE 1S78C 1MI5D 3RWIA 3AROA 4NZUL 4QKXB 4C4KO 4P46A 1EFXD 3OF6D 3MRLA 4ODUA 5IBTL 4ZNEA 1JYXA 4QOKE 3OAUH 3MQIA 1TJIL 3IETB 5T3XH 4F7PA 3LIZH 1TFHA 3TT3L 3TCLA 3VXME 1UKTA 4LHUB 2DLEA 3SBWA 3SGEI 3LDBC 2ZOLA 4XX1E 3TA3B 4JFFA 2IALB 4WTWA 2X1OA 3TJEH 2JELL 4HIEA 4L5FH 2WMPA 3CSGA 4I0PC 1NMCC 4YHYB 2EC9T 3L3DA 2DKMA 1S7XA 4KGJA 4N5EC 5FHBH 4D0CA 5CINL 1MCPL 3EOBB 3O2DH 3I6LE 3UAJD 1XIWD 1JGVH 4P3WA 3HN3A 4ENED 5KSUA 5CSBA 2BZDA 1AGFA 2HH0L 5D6CB 1QO3A 3WFHB 3WE6A 4OQTH 3MJ9A 5E5RB 4ZTPH 5IBUG 3REVA 5C1MB 4HZAA 2QKIA 2EE9A 4MQ7B 1HYSC 4JFPB 5H2BB 2FYYA 5HBBA 4PJAA 5FA3B 1RURL 4N0UB 5A40E 4H20H 3GIVA 2CH8A 4PRPA 1HHIA 5IGXL 4N8PA 1FZOB 5GGRA 4OI7A 4NYLA 4LIQL 5M7QA 5E9DA 4F7MB 4X6EA 4XCCL 3UTTB 2BC4A 3PWPA 5SWZD 3K0WA 2L7UA 3HMXA 3U6RB 4HIHB 1ZLSH 2X6MA 5I15H 1KV3A 3MLUH 1GAFL 1BQLH 3RTQB 1E4XH 3V95A 3KYOA 4PBVC 4HFWB 1BX2A 1RIVH 2X4PA 2Y9RT 4NP4L 5I1KH 3TO4D 4JFDE 2EKSA 3ZKXC 4CVZB 5DVLA 2CLZA 4O2CA 5HHMB 4PLKD 2G9HB 3QB7C 4UTAH 5DQJA 4PRAB 5CBEB 2IG2L 4PJAF 2VNCA 1KPUA 2B4CC 2DBLH 2RCSL 1H8NA 2DMKA 3MOAH 3RUGB 4YAQA 3MBXL 2ZUTA 1S8DA 4IIQB 5EOQH 5CLTA 4KKNA 4MA3B 2R0ZH 4LSQL 2VL4A 3L5IA 5FGSA 5EU3B 2HTKC 2D0GA 1CK0L 1IGMH 4R4BB 3QJHA 4LU5H 1F4YL 5DT1L 1UZ8A 1MCOL 3UMTA 2E6JA 2HKHL 2KQMA 5L2JA 1ZVSA 3ET9F 1J12A 5D8JH 4U1JA 4IOIA 1QSFE 2OTWB 1QOKA 5KS9B 5DJ6A 2BY1A 4HIJB 1PSKH 1R3JB 4PR5B 2ENYA 3C8KA 5EWIH 3VXPB 2ITCA 3U0WL 1DBAL 1WF5A 4K9EL 1OP9A 4OSUH 2QQKH 3FFCA 2J1KA 2LFGA 2R1WA 4YHZH 1DBKL 2BNRD 4JY4B 1F4WL 1GOGA 4WFGD 3B5GA 4XC1L 3RUGE 1I8MB 5L2KD 1H3VA 4D3CH 1C08B 5ERWB 4UILL 4DQOL 4A6YL 3OKMA 3GMRB 1YEIL 3CFKB 3MMEA 2PR4H 2V2TA 1FL5A 5D1QA 5ITBL 4ZFGH 4NNXB 1PY9A 2IANE 6CGTA 1AJ7H 4NQUA 1LO2H 1DLHB 1HXYB 1EXUB 1GGTA 1L6ZA 3MLTB 3RWCA 5L8LB 5KS9E 2W38A 1AO7D 1P2CA 3K1DA 2X42A 1CR9H 3KXFA 2EZ0C 3R06A 4EOWL 1XGYH 5EORL 2IFGA 1X5FA 1JRHH 1GGYA 3DV6B 5D70H 3S5LG 2CDFB 1A6WH 3GRWL 2DL2A 4JM4H 1WK0A 1INEH 4N0CC 2Y06L 3RY5A 3ZDYF 1OSZA 2V9RA 4AG4L 1TQBB 1SJEA 4YGAB 3G5ZA 4OFDA 4Q9BA 2EXWD 2OL3A 3GEWB 5F9OH 1YEFL 5B8CB 3VD4A 4I18A 2XPGA 3S36X 1UQSB 5C92A 2G2RB 2SEBA 1XCQB 1UB6A 3FZUD 1XH3A 4ZD3L 3G5VB 2D4DA 3DWTA 1J0YA 5AWNL 3DRTA 3H3BC 3VDAA 2XG5A 3NFNB 3ZE0F 4J3XA 5EN2B 2XT1B 3FRUA 1OAYL 2E7LC 4NQCD 5AUMB 4KK6D 3P4OB 3PUCA 1GGCH 2HKFH 4HAFA 5GGTL 3CDFA 3WFEL 2VZSA 4OCRH 2VUYA 4QGYA 2FIKB 3OJ2C 4POZD 1I7ZB 1WAAE 1FGNH 3VFRA 2UUDK 4K3DH 4GXUN 2FX9H 3HTLX 3CK0L 4Z9KB 1A1NB 3ALWA 5FYLL 1CDGA 1G9ML 5DGRA 1JHLH 5C0CA 4Q74A 4JDTL 1TLKA 4HS8L 1D6VH 3T0WA 1DZBA 4MNQB 4M3JA 3V52H 3QH3A 5EC1A 3TT1H 1A14H 1YMHA 3PQYA 4JZOA 3DHJA 1ZLVK 2BNUB 2CRIA 2F54D 2BMKA 3DGCR 5SV3A 2QL1A 3DI3B 4X6DF 4HXBL 5BVPL 3H9YA 2X4OB 2I60H 1J0JA 2ATKA 3SKJL 2ZKHH 1HYRC 3EW3B 3J7HA 1HILB 4DCQB 1CBVH 3VFUA 4QNPE 1JYWA 2BSED 3P0VH 4K8RD 1ACYH 1MCWW 3NPSB 5I18L 3U7WH 3VI4F 4KY1H 1UA6H 1MRDL 1XF5A 5MP6L 2HLFC 1KIQB 1IFHL 4JEGB 5I1DB 1K85A 4KHXL 2AV1A 4U1NA 3S98A 1F4XH 5IMKA 1IM3A 1LO0H 4PLOB 5T1LB 3CDGB 32C2B 3D3VB 2A9MH 5DRXA 3L6FA 5HGAB 4NM4L 5F6IC 1AHWA 5JLZA 3C6LB 5EPMB 2MCPL 3F5WB 4HPYL 1MWAL 1T6VN 2DQEL 4A2LA 1VDGA 4WV1A 2Z91B 3ME0A 3QDGD 3UZVB 3UTSD 2P5EE 1AD9B 3P4NA 4TNVK 4CVUA 2ZUWA 5EBWB 3WIHH 3QNYB 5K9JH 3RZCC 2H8PA 4RISH 4TN9A 1MOEA 1NGXA 5IROC 1KJ3L 2NTFB 4XBGA 1FNGB 1IGCH 1U8HA 4LPVA 4OGXH 3VFMA 4X6CE 5A2KH 5HYSG 4UT6H 5I66A 3MRBA 4FQXB 5MEQB 3SKUD 1JTOA 1P1ZA 2H9GB 1I1YB 1M1SA 5C0AD 5DC4B 2UZIH 2CO7B 1BBDH 2CLVA 3MREA 1I1FB 3THMH 4Z76A 4MHHG 2WBJC 1OL0A 2W0KA 5IF0A 1BF2A 3I02A 2PTTA 4Y4HB 3MUZ1 3L7EB 1FAIH 4RRPG 4ONHB 5JIHA 3F65A 4LOUD 1TVDA 3O3UN 4PJGA 5SWQB 2V2XA 3B2VL 4FFZL 4K3JL 4NHCH 4Y4FA 1U8NA 5E8DL 5F88B 2MQCA 1A1OA 2B4CH 3TV3L 3SDCB 2DLGA 4GSDH 1NQBA 3DROA 3N1GC 5T1DL 3H7BB 3TH3T 1XMWA 3K2MC 4QYOB 5ILTL 5DMKB 3KPOA 2DN7A 5GRWA 3LKRA 4WO4B 1RJCA 3OB0H 3D87B 5L9DL 5DI8B 1X5GA 1ZLWH 4FQ2H 3O4LB 4ZFOL 3MYJA 1CYGA 3TNNB 4OFIA 4RSVA 4Z5RB 4KU1A 1F11B 1TPXB 5DJXA 3L3HA 1WVZA 1EH9A 1BVKA 4D94A 1MCFA 2FJHA 