3OMZA

Crystal structure of mica-specific human gamma delta t cell receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
240
structure length
215
Chain Sequence
SVIRQTGSSAEITCDLGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSKNLRMILRNLIENDSGVYYCATWDQNYYKKLFGSGTSLVVTDQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKRLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGESLTRADKLIFGKGTRVTVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a {gamma}{delta} T-cell receptor specific for the human MHC class I homolog MICA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords human Vdelta1 gamma delta T cell receptor delta1A/B-3
total genus 48
structure length 215
sequence length 240
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3omzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3omzA01
5GRJL 2NLJA 4M3KB 4UTBL 4EI6B 2JJSC 3S3PA 1UWXK 1X5LA 1HOCA 1WCBA 4RRPA 3SDDD 1X5IA 5E1AA 3KYOA 4Q7DA 4PRHE 4BFGA 3LKRA 2OMNA 4JFYB 4PP2B 5I1LA 5KS9F 3ZDXE 1TJGL 1VACB 5IEKA 5ICXA 2EDBA 2WINA 3FQRB 1PQZB 4NQUA 5ISZD 4J4PC 2JJUA 4CDGC 5IIEB 1U9KA 3ZKXC 4F7CA 4OGZA 5IB3A 1LO5A 5DHVA 4APQA 4ZFOB 1QA9A 1MI5D 3NFNA 5T33H 1TZGL 2NY0D 3WIHL 4P5TC 1M7DA 4ORZC 3VD9A 5D70L 1T89A 2ZNXA 3NH7L 1OF2B 4XPBL 4EQ3A 1I8MA 1XGUA 2B2XH 3D0LB 2HFGL 2QSCH 2R0KH 3U0WH 3T65A 4GXUN 5KW9L 3ILQD 3T09A 4Y4KD 4KTDL 3QDMA 4PJDF 4DCQA 4JFYA 4PP2A 1DBML 1MFBH 5EIVA 3HAEG 1XF1A 4LLAA 3HI1A 3TFKC 1QFWH 2V2TA 4LOUC 3ZZ1A 1YPZE 5FGSA 1JYVA 1WICA 3EYUL 4QHKI 5ENWB 2NY1C 4YNYA 3VFTB 3LH2L 3HAEH 3NOIA 4HX1B 2QQLL 4YFEA 2ZOLA 3MBXL 3KYAA 1NLBH 3QIUA 4L8DA 4HXBH 4NUJA 4ODVL 3WHE1 2VLJB 3MCKB 1GPOL 1JHTB 2B0SH 2GTWB 1I8MB 3FN0H 3RUGB 4XI5D 5BZWB 4NQSA 1Q1JL 4Y1AB 4Z7QE 4X4MA 1DUYA 4OD1L 2R0LH 2RB8A 3KPQB 3T8XA 4C56A 4KRPC 5TF1H 1MRCL 1IAKA 3MLSH 4PD4K 1TJHL 4TSCH 1V3KA 3PXHA 1A21A 1RZFL 4HF5H 4PJ8A 3VWKB 2OR9H 3IKKA 2G75B 3ARWA 3GI9L 5DUML 1HILB 2FX9H 5C0CD 5E0QA 2AJXL 4YXLL 2PTVA 2R1YB 1CL7I 2E7LA 2JJTA 1WWWX 5EU3B 35C8H 3HZKB 3HNVH 2Z31C 1KGCD 1T5XA 4R26L 4ZMAT 1B0RB 4JGJA 4ETYA 1F4WL 1RZ7L 3TP4A 1T5WB 4X8JA 5TDNA 2EH8H 5HBBA 5J11C 3HI6L 4OJFL 3F7YA 1FYTA 1T21B 3KYNB 3P4NB 5HVGB 5GS0D 5F96L 5K9KA 4KHTH 5EH1A 2GCYB 5DO2C 5FGCB 1LWRA 4ZOBA 4MJ4A 1CDBA 5DURD 4NBXB 5ID1A 5C0IA 5IF0B 3TJEL 1KN4H 3DMMB 4G8FB 1WC7B 4GKSA 4PFEA 5CJXC 4G3YL 3SDCC 4ERSL 1PEWA 4AEHH 4WHDA 4YHYB 2W60A 2ADJA 1QRNB 3IU4L 2C3XA 1AHWA 3CK0L 3KPPB 3GMLA 4GSDL 2N7AA 5GGVH 3SGKA 5FUZL 4DGVL 3PE9A 2D7TH 5K9QG 1FDLL 1CXHA 3DX6B 5HDLA 3F6IA 5GGTL 5IEKB 2BVQB 2VB5A 1Q9OA 2V2TB 3OKEB 4ELMF 4OZFA 1CZ8H 4MA7L 5M94B 4GAGH 4XCFH 4WI2A 2IAMC 2AEPH 4M8QA 4OGXL 1E4KA 3QIUC 1O5DT 1EZVX 4UAOB 5FO8B 5J89A 1UEMA 3MLPA 5T1MA 1KCKA 3QNYB 3V5DB 5DJ0A 5HHOA 3OX8A 2VMFA 4RMRA 2AJ3B 1JN6B 4NSKA 3QJFB 2CRYA 4J3WA 4Q9QH 5DMIH 3V7AG 3STZA 1ES0A 3T8XB 4P5TD 5IW6B 3VXRA 1SM3L 2H41A 2B4CH 3Q48A 2FO4A 1WBYB 1JZ2A 3B3IB 15C8H 4OGAC 4U4BA 3L3HA 1A6AB 5I8KL 3KS0H 1JNHA 1KXTB 4PRIB 5BJTA 2XI9A 4I5BA 3NZHL 1IGFH 1BZ9B 4XCNA 4X7CC 2LU7A 3WLBB 4E9LA 5IOPA 2CSPA 3P0YH 3UYPA 3OAUL 3VXOA 2HYMA 4GLRI 1QSED 4LPCA 3K2UH 5D1XC 5T3XL 2VXSH 1T5WA 2J88L 3ZE0E 4PREA 4K71C 1Y6NR 4XCYA 5F9WC 5J4MA 1S9WB 4RZCA 4ZAKA 3V9FA 3QUZC 1N0XL 4RCAA 4U1JA 3ZDZE 4APQD 3IKCA 3DETD 4HZLB 1FIGH 3UEZA 1YNKH 2D4FA 4LCIH 5JW3H 1WBYA 4UT7L 4EQ2A 3OBAA 4QHLA 2I9LA 5A16A 2HT4D 1XZ0A 5LXGL 4JDZB 1MJ7H 4Z78B 1LO0H 2BXYA 1SYSA 1ZSDA 3FT2A 1MCSA 1QLFA 4OD2B 1K4DA 3KWWB 5HJ3A 2ARJQ 4DGIH 1OAQH 3MGOB 3TV3L 4DZ8B 3IXTB 2R0ZH 1BF2A 3MCKA 4XVJL 2VE6B 2BNQD 2C1OA 4L3CA 4AM0B 1EDQA 1ITBB 1SVZA 3W82A 1PDKA 3HZMA 4KQ3H 3EYOB 2NY1B 5BS0A 3D5OF 4JY5H 1E4XL 3PGDB 4TQEH 5F72S 3UJJL 1AKJD 4PJAF 4PTTB 1R5VB 1ZA6B 1SEQH 4FQ2L 4I2XB 5FGBC 2VZ1A 3O3BA 1INEH 1JF1A 2F53D 1NQBA 4HKJA 1QTYT 2OSLA 1CK0H 4NZTH 4MSWB 4OQTA 3O4LD 4JG1L 2F8OA 2BVQA 2JLLA 2P7TB 4WIQA 1YEFH 4NKOA 4Z95L 1CG9B 3VA2C 4MJIA 5FGBA 3UPCA 5FOBB 3LV3A 5J8OA 1GVIA 4KRNA 4ODWB 5ERWA 2X9XA 5GXBB 1S3KH 1H8NA 4ZFGH 2YD9A 4LARL 3QIWA 1JYXA 3GUTB 5CP7A 1R3LB 5I0ZA 4UNUA 1QO3B 1PAMA 1F6AA 1MPAH 1NSNH 4N9GB 2XTJB 4M93C 3VG9C 2YSSB 3L95B 2N4IA 1WT5A 2V6HA 5EWIL 3VGGA 3VFWB 3BUYA 4OLVH 3E2HB 3HC4L 1IEAA 5H8DA 1AGBA 4BH7A 1A8JH 1JJUA 4PJDE 1HKLH 4PS4H 3NN8B 4XHJD 1QNZH 2R2BB 1K4CA 4DVBA 5IMMA 1F6FB 4ENEC 3JV4B 1D6EB 2A0LC 1FBIH 1OCWL 5ENWA 1NBVH 3RIFF 1T80A 4Z5RB 2FD6L 3D3VB 4LSQH 3VI4E 1OAZL 3VH8B 3ULVD 4OD3H 5C3LD 2YPLD 1Z3GH 5C0GB 1NGXB 4MS8C 2NX5D 3GJEB 4WTXA 4ZFOL 1ACZA 4YHIA 4QRRA 5FO7B 5H35A 1OTUD 2GI7A 3OV6A 4PJHF 2GJ6E 3SHSA 1WCQA 5E5MB 3VWJC 3ZKND 3BZEA 3QO1A 3DBXB 3ZDYF 5KS9E 4FP8H 5K9JH 3MRDB 4MNQD 4XNXL 4CL7A 3O0RL 1YJDL 1SYVA 3GMNA 4C83B 4XWGH 3EGSA 4RRPG 2BOCB 3C6SB 1H8SA 1AY1H 1U3ZA 4FQ1H 1GIGH 1DN0A 1E6JL 4UOJA 3MQIA 3LH2H 1X7QB 4N8PA 1S7UB 4PJ8C 3MGTB 3RKDD 2EYTB 1T1XA 4H26A 4PLJC 3TBTA 1KOAA 1Q8MA 3MLVH 4HV8A 4O9HH 1GPOH 5GIRB 4UUJB 4BM7A 1AQKL 2VISB 5FV1L 2Z8VC 2HWZL 3BDBA 4BZ1L 5JHLH 4OLYL 4OD1H 5DF0A 1MVUB 1MRCH 3UBXB 2AI0L 1QKZL 5D7IE 3CVHB 5BQ7B 2F53B 5CZKA 1EO7A 5LGJA 1K2DB 3ZE2E 4JQIH 3VXUE 4ZFFB 2GJ6A 5ECJE 4NQCE 1CICB 3D39A 4OI7A 