4ALAC

Structure of dengue virus diii in complex with fab 2h12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
92
structure length
78
Chain Sequence
AMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTRLITANPVVTKKEEPVNIEAEPPFGNIVIGIKALKINW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus 3
molecule tags Immune system
total genus 10
structure length 78
sequence length 92
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4alaC00
5IZ7A 4L5FE 5AAWC 2P5PA 3WE1A 5IREA 1UZGA 2V33A 2HG0A 3VTTA 3J2PA 4GSXA 4FFYA 5JHLA 4UTCA 1URZA 4X42A 1TG8A 4BZ2A 3UYPB 1SVBA 2R69A 1RERA 3P54A 1OANA 1OK8A 5GZNA 4FFZA 3J27A 1OKEA 2JSFA 4GT0A 4UT6A 1Z66A 3C5XA 3N41F 3C6EA 2R29A 4BZ1A 1S6NA 3N40F 2ALAA 3N42F 2JV6A 5H37A 5JHMA 5GZOA 5AAMC 5LBVA 4AM0Q 4AL8C 5LCVA 2I69A 3UZQB 4UTBA 2H0PA 5KVFE 3UZEC 4FG0A 4UTAA 3N44F 2GG1A 5LBSA 3MUUA 1ZTXE 5B1CA 1PJWA 3UZVA 3IRCA 2JQMA 3UAJA 4ALAC 1Z3RA 5KVDE 4UT9A 3G7TA 3N43F 5KVGE 5KVEE
chains in the Genus database with same CATH superfamily
5EOTB 2ZXDA 5FYKL 4Q14A 3WS3B 5B4MC 4HQQL 5HGBA 5AOZA 4OF0A 3MUHL 2XPZA 1QI4A 2WJ5A 5DMIL 1R24A 1FCCA 2VLJB 2QQLH 2B1OA 4IIQB 4NENB 1JTTA 3QXAA 5EN2B 3VXNA 4A6YL 4H40A 4DP7X 3BXNB 4F8OA 5HHVH 5MENA 4HIIA 3IXAA 4MDJB 4UINL 1DR9A 4JDZA 4B6ZA 3N0AA 4OKVA 2Z31D 2A6DA 3MXVL 4P4KB 2J12B 4KK6D 4FI8A 4QLWA 3LNHA 5EU7E 2ZUQC 4G7YH 4X4XB 4A7QA 5DHVB 1OCZB 2WLYA 1B6DA 1W2KT 2FNBA 2ZCKH 5SV3A 2UUDK 3E6HB 2CKBH 2VL5A 2XX1A 2PF6A 2AEPH 2HFGH 4PWJA 2Q3AA 5FGCB 3W2DH 1FFOA 4K9EH 3UZQA 1J87A 1FUNA 3WO3B 2Y2TA 4LLAA 4RWYL 4Y1AD 1HHGB 3MJ7B 4K8RL 3CBKB 4C56D 2X0WA 3FO1B 4FQCL 4GIOA 3IMTA 2XV2A 4L0YA 3RVVD 2F5BL 4Q9QH 1SM3L 1BYOA 2MHAA 4H8WL 5F7DA 1ZAGA 3S88L 1EV2E 5KYYB 3SB3A 1HILA 1EO5A 1NMBL 3BYYA 4M5SA 4PJ9D 4J3WA 3KYMB 1E4JA 3IB4A 4WWPA 2H3NA 2TAAA 3QRLA 4M1GH 3B9KD 1SHSA 1PY9A 4NC2B 3EZ8A 4HBCH 4QTIH 5EF1A 2PYFA 4PVBA 4KNUA 1OP9A 3QJZA 4M6NH 3NIDB 5AOMA 2VSMB 1HK6A 4G7QB 2AQPA 1IV8A 2V17H 3RUGB 5L7XH 1XZWA 4LSSL 1F58H 1E4KA 3AXIA 3VFOB 3UBXG 1T21A 1J12A 3DRTA 1DDHB 2EEAA 3FSOA 3RJQB 4JFEB 4JQXA 4BHUA 4PB0H 3M1CA 4YDJA 5FA3A 2OMXA 3G5VB 4EVNB 1SJEA 4L23A 3QNXB 4ORGB 5I8KH 1ZTXE 1F1DA 4KH2A 4BFKA 2XA8L 4JGMA 4F7MA 4ODHL 4YHNA 1X5LA 5E0FA 3ILDA 3KCWA 3KYNA 3MHZA 4DGVL 4EDXB 1J0JA 4NQSA 5DEFB 5CJXC 2YUWA 3KWTA 5DRWB 5E9NA 4PRIA 2WXKA 4L8SB 1KLGA 4Y4HB 4P5TD 1AD0B 4HJTA 2VISA 2JMRA 2YWYA 3SKUD 4KTEH 4G11A 4QXTA 5KBDA 4I0PA 4JRYA 4IOFC 4Q97A 2W95A 3VFGL 3MBWB 4Y8DC 2Q8BH 5DEGA 4AV0A 3TU6A 2AEQL 1J1PL 1MEXL 2EDDA 2IPTL 2NNFA 1HT6A 3LKSB 5CP3A 5EU6A 3CQQA 1IAOA 1FORL 3FS9A 2Z91B 3QRBA 1QHQA 3IFPB 4JO5A 5GJSH 5HDQH 5I1DA 1XH0A 3VXRB 3PWPD 2P26A 4BQBA 1URZA 4OF5A 4TNVK 3EDDA 3ZR5A 4OGAC 3V4PH 4ETQB 4W1TA 1J1OL 4PGDA 2GTWA 1YHPA 4GH7B 3TO4A 3TF7C 3C6LA 1P4UA 3BAKA 2VN5A 3BKJL 3O9WA 1FIEA 3D0AA 5CR8A 4GRLA 2F19L 4TSBL 3LB6D 1ITCA 3MNZB 2FNWA 2R29H 4FHKA 2V2XB 3WXWL 4Z3IA 1YEGH 3X14B 2BWDA 1P9MA 4XP4H 3SHSA 4A2DA 1NOFA 4MXVF 4G6KH 3PS6A 3ARRA 3WS6C 1RIUL 2H41A 1Z5LB 3KR3H 2A38A 2WSDA 3R19A 3BAEH 1LO2H 1OPGH 3ASWA 4MAZA 4NUGH 5E03A 3SKJL 3U36A 4QAMB 3VYOA 3PUUA 4Y2OA 4NFBA 5D93C 4FQJL 4YVNA 4ZAKB 1JYWA 1GTFA 3PNWB 3K6NA 1ZLVH 4AQ8A 1AO7B 4M8QA 1I9IL 3RDTD 4GXUM 4PJDF 4EEEA 2KDYA 1IBDA 2K1MA 3WY3A 1UOVA 2RR3A 1ETJA 3DURB 3L2NA 3HZMA 2UY7B 4G7VL 4WFEE 3MRHB 3CN2A 3MLXL 5T5FA 4FTVE 5HGHA 4OZGF 4NQDA 2YXWA 4Q2ZA 3GMLA 4Q52A 