3OMZA

Crystal structure of mica-specific human gamma delta t cell receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
240
structure length
215
Chain Sequence
SVIRQTGSSAEITCDLGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSKNLRMILRNLIENDSGVYYCATWDQNYYKKLFGSGTSLVVTDQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKRLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGESLTRADKLIFGKGTRVTVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords human Vdelta1 gamma delta T cell receptor delta1A/B-3
publication title Crystal structure of a {gamma}{delta} T-cell receptor specific for the human MHC class I homolog MICA.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 215
sequence length 240
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3omzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3omzA01
5F89A 2J8OA 1JTPA 5DSCA 2RR3A 4PJBA 4YNYA 3O0RH 2G9HA 3GUTA 5KJRL 1O7SA 2EXYC 3K3QA 4HFWA 4D8PB 4CN1A 4IEFB 1JGUL 1KBGL 2R2HA 5F9WC 3TBWA 4QRPD 5I75C 4PLKD 2FIKA 1HYRC 1VPOL 5C0BE 3P30L 1CGTA 4XNZB 2NTFB 5E08H 4PJ8A 3WXVH 2DI8A 5HI3C 1D7FA 4OKVB 2CPCA 3MGTA 4M1GL 2NY1D 3BZEA 4UDTB 2FJFB 1RK1B 3TV3L 2CRYA 4JFDA 3ZYJA 3MV7A 2P4AB 4LQFH 3ZE2F 4ELMF 1WJ3A 3DV4A 1M71B 3U46B 4ZXBC 4KROD 3OKDB 5BW7C 4X7CC 3UJJL 2GTWA 4QOKA 3EJYD 4NQSB 4LIQL 1EO8L 4JEGB 1G9MH 1BQHA 4W81A 1T1YA 4PJBE 1MFNA 1T1WB 1G7IA 2P1YA 4XNZC 4BQCA 1LO0H 4AH2A 5BRZE 2NY6C 4RGNE 1G7QB 2BNQA 5DJ2B 3HE7A 3MRMA 5D7JB 3LN5A 2H8PA 5DD6B 1RJCA 2ESVA 4MD4B 4C59B 4OCSL 3RFZC 1YMMA 2OBGA 2OTWA 2HRLA 1NLBH 4K07A 2EE6A 4P5KA 1JFQL 4PJGB 2DD8H 1T5WB 3OKEA 4OV6F 4MB5A 3RU8H 5DLML 1UACL 4P99A 1QQDA 4NC1C 3BHBB 3O2DL 3OHXB 2FEDD 3MV7E 1YJDH 1HIMH 2PUQT 4YAQB 2C9AA 3AXLB 2AJZA 1IM9B 3MRGA 1Q9KB 4QOKE 2XTLA 4FQJL 3IXTB 3D3VB 1RIHH 2GITA 4JQIL 3CJJA 1BFVL 2BRRH 3VRIA 4ZO8A 3MA7B 1ZA3A 1F90L 1RK0A 3B9KB 3BZFA 3GSWB 3QXWA 1YEJH 5DI8B 3CXHK 1VKXB 3B5GA 4PGDA 3VI4E 2OTUA 2BNQE 4ELKB 4X7TA 1FGVH 3HR5B 3QDME 5DJYB 2ESVE 4HUNB 3ILQC 1T21B 3B2UC 4WI9A 1P6AB 2R1XA 2VN4A 5FDWB 1SVCP 4CVWA 3L7FB 1PKQA 1ETZB 2A74B 2IH1B 1KTDB 2YBRB 4NN5B 3HLAB 3WLWD 1EEQA 2FX9H 2CO7B 3T2NH 1C12A 1NSNL 1T66C 5I1HL 5HHXH 4OV5A 4RMUA 3MRIB 5E2WH 2V2XB 3HMWL 4JDVB 4QF1A 1K3IA 1VADA 4AG4L 4JFQA 4XPGH 4YFEA 5D1QB 5F7FA 4LCYB 5EZIL 5EN2A 3QZWA 4FQXB 2DQDH 3QXDB 4ONHB 3UYRL 3MLXL 3VRJA 4UMGA 5EORL 4LSUL 1B4JL 5EZJA 1FAIH 1P4LB 1FCCA 2Z92B 2QSTA 4U1MB 4DJMA 2HRPH 3THMH 5T1MA 2X9WA 1ZLVK 4U31A 1UGNA 4ERSH 3ET9F 3UZQA 5EBMA 2DS4A 2NX5B 2GUOB 1FLRH 5ERWA 1JI2A 3JBG7 5D1QC 2WQ8A 4JFEE 1ZLWH 3IF1A 2KQMA 2Z4QA 1IAIH 3MLUH 4D0DA 1EVUA 2ITCB 3M17B 1H8SA 2BXYA 3U0TA 4CKVX 5CD5D 4MAUH 4X4MA 3RWCA 2BNRB 4HQQL 4DUVA 1CFNA 3QP3A 2KL6A 5SWQA 1FL6B 1Q9LB 4JO2L 3IAGC 2Q87A 1FL3B 1XIWB 2A83B 3Q6GL 2IADB 3LKRA 3Q1SH 5EC1A 4DVRH 4RWHA 2GW5A 2FIRT 4XTRD 3HG1D 4PRIB 3HN3A 3TYFB 4JZJA 2DMBA 4OFPA 1N3NA 1KLGB 1AIFA 3RWGA 2XI9A 5F6IC 4TVPE 3V52H 4Z7VB 3BYYA 4OUUB 4KQ3H 3MNWA 3RGVB 2O5YH 3HC4L 3P4OB 4ODSL 4TUJB 4MNQE 3ULUH 5F3HA 1NFDF 1UCBL 1XIWC 3LKSA 5GGQL 2IG2H 3UBXB 4BUHA 4MZ2A 4E5XB 1IGFL 3QUYD 3V5DB 1ND0B 2B39A 3P11H 4LLWB 1PVHA 5GS1C 1XGPA 2V2TB 2V5RA 4EQ3A 4NRXA 4DKEL 2IAND 3G5XB 2VDQH 1PZ5A 4PRDB 1TVBB 3RGVC 4PJXB 2ZCHL 4X6DA 3SKUD 4LHJB 1NFIA 2PF6A 3KWWB 1FVDA 4ZNEA 3TA3C 3S3SA 4OD2A 3AUVA 2BVOA 3RHWK 1FGNL 4N5EC 5DK2B 3MRKB 3KAAA 4XZUB 2G75A 5KOMC 3SE3C 1MREL 1FPTL 3HRZA 1L7IL 4ZOCA 4U6YA 1EHXA 1MPAH 2YKLH 1OW0C 2HTLD 3T1WA 5E5MA 4RWYL 5J6GA 4OSUL 5DD5H 5EU6D 4Z18A 2MQ0A 1RULH 2L0DA 1F6AA 1JRHL 4HBCH 5DXWA 4I3GA 4DKFL 5J4MA 4L8SA 1SM3L 1BX2A 3OKOA 2CKBB 4K8RC 4QHLB 2GIYA 1CE1H 5B3JE 1D5BB 4P2YA 4OQ1A 5ESVB 4X6DE 4X8JA 4YHLH 4HIXH 2A6IB 4ZNEE 3MODL 1QD0A 4AK1A 3FTGA 2KUTA 3R8BB 1OPGL 5T5NG 3VGBA 1NC2B 3CFBB 5ACLA 2NY4D 2WWMC 1CF8H 1G1YA 1PEZA 4M7JL 2VE6A 4YHKH 5EC2A 1IGJB 4QXTB 4M1DH 4J3WA 1HI6B 4YBLB 4GRMB 2VLKD 3VFNB 5E8OB 4OFYA 1A6UL 3CX2A 3D9AL 3UTZB 4AMKL 4PLJC 1OARH 1TNMA 4LASL 3U48A 2EZ0D 4MJIE 1ZLUH 5CMAB 2IFGA 4D8PA 1TCRA 3MLYH 5ACMA 5HDLA 1WIPA 1WISA 4QHUB 4YBLC 4APQB 8CGTA 1EHAA 3SO5A 3TO4B 4JN1L 5DUBB 3FQNB 3UO1H 2NTFA 4UTBL 5BVJB 4OFVA 1KIQB 4UDTA 3W2DH 1GGBL 1RK1A 5MEOB 2ATPB 3JWDH 1DN0A 1HILB 2VJXA 3FO2B 4R7NB 1M71A 3QIBB 4M7ZB 3U46A 1MFEL 2DOCA 5DRWB 2RJMA 3T04D 4NQSA 3IDGB 4YWGH 4APQC 3SOBH 3VFOA 5IBLD 3GZKA 1K5NB 1T1WA 3ZKXB 1ZA6B 2VISB 3QAZC 3ARZA 2R4RH 1G7QA 5DJ2A 2HVJB 4O51A 3W0WD 1MJ7L 3RVXC 1NKRA 5DD6A 4NO0D 5IESH 4P5TD 4MD4A 2QSCL 1M05B 1E4XH 4M7ZC 1DFBL 1JGEA 4OCYH 3AY4C 4IDJL 1D3CA 1T5WA 2ED8A 4K7PH 2MKLC 1ZWIB 5GZOC 4PPTA 2UWEB 1N6QH 5FA3A 2D7NA 5I74B 3QPXL 3BHBA 4M5YL 4M62L 3OHXA 5JHDA 4N0YH 4BSWB 3AXLA 5L6YH 4XNYL 5J56B 1H3XA 4OLWH 1EBAA 1OWWA 5JQHC 4JFFE 5E6IB 5IB1A 1Q9KA 1XZ0A 3UPAA 5J06A 3D3VA 2DI7A 1ZLSH 1H0DB 1KXVC 1EX0A 1S9XB 3QHTC 1UXWB 4EXPX 3DSNA 3MA7A 4OZIF 2L7UA 4KKAC 3B9KA 5CLTA 5IF0B 3GSWA 4C58B 5ID0A 4JHZA 5DI8A 1VKXA 4PTUB 5D1ZB 2K1MA 3BFOA 3GGWB 4UV7H 2F58L 4TYUA 35C8H 1T21A 5FDWA 1K8DB 4OCNC 4GFTB 3L7FA 4PJGE 1ETZA 2A74A 2YBRA 1MNUH 5E6IC 4DAGL 3HAEH 3HLAA 3RIFK 1KV3A 5KVGL 1ODAA 3MRIA 3QEGL 4MA3B 4RFNC 