4TOYL 3EO0A 1QLEL 4IHOB 2IBZY 1U92A 4WUUA 3HFML 2IEPA 3L3GA 3BW9B 4H1LA 5BRZE 1NCNA 1QHOA 2HJLB 3GBML 3P11H 5HYJD 1F4WH 4TTGA 5FHAH 3W0WD 4UTAL 3GSNH 1VADA 1YEKH 5D7KE 4Z7WF 5KSBB 2QQQA 5D7SH 4G9FD 1OQXA 1TNMA 2CLRB 2ZUQB 3WJJC 2UUDK 4LPVA 2EO9A 1TZHA 5JW4M 2OXHA 1PQZA 3MV8D 5HHOD 4I4WB 1W72H 4Y7MA 2EDTA 4MHHG 3JV4A 1A3QA 4QT5B 4ZD3H 5I9QC 3TIDB 4OCYL 5SWSE 5F1OB 1U8MA 4JZJB 1TCRB 3LRSB 3HAEB 1V3MA 4CVXA 4XP1L 4Z7WA 5ETUB 1EXUA 1PX4A 1D3CA 1JWUA 1MRDL 1PLGL 4IBLT 1F8TL 1JUFA 4Q58C 2VQTA 5ITFB 4DGVH 1I8IB 1BLNB 1AQDA 4OM0H 3ARGA 5J9PB 5KSAB 2OJZH 3LS5L 4ZO7A 2O5YH 1D5MA 2YXFA 5KANI 5TQ2L 3EJYD 3MJ7B 2WBJC 3QEHA 4MQTB 4P4RB 2ADGB 1TETL 5DEFA 1EA9C 2L7UA 3ARDD 4UOW0 3RVWD 2DOCA 4OLZL 1VSCA 4WU5A 2OR8A 3FOMA 4ZSOB 3EOTH 4MNQA 3PWJA 3RY4A 1I8LA 1TTFA 3BGMA 1RMFL 4OFIA 1QFHA 2W65B 1IBGL 1J1PH 1CGYA 3F7VB 5DWUL 3OKEA 2C7UA 4X9HA 2F54B 1MEXH 2LVCA 1ULVA 2Y06L 1KFAL 5DZOA 5BOZG 3RI5F 2GJZA 4X99B 2MQ0A 4WDIA 2Z93B 1MHCB 4E42A 3S6CA 1RURL 4U3CA 3QEGH 4Y4HD 4PBWD 3SGEH 2CGRH 5CD3A 1ZLSL 3JWDH 1I3UA 3L5IA 4ZODA 1B2WH 1QLFB 4OD2A 3VU2A 3CCHA 4NJAH 4U6VL 2AJSL 5CWSA 1QZ1A 3P0YL 4WI4A 1U8HA 2PR4H 5DJYB 2JJVA 1XR9B 4R4BB 1DUYB 4UBDC 3OKLB 3VMNA 1EK3A 5ICYB 2W65A 4F9LC 4ONFL 1HHIA 3GM8A 3CFEB 1MCBA 4O58L 3FHQA 3TBWB 4NNXB 4XCCL 1NBZA 2ID5A 2WIIA 5ALCH 5GZOD 4UT7H 4H5SA 4P46A 3Q1SL 4X4ZA 4NHUA 4KGLA 3IJYB 5IROC 2Z31D 5D5MA 5LXGH 3LEVL 4Y5YC 3QUKB 3C2SA 3D85B 2MFNA 1DQDL 2R23A 2XWTA 4YEEA 5EBWA 3QUYC 4U6HB 2WWMD 5IB4A 5E2UL 2VXQL 4OIBA 5HY9B 2HJLA 4KK8C 5E08H 3GUTA 1A0QH 3FT4A 4R4NC 1CGSL 1S7WA 1QBAA 4X5WB 5C2BH 3DVFA 5KSAA 4E5XB 3SDAB 4MJ5A 4PV8B 1F5WA 4U1MB 4FABL 5DI8B 3UJJH 3ARGD 4PJXE 2PCPA 5IB2A 4KI5C 1LEIB 1MI5A 1TZGH 4DW2L 4PUBL 3KJ4C 4NZTL 4JKWA 5DD5H 4NNPH 1EHLH 1D5XA 2UYLB 3GHBL 3KS0J 5F3HB 1IM3A 1RHHA 2IH1A 4WCYL 4S1SL 4JVWA 2B2XL 2R2HB 2ED9A 5L7XH 1YJDC 2HG5A 3FOMB 3OPZH 1R3LA 4JQVC 3TT1H 2WMPA 3OGCB 1FSKC 4L8CB 1TQCC 1AD0A 3VWJB 2ZSVA 4OGYL 4NC1C 3SY0B 2NLJB 2OZ4L 3RTQB 4PBVC 4ZFGL 5C0NC 1ORSB 1OGAD 3KG5A 4FHBD 3QUXC 1N3NA 3MXWH 3K74B 3PQYA 4LQFL 2VDLL 2E9WA 1OP3K 3EYQC 2OM5A 1G7IA 2YPKA 1S8DB 5CJ5A 2OI9C 4LLYB 5A2KH 1NLBL 2WUBH 5ANME 3DXAA 5ESAA 5EWIH 3DECA 2JK5A 3VDAA 3BZEB 1BF8A 1IGTB 1T03H 5GJSL 1YQ2A 3HC4H 4QXTB 2QSQA 3RHWK 3SKJL 4PS4L 2B0SL 3BKJH 3ULVC 5EFIB 3G6DL 1RZJC 2OTWA 4MGXA 3VGBA 1AD0B 3TN0C 4Y16C 3FO2A 3MLTB 3UPRA 3U0PB 1GYAA 1RUQH 4OKDA 4K3EH 2BHZA 3G5XA 3BEWB 4H20H 3WXVL 1NAMB 1AR1D 1OSZA 4OCRL 4L4TD 4RGOH 1IMHC 1H0DB 4PJAA 3X17A 5C07B 3ZO0A 1RD6A 3EGSB 3UO1L 4LLWA 1INQB 4OF7A 5I66B 4XNUL 4DWHA 3IAGC 4C54A 3I3EA 1SJHB 1W72B 3CFJB 1IEHA 4RZCB 1UACH 4QHNB 5EZLB 4JDTH 1KNOA 2GFBB 3GDBA 2B8OT 1EEZB 2BNUA 3O4LB 3KPSB 4CMHC 2QADC 5LQBH 5F7MC 3GRWH 2PYEB 3VMOA 4OM1H 2GYSA 3TJEH 1D6VL 3ARFD 2GCYA 5GHWL 2VDQL 3S5LG 5DLML 4HPYH 5IHUH 4YBLC 3BH9A 3BIKB 4JGUA 3KXFE 5KZCD 5C07A 3KPNA 1IARB 1W8OA 2R8SL 1P7HL 3NCJL 2BNRB 4PPTA 5GRJH 2P24A 3IFPB 3WNLA 4XWOD 4YXKL 1DBBH 5B8CC 3EFDL 4OGAD 1A7BA 3RWCA 4PRBB 4BQ6A 1A1MB 2BDNL 4LRNH 1JN6A 3WJJA 3CVHL 5ADPL 3KPPA 1FORH 3NFPB 4JFZH 4R4FH 2VLKE 3N1QC 1DANT 3S34H 4QRUB 5ITBL 1A2YA 3V6ZA 3O2DL 4E5XA 2JKXA 5D6DA 1QBML 2APFA 3FL7A 4ZFZB 2VERN 1GGIH 3FTGA 1MLCA 1S7XB 2BERA 1FLRH 5ESAB 2DB8A 3LV3B 2PXYD 4J3UA 5DJ2A 2YD6A 4RQQB 5D6DC 3NH7H 1G7IB 5CJBA 4I0PD 4LCWA 4FZ8L 4PJ5A 4NQCB 1J8KA 1DR9A 3OZ9H 2VZVA 1QRNA 2FRGP 1UWGH 3MRCB 1P9MC 4ODSL 15C8L 3DSFH 4M6ML 3EZJB 3PP3K 1K8IB 4LRIA 4PTUA 3KYOB 5BMFH 4JANA 4WJ5B 1IEAB 4BH7B 5IR1A 1J0JA 2APXA 2XA8H 4GW1B 2AAVA 5IHBA 3GSNA 2DTMH 4M02A 4JGMA 1HHGB 1OLZA 4OM0L 4NDMA 4F33A 1BZ9A 1O7SA 3K80A 3RP1A 3UPAA 5DVOA 3S35X 4N0FA 3RY6C 4LKXA 4P2QB 4ODXA 5F7HA 4FQIH 1XGQA 3HZVB 3REWA 2E3VA 4IDJH 1S7RA 2X10A 3BGFB 4LGPB 4Q0XL 3EFFB 3W0WA 3QRGH 2YD3A 5FUCC 2CDGB 1NMAL 3VFVB 3VDCA 2JB5L 1RZFH 2WANA 3JTTA 5MP6H 4BFEA 4CBPA 1D9KD 4KJWD 1G0YR 4YXLH 1I7RB 1UCTA 1MCEA 4KRPB 1WFOA 3FO1A 3L7EB 3GSNB 1CDHA 2AJZB 5HI5D 2EO1A 4LGRB 5CBAB 5F9AC 1ORQA 4C59B 3GB7A 3RKDC 1L0QA 5FYLE 4K3HA 4YC2B 4YIQB 4O5LL 1D7FA 1DVFA 4U0RB 3ABZA 1AGFA 5AD0B 5HI3C 4WTZA 3L3JB 1L7TL 4P46C 2Z35A 5CJQL 5BO1H 4JVPA 1EPFA 4LIQH 2D2OA 1PD6A 5DFWH 2DQIH 5FCUL 4MNGB 1YUHA 3VFSA 5C0ND 1MLCB 1HIML 5I8OL 1NCDL 3IDNB 4QTHA 3RNQB 3DVNA 1IQDB 3SE4A 3VFMA 1SQ2N 4PJ9B 2CO7B 3SPVB 5DK0A 4POYA 1BX2A 3F7PC 3CSBA 4LSSH 3QDJB 3FRUA 4HKBA 1U93B 4F3FA 1MPAL 1NSNL 1XF5B 3VFGH 2X41A 4OF3A 5FECB 4QXUH 5HYQA 1RK1B 3SO3B 5I1CL 4XP6L 4XPTH 2VXQH 1NGQH 3L5WA 4F58H 1MELA 4QOKD 2R9HC 1CDUA 1OT1A 5GGVY 1FZMA 5HYJE 3EBAA 2FGZA 5EORH 3WSQH 3E8UH 4A6YB 1FBIL 1OCWH 5D7KD 3QULB 1ZT1A 3VG0L 1BFVL 3IDIB 2YKLL 2LV4A 1FHGA 3U30C 2C5DC 1QLRA 1Z3GL 5TGBB 4HD9A 3EIFA 4S1SH 4KROC 4U6TA 2R1WA 1N2RB 3TJHD 3I6LD 1P7KA 4F80A 4N0YH 3IETA 5FYKU 4KDTA 4NRZA 4MX7A 1FO0L 5F9JA 5MHSD 1IGFL 4W70A 1EJOH 1GGCL 4F57L 1T7VA 3RL2A 4U2ZA 2DM7A 2WUCL 1J1OL 3I9GH 1OTUC 2QSCL 2R0KL 4ODUB 2UWEE 4UV4L 2VQ1B 1XGRB 2XZZA 4KZDH 2ENYA 1I9JL 1GIGL 1BAFL 1T22B 4PJXA 3B83A 2EIZB 1S9VA 5LAXA 3O9WC 1ZGLA 4WTZG 1NCAH 1QFWL 2NW2A 3VGHA 4R96A 1UFUA 2EIBA 1F4XH 3SKOA 1ZLUK 3RUGE 4LFHD 2D9QB 1RZKC 4Q6IB 5SV4A 