2F54A 1M7DB 4FA6A 1A9VA 4CJ0A 3PP4H 3NP4A 3GNML 3MLYL 3GRBA 4XH2B 4Z7WF 4ZW5A 3T3MB 2VXTL 3TX4A 2XG4A 2BDNH 5INDA 5FWRA 4MRCA 3QZNA 2ZUXA 2OZNA 4RESB 1GH7A 4XNYL 3BEVB 4H26A 5JIQA 2Q0ZX 4WW2B 3GSXA 3K2MC 5A2CA 3IJHB 5LGKA 2XBDA 3PF2A 2ZWYA 4BK5A 2O5ZH 4JRFA 2L3BA 4KXAA 1KTLB 3APNA 1U92B 2CLZA 4P46C 4A66A 1J1XH 3LJ3A 2X28A 4QRBA 3MVSA 4G6JH 4M7LL 2ZXQA 1NGPL 1INQA 1TZ8A 1ZT7A 2IC2A 5LBSL 2FWUA 2W9EL 4FQ1L 1IKNA 5EOQL 3L48A 1N6UA 1BW8A 2HT4D 1TT6A 3TJPA 1DQML 4GRWE 3CFUA 4FX5A 3EG9B 3NFPB 2EVJA 1A9EB 1BVNP 4M6OL 3NCYP 1XGPB 1CL7L 1OLZA 4LPTA 4GSXA 1FZKB 3QXVA 3I6SA 4X6EA 5EUOE 3MGOB 5HHOD 4UB0L 2XUWA 1JGLL 3G6AA 3DJ9A 3LZPA 5EU5A 4ZX3A 1EAOA 2UYLA 4W70A 1AGEB 2CZNA 5CU5A 5T3ZE 3UYPB 3SOTA 4FAAB 3LZFH 5DRXA 4CU8A 3MNWB 4PUBL 4FXTA 4AH2A 2YBRB 3S5ZA 4RSVA 3MOQA 5EORH 4H4NA 2XG5A 1QFHA 4E36A 2LR4A 1DANT 4OV5A 1IARB 4X83A 4WHYH 5KYUB 1DQLH 3KLLA 4KX7A 1HCYA 4JVUA 2MPVA 4OIFA 2MPAH 3L08A 2CXKA 4YDKH 1BFSA 1TJIH 1U3JA 3IVKB 2B7DT 4Z7QB 3EFDH 4U1GB 1PZCA 4AQEB 1GPOL 5I15H 3CZSA 4LCIL 3FZUD 4DKAA 1EQWA 1KCLA 1OCCB 3AS3A 3FQWA 4RGNE 5LNDA 2FZ3B 1OAUL 3CV5A 4P2OA 4XN1A 3RWEA 3SKMA 4F2MA 5MERA 1X9QA 4OV6F 4XB7A 3LZLA 4PLKC 3CDYA 5E2VL 3RWFB 3T0EB 2G3XA 3AZUA 2FWLB 3O3AB 2JJTA 3WIHL 3H2PA 4PAZA 3PV6B 2X2JA 1QNZL 2BIIA 2H8PB 3MLRL 1I1AC 1I7RA 2FO4A 2FGZA 4AIOA 4Y19E 4DGUA 4PRPD 3GXMA 1WAPA 4Z78A 4AI7A 5GS0L 3UZEC 2CIIA 3W37A 3HUJB 1DVFC 2J88L 3H3BC 1TMQA 5ESAA 2UWEE 5K39A 4PJ7E 4JFHE 3IPBA 2DAVA 3FTZA 4BKLB 4ANXA 3CFDA 3PAUA 1B0GB 3PFQA 1ZJAA 4JFUA 2E4FA 2GG1A 2ICWJ 4MNGA 4RETB 4TSCH 4LASL 5DI8A 4KQ4H 4TYUA 2XKNB 4QKXB 2JCCE 1NJ9B 5AG8A 2FSEB 3MV8B 4JQIL 2GFBA 1JUFA 4DP2X 4Z76B 1YJDC 1NBCA 3CFKB 1LO3L 5TPWH 2CHZA 5D72L 5E9DD 1ZV5A 2KQMA 5C2UB 1ZLUK 5B1JA 1QI3A 1Z9OA 3BO8B 1QLRA 2FECI 4HVBA 4JM4H 4CAGA 1KIPB 5EU3A 3PG2A 4JO4L 4AM0A 4Z8FL 3Q1SH 3RAJH 3CDCA 3LMJH 2EH7L 3MRLB 1BVLB 2N7SA 2WUCH 4XHQA 3VFMB 2CJUH 4KKQA 4MQ7A 1A4JB 4PY7B 5D7IE 4U1SA 4XHJC 1A22B 4ZUUB 4LVOC 2XN9A 1LEGA 2C3WA 1KFGA 3WTSA 3WFDL 3KVQA 3W9EA 1FVEA 1MG2C 1QPPA 2GYSA 3JWNC 4XCCH 3TN0D 3MRIB 2YXVA 4A7UA 4F8PA 1DJIA 4L1DA 4KMQA 1RUQH 2CUIA 3II3A 2FUTA 1G9NH 3H9SA 1WWCA 3MDJA 2WO4A 1W80A 1QMUA 1RK0B 5MEPB 3D09A 1L0QA 1VACA 4FJYA 2OSLA 1SY6L 3FSWA 3CN3A 3G6JF 1MVUB 4EUPB 4IJ3B 1TXKA 4GO6B 4XMLL 5EA0H 2BP5M 3D69A 5E8DH 3FU6A 5EF2A 4XO3A 5IVZA 4E9XA 1IZKA 2VMCA 3PLYA 4YFLI 3LPPA 5FA4A 3FTUA 3RWDB 4EN3A 1EFXB 2JB6B 1BOGB 1X7QB 3SE4A 1QWNA 1GJUA 1SEQL 4CU6A 3UAJD 1JCKA 1YEJL 4DP9X 4GW4A 1I8MB 1BX2B 2AZUA 2XQBH 4X7TB 4H5SB 3BSZL 4XPFH 2BP8B 4IOIB 4ZMVA 1HL4A 3MLPA 5PCYA 2F2HA 1SF5A 5HDBE 4O5LH 1Q0YH 1Y1DA 3SDDD 1A02N 4FQHB 4N2HA 3UTSD 4D0BB 5L2JA 4PRAB 2LLGA 1LP9A 3OKMB 5IBTH 3SYPA 3V0HA 1QVOA 1E4KC 2ZUTA 4YHYC 3OAUL 5K1JA 5DD0L 4LSRH 1BIIB 4KJQC 4HIPA 4QO1B 4HSCX 1KMGA 1F4WH 3RNQB 4JQXC 5DJYA 4BUQA 3KM2A 3ZTJH 3UERA 2ZWSA 1PG7L 2BSRA 4FYTA 5FIEA 4J7RA 4L4TE 5J13C 3TA3A 3IBOA 4YDVA 1TPXC 4M4RA 4PJAE 1PG7W 2RIKA 4PJ5B 3VG0L 4PJCA 3VFTB 2KZKA 2OV0A 5HXMA 2YUVA 3IAGC 3MXWL 4M29A 4LPCA 1H8LA 1MJ8H 4TKWA 1OIOA 2VC2L 3HZYB 3TIEA 5T1LD 1ZLWK 4XC1L 3ULVC 5CZXC 4NJ9L 1JV2A 2WBWB 4Y5XA 3P3YA 1EO8H 3T3PF 4HT1L 4LE8A 4BFNA 5EZLB 3RY6A 2KS0A 1JVLA 3IDNA 3KPQA 3MLZL 3ZMEA 1E9PB 2EE6A 4FI6A 4I0PC 2HN7B 4HFUH 2A1WH 3NFNB 3VFNB 1N4XH 3CFIC 1Q1JH 1FYTD 4OSUL 2D7QA 1P6FA 1MQKL 3KPSD 4HKJB 4N8VA 4ZSOA 4JG1L 3BH8A 4ANWA 