2NY3D 3TP4A 4NUGL 5BV7H 1QLRA 2VDNH 5A2IH 4JDVA 3JV6B 1BFTA 1KIUA 1SQ2N 5EFIB 2VMFA 5T1KB 5D1QA 4LCYA 4BKLB 2ED9A 1HXMA 4K71B 4ONHA 3VWJC 1EO5A 4H8WC 3S36X 3Q3GB 3V4VL 1RIVL 2Z92A 4U1MA 4OZHB 3A6CH 4IJ3B 5LBSL 1UENA 1T0PB 3FQTB 2CK0H 5I66B 3CMGA 1G7HB 4GKSB 4Y89A 3SHSA 2DL2A 3CGTA 4LVHC 1EZVX 2GUOA 3BPLB 3SE4C 4WI5A 4KZDH 3BD3A 1CLZH 4EXKA 2ITCA 2F74B 1S7WB 1C5CL 2GJZB 1Z3GH 4IJ3C 2ZUXA 4OCXH 4PJ5D 4Y4KD 1B4RA 2V5YA 4X7EC 5DD3L 1CGUA 3L5IA 1FL6A 1Q9LA 1FL3A 1J86A 1XIWA 2IADA 2DJUA 4IIQB 1ZTXH 1AR2A 3GM8A 4PRIA 2D31B 1NJ9A 1GGUA 3HFML 5GS1A 3TYFA 1WT5A 5T5FL 1KLGA 3MOAL 4G7YL 4M03A 4TVPL 1AJ7H 3INUH 4Z7VA 2QQNL 1JZ5A 4Q9CA 4RGOH 4OUUA 4FFWC 4O5LH 2MMXA 4LPVA 4DGIH 2FYYB 3RGVA 3P4OA 2Q8AH 2NX5E 3C8KB 5C0CB 1KJ2B 4TUJA 1FZMB 3WV0A 2Q7NA 4W4NA 1DEDA 3TA3A 1BMGA 5ESQB 2MCPH 3NCFB 3DX8B 1OAXH 4ODTL 3QO1B 1S5HB 2R8SL 2DKSA 4LHUG 4E5XA 4HUVB 1RV6X 4QGYA 1ND0A 4K3DH 1KEML 5EBGA 4PJ7A 3HMXA 4LLWA 5FF6B 3NA4A 3ZKMD 2V2TA 2AK4D 2BNRE 4HUWB 3SE3A 1KCVL 3NFNB 3DETD 1FIGL 2R29L 3G5XA 4PRDA 4NNYA 1TVBA 4BFGA 4JO4L 2C3WA 4TOYH 3ARDC 4YE4H 4PJXA 2XT1B 3OXSB 4KV5E 1OW0A 4P4KD 3KWWA 5CP3H 2OR7A 2D7TL 3VG0H 1T1ZB 2AK1L 4Z7VE 5ISZB 1QFPA 2DMCA 4M1CD 3T2OA 4D2NA 5DK2A 3MRKA 1KB9K 4J3SA 2OJZL 3K8LA 5AZEL 3HZYB 1ZHKB 1E4WH 3WFEL 2P8LB 2E6QA 3MV8A 3QDJA 2EICA 3ELAT 2V17H 4DOHB 2H41A 3MJ7B 4X5XB 4HGKC 4JFYB 2NW2B 3BRDA 1WEJL 1KTRL 4YZFF 4LGPB 1EBPA 4XP9L 4OF0A 3VGAB 1MAML 4JM2B 4HKBA 1DE4B 1QKZH 3WL9B 1DLFH 3WCYA 3DGGB 2UZIL 3PHSA 1TZHB 5T3ZD 4WFHE 2CKBA 3NIFE 1AI1L 4ZD3H 3IFPB 2DIBA 5JORB 4PJXE 1D5BA 1KFAH 5MI0B 2F53B 5ESVA 3H0TB 2UV3A 2A6IA 4IRJD 2WINB 3ZT7A 4X9HA 1Q0YH 3SDYL 5JZ7C 1BIIB 4Y5XC 5DHVH 3HNSH 1PLGH 4Y4FC 3CFBA 3VGAC 1PQZA 4RMRA 2FZ3B 2HFGH 2R0WL 2P7TB 3HI6L 3RVTC 1IGJA 4NZDA 4LSVH 4QXTA 1OQOA 3N9GH 1HI6A 4GRMA 3VFNA 4I0KA 5E8OA 4G9FD 3UTZA 2QADD 2MNUA 3AS3A 4PJFF 2PXYD 1FL5B 2JLLA 3QBTB 4J8RB 1GC1L 1L6XA 4J3VA 5KG9B 3HE6B 2EDFA 4AEIL 3MBEC 1KN2H 5DFVD 1UVQA 2Y9RT 4OGXL 1YNKH 1I7ZB 2YUXA 4U6XA 1OAZL 4E0RA 3QUMB 2FR4A 4JPKH 1SY6H 2D03H 5SWSD 4APQA 2ADFL 3DXAD 2VXUH 3PGFH 4KHXH 4OZGB 4XHJC 1T1XA 3TO4A 1AR1C 4WHYG 4Z7OF 1RJYB 2WIMA 3FQNA 1AXSB 4FQ1H 4X7SH 5J6HA 5BVJA 3HE6C 1CS6A 4PG2C 3R8QA 2VKWA 5IIEB 1C5BL 1KIQA 1DEEB 4OB5H 4QXUL 1RZIA 5MEOA 2ATPA 3O3AB 4F9LC 1HILA 2YMXH 5FYLL 3ZE0E 4DGYH 4R7NA 1TTUA 1K4DB 2DBLH 4K94H 3AY4A 4UB0H 3LHPH 5CEYB 5DRWA 5KOVC 3F12B 1R24B 3QG7H 3IDGA 3UEZA 4OF5A 3PUCA 2AXHA 2M26A 1GGIL 1K5NA 2W38A 1ZA6A 2VISA 4OBRA 2HVKB 5K93A 1AO7D 4ZUVB 3KLSA 1XCTB 1IGTB 2HVJA 5JW4M 3SO3B 4HGMA 1YMHB 4HW6A 1I3VA 3QISA 4YFDB 3RAJH 1SBSL 4WRLA 4L1DA 1T5XB 3FT2B 5GRYA 1S3KL 1ZWIA 4HWEL 5F71A 5F97E 2K9UA 2UWEA 4EBQL 4KI5F 1H3TA 3P9MA 4GG6B 3DI3B 1SYVA 4CJ0A 1AGEB 3LEVL 3SO3C 4POUB 3ARPA 4MXWL 5E6IA 3RZCB 4XGZB 1L9MA 5CZVH 4UIKL 5TPWL 1H0DA 1UXWA 1UWEL 5IF0A 4PTUA 5C0GB 2NR6D 3FMGL 5CUSH 3GGWA 4LSQH 1JP5A 2BDNH 1SYSB 5HDBF 1D9KD 4QRRD 5TGBB 5D7KD 1K8DA 2ZCLH 3GM0A 4ALAL 4M5ZH 1J7VR 3V0WL 2IFFL 1EZVY 5D1XD 4JPWH 2UWEE 3BDYH 4NYLB 4NZRL 4MA3A 4ZFZB 3A6BH 1RURL 3JV6A 1NC4D 1E6OL 4EN3B 3RKPA 2VDML 2DTML 1S7SB 2JB5H 3SE4A 5F1SA 1U2CA 3IFLL 4OF7A 4BKLA 4WEBH 3U83A 2RHEA 2B7DT 2BVPB 4HPOH 4IRSB 2VLLB 1RUQL 4OZHA 3SDCB 3W11C 5DR5H 2KZ1B 4X5WB 3Q0HA 1QBBA 3FQTA 5I66A 1ZANH 1G7HA 4GKSA 3L3GB 1FLTX 4K9EC 2AQ2A 1A47A 1JGLL 4YXKH 1RAMA 4EN3C 1N4XL 4L4VA 2ADJB 5FA4B 5AZ2L 4PJCF 5DMIL 3HC3H 4H0GA 2EO9A 2GCYA 2A9ML 2AEQH 3CAFA 3V2AR 2SEBA 4FTVD 2F74A 2FO4A 1QLFB 4MZ3A 4M6NH 4UOJA 2YA1A 2GJZA 1UYWH 4OLXL 5CINL 5C6TH 2IBGA 2DLEA 5EUOE 5JMOC 3SDCC 2YK1L 4PTTB 5FXCH 2WBWB 1QACA 3Q6FB 3MC0A 3KPLA 4LHUA 1J0ZA 5I1JH 5H37H 1KYOJ 4IRZL 2YPLD 2D31A 4OZHE 2UZYB 5ICXB 2I27N 2V9QA 3MJGX 1GPOH 5F70A 1K85A 5M94B 4UBDD 4KKCD 3C8KA 5C0CA 1KJ2A 3ZDYF 1QNZH 2JJWA 1LP9B 3RA7H 4GW1B 4BM7A 3T65B 3UX9B 4NKMA 3DX8A 1JV5B 4UT6L 2C3HA 1S5HA 3IJHB 3QO1A 4BQBA 4HUVA 4PJEB 5TQ0L 2QQLL 1JMZA 5FF6A 3O6LH 4HUWA 5CIPB 5J1TC 2FB4L 3NFNA 4PG9B 3LCYA 4DQOH 15C8H 2O5XH 1TJIH 1RZ7H 4ZUWB 4XRCB 3G5YA 2BHZA 3OXSA 4POYA 4XCCL 1XGUB 3KLDA 1JPTH 4PUBH 5DEZA 2OCFD 1T1ZA 3ZTNL 1RUAL 4JDTH 3OR7B 1ZSDA 1T7YA 3V95A 4YO0B 3HZYA 4FQ2L 1ZHKA 5C0CE 1JZ8A 1SJXA 5IEHA 2FJHA 5HBBA 5BJTB 3PWPD 2DQTL 1MCEA 4UNVA 1NMAH 3MLVH 2EDWA 2NW2A 4Y5XA 4HULB 5KBNC 4Y4FA 1J0KA 4XPAL 1AD0A 5EOCL 2CXGA 3OJ2C 3SE9H 3LOWA 4WUKL 3WL9A 4UINH 3DGGA 1TZHA 1Y18B 2EDEA 2OQJB 3IFPA 5JORA 3WSQH 1A6TB 2F53A 3BPOC 5DDHB 1MRCH 3E6HB 2WINA 4UV4H 5HYSB 4FFVC 5F7MC 2IPKA 2R2BB 1BIIA 2FECI 4HHAB 3MBEA 5ISZE 5IK3B 1UZ8B 4I3SH 3S36H 1N59B 3TN0D 3BP4B 2FZ3A 2QHRH 3QIUB 3I3DA 2P7TA 2AP2A 3DMMD 4DOHE 4ZS6D 3S3PA 1IQDB 4KGLA 4R90H 1FG9C 5T1LD 4CN4A 1QEWB 3DJ9A 3WIHA 1FL5A 5IVNA 3BDBA 5KG9A 1DJSA 3HE6A 4PG2A 4KU1A 3QWOB 2Y06L 4CL7A 2CKBL 1F4WH 2EIZB 4F9LA 1MUJB 1I7ZA 5IBUB 3W39B 3MXVL 2F53E 3QIUC 3QUMA 3AS2A 2P46B 1L6ZA 3L3OB 5HDOA 3OJVC 3C08L 1B0RB 3OF6A 2QQKH 3K46A 1RJYA 1AXSA 1IAOB 2DMKA 2J4WL 2ZZUT 1GRWA 4HMEA 1BBDH 2Q76B 4I18C 1EO7A 3VH8G 1U8PB 3HB3C 4JHAL 1B6DA 3EOYG 4V1DB 3GMMA 1F4YH 4GOSA 3CFJA 5CEYA 4P23B 2W9EH 3F12A 1R24A 3SDXF 2OL3A 5ALCH 2NZ9D 4FA8A 1MCFA 4UTAH 