4JM2B 3QFJB 4YZFF 4PJ5D 1HNFA 3BDYH 3G6DH 1NANH 1NCWL 4NRYA 3O6FB 3HC0B 3S96A 5KVDH 3DROA 4NNYB 5CINH 4NO5A 2MCPL 4P4KA 2I5YH 2IAMA 5FM5M 5FB8B 4X9FA 1RU9L 2O61A 3EYSL 4Z7VA 3FO0L 1J05A 3LKSB 1IQDA 4KV5F 4XH2A 4IMLB 5JW4N 4B7IA 4V1DA 1S9YA 2G9HA 5C1MB 3U4EB 3WJLA 3VFTA 5HPMA 4HWUA 3P40A 1WZ1L 3DV4B 5DUMH 1I7TA 2IANA 3QIUB 5ANMA 4X5XB 1A6ZB 3IFPA 4JHWL 4NKDB 3MA7B 2FLRT 3LHPH 3QDJA 1N6QH 5DJXB 3ZHLA 1HHIB 4R7NB 5E8OA 3TZVC 1A3LL 4Z76B 4OUUA 5LQBL 3QWOB 1W72L 4OJFH 3LQAC 4F15B 2A74B 4XNQB 1H3XA 3EW3B 1OGTB 5EU4A 1ORQB 4WHTA 3HE7C 1P4IH 1KJVB 1F3DH 2PNDA 5DLMH 1BIHA 1KTDB 4IOIB 4QGTA 4IM8A 1ZHBB 1SJHA 3QULA 2FIKB 2K7PA 1FNGA 1R5IA 5FO9B 1QA9B 2IPTH 1UB6B 1YY8A 4M1DH 5A40E 4UMGA 3AS0A 2VDMH 1JHKL 3A6BL 4NO3B 4PYHA 5J13B 1H5BA 2BSRB 2XACC 4M7LL 4MNGA 1R5VA 1QNZL 4K23L 3D48R 4RNRB 4JFFE 3B9AA 2ATKB 2HTKD 4KC3B 4WU7A 1TVBA 3BZ4B 4HUXB 3RIAF 4KPHL 1H15B 2FJGB 2AS5M 4GFTB 4PJ9A 4XAKE 1MREH 5E99L 3D2UB 5C0JB 1CZ8L 3LRSA 3DO7B 4KI1A 1Q94A 2PW2A 3KXFA 5C07E 3IRZA 2YOCA 1JPGA 2O5XH 1CICD 3G5VA 5SX5H 4YDLB 4Q97A 2BY2A 3RA7L 2JTDA 3PWVB 3BWUC 2FWOA 2V7HB 3O6LH 4PB9L 4U6XB 3M17B 3UJTL 3S36L 4NQDA 1PYWA 3HC3L 4PLJD 5J6GA 5D2LF 3EO9L 4FQ1L 3H8NA 3X13A 4ETQA 4HJGB 2XA8L 1JZ3A 4R8WH 3QIWC 4MNGE 2M26A 2VH5H 4N68A 4OBRA 2ITDA 1HWHB 2E9BA 5KSVB 3BWAA 3MREB 3D39B 5IWLC 2BSTB 2P44B 3ZTJG 2RFXB 3I3BA 1MRFL 1E28B 4HIIA 4D8PB 1P4BH 5D71L 1OSPH 2IAMD 2VXSL 3VGFA 4FQXA 5C0BA 5J7CC 3J8F7 3GKWH 5DFTA 4PLKD 3HE7A 2RCSH 1HQ4A 2MPAH 4XVTL 4JM2F 2XQYG 5EC1A 1PG7L 1T89C 2BVEA 4KGJA 1PGRB 2QKIB 4ODXB 3F12B 3T3PF 5T1LB 5CGMA 2GITA 3RVXC 3X12B 3FONB 3UTSD 2A6KA 4C56D 1VENA 1EBPA 3GSNL 4M7LT 1OD7A 3CDYA 3EYQD 3BZFA 5CSBA 5GRWA 5INCB 2PYEA 3S88H 4PGCA 1NC2B 3DXAE 3KDMB 1FVDA 4NO5B 4HV8B 1XFPA 25C8L 5JHDD 4G5ZH 4NWUH 1CFVH 1G7HB 1U8PA 1DBJL 2EDLA 3ZYIA 4JZNA 4NNPL 4RBPH 1E4XH 1J10A 4UINL 2C3WA 4NFCA 5ICZA 1GZQA 2DQIL 3I50H 5C0BE 4WEMB 4OLWL 1SEQL 4RMTA 3FRPG 5E4EB 2FO1A 3EHBD 3VRIA 3U2SB 3RWCB 2W60B 4MS8D 1XF3B 3I6GA 1ZLUH 2IH3B 1GC1H 4EN3B 3WBDA 1WJ3A 3NVQA 3TO4A 3P0VL 5FAAA 4WI5A 1VFBB 1OP5H 1PKQE 4DOHB 4YPGA 1NC4A 3MV8E 3VFGL 3GJEA 5D2NA 1S3KL 3G04B 3QCTH 4Y2DB 3Q6GH 3LZFH 2EDWA 5CCKL 1X44A 1DEEA 2AXFA 4GQPH 4H8WL 2FX8H 4HLZG 3RDTC 2Y07L 2DN7A 4FFVD 4GMTL 5JPMB 3BJ91 2ZCHL 3FB5A 4GRLA 2EEAA 2VXTH 1BQHA 3FQNB 3GMPA 1RSFA 1S9KC 3VD5A 1SJXA 2IWGA 4ODWA 9CGTA 4YBHA 2UZXB 3BISA 1O0VA 3BX7C 3RPKA 1N4XL 1SBBA 4A6YL 1DN2A 1LILA 1CXKA 1YMHB 3GIZH 4HIJA 2DI8A 4AQOA 4R2GD 1OAZH 2IMMA 4OTXH 3B6SA 4F7MB 1S8DA 1X4ZA 3BD4A 1XZ0B 1OAUH 1JPST 2HFFB 5GS2H 4X6BA 2CGRL 1MCWW 1IGCH 4XBPA 3JWDL 3DV6A 5IW1A 4NPYB 3SDAC 3PWUA 1AR1C 4NJAL 4F8TA 4CRPA 3JTSA 2VDPH 3HPJB 3D2UA 4OZHB 3PJSB 5C0JA 3WFDH 4LLWB 4O2FB 4NUJB 3P2TA 3A6CH 1CR9L 1IT9L 4LCUA 3MLXL 4PREB 1YJDH 5T1LD 4WWKC 5ANMB 3L6FA 4O58H 2IBBA 5HY9A 1CIUA 1NDMB 3IDGB 5DVNA 4RA0C 4WO4D 4JY4B 4NQED 3QUYD 4LCWE 3OAZH 4WWKA 5TH2A 4QHLB 2DQTL 2XKNB 1JNHB 4PRIA 5FFLA 3C6LC 2JIXA 1F58L 2NY7L 4U1MA 4A2MA 1T7XA 4JFDA 2F58H 5IMLB 3BEVB 4PG9B 2X89D 3QG7L 5GSVA 1LP9F 4TTDD 1CL7L 1XF3A 3ZDXF 2AI0H 2H2SD 4W4NA 4YC2C 4YK4C 5I71C 3KPSA 2BOBA 4E0RB 4WWID 4J23A 4G7YH 1FFNA 4WUUD 4QHNA 2NTFA 1QFOA 4JO4H 3GJFK 3OKLA 5C6TH 1RZIB 5IFJB 4TN9A 3HUJB 3MRRA 2DLIA 5L2JA 5MENE 2HJKA 4PJFF 4YPGB 3RJDA 3EOAB 1A02N 3QDGD 5DD6B 1MCIA 2E27L 1K8DA 1FL3B 5EUKB 3OKDA 4JJ5B 1LQSR 3WDHA 3UP1A 5AZEL 1P6FA 3O4OB 5HHXH 5D7SL 3TT1L 4ZS7H 4N9OB 3R8QA 2OK0L 3CXHJ 4CMHB 3BE1H 1B6DA 3NN8A 4M3JA 3MUJA 2IAND 1CGXA 2R23B 4JG0L 4M6MH 4AH2B 1J0IA 2YN3A 2BVYA 4YR6B 3AU1B 4TVPL 4ZO8A 3DRTB 2IPTL 2GSIB 4M1DL 4JR9L 3UTTB 2VL4A 4Y16A 3VXMD 4DN3H 5GRUH 3NACH 3V52H 1J8HA 3M45A 4CUCA 2DQFB 1IAIL 5JW4Q 5EBMB 2HH0L 4UT6L 1MRDH 4WNQA 3QEQE 4K23H 2WAHA 3S3SA 3QIWD 5EN2B 4MVBD 4YNYB 2NX5A 3FFCA 2NY3D 4I1NB 4FFVC 4LSRL 3SKMA 1A6VH 4NT6B 2JB5H 1W0WB 4EIZC 5I1GL 5I8CB 4N1CA 5MP6L 4U1KA 5IJVA 5D5ME 4K3EL 2D03H 5ETUA 3CMOH 1CCZA 2ARJA 4YR6A 5GZNC 4X9IA 3BKYH 5HXMA 2BHUA 4OCRH 2FX7H 3E3QE 2NY5H 4Y5XB 3KPTA 3SCMD 1HEZA 4KJYA 2CKBL 4LLVA 1YN7B 5J6HA 3TBSB 5C0RL 2KQMA 3CH8A 3C5ZB 1YUHB 1IBGH 1J1PL 3ZSSA 2BHYA 3UJTH 1ZE3C 4N1HB 3P77A 4HH9A 5MHSE 1EEUA 4X0KB 3TO2A 1CFQA 4HC1H 4NQEA 2O5ZL 1NEZA 4JFFA 2PXYB 4FQXD 1EBAA 4EJ1C 1C7SA 1TFHA 1X4XA 4OB5H 4L4VA 4DTGL 1PZUB 5GGSY 4YX2H 5ID0B 3PGCA 2VNCA 1CDCA 3OMZA 5C08A 2FBJL 1GOHA 4IJ3C 4Q9BA 5EZIH 5GHWH 3G6JB 1NGZB 4OZHF 5FCUH 5EC2A 2KDGA 2VDQH 3I2CL 3MO1B 4MXVF 4U6XA 5IW3A 4U1LA 1F11B 4PJ8B 3OKMA 3VI4F 5HSFA 2P47B 5IBLD 4NFDA 4QOKA 1CD0A 2C26A 4JB9L 3QH3A 3UYRH 4YXKH 1GGBL 1JPTL 3BRGC 5JZ7D 2F53A 4GKZA 4LRIC 4JN2B 2HKHH 3B9KD 3WMSA 5DHXB 1FLTX 3RVVC 3HNSL 3BRFA 3HE6A 4G8EB 5EU6E 4D9QD 5C70A 5EOTB 1TENA 4LMQE 3T0XA 2VR9A 1IQWH 3D39E 1M7DB 4QT5A 1KIRA 3T08A 5GRXG 4PJGE 3QUYB 3WN5A 4RGNC 2X7LA 3IDGA 1NDMA 3PQYD 3CX5J 5H94A 1DQDH 1GGIL 4I0PC 2JCCE 4PJHA 5GS0H 1OGAA 2R69L 5IVZB 4P9ML 2M1KA 5AG8A 2NZ9C 1F11A 5ALBH 3MOAL 2GUOA 3OL2A 3LKOB 3UC0H 2W9DH 3Q2CA 4UIKH 3MMEA 3RWHA 4NKIH 1KG0A 4GKZB 3GK8H 2MWCA 3AXLA 1DVFD 4PJFB 5FO8A 3SKMB 4OZGA 5LGHH 5DJZB 1YEJL 5IVXA 2FJFA 1LK3L 5I2IB 2NNAA 4N0CC 1UQSB 3MUY1 