2FLMA 5IMOA 3ABMB 4AT6B 3U9PL 1QLEH 5DLMH 2VDPH 4PMFA 4XX1E 4QR7A 3BT2H 1OQXA 1QG3A 4UTAH 2MWCA 4PRNA 2WWKT 2NX5E 2VZOA 5HJDA 2MFNA 2O6EA 2DQJH 2GVYA 2X4NA 1KJMB 5HYJA 4IOSD 2BFVH 2EEFA 1IC7H 3W5NA 3TO4C 2QTVA 3HC4H 1DUYB 3GSQA 5AAMA 3ZGHA 1PG7X 4RQQB 3N44B 3C6LC 3O9WC 2OSXA 1DZ0A 5IW6B 4GRLC 3O11A 1A4KB 1TZIA 4WWKB 4HUVB 1VFBA 1XH3B 3L3JB 5E23A 4U1KB 1KJ2A 2PYED 3LYRA 2BINA 2P28B 4ZTPH 1DO5A 1Z6JT 3D9AH 5F7EL 1P9MC 4APQB 2WQXA 4QHMA 3X3FL 3QQNA 3Q8AA 4ZW6A 1HKLH 1A1NB 2R56L 3VI4E 4AUUA 3C8KB 4V1DB 4FQ2L 1MCEA 2D3JA 1P53A 1RU9L 3WELA 5KVFE 4IEFB 3NZ8B 2W9DL 5DZVA 4U0RC 4AQ8C 4QRRE 2Y36L 4PRHB 2QR0A 3I75B 3NT0A 2NY1C 5EH1A 5C0BB 4OLUL 3ZDYE 2WCGA 5T5NF 3ETTA 4ZX5A 3R8BB 5IMMB 3KDPB 2GC7C 3T1FA 3CC5A 3LKRA 4HOXA 5A2JH 3BKCL 2NRDA 3K3QA 1MFBH 4NUPA 4LLVB 5KOMC 4DZ8A 1YYLL 3N55A 1ZLSH 3TZVA 2B4CC 5FX3A 4MXWH 4U1MB 4U6HB 3FMGH 5TDNA 2IAMB 4UT7L 2AXGB 1FL3B 5D7JB 3MNVA 4PU2A 1GMEA 3FSVA 4PJDB 3GMQB 4UDUA 4WV1A 4ZNEA 3N43F 4DESA 1XH2A 4D0DB 3HE6D 6FABL 4BK5C 3DJZA 4FNRA 4YHKH 5BZXA 1KTRL 1RP8A 4OZGB 1VCBC 3F12B 4GG6E 1NCJA 2FLBT 1ZHLB 2OTWB 1PAMA 3A67H 3BUBA 4RFEB 2QGBA 4BSJA 2EUXA 3ULVL 3SDCA 2AK4A 4OGZA 5ELIA 2QPUA 2V33A 1OGSA 3QR0A 4Z7WB 3KXFA 1U8HA 2YGPA 1HZKA 1IFHL 4N2IA 3JVGA 1KGCD 1IKNC 1T7ZA 2ZCZA 4P23B 2C9VA 1WUNT 3IFNL 1VADB 4AW4A 4KKRA 4LKCA 3OM3B 3LQAC 3Q43A 5E5MA 4ZQKB 3RVTD 2AV7A 1SFDA 3SGEH 2E9WA 2WVSA 2CE6A 4OGYH 2UXVA 1INDH 3KGTA 2R2BA 4KO7A 3MA9L 2OXGB 4OZFA 3KLAA 4X4YA 1OAQL 1GGUA 3A24A 5FS5A 1A1OB 5HVGB 3DVGB 5BQ7B 3LXCA 4ZUVB 4AVJA 3CN4A 4OUUB 3CDZB 1YC8A 3E8VA 3TYFB 4LSPH 4RISH 4UM8B 4JRXE 3ZRCC 5ID0A 1ZVSA 3T8XB 3CPUA 3H8NA 3D50A 4M93C 1SNRA 3ALPA 3NSDA 3OKDB 2B9BA 1BJ8A 4Z7OB 3VXME 3AMKA 2UX7A 3U1SL 2C9XA 4WUUA 3P0GB 4GAGL 2XJLA 4JHZA 2IBBA 2FO1A 5KVGL 2DM3A 2MH4A 1XB8A 3EH4B 4OLYL 4N8UA 2OK0L 3C5JB 4HS3A 3MREB 2IADA 1OGAE 3L5JA 5DQJA 2VOTA 1X44A 3CH1A 1NCOA 5GGQL 4JKLA 1EDQA 3RI5K 5HDLA 2ZUUA 1UJTA 5LDUA 1JPGB 1M7UA 2WCSA 4P2OC 2F6AA 1QBAA 1ZVNA 4XGZB 2VT0A 4PJEB 4AENB 5D1XE 5MHSD 2JJTC 3L5WA 5KSBE 4OTXH 2ZF8A 4HIXL 4I18B 4DPBX 5IB5A 1H3GA 4QEGA 1U58A 3OAZK 3JTSB 3VU2A 1VESA 4F93B 4NNPL 2XFGB 4XP5L 4DKFL 3ETBJ 4DUWA 5SWQA 2B4CL 3GSOB 4IRZA 3C6SB 1G7MB 1LVEA 3HRZA 3K1DA 4MZ3A 4QT5A 3M1BA 1CFNB 4YZFF 4Y2LA 5C9KA 1IQDB 3LDBC 4ZK8A 5ACMA 6CGTA 3HVNA 4HK0B 1AANA 3H55A 5DURD 2XPGB 5ACZA 3PWLB 1CWVA 1K6QH 2GITA 1BA9A 5IZ7A 2XZAH 3QUXA 3MR9A 4I3RL 4LLQB 4UNTA 4KTGA 5E24E 4K3JL 3TXAA 1NCCH 2GW5A 4LO9A 3CVHH 2AAAA 5FGRA 1HKFA 1IBHA 5F3HA 3ZKXB 4PLJD 3BC9A 5D9SA 2NY5C 3U7WL 3S7GA 5J1AB 1LDPL 1XZ0A 1CFQB 1JHTA 5JO5B 1M2VA 1Z5YD 3VTTA 3QHZL 1P5UA 5FKPA 2CHDA 3PHQA 3MZGB 4JO2L 5B1JC 1UA3A 4Q9CA 3CPLA 3GMMB 4E9WA 1AY1H 2E76C 4G8IB 1F1AA 1H6EA 3VM5A 2GBUA 1XBRA 1JN6A 1XCQB 3VI3F 4R9HA 3LQAL 2YD7A 1Y6KR 1GYWA 1D5MA 1BD2D 1QBLL 3GJFA 1G1OA 1U8IA 3K80A 3SZ6A 1U8CA 5CEZE 3VW3H 2MKLC 2FEJA 3HG0A 4DT2A 4FXGA 4R5XA 1WTLA 2A9BA 4XX1G 3WXVH 1OE3A 2VH5H 1YEIL 1C7SA 1NCIA 5J7CC 1FVDA 2HKAA 3EDFA 3QEQA 1UACL 3CLEL 3WAJA 1HH6B 1VZHA 2BNRD 5EEWA 3D39D 3FU0A 2NY3C 4J6RL 3ARGB 3MRRB 1QFOA 1ZLDA 3WSQH 3ESPA 4JPKL 4KRPC 2IXQA 1MHHA 4UDTA 3QIUB 5JUEL 2GJZA 2WZPD 2AITA 1OE2A 1LDSA 2V5YA 2IANA 1FE8H 1S78D 4JFPA 4QOKA 4U3HA 2XVGA 3SCMD 3QJVB 5LN8A 1T83A 4S1DC 4AITA 3MJGX 5DZJA 4F58L 1J9QA 4EN3C 3MCKB 3DYPA 1I8AA 3ULUH 4NPYB 3MV7A 3SE4C 5KYWA 4OGQC 3OLDA 2BSSB 4YBQD 2BH0A 