3ULVH 4FXGB 4QHKJ 4QT5B 3QDAA 2FO1A 2HVKA 1UKQA 5IHZB 2IMMA 4X9GA 5GZND 2VDRH 1YQ2A 4J1UB 2YEZB 5EPMB 1IGTA 2EH7H 3MUZ1 1YMHA 4JKLA 1OB1A 4WI7A 4PJ8D 2ZSWB 4OZGE 4PJ9C 4JGUA 2JELL 1TFHA 4ZTOH 4P23C 1A7RL 1T5XA 3FT2A 5K9QG 5FCSH 4JFDD 5C08D 1OP5H 3MV7D 3UC0L 4HEPG 1I9IH 5JDSB 2X40A 5DQ9B 4X99B 4NRZB 5HGBB 1KACB 1AGEA 4FFZH 3X14B 4M9OA 1N5AA 4XGZA 5AG9A 3ZKSD 5IFHL 5JOPE 5L7XH 3SY0B 2BNQD 1BWMA 1JNHA 2R0ZL 5CEXA 4BJLA 2ESVD 4GS7B 1YMMD 3EAKA 4HDIB 1QLEL 1SYSA 4HG4J 3D5OF 1D5IL 4MS8D 5D71L 1R3IL 3L6FA 1EMTL 1XH3A 5IFAL 3D1MC 5D5MA 4UILH 2XXMB 3SQOL 1HHKB 1QBLH 3O8XC 4KRLB 4YGAB 4ZFZA 4L5FL 2ICWJ 4GG6E 2ICEB 3L95B 4EN3A 3CVHA 4YX2L 4P46C 3SDDB 1OF2B 2DJ4A 2R69L 1B2WH 1AXTH 4LOUC 5ADOL 3CLFL 2E27H 3MGOB 3RPIA 2BVPA 3C60B 4PY8I 3UTPD 1CBVH 5FGCB 2BK8A 4IRSA 2VLLA 4XVSL 3SDCA 4MHHI 1OTUC 4X5WA 3D85D 4XNUH 4PRHB 2VH5L 1MCIA 3L3GA 1P4IL 3QFDA 2J6EA 3DSFL 3WIIH 3QIWD 2ADJA 4H8WL 4LEOB 5FA4A 3BP5B 1FYHB 5I1IL 3MLRH 3T08A 3KYMA 3VG9B 4H1LH 3SEPA 5IMOB 5TE6L 1QLFA 4FQQA 2R4SL 3BGMB 4X9BA 3I50H 1I1FB 2AABL 2Y36L 3OGCA 2H6PA 4O2FB 4LKCB 4BFBD 3T0DA 1PG7L 1DBAL 1DLHB 4X98B 1UWGL 4PTTA 3GHBH 4N8VG 1IZKA 4PJIF 3Q6FA 3QEQE 3VXRE 3HI5L 4JY5L 5ESAB 1XF2A 4JPIB 4MXVF 4TVPD 1UG9A 4NWUH 2BSTA 2PTTB 4AIOA 1PEWA 2DLHA 3VG9C 4P5MB 3ETBF 1C1EL 1YZZA 4NQXB 4GAGH 2NCMA 4AENB 4MQ7A 4S1DD 3T3PF 4QHNB 5DQJB 1LP9A 5T3ZH 5DQDH 3QQNA 2I5YL 1FE8H 3O11B 3T65A 5DC9B 3RJDA 2H1PL 1JV5A 1UC6A 1KIRB 1A7QH 3IJHA 4LKXB 1X5XA 4HUUA 4PJEA 4HWUA 3IU4H 5I0ZA 4MXQD 1HSBB 4PG9A 3SBWC 3QHZH 1MF2H 2W07A 1WFNA 4HS6B 4XRCA 4ZUWA 4PS4H 3TESA 2FD6H 4PGCB 2DLFL 1W0VB 1LNUA 5I1CH 1JZ4A 1NLDL 4R96B 3QCTL 3O6KH 3BSZH 1CGYA 3EOAB 3OKKB 3EOBA 5MERB 3OR7A 2HJKB 1JZ6A 5KJRH 4YO0A 1OD9A 3QQ9D 3BIAX 1KJ2L 5C09B 1JGUH 4WWKD 1KBGH 1YUHB 3S35L 3IS1X 4TSBL 5BJTA 3L5WB 3GSRA 3RUGB 4M6ML 3V9FA 1VPOH 1CL7L 2ADGA 3P30H 4U3CA 5DEGB 4PJEE 4W6WB 1CN4A 1D6EB 4QWWD 3MMEB 1C8PA 2EEBA 1NCBL 1JYWA 5D70L 4M1GH 3TV3H 1Y18A 4HK0A 5L9DL 4WV1B 1OAKL 3EBAA 4RA3A 3BKJL 3U1SL 1A6TA 1JI1A 1NMBL 1INDL 5DDHA 3ZHDA 3E6HA 4G9DB 4LK4A 3UJJH 4LAQL 2VR4A 4LIQH 5IMMB 2R2BA 1JE6A 1TZGL 5LGHL 4HHAA 3STZB 5C07B 5IK3A 4M43L 4L8DB 3KPSE 1UZ8A 1H3VA 1CD0A 3BP4A 4JRYD 3QIUA 4ZFFB 4OF6A 1ZXQA 4GQPH 2UUDK 4ETYA 3TBSA 1IQDA 2V9RA 4OCSH 1O7VA 4G3YL 1JFQH 1QEWA 1C08B 3ZZ1A 2Y4SA 4JZOB 3TBYB 2KZWA 1A6VL 1I9JL 2BC4A 3PIQB 4MLIA 4RFOL 1OGAB 1FNEA 5DLMH 1UACH 2JE8A 3M45A 1ZHLB 3VH8A 4JGJA 4DTGL 4I18A 5D4QA 3QWOA 4JRXA 3O2DH 3DI2B 3TWCL 2EIZA 4M9PA 2JCCA 3GSQB 4R3SB 1CICD 3W39A 5FKPB 5EU3B 1AP2B 5E8NB 4KPHH 1HHGB 2ICCA 1OQXA 3L3OA 4FQJH 2R23A 2EXYD 4JQIH 3NGBB 1BFVH 5J0BA 3BKMH 4KRNA 4OLEA 1F90H 3G6JF 4X9IA 4NT6B 1U93B 4N5UA 1IAOA 5EBLB 3D0LB 4OFYD 5FYLD 5GIRB 1F58L 4OZFH 1G6VK 2HN7B 3GI8L 4G6FD 1UCTA 4HWZA 3NCJL 4ZODA 5SWZA 5HI3D 4XVTL 1U3JA 4PJAB 4PJ9A 3RY6C 3RNKB 1IAMA 1WCBB 4P23A 1CFVL 3WIHL 2R0LL 1ULVA 4GRWB 4XPTL 4UIMA 3NZHL 1MY7A 4UNUA 3VXUD 1NSNH 1KEGL 4WY7L 4K3EL 1IC1A 3IJYB 4FXGA 4Y16C 3HZMB 4QT5A 4ZXBD 4YBQC 3HMWH 5IHZA 3F5WB 4LSTL 1GOFA 3VD9A 4BA8A 1Q94A 1WLHA 4J1UA 4AG4H 3QUML 2YEZA 4G42B 3FAWA 5EPMA 5I15L 1F8TL 5EZIH 2E7LC 2EYSB 2VB5A 1MCOL 2HLAB 3MLXH 4WI4A 3UYRH 2A38A 2ZSWA 5EORH 4LSUH 2NY6D 3RY4A 1B4JH 2ZWLT 1AQDB 1PY4A 5GRJL 4AEEA 4JDZB 5JNYB 3LKQB 3C6SB 4XMPL 1E4XI 5LJYH 1JK8B 5JLZB 5DQ9A 3I9GL 4NRZA 4V1DE 3TIDB 3UMTA 3NZ8B 4R26L 1LO2L 4KMTL 3X14A 4MJ6B 4KAQL 2OL3L 1IL1B 3SY0A 1MLCB 3D2UD 1N8ZB 1JWUB 3QWRA 3QUXB 1IKFL 4X6CF 5JXEC 2RCSL 3LAFA 4HDIA 4OZIB 4IOFC 4JO2H 4RAUB 1QZ1A 3DX9B 4L8BB 3Q6GH 3BXNB 3HPLA 1B9ZA 1A9EA 3KYNB 5IJKC 5HGAB 1SEBB 3BP7B 3VFPB 5E24E 4YDIL 1QYGL 5JHDD 2IALA 3ILQD 3B2UD 1HHKA 2GJ6B 5IUSA 1NH6A 2EDXA 4YH6A 3V6BR 3HC4H 2ICEA 3L95A 3D3VD 4ODSH 5EU5B 1T66D 1JF6A 3TM6A 3SDDA 1OF2A 2XN9D 1UCBH 3IETB 3KPRB 4DCQB 2JIXB 5KSBF 5GGQH 1CDJA 5E1AB 5E2VL 1IGFH 3MGOA 2A6JB 2OXHA 3VE0B 3ZMRA 1VACB 1J18A 2B5IB 4CU7A 3MXWL 4HS8L 4DKEH 3VXPB 4PRHA 4JR9L 3R1GL 4Y19B 2ZCHH 1T22B 5IW3A 1PW3A 2GQHA 2E9JA 2AXGB 4LEOA 4ZSOE 4GKZB 3LS4L 5GJTL 3NIGF 2EDBA 1FDLL 3ECBB 1GGCL 1BP3B 3I6KB 4MQXC 5IMOA 1ADQA 3BGMA 3NFPB 5D1QD 1FGNH 4GXUN 1I1FA 4K9EL 5CKAA 4O2FA 4P3WA 2B5IC 1WVZA 4LKCA 1DLHA 3CVHL 3O3BA 4X98A 4NDMB 1FNSL 1MREH 4M3KB 1FPTH 2RB8A 5FM5M 1BD2D 1L7IH 4LSSL 5ESAA 5B38B 3FRUB 4JPIA 4RWYH 3ES6B 1TPXC 5FO9B 4OSUH 2PTTA 5FGCE 1JRHH 1XMWA 4MDIB 1PX4A 4P5MA 4YHOL 3MRJB 4DKFH 4FN0A 3SBWA 1FC1A 1SM3H 3CDCA 5FOBB 3GSOA 5IB3B 1UWXH 5F7DA 2AXJA 4AENA 1CFBA 3WNNA 3KPNB 2NXZB 4N8PA 4QHNA 5DQJA 4TRPL 3OB0H 3O11A 3MODH 4LCIL 4D0CB 3OKYA 1OPGH 1A7BA 4LKXA 3WNLA 1NFDA 3GMQA 1XIWD 3H7LA 1T2XA 3ROLB 3B8SA 1HSBA 3F65A 1U91B 5HGDB 1S7VB 3PQYB 4PRID 2CDEB 1CXHA 1A6UH 3D9AH 4AMKH 4PGCA 1CD1B 2NXZC 1W0VA 3ARFB 1AE6L 3EYVA 4EI6B 4JFHE 4R96A 4H0IA 1JYVA 1WBYB 5E8DL 4HMDA 3RGVD 2Q7YA 4HIIB 4LASH 3ROOA 4PJBF 3MO1B 4RIRB 3TA3D 4G6AC 3IT8D 5IW6B 1YUHA 1BF8A 1ORQA 3AC0A 3BH9A 3L5WA 4N5ED 5D7LA 2H32B 2W0LA 2CD0A 4D9LL 3ARFC 1M6OB 3BVNA 2NY7L 4JN1H 2EDHA 1D6EA 4WFHD 4JKPL 3OR6B 4UTBH 1IGCL 2R2EB 3B5HA 1GGBH 4KY1L 4P9HC 3GJFB 4YHIB 4LPXA 1YPZB 4WV1A 1NGPL 2QEJA 4Z7WB 2J8UB 4G6ML 1MFEH 