4N8CL 3C8KA 1HHHB 1A6TB 1EJOL 1GGCH 3PHOA 4PJCE 3QXWA 4PJ7B 1YDPB 3PWLA 1VADB 1T83C 4ZG1A 1XF2A 1AHWC 5IMOB 3M1BA 1XGTB 1M6OB 1DE4A 1OVZA 5I1LB 4J6RH 5I1EL 1NUFA 3OKYA 5CJOL 4KJPD 1K8DB 2IQAB 2V2XB 4XPHL 1FCGA 5GGSB 4HWZA 2EC9T 2EDEA 4M1CD 2I27N 3FZUD 4GW4A 1QFWI 3QJHA 5C6WH 4Z9KB 4BZ2H 5CBEA 3V79C 3C5ZA 1XH3B 5IB3B 1NCCH 4P2RA 2ZCHH 2X4UA 4R96B 4LLQA 3CX5K 4F7TB 3SDDC 3QDJD 1GRWA 5DMKA 1NFKA 5EB9A 1ZOXA 3TN0B 3L9RB 3C5ZC 5TGBA 1R3HA 4ESKA 2BVPB 4H0GA 5HI4C 2FYYA 3EYSH 3W9DB 3DWTA 4WUKL 2DQDH 3FO0H 4RBPK 2DQGL 5E70A 4EI5D 4OCMC 3WD5L 5DC9B 4YHLH 5GISL 3KYMA 4UIMA 3HNTH 4G6JL 2DLFL 4MLSA 3UCRA 5DSCB 4O5LH 4KWUA 1UT9A 4PGDB 1PBYA 5C3TA 5C92A 1QQDB 4XZUA 3ZTJH 3LRHA 3B9KB 5JHDB 3BZDA 1HH6B 4MQ7A 3P9WB 5ERWB 2YC1A 5C2UB 1ZEAL 4LLDA 1KCSL 3AC0A 4O02H 1JZ7A 4HCRA 1XT5A 2VDRH 1JVKA 2J4WL 3BH8A 2GUOB 4MXQD 3VCLB 4X9GA 3V4VH 1KYOJ 2AXGB 1KV3A 4OM1L 4PJDB 1K4DB 3KWWA 5FGCE 5HJ3B 1EO8H 5BZDB 1KJMA 3MODL 4R97C 1A1NB 1FL3A 5FYKL 4LVOC 4GBXD 3VDBA 4WEBH 4BZYA 3CNKA 3MUHL 1TVDA 1ZT4B 2VRAA 4G8IB 3ES6B 3GHEH 4LDEB 1T2QH 1EGJA 1R5IB 5J13C 3TVMD 1KPVA 5F8RC 1BFSA 1MSPA 5JQ6L 3CZJA 3EDEA 3TYFB 5EORL 2VDNH 2AEQH 4KY1H 1UXWB 2R2EA 4KRMB 1E6OH 1YMMD 5ADPH 3DUUB 3HLAB 2YPKB 1FVCB 5E9DB 1EIBA 2ZSWA 3I75B 4ZUWA 2VDKL 2K7QA 4HKXA 1KT2A 5GSVB 4M7JH 3O2DH 4MJIE 5DJAB 2WIMA 5FOJA 4HQQH 5JOPD 3LAFA 1FFRA 5HGAA 1HWGB 3MJ7A 1OM3H 1OTTD 5FA4A 3SKOB 2KH2B 3CFKB 4ZS7L 3RA7H 3TO4B 3P4LA 3ZTNL 2XWBB 1FO0H 3TZVB 4G43B 3BE1L 1KIQB 3MUGA 1FL6A 3WN5C 2P1YA 2P46B 4EI6A 4G9FA 3MGTA 2P8PA 5GSRA 3QT2A 1T3FA 3S36H 3EDJA 4PYGA 1ZVSB 4QRTB 2RR3A 1I7RA 5D1XB 1I9JH 1YMMA 3FO2B 2CKBA 4NC0B 2FR4A 4JFED 3ZT6A 1IKNC 4I18C 1QSVA 3TA3B 3QWRA 3OKKB 1G7JB 1KTLB 4TULH 2V7NA 3FAWA 4PJBA 3G5ZA 1JF5A 4P23C 4ZUVA 2HKFH 3PWUB 2ZG3A 2EKJA 2HH0H 4JLRA 3NIFE 3VXTB 1PG7W 5CP3A 1BP3B 3I6LE 5EU6B 1S7VB 1P4BL 5D71H 5EBLA 4Z77B 4YFLF 4APQC 1YECH 5BRZB 3VGEA 1DDHA 4YHOL 4AEIL 4WI7A 1J8HD 2FECL 1N8ZB 5CD5C 4K8RH 4DAGL 2OL3H 4O51B 3UTSA 4IRJA 1RIVH 2ORBH 4KKCC 1EJ6A 2V2WB 5TE6L 2AK4B 3OKNA 5CAYB 1S9XA 5FYLH 1C5CL 4FTVB 5C0RH 5KSUB 4RGMB 2OLDA 3W2DH 2CD0A 5CEYA 1YYLL 5IBTH 3LHPL 1RFDH 3VI3E 3MV7D 2PF6A 4MAUH 5F7DB 3G9AB 2GITB 4JAMB 4PD4J 2O5ZH 4D8PA 1XR9A 3AM8C 4OQ1A 2XICA 1J87A 3MV9A 3DVGA 2IBGA 1CGTA 1LP9B 4MDIA 4Y5VB 3WV0A 2X4NA 3ES6A 2FB4L 4JFPA 2BXZA 2HP4A 1HH9A 1UJ3A 4GAYB 2AGJH 4XP4H 4JHBA 3H3PL 1GH7A 1CLYH 1EEYB 4UINH 2EKSA 4D0DB 1MFCL 3C6LB 3I2CH 4TNWK 3O9WA 5BO1L 3O8XD 4PRDB 5JIKA 5I1DA 3DETC 5H2BA 5IEHA 4DQOH 4ZUUA 1NAKL 3CGTA 3DX9B 3FOLA 5ACMA 4CNIB 1Q0YH 2O26U 4XH2B 4XB8A 3WUWA 4JPKH 1TIUA 1WEJL 5C9KA 2X9YA 3CIQA 1AC6A 4FQJL 4GRWB 3G6JF 4M61B 3WKML 4Q9RH 2DQEH 4PJ9C 1AO7D 1JFQL 1KNOB 4WUUE 3MV11 2WLZA 3FFCD 4B41A 1FNLA 1I9EA 2FHFA 3WEXB 5CCKH 4BQ8A 5B8CB 1ITCA 1IQWL 1P9MA 5E95B 2ZCLL 3T3MF 4R7NA 1FJ1A 1KPRA 2APWA 1DLFH 1IAII 4JM4L 5C0CE 1A6WH 1FGNH 1NGWA 4RSVA 3N50A 4NO2B 1NGQL 4F58L 3MOAH 4WFED 1Q9LA 5IFAL 1KGCE 2Q8BH 3ZT7A 4UIKL 4AL8H 1WV7T 2ED8A 3GK8L 1NPUA 4TTDC 4PRNA 4HH8A 2KPNA 4ZOCA 1VCAA 4PB9H 2D7MA 1MFDL 3KPOB 2VN4A 1NGPL 5F6IC 2YKLH 4MXQC 2IANE 5FM4A 1E4JA 1FFPA 2J6EL 2A6DA 1RJLA 4FFWD 4WV1C 3DUUA 2YBRB 4F7MA 3S35H 3HI5L 4LLUB 4HGWA 2Q8AH 3MLYH 2DQCH 2IPKB 4M6NL 1G0DA 3CSGA 5LG1A 4ZUVB 1CR9H 3IXAB 4P4RA 2NY0B 3D25A 1S7SA 5TPWH 1R3KA 2W9EH 1S78C 4GRLD 3MFGB 1UH2A 3GSRB 1U3HD 3EYUH 3IDMB 1XF4B 2XT1B 4P23D 3C8KB 3MA7A 4IHOA 4KMLB 4QHKJ 3KHOA 4Y4KB 2OBGA 3GKWL 4M00A 4KAQH 3IETB 4LAQH 3PGDA 4J3TA 1PG7H 2XNAB 3MLZH 1ZLVH 5J6HB 2F58L 3QWOA 2HLAB 4YUEH 5DO2D 1OAKH 3MJ8A 2UVFA 4Z8FH 4HWBA 1JMZA 4G9DB 2YZ8A 5ACZA 2C3VB 2MCPH 3WS3A 2I5YL 2X40A 4F2MA 3WNNA 2EXWC 1I1AB 3GI9H 1MLBA 1HQRA 2CLZB 1I9IH 1C7TA 3DJ9A 4GW5A 4PV9A 3ZL4H 4FZEL 4Q6IA 4ZUSA 25C8H 3L3KA 3WS6C 4JREC 5ISZB 4JRXB 4L29A 4GRMB 5I8EB 4OBSA 3ARDB 4ZO6A 4MZ3A 5LCVH 2E27H 1CXEA 5K59E 4JQXA 1B4RA 5E00B 5A3ID 5B8CA 2BC4A 5HDBF 4P2YA 3UTTA 4P46B 5JIPA 1ETZB 3PWPD 2F5BL 3R0MA 1CD1A 3HLAA 3GSUA 5E8NB 1A3LH 1SY6H 2HA1A 4HFWB 5TDOB 3D0VA 3PWNB 2BSED 3D39D 1IGMH 1VFAA 2J8UF 4FOMA 4OZIA 3VXSB 3BPNB 1T20A 4BSWA 3FQWB 4K7PL 4QNPE 4H8WH 3DVIA 2WWKO 5C0BD 3MV9D 1LK2A 5DD6A 2G60L 5J12B 1MHHB 4QRPA 1G1CA 3STZB 2VXTL 2DWEB 2IADA 2VDNL 5JNYA 3VFRA 4RGND 1UC6A 2XQYK 1Z5LB 5EOCL 3OXSA 3IXAA 1LEGA 3QDAA 4O00A 4QWWC 4LSUH 4HHAB 1YQVH 1NMBH 1IJ9A 2EEBA 2EDOA 1FZJB 1U8QA 5JR1L 1YA5A 2CK2A 2VLKB 4DUVA 4KPHH 3NAAH 1UYWL 3C2AH 3V4UL 4BQCA 3H6JA 3L1OL 2WM0A 2F74A 4NOFA 5D7LB 2N56A 1QR1B 1U8LA 4YDKH 2UY7A 5D7LE 1DJSA 2O5XL 3SE4C 1JRHI 2EDDA 4K94H 4QO1A 3NIDF 2C7UB 5B4MC 5DMIL 2ZKHL 3T0EA 5I1KH 4HC1L 4KTDH 5EBMA 3AS2A 1IT9H 4R7DA 3SDAD 5DK2B 3QZWB 2M2DA 4JREB 3OGOE 5J11B 3WJLC 2VAAB 5GZOC 2DJUA 2P48B 3GSRA 4I3GA 5F21B 2LFGA 3SGEI 4OCXL 2Q1EA 4K07A 4R8WL 4P5TB 3FZUC 2R15A 4YBLB 4JPIA 3D0LA 2NY6B 4YIQA 1JGEA 2DQTH 3IXTA 4GJTB 5C7XH 5JW5A 3DUHA 3WIFB 2F54A 5C0AA 2WK2A 4JRYA 1CD8A 1P1ZA 2HVKA 4NN6C 3L3KB 4N0UB 4PRID 3DRQB 1MRFH 3IDYC 4KDWA 1MCJA 4KMQA 1Q1JH 4MNHA 1JGLH 5MEQA 3GKZA 3TIEA 1FG2A 4XPGH 5TF1L 3GO1H 1FIGL 1UM5L 3QIBA 1TJHH 5FF6B 4NM4L 5EDXA 3CFBB 1AP2A 5D8JL 4YWGL 5JDJA 3RWHB 5H2BB 