3L1EA 2ZXWB 5DDHB 1P4LB 3MRJA 3R8QA 3E2HB 1N5AA 3RGVD 3T2NH 2XVLA 1YNLH 4XVJH 4XNUH 2L7QA 5D1QE 3ESNA 4J12A 4TVPE 4ZS7H 3O0RL 3B2UC 4PJAA 1NWPA 4BE5A 2ICEB 4N22A 4JFTA 1UZ6F 1OOWA 3V5KB 3T4YB 4U6VH 3DBXB 3O2VL 1E6JH 1M3IA 3QWOB 4XBPA 3NIGE 3KVPA 3J7HA 5DMGD 2WZAA 2VC2B 1DVYA 4MAUL 5D5MA 1VPOL 2YEZB 4JKPL 4HJUA 1ZT1B 2ZCLL 4M1CD 4N0CC 3BIKA 4E9QA 2OMTA 5I6XC 3WLBB 2ENJA 3VYNA 5FYJD 3EJZD 2EIMB 1OZTG 1KSRA 4ACTA 3PQYE 3QCUH 3JSSA 4FD0A 5KVEH 5IMLA 1BHGA 3UG5A 4ERSL 5HI5C 2DYPB 1AMYA 1JZ8A 3VXUD 3TA3C 3U2SB 2PPEA 2DWYA 3P0YH 3ZK0A 4I2XE 5H35B 1JXDA 3BVWA 4LVOB 3J2PA 2NY5L 3D5OF 4NZRH 4UQBA 1AHKA 5ITBH 5IUSA 3LN9A 3OAYH 4WZ9A 4YE4L 4Y5XC 5MENB 4HIIB 3AGWA 3R0NA 2YPLB 1L6PA 3O45B 3RY6C 4OLWL 3L9RB 3CCHB 1S7XB 2PCFA 3O81A 1BVZA 4P4RB 1AGFA 2CIKA 1EZLA 3HG1A 4DGYL 1ZS8B 3UCRA 2HH0H 2HKHL 3OR7A 1CXIA 1A6AB 2YRZA 5F7HA 4EQ3A 4G59C 2B2XH 3E8UL 3CIAA 2DQUL 1OP3K 4RMUA 2Y07H 3O3EB 3RBSA 2EABA 4GG8B 1M71A 1TVBA 3JTTA 3T3PB 3LHPH 1JXKA 3TNMA 1GGCL 4E0RB 3NAAL 2FEDC 1JWMA 2O6DA 1JZDC 3V6FA 3L17A 3AMLA 2PPAA 4JO1L 1PSKH 4M6ML 4BEIA 5AAMC 5I66B 3RHWF 3FHQA 1IBZA 1H9VA 2QPDB 4YBLC 5DHMC 2W0FB 5IJCC 3WD5L 4A7GA 3NA4A 2W38A 4ODUA 4X5XA 2P8MB 3IF1A 4HHWA 5INCB 1A7QL 2MTPA 4BM7A 4GAJH 3LKOB 2R0WH 4PJCF 1P4IL 3E0GA 4UIMB 1E9OA 4WU5B 1U6AH 3QDHA 1YPZE 4R4ND 1OZUA 1W8EA 2QSCH 1LILA 4G8EA 4GQRA 3FT4A 4RFOL 3QEHA 1HXMB 5A7BA 4X6CB 1DQVA 1NL0L 5D71H 1HSBA 4BCXA 5ALCL 2CK0H 2VYRE 3TYGH 1XDTT 2W59A 2ZWKA 5F1KC 3FHEA 5L6YL 1N6VA 2D2OA 4DCQA 2YGOA 1TETH 2J5LC 3JV0A 1HH9B 3ATBA 3IDYB 4OZIA 5D70L 1IGYA 2ZPKL 1TPXB 3PGCA 2IFFH 4J8RB 6PAZA 4FQXD 1EHAA 1XAKA 4YDLC 3AU0A 3PWJB 4WEMB 2P5WD 1I75A 1HHIA 5HHXH 2WXGA 3NYKA 4KC3B 4E2OA 1TQTA 3BDYH 1URIA 1TCMA 5LBGA 4RX4A 4PLNC 3QJHB 1D6VL 1X9UA 1DZBA 5I1IL 3TZVC 3KL5A 4A63A 4PRIB 2E56A 3TOPA 3E3QE 4HUUA 2QPEB 3E1F1 3VQ1C 1RJCA 2R15A 1EHNA 1AHMA 2I07A 4JFFD 4N68A 3ZKND 1MCWM 4WV1C 2IH8A 4Z7VB 2Z31B 4NWTH 4ISVB 1HYRC 5CIPH 2DB8A 3WHXB 1R5IB 1LWRA 2C4FT 2WXOA 3EOBB 3MBEA 3MU3A 1EH9A 5CCGE 4Y4KD 4KROC 1X4ZA 4HPOH 1MCRA 1QA9B 3COOA 1DBML 2BSTB 4GRMA 1KGJA 2HRPL 3SDCC 3SJVE 5B39B 1WP6A 3FB6A 4X99A 4HMCA 4AUYA 1A7NL 1E4XL 1CFBA 1MREL 1AOHA 4KKAD 3JVGC 3SGEI 4C56B 1QSFE 3P4OB 2I60H 1RZJH 3DMMA 5DFAA 5IOPB 5DVNA 1MRDL 1GY1A 5JW3L 3N43B 3RWIA 2CKBA 4WHCA 4WNQA 1M6OA 2XIDA 3O9WB 3BKYL 4LCUA 1QFUL 2Y25A 1G4RA 2DM4A 2IF7A 1VJSA 2IDQA 4MA1C 5ETUA 2X42A 3ALXA 1AR2A 5F21B 5IKCA 4OF3A 3MOBH 5CHNA 5TDOA 3ZQ9A 3TBTA 5LVEA 1I3GL 3EHBC 4G42A 4IDJH 5LAXB 3BKMH 3KZ8A 2VN3A 1DQQB 1ZRUA 4HYTB 1SDYA 3MX0B 4JJOA 4L8DB 2CO7B 4RIRB 5EOCJ 3BAWA 4UTBH 3H3PL 4MDRA 2ZKHL 3BGAA 5A16A 4N9GA 3IMVA 4YHIB 4P3CL 1UB6B 4R7LA 1OD7A 3Q0HA 4RRPM 2XY2A 3MAWA 4S10A 3M1OA 1RZKL 4E41A 4M8QB 4TRPH 2CUHA 2EDWA 1AZNA 2DTML 4N2EA 5GRYA 2XZZA 3HZMB 2A9CA 3T2QA 4EDWL 4UOJA 2XKUA 1JP5A 2AJZA 5IQ9B 1WG3A 3L5XH 5E6IA 2ZSWB 2LQRA 1KJ2L 2ZT9C 1S7VA 5E51A 5EDXA 2CNYA 5AUMA 3VG9C 4Q2ZB 3ZX1A 1OXYA 2X4SB 5AW4B 3U7YL 4X6DE 4HX1A 4JHAL 5JIKA 3VFWA 4MJ6B 3K6SB 1WGOA 5JNYB 1AGBB 4H8VA 4P59L 4QIRA 4PJBE 1UD4A 1QYGL 5INDB 1QSEB 4OI8A 7CGTA 3TV3H 4P5TB 5HBBA 4H26B 5T3XL 1C9SA 2EJ1A 3AG1B 4LRNH 5E8PA 1IBFA 2IFGA 3W38A 3ML8A 4FFWD 1RMFL 1NCDL 2ZG1A 1NA8A 3IFLH 3LEVH 4NQTA 1AXTL 1WFUA 2DKSA 4P2RD 2DLTA 2I26N 4L0ZA 5JW4Q 1G7HA 1EPFA 3HRZC 4WW1B 5E95B 1W8OA 3QCVL 5EBMA 3WE1A 3F6IA 3ORJA 5TD4A 1SQ2N 4P2QE 1UD6A 3X1GA 