3E2HB 4PJGF 4EI5C 1QHPA 4P2QB 1J87A 1UACH 1GPOL 4ZUUA 4JHZA 4JQIL 3S97C 1OB1A 4UV7L 1F6FB 1HDMA 1T7WA 1VCAA 2EDFA 4QHLB 4UV4L 1G1YA 3FT2A 4NPYA 3ILQC 3VFSB 5C08D 5I75C 3FN0H 3RRQA 8CGTA 3SOBH 5KVMC 3BISA 1ZVYA 3B83A 1UFUA 3K4DA 4OZ4B 4MNGE 5BXFB 2HVJA 4HPOH 2R69L 3K3QA 3RKPA 5JXAL 5HHNB 5LAXB 3FTGB 1ETZB 4M9OA 1A7QH 4W68A 2YEZB 1C1EH 1TJHL 5INCA 4OZIB 1IT9H 2C9AA 2ICWA 1CDUA 3NCJL 3DSFH 4AT6A 3EDEA 1RJYA 3D2UA 4BYHA 2O5ZH 2NQCA 1I8KA 5EZIL 4OLXL 2FBJL 4P2QE 3QQ3B 3SJVE 3X12B 1N64H 5E4EB 5FO8B 1YMMD 3OSKA 2P44B 4NQDA 1CG9B 2AP2A 3KPPA 1D9KD 1IL1A 2L0DA 2PUQT 2VIRA 3QUZA 4TRPL 4U1IB 4N8CL 4PRHD 4ZUVB 4D0BB 3GBML 3DX7B 1N0XH 5I8CA 1RI8A 3B3IB 3C5JA 3DXAD 4MXVF 5EUOB 3ARGD 3MRCA 2AJ3A 5HHPA 4PREB 2J8UF 3FCTA 4G9FE 3VGEA 4M1DH 5L88L 1J1PH 4NN5B 5IM7B 4FQ1L 1NEZG 2Z92B 4X80H 2CLRA 4WFFD 3WUWG 4P4KC 1JBJA 1SM3H 3O8XA 1LILA 4F7EA 3PGFH 3ABZA 4LKXB 4LKCB 1I1AC 2AQ2A 3QUYC 1U8MB 4Z77B 2ADFH 1EX0A 5GZOD 1KB5A 1V05A 1CGVA 2O61A 1YA5A 4X4ZA 2FEDC 1FL3B 3G6AA 1BLNB 2R9HC 4HMCA 2VYRE 3B9KB 3NCYS 4PJ8B 3BZFA 3KPSD 4YFDB 1CDBA 1BD2D 1U9KA 3TN0C 4LCCC 5IWLC 5B38G 2NX5B 5D5MA 1Z6JT 2AJYL 4JPIA 4C56B 4JO1L 3QEQD 3GMNA 3PP3K 4JFQA 4J8RB 5C0FA 3L5XH 3WNNA 3S4SG 4JG1L 3WFDH 5CIPH 3VGBA 1MVFA 1B4JH 2AJSH 3MA9H 2RBLA 5SWSA 5J6GA 4QRQA 1DUYA 2CDEA 4P5TC 5EIVA 1F4AA 3ZE2E 1GZPB 3BH8B 2C4FT 1G7IA 2XA8H 1I3UA 1VA9A 4L4VB 1SYVB 3LKQA 5D9SB 5JW5A 2NW2A 1KEMH 3C5ZC 1D5XB 1F90L 1PY4A 1A6AA 4R2GC 1OM3H 1I9JH 1N6VA 4WDIA 3WCYA 1F97A 3Q6FA 4K8RL 4C59B 3QDJB 3VXUD 2BX5A 4Q7DA 5IHBA 1BAFH 3WD5L 1KT2B 2AEPL 4JGMA 3V4PH 5BV7H 1IGFH 4H5SB 4J3OC 3SE3A 5ISZB 1MH5A 2VDNL 1RZJL 1QFWH 3MLSL 4CU8A 5F93C 2AS5M 1ZT1A 3VH8G 3X13A 3NPZB 5T3XD 3TZVD 3GSQB 1I85C 5FB8A 2BVPA 3VFNB 5HHQB 1M7DB 2QHRH 1AC6A 3BQUD 3ISWA 1JZ4A 4MCYA 1FHGA 4JFYB 2CGRL 5DVMA 1QSEA 1MJ7H 1UYWL 3RGVD 1KC5L 2ED8A 1DQJA 4GMSH 1U8QA 3MJ8B 4ZPTA 3RWFB 1PD6A 3LB6C 1X7QA 3SDDA 4YDIH 4WUKL 1Y6MR 2N7BA 3G5YB 2AVGA 3S36H 4JRWA 1YQVL 3PHQB 1DQLH 5IHUL 1NC2A 4JREC 1L7IH 3DYMA 4GG8A 1RUQL 2ZSWB 3EJYC 4UQ3B 3AU1B 1U8PB 1CGUA 1QR4A 4FFYL 3W9EA 3SDAB 4YHKL 5HYIA 3NZHL 3LEYL 3RVUD 1TVHB 5DVNA 2EDKA 4ODTH 4WJ5B 2YPVH 2QSCH 3C5SB 4YIQB 4ZTOL 3PP4L 4X83A 5JHDB 2DWEB 4X6FB 4R0LA 4IS6A 35C8H 5B3JE 2GTWB 3WDJA 5J57B 5HY9A 3UO1L 1CCZA 4X7TB 3KPRE 5L0QB 1SVCP 5IV2B 4JHAL 3VXSA 1SMOA 3VWJD 1K8IB 1HINL 3ZHKA 4ZYKA 4WTZA 1FDLH 5IR1A 4OM0H 4UIKH 4PJIA 1VADA 4ZFZA 2AERT 3SGKC 3VFWA 5CWSB 3MOBH 5IJKC 4Z8FL 4L29B 4UOJA 4NKMA 3RGHA 5EULV 4Z78A 1JZ2A 1H3WM 2ESVB 5GGVL 3W11D 3IETA 2DJSA 1KCVL 1WQVT 2Q6WA 1OAZL 4PJDB 1RIHL 4LHUA 1QQDA 3IKCB 5JHDE 5FYKH 1T1YB 3EYSH 1R5VB 2J3SA 4WW2C 3UTPD 4L3CB 4FTVB 4WHTB 2D9QB 4XH2A 2ZUYA 2XQYG 4P9MH 5T3ZE 3QRFM 4ELKB 4E42B 3EOBA 4P59H 4IMLB 1NJ9A 4I3RL 4LCWD 4TVPH 4PJIF 4XNQA 2PO6A 2YC1A 3WFHA 4ZO7A 2GHWB 5E8PB 3HAEG 4MQ7A 1EO8H 5FHAH 2NY1C 4W70A 2Z4QA 4JFPA 1BFVH 1A02N 4S1DD 1YPZB 2B1AH 4N0UA 1JZ3A 4HC1H 3MFGB 3IFLL 4Q0XL 1PEZA 3T4YB 3BUYA 4JRXE 5D7IE 1EGJA 4ORZC 1FZOA 2WIIA 1HN1A 1YEEH 3FO0H 3T0VA 1DUZB 5A2IH 4UT9H 1FORL 1Q1JL 4MB3A 4QF1A 1AQDA 3UTTA 4FXKB 4XGZB 3U6RA 2ZCHH 4HIHA 3MV9E 5I1AB 3QWOA 1OLLA 1R3KA 4QXWA 1B9ZA 2CJUH 4U0QB 3RTQA 1HI6A 3NIGE 3MPCA 4OBRA 4QTHB 1EPFA 2E27L 1NUNB 4NUJB 1OSPL 4LF3B 1RULL 2CKBB 1ZA3B 3Q5TA 1FC2D 3W0WA 4HH8A 4YHMH 3MRFB 5E2JA 4JVPA 3AUVA 4NKIL 2G9HA 2DQCL 4PRAA 5CBEA 3KJ4C 5E94B 5DUBB 3OQ3B 4K3GA 2G75A 3TJHC 1D3CA 5HHOA 1RZIA 3U1SL 1UM6L 1T03L 4BH8B 3T3MF 3WJLC 2P24B 4IRJD 4PGJA 5C6PB 4IIQA 3EYUL 3LEXA 1GXEA 4MDIB 4BM7A 1FYTD 4PRNB 1NUGA 1JPTH 1FVEB 5EU3A 3LQZB 3VDBA 2YXMA 4R4BA 1ZAGA 2UWEB 4KKAC 1X44A 1BWMA 3PGCA 3SBWC 3ZT6A 3HI5H 3QQ9D 2NY0C 4MA7H 1N6QL 1CQYA 4Q6IB 1KENH 2VQ1B 3FQRA 3OGCB 2OTWA 2X9WA 4NO0B 1ITBB 4NO3B 5DWUH 4PJHB 3U4BL 1YEJH 4PR5A 3VXTA 3VXPA 2E9WA 3S8WA 4PRIB 3QCUL 1IM9D 1NGWA 2YSSA 1W72B 5E6YA 2B5IB 5D96B 2MQ0A 1S7SB 3T08A 4QO1A 4JY4A 4M6NL 3MODH 3FQNA 3R1GH 3G6JB 3R4DA 5C6TL 4S1RL 1HSBB 5EBMB 3RUGF 