5L8LB 5FOBA 1INDH 5CEZD 1PY9A 2MPAL 4P0DA 1C5CH 1BZ7B 3VFUA 3NCCB 4HK3J 3QUXB 3W2DL 3BVNA 1I4FA 5CP3H 4BSJA 3RVUC 2PO6B 4KJQC 3RPIA 1UGNA 5CSZB 3P3YA 5FECA 4KK9D 3C8DA 2BY1A 4G6FD 2HVKB 2OS7A 5DZLA 3QPXL 5HHXL 4OCSH 3IJSB 5IJKA 1AKJA 1E4KC 4S0SD 5DI8A 4HMEA 4ELMB 4KHTL 1JYNA 4YE4L 3V0WL 2NY4C 3DIFA 3ARQA 5E6ZA 3NCFB 5HHVH 1KBGL 2CIKA 3RI5K 2H1PH 5GS1B 3GSVA 1CFVL 2ATKA 4XC3H 1J86A 4MJ2A 1JHLH 5DVMA 3B2UD 1ZT7B 4GG8B 1QVOB 3LIZH 2XWBA 1VEMA 4U1SB 1UZ8B 3LKNB 1UB5A 2X5PA 1FJ1B 4BK5A 3OJ2C 5EO1B 4HUVA 2CDFB 1Q9KB 3BYTA 1MH5B 5CMAA 3T65B 1OLLA 4NZRH 5DGRA 1I1YB 2D7TL 1M7XA 3GJFA 2DQUL 4LCCA 4UV7H 3LZFL 2D31A 3MRFB 1A6VL 1WAAF 2W0LA 4NQCD 5IB1B 4WRLA 4PRHB 3NIDE 3H9HB 2VXVL 2WLYA 4PP1D 4LCCC 1KENH 2DL9A 4PJCF 4OGXH 4GMTH 5IQ9B 1S7QB 1WBXB 1U0QA 4PIRF 3GMNB 1AGEB 4HXAH 3OAZK 4RFEA 5GSRB 5IV2A 3TFKD 4YPJA 5SWZA 2N7BA 1JBJA 1FAIH 4PP1C 3S3JA 1VA9A 3QEQD 1KJ2H 3H9YA 4RGNB 3DRTA 5C8JB 3IGAA 3WUWG 1BVKB 4MA1B 4JFEE 4KROB 4A6YH 2DS4A 3ZKNC 4P2RD 2BMKA 3OHXA 4Y4FD 4U7SA 5DDHA 4XMPH 2EEDA 3H3KA 2MQ3A 1WGOA 4YX2L 1BIIB 5JPNA 3ELAT 1J05B 3LKSA 2E7CA 3UBXA 2FBJH 3SKNB 3SDXF 5L8JB 3TNMB 5CBEB 1BBDH 2VR5A 5BRZA 1G6RH 2AERT 4TSBL 2X2YA 3GMOB 5LJYH 3QISA 4WU5B 3WXWL 2F74B 4CKVX 5EZLA 5AEAA 5CD5D 5I8CA 1XIWD 3OAUH 4JN1L 4XXCA 2J4WH 3O6FA 4Y5VC 4I8DA 1A7OL 4NBZB 1E6JH 4WGVB 1AJ7H 2Y5EA 4Y4HA 3CLEH 3ECBB 3IF1B 1CE1L 2VZTA 2G2RA 2AQ2A 2X4PB 2EYSA 3MODH 4PJAB 1VGEL 3OJDB 4MAYB 3PL6C 3MLZL 2Q7YB 4YUEL 2XFXA 1AQKH 1JF1B 4HKJB 5L88H 3WE6A 4C58B 3T0ED 1U42A 1KJMB 3BQUD 3FQUB 4HMDA 2HT3C 4XTRC 3VD7A 2YMXH 4BZ1H 5HDBE 5F3BB 3EZ8A 5TE7H 3RJQB 3S37L 3C9NA 1FH5L 2N1KA 3ULVF 1BFOB 2V5YA 3MLWH 5T1KB 3O2DA 4IMKC 2NXYB 4M61A 2EXYC 1SVCP 1B3JA 3QUMH 2C1OB 1AIFA 3G5YA 4L3CB 3BZFB 2R1XA 3ETBF 2P8MA 3THML 2DWDB 4XNZC 1VFAB 3RGVD 3NFPA 3RBGA 2W9DL 4IOFD 3ARUA 3DUSA 2NMSA 3M1BB 1NAML 3MACL 4Y19D 3ULUL 1RJZB 3VXPB 1QSEB 3F5WA 3HMXA 4FQ2H 5IMKA 3QXTA 1I1FA 3RWDA 3P9MB 5BXFA 3FO9A 3QFDA 3HRZA 4JZJC 1BEYL 5D70H 3OTTA 3UAJC 2DLEA 4BUGA 1YEFL 2D7NA 4UNVA 3KYKH 4G6ML 1DL7L 2HFGH 1P2CB 5ISZA 4G42A 3U0WL 2MKWA 1IGJB 3O6ML 1AE6L 5KN5A 4KI5F 4U33A 3UZQA 4J6RL 5I1EH 4ZNEE 4G9FB 2ITCB 3MNWB 5EO1A 3CC5B 5F7NC 4JG0H 4YHPA 5F89B 2A6IB 3QUMA 5D2NE 3U6RB 5DQDH 1I1YA 5AAWA 2J3SA 4IRJB 5DJDB 2VKWA 4YHIB 2G60H 3B8YA 3CLFH 1NCCL 4D0CB 3QHFL 1CG9A 3WS6A 3KJ6H 1HI6B 3QAZB 1GZPB 2CXKA 1NCBL 3DI2B 3ILPB 3HS0A 1IAIH 2CXGA 2GSGA 1U8IB 3K4AA 3R06A 3B9VA 4UT6H 3LN5B 5F3HA 4WO4C 5E5RB 1RHFA 5AUMA 1L9NA 1VEOA 4Z77A 2IALB 5SWSA 2LTQC 5D72H 5IVOA 4K8RL 4PY7A 2XWJA 2DQGH 2BY0A 1QPXA 5JR1H 3I6KA 3WD5H 1A6TA 3RDTD 3U82B 5DJ6B 3L3JA 3DX7A 4BH8B 4MDJB 3K0WA 2NY2C 3L1OH 3MCG1 3U0TB 1SHMA 4YDLC 3TM6A 5GGUB 1KCUH 3MRQA 3EOTL 4GXUM 3IAQA 5IWLA 1HHKA 1RMFH 1YMMB 1MFAH 1P84J 4GO6B 3QCUH 1PFCA 1TZIB 5IBTL 1ZLWK 3RVTC 3TBWA 5I1KL 2H26A 4ELKB 3BJLA 4YQXH 2H3NA 2ED7A 4M8VA 5EBWB 1R3JA 3ARDC 4KUZL 4O02L 3RVWC 2FB4H 2CRMA 1JV5B 4XWGL 3QEGL 3BP7B 1PVHA 1X5KA 2BNRD 1BD2B 2PW1A 3O41A 4JFQA 4PGJA 1NFDF 1JF6A 5FHBL 4U6VH 1S78D 4GRLC 2MQCA 3WLWC 5C7XL 5EU7E 4RMQA 1ACYH 1TPXB 1T04A 4G3YH 1FG2B 1RZKL 3KLHD 1Q0YL 4QRSA 1FZOA 2C4XA 4F8QA 4F37K 1P53A 3DMMA 4WI8A 1YN6B 1NDGA 5HTSA 4DUWA 5FUCE 3QEUA 4U6YB 1LO2L 4WHYG 3V5HA 4L3EB 1QYGH 5FYKD 4YDVB 3CDGB 2Z92A 4ONHB 3F65A 5EO9B 3CCHB 2Y4SA 4GSDH 3FO9B 4OKVB 2XPGB 4AIOA 2PYFB 4AG4L 1D9KC 4KJWC 3HNSH 2YEZB 2CK0H 4OLUL 1IRAY 4OUOA 5GGTH 2D3VA 3FQWA 1DUZB 4XMLL 5E94B 1CT8A 4OFKA 3T77B 5IF0A 3V6FB 4ISVA 4CVZB 2BSSB 2I9TB 3VG9B 1F00I 1IEBB 4Y88A 5JXAH 2GSIA 2RQ8A 4WNQB 4YBQC 5D96B 2F5AL 4HG4J 4HFWA 3GIVB 3MRIA 4OCSL 5HPOA 3RY6A 4UDUB 2WP3T 2AV7A 3LKPA 5EIQA 2BVTA 1FN4B 4YDVA 3D1MC 4FABH 3VXTA 3OXRA 3BFOA 2IPUG 1NGPH 5LVEA 4PG2A 3VFNB 4E41D 1IC1A 5C71A 1QFWM 4HIEA 5F44A 3RX5A 4XMKH 2J6EH 3RWIA 1KULA 5DD1H 2B4CL 5DJ6A 3QDGA 4MCZA 1G6RB 4I2XE 4K3DL 4MLIA 4WCYH 3NABH 4P3WA 1JI2A 1MFEL 1II4E 4HIIB 3O6KH 2GEEA 4MD4B 2GAZA 4MJID 4AQ1B 3VFRB 1LNUB 2DQCL 3NZHH 2HKFL 4PRPA 3ZMRA 5EUKA 5A16B 5ESVA 2WBJD 5F7LB 4LVHC 5ACZB 4NN7C 4DKAA 1U8MB 3CXHK 3OKOB 1I3VA 3MR9B 4JFXA 4HS8L 1QP1A 3MRLB 1JNNH 4LASH 3AGVA 1YEEH 4B7LA 5GJSH 2UVEA 2XZAH 5BW7C 2JIXD 1YNKL 4NC2B 4OLZH 2JF1A 5C86A 1OAYL 2QLVB 3NCEB 3OQ3B 4X7TA 1Q0XL 1LO0L 3QDMB 1DE4B 5IFHH 1U36A 1NBYA 5FM5O 1P7QA 3F6LA 2YR3A 3L3HB 2LTQB 5JIIA 1OWRM 2RGSA 3INUL 4A2LA 2A73B 4XMPL 2GSGB 2P5EE 2QSTA 4YDIH 3P30H 1CLOH 1TNNA 4UNTA 3NGBC 5KG9A 3HZVA 2IANB 2GJ6B 1F4YL 3FKUS 3GNML 2ZP0T 5IK3B 5E8EA 4EDWH 3GI8L 2I24N 2JELH 4HFUH 4OZIB 3ARTA 1NC4D 1I4FB 3MLTA 3UPRB 4I48A 1RZ8B 3HZMB 4P3CH 1AD9A 4ZXBA 3H7BA 2CMRL 1VFUA 3P4OB 4FXKB 1A7OH 2J5LB 4L9LA 4JPKL 4P4KB 3Q0HA 5I15L 3H9SE 5E4EC 3PF2A 4G9FE 3QWRD 4YFDB 1XGYL 4JFEA 4Q9RL 1V5JA 1CFQB 4CMMB 1G7MB 3HKFA 1MCHA 3V4VL 4Z78A 1R0AL 2Z92B 3Q1SH 1L9MA 2DLHA 3P9MA 2HJFA 5BXFB 4U6HA 4U3HA 4JRXA 4L29B 3Q6FA 1UQSA 1AXSB 2EH7L 3RWIB 3V4PH 3NCJH 4IRJC 1UJ3C 1NLDL 5CZVL 4JM4H 4IRZL 4LEXL 3B5TA 6FABL 3B8SA 1T2QL 3L3IB 3LKQA 4LRNL 4WW1A 5EOCH 1WFUA 3ARFC 5E08L 2PTUA 4WHTB 4XWOC 5CMAB 1CIDA 3SGJA 3UBXI 2CR3A 2XN9D 5EU5A 2E8ZA 2GIYA 4PJDA 3D69B 4O2CA 4QF1B 3ARED 3KLAB 1LEGB 