3N85L 1MY5A 2OMUA 1V55B 2CRIA 4TLUA 5EO9A 4HISA 4N87A 4M8VA 4G5AA 3DX7A 2PN5A 3PWPB 4N2AA 4ZDHB 1W16A 3F5WB 3QUXC 5IVOA 4UIKH 2X9ZA 1GXEA 1LEIB 5LWYL 4FFVD 2PPFA 4Y9BA 3OHMB 4G43B 4NNYA 2E7LA 4LMQI 4ELME 2CBTA 3EJSA 4KUZH 3GT6A 2UYLB 1DTUA 3RKDD 3QDMA 3L3IA 1P5UC 2XXCB 3K7UA 4KAQL 1LNUB 5IT2H 3I3DA 5GXBB 4G6ML 4ZODA 2B1AH 4OJEH 3QXWA 4IKJA 5DRXB 1XBDA 4J3SA 2QTEA 3V4PA 3D3VB 1CTNA 4QCIA 5CNHA 3DXAE 2EAEA 4M5ZH 2BCMA 3BUYB 3BSGA 4OV5B 3GTNA 1GZQB 4Z3EA 4LFHG 2KH2B 3KLHD 1KACB 1EK3A 5BXFB 3D25B 1HL8A 1LWHA 4NZUH 3TTYA 1F4HA 3K4DA 3OKLB 2HVJA 4DQOH 1WAAA 3RZWA 3QFJD 2R29A 1ET7A 3RDTB 4FXGC 2F68X 1FNSH 2H1PL 1AQKH 4GJTB 1V05A 5K1NA 1TQCC 4PLOB 5EIIG 4B50A 3I85A 2WBJA 4L5FL 4MNQD 4L9LB 4Z7IA 1FNAA 1P1VA 2MCPH 1YY9C 2BP3A 3GMOA 1SLWA 2G2RA 2MRYA 4GFXA 4XBMA 2VDLB 3MFFA 4NP4L 3NJMA 3VI3B 3QXTA 4HIHA 4XHJD 3S5LG 1ACYH 1Q9LB 3SYOA 1I7RB 4Q7DA 1IU1A 1ZANL 5IB4A 3UJJL 5AW0B 1XGQA 4Z78B 4PM1A 2G60H 4CC1A 1T83C 2FX9L 1WRFA 2K8QA 5ANMB 3UJTL 4BCYA 1T4KB 3MV9E 5HY9A 5K39B 3TBVA 1OB1A 2CLVA 2ZONA 3V0IA 2GI0A 2JVUA 4TUKH 3NSJA 3O6LH 4G80B 1BXXA 3ZKMD 5E1HB 1J5OH 1E0OB 4D2NA 3TURA 1NIAA 4JMXA 5EWIH 3DUSB 3VH8G 3CLFL 4MDIA 4LF3A 4WDIA 2KL6A 4DO6A 2BP0A 3QEGH 3TT3H 1SYSA 2PLTA 1VGEL 3UBHA 1RCYA 1ZEAH 3D6GA 1A5FH 4G8AC 4IW4C 1HZLA 1HZHL 1CDCA 2BCKA 4PJXE 3ETSA 3TP4A 3H2WA 5IFAL 4JREB 1NMAL 4RA0C 1B0RA 3CXDL 4NEHB 1R3IL 4ONFH 1IO4C 3AFLA 4FEIA 4IRZL 4NQCD 1ZT4B 3N9GL 3TO2B 5HHOB 2AJVH 3EJUA 4AEHL 3AWFA 5SX4H 5DJ6B 2O93L 2IH9A 4MJIE 1UQSB 3QAQA 1HE8A 3TF4A 3LN5A 3RILA 1D7FA 1KFAL 1H3PL 1LEKB 3C09B 4MQ7B 5E8EB 1UM4L 1WS8A 4PJFE 3HRPA 4LLDA 3WKML 1VF5C 3HNTH 4M61B 4WI0B 4XZUA 1KEMH 3BQUA 3DOIA 1XGRB 3TVMD 2NLJB 2CAKA 1SJHA 5CXPA 3FU5A 5HYSG 5I24A 2EIKB 5B21A 2XU9A 4BJLA 1T2XA 3J27A 5BV7H 4PP1D 3M46A 1MCOH 5ID1A 2YQ2A 3SPCA 3A6BH 5BRQA 5ICYB 1YEFL 1H3WM 3MI6A 1ZGLA 2YLKA 2F53D 3KPPA 3MLTA 4L4VD 5C08D 3WE6A 4XXWA 1GKOA 2XX0A 3LZQA 5E00A 5J1SC 3TT1L 1KB5H 3PABB 4JM2D 1WLHA 3GRWA 4GUPA 4XNXH 4K23L 5SX5H 1CGSH 3BIBX 3IGUA 4MTMA 1WFOA 4WU7A 3PJSB 1TSRA 4PRPB 3WTWA 1I8IA 2ED9A 2QLYA 4I0PD 2R2HA 1S7WB 2G5BA 1OK0A 2H9GB 1GC1L 1S5HA 3SKOA 4JO3H 2EDKA 3WKNA 3GJEB 5E6RB 5F9WC 2VDML 3WMSA 3WFEH 4DVRL 1BEXA 1UXWB 3MRQA 4KTDL 4IRSB 2I27N 2A77L 2DEWX 4CMMB 2E27H 4CUCA 2OJEA 4YX2L 2JKTM 3C9NA 4XI5D 4GQ9L 3ME0B 1QSVA 1XGUB 1MLBA 2Q3XA 2BNUB 4BV1A 3KG5A 3CDGB 1TVHA 4NXKA 1T5WA 2BMKA 3AS2A 4E9RA 5LUMA 5D7LA 5JHDA 2JIXD 4OFIA 2H26A 3UC2A 4R96A 4MQXC 2OMZA 3UAAA 3GKZA 3PGFL 3S4SA 4UT6L 2DJSA 2P5EE 3PL6A 2VDRB 3BW9B 4CW1B 3NJVA 5J11C 5CZVL 4A37A 2ZOLA 1KEGL 2BSRB 1DLHB 5MP6L 5IHUL 1EHLL 1S4IA 5F7WC 1INEL 1Q0XH 2EVIA 4LVNC 2GCYB 2VZVA 1E5BA 3ISRA 3K91A 4Q0XH 4W9KC 4XVTL 5C09E 2D3VA 1N8ZB 2JB5L 2Q2LA 1COBA 3C08L 3WEAA 3IGKA 3Q01A 1PFCA 3F7YA 2R1XB 3QJTB 4O2EA 4BFRA 5JHAA 1F8TL 4ABUA 5DR5H 4FZEL 2XWDA 3LSOA 4LCCA 1O7SA 1QSFA 2I9LA 2ICCA 4FCAA 4LSQL 1L0XA 3X12B 1XGYL 3B37A 1XD0A 3QSKB 4N86A 2DLHA 4PYGA 3TN0B 4S1QH 1FDLH 1Y6NR 3MQIA 3R1GH 2R69A 4GW1B 2KI6A 4HUXA 4W68A 5TQ2H 2DWXA 4Q6KA 1IVLA 1WQVT 1AZRA 3BX7C 4H0LC 1CTMA 5B38A 4N8VB 5FOBB 4CBZA 3MBEC 1YO4A 1R3HB 3WN5A 2EIEA 1RURH 1K5NA 2L8AA 3QVAA 2N1TE 3P9LB 2LTQC 5BMFL 5JR1L 1ZHNA 2FLRT 1WS7A 2K78A 3JZYA 3KJ6H 4R0LA 2CRYA 4KTYA 5DC0A 2WXNA 3VVVA 2XQYA 1IILE 3UO1H 2ESVE 1WZAA 4EO5A 1JK9B 1WZ1H 4LMQE 3B5TA 5J6SA 1CUOA 4CVXB 2X4NB 4QJ3B 1ZXKA 4KK5C 2YD4A 