4G9DA 2YD1A 2YSSB 4BQ9A 2COQA 5FAAA 2FH6A 2BY3A 4K8RD 5IMMA 3P4NA 4PIRF 4G43B 5A2LH 3VWKB 3Q5TA 4L9LB 5MHSD 3STZA 3MV8D 3QDJD 5C07A 1X5HA 1OY3B 4L8DA 3SQBA 2PYEE 4NN6B 5D9SB 5C09E 3VI4F 4LVEA 3A0OA 1MJ7H 4OF3A 5GHWL 2ZJSL 4LCWB 4DFIA 3VXMB 3RUGE 1S7UB 1SJEB 1F2QA 2QSCH 3FFDB 5KS9B 2WWMD 1DFBH 3BKCL 4FQCL 1C08A 5C6PB 4IDJH 2VSCA 4JZOA 3TBYA 2GT9B 3PIQA 1TZIB 2NQCA 2FX8L 3P3YA 5E8EB 1OGAA 3RHWF 3VWKC 1ZHLA 3QPXH 4L9LC 1PGRB 1TNNA 4M5YH 4M62H 1MCBA 3GSQA 4R3SA 5CWSB 5F6HI 4B41A 5CEZL 5FKPA 4HJ0D 5BCAA 1NCCL 1AP2A 3RY6A 1R3HA 3C5ZB 2FBOJ 3GIVB 4DEPB 3MRCB 1HHGA 2WP3T 3JWOC 4GMSL 5HHOD 4EOWL 5EOTB 3PDDA 4Y16A 2A6DA 5FYKL 2YOCA 4M4RA 1L0XA 5EBLA 3D0LA 3L5XH 2FRGP 5GIRA 5TE4L 4NKIL 2HN7A 2F58H 3D48R 2E7LA 1JMXA 5I76B 4JGMA 5IHLB 2DI9A 3C5ZC 2OR8A 4DEPC 1WCBA 1M4KA 4DAGH 4XB8A 1MCPL 5IGXH 5KVGH 1U8KB 5EOCJ 1OGAE 2HP4A 2ZOLB 1HOCA 3QEGH 4WWID 3IJYA 4NUGH 4R4BA 5FUCC 4WW2B 4LVOC 3OZ9L 4APQD 3F5WA 3IAQA 3QJFB 3UROR 3FKUS 1OAQL 2DQCL 3VDAA 4ZDHB 1HWGB 2EDNA 2ERJC 2GK2A 2HLAA 5GGSY 1V3KA 2VLRB 4GAJL 4GXVL 4I9WD 1BGXL 1YNTB 2AXFB 3W5NA 3V4VH 4BSVB 1RIVH 1KCUL 3RVXD 5LBSH 3UAJC 1AQDA 2OI9C 3LKQA 2EDKA 3C6SA 5ITFB 4CNIA 3PDOA 5J11B 1RY7B 4X6BB 3DHJA 1YYML 4RNRB 5GZOD 1VEMA 5DJ0B 3TIDA 3NZ8A 4PJAE 1U8NA 5IJKA 4L4TB 4MJ6A 4J2XA 3VW3L 4WO4C 4GRWE 1HE7A 3NCMA 3CSYB 5J9PB 1IL1A 1MLCA 4KXZH 1C5CH 3LQZB 1N8ZA 1JWUA 2NTSP 3L9RB 3NMEA 3QUXA 4U0RB 5FM4A 5DK3A 4OD1H 4OZIA 5DD3H 5J11C 2P5WA 2QSQA 2AAVA 4KVNL 3E3QE 4RAUA 3DX9A 3PF2A 4KKAD 2VUOA 3BXNA 3STBA 3GMNB 3KYNA 4KI5C 5HGAA 1SEBA 5ABDE 2NY5C 3BP7A 4DZBB 4HPYL 5EULV 3VFPA 4CMHB 3HFMH 4LCCB 5I1EL 5T5FH 3MOAH 4G7YH 4P4RB 2GJ6A 3GNML 4TVPH 4Q97A 5B21A 1T0MB 4KK9C 2QQNH 2F5AL 1BHGA 2XWTB 1A6AB 5E6ID 4U0RC 4YHZL 1NGZB 5EU5A 4HC1A 5DUML 4DCQA 3IETA 3EJZC 3KPRA 2JIXA 3DVGB 5E1AA 4ODTH 3WNKA 2R8SH 3MRLB 4WFGE 1DUZB 1ZV5A 2X4NB 3RX8A 1ERNA 1KEMH 4WFFD 4NQDD 1CGXA 1VACA 3DVNB 1KCVH 4N9OB 3VWJD 5T33L 1FIGH 1F6LL 2R29H 2A73B 1JCKA 1G9NC 4JO4H 4U1LB 4Y19A 5B3JF 1CXIA 1EPFA 4X6DF 5I1KL 2I26N 4YPGB 1J0JA 2FHFA 2P8MB 2D7TH 3ECBA 4ZUUB 2C3VB 3I6KA 3QQ4A 2GJ6E 4PJCB 2AK1H 1N5YL 2VZUA 4HFUL 3NFPA 1KJVB 3TNMB 1I8LA 5AZEH 2OJZH 1N26A 5D96B 3WFEH 4NDMA 4KJQC 3VGGA 1F4AA 3GSVB 1UM5L 1RSFA 4R7DA 3ARRA 3FRUA 3DWTA 3ES6A 3FB7B 1WEJH 5DJDB 5FO9A 5MEQB 3RIFF 1R3JB 3GSNB 1CVSC 3FT4B 4JG1L 4XP9H 1MAMH 4L4VD 4Y1AA 3ME0A 4HKJA 4MDIA 5DMGC 2UZIH 4PRNA 1F13A 1AI1H 4OGAC 4Y19E 3JTSA 1A8JH 5TE7L 1FZOB 1A2YB 1IC7L 5CCKL 4FFWD 3PHOA 5E6YA 5FUZL 3SDYH 4I3RL 1ADQL 3S5LG 4XH2B 1KLFA 4YPJA 2VLJD 3OXRB 1U36A 3DIFB 4LLVB 3VGEA 3ROLA 4Z0XA 4LHUD 4KRMB 2R0WH 5E99L 3RDTB 3HI6H 4PREB 5HGDA 3T2QA 4PFEA 3PQYA 3PABB 2CDEA 2HJFA 4X0KA 1NEZG 5FM5O 3ARFA 1KB5B 4EI6A 2DQHL 4LLDA 4X6EA 1IGML 2BVUA 3V6OC 3K7UA 3ARDD 3VFUB 1GC1H 3NBNA 5C0CD 2EH8L 5DEFB 4AEIH 4HIIA 3TO2B 2IH3B 4MLSA 3MO1A 4I4WB 4RIRA 5BZDA 3C5SB 4OGXH 1OAZH 3RDTC 1WZ1L 4YXHL 2H32A 2ADFH 3BPNC 3RIAK 5D6DC 1M6OA 1PG7X 2EC8A 3L3HB 5DUPL 1MVUB 1GIGL 3OR6A 3FQXB 5IWLC 5L8JB 2R2EA 5GPRA 1C5BH 3GKWL 4QXUH 1X7QB 4YHIA 2EDLA 3GJFA 1UQSB 3PQYE 1TTFA 1YPZA 4LARL 4Z7WA 5FYLH 2J8UA 3I6LD 4ONOA 3FN9A 5JO5B 2YSSA 2AI0L 5D8JL 1Z5LB 1YQVL 2QKIB 4GLRI 4GW5B 4G43A 1QSFA 3EO0B 3VWKA 5ICYB 4L9LA 4P2QB 1WZLA 3NABL 1GGIH 1U95A 5A3IC 2XY1A 1KULA 1OGTB 1BFOB 5D9SA 2VDOL 5JZ7D 4OM0L 2Q8BL 5HVHB 1IFHL 4Y4FD 4M6AA 1SJEA 2PO6B 2BZDA 5KS9A 2F15A 1INEL 5DRNB 3U36B 1SBSH 1BVLB 4PJGF 3RVTD 2GT9A 4L4JA 1S3KH 4HWEH 4XT1C 3BUTA 5E8EA 1MFAL 2XA3A 4LPTA 4EBQH 4KJWC 1RHHB 4Z7WE 5CWSA 1A6WL 2J8UE 2HT4C 2IQ9L 3GJEB 3LEVH 4PJDE 2ZOKB 3C5ZA 3GIVA 3KPPB 3SKNB 3MBED 3MRCA 4MXWH 3RTQC 5C0FB 4UIKH 1RZGA 2CMRL 5TPWH 3SJVB 1MWAB 5EOTA 1FN4B 1NFKA 1UWEH 5F7NC 2IAMC 4XCYA 2VN7A 3FJTA 3S35X 5J7CC 4YK4B 3FMGH 4XHJD 2XFXA 4ZTPL 5CJ5A 3L1OL 2ZUQB 2VQ1A 1OTSC 1KUMA 1AR1D 3N1FC 4H20L 4LCWE 4HT1L 3VXME 3RL2B 1HH6A 5KS9E 3D69B 3HE6D 4ALAH 3V0WH 4L29A 2IFFH 1Z9SA 3BI9X 1U8KA 3K74B 5KN5B 2ZOLA 3RWIB 4NZRH 4NFBA 1YA5A 5FO7B 2CJUL 5F1IB 1WFOA 4RCAA 3ZKNC 1RURH 1MRFL 1E6OH 3DYMA 3QJFA 4XNMB 2VDMH 4YK4C 2DTMH 2ZUQC 1MFCL 3DROA 3IFLH 4ZDHA 4WO4A 1FHGA 3WDIA 2VLRA 2ZUYA 4Y0GA 2OMNA 5F88B 4HKXB 4BSVA 1GZPB 5EU4A 4S0SD 1Q8MA 1RUQH 1ZHBB 4RDQF 5ITFA 3U0PB 1UJ3B 5I16A 4XP5L 4C4KT 4X6BA 3ESUF 2DB8A 4RNRA 1JGLH 2VDKL 1N4XH 4QCIB 3GMOB 4KUCF 5AZ2H 5DMIH 1JTTA 2A9MH 1U8JA 3EYOB 1JYNA 5SX4H 3LQZA 3L9RA 4OLXH 5CINH 2AVGA 2XYCA 1E28B 2YK1H 3X12A 4NO2B 5B39G 2DM3A 3PWUB 4U3HA 2VLRE 4KV5F 4IRZH 1U6AL 1OP3H 4DZBA 1F00I 1CDUA 3QQ3B 1DQML 4XI5C 1NL0L 3C6LB 4LCCA 4LPWA 4P4RA 1T0MA 3KLHC 4Z7VF 5FYKU 4URTB 1NGZA 5MENB 4OLVL 3VFRB 3ZDXE 2BCKB 1RIUL 4L4TE 1YNLL 3TC9A 3LMJL 3WDHA 3DVGA 4UT6H 4K2UL 2WWKT 1DUZA 3K1DA 3O45B 1FV1B 5TQ0H 2QQLH 5BZWB 3TVMB 5LVEA 4H88L 2VXSL 2FB4H 2K3TA 3V4UH 4F7EA 3FOMB 1A0QL 1QSEB 3O4LB 4G7VL 4XAWL 3NIFF 4U1LA 4AQ1B 3DUSB 4XCCH 4PJXF 3W11D 4OFIA 4Y7MA 2Q20A 4MA8L 2XY2A 4YPGA 4OBSA 2P8MA 1Y6KR 5TDPB 5E0QA 5FDYA 4EN3D 3ZTNH 1RUAH 2C3VA 4JANB 4PJCA 2CDFB 2XG4A 4WJ5B 5EIIB 2ID5A 5JW4Q 1KJVA 4NJ9L 5K59E 4FQ2H 4XVUC 2PTVA 3V8OA 1QFWL 4PY7B 5GRVK 4KHTL 1IC4L 3GMRB 1QR1B 4HC1L 3MUY1 4OQTA 3P0YL 