4JEGB 1QBMH 3ULUH 3K4DA 1GL4B 4IRSC 4QHMA 4D9RD 4J4PD 3D0VB 3PWNA 4L8DB 1HN1A 4FXLA 4I0PA 5FYJH 4OIIL 3WN5B 1BEYH 1MCDA 5J1SC 1S7RB 1M1SA 5L7XL 1X5FA 2VL5A 1H3TA 2P4AB 4JRYB 4M6NH 1B0WA 1ZHLA 4X4XA 2AJYH 5F9OL 1UWGL 2YUXA 4PY8J 2A9NH 2YRPA 3F5WB 4WWKB 4N5UA 5KS9A 2CH8A 1BQHB 1D5IH 1OWWA 3FQNA 3GMPB 2W0PA 4H1LG 3OR7A 3RVTD 1CQKA 1AY1L 3HCVB 3MXWL 3MYJA 5GJTL 3BPLC 1YEDA 5I19L 4NQDD 4GKOA 4YJZL 5E2TL 2R2BA 5DXWA 5L9DH 4P3DB 2J8UA 1GAFH 1WFTA 4OZ4B 3FB7A 4XXDB 2J2ZA 4ZNCD 2IPUK 2EICA 4HUWA 5L2KD 4GRMA 3T1FA 4OLYH 3OAYH 2A6IA 3QUMB 4Y4FC 4XPGL 4WI3A 1MCRA 1QKZH 5BCAA 1RUKL 1JGUH 4NM4H 4M5ZL 4PTTA 1ZTXH 4U1NA 4M6OH 4G6AD 4HWZB 4KVNH 3BPOC 4X6DA 3G5ZB 4RDQF 4TOYH 3RX7A 5C0CA 4XNMA 1DQLH 1S7SB 2XN9A 1JTPA 1LO4H 3TIDA 3MNVB 2X4OB 4H25A 3X11A 3WDJA 1IILE 1EFXA 1KEML 2YPLB 4HUNB 4UQ3B 4DGYL 5HYSA 3D87B 2Z8RA 1TTGA 1BPVA 1P6AB 2ZCKL 1LK2B 1VPOH 4X7DC 5FHBH 5HVWA 3GSQA 4ODHL 5KVEL 3F12A 4OT1H 3BD3A 5DJAA 1JHLL 3WFBL 3LKOA 2NYYD 3RGHA 1IGML 3GMMA 2GJ6D 2E7BA 3ARGC 4J3VA 1L6ZA 1QBBA 1RK0B 4WUUB 4E0RA 3PIQA 1IM9A 4YZFE 4Q6IC 2FATL 3V0VA 1D5XB 2R8SH 4PJ5E 4NN6B 2B20A 1F4HA 5GS2D 3QJFA 5E24E 4H25B 4U7KA 3B2VH 1PLGH 5F71A 3EYFB 2HT3D 2ZOKA 4HBCH 1AH1A 1W0VB 3H42H 1YMHA 1T1YB 1B4JL 2F9BT 5F1NA 3RTQC 3I02A 5CSZA 4PV8A 3JVGA 2JJTC 2E8YA 3V6BR 2Y7QA 1ONQB 2UWEF 5D93B 1ZVSA 2R29L 4Y8DC 4FQQA 3KPNB 3VH8G 1IC5L 4MQSB 4OCNC 4D0CA 3FB5B 3W5MA 1UYWH 3C08H 2F5AH 1CTNA 3ILPA 4LHUD 3CFKA 5LBSH 4U1SA 3CDFA 4RAVA 4CADA 1M71B 3NA9H 3VE0B 4RWYH 5HGHA 1ZLVK 1N59A 4WY7L 4Y2DA 1MNUH 2NZ9D 4HAFA 1PW3A 2J8UB 1LGVA 4UBDD 2AK4E 4Y16B 1MEXL 5HDQH 3HE6D 1KFAH 1IC4H 5KZCB 4ODSH 1DBAL 2XG4A 4DOHE 3QI9A 4N0YL 43CAB 1LDPL 5HYJA 1G6RL 4P5KB 4OFYD 2WBJA 3WNOA 3S35L 1MIEH 4KXZI 5E8PA 2AP2A 2EIDA 5KSUA 5JOEA 2Z9TA 1FQ9C 4NQXB 2APTA 1KIQA 3X3GH 1AJ7L 2HN7A 3I84A 3JUYA 1YY9D 1I7ZA 1U8NA 1F2XK 5HGDB 1T5XB 2D4DA 8FABA 1YEEL 1PEZA 3MV9B 2X4SA 2XZAL 3LN4B 1RZIA 4JFFD 4CJ0A 1RZ8A 1UH4A 3GSQB 5FB8A 4PG2C 5L88L 1XR8B 3QHZL 1I9RL 2P8LB 3PABA 2VLLB 5DDHB 2IQ9H 1TITA 4MD0B 3MRDA 2C1PA 4PJFE 1FAKT 1HZHL 2A74A 1W0YT 4YAQA 2VC2L 3ARXA 4XP5L 3ARZA 3Q5YA 3T3ME 1CLOL 1MQKL 3VRJB 3DVGB 4F7PA 1A1OA 5DFVD 5C2BL 5I1AB 4ZPVA 3LQZA 1RVFH 4WVRA 5GGRA 2X4PA 1NH6A 4RIRA 4YHZH 4AZ8A 5C0FB 4JHWH 5T3ZH 4CN4A 2FZ3A 4LCYB 5K9KB 2VJXA 4ZS6D 1A5FH 3WL9A 4FZEH 2VLME 2VLRB 4KKAD 4GG6B 1KBGH 2H32H 2IADB 5FA3B 1KLFA 4NHUB 4XBEH 1X9QA 2WW8A 3PABB 1BHGA 3NMEA 5MENB 3QSKB 2V9TA 3GHBH 4MD0A 1S5IH 3D69A 4O2CB 1CDYA 1DL7H 3SPVA 4I3SH 5I8OH 5HYFA 4Y5XC 2C4FT 3QJHB 1A7NL 4PRNB 4RAVB 4CADB 4JCLA 4OF8A 1VKXA 4BFIB 1R0AH 4X98B 1T1ZA 3KPRE 2ICCA 4LSSL 3KYNA 4YDJB 3BPNC 5DQDL 3R1GL 5F70A 3V4PL 3CUPA 2YA0A 1KCVH 4NO3A 3PWLB 3QXAA 3U0PA 5C8JA 1A6UL 4IRZH 2XTJE 2D0HA 4RDQG 6FABH 3QQNA 2LU4A 3QI9B 43CAA 2VXVH 5IIEA 1JHKH 4HT1L 1V3LA 4JKPH 2UWEA 1XCTA 1T1WA 3X14B 1DQTA 3D25B 4ZOEA 1KEGL 4Q9CA 1JWSA 3QFJD 4M03A 4HXAL 5EZJA 1C5BL 2JK5B 1IGYA 3OR6A 4IEFB 5ADOL 4X9BA 1FAIL 1X5ZA 2BSTA 3TVMC 1RAMA 5E8DH 1EH9A 3OB0H 1WBZA 1MAKA 1NMBL 1AXTL 2ICWA 3VWKC 1KCUL 2XNAA 1UKSA 3LN4A 4P57B 1FIEA 4OZFH 3QCUL 4XNZB 4LPYA 4NZDA 3SY0A 1Q9KA 3TC9A 1MHPH 4DJMA 3HR5B 2CKNA 1G9MH 1CDJA 1ZVHA 3UO1H 1HHJA 2NXZC 4B0MM 1ZT1B 3MFFB 2WUCH 5F7YC 1J0ZA 2BRRL 3WXWH 1J7VR 5EU6A 3O2WL 2HMIC 1T0NB 4JDTL 3OR6B 3V5HB 3LD8C 3EO9H 3EDFA 2CJUH 1A1OB 2RFXA 4LSDA 3M8OH 2VH5L 2KKQA 3AY4C 2J8OA 2VL5B 4X7SL 4KHXL 1GAFL 3PWJB 4LLDB 2FEDC 1IL1A 4NNYA 4X7TB 4M5YH 3MO1A 2DMBA 1FG9C 1U58A 5EULV 3LPGA 5GS3A 3LSOB 4X6DF 5GGTA 3ZKMC 3F62A 3MRJB 4L4VD 4M7KL 4HCRH 1QACA 4I77L 2DMKA 4QKXB 3P0GB 1ZTXL 3FAXA 5GQBA 3RIFK 3IDNA 2P5WA 4URTB 2MMXA 5JLZB 3UAJD 4RQQA 2NPLX 1KB5L 3CSPA 5T5NF 4NQVB 2F15A 3MRPB 1ZHBA 2AVGA 1I1AC 1WZ1H 2VLJE 2Z35B 3CSYA 2X4QA 1UJ3B 4GAYA 4Z7WB 1LO3L 1NAMH 4FQHB 2R56L 1XMWA 4ZTPH 3C5SB 4LDOB 1CDIA 3WL9B 4HS6B 1X5AA 4MA3B 5DFVC 3H9SD 2WNGA 5SWZE 4QRTA 3ULUD 1M7IA 1CGUA 1OY3B 3QXAB 3A0OA 4JZNB 3LMJH 5JXEA 4W6XB 4GW1A 4FZ8H 1KLGB 2EXYD 2VWEE 5IBUG 5CZXC 4G8GA 3K8KA 3BPCB 5FIEA 1A6ZA 3O6FD 2DIAA 3JZ7A 3L5HA 3V0WH 1P4LA 4OCWL 3PWPB 4RWHA 2C9AA 3N9GL 2HRPL 2SEBA 5BMFL 3HUJF 3PHOB 4GMSL 2CDGA 2ATPB 3B2VL 3JV6B 4FXGA 5FA3A 1LNUA 3TH2T 3QO1B 1M7IB 2IQAA 5B3JE 5GRZA 4HULB 3SDDB 1HHGA 3MMEB 3X3FH 5D72L 1KTLA 1F3JA 4LASL 1INQA 2Y07H 1MCPH 3C5ZD 2FHBA 2DQUH 4EVNB 1NMAH 3GMQB 4XBGA 5JMRA 1MREL 1CFNB 3S8WA 1T3FB 1JK8A 5LBSL 5HI3D 3O41B 4JFQB 1T7WA 5FKAA 3RRQA 4AENA 1MFAL 1T6VN 3FRPA 4IIQA 3V0AC 4CN6A 4RWYL 5TDNB 1L7IL 4U1LB 1MNUL 1FFQA 3W9DA 3HI1B 2YK1H 4JFDE 3O3EB 4N0CD 2RAMA 3BH8B 3P4OA 4YQXL 4QCIB 3BGFC 1G7QB 1J1XH 4EUPB 2UY6A 3B5HA 1KB9K 1NJ9A 4PJBE 5INDA 4XVUC 3RL1A 2XZCH 4LLQB 1A64A 1F4YH 3GNMH 3HC3H 4QTHB 2W38A 5CS7A 4X7FC 4LDLB 3GI8H 1J0KA 4HFUL 1LDPH 2JELL 3K8MA 3RKPA 4B5EA 4PG9A 1A7PH 2YN5A 1NKOA 4CN1A 4Y1AD 2EDXA 1ADQL 2DRUA 4GUPA 1L6XA 1N26A 3QUYA 2AJUL 3LDBB 1BBDL 4XC1L 2CRIA 2L0DA 5T5FL 1ZGLP 4WFFD 3A6OA 1JIBA 1NBYB 2W92A 1T0MB 2EE9A 1S5HA 1LO2H 2DJSA 3K4ZA 2VO5A 1SJEA 3KPMB 1TPXC 2DD8H 3VXPA 1JZ4A 4QYOA 4BKLB 2OSLB 4R0LC 3P77B 1YEGH 1I9RH 2BNRE 4MA8H 5C0EB 4CMMA 1BOGA 2YA2A 3SKNA 1UZ6F 4Y19A 3CH1A 