3DMMC 1W91A 1WBZB 4MD0A 1WD8A 2X4UA 2Y4SA 5DRNB 5CGMA 1EWHA 3GSQB 2OX5A 1AC6A 2ALAA 3E6FA 1AR1D 4JL2A 5GRVK 5C0DB 2Q8AH 4YBLB 4OZIF 3RY4A 3P77A 1XXFC 3F05A 1DN2A 4JFDD 3EXJA 2DLFL 4LBEA 3QQ3A 1A9BA 1VIWA 3C60B 3JV4A 3QUYA 4YWGL 1EEYB 2ZQKA 3U83A 4BFEA 4ZMWA 1KJ2B 4ZXBD 1DL7L 3MRFB 2NCMA 3TPKA 2B3IA 3PWVA 4LL4A 2HVBA 5ALBH 1I9EA 4QHMB 4XTRD 3SDDB 4ALAH 4BZ2L 1NLDL 3RNKA 2JFCA 2ADJA 3BUQA 3QXDB 2P7TA 3HPLB 3KPLA 3SBQA 3UTSB 1ODAA 4OLVH 4CMHC 5DHVH 4U3SB 2QR0B 3NIFF 4A7TA 1CE1H 1KBGL 3RFZB 3OZ9H 1DE4B 2WLMA 4CN6A 2FK9A 4UYPA 2E7BA 3CSFA 4N25A 1MI5E 4MS8C 2NY2D 2XRAL 3O6ML 1V7NH 5E6IC 1W72L 1USZA 1UHVA 3NJGA 1KT2B 4JCLA 2VLKA 1KIUA 4IGBA 5DRZA 3LEXA 4QRUB 1Q9WA 2L7EA 2DBJA 4ONGH 4H0GA 2FEEI 3VWKD 5BO0D 2Z1KA 5EEXA 5T1LB 4P49A 3HW7A 3V4VB 1F3DJ 1T6BX 3MJ8B 2WNXA 2YIHA 1HX0A 1E27B 2AMGA 1SHXA 1CI3M 4U31A 3ARQA 2IH1A 3L1FA 5BS0D 1RJLB 2Z93A 2VM9A 2BO0A 3IJSB 1E3FA 4YBHA 1FH5L 3WJMB 3U9UA 3AJ7A 2WKGA 5D1ZI 4A04A 3KPSB 5I1AA 3BVNA 3S36X 3X2QB 1NMCB 1KXTB 4HCGA 5EO1A 2I9TB 5DUBB 2VB5A 1U3NA 3EYSH 2PMZA 5BZDB 1MJJA 4QTHA 5E8OB 5I74C 4J3OD 3PFUA 4JG0L 4LNRA 4CJ1A 3GPSA 5MI0B 4BQ9A 1R3JA 5JXED 1RHHA 2LVCA 1TEYA 3DHMA 1F6LL 4HWNA 3CFEA 4HDIB 1NH6A 2Y9RT 4CSSA 1X5ZA 2Y6TE 1MWAL 1S7QB 4GEJA 3VSVA 4LEXH 3IDUA 3HE7A 3QDGD 4RAHA 3GEWB 2E7LC 1S3KL 1U2HA 2OMWA 3C5SA 4W81A 2EDTA 1DCLA 1IAIM 5HHVL 4NIKB 2A3TA 3NSFA 3QHFH 1NC4D 1PY0A 3BPLC 5C0IA 1F86A 5F7MC 4XO8A 3T09A 3OLIA 5ID0B 2HTKC 5DLLA 3PAVA 4HZAA 1ED3A 2ZCKL 3L3KA 2ZOTA 3NDYE 3AQDA 4QDGA 1C5DA 4HG4J 3D4GA 4D9LL 1LWJA 2X89D 3W2DL 5JHLL 4L18A 4WO4A 4HFWB 1VEMA 1CXEA 2UZIH 1U33A 4WKZA 5I1KH 5GGRB 4NN7B 1KUMA 1T7XA 2CCLA 1NCGA 2FJGA 2FBJH 4K9JA 4MJ2A 2K8MA 2VTFA 1HQRA 2EYSB 3RL1A 4A7VA 1HHKA 1Q9OA 4Q9QL 1AP2B 3MLWH 3HR5B 4HH8A 2WBJC 1NBYB 3QO0B 3CH1B 3CVIH 4PR5A 1BMGA 1SHWA 4QRTB 5DFVD 1K8IB 3DYOA 1UEYA 4NO2A 1PQZB 2C1PA 1G94A 5GIRA 4M1GL 3QI9D 1S7UA 4G6AD 4JKKA 3L5WB 2VSKB 4QTIL 5CZKA 2OTUB 3OAWA 3LV3B 2VDOL 4JHWH 1CDIA 1O9WA 2ZX5A 4ODXB 5JPNB 1R34A 4HLEA 1LK2B 2J6WA 4GXFA 2ATPA 2JJVA 4RDBA 1F58L 2YD6A 3CSBA 3TIDB 4DQAA 1RFDL 4D9RE 5DJDA 1A66A 1L9TA 2NY3D 3GPEA 4KRLB 4LHQB 4XCEB 3HRZB 4ZPTB 4QT5B 2X2UA 3NCJH 1LD9A 3DX9A 1NFDA 2FIRT 4OIAA 4NHCL 5FPIA 4HZ1A 2GITB 1KIQB 3B83A 2X70A 4WENB 4FXKB 2NY7L 2AQSA 4WKXA 4LDCA 4YHZH 1PLGH 2V7HA 1F4YL 4JFXB 4OFDA 4QRSB 5HPMA 2ENPA 2VLRA 5FKAB 1OB0A 4XNZC 4BK4A 1CJYA 3RVWC 1ACXA 2XYCA 3W11D 4R8WH 3O2DH 3AITA 4YSPA 1FBIL 5CGYC 1G0YR 3ULSA 1L9SA 2WP3T 5ABZA 5L0QB 3LRMA 3EH1A 5I8OH 3FFDB 3DOSB 1B3IA 3AB0C 5IM7A 2OYLA 3WKPA 3ZUCA 1IT9L 1LO5B 4XB3A 3FOLB 1JFQH 4X7FC 4KJWD 1G7PA 3S3DB 2N7BA 3ZT5A 1IUZA 1CU4H 1K4DA 1VERA 4XWOC 3SBPA 1B2WH 3BQUC 3V0EA 4TULH 4H20L 1L9OA 1WT5A 2PW1B 4PGBB 5GJSL 3QNZB 3FO2B 4MMYA 3ROLA 4HUKB 1FVCA 4WEUD 4X5WB 5ADPH 1TKWB 1O6SB 1IGIL 2GTZA 3BMWA 3EYFA 4Q9RH 4WSGA 3TA3D 3U30C 3WUWG 4NCC2 3D4YA 2A2QT 2JQAA 3F65A 3UTQB 1AS6A 4KDTA 4XXWC 4P5MB 5FUOH 3I3EA 1XEDA 4FCHA 1C7TA 3MODH 4OCSL 1KTJA 1JPSH 2NTFB 4FG0A 1FGNL 5IMKA 3IKCA 2DIJA 1KN2L 3D48R 2XI9A 3KJ4C 1EA9C 4UMSA 4P07A 1QASA 2WQVA 5KANG 3B6SA 1N7MH 4IU2A 2QV2A 2HUEA 4KFMA 1I82A 4PRBB 3HS0A 1LO2L 1OPGL 4NUGL 5BOJA 2Y06L 3GXPA 1RULH 5T1KA 1J10A 5BOZG 5B1CA 1KV7A 1N5AB 1FLTX 3RX8A 1HHHA 3LNDA 2PW2A 4U1LA 1HEZB 2H1XA 5FW7A 4G9DA 1PNCA 1IEAB 5JDSB 3LVTA 3ARVA 3GLAA 4NO3B 5IUCA 1V3JA 3QFDB 4U1NA 3X1BA 4TVSa 3K6DA 1DN0B 