1IQWL 1EXUA 1I7TA 1Z9OA 2DQTH 3KPOB 1IT9L 1U3YA 3GSVA 3SDCD 5A2FA 3BRGC 1IRAY 3FB7A 4GQ9L 4I77L 4XPAH 1P2CB 4ZOBA 4EQ2A 5EOCH 1R3JA 3GSNA 1X5KA 3FT4A 4WUKH 1P69B 1QG3A 4YEFA 1XGYL 4G6KL 3W9EB 4D9QE 5FV1L 3UTSB 1DP0A 5K9OB 3MRHB 5HYJE 2VXVL 5KSAC 2O26U 1FZOA 1J5OL 1A2YA 3RX7A 4JB9L 3V6OA 4CDHA 3OXRA 3DIFA 1QO3B 5C92A 4XXDA 2FATL 4G8EB 4O2EB 4QRUB 3RDTA 2OS7A 5F21B 4PREA 5IV2B 3PABA 5H94B 4RSVA 5D6DA 1F3JB 4Z77B 3QFJB 3ZE0F 2DIAA 1KB5A 1LEKA 4RAVB 1Q1JL 2HMIC 1GGTA 1QRNB 4WFED 4OFKA 3S8WA 4MJ5B 3VDBA 5INCB 1QFUL 3LQAC 4Z7NE 5DEFA 5HHVL 3TO2A 3MQIA 2Y06H 2CKBH 1K4CB 2V5SA 2Z8WC 5DHYB 4MA1B 4I4WA 2R56L 2NY0B 4G6JL 3MXVH 4LGSB 3LN9A 4OGYL 4PRPB 4ZO7A 1C5DA 3V6OE 5IT2L 5FYJL 2XV6B 3C08H 5C9KA 3OSKA 3L3HA 1MVUA 4OI9A 3BP6A 1FVCB 2J4WH 1HHIA 4LVNB 4JHAH 1UQSA 3N0PB 4MA1C 4MHHG 4L3EE 2GKIA 2NY0C 4M48L 1II4E 1YYLL 5JO5A 4LDLB 1WIUA 3MACL 1KGCD 1Z5LA 1ZS8B 2QKIA 1BQLL 2G60L 2JB6B 1VESA 2F54D 4GW5A 3EO0A 4MMXC 5ICYA 4P2QA 1A22B 2OR9L 4P9HL 4IOIA 1KPRA 3SN6N 4UAOB 4CGTA 1TETL 2HFFB 4FFVD 5A16B 3MFGB 4LVNC 1XEDA 4JJ5B 1GSMA 3RTQA 3QA3B 1KELL 2XWBB 3H9YA 1FP5A 5DRNA 1MCWW 1DQJB 2JELH 4TSAL 4D0BB 5JDJA 2O5ZL 1BVLA 1A7RH 2IAMA 2ZCKL 2HFTA 4KRPC 5T3XE 3M1BB 4NZUL 3VXQB 2A6KB 5CEZD 2UWEF 1EAJA 2D7QA 5DJ6B 3UC0H 4BSJA 1JNLL 2YD9A 4HH9B 4X83A 4L9DA 5D2NB 2DM7A 4UAOC 3IFOB 2OXGA 4XBEL 1RHHA 4DKAA 2ARJB 1MCJA 4ODHL 3GJEA 4ETQB 2QR0A 4WUUB 1BM3L 2ZOKA 4F8TA 3KPPA 3SKNA 2AQ3A 2H3NA 3CSGA 5C0FA 5FYKD 5IFHH 1D6VL 3SJVA 1MWAA 2VL5B 4NQCD 5L2KA 3QIUD 3GRWL 4P2QE 4Q6IB 2R0ZH 3KXFB 4MB4A 3G6JB 2BHUA 2VQTA 3GSXB 1J8HB 1QLEH 2FL5A 5KANI 3I75B 3JWOL 3RL2A 1D5IH 3U4EB 1WUNT 5DRXB 3JVGC 5D71H 1F11B 1PJ9A 1R3IH 1EMTH 3CFDB 1X5YA 5IFAH 3VD7A 2ZG2A 4JRXD 3HB3D 1NUNB 2V9TA 2ZNWA 1CG9B 3LPFA 3PG2A 5KN5A 3SQOH 3RWIA 4XHQA 3SDXA 2ZUVA 4L5FH 1N6UA 2X1QA 5DFTA 5EUOF 1TQCB 3ALXA 4YX2H 5IB5B 2R69H 2W60A 4EDXB 2CLRB 2VAAB 5ADOH 1OD7A 3DECA 3SJVE 3CLFH 5F88A 4G5ZL 3OV6A 4HKXA 2C3XA 4LLAA 4XVSH 4ZQKA 3C09C 1VENA 3KYAA 1J0IA 1ZHBA 4OZHF 5SWZD 43CAA 4PJ9D 1UJ3A 2VH5H 3K8KA 1EHLL 4P23D 1P4IH 3D0VB 3F7VB 2BSED 3DSFH 4QCIA 2P5EB 3GMOA 1S7XB 4H8WH 1NBZB 25C8L 3CZFB 3KJ4B 4Z95L 4IMLA 1QVOB 1NQBA 2APVA 5I1IH 1ORSA 4GKNB 2HH0H 1SMAA 5TE6H 2R4SH 2DQJL 2AABH 2Y36H 4WIQA 1VHPA 1PG7H 1DBAH 4R9HA 4XBPB 3MJ8A 3RVUC 2XA8L 4NO2A 5L8LB 5EO1A 3HI5H 3E0GA 4JY5H 3WNOA 4NP4L 1Q9OA 3IS0X 4FABL 4Q0XL 1RZJC 1A7PL 2DQFB 3QQ3A 5ECJE 2ORBL 4HZLB 1B0WA 3C6LA 4HIJA 1W72A 3L5JA 3QDGD 1C1EH 1HKLL 4PGBB 4WENB 1IAKB 1FZJB 1L7TL 3IDIB 4DN4L 3VFRA 2E8ZA 1QSZA 3AVEA 2NY5L 2P24B 2I5YH 3QWRD 3ZO0A 3O8XD 5DFWH 3S3JA 2H1PH 4U1NA 3KYOB 4LPUA 2GHWB 4HWNA 3WLBB 3VFGL 4P46D 3TZVB 1FV1A 2NXYB 2XNAB 4PRAB 4U6HB 1MOEA 1CT8B 1OM3L 4LOUD 5DC4B 1F3DJ 3BWAB 3MR9A 4RX4A 3FOMA 1K8IB 4XWOC 2W1NA 1QSEA 3O4LA 4MAYB 3DUSA 2DLFH 4XCEB 1OTUD 1NLDH 1SEQL 1T6WA 3QCTH 4FXKB 2YD4A 5TDPA 1NAMB 1OLZA 2XQBL 5BO1L 5ALBL 4NBYB 1WAAA 1A14L 2CDFA 5EO9B 2GTZA 1VB9A 2NXYC 3WFCL 1G9NL 1TQBB 3DHMA 5IMLB 5MENE 1KJ2H 4RRPG 4PY7A 3GMRA 1EIBA 3S35H 1VEPA 4TSBH 2AV7B 3KPOA 4BH7B 2AERT 3WHE1 4MX7B 3FL7A 4M6MH 2X4OB 4G8GB 1CL7H 4PRHD 1LEIB 4XPFL 3E6FA 3FOLA 4EVNB 4MJ2A 1QUNA 3K81A 1CTNA 1NCBH 1G0XA 4GUPB 3ZYOA 5D70H 2QLVB 4JM2F 5I0DA 1CGSL 5FO8B 1TQBC 3PP3K 4N0UA 1WC7B 4Y5VB 5L9DH 3UTSA 1OAKH 1OLLA 3BKJH 3U1SH 5K9OA 1NMBH 1T3FB 3MRHA 1INDH 2X44D 3MCLL 1S7QB 1X5AA 3RX5A 4HIEA 4LAQH 4NQED 1FH5L 1S9VA 4J23A 1TZGH 1WAAE 5EA0L 5LGHH 5T1DL 2XTJC 1MCHA 2PKDA 1ZT4B 4M43H 3O4OC 1QO3A 4G8EA 4O2EA 1NCTA 1V5JA 3D18B 4QRUA 5CGYC 4GSDL 4OQTL 4LSDA 3HAEB 4Y5VC 1CDGA 2LU4A 5H94A 2UZXB 4G3YH 3QFJA 4GBXC 5BV7B 2AJYL 3F7RA 1KCLA 1A6VH 3QHFL 4MNGB 4N90E 4MJ5A 3DBXB 4LP4A 4RFOH 4DTGH 5KVEL 2LTQB 1LE9B 1EDQA 5F1NA 1K4CA 3TWCH 5D93C 3UTSE 1MVFA 2X2YA 3REWB 3RL1B 5C0EB 1DQLL 4PRPA 4RGNB 4OZGF 4Y2DB 3T2PA 3P77B 5ETUA 1FVCA 2WUBL 1F58H 3GI8H 2IBZX 3KJ6L 2NLJB 1A1NA 5BMFL 5IKCA 4TTGA 3NCJH 4WHYH 3QFJE 4XVTH 1KB5L 1CI5A 4JCMA 1CFVH 1DTUA 3WIHH 2R0LH 1QRNE 3O9WC 4XPTH 5TDNA 3NZHH 4RGNC 2JB6A 2D4FA 1KEGH 4K3EH 3QI9B 2MTPA 2R1YB 2WV3A 5D7LD 3WO4B 4LNRB 5GGUB 5TQ2L 2ITDA 4LSTH 4WVRA 4FZEL 4JN2B 5A16A 3QUMH 1J0YA 5I15H 3TCXA 1QA9B 1F8TH 2M2DA 4MA7H 4JJ5A 4PRPE 3QA3A 1MCOH 2EDJA 2XWBA 1SJHB 1SVZA 5JA9A 1DQJA 3TFKC 4FFYL 2JKXA 1IBGL 4D0BA 3QDMB 3U0WL 5GRJH 2RQ8A 1UH4A 1WWCA 3HNVL 3M1BA 2Q86B 4GO6B 3VXQA 4XMPH 2A6KA 3QI9C 4HH9A 4QY8A 5D2NA 5JW3L 3IFOA 3I9GH 3V6FB 2DIJA 2ARJA 3JVGA 1BVZA 5DT1L 4GG6F 4ETQA 3BPCB 4WUUA 2I9TB 4QTIL 4R26H 1LO2H 1OHQA 4EUPG 3L3KB 4KMTH 4NSKB 1BQHG 4KAQH 4ORGB 5C07D 1FCGA 2OL3H 4AM0B 3U7WL 4F57L 1KPVB 4LLQA 1F3RB 3RNQA 5C3LD 3HZKA 4GRLB 1IKFH 2RCSH 2FCBA 4J4PC 3G6JA 5DJXB 3GSXA 1J8HA 4TSCL 3I75A 3BEWB 4Y4HC 1XR8B 3U4EA 2NW3B 1J9CT 1OGAD 1Q0XL 1T89C 3CFDA 4U1JA 2Z31B 2A77L 1UA6L 4YDIH 1QYGH 3C87A 2HA1A 2CIIB 1HWHB 5E8PB 3ULUE 5FYJU 3IDXL 4JFEB 4K55A 4GRLC 2CXKA 5D2NE 3AAZA 2GEEA 1X5FA 3BDXA 2X42A 1NMCC 5GGVL 4QRPB 5IB5A 4Y16D 4F15B 5BS0B 4EDXA 1JBJA 4YBQD 4EIGB 2CLRA 2PCPB 2VAAA 3MROA 2DLGA 1JNJA 5K9JL 2Q3AA 3KXFE 1WWAX 2NY1B 3MXWH 1YEGL 3RKDC 4BH8B 4HS8H 4C56A 1J8HE 1MFBL 3IGAB 4JR9H 3F7VA 3R1GH 