4QRUB 5HGDB 3C08H 1I8MA 4BSVB 4L8DA 1C08A 5ERWA 1DVFA 4I77H 4LVOB 3GMRA 3L5WB 3QFJE 3CFKA 4IOFD 3CCHB 5DJ8B 1OTTC 2P8PB 3TO2B 3P30L 2W9DH 2YKLL 4R8WL 4NNXA 3MR9B 2YMXL 3L7FB 1TDQA 2OQJB 5IG7B 4HUVB 1UM5L 2VKWA 3F8UB 3MUHL 1EXUA 3MLTA 3MRPB 4KHTL 4POUB 5KS9F 2COQA 1T2XA 5D7LA 3GKZA 1KB9J 1MVUB 1NL0H 3DV6A 2F8OA 5TFSL 4P48A 4IHOB 5JDSB 3RBGA 3M8OH 4YR6B 1R3IL 1YNTA 3BPNC 3UPAA 1S78D 1EBPA 2DI8A 3TYGH 1D5IL 3C9NB 3G6JE 4U7KA 3MBEB 1IEHA 2WBWB 4WWKB 4U4BA 4U6XB 1K9TA 4JKPL 4ZSOB 4RMTA 5B8CA 3QIWB 4FXGB 1UWEH 2VJXA 1IMHC 1UCBL 1UQSA 1UVQA 4X7DC 1XCQA 1R5WB 5JA8B 1A1MA 1TNMA 2PTVA 3GSUB 5JW3H 3P9LB 2RIKA 3NFNA 4I0PD 5EN2A 4OF6A 1NPUA 2VDQH 4MD5B 1CICB 4N5ED 4QTIH 3DO3A 4FMKA 3P4OA 4U2YA 3ESUF 2FGWH 1M7IA 1AXTL 4OTXH 4L3EB 1KCKA 4TTDC 3SO3B 1I7ZA 1FAKT 4OQTL 1YN6A 4O51A 1HYSD 1G7MB 1A1NA 1NKRA 3X14B 1BREA 4Y19A 5HYEA 5J13C 4XZUB 4ZSOE 2H3NB 1UKQA 1DLFH 4KVNL 4MNQA 1XAUA 2MWCA 1SY6H 1AKJB 1EMTH 4JG0L 2R8SH 2EDYA 1BGXH 2A74B 2BNUA 4PJCE 5E6IC 5ADPH 2PW1A 4BKLB 5ESVB 1ZLSL 5TF1H 1MFDL 1N59B 1NCNA 3VFGH 5C0JA 2X4OA 1FIGH 1E4XL 4YQXL 1QYGH 4MXQC 1RAMA 1RIVL 4I3SL 2F15A 3PV6B 1HILA 4DCQA 3GBNH 4BZYA 3ARFB 5DURD 4F2MA 4U1GC 1PGRB 3DIFA 4UTAL 2Q8BH 1IKFH 5GJTH 3KWWA 3DURB 1KIQA 5I1DA 4R4FL 4XP4H 3NABH 3RA7H 1OGAB 2XKNB 4YFLF 4ODWA 1NC4D 8FABA 4YWGL 4Q9QL 4GLRI 3LRHA 3OG4B 3BX7C 1XT5A 3GMMB 5T1LA 2DIJA 2HTKD 32C2A 4XVTH 3D3VA 4TSAL 5LGHH 3UTZB 5HGAA 3AY4A 2FD6H 1I7TB 2BVOB 4I18C 2MTPA 4LU5L 4HSQA 4OM1L 3S37L 1PZ5B 1OPGL 1A7OH 5ID1B 3K1KC 3OXRB 2FRGP 3DI2B 5ETUB 2H6PA 4LLMB 2A9NL 1ZHLA 3WUZA 3KYNB 5JIPA 1WLHA 1AD9A 5EWIL 1JPFA 4UOW1 5EBWA 1WFOA 4DOHB 4IBLT 3VXRB 2J6EA 2P42B 4LVNC 1UJ3B 3QXDB 1JZ5A 3QNYA 4XBEL 3V8OA 1L6XA 4HHAB 2VZVA 2NTFA 4ZOEA 1JN6B 2BJMH 4DKFL 4TULH 5HHXH 2QLVB 4TUKH 3ARBB 4FQXA 5E2UH 5F7KC 1BOGB 5IEKB 3HI1A 2QQNH 1JNHA 5F1NB 5BO1L 2B0SL 2H9GA 2XRAH 1GOFA 3B6SB 4DN4H 2CUHA 2VQTA 5J56B 1KGCD 1FJ1B 1I1FA 4CJ0A 1FGVL 4KI5D 3CFIC 3V6OE 1HWGB 1CR9L 4Y4HA 4QWWC 3V79C 1XGYL 2E5EA 2APBA 3L7EA 3S88L 5ICYB 3NFPB 4D2NA 3QCTH 4DOHE 5JW4N 3QUXB 1YDPB 3MA7B 5BS0D 2ENSA 4N0CD 2H41A 4XP5H 1INEL 3O6FD 2OMBA 3QIBC 1SJXA 2IC2A 3U7YH 5I71C 4YPGB 5FYJH 3SDCA 1P6AB 5GZNC 2CRYA 4PJXE 5DO2D 3UZQA 1CFSB 2WM0A 5DJDA 4CVWA 1EHLL 3L95A 2GUOA 4CMMB 4IMKA 5BMFL 3LN5B 5DK0B 1OWRM 1GHFL 5DMKA 4M62H 4Y2DC 1FV1B 1KCRH 3CSYB 4WO4A 2C1OB 1CLCA 1HIML 2DM4A 2H1PL 4X4ME 3ES6B 5DS8B 5ESQA 1FO0L 3SKMB 4L4TE 3QQ4B 5CEZH 3O4LA 4OF3A 3C60C 3Q3GB 3V6FA 5M94B 1XR8A 2HKFL 1H0DB 2QADB 4Z5RA 4HJJL 1P7QB 3QI9B 4HMEA 1MJUL 3D0VA 4NN7C 5E8OB 3WS3B 2CPCA 4YDVB 1ZS8B 4K3DL 4KWUA 5ICXB 4G7VL 2OP4H 2Q8AH 1DFBL 2ZPKL 4ZS7L 2R0WH 1AFVH 4X99B 1A3RL 4QHLA 3PWLA 3VFSA 2W65B 3KPMA 3V52L 3FQWB 4JJ5B 4G42B 3DX6A 1A7RH 3FB8B 4W81A 5M95B 4OZ4A 1CLYH 3RKDC 2DLFL 4E41E 3BIAX 5CUSL 1OGTB 2BVQB 2OK0H 4PJ5B 4OLYH 5HHNA 4DW2H 2E9IA 1EAJA 2R4RH 1ETZA 4KMTH 5FK9B 1G9NH 1DQQA 4OZIA 1CTOA 5C0BE 4LRNH 3C8DA 5D1XC 1F4HA 5BVJB 4NRXA 3SDYL 3HMXH 1YC8A 3BN3B 2X4TB 1H3PH 1QVOB 1KTLA 4OQ1A 4R97B 2GJ6B 1WBZB 3IDGB 4U6YB 3QQ3A 4RMQA 3DVFA 5F9JB 4CW1B 3P0VL 1HHJA 2JJTC 5F7WC 4POYA 3U7WL 1CG9A 4KY1L 1AGEA 1VPOH 5FAAA 4HUWB 5DRNA 5DD1L 2YPLD 1GGBL 4P2OC 4V2BA 5EO9B 4Y4FC 5EUOA 2DDQL 1GOHA 1I8LC 4PREA 4JPKH 5LGJB 1LO0L 1QA9A 1U42A 3UCRA 2A9ML 1GIGH 4G8EB 1AO7A 3VGAB 5CZVL 3FO9B 4XAKE 3WFBH 4OZIF 2Z92A 4M5ZH 1MNUH 1JNNH 3H3KA 1HHKB 4KUZH 1KJ2B 2VWEC 1HCVA 4LIQE 1U8MA 4Z77A 1UADC 5E5MA 4Y1AB 5EU4B 2GJ6E 1HKFA 2F19L 2D7QA 3GSWA 5D7JC 2OXHA 3OR7B 2YBRB 1FL3A 1RPQA 1CXFA 5H8DA 3VW3H 4DEPC 3WIHL 1RHHA 2Q86A 3B9KA 4YO0A 4PJ8A 3JWDC 5K9JL 3UBXI 2UUDH 4LSUH 5EU7C 5FUCC 2GJJA 5CJ5A 4AIXA 1QBMH 2NX5A 4OGXL 3DMMB 4OCXH 1MIEH 4C56A 3QHZH 5EUOF 3GNMH 2VLRD 4NO2A 4CU7A 5HHVH 1MAML 2NY3C 4J8RA 4L9DA 1DQMH 4QGTA 4YGVB 3CX5K 4NNYB 5IW1B 3QIUD 2C3WA 3HNSL 4F57H 3UEZA 4PGBB 4M7KL 2D7PA 1JE6A 1BBDL 5EBLB 4XP9L 1CXKA 2FJFB 3MV7D 5KANG 4OLUL 5T1MA 3MLWL 5DF0A 4FABH 4Y1AE 5J6HB 4HBCL 