5J89A 5KS9E 5A40E 4R2GB 2IMNA 1UYWL 1QR1A 3LZNA 4FEMA 2BNQE 3PP4L 2A0LD 2OMTB 3OKNB 4KO6A 4W9DC 5DO2C 5DWUL 1H5BA 3EYUH 3VFPB 3MJ9H 5HYJD 3OF6D 3GSUA 3KBFA 3PL6C 1A3QA 4MVBD 3U1QA 2FUQA 3BUIA 5I6OA 4R97C 3N41B 4NZ8A 4WFED 5K93A 2YPKA 4HIEB 2GJ6E 1YYCA 3US1A 2FT7A 4XCFH 4FTVD 5I76A 1KCSL 2TSAA 2ADYA 1T7VA 1BDYA 3CVHA 1YY8B 4LHJB 2HRGA 4X8XA 3MCLL 2X4TA 5I16B 2KQNA 5SWZA 2AEOA 1IJ9A 2A9NH 1GSMA 2OP4L 4QY8B 1F3JA 2J57A 2WD0A 4EI5A 3L4VA 1X6LA 1J8HE 1BD2B 4Y89A 2GHZA 4HPHA 3T2OA 4IKLA 1BGXH 4EOWL 1B2YA 1PAZA 2WB7A 4LCCC 2BVQB 4HP5A 3KPOB 4FNPA 1TYRA 3G6DL 3T5WA 5IR1B 1OAYH 3T77B 4I4WB 2JI2A 5FUCC 4PY8I 4JFOA 3UJIH 3U6XS 2GIMA 5KZCD 4G5ZH 1R9FA 2EZ0C 1ZTMA 1R5WB 3UAFA 5FYKH 3WTYA 2RFXB 3WFCH 4TVUA 3WN5C 4HQQH 3GXDA 5BOPA 2ISDA 1EZVX 3DO7A 4PJIF 4ADJA 1BZ7B 4F33A 1KG0B 2MIZA 2J8UE 4R0LC 4JZNB 4Z5RA 1TENA 3OMAB 4Y5YA 2BXYA 1TVBB 4IMLA 3CN1A 1ZKAA 3TNMB 4Y1AE 4UINH 4DO4A 2UVEA 3TBYB 3SCMB 2IH3A 2BVPB 3DGCR 2D31A 4ZFOA 5FYLE 1I7TA 4LDOB 1G9NC 5EORL 5BNXD 2ZIDA 4MJHA 4X4MA 2VW7A 3VUAA 3L1GA 2YD8A 2FB4H 1RJZB 4GKSA 3EOAA 3GLEA 1ILSA 2DQHL 3GKWL 3W57A 1QR4A 3IAQA 3AREA 1TFPA 2JELH 1DQLL 5FO7B 3QT2A 1MW1A 4JFZL 5C0EB 8FABB 4X5XB 3MA7B 5FGSA 2MPAL 3QNYA 1FL5B 1TZHB 3PHAA 3WIIL 5T3ZD 3GRWL 4YDKL 1TJIL 4F3FA 3LPOA 3QUYC 4RWYH 4D0CA 2QVIA 4K8RH 1W72B 1S8DA 4FQCH 5I15L 4MSWA 3RBGA 3W0WA 2F5BH 1TU2B 4N90E 1NUFA 4PGZA 2ZCHH 4H8WH 4Q89A 3S88H 3VE0A 2JI1A 5HJ3A 1NMBH 3I84A 3PE9A 1SRDA 3T0VA 5HYQA 1BLNA 1MFEH 1WIOA 1ZJBA 5DZOA 5DZPA 5KSUB 4OZIB 3APCA 2BIOA 4TOYH 1HJCA 3CGTA 1UKTA 5IVXF 1J0HA 2Z65C 3FBKA 4EUPH 2OS7A 1ADQA 2BOBB 3QO1A 4HUMB 1UM5L 4RGND 4LSSH 1NANH 4IGBC 1KTDA 3D7PA 1Y0LA 2ATAA 2J44A 1DEEA 3HPJB 1CD1A 4TSCL 32C2B 4KQ4L 3ZIMA 2G75A 3HN8A 5IJDC 2EIJB 1UWXK 3NIFB 1OY3B 1FRGL 4Y19D 1J0KA 3KGUA 3EBGA 4N0UB 1MWAB 5C0FA 5A2KH 4YMPA 5ICXB 1UWEH 3WEBA 1FF5A 4KK8C 1D5IL 3GO1H 2DL9A 3U0PA 2LTQB 3GSRB 4JFHD 2XA8H 4DEPB 4ODHH 4BA0A 3T6XA 3NCYS 4DGVH 1XR8A 4OCMC 3ARBA 3BZ5A 4WF7A 5JQHC 2VITA 4L8BA 2IQ9L 4X99B 3LOWA 3HMWH 2H2SD 2WXQA 2YFOA 4MD5A 3Q1SL 2OQJA 3O0LA 3FSZA 1UVQB 2Q2EB 4R7DA 1BOYA 4C4UA 2WUCL 2R69L 3ARDA 3UTTA 4XNMA 1DJSA 2AEQH 4BSWB 1J1PH 1CICD 5DJAB 4ZFFA 1PIGA 3HE7C 3L6FA 1O6TA 2IPTH 3VFUB 2XWXA 3HZKA 1LE5B 1E3ZA 1BF5A 3QUZD 3RWJA 3M86A 5IHBA 1YLBB 3IE4A 1FORH 4POYA 4FLSA 3IJEA 3TBTB 2HPOA 1KPRA 2BY3A 4FG6D 4GY4A 1AG0A 1RUQL 4B3VA 5A16B 5I71B 1L5GB 4N9GB 3SE3A 1LGVA 3FB5B 1OT2A 2X3CA 1J1OH 2DWEA 2PTTB 2QADD 5AVVB 4FL4C 2NY0C 4YGAB 3WG7B 2DQTH 5KBNC 3VQLA 4WO4C 4TNWF 4MA8L 3UP1A 1PDKA 1CFSA 2VDOB 4K7PH 3TJEL 3AG2B 5E8DL 4H88L 1MFUA 1CXHA 5F9JB 1YAZA 2WVVA 4Q6IA 1JV5B 5I8EA 4QXVA 4FQXB 5AUMB 4Y2DD 3SD5A 3NZHL 4Y4FD 2P5WB 1WF5A 2BJML 3VFWB 3PIQB 3L4ZA 4AIZB 5LGYA 3MRCB 3G5YB 5IF0A 2KZ1B 2XQBL 2WQRA 4TLTA 2BOLA 4L3AA 1CF8H 2BY0A 4EXPX 1I9IH 3O4OB 1DQKA 3H2QA 3L95A 2TSBA 2WN2A 4PRDA 5B8CB 1MH5B 2CDEB 3STLA 4WHTA 4N4YB 4B53A 3VD1A 1T5XB 3DOHA 3FUFA 3MLXH 1CDBA 1SOSA 1Q0EA 2X7LB 2QQNH 3C2AH 3KPMB 4J2QA 1BP3B 4NQEA 4E5XA 1NBQA 1XH1A 1N0LA 4KK9C 1OLLA 3KPRA 4OCRH 5HYFA 1JGDB 2PKDA 4XBGA 1MCPH 4HA1A 2DF3A 5F7NC 4IRJA 5I74B 1F4WL 1IM9D 1KLFA 3GNMH 1J0YA 1MAJA 2DMGA 1MLCA 2IQAB 2OMUB 2DQGL 2VXTH 4YSEA 1B4JL 1Y7VA 1DLFH 2OCJA 3AVEA 3H53A 4PJ8D 3HBPA 4XNYH 1JZIA 3VXSA 4HEPG 2NW2B 2VUYA 4YGVA 4TQIA 3Q8BA 2NMSA 2IGFH 1AAJA 5C0JA 2DYSB 4YOKA 1TJHL 3P3TA 1MJ8L 3STBA 4AYFB 