1KCRL 4FG6C 4LFHG 5DHVB 1XT5A 1BQSA 4MNHB 2FLBT 3CU7A 1NBZA 3CZFA 3LS4H 1GJIA 5GJTH 4Q9RH 1FDLH 1GGCH 4GKNA 4RMQA 3JV4A 4MNQB 4K9EH 5I6XB 3CVHH 4XBPA 2E3VA 3UJTL 4R6UA 1FNSH 3PHQB 2VXTL 4KXZI 4LSSH 1Q9WA 2DKMA 1PD6A 4O9HL 5JXED 3CH1B 4YXLL 1WWBX 1F45A 3BO8B 3IRPX 4IOFD 4HZLA 1W8OA 4MD5B 3UXFA 2AJVL 4WHDA 4YHOH 3D39B 4PGBA 1ZLWK 5CZKA 2ZPKL 2P5EE 4O00A 3MRBB 3IKKA 3QEHB 4TRPH 2P24A 1LP9F 1YEFL 3BN9C 3KPTA 3GK8L 4LCIH 1S9YB 4PP2A 3L3DB 4EJ1C 4JQVC 2P5WD 2YXFA 5IVXB 1UT9A 3CDFA 5KSBA 2XNAA 4PJEF 4PRAA 4RRPA 4U6HA 4NKDA 2IPTL 4P2CG 5CHNA 2BP3A 4MVBC 4MAYA 1PG7W 4NM4L 3GMLB 4KZEL 3VI3E 2XIDA 2K7PA 4XCEA 1AE6H 5FHAL 2N4IA 4FXKA 1JHKH 5E8DH 2EIDA 1NAMA 1JWMB 1W72L 4HK3N 3TYGL 2EE2A 3B83A 5EO9A 3DTXB 1S9WB 3KPRD 5IMLA 1HEZB 2G5RA 1YN6B 4MQXD 2ZSVA 1U3ZA 2AV7A 1JPGB 3BJ91 4MX7A 3QUZC 4D9LH 2X4OA 4G8GA 1U8MA 2Z8RA 5FGRA 2NY7H 1QBML 1LEIA 2XKUA 4JKPH 1MCKA 4EVNA 3B2VL 4NIKB 3HZVB 3TGXA 4GUPA 2PN5A 1IGCH 4KY1H 4NM8L 4Y5VA 3ZYIA 1NGPH 5C7XL 3WHE0 1T3FA 2PETA 4GBXA 5JIKA 1IZJA 4G6MH 1S7QA 2VABA 4MJIB 3G08A 2PW2B 3FQRB 1YY9C 3GI9L 2VZTA 1CDCA 1HSAA 4AT6B 1ZT4A 1CDBA 1EUTA 4NBXB 1FYTE 1S7TB 3D18A 5C0BA 5GHWH 3HAEA 2ZJSH 2QBWA 3ZLQC 3LPGA 3QPQC 1G1CA 1OAYL 1PKOA 1P4BL 4QTHB 4Y1AD 4HV8B 3SPVB 3BKCH 4FQCH 4L8SC 2IBZY 1NBYB 3BKYL 4MNGA 4U1GB 2FX8H 3DBXA 2CUHA 1HHJB 5D7IE 2NXZD 4XB7A 3B6SB 1JHTB 1RVFL 2ZKHL 4HSQA 1JJUA 3REWA 3RL1A 5C0EA 5CEZH 1YY8B 1NCCH 5FYJD 1MJJA 3TBTB 2LVEA 4UU9B 3O9WA 3FB8A 1BREA 4GMSH 3LQAL 4G6AD 5BRZA 2V6HA 4EOWH 2H2SC 2DWDA 5GGRB 4J6RL 3PQYD 5FYKH 3WHXB 4U1GC 4Y2DA 1GOHA 3P77A 3U6RB 5TE4H 3H8NA 3OB8A 4KTDL 4NKIH 3VD5A 3L3IB 4JE4B 4M93B 4GG8B 5IB4B 3P73B 2WBKA 1EGJA 4K7FB 3Q48A 2BFVL 3AMLA 3MCKB 1MCPH 3DVIA 4FQPA 4MNGE 4WI3A 1ZLUK 3OX8B 3KNBB 4QGTA 2R9HC 1YDPB 4KUZL 3QI9A 4JFFB 2JK5B 2R1YA 4LNRA 5GGUA 2NY2B 3H2WA 4EUPA 3I2CL 1RU9L 1OAQH 2DQCH 4DWHA 1QA9A 3CVIL 3QSKB 1RHFA 1ZOXA 1TENA 2HRPL 4E41D 4WI8A 2PW1A 4GAJH 2VITA 4GXVH 2WP3O 1BGXH 5EU6B 3QDMA 3I3BA 1KCUH 3IVKB 2ATKA 2Q86A 3CXDL 4J4PA 2VERN 4X7FC 4NPYB 4CUCA 2A1WL 1YYMH 4Y4HA 3V6FA 2NY2C 1UXSA 1EEUA 3EJJX 3PP4L 4RMWA 2I9TA 1QSFD 3VWKD 1T89A 3L3KA 4NSKA 4ORGA 3VW3H 4AM0A 1A3RL 1F97A 4H25B 1KN4L 1KPUA 1DBBL 1KPVA 1P1ZB 5D7JC 2NY4B 2CRMA 4QHMB 3KS0J 4PGEB 4GRLA 4YDVB 4JG0L 1L4IA 2V7NB 2BVEA 5J12B 2DICA 4YGVB 4KVNH 5DJXA 1HXYB 1BBJB 3HRPA 2EE3A 2E9BA 3BEWA 1XR8A 3X11B 3NCEB 2NW3A 4GH7B 3QH3A 3L7EB 4HPYH 3NCYS 2O5YL 5I1EH 3SKOB 4EEEA 3GNMH 1AKJB 2WSKA 3C5ZD 4JFEA 2F5AH 2DYPB 1J12A 4YHZH 2YD6A 5J12C 2VDLL 3C5JB 2X9XA 5DUMH 3B9KC 5BS0A 4WI2A 5F3BB 4U1IB 2BVYA 2PCPA 3DO7B 4FNLL 4JLRB 2V7HA 3LSOA 2CKNA 3CUPB 1BIHA 4BH8A 5T33H 2OSLB 4U1SB 4NN5C 1NPUA 5DMJB 4MNHA 3FQWA 5I1KH 1T4KB 4LLUB 1YN7B 5ADPL 2UY6A 3PL6B 2C1OB 2DM2A 4PLOB 3OAUL 3F7QA 2RFXB 3I02B 4OT1L 1OAUL 3VFSA 1X5IA 1N5YH 3G9VA 3P40A 4MNQA 4HFUH 4M7LT 1WCQA 3IDMB 4FQXC 3VJ6B 5ACZB 4WO4D 3I6GB 4P5TB 1PSKL 4QRPE 4L1HA 3PHQA 5JOFB 3PWJB 1NUGA 5BS0E 1UM5H 1IILE 4KKNA 5F8RC 4RDQG 4IHOA 4JQVA 4U4BA 3PL6C 3S34L 1Z9LA 4F7CB 3S6CA 3KDMB 1IKNC 4JG1H 4ZO9A 3RWEB 1NANH 4KI5D 3D39A 5E94B 5AYUL 3PNWB 1X4XA 3OJDA 4XMLL 5GRUL 4LBEB 1VFAA 2X1PA 3LKNA 1DL7L 1RZJL 3MRBA 3QEHA 5TE7H 4KK9D 3L3JB 2BNUB 4TNVK 1IC7H 5CCKH 5ICZB 1GAFL 3L3DA 1J1XL 5KTEL 1KTLB 4XAKD 5FUZH 4CRPA 4I3RH 1ADQH 1FO0L 5GRXG 1R6VA 5CJ8A 5IVXA 4EDWL 3EJZD 1LWRA 5GQBA 5E99H 3U4AA 3NACL 5DURB 5JIHA 1RMFL 1FG2B 1WT5C 3LQMA 3QUZA 4P59L 2DQHH 2FSEB 2Y72A 1IGMH 1P7KB 4NHUB 2XKNB 1JWMA 2NY3B 5A1AA 2EH8H 3D39E 5HYQB 1FSKB 4QKXB 1S9WA 2F8VA 1HEZA 1DANT 3UBXG 1RJZB 1WZ1H 1YN6A 4YXHH 1JPGA 3RUGF 3ULVC 3SDAB 4PV8A 1J11A 1NGYA 4KJQD 3NCCB 5DUPH 5GISH 5IVXE 4L8CA 4U1KB 1GIGH 5DVLA 4H0HB 1T7ZA 3TCLB 3P0GB 3GKWH 3FFCB 2J7LA 3MJ9L 2J3SA 5DJAA 4LARH 5CZXC 3U82B 4Z0BL 1A4JB 1MCNA 2CQVA 3MJ6A 5DMGD 4MJIA 2AI0H 5D8JH 2PW2A 4OGAD 1YQVH 4R2GB 1NAML 4HBQA 1BQUA 3IDYB 3SDAC 2N7BA 4HJJL 4AT6A 3NABH 5GGSA 4C54A 1VFMA 5DO2C 4M8QA 1FVEB 1RUML 1QSVA 2VDOH 4NO5B 1S7TA 1LILA 4OM0H 5F7LB 2Q8BH 1IFHH 3RPKA 3QJHB 4QTHA 3S88L 1INEH 5DZLA 3RWDA 4HV8A 3SPVA 1NBYA 4X6FB 4HKZB 3OAYH 4R2GC 4Q9QL 4OLWL 1MFAH 3UTOA 1NEUA 5EO0B 5L2JB 3B6SA 1JHTA 1YEDB 4TVSa 3FO9B 1A6WH 1CZ8L 2IQ9H 1YY8A 3V4PL 3IAPA 3WD5L 2MQ3A 4LRNL 4TQEL 4MCYB 4UU9A 4YQXH 2CMRH 2XZCL 4KVCL 3RDTD 5GGRA 3KPQB 1CD9B 1FFPB 4MMZC 3U6RA 3RI5K 4YFLI 1X6NA 4ZTPH 3L1OH 3L3IA 2O61B 4H20H 4GG8A 5IB4A 4HT1H 3P73A 1FFOB 4U6TA 2V2WB 4H1LB 4P4KB 4OKVA 4K7FA 4F7TB 4RISL 4PJAF 1JF1B 4KDWA 2FJFA 3MCKA 3FZUC 3F58L 5EIVA 1X5ZA 4GRWF 5C0RL 3KNBA 5GS2D 4HLJA 1YDPA 4YHNB 4KI1A 4RAHA 3OKDA 4JFFA 2JK5A 2CJUH 2FLRT 1R3LB 1IVLA 1MRFH 1XF5B 4RMSA 3MV9D 5DK0B 1NCUA 1HZHL 1MFCH 3TO4C 5A3ID 1S9KC 1KXQE 4O02L 4U2YA 3MYZA 3OTTA 5JMRA 5EU6A 5D7JA 2BVQB 3IVKA 2F5BL 2IANE 1MQKL 4KZDL 4NPYA 3B9DA 3QIBC 5GRZA 2M1KA 4PJGA 5TF1L 2BOCB 1A1OB 4XP5H 1ZK9A 2VDKH 4DVBB 3NPSB 1EGJL 3T4AB 1FBIL 2D7PA 5ITBL 3I3EA 4P2QD 3ZKXC 4KJWD 1N0LA 1SMOA 4YAQA 4H25A 4KKLC 1UB5B 2HT4D 3ALPA 4NUJB 4QRTB 1DBKL 5F7KC 1IM9A 4KTEL 4QHMA 4PGEA 3PV7A 5E70A 2MCG1 4JPVL 3RTQD 3IXTA 4XCNB 5DF0A 1FFRA 2V7NA 2VZVA 4HH8A 4YGVA 5DD1L 1OVZA 1BBJA 4Q2ZB 