2BJMH 2OCFD 3D9AL 1V7MH 3FRUB 4HKBB 5JDSA 4F3FB 1HZHH 4XI5C 1A4KA 2ZZUT 3G08A 3WKNA 1DZBA 5D7JB 1CL7H 2NXZB 1AD9B 5GZND 2V9RA 4K9EH 1SMAA 2BNUB 1ZA3B 3K1KC 5CP7B 2EKSB 4C55A 4D0DA 3ESUF 1ZS8A 1QVOA 3RWJA 1U8KA 4G7YL 2DDQL 2APVA 1MCFA 2J8UE 1XGTA 2LVEA 4OF0A 3RWGB 1KLUA 3THMH 3DX6A 4KK9C 4YHZL 3SE3A 2H2SC 5D1QB 3LS4H 1IVLA 4NKOB 5IESL 4D0BA 2YA1A 4J3SA 5DEZA 4HGWB 4U6YA 5FYJL 1T1WB 4XMKL 3X14A 5E6IB 5JPMA 2WZPD 1S5IL 5AZEH 5DS8B 2X1WL 1FRGH 4NKMB 5GS0C 1HYSD 4OZHE 3RFZC 4GG6F 4DK3A 4NT6A 5FYLD 5A3IC 3ARYA 5DK3A 3H7LA 3CFDB 3KYKL 3ESVF 4AIZB 5C0GA 4UV4H 1EMTL 3R1GH 1MWAA 2NY0C 1ED3A 3E6HA 5MENA 1FZKB 3U9UA 3MPCA 4E41E 3G9VA 1TLKA 5GRUL 4N8VB 3V52L 3VRIB 3RNKB 4L3ED 1E4WL 3MXVH 2DL2A 3QXVA 3CLFL 1ND0A 2DLTA 4X0KA 3HZKA 5JHDA 1JZ5A 1N5YL 5C0DA 3BP5B 4CVWA 1U3JA 5KVDL 2K9UA 3KLHC 2CDEB 4D9LH 1N7MH 1JWMA 4M5ZH 3HMXL 1G6RA 1RU9H 1JGEB 1UWXH 4GUPB 5I1GH 4Y5XA 4MXWH 5ILTH 3T04D 4PLOB 4QOKB 2D03L 4JO1L 4U1NB 4ZOAA 4HEPG 4H5SB 3BRDA 2ICES 2DBJA 4WENB 2YD2A 3STBA 3HNVL 1LO4L 2FJHB 1OAUL 3RWEB 2C3VA 4NP4L 1RZ7H 2QKIA 2XTLA 2A6JA 4KROD 1KJ3H 3TN0D 1KEMH 2BK8A 5JDSB 1NFDA 1EAPA 4F7TA 4G6AC 4IMKA 3C9NB 4NCC2 4YHML 1G84A 4OLEA 3IDJB 3FB8A 1VPOL 2BOBB 4UT9H 5L8KB 1BVKA 3GBNH 5DMGD 4X7SH 4RIRB 1F45A 3K7UA 4Q74A 2CIIA 4CDHA 1CBVH 5I9QB 1I85C 5CIPA 1P4IL 2BC4B 1D5ZB 1WC7A 4GKSB 1LE9A 3RWGA 5F7EL 1ACYL 2AK4A 1YYML 3OKNB 4JN2A 4J8RA 3E1F1 4WU7B 2YUZA 3BD5A 4I77H 3RZCB 3SDXA 3IVKB 5CEYB 4LEXH 1P5VA 2HFTA 4HBCL 1U91A 5FUZH 3UTQB 1WVZA 3F7YB 4IRSA 3K81A 3O3AB 1A14H 1Z6JT 2NR6C 2E6PA 4ONOA 4X98A 3U7AA 4M7LH 4YGAB 1ZA3A 5D93C 2NXYC 1KF9B 1K6QH 5L2JB 3O9WB 2PTTA 4U0QB 3UTZA 1A7QH 5DJDA 4ZSOE 1KB5B 3VRLE 5AYUH 4GAGL 2CK0L 1LP9E 3M17A 4RAHA 4QYOB 2V2XA 2ESVD 1GGTA 1G9NC 3LRGA 2HTLC 2F19L 3HCVA 3V6OA 3U2SA 2F53E 3CDGA 4P2QA 4KDVA 4HDIB 2KBGA 1JNLH 2FSEB 2ZOKB 1WAAA 2XWJB 3DTXA 2PETA 4CVXB 3OJVC 5I2IA 3BAEL 1EGJL 4KUCD 1NC4B 3I02B 5JW4R 4TSAH 5ISZE 5I75C 1F02I 5LGHL 4S2SA 2W91A 5BVJB 3WEXA 1Y18A 4JFHE 5HHNA 1DVFC 1NAMA 1T0PB 4TVPH 5I76B 1G7LA 3BHBB 1ZHKA 4DK6A 3VI3F 1OP9A 3IRPX 3MRHB 5L9DL 3QNYA 3V5DA 3KLAA 4TNWF 1RZGA 3QIBB 2XTJD 1KCRL 5K9OA 2A6JB 5J1TC 3FFDB 3ROLB 1MJUL 1SYVB 3TCXA 3ZYOA 3DNKA 2ICEB 3HG1E 5EFIA 4MJ6A 4ZFFA 3P4MB 1I8KA 3ARSA 1RUAH 4BZ2L 5CEXB 4L4VB 3QFJE 1WIUA 1GHFH 3U83A 2VABB 3PNWB 4MCZB 2ITCA 3PHQA 3B9KA 5FO7A 4HS8H 2RCSL 3EOBB 4P2QD 5C0FA 3LB6C 1ZKAA 1P1ZB 4J7RA 4JZOB 4JY6B 2DIJA 3TBSA 4UB0H 1TXKA 3IF1A 4C57C 3W11C 3MV01 2EZ0C 3QZWA 1R3KB 3ARRA 4QRSB 5IP4A 2XA3A 3RAJH 3BWAB 2NX5B 1QFUL 3KVQA 5CD3B 5L2KE 4YHLL 1RK0A 1IFHH 1DN0B 3DARA 1HK6A 4LCUB 4U1IA 4MD5A 2XZCL 4Y0GA 4OZIE 5JO5B 4MVBC 3D6GA 3BP7A 2MKLC 3BI9X 1T20B 4TQEL 3V2AR 2HLAA 5KVEH 3TCLA 3HC0A 4N8VG 5IBUB 3Q5TA 5D2NB 1OPGH 1ZEAH 5HHPB 3FQXB 3BUTA 5T5FH 2Q7YA 4XHQA 2EE2A 3SCMA 3WO3B 4KZEH 2KZWA 3KPSD 4F7CB 1HQ4B 2YHGA 2YRZA 3SGDI 3ARBB 2QBWA 3SOBL 3ZHKA 4PJ7E 4G8EA 1JPTH 5I15H 1H9VA 3SCMC 4XNMB 3O8XA 4QTIH 4LPTA 3SGKC 5IB4B 3P0VH 2PUQT 3BIBX 1DEDA 3LQZB 4Z0XA 1ADQA 1BVZA 3Q6GL 4OAWA 3C5SA 2P8PB 4PJCA 1QSFB 1XGPB 2FEEL 3HUJA 3MRRB 4CW1A 4MB3A 3DMMD 3OKMB 3TCLB 4HJ0C 3GMRB 1A4JA 2CLRA 3ULUE 1J88A 3C08L 3VXME 4AIZA 1PKOA 4S1QL 3NIGF 2DAVA 5ALBL 1HXMA 4X6FB 4KK6D 1NBVL 1FZKA 5FYJE 3DVNB 3RWFB 3U9UB 4CNIA 2FD6H 2VLRE 3CU1A 3UC0L 2E9JA 4K2UL 5IESH 2VDKH 3DXAB 4NKIL 2DKMA 4IRSB 3N06B 4AIXA 3GIZL 3OAYK 4J3XA 4EI5B 2LU3A 1IC4L 4K9EC 1WBXA 2H32B 2BP3A 4PJ7A 1EXUB 4LHUG 3UTSE 4EUPG 3CFCH 4ZAKD 3JXAA 4PR5A 4MCYB 1ORSA 3L5WB 3KPLA 3ZTNH 2DQJH 4HZLA 4ENED 1H8OA 4FQXB 1D5BA 1S7TB 1QSEE 1CLZL 2AEWA 3PHQB 4MDJA 32C2B 4XNXH 3S98A 4D0BB 1K4CB 1RJCA 4ELME 5CGTA 4QRPE 5KVFH 4FFYL 2CUIA 1A9EA 3DX8A 4OZGB 3BSZL 3V6OC 4KTEH 3HPJA 5TQ0H 2P5WB 4BQBA 4PJ9D 3BT2L 2PN5A 3MV8B 1FYHB 1BZ7A 3VFUB 1E4WH 1FNEA 1G1YA 4LEOB 2AXHA 4FS0A 4YHYC 1NANI 3PGCB 5KANG 3SQOH 2ZUYA 3AFLA 3QWQB 3BESR 2NR6D 1AR2A 3KR3H 4HS3A 4JFDD 1F58H 2NY7H 1YEIH 4I3RL 4AEIH 4X5LA 5CFHA 1N7ML 2X4NB 4MNHB 4X99A 1KIPA 5DHYB 2ESVA 4KJQD 4PRAB 1AKJB 1DQMH 3C09C 2JIXB 2DQDL 2COQA 3VFOA 2G5RA 1U8JB 2IPKA 1JGUL 5I30H 1QSEA 1NDGB 5CLTA 3O8XB 4HF5L 4X6EB 3FMGL 2P5EA 1DANU 3HNTL 2DLFH 3BP5A 3VXOB 2VAAA 4JPVL 1SBSL 4UTAH 4PRHD 4XCYB 2LQRA 5JUEH 4OZIF 1GOGA 1F6LL 4GBXA 3PQYE 3AREC 4HUVB 1DP0A 4FG6C 1AO7A 1FNFA 1KCSH 1UXSB 5FF6A 2R0WH 3HI6H 3IU3A 4OFVA 1NFIB 1DEEB 2AXFB 5F89A 1JPFA 3GBNL 1EFQA 1A7NH 4XAWL 2OK0H 3MRJA 5EOQL 3TZVD 1E27B 2ENSA 1G7PA 5FKPA 3CFBA 1RY7B 3SDXB 3IVKA 1KT2B 4DVBB 5EZJB 1FNSL 5I16B 3PP4L 3B4NA 5ESQB 1DVFB 2UV3A 1BWMA 3CU7A 3TEUA 1X6LA 5GGRB 1DQJA 2OJZL 3LS5H 3HZYA 1D9KB 1KPRB 4YFLI 5AG9A 1XIWB 1A22B 5KAQG 5D1QA 3S97C 4KUCF 4JKLA 3X3FL 1K6QL 5DQ9A 4KY1L 2D7OA 1XGRA 4LCWD 3AXLB 5A2FA 4LMQI 4HJGA 3KPRD 4RISH 2NX5E 2RJMA 1OARL 2AK1H 1WWAX 1LMKA 3UJIL 2FDBP 5CILL 2LAGB 4L9LC 4HQQL 2HN7B 1UCBH 2NY5L 2GJJA 3MNWA 5DJYA 3PXJA 3FT3A 8FABB 1I8IA 2CKBH 1F6AB 2Y06H 4FFWC 3LKQB 1Y18B 4TSAL 2I9LB 5AZ2H 4DKEH 2G2RB 2VQUA 1JL8A 3O2WH 3VXUA 4JFOB 2B4CC 2NY4B 4PRHA 4MMXC 1FZOB 5MEND 5J1AA 3ZHDA 1B90A 2CJUL 1JP5A 5EIIA 3MGOA 2FSEA 3M8OL 4Z0BH 3LN9A 3AMKA 3G6AB 3HI5H 4KH2A 1OD9A 1PKQA 