3IFOB 1VKXA 3DV4A 4TNFA 5FM8A 4OU3A 1YEKL 3LN4A 4NDMA 1NCTA 4GW5B 3QDMB 4LP5A 4MASA 3L3IB 2O5XL 4X7SL 4QGTA 2YA2A 4KZ0A 2VMJA 4L3EE 1NAMB 3HBQA 1HINH 4HFUL 4LLMB 4OI9A 2P4AB 4L4TD 2A1WL 4PHXA 1JOIA 5LBSH 2W9EH 1FC1A 2WXMA 4NZFA 3DUUA 3X17A 3C6EA 4WGKA 2EE0A 5CKAA 1DQMH 4QCIB 4NC1C 3ARUA 5IWLA 1RZIA 5EC2A 4ZQTA 1D9KD 1NEZB 1LQSR 2VJXA 3MRDA 4M6OH 5FB8A 2GIXA 1CL7H 3OGCA 4I3GA 2I85A 5IBLD 2A9MH 4KQ3L 4UB0H 5DLML 1PTZA 2GB2A 1JYNA 4EKXA 5F1NA 1WT5C 1C12B 3GSWA 3L13A 2IV8A 4HZLA 2WKOA 5HI4C 4MLSA 2P1YA 5ITFA 2LU3A 4UTBA 2VRKA 3FU7A 1S2EA 1VFOA 2Y5TA 2DQJL 4PUBH 1Z9LA 3VWJA 3F58H 3ZDZE 4JN1H 3GF8A 1FO0B 1B3JA 3HC4L 1KCWA 4G2AA 4PW4A 4IHOA 4KDTC 4OZHF 2XV6B 4Q4IA 4UOQA 4X0NA 4ENZA 2VERN 4J4PA 4DP6X 3APMA 5IB4B 4UBDC 1XGQB 1OVZA 3LHAA 4NKOA 2J2ZA 2HPTA 3B9EA 2NX5D 2X1QA 3D9AL 3Q8FA 4XOEA 3TEYA 3GM0A 5AAPA 1HKLL 1GPOH 1F02I 4LCIH 1CGTA 2QQKH 3N50A 3HS0C 2OCFD 1OAUH 2Q3ZA 5K9OA 3ATFA 3HC0A 4P2RB 3QH3B 3TNNB 1F2QA 3OKEA 5E2VH 1NFIA 4HV8B 3RWGA 1R3LB 4XO5A 5F9OL 3WIHH 1DJHA 2C3XA 2KT6A 3BP7B 4PTTB 1M1XB 2NUTB 1YUHA 4GAFB 1SYSB 2OR9L 2XOTA 1M9WA 2WY3B 5JYLA 3FRPA 5I30H 5GS0H 1R75A 1IGJB 2GI7A 2YR3A 4ZOAA 3QQDA 1R17A 3NSYA 1H6UA 4QRPA 2J88H 1UFGA 1ZLSL 5IROD 2QFRA 2A7BA 4MXWL 5F93C 1H5BC 1T1XA 5D1ZA 5G5DA 4FXLA 2DLIA 5E9DE 3NJKA 4QRRD 3HZVA 3S98A 1PW3A 1ASOA 3QPQC 1L7TL 4LASH 3KWUA 4UOW1 1L0YA 4UF7C 5HVFB 4HJ0C 2UZYA 1XEUA 1YN7B 1F56A 1RK1B 3R06B 2BS9A 4JQIH 3BSHA 3GRGA 2NY6C 5MEOB 5J3HD 1KLUA 3U6RB 2YOAA 1H6TA 1AIFB 1E5ZA 3AACA 3NCWA 1JK8A 4XMVA 3BJLA 4EI5C 2A73A 3KHOA 3BQUB 5DXWA 5E56A 4YSUA 4A1RA 4XVUD 2ZUVA 1G7QB 4ZUWB 3ZSTA 3ZZSA 4NRXB 3FF7A 3FTWA 4HLZG 2X10A 3QFJB 5TE7H 2DL2A 3LQMA 1CYGA 1E5CA 1JZEA 5FM5M 1ZA3A 1UKSA 1FFRA 2Z35A 3G08A 3JV6A 1EGJL 4JFEE 4YDIH 2EH7H 3GS4A 1D5ZA 4F2FA 1NPUA 4MNQB 3WE6B 2K7PA 2CO6B 2ATKA 2AGJH 1Y1UA 4IU3A 1UOWA 2FYVA 4NLAA 5FK9B 2YAFA 1S9VA 5EIQA 4P0DA 4Y5YC 4N2KA 4YC2B 1T1YA 3VMNA 4EBQL 1K4CA 5J12B 2FX8H 1IFGA 5KOVC 3KYKL 1E5YA 2H32B 2R2HB 3UIZA 3KWWB 3FYEB 3OAZH 2F58L 3E80A 4U1JA 1ZV9A 2NT1A 2XWJB 4C4KO 3ZO9A 4FYRA 5E7BA 3OZLA 4WSKA 1CD0A 3MRPA 2XN2A 2GJPA 4R3SB 4NRZA 5DK2B 3AREC 4NBZB 4ZFQA 1JZ3A 4S2SB 2CKNA 3S3PA 1NGZB 3BN9C 4U1HB 1M7XA 1SY6H 4PJIB 4UT9H 1YMMB 5BPPA 3DK2A 1V3LA 1KNOB 2HVKB 3EJYC 4GPVA 4XMLH 3UZVA 1DVXA 3SY0A 2YXMA 5ERWA 1YMHA 5K69A 3V0AC 2HKFH 1ZGLM 4WFFE 1UOLA 2OJ1A 4R96B 1F3RB 4JRXD 4PP2A 5IW3A 2W9LA 3ULUC 1T89A 2VWEE 4LCVA 5D4JA 4EI6A 5K9QG 4TQHA 4FYSA 3RWCB 1SEQH 3VXMD 2NNRA 2WW8A 2FIKA 1YEJH 2YSSA 2BHUA 2D7OA 2Z8SA 4HK3N 3PGDB 4NQCB 4B9FA 4KKLD 2C3GA 3BSZH 2DMKA 4E9LA 1NANI 1NLBL 5D6CB 2JK5B 3BWAB 3S37L 2LFEA 3OLGA 5DHYA 2BW5A 1FL6A 1RZGA 1OGAD 3HCVA 3TCLB 5CBAB 3V10A 4FNLL 2OZ4L 3D1MC 1ORQB 4JZOA 4B97A 5AVXB 5H37G 5ISZE 5D1XD 3OAUH 4GKNB 4LCCB 3OKKB 5DD0H 1AOZA 4BFFA 3L3GB 4LCWA 3DPBA 2IBZY 5L2KE 2VKXA 5EEZA 3U4KA 1K6QL 3EYVB 1GIGL 3QQ9D 4KJYB 2EADA 1PG7H 3SYQA 2VGLM 1QQDA 5IVXB 2Q7NA 3QIWA 1MRCH 1A1MA 5EZOL 3MMEB 4ANVA 3CVHL 3QG6B 5F3BB 1RJYA 3OMNB 1X7TA 2W07B 5CWSA 3ZT6A 3MXWH 3K81A 4HIJA 5CJOL 4L4VB 1YG9A 5C08B 2VC2H 4R0LB 3ARBC 3OPZH 4LLYA 4GLRH 4GBXA 2Z4TA 1U91A 4NJ9H 3DX3A 4Z7UE 2NQDA 4JM2B 4K5NA 3ULUF 1DSFL 2P80A 3SPVB 3MLZH 2ZE0A 1XB3A 4OFPA 3D08A 3D07A 3D18B 3STZB 3AAZB 3QHTC 4ZUSA 3QS2A 3X1NA 2X4UB 1MHEB 3DRQB 3ARDC 4MMZB 3Q3GA 4OSUH 1DYZA 1P2CB 1PZSA 2GUOA 4CVWA 1MQKH 4F7TA 4JG1H 3VW3L 1KB5A 4