2IAMD 4G9FB 3X11A 3OAZH 2QADB 3NPSC 1BAFL 4ELKA 5I1DB 4P3CL 1B90A 5I74C 4I0PB 5EU6E 3NAAL 3HCVB 3HR5A 3HI1B 1U6AH 5DJYA 1OTSD 1DQMH 4YFLF 1NL0H 4KK8C 1P7HL 5HYIA 4S2SB 3SKOA 5I9QB 1AKJA 2IH1A 1KTDA 2DYPA 4WTWA 5JIIA 5J13B 4C4KO 4OLVH 1RIUH 5L2KD 5SWSB 3C5JA 1YNLH 3UPRB 1URLA 3LMJH 4M8VA 4U1IA 2V2XA 3ZKND 5EUOB 3ULSB 2EIBA 5D1ZC 3F6LA 3DO7A 4K2UH 4I0PC 2KKQA 4JLRA 4OCWL 2P49B 1EFQA 3N50A 4QRSB 1TIUA 4FQXA 3CUPA 3QXDA 3OG6B 4H88H 2VXSH 1F4XL 5I9QC 3RVWC 5IEKB 3DLQR 1A0QH 3BT2L 4XAWH 4G7VH 1P4LA 4U1SA 2Y6SC 1VFBB 1U8HB 4ZPVB 1GZQB 1T4KA 3CMOL 3R06B 1YN7A 1UM4L 3B9EA 3PL6A 2C1OA 1FZKB 1IKNA 3FB5B 2NX5A 2RFXA 2XPGB 4NZJA 1TMCB 1VDGA 1AO7B 2DKUA 1KC5L 2P43B 4NO3B 3IDMA 2F9BT 3PDGA 4NJ9H 5ACZA 3TBVB 4K71C 3C8HA 5SV3A 1QFWH 3I6GA 4KHTH 1IC4H 4P5TA 4HC1H 2P47B 3M17A 3EDKA 4J3UA 1IQWH 3P0YH 2G2RB 4X7DC 4ZUTB 1IT9H 3JV0A 2BNRA 3OBAA 4F37F 32C2B 4GQ9H 4I77H 3WNMA 2A83A 2WWKO 5B22A 1KFAL 3KDMA 3WDJA 4NRYB 3RWEA 3BPLC 2J88L 5EZLB 1XGYH 4G6KH 5E94A 4XI5D 3O3EB 5DTFB 3P9WB 3RWFB 2VXVH 3KLHD 2OP4L 1J5OH 4S10A 3VFMB 1S8DB 5ICZA 4JB9H 1BVKB 4OZFB 1KTLA 5F44A 5GJSL 2D2OA 1I9EA 2I07B 1WZMA 3BZ4B 5FUOL 4H26B 2FATH 4IIQC 3UBXA 5CLWA 4BELD 3V5DA 1G7JB 3EYQC 1D9KB 4QRRB 1JGVL 1UZ6E 2VQUA 3MUHL 3K4ZA 5KANG 5HVWA 2DJSA 1Q1JH 1P7KA 12E8L 5D1XB 3S96B 3MRQB 5JOEA 1QFUH 3KS0H 2YD5A 3FO0L 1FIEA 5HHVH 2CLVB 5HYQA 5EUKB 1NC4B 4ACPA 5KAQF 2R56H 2WIIB 4G6JH 3MCG1 4N68A 5HYEA 1FFNB 3A6OA 4OGYH 2J8HA 4P9ML 4AEHL 5IR1B 2ARJQ 3JXAA 4XZUA 2XWJB 5AUMB 5IT2H 5FYJH 4XVUD 3SDAA 2DM4A 4RX4D 3V5KB 1QSED 3O4LD 3PXHA 4KWUA 1CLYL 4U1KA 4UI2A 5E56A 5HHMD 5J89A 5IW1B 1MI5D 3OKNB 3FFCA 2YA0A 2VKXA 1CL7I 2VIRB 4M48H 1YPZF 3PGCB 4YIQB 4Z7WF 1YYLH 2J8UF 3ULVE 1A4JA 4V2CB 3MACH 4FXLA 1N6VA 4JHBA 4QHLA 5LG1A 1BQLH 2G60H 4GAYB 4A6YB 2OR9H 4P9HH 5KSAD 3Q5YA 2YA2A 1TETH 1NC2A 4O2CB 3LV3B 3WO3B 2H32H 1XR9B 1KELH 3QJHA 3W5MA 5KS9F 4HUXB 4JM2C 2C7UB 4TSAH 2O5ZH 3BX7C 4HCRA 1GXEA 2ZCKH 2WLYA 4NZUH 5MI0C 4BZ1L 1JNLH 1S78C 3FFCE 3GJFH 5EO0A 5CZVL 5L2JA 1YEDA 3WEXB 4XBEH 1D5XB 3FO9A 4ODHH 4BFIB 3DGCR 1BM3H 3RWHB 3K80A 2P44B 2Q1EA 4MCYA 5CMAA 1D6VH 4U0QB 2AJ3B 5F9AC 3GRWH 5JR1L 4I2XB 3KPQA 4PJ5E 1FFPA 4QHUA 1NBQA 2CIKB 5IMKB 3RP1A 1NCWL 4CDGC 5DUBA 4CVUA 5HHPB 3JWOH 2E7HA 1X9QA 5E5UB 3WN5B 5LXGL 4K23L 1FFOA 4H1LA 1ITCA 4P4KA 4F7TA 3WBDA 2NY0D 3FO2A 3QIBA 1I1AB 2X89A 1R3LA 4WW2F 3UP1A 1G0YR 1VGKB 1XF5A 2CLZB 2XZZA 3VFVB 5DK0A 1DZBA 3H3PL 1K2DB 5I19L 1WSST 3SE8L 5IVZB 3WN5C 4DUXA 3WUWB 3K2MC 5LWYL 1U58B 1DDHB 2X4SB 4G5ZH 2BVQA 5FHBL 4N8CL 5DRZB 5FGSA 2AK4E 5DZNA 3K2UL 1FQ9C 1QTYT 1M05A 5J8OA 4J3XA 1I1AC 4P2OB 2BOCA 1A1OA 4NGHL 1EHLH 3O6ML 4NKQB 4PYGA 3EGSB 4DVBA 5I8OL 3T4AA 4KRPD 1VERA 3ZDXF 25C8H 4Z95H 4N0CC 1CXLA 3UTTD 1I7RB 4BSWA 1UB5A 3OKLB 4NUJA 4QRTA 5C0JB 4U1HB 2DQJH 3TN0B 5ELIA 4MCZB 1RZKC 4YDJB 3WJJC 4UOW1 1S9XA 1OWRM 3DMMB 2XA8H 4P2OC 3SGDI 4F58L 4XNQB 1OTTC 3H9SD 4NP4H 4FABH 1MHPL 5D1ZA 1OP5K 4Q0XH 3S37L 5I1DA 4I0PA 5KSUB 3HCVA 3HI1A 5FOJA 4X4YB 2ORBH 3AS1A 1R0AL 2J1KA 4S2SA 5BOPA 5T3ZE 1HKLH 4WUUD 3RZCC 5I71B 1L7TH 4DN4H 4U49A 5K59F 7CGTA 2NY5H 3UPRA 1YEKL 3DRTB 1WBXB 5EUOA 3IKCB 3BIKB 4PY8J 2YHGA 2HG5B 5EFIA 5FKAB 3Q5OA 4DN3L 5E2UH 5MEPB 5AAWA 5T1KA 3VFGH 5IJVB 3QEQB 4QRSA 3VXRB 5IVOA 4KDVA 1OM3H 4LQ1A 2YZ1A 5IEKA 5EB9A 1T03L 5I73B 3Q3GA 5I71C 5F89B 2EO1A 2EDQA 4G9FE 1VFBA 4ZPVA 1SEQH 1T2QL 1MAJA 3R06A 1MCRA 2EC9U 4HFWB 1DQQB 2VC2L 1FZKA 4RFEB 5BO1H 2XQBH 3G6AB 5ALBH 2PTUA 2XPGA 8FABB 1A14H 4Q7DA 3WFCH 1AO7A 4L3AA 1G9NH 3ALWA 3T0BA 5I1GL 4Y5YB 1S7WA 1BEYL 1EJOL 1NAKL 5SWSE 3DXAE 2A9NL 4PJ8B 4IRSC 5A43C 5GGVY 4ZUTA 4ODUB 5KSVB 3BZEB 32C2A 3RVUD 4JFDB 3H42L 5C08B 4C56D 1A5FL 4XPFH 4IIQA 1PBYA 5EZLA 2D9QB 4Z7NF 1CGSH 5F96L 1D5ZB 1UFUA 4LIQE 3O3EA 5DTFA 2FWOB 3MNZB 4XPHL 1OCWL 1T1YB 4Y5YC 3MCLH 2JJSA 1S8DA 3VFMA 1X5JA 1FH5H 2FYYA 2YRLA 1GCFA 1CFQB 1FZMA 4JCLA 5EA0H 5T1DH 1WV7T 4KK5C 1AO7E 2CUMA 2I07A 3S4SB 1YMMB 3BZ4A 5ESQA 2B2XL 4P5KB 4CMMB 3VFWB 2PR4L 4GSDH 4OQTH 4QRRA 1EFXD 2VDPL 5I8KL 2AJYH 4XWOD 1H3WM 5D1XA 3S96A 3QHFH 2AJZB 3MRQA 4PP1C 2WAHA 4S1SL 1OSPL 2GAZB 5KVEH 1MJUL 1CVRA 3GBML 2CLVA 1I4FB 1P9MC 5EUKA 2GITB 3BAEL 3T0WA 1ZA3B 1RK0B 4IDLA 3TH3T 1DQLH 5ISZA 2NXYD 4PGDB 3KPSB 5HHQB 5HTSA 2XWJA 1J8KA 4LDEB 1FC2D 3IRZA 4X7TB 2P8LA 1WFTA 3V5KA 3VGFA 3OQ3B 2CGRL 3MJ7A 3D85B 1JYXA 3X13B 1PKQB 2MKWA 2WUBH 4X5XA 4XBGB 4JFYA 3VMNA 5IW1A 4P57B 3KJ6H 3OKNA 5CSZB 5BMFH 3HMXL 4QRRE 5D7KE 1AGDB 3QIWB 2VIRA 3PGCA 4JM2A 1DE4A 1KB5H 5DGRA 3LD8B 1VADB 3QWQB 1OP9A 3T3ME 1WGOA 4GAYA 2B20A 5EN2B 4A6YA 1ZT1B 3H0TA 3W82A 2X4QB 2F19L 3PGDB 5TQ2H 3QRGL 4FZEH 5GS2H 1P53A 4C83B 4G8GD 1EEZB 1U41A 2XTJD 3LV3A 4K8RL 4JY4B 4HUXA 1TJHL 5ID1B 5E4EB 2C7UA 3LD8C 4FFYH 1IBGH 1A3LL 5CGYD 3RVVC 1A6ZB 5DA0B 3U0WH 5DVKA 4B53A 5IG7B 5ERWB 4HWBA 3HNVH 2FX7L 4Y2OA 3IF1B 4GBXD 3TIEB 4P2RB 5DYOB 5JW3H 3WEXA 4J8RA 5DT1H 5HYSG 4BFIA 3CH8A 3U0TB 1JTOA 4QTIH 3RWHA 1A64A 4R97B 1FNFA 4ODWB 1I3GL 4OLZL 2X70B 1CFNB 4FTVE 3UZVB 3CLEL 3U7WH 4F57H 2FGZA 4DW2L 2AJ3A 2HAZA 4JRWA 5FECB 5C0BD 4RBPH 3LKRB 5EC1B 1F6FB 2CIKA 2WM0A 5IMKA 4OZGA 2I60L 4UT9L 2Y23A 4TSCH 4JZJB 5HHPA 