2XY2A 4A6YB 4L4VA 1SYVA 3QDHA 3OKLB 4QRRD 3LH2H 5D9SA 1S5IH 5I1IL 3PJSB 1D5XA 3MCKB 5IVXB 5IOPB 4YEEA 2V7HB 4NHCL 1BJ1H 2AEQH 1KUMA 1QPXA 1FNFA 3BAEH 1KT2A 4P5MB 3ARTA 2X05A 4GSDL 5CP3A 4JN1H 5I9QB 5CEXB 4KV5E 5I1CH 4H5SA 5ISZA 3EZ8A 1II4E 2PXYA 2EIZB 4Z7OF 5KN5A 3ZYZA 4G5ZH 5CGYC 1KN2L 4PS4L 4XNYL 3OKEB 1V3LA 4Q58C 3O45B 2P4AB 3OAZK 3VFNA 5HHQA 3BPCB 1TQCB 5C07D 5GRYA 3N85H 1WT5A 3HB3C 4L9LB 4JRYB 5FYKD 3ZL4H 2EDHA 4MLIA 2HT3C 1VKXA 3HG1E 1MF2H 3WIIH 4L8BB 5CFHA 2VN7A 1CU4H 3CU1A 3TGXA 4DWHA 3JZ7A 3S96B 3RWFA 4XPTL 4TVPD 1NCUA 4D9QE 3O3AA 1CIUA 1J8HD 3HE6D 2WSKA 1NGQL 4PG9B 5EH1A 3ILQD 1Q9LB 3EYFA 1WCBB 3CUPB 2R56H 4YBQC 1HZHH 2E8ZA 1PFCA 3FN0L 3AU1A 3X11A 2FX7H 3SOBL 3REWB 3MC0A 3WHXA 3AVEA 5IMMA 4RQQB 3SDAA 3WO4B 1X3DA 1EUUA 1TVHA 4ELME 5EA0H 4WJ5A 3QDGA 3ULVF 3C5SA 4J23A 4YIQA 3UTSA 2VZOA 4LLUB 4PY7A 1IT9L 1QBLL 5I1GH 5HYQA 3DSFL 3T04D 1JHKH 4OF8A 4Y5XB 3QZWB 2XACC 3CVIH 3VG9B 3IU4L 2QEJA 3TFKC 3F7QA 3B9EA 5JOFB 1NCCL 3LAFA 3QUMH 4XWGL 2GTWA 3MRIB 4Z7UA 5CP7B 3RWGB 5B3JF 1SJHB 4WGWB 2FJGB 4G80B 2LVEA 2EDQA 2NR6C 3BP4B 1JK8A 4C4KT 5IV2A 2AXHA 3SDXB 1LK3L 1K8IA 1JPST 3JTTB 2VDKH 2XTJB 5I6XB 3SE8L 3EOYG 1QFHA 3KJ6H 4LCYB 2IGFH 3I85A 1X6NA 4KRPB 3V7AE 4LDLB 4W6WB 3HC3L 3LD8C 2ESVA 2VDOL 4O2FA 5FYLE 1NCTA 1F6AB 2NY4C 4WHYH 3HC0B 2EH8L 2V2WB 4P4KD 4PJDA 1G1CA 4X80L 1RIUH 2HRPL 4S0TD 4MXWL 1EFXB 2GIYA 4M7LH 2HWZL 1I1AD 4LSVL 3PGFL 2A6IB 1T1YA 3T0DA 3HR6A 4FQPA 2ADFL 3CIQA 4FTVA 1K5NB 1ADQA 3MOQA 4OZGA 3K46A 2R9HD 2OI9B 4XNZC 1OW0A 4ELKA 4E42A 3SDXE 1WWCA 4IMLA 3IDYC 2BVTA 3TN0D 3UTOA 1MWAB 1CGYA 3PWNB 4KJQD 3VWKC 3U0TA 3RDTB 5KVDH 2NXYB 4P2RB 5KSBB 1IAIH 4NOBA 5E8PA 5T33H 2X4UB 1R0AL 1DSFH 1BEYL 2A1WL 3UYOD 2VXTL 4NN6B 4WHDA 1YPZA 5ACZB 2GTZB 2FB4H 4YJZL 3T4YA 1GZQB 3U48A 1MI5E 1OLZA 3WFDL 5GRVL 1MQKH 1B4JL 4O02H 2AJSL 5MI0B 2NY2C 4PJDF 5L7XH 2EO9A 3MA9L 5C9KA 1DUZA 4P5TD 1G6RB 4S0SD 4JFEA 2FO4A 3CMGA 2CXKA 3U30C 5ITFB 5H35B 5D93C 1XGQB 4XGZA 5CSZA 5E2VH 2DYPD 1FPTL 2VLJB 2VLMD 1T5XB 5GIRB 4ZUSB 5I2IA 3BD5A 3BO8A 1P69B 2BOCB 5E8NB 1I9JL 2AJVH 2CKBA 3L3IA 2AK1H 5D72H 4AL8H 1ZA3A 2VLLB 4P2RE 4OZFA 5C08A 4OGZA 4S1QL 5FDWB 3LEVH 1N7MH 4JLRB 3WXWH 1WZKA 4YEFA 4MJIB 4KFZC 3WNMA 3V4PL 5BV7L 3IYLW 4IDLA 4IOSD 4GAJH 5DUBA 1I9RH 1YPZF 1QFWL 1IGIH 2ITDB 5BJTB 1YNLH 4N8VG 4WTXA 1IEBB 4N0YL 1NAML 1P5UA 5F89B 1CVSC 2P24A 3EGSB 2J8OA 3BE1L 4LQFH 4FNLH 4PB9H 1LD9B 1NDGB 5IP4A 2JIXB 1HH9B 12E8H 1QZ1A 3RNQB 4PTUA 2QTEA 4MDIA 4U33A 4PRNA 1FVEA 5HDQH 1H9VA 3LQZA 1MJ7L 3K81A 2UWEA 3O11B 3DECA 4WUUD 4I8DA 5I17A 3K4AA 3TA3C 5SWZE 5IB5A 2QHLA 2XZAH 43CAB 5DSCB 5K9QG 3K74B 2IMMA 3UJIH 4IEFB 3JWDH 4PJHA 1CD8A 3FQXA 3LHPH 3STBA 3UYRH 4YHYC 1VHPA 5F72S 4PRIA 1W72A 4Q9RH 4YHLL 3EJYD 1U8JB 1A2YB 1DR9A 2DLIA 1S7SA 3S9DB 3LV3A 4N1CA 2VOTA 2WLZA 2Z31C 5FIEA 5K9KA 1RZKC 1B0GB 4P99A 5HTSA 1HSBA 3LPWA 5EBMA 2YHGA 4QRUA 4UDTA 3PP3H 5HI5C 2JKXA 4BSVA 4WI6A 1U91B 4TOYH 1EJOH 1S7UB 2YPVL 2QSCL 1IVLA 3WSQH 5DYOB 5DJ8A 3SGDI 1OAQL 3TO2A 1ZGLM 2P5WB 4XTRD 4LQ1A 4OV6F 3WHE0 5T1KD 2B1HH 4J7RA 4WEBH 3L7FA 2OQJA 4HUVA 1FE8L 3BKMH 3CXHK 4AYFA 5J11B 1RZ8B 4PJHF 4X8JA 1DANU 1MVUA 4L1HA 3QJFA 4OM0L 4UIKL 5H37H 5JDSA 5GS0L 4KK8C 3IJYB 3C9NA 4S2SB 4ODVH 3ARDD 5TDOA 3G6JF 4WWKA 1F8TH 1IC5H 1JF6A 5C70A 4KROD 4ZXBD 2BNRE 1X4XA 3DUSA 4FXGA 4WFGE 5DMYA 4LLVB 3BI9X 4NRZB 3B5HA 1R5WA 5L2KE 2DQJH 2ARJB 3P9LA 2ADGA 3ECBB 4IIQC 5HVFB 3Q6GL 4OLEA 4MD5A 1PYWA 1UG9A 1CICA 2C5DC 2XTLA 3BKYH 3A67L 1MPAL 2G5BB 4GQ9H 2PKDA 2X4RB 2Z8RA 4GW5B 2DLHA 4L3EA 4V1DD 1ZT7B 2GSIB 2V17H 2HP4A 3DO7B 1KB5H 1VERA 4L4JA 2RGSA 4TVPL 2EYRA 2ZCLL 2PYEB 4K7FB 3BMVA 3EYVB 1B6DA 3ARPA 2VZ1A 1G7MA 2NY1D 3H9SD 3TZVA 1EO8L 4MA8L 3X14A 1NFDB 1T6WA 1BFVL 1BM3H 2B1AL 5CLWA 4HC1L 4ESKA 2H3NA 3VCLA 3TBWB 5TQ0H 3FB7A 1EEYB 1YEEL 4M93C 3P0YL 2A74A 3O3BB 3FO1B 2Q7YB 4EI5B 5HPMB 3GM8A 3V0AC 4BKLA 5ESVA 1FVCB 1AE6H 1G6VK 1N59A 3DTXA 3ZT7A 2ORBL 4Y88A 1AY1H 2I25N 1RK1A 1JGDB 4ONFH 