3BO8A 4MWFB 2XG5A 4MJ6B 1WLHA 2OQJA 1SYSB 1BVLB 4JO3H 4KKAC 1YNLL 5KVGL 3MV9E 2ZPKL 5DJCB 4GRWH 3EYOA 1EERB 2VZOA 4WHYH 4NBYB 2DD8L 5IFJA 2Y9RT 1G7QA 1DUZA 5KSAC 4Z7NF 1L0YA 3SO3C 1HILA 4DKFH 1SJEB 1AO7B 3MRGA 4L3AA 4LAQL 4X6BB 2ZJSH 1ODAA 2BJML 1RIVL 2ORBL 2CUMA 3U1SL 1V7ML 1YEHL 1QQDA 5TE6H 3QHZH 2FH8A 4JAMA 1MJ7L 4L4TE 2NY3B 5T3ZE 4PGBA 3O3DA 1YYLH 3U36A 2QTEA 4L4TB 3HAEA 1KIUA 3V0VB 1FYTB 3HG1A 3ARDA 4LVNB 5CUSL 2VC2H 3CZFA 4HUUA 5H37H 4U3XA 5JIHA 4YBQD 3ZE2F 5E1AB 4RNRA 1KPUB 4ALAH 1REIA 4PUBH 3D18B 3QNXA 4KQ3L 4DVRH 3VFWA 1QOKA 2QL1A 4S1RL 5T3ZL 5E6YA 2A83A 1RULL 3QQ3B 4OCWH 1YEJH 1KG0B 1OTSC 1SJVA 1FRGL 1HXMB 4X6FA 1LK3H 2A2QT 1PG7X 1CK0L 2AXJA 2NY2B 2F5BH 3W0WE 2JE8A 4V1DD 5JOPE 2H6PA 3IFNL 4FQXC 4APQB 5D7IA 3KXFD 4QXGH 3AB0B 1J18A 4G42B 5D7LA 5IVZA 1CFTB 4C4KO 1EMTH 4LFHG 2DQEL 3HG1B 4PRIE 4CW1B 4TVPD 3TGXA 1T7ZA 2FL5A 3QIBD 2VDLH 1N6VA 1UXWA 1UG9A 2R2EB 1D9KA 3BP4B 3REVA 3GM0A 4MD4A 1Z0MA 4XPHH 4PR5B 4ZQKA 5C0IB 5IMKB 3T0BA 2NTSP 3T4AB 1ZHLB 3S4SB 3ZDYE 4DEPB 1KCVL 4GLRH 5A2JH 2F54D 4POZD 4R7DB 4PJIB 1QHPA 1F2QA 5HYSG 4Q2ZB 1YY9C 4K3JH 2VQ1A 2F8XC 5TF0A 1M4KA 4HT1H 2Y25A 3DHJA 4D9LL 3IDUA 4EI5A 3TO4C 1PX3A 5DK2A 5IFAH 1RHHB 2IH1B 5EG6C 4W4OA 4B53A 5HGHB 4XVUD 1V7NL 3BN9C 2VAJA 2OYPA 5HHMD 5ADOH 1OW0A 2A1WH 1BQSA 3WXVH 3G6JA 4FTVD 1A4JB 4HUWB 3NAAL 1NKRA 5ELIA 2NY6D 3MCLH 4OD3L 4P99A 1I3RA 2AQ1A 3QA3A 2UUDH 1R5WA 4WW2A 1JTOA 2D7PA 1B9ZA 4GRWF 2V5SA 3NTCH 3GSWA 5I17B 5I1JL 5L0QB 1A7PL 4YXHL 1A3RL 4Y16D 3U4BH 1S9VB 5LAXB 1XGQB 4QRQB 1ZGLB 2BRQA 3P73A 1F3JB 4WW2C 1UM4L 1CLCA 5KVFL 3CD4A 4XC1H 4Y2OA 3GB7B 3GRWL 4XCEA 1JWMB 1Q38A 2J1KA 1NBQA 2P42B 3J7HA 1A1MA 1UVQB 3ARBD 1RJLB 4U7MA 4OCXH 1UZ6E 4P2QE 1WF5A 1EHNA 3IT8D 4NCC1 2VIRA 4HWBH 3FJTA 2GTZB 4MB5A 1YEGL 1XR8A 1MCCA 5F7EH 4CVZA 2K3TA 4KAQL 4FXKA 4L9LB 5JXED 4EBQL 2NY1D 3T2OA 4QCIA 5F7KC 5MERB 4GAFB 1DBBL 3ALPA 4OI9A 1JGLL 1GC1C 3DX9A 3FOLB 4G8GB 5F97E 3B43A 1CGVA 1EV2E 1NEZB 4JFFB 3VD4A 4MB4A 1KJVA 5TDOA 4XZUB 2NY2D 1T66C 1I7ZB 5HGDA 2AEQL 1IGJA 1AXSA 4WI9A 2A0LD 1FVEB 2ZUXA 5D4QA 1RIHL 1NEUA 5BV7H 1I9IL 3EJZD 4TVSa 3WIFA 1HHHA 3B5GA 3BP4A 3REVB 2E6JA 5C0AE 1FGVH 4R9HA 3U48A 1KIPB 3N85H 1T1YA 3MLRL 5D1XA 3GJFB 2V17L 4F7EA 1F4AA 3QH3B 1Q9OB 5GS1C 1YEKL 5DQ9B 3TJHC 1U2HA 5IB1A 4I4WA 5EUOA 3QCVL 2C3HA 3DHMA 5C08E 1HQRB 4XAWH 3OZ9L 4WO4A 2DI9A 2L4OA 4L1HA 4YE4H 3W9EB 1SY6L 4BFIA 2X4UB 3ZDZF 3DSFL 1MAML 1UB6A 4GG8A 3AAZB 1CT8B 3QEHB 4XC3L 1MF2H 3SBWA 1FE8H 4XVSL 4ZD3L 5FDWA 1VFMA 3SJVE 3ZE0F 5I1IL 1XGUB 1N5AB 4NHCL 3FTGB 1AGDB 2ZSWB 4G7VL 3O2VL 2HRPH 3ME0A 3QNXB 2IMNA 1S7TA 5I76A 4GMSH 3T0EE 3MXVL 1GJIA 3NCMA 3T3PE 3D2UD 4FQIL 2Y23A 3BKML 1VERA 1L0XA 3RVXD 2VN7A 3DO7A 1MHEA 2B7DT 1I85A 4HWEL 5BS0D 2GT9B 4QHUB 3VXMB 4JZJA 3MUGB 4HWNA 1OGAE 4XP9L 3DGGA 4D2NA 2EDYA 4DAGH 1K8IA 4PJIF 4CAGA 4M7ZB 3UJIH 4HPOH 4UILH 1TETH 3TVMB 1DSFH 4P23B 3JBG7 3V4UH 3JV5A 4YO0B 3ULSB 4FXGB 3PV6A 1IC7H 3V8CA 1NUGA 2BFVL 2V9QA 1VGKB 4GXVL 3VCLA 1U6AH 4WTWA 4I5BB 3QUXD 1CTOA 1A9EB 4WI6A 4WFHD 4XNYH 2ESVB 3NIGE 4G80B 1IGYB 3QDHA 2D9CA 4U1HB 1J1XL 1F42A 2VLKA 1WT5C 3FQUA 3VXMA 4OKVA 1JHTA 2Z4QB 4Z0BL 2P5EB 4JDVB 5DEGB 5F1IA 4Q6YA 1RURH 4RFEB 1AGCA 5HGBA 2X4OA 1ZLSH 3WIIL 1CLYL 5IVXF 5DD3L 1OQOA 1OW0C 1UWEH 3EYFA 4IJ3B 2C4FU 4FFZH 1ADQH 5D1ZC 4KZEL 4JN1H 5HHOE 1LE5B 1NAKH 3W39A 4LU5H 5CBAA 5HHPA 1VACA 4X6DB 1R6VA 1WEJH 1GSMA 1S9YB 1FNAA 5DZNA 4QRRE 1CE1H 4X6DE 3EOAA 3RL1B 4ZUUB 1A14L 2AV7B 2Z91B 1E27A 1MWAH 2X4TA 4TUOB 4X8XA 2X1PA 4LHJB 4XP6H 2AW2A 1EHAA 1INDL 5DJCA 3BW9A 4H1LB 1C12B 3QPQC 5L0QC 1EHXA 3AU1A 3PG2A 5AYUL 3ARFB 3RQ3A 3WIHA 4DN4L 4DEPC 5B21A 3L5XL 1U58B 4NJ9L 4D3CL 1ETZA 1JPSL 2EYSB 4QEGA 4R90H 1S5HB 4X4XB 5DRZA 3VG0H 5B38G 3TH3T 1A0QL 2Q8BL 4RGNE 5KS9B 4MJIB 4ALAL 5IG7B 3U7YH 4ZTOL 1C1EH 1TVBB 2WQ8A 4JKMA 3MC0A 4GH7B 3LS4L 3V7MA 1BQUA 3LEXA 4PJCB 3TN0A 4P48A 1M71A 3FHAA 4F57H 1MUJA 3RBSA 3C60D 1FPTL 1QG3A 5D7LD 4MX7B 3EOYG 2X70B 4JCMA 1KCRH 4V2BA 3IGAB 1TZIA 4OV6F 5TQ0L 5FYKE 2G75A 3AB0C 5EU5B 1FL5A 4HIXL 4KRPD 4ELKA 3MYJB 2LE9A 1J5OL 5I66A 2V5TA 4MAYC 3S5LB 1X5XA 3QHFH 4XXCC 5HHQB 1H0DA 2YPVL 4E42B 4EZMA 1W72A 4FQCL 3VH8A 4LVOB 2WUBL 2A77L 5T3XD 5IV2B 4MAYD 4GW5B 2FL5B 1KENL 3SDCB 3BKJL 4R0LB 5I8EA 4J4PA 4Z8FL 4HS3B 4RFOL 3RUGF 3QA3B 3RAJL 3FQXA 1R24B 4LHUA 5F7UA 1IGIH 1RV6X 2P8LA 1JPFB 3W11D 2EDNA 4KTYA 3S37X 4IMLA 5CJ8A 4P2CG 3CH1B 1WQVT 1AI1L 3NTCL 5I1JH 5MERA 3ZL4L 2MNUA 5CEZE 3UTQA 1A4KB 3G08B 3WHXA 1EX0A 4HEME 1T83A 1U8NB 5TE4L 3MV8A 4S1DD 1UM4H 2JB6A 4DZBA 5C6PB 3EFFA 2VTFA 4ODTH 5DHVH 5KSAD 1KJ3L 1DLHB 3WNMA 2PO6C 1QSFA 2EYRA 4YHKL 5JORB 1CF8L 5I75B 1TMCB 1BQHG 2HTLD 2R39A 4YHMH 4MMZC 4KK5D 4W6WB 3UTTE 1CI5A 1YN7A 3DYMA 4J3OC 3SOBH 4HS6A 2YD8A 2FLBT 3BIAX 3KNBA 2IFFH 1FNSH 1U8PB 5DHYA 5BOPA 3RHWF 4X6CF 1BGXL 5BVPH 3Q3GA 1S9XB 2LAAA 3BZ4A 4HUXA 4PJFA 3VWJD 2Z31A 3LY6A 3VMPA 1EAPB 4HIHA 3E6FA 4N90D 4P2OA 4NZUL 1I7TB 2R1XB 3A6BH 2Q6WA 1C12A 4BSWB 1T1ZB 3UROR 4I0CC 3EFDH 3QUML 4PRPE 4ZNEA 4HLZH 1MCKA 3T77A 5HYSB 3TESA 2QHLA 3G04A 4PRPB 4N1EA 3C60B 1G7LB 3CVHH 2NW3A 1Z9MA 5B3NA 4RISL 4W68A 5GGSA 3S34L 2DM2A 3N85L