3QR2A 1AIFB 3RWGB 2E7CA 3WN5A 3U2SB 1Q0XH 2I24N 5IIEA 2Y5EA 4R97C 1DEEA 2A77H 4HCRL 2OZ4A 1UA6H 2FDBP 3O3AA 5HPOA 3N85L 5JHLL 1K4DA 1I1AA 5IBUG 5EIQA 3LKSB 3IDXH 4MGXA 3O9WD 4U3XA 4WWKB 1VGKA 4Z9KB 2CLZA 3VFVA 5BRZD 4RGND 2ZP0T 4HLZG 5GGVH 4TNWK 4Q6YA 1XGPB 3PWLB 5HVGB 5IVZA 2DDQL 4NRXB 4ZUVA 3WUWA 1XCTA 1DDHA 5K9JH 4NQUA 4I2XE 3K1KC 5DRZA 4K7PX 5I2IB 2DWEB 5KVDL 3WJJA 3MLSL 1YEGH 2XZQH 1NFIB 1U0QA 4P2OA 3TFKD 1MFBH 3CXHJ 1KCRH 2BVOB 3EGSA 2GY5A 1LO4L 3QI9D 4FMKA 4QOKD 4GG6A 3C2SA 1I7RA 3GHBL 1LO5B 3OKLA 3ZYZA 5C0JA 1UJTA 4U1HA 4U6YB 4Q9BA 3RZCA 2H2PC 5K9QI 4MCZA 3ARSA 4YDJA 3KHOA 4JRYB 4FZ8L 4MQTB 3DMMA 3PWPE 3UJTH 3BMVA 1NGWB 3HE7D 3QDMD 1FNGB 2VXTH 3IXAB 4XNQA 4KQ4L 2XOTA 5C0GA 1JUFB 4MJ4A 1TCMA 1LDPL 4O9HH 4YXLH 5EG6C 4J4PD 4OI8A 3OKOB 1BX2B 5KSUA 2E8YA 3EDFA 5C70A 4Y4HD 2AJVH 5TGBA 5E6ZA 4ZAKB 4ZSOB 4UQ2B 1ED3B 1I75A 1H5BB 1CICB 3VDCA 1G7LB 5B4MC 2B0SL 4NYLA 4CVZB 4JVWA 5EU7E 2EYTB 5CJOL 1IJ9A 1YEFH 1WBXA 4GRLD 1GC1C 2FEEL 3GK8H 4GS7C 3IKCA 2Y25A 3BIKA 5FKAA 2HG5A 1DBJL 3REVB 3VXSB 1S7SA 5IJVA 3QEQA 3VXRA 4EI5B 1B0GB 1RI8A 2C4FT 1JNNL 3EIFA 3V8CA 1W2KT 4ZAKC 5FB8B 2IPTH 4G6FB 3AU1B 1H5BC 4XPBL 1NDGB 3U9PL 3U4BL 3P4MB 4NQVB 4NM4H 4KZEH 5I1AB 2HWZL 3RKDD 5FHAH 4JFED 2AEWA 5CSBA 3VXUB 1DQQA 4LFHD 4RFEA 5E2TL 1TCRB 1W72H 3G6AA 4ZXBB 4FG6D 3TYGH 8FABA 4HAFA 4Z78B 3BMWA 1QFHA 1WAAF 3SDDC 4EI5C 5BS0D 1IARB 4Y5YA 3C60C 5E03A 3IFNL 3OWEA 2NY6B 1HINL 4ODUA 4ZUSB 5KSVA 1IAII 2HYMA 3ZTJG 5C08A 1QBMH 1DN0B 4CN6A 3B2VH 1NCAL 5HYFA 4GW4B 5D72H 2Z9TA 4NM8H 5IQ9B 1D5ZA 2YS4A 3DARA 4AL8L 5ICXA 4P49A 3VFOB 5C7XH 2FWOA 3MNZA 2EYRB 4MNQD 1NANI 4M7KL 3D2UB 2KDGA 1IGYB 1A9BB 3GI9H 4O51B 1CFQA 3QNYB 2CRZA 1P9MA 4GW1A 5E7BA 3S4SA 4CMMA 3BN9D 4KKBC 2Z93B 4P3DB 4KFZC 1JGEB 3VFWA 5ILTL 5LQBL 2W9DL 3NIDE 1TXKA 4MB3A 5FA3B 1OAYH 5GSVB 1P4BH 5CIPA 4ONFL 4DK3A 4JFDE 3D39D 5C08E 5JHDB 4MVBD 3BKYH 4XP6L 3CFCL 1UWXK 3BWUC 1B6UA 2GAZA 2LU3A 2BX5A 4KPHL 1CK0L 5IB1B 1XZ0B 3MLWL 1I4FA 1XGUA 3MV01 1RVFH 2ZKHH 3OB0K 2J2ZA 4XX1E 3WNPA 3BKML 4GKOA 2XN9B 3EOTL 5ID0B 3KPSA 5HHQA 3R0NA 4MYWB 2PYEB 3LQAH 2Z91B 3SKMB 4OCMC 3BIBX 4J6RH 5EDXA 4BZYA 1YMME 1NCNA 3D85A 3A67L 3X13A 4XBGA 4KTDH 3QUZD 4P57A 5CSZA 1AGDA 3QIWA 4PB9L 5HD8C 5E9DB 4PJHB 1BFSA 1QLRB 1ITBB 2BFVH 2YRZA 2OQJA 3N06B 3VXOB 3MA9L 3QCUL 4KUZH 1ZT1A 3X17A 3ORJA 1HXMB 5FEBA 4PBVC 2X4QA 1G0DA 4I13B 4HG4K 3PGDA 2E7BA 3RBSA 4YBHA 5HYSA 1EO8H 1YY9D 4C83A 3I2CH 1RU9H 1BD2B 1EEZA 1ROWA 3ARUA 3CVIH 3J8F7 1GH7A 1N59A 2AJXL 2DBJA 3MFFB 4JY4A 3T0XA 3UTPE 5ID1A 3O2VL 5EZOL 1P7QB 1A6ZA 5IG7A 4I48B 4WV1C 1AC6A 3QPQD 3CXDH 3LB6C 1PKQE 4NNPL 3TIEA 2A1WH 3AMKA 3ULUF 4P2RA 5F6HJ 1AD9B 4MJID 5DYOA 5F6IB 3PP4H 2OJEB 4LAJH 4ODWA 2R15A 2X70A 3OPZL 1MUJA 1A3RH 1X4ZA 3LDBB 1KN4H 1DBBH 1I85C 4A6YL 5D6CB 5FECA 2WMPA 3GHEL 3ISWA 3LKOB 4LDOB 1R5WB 1JPSL 3QEUB 4JG0H 1JHLL 1V05A 3V7AE 4N9GB 1B0RA 2C1PB 2H2SD 3UCRA 5E4IA 1BZ9B 1NJ9B 2R0KL 5GS1B 2YPVL 3KLAB 2CRIA 4K7PY 4PB0L 5I8CB 2XG5A 3AREB 3U2SA 5JQ6L 3MREB 2Q76A 5C2BL 5D7SL 1U8PA 1T83C 4HWBL 3LDBC 4V1DA 5EBWB 2GK0B 5A2JH 4FQHB 2VTFA 3L5HA 2HTKC 3TA3B 4P2RE 4BFEA 3KVQA 4WWKA 3NGBC 5I1HH 4OM1L 1I3RB 2R9HD 2VDLH 3EO1B 4PJ7B 5GS0C 4X4ME 3PWLA 2XQYK 4LRIC 3AREC 4FNLH 4JM4L 4NNYB 5KVMC 1YEIL 5I2IA 2DWEA 3TPUB 2AW2A 5AAMA 3CU1A 2EEAA 4TUKL 4Z7QE 3CSBA 5I1LB 4W6XB 3MLPA 3LIZL 2EC9T 4IBLT 3LH2L 2OZ4L 5JDSA 5ADPH 4JFFD 3X3GL 4X99A 5HGBA 3OAUH 2NY2D 3MV8B 1LO5A 3QDJB 3MYJB 1OAUH 4OT1H 1G6RB 3E3QC 1HDMB 3VA6A 3SKJL 4JRYA 3DVFA 1OT1A 2LFGA 3H3KA 1PSKH 1NGWA 5D7JD 1ZMYA 1FNGA 3IXAA 4JHWL 4HKBB 1JUFA 4U6VL 2DTSA 4HQQH 3VI3F 2IPUK 4DK6A 3AFLA 3S34H 5F1OB 1RZKL 4R8WL 3FONB 3UTQB 2MOVA 5IBTL 4ZAKA 4ZSOA 1U8QB 1ED3A 4NQTA 4UQ2A 4OI7A 5AYUH 1H5BA 1CICA 2X1XR 3S98A 1G7LA 4XMLH 5GRUH 1MELA 1DL7H 1BPVA 1RZJH 4U7SA 4CVZA 1IM9D 2EYTA 4HX1B 5HHOB 1H9VA 1PQZB 3QUXC 1GAFH 1J1XH 5KTEH 3REVA 3VXSA 1FO0H 3SCMB 3WFHB 1NDMB 4EI5A 3B9KD 4EDWH 1B0GA 4JRYE 2ENSA 5FB8A 3NACH 3C60A 4MD0B 4V2BA 3WKNA 3AU1A 2YWZA 1NDGA 3VA2C 5F9JB 4HJ0C 3P4MA 1RMFH 4NQVA 5I1AA 4P59H 3VD3A 5GS3A 1AKJD 1UVQB 3U9UB 3VXUA 2ZUTA 4U6XB 2DYPD 4E0RB 3PXJA 2FR4B 4ZXBA 4F8QA 5BW7A 3SCMC 4Z78A 1G9EA 1X5GA 3BP5A 5I18L 2HKHL 1LK3L 1T1XB 2KQNA 4KJPC 1FFQA 3QAZB 5F9OL 4FQXD 1LD9B 1YEEL 5J6HB 4W4OC 3NCBB 4ZUSA 4S0TD 4F33B 3VXSE 1RZIB 2IJ0C 3FCTB 1BJMA 3VRLE 1QFWI 5FYLE 1E27B 4NJAL 4S11A 5D7IF 4GW4A 6FABL 4IMKC 3S37X 3MJ9H 4FMFA 5IQ9A 2H26B 3PL6D 4XWGL 2FGWL 1CU4L 2EYRA 3BQUB 4Z0BH 2NX5D 4KUCD 1DN2A 3JV5A 4NQXA 3F7YB 3VXUE 1I8LC 3D2UA 1IGYA 2J6EL 1NAMH 4ONGL 3T0VA 1A9BA 5IQ7L 3UZEA 3GO1L 3QNYA 4HJJH 1RUMH 2Z93A 3EO9L 4P3DA 5AEAA 5BXFB 1KIRA 2AGJL 2BNRD 4OCRL 5B38G 3O81A 1KB9J 5E00B 5GSVA 3S88H 3BQUC 2PYFB 3U7AA 4M7JH 1QPPA 3P9MB 3B5TA 1SYVB 4Q9QH 4HS6A 3QNXB 4ORZC 4RGMB 4JO3L 4WU5B 1QR4A 4BUGA 1CZ8H 3EOAA 2A2QT 4RFNB 3OKKA 3V4PH 5MERA 4NC1E 2XN9A 1AY1L 3WD5H 4LRNH 4TQEH 1IGIL 1HH9B 2HJKA 3L5XL 2PYEA 2Z91A 5C09A 4OJFL 2XZCH 3SKMA 4KVCH 4NQDB 2HT2C 2VNCA 3RUGA 3VWJB 4JFZL 5DURD 1M7IB 2C26A 3LEYL 1Y0LB 3F7PC 3ULVD 1CDHA 1RFDL 5I17B 3M8OL 4RGMC 1FNAA 3GB7B 5DEGA 5IGXL 4F7PB 3T0AA 3MMEA 1ZLVH