5LQBL 4JDZB 3RIAK 1VFBB 2F54B 3PV6A 4V2CB 2PYEE 5I75B 4NQCE 1KJMB 1TZIB 5MERB 4Z7WB 1J86A 4R7NB 4PJ9D 2IQ9H 4HF5L 5TDPB 4DTGH 3WXVH 1QTYT 3MUGA 3F12B 5SX4H 4ORGB 5KSVB 3VI3E 4RMRA 3P0GB 5FYJD 1QKZH 3TJHD 3QEGH 3O3EB 4RMVA 3EDJA 1E4XI 2DQIL 3ARYA 5J9PA 1O5DT 4XRCB 5E03A 3CC5A 1OAKL 4CN6A 1MCCA 4JPVH 1JGUH 2EKJA 4P46D 3DVGA 1TQBC 4HUKB 3BXNB 1ZGLB 3GMMA 1QSZA 1E6OH 2I5YH 2XZZA 5JO5B 1EHAA 3JV6B 4KKAD 4Z0BL 3UTZA 5B8CC 1T83A 4HUUB 1I7TA 2BVOA 1YECH 2QV2A 1KG0B 4LSTH 5CEZD 4RFOH 5ID1A 3HI5L 4JFFD 5IEHA 5ETUA 1EVTC 1KENL 2NY5C 4LLMA 2F54E 1FC1A 1HCFX 4XP6L 5EG6C 5DWUL 3L3OB 4OF7A 2ZUQC 5C09A 3QRGL 4W6XB 3VXRA 3D69B 4U1HB 3DPBA 1UJ3A 3LQMA 3QULB 3TPUA 6FABH 4QHUB 2E7BA 3ILPB 1JN6A 3T77A 4UNVA 1YEDB 4WI8A 1FCGA 3C08L 2ZOKA 3GUTB 1RUMH 5D7SH 4W4NA 3ARBA 4XWOC 4I77L 3SQOL 5IMOB 5IEKA 5LGKA 2YD2A 1T21A 5F1NA 5AG9A 1MFCL 4RGNB 5D2LB 3R8BB 2W9DL 4PRPD 1QFOA 3B6SA 4QHNB 4X0KB 2HTLC 1DBBL 5E9DD 1QRNA 2Y07H 1T89A 1OCWL 1IBGH 2AGJL 3PWPD 1MCQA 2DWDB 1IRAY 1IJ9A 1NL0L 4HCRH 2ADIA 2X4SA 3NFPA 1UB5B 5B4MC 3PWVA 5GSRB 5IT2H 3QUXA 3MA7A 1QFUL 4F33B 2X44D 2FATH 3M8OL 3HUJB 1LO3H 3MRKB 4OCSH 3KLAA 3E6HB 5DC0A 3AXLA 2EEBA 4UAOB 5D2NA 1H3GA 1KIRB 3HNTH 2FDBP 2VTFA 3NPSC 4BJLA 3NA9H 4CMMA 3EHBC 5GSVB 5DK0A 3B5TA 4KKLC 1JRHI 5TGBB 4HT1L 5KOVC 4EQ2A 3K8KA 5E56A 3MRQA 3ALPA 3C5ZB 2I27N 3CSYA 4ODBD 4R2GB 1FG2B 5ALCH 3HR5B 3ES6A 3H6JA 1FZJB 2EYSB 5DS8A 3SKMA 2VDQL 1V7MH 3QQ4A 5IFHH 4NZRH 1BBJA 2AK4B 3LQAL 4DVBB 5C0AE 1H0DA 2HYMA 4TTDD 1JWUB 3AY4C 1IQDB 1O0VA 3C6LC 4WGVB 1P7QA 2CRZA 2BOBA 3HUJE 5E8OA 1MIML 1REIA 4YDVA 1ZS8A 5JOEA 4M02A 5ICXA 5CAYB 5DJCB 3HCVB 4C54A 1JVKA 1G7PA 2LU7A 5IJVB 1RZKH 1NLDH 3FFCD 4EDXB 5C2BL 4GKOA 5EU6B 1MJ8H 4U3HA 1DLFL 5CILL 4JJ5A 4G42A 1SY6L 2OYPA 1QD0A 3RY6C 4ERSH 1KCUH 1OTUC 2HG5B 3FB8A 4PJFA 1A7NH 4H25A 4WTZG 1OGTA 1MCJA 4PJ5A 5IBLC 1EGJH 3OJDB 1RUPL 4FQXC 5FK9A 4YX2L 3WFZA 3RIFF 2E6QA 3EDDA 5D1QD 5DUPH 2ICEB 4KDVA 1J1OH 3OKKB 5BVJA 2C1PB 5I1HH 1NUFA 3ELAT 2I07A 2X4TA 1QVOA 4JREB 4RFNB 1X5AA 4NM8L 3D1MC 2EDLA 2Z8WC 3STLB 3IDGA 3CFJA 4DAGL 3I3BA 3KXFD 4LHUG 1WEJL 5F9JA 3E0GA 4CW1A 4Y4HC 2F53D 3T1FB 2YUVA 5GS1B 4KRLB 1NCWH 2YS4A 5I1EH 5DMIH 1WBXB 5GJTL 1UXWA 5J06A 4HIXL 4FQHA 4HUWA 4NRYB 4BFIA 1U3ZA 3MXVH 3HE7B 5EO9A 2EIEA 5HYJD 3V9FA 5DFWH 3EYOB 4NKOB 1KBGH 5LGHL 4UU9B 2HFTA 3FO9A 3DXAB 3HMWH 3LKNB 4S1SH 3ARGB 3U82B 2GCYB 3IXTA 1A7OL 4J3VA 3CLFL 5HYSA 3FONB 4WO4C 4HK0B 1KJ2A 4JY5H 5K9OA 3RIFK 1DBMH 3G9AB 2BNQD 2JCCE 4OZHE 4MHHI 5DEGB 1U3HB 5LCVH 2D31B 3W2DL 2J4WH 3GBLA 2YBRA 1BOYA 3OR7A 4G3YH 5JMRA 1XGTA 3IU3A 3WFCL 1TPXC 3GSNL 2LV4A 4YHOL 2GY7B 4KTDH 5KVEL 1PLGH 2VLKB 3QA3A 4RAVB 2BJML 1YMME 4TULL 3MGAA 5FOBB 3F7VB 5F9WB 1Q8MA 5KW9L 4WW2B 3D48R 4J6RH 5C0CD 3CFEB 1BD2B 3RZWA 4PRHE 4B5EA 4MJ2A 3QXWA 3DXAE 3RVWC 1L9NA 4PGBA 4Y0GA 4DN4L 1MFEH 1DQTA 5EIIA 1FFOA 5AZ2H 2OJZL 1ES0A 4F7TB 1NCDL 2MHAB 4D8PB 2R2BB 4QWWD 1U58A 4K2UH 1EERB 4WFFE 1L4IA 3JVGC 1RUKH 3PJSA 1IAKB 2GY5A 3QCTL 3PE9A 4NFDA 1ORSB 3MV8B 4HD9A 3MCKA 5IVXA 2VZTA 5IOPA 2V7HA 2AEWA 1XF3A 1YNKH 3MGOB 3U7YL 5GZND 5EC2A 1ZHKA 5E4EC 2XG4A 5F70A 5CEXA 1A6TA 4KVCL 1P7HL 2FL5B 3KPSE 4KV5F 1BD2E 4RWYH 2AXGB 2EIZA 5C6WH 2B2XL 3KGRA 3OKEA 3O45A 1KCRL 5F1IB 3QEQE 3ARQA 5DTFB 3FO2B 1MQ8A 5I16B 1BZ9B 4L9LA 2YWYA 4M43L 5LWYL 3C60D 1G7JA 4JRYA 3MCLH 2NY5H 4L1DA 4NN5C 1K4DA 4RIRA 4YK4B 4Z7NE 3QPXH 1JYNA 2XOTA 2CR3A 1NSNH 5CJBA 4L8BA 4CDHA 4OLZL 5IVXF 4CL7A 1OY3B 4ZQKB 5E7BA 4TSBH 4B7IA 3BZEB 1F3DH 3AFLA 3WLWC 1A4JB 4J3UA 4MDJB 4XCFL 4U2ZA 1AFVL 4PD4J 3MJ9L 4YHNA 4TPRH 1Q9LA 2BVYA 5FOJA 1WCBA 3B9KC 4M7ZB 4PJ8C 3VXUE 3TVMB 1A7RL 1BJ8A 1C5DB 4CAGA 1JGLH 3RKDD 2NY0B 2WBKA 1JJUA 1S9VA 2FHBA 4OLYL 4LVEA 4HUMB 2YN5A 3U83A 2O5XH 3GI8L 4NUGH 1G9NL 2DKUA 5IVNA 1OARH 2GK0B 2P7TB 4GKZB 3G5XB 2WWMC 5DJZB 3KLDA 4MQXC 3QZWA 4NC2B 2QSQA 5CP7A 3RWGA 1CGSH 2IQAB 1SJHA 1AIFB 4G80A 4RX4A 4J2XA 3BP4A 3ZDXE 2HJKB 1JF5A 4DVRL 3RAJH 2VE6A 1VPOL 2KZ1B 4Y2OA 4P2OD 3H9ZA 1UH3A 4Y4FD 4APQB 4LCYA 2Q7NA 5J1AB 3C09B 1EFQA 3VWJB 4JPKL 4J3TA 4ZNCD 1G9EA 4C57C 2DOCA 2VDLL 2DM7A 5JORA 5E2TH 5BRZA 1GIGL 4ZMAT 1PZUB 2V2WA 2H2SC 1MNUL 4AJ0A 4KUZL 1S7RB 3QEUB 3W9DB 2A6IA 3NIDE 5D7JD 4P57A 3ULVC 3GHEH 3EO0B 2EH7L 3NCYP 4UBDD 3SDXF 4BQ6A 4DKEH 2DI9A 1VEMA 4LSUL 4NSKA 4RZCB 1VGEH 3PWNA 2G60L 5KSBA 2X4UA 3AM8C 3M17A 4OGYL 1MIEL 2J6EH 1G0DA 3QHZL 1KPRB 2NY3D 2YPKA 1J0ZA 4JFXB 1PVHA 2GTZA 5E1AA 1NBYB 3O6KH 1P4IH 1GZQA 4UTBL 5JUEH 2VDMH 3O2VL 1MLCA 3WBDA 2V5YA 1G6RA 3FN3A 5ITFA 1Z3GH 1S7WB 1XGQA 2ZSVA 4HUXB 3SDAC 2VLJA 1T5XA 5GIRA 3VH8A 3PNWB 1PW3A 4XI5C 4XNUH 1A3LL 5CD3B 1V7NL 3D2UD 2BOCA 1I7UA 5E8NA 4LPUA 3UTPE 3V4VH 1EIBA 2ICES 4GG6B 1OP5H 2AEQL 3EO9L 2PW2A 5DC9B 4JLRA 3RVVD 3RPIB 4NFBA 2NY7H 1Q94B 4L8SB 4JN1L 4DKDC 4MJIA 5L0QC 4EDWH 2A0LC 5E6IB 2DQUH 5L8KB 5I1CL 4LCWE 4EBQL 4WCYL 1JPGB 3QUZD 3INUL 4KK9D 4G5ZL 5BJTA 3H0TB 3O4OB 1TETH 4N0RA 5GPRA 4OJFH 4M4PA 4I9WD 3SQBA 3Q1SL 1Z5LB 2OL3L 3CXDL 2PNDA 3EGSA 4U6VH 3HB3D 2R0LH 3JWOC 1LD9A 1NDGA 4Z7VE 2JIXA 1HH9A 3RNQA 5TDNB 5I0ZA 3VGDA 1AC0A 3ZL4L 1OQOA 1U8KB 4BFEA 1Q9KA 2CRMA 3IS0X 4AQ1B 3O8XD 4MD0B 4NWUH 1YJDH 3UJTH 1QFWI 1TJGH 4HS3B 5CKGA 3BW9A 5IESH 3MLPA 3BEWA 2X9YA 3H9HA 5DSCA 1DTUA 5EO0B 2C4XA 5DJYA 4BQBA 4NHUB 1FO0B 1CTNA 1VESA 4BFGA 3O6LH 2HVKA 1FSKC 1MHHB 4YHPB 4K3EH 1H15B 1KCSL 4OKDA 4JR9L 4KGLA 2VAJA 4TYUA 1B0GA 3NH7H 1LQSR 3LZFL 2BCKB 2E9BA 1PKQB 3QUKB 3BKCH 4G6KL 4J4PC 5GHWH 3WDIA 5KTEH 3CFCH 5DYOA 4X6DB 3V0WH 3T0AA 2NZIA 3MLXL 5D71H 3LN4B 5FGRA 2DQGL 4GXVL 1ZHBB 2LAAA 4I2XA 3RZCA 1M05A 2LVCA 3CVIL 1FYTE 4JFHD 5IB1B 4QXUH 1RZ8A 1Q9OB 4XBPB 1IE5A 1DL7L 1CLZL 2NLJB 3DX8B 1J1XH 3DARA 1U8OB 2VLRA 1MHCB 4P3DB 4HQQH 4FMFA 5EOCJ 2VDKL 4LSSL 4C55A 2AI0L 2IGFL 2Z93B 1QR1B 4HWBH 2WBJA 4GJTB 1B0WA 5F71A 1PX3A 2NY4D 3O41B 5JNYB 3X3GL 3C87A 4LLVA 3WIFB 5MEPA 4M7LL 3PG2A 3VD7A 2ARJA 2XZCH 2AJZB 4Y5YB 3ECBA 1GCFA 2Q3ZA 1WITA 4FZ8L 4KZEH 1FH5H 4U6HA 1QSED 2XNAB 3QHFL 3UXFA 2GSIA 4JAMB 1QLFB 3DO7A 4F37F 3VWKD 5FKPA 4K7FA 4Q6IC 5CHNB 5JXEC 3EYVA 5T33L 4OCNC 4YDLB 4FQCL 1DSFL 3SDDD 1J5OL 4U7MA 1NFDA 3UC0L 5JW4Q 3VXQB 1C12B 3U4EB 3PDDA 4YDKH 3S35L 3FFDB 3VFVB 2B5IC 4MWFA 5D96C 2NY2D 3BZ4B 5EIQA 3PWUB 4GRLC 1JNLL 3OBAA 5J89A 4WU5B 4NGHL 5K93A 2L7JA 4HZLA 1RFDH 4JDVB 4NN7B 3FHAA 3RU8H 4XVSH 4EI5A 5HPMA 1QPPA 1U41A 3QYCA 5E2VL 1QLRA 1FVCA 2VXUH 4K94L 4PJEB 1WTLA 3KR3L 4LVOC 4XHJD 5DHVB 3FQUA 4Y16B 4H1LB 4IRZH 1JGDA 3BGAA 4KPHH 3VA2C 4YZFE 4G6JL 5A43C 4JDZA 4Y8AA 2VXQH 3HZYB 3KNBB 3T0EB 5D72L 1T20B 5MERA 4PJ7B 3WXWL 4Z7WA 3N1QC 1U93B 4M1CC 5FGCB 5TF0A 1P6FA 4F37K 3DYOA 3NCEB 5FYJU 3EKCA 4ISVA 1A64A 1F42A 4GAJL 5KSVA 2PTUA 5I19H 3VI3F 3K80A 3O3EA 1JF1B 5IW6B 1YNLL 4NC1E 5CP3H 1AI1H 4XRCA 1A0QH 5D1XB 4FQJH 3M1BB 1IQWH 3MBEC 3EDFA 3BXNA 1ZGLA 3D39B 4TVSa 1SBBA 4PJEE 4LSRH 2R0KH 3IRPX 3KPQB 3JV6A 3QFDA 2PCPB 3QIWC 1JZ7A 4HUUA 4KXZH 4LHUD 2KPNA 4JCMA 2JLLA 1KG0A 3ULVH 3TA3D 1NC4B 3ZKMC 3VE0B 3PIQB 2Y7QB 1S5HB 5MENA 2XZAL 4WNQB 2HFFB 3T0EE 3HPJB 3EOTL 3H42H 4OD3L 4PJ7E 3MSPA 2NMSA 2P45B 3RVXC 1CICC 2JB5H 3GJFB 4Z7WF 5J12B 5HJ3B 1MREL 1ZT4B 4M7JH 4YXKH 3QXTA 3SO3C 1DN2A 4QHUA 1BF8A 3ILPA 1SVZA 2XA3A 5HI5D 2W9EL 5IW3A 3U36B 1FFRA 1HHGB 1MEXH 3MGTA 3QUYA 1JMXA 4M8QA 4I4WB 5IMOA 1P4BH 4HK3J 3BEVA 3NN8B 1MRCL 3WSQL 1GJIA 4HGWB 3U4AA 5D2LA 1NEZB 4O00A 4G8IB 4DEPB 4H26B 3VD9A 3WUWB 1YYLH 3MXWL 1Q0XH 4X0KA 4O58H 2B1HL 5E0QA 1QFWM 1PG7X 4ZOBA 2R23B 3UTTD 3TN0A 5IWLA 3WYRA 1IC7H 4G8GB 2DWDA 4KKBC 3CVHB 4L3AA 3K2UH 3ZYJA 1J8KA 2D7OA 4QXGL 1T22A 4GW4B 5EUKA 3VFTB 3O81A 4N0FA 3RTQD 1UB5A 5CKAA 5GSRA 1JTPA 3WDHA 4KK8D 3P3YA 3O9WC 3MLZL 1I4FB 3MLRH 3QO1B 5B38B 3QR2A 4HFUH 4ODVL 4JANB 3E6HA 1BIIB 2XN9B 3WL9B 3A6OA 4OFYA 3ARFC 2WINB 5HHMD 5JIKA 3VRLE 1LO5A 3QT2A 4N9GB 2X10A 2NYYC 4P5TA 5GRZA 3WV0A 1YUHB 5AYQA 1IC5L 1MY7A 3BPOB 5I76B 3S4SB 3NACH 5GSVA 4Y4KC 3JWOH 4OCYL 5TGBA 2MJWA 4YBHA 4XVJH 5ANMA 5HHOD 3ZHLA 5D2LF 3ZKNC 2CK0L 3C5ZA 4KMLB 2BSSA 2YD4A 3H3PH 2NTSP 1FZJA 2BRQA 3BIBX 5F96H 2V7NB 4K23L 3KDMA 2R1XA 4NZDA 5C0RH 5KSAB 2IF7A 2W59A 3BKYL 2DD8H 2AK4A 2QR0B 5DQ9B 4DVBA 1AGDB 1OAXL 1D7FA 4F3FB 4MMXC 2A6KA 1ADQH 5GGQH 4KI5E 4OF5A 3TCXA 3HUJF 2HFGL 3P11L 2XXMB 5AG8A 3TNMB 5DJCA 3BHBB 4TNWF 3HCVA 2ZG2A 5F7EL 1GC1C 5B22A 3JV5A 4AEHL 4HX1B 5BS0E 1SBSH 4EDXA 3ZSTA 1F02I 5EU6A 1DP0A 5TH2B 5ACLA 1UJ3C 4AEIL 1UENA 4R90L 2DM3A 5GGRY 2OTPA 1KELH 2X70B 3IXAB 4WUUA 1OF2A 3DVNB 3HLAA 4OGAC 1DDHB 4HWNA 5GQBA 5GISH 4XMLH 4I5BA 5C0GB 2XWJB 3OJDA 5FM5O 4KAQH 4NDMB 2ICEA 3MRJA 3OKKA 2VAAB 3ZTNH 4ONFL 4TQEH 3CPLA 2C3HA 4KTEH 3GGWB 2ADJB 3EFDH 1DN0B 2FWOB 5I8OH 1T89C 5DHYA 3P4MB 3STLA 1S9XB 1UWGH 5D7LD 2IQ9L 2RFXA 1MCLA 4JO3L 2R2EB 3T1FA 2CKBH 1UWXK 3JTSB 3TF7C 4MB5A 4PP2A 1HHHA 5FM4A 1QKZL 4MJ6B 4NRYA 3NAAH 1XFPA 3HE7A 4FFWC 3FAXA 1NBZB 3A6BH 4U31A 3EYOA 4RFEA 5AYUH 5CEYA 5TE4H 3FN9A 1RQ5A 4AK1A 3SY0B 1QNZL 1ND0B 3RQ3A 1JWSB 2I5YL 1E4KA 1EVUA 5HYFA 1Z9MA 1YECL 1LDSA 3LKNA 1MRFL 2GCYA 3BPLB 1NAMB 2ZJSL 2XFXA 4HK0A 2AJXH 3RPKA 2JCCF 3CX2A 1Z0MA 1A8JH 1U3HA 5CD5D 2D31A 1LE9B 2A77H 4U05A 3V5DB 3LD8B 1MCHA 1U92B 3MFFB 3GMQA 2QADC 3FT3A 2IPKB 1Y18B 3QI9C 2VLKA 4LLDB 4LASH 4NO5B 4OKVB 3CLEH 1W72H 4JKLA 4O4YH 2YA1A 4GAGH 3QWRA 4X5LA 4XWOD 3F7VA 5EZOH 4R7DA 4WW2A 1RUML 4Y19D 3CFEA 2YPLE 4MNQD 4OZFG 4XNZB 4JVWA 4QRPB 3ZZ1A 4FFVC 2HTLD 3WLBB 4GMTL 4HXAL 2WQRA 4V1DA 2Y07L 3VG0L 5SV4A 5ECJE 1LO4L 2MHAA 4D8PA 2R2BA 4HIIB 1T7ZA 4LCIL 3ZE1E 1WZ1H 2OXGA 3H9SA 5I30L 1U6AH 1F58H 2EDRA 5IT2L 1LK2B 5DK3A 3FB6A 3MV8A 3O0RH 4OT1H 1BFTA 4XPHH 1SMAA 3L3KB 3GZKA 2VN4A 3BKJL 4QRRB 2ZUVA 2AV7B 2FCBA 3I6GA 3MGOA 1YEHH 2AABL 3HAEB 4R97C 5MEOB 4H8WL 2P8MB 1PBYA 5J0BA 3HPLB 4X7CC 2I24N 4GRMB 1SEQL 3GKWL 3U30B 3HNTL 1MCDA 4QOKB 2AXGA 2IADB 2AQ3A 2UV3A 3DRQB 2MCG1 4QRPE 3VXMB 3KYKH 5F1IA 1IC4H 2J88H 1QFPA 1N5YH 1CVRA 4WFED 5ALCL 3FO2A 4ODHL 4HULB 2FX8H 3W5NA 2VITB 1SEBB 4GT7A 5T1LD 5I16A 1A7PH 1V7ML 2E6PA 3D3VD 4PGCB 1T5WB 4YXHL 5IFHL 4K55A 2Z8VC 4MD4B 2XICA 5JR1H 2FZ3B 3AGVA 3MV7E 3NGBB 1MCNA 4OUOA 3PABA 2NW3A 2AXJA 4X5WB 5CCKL 4TSCL 1GSMA 2X4QB 4KK5D 3C2SA 4JM2C 4ZQKA 3EDKA 4QRRE 3BZEA 3DUUB 5ALBH 3ZLQC 3OZ9H 3WJLA 2E7HA 4URTB 3HA0A 1A4JA 2E9JA 3S3SA 5GGUB 4MDJA 3IDMA 4JKMA 3GDBA 5BW7C 4RGOH 1RZKL 1NLDL 3QQNA 5TE7H 5JQ6H 1TMCB 1DJSA 3FB5B 2DS4A 1INQB 2PETA 3MUY1 1K6QL 4GAFB 4HV8A 1OTUD 1C5DA 2VH5H 3E8UH 5JDJA 1CLOH 2ZUUA 1J8HB 2EDOA 2YK1L 1IARB 2YD5A 3DMMC 4B7LA 4HLJA 5IBLD 1P84J 5AD0B 3BFOA 4FQXD 2CD0A 2V5RA 5ACMA 4OV5B 4B50A 4IM8A 4U1KB 4K9EC 5I1LA 2GK0A 4GKZA 1KN4H 4RGMC 4RDQF 5C07E 4X4YB 2Z31B 4CUCA 5IB2B 3A6CH 1RUAH 2WP3T 4LP4A 4JZNB 4Y4HD 1ZE3C 4JFDB 1AIFA 4HGMA 1RVFL 1Q0YL 2HJKA 1E4WL 1G7QA 3WNOA 4GKNB 3FT4B 5I1EL 3C8HA 4YC2B 1P53A 3HC4H 3MXVL 4TVPE 4XPAL 4GAYA 5JA9A 1KYOK 5CZXC 4S10A 5JMOC 1FFNA 1J8HE 1KJVA 3CH1A 3SCMB 1KNOB 3SDCD 5JZ7C 4D9RD 2KBGA 3IDXL 5I9QC 2CR6A 2EC9U 3LKSB 4NCDA 1CL7H 2XY1A 2W0FB 5BZWB 2KL6A 5EU5A 1JFQL 4WO4D 2YA2A 5DQDH 2FO1A 1S7RA 3QEUA 4Y5VB 3LY6A 2KZWA 5D7KD 1DBML 3RL1B 1TQCC 5GRXG 3RWDB 3NIDF 3JUYA 1QSFB 5KANI 3O4LD 4L9LC 5I73B 1FCCA 2BFVH 3EO0A 3T2PA 4HEPG 5E00A 1VFAB 4FQLH 5CJOL 3NFSH 1OT2A 1ZWIA 3HZVB 1GC1H 1ZANL 4RZCA 3DETC 2JB6B 2HLAB 1T66C 4BH7A 4P2QD 4M6MH 1NMAL 2VXSH 1CT8B 1CFTA 3ROOB 3TH4T 1MFBH 1MHPH 1W0VB 4KMQA 4JFXA 3FJTA 1I3GH 4J6RL 4DFHA 1IC1A 1IEAB 2H26A 2R29H 1XF4B 1NBYA 2OZ4L 2EDXA 1C5BH 3DV4A 4KQ4H 3MRNB 4HG4K 3FOLA 5AZ2L 2IANB 5B39B 3T1WA 4RA3A 4G6FB 4ZAKB 1RSFA 1WZLA 1S7WA 4HUXA 1M4KA 3WO4C 4PGDA 3FKUS 1JPSH 1G9MC 3MLYH 1I3RB 3TM6A 4F7CB 5DD3H 3OXSB 5FV1L 4NZJA 2D03H 3N1MC 5IK3B 4Y5XC 4GG6A 2VB5A 3VG9C 4EN3C 1YNKL 3WNPA 3GI9H 4M93B 3AS3A 4ACPA 4L8SA 5HPOA 3QNZB 4M48H 5AZEH 4X4XB 5E6IA 2QQLH 4QRSB 3VMNA 1JPGA 4EXKA 2XTJC 3H0TA 5I6XC 3G08B 1MCEA 3D25B 5C0NC 4KRPC 3WNLA 4YUEH 3WN5B 1LWRA 2WUCL 5TDNA 4F9PC 4X8XA 3MCLL 1T1ZB 2X7LB 5HI4C 1PX4A 1U8IA 3HZKA 4P3CL 1U8KA 2F58L 3QPXL 4XMKL 4NZUH 3KHOA 4UDUB 1AP2B 4WEUD 2F53A 2X4NB 4HS3A 4CNIA 1TJIH 2VISA 1RZGA 4UMGA 2VLME 1N26A 3WLWD 3TT3H 2W60B 4GG6F 3UZEA 15C8L 1S3KL 4NHUA 4DZ8B 5HYJA 1XCTB 4ODSH 5IUSA 1KFAL 2OI9C 3CFDB 3B9KD 1NBQA 4PJ8D 4K7PX 1H15A 1CD1B 4KKCD 4XNMB 2IBZY 2NX5D 3F58H 2DMBA 2ERJB 3RDTC 2NXYC 4PJBE 4C56D 4XMPL 5CINH 1DCLA 4U49A 1JP5A 3QUKA 4U3XA 1EUTA 2BNQA 2HH0H 5IMLB 4NN6C 4ENEC 4Q97A 4X6DA 2ZUQB 5DD6B 5DR5H 2WWMD 4U3CA 4MQXD 3LN4A 4OB5L 5MI0C 1ZHBA 1KLUA 3QCVL 3QHTC 1EEQA 1RURH 3CSBA 4NZTL 4MNHB 1T04A 4L4VD 1Q9OA 4XBPA 4KDTC 4DKAA 5IGXH 1IGJB 2NLJA 3DX8A 2OTUB 4LIQH 4DJMA 1HOCB 3CFBB 3RAJL 1MHCA 3T4AB 2GAZA 1KIPB 4HH9B 3IJHB 3HZMB 3QDJD 1B2WL 4NWTL 3IFNH 2Z93A 3LS4H 1QR1A 3IFPA 5F7DB 4G7YL 5ISZD 3O41A 2P1YA 5JNYA 3RWHB 4EZMA 5FCUL 2PXYD 5C7XH 4JCLA 4NP4H 1FP5A 1CN4A 5E2TL 1KXVC 1KTDA 1LP9E 3ARDB 3F7RA 3WIFA 4PRDA 1VGKA 1FZMA 4XNXL 2LU4A 3P73A 3QUMA 3ULUD 2DMCA 5IIEB 4PLKC 2IG2H 1X5ZA 3BD3A 4KROB 3M45A 3ULVD 1W8NA 2RCSH 3QIBA 3VRIA 5L6YH 3GHEL 2P5EB 1YZZA 1KJ2H 3MBXH 2XNAA 2ZUXA 3GMOB 5EZLB 4JAMA 1QLFA 5HDBF 4M03A 4MLSA 1HQ4A 3RX7A 5CHNA 1KOAA 1NMBH 4PTTB 4Y2DA 3IJSA 1CK0H 1RZFH 5EDXA 4LLWA 1ITCA 2J6EL 4X6CB 3FOMB 5DT1H 2WV3A 4M61A 4M4RA 3VXQA 1C12A 1NAKL 3VFVA 3O6KL 1CDIA 1G7HB 3C60A 3NCBB 3BZ4A 3GSNB 2APXA 1CGXA 4MB4A 3PWUA 2VDML 2OJEB 4WU5A 1AGCA 2EYTB 2IPTL 4K9EH 3K7UA 3CAFA 3SDAD 3TBYB 1IAII 4FOMA 1DBKH 1QRKA 1BJMA 5A2FA 1F4WH 4N8VA 5DHVA 4Y16A 4H1LA 3ZKQD 1BVLB 4QXTA 1WICA 1IZJA 4YZFF 3QDMA 4EVNB 4DQOH 5F7LB 4A6YH 4X9HA 2EE2A 3B2UD 3KNBA 3HZYA 4I1NB 2BXYA 1YEIH 4AENA 4AIOA 3GSOB 5ITBH 4N1HB 5K9QI 2R4SL 4WI7A 5J11C 1V3MA 5CJQH 2Q1EA 4R3SA 4XAWL 4FG6D 3MNVB 1JF1A 4FS0A 5IW6A 4M1GL 2XV6B 3H9SE 5D1XA 3IDNB 3N1PC 2CIKB 4AZ8A 4JFOB 4ZO9A 3D85A 4U6VL 1I7RB 3HS0A 3GRWH 2ESVD 4TUJB 5KJRL 5CGMA 4NJAL 3D39A 3FRPA 2C3GA 1UEYA 3U2SB 2Y06H 1OAUL 4MCZA 3KPQA 4PJEF 1A21A 1RJLB 4WY7L 3V7MA 2JJTA 2RHEA 4UIMA 4XC3H 4P46B 4A2MA 1YJDL 5TQ2L 3L5HA 1MHEA 5IESL 2HT2D 1YEFH 4P2OA 3I75A 4WNQA 3ZT5A 2EXWC 4OD1L 3WKML 4FTVD 3TCLB 3HPJA 5GRJL 1L0YA 2P8LB 4PJ7F 3GJFA 1I8LA 3O6LL 5HJ3A 4ZD3H 3UYPA 5AWNH 1ZT4A 4QHMB 4F15B 1PKOA 1OAYH 2VDRL 1XGUB 3T0BA 3BRGC 3I9GL 4QCIB 5GGTH 5DDHB 3DLQR 4UOW0 3WFEH 3GK8L 3P77B 1HHGA 4JY6B 4MNGB 3GMPA 5FYJE 4I4WA 5E2WH 5KTEL 2F5BL 3CFCL 5D7JA 3NN8A 3REVB 1NGYB 4HGWA 4OIBA 2GT9B 3CK0H 3LRGA 4CADB 3MO1B 4ZNEE 1WBYB 1OWWA 4JFED 2R23A 3VMOA 5GGSY 3KS0H 4HS8H 5HVHB 4G8GA 3GIVB 5DVKA 5BQ7B 4QXUL 3CVHA 3I50L 1FLRH 3I84A 3RNKA 3SJVB 5CEZE 5FECB 2V9QA 5I74B 3ARZA 4GW4A 1J1XL 3TWCL 4JFFE 2B7DT 3RL2A 4DGYH 1F2QA 2DQFA 4LEXH 3ORJA 2BC4B 1I4FA 3ZHDA 3MZTA 2H45A 3QO1A 4HXBH 3AMLA 5BVPH 1ULVA 5ICZA 4K7PL 3WL9A 2R1YB 2ICWI 3SKJH 2J8UA 4N9GA 1BX2B 3VRLF 2X4PB 4G9FB 1YUHA 2Z35A 5I76A 1O7SA 5KZCB 1CFNA 4FQQA 4FQIH 4LHQB 2EKSB 5DD5H 4KQ3L 2A2QT 3DUHA 1R3LB 5HD8D 5DQJB 3VXOA 4K8RC 1L0QA 4PJAE 2XZCL 5HI3C 5MP6H 3BRFA 1IFHH 2V7NA 3KVQA 4PP1D 5KSAA 4PRPE 3L3JB 4CKVX 3IF1B 2QR0A 4XXCC 4LRIC 1AGDA 4QT5A 1RZJC 5E9DE 4ZUTB 4F3FA 4F8QA 4WEMB 1T2JA 1Z9SA 4KC3B 3PWPE 1I3VA 2VXVH 4PV8B 1QLEH 3D0LA 5JXED 3TESA 5JPNA 4KI5F 2NXZD 3GJFK 4I0CC 3TNMA 4NM4H 4U1SA 3BHBA 3QJHB 2V9TA 4HPYH 3GB7A 1A6PA 1MWAH 4PRID 3K8MA 4HX1A 3QZWG 1MLBA 2O93L 1CE1H 4IOIB 3DGGB 4MYWB 5DJ6B 2NY6D 5A16B 4P9HL 4OFKA 3KPNB 3X3FH 3PF2A 2X70A 1NANI 1RFDL 3RU8L 3FFCB 4XVSL 1HQRA 2R1WB 4ZS6C 5C0GA 4HJ0D 1KJ3H 3JV4B 1M6OB 1G6RH 4NDMA 4IRZL 3WHE1 4RGNC 5BZDA 5DFVC 3DNKA 4M6OL 2EXYD 4RAUB 4OD2B 3U9PL 3OKMB 1DN0A 2FWOA 3MMEB 4NQEA 5D1QB 1B4RA 3U9UA 3SE4C 4UB0H 2HJFB 1LDPH 4ZDHA 4GH7B 5I19L 1JUFB 1R3HA 1CDHA 3PL6B 1K3ZA 4MJ6A 4ZUWA 4OBSA 2FEEL 1R24A 4KJWC 5IHZA 5KAQG 2BHUA 2O5YH 4HS6B 3MBED 2ILLA 4WWKD 3FFCE 2QBWA 4LOUC 4UAOC 3SN6N 2DRUA 2YUXA 3B2VH 3QIWD 4FFZH 1JWSA 4K3JH 2C3VA 2R0KL 4LSRL 3ULUL 4I48A 5E8DH 1ZLUK 1OSZB 2BK8A 3EYQD 2CMRL 3ZKMD 5SX4I 1UXSB 2UY6A 1TCMA 5DUML 5EOCL 1SJEB 1MUJB 3CU7A 4LEOB 5T1DH 3UX9B 2OL3B 2IWGA 2P48B 1CICD 1J11A 3H42L 4ETQA 5ILTH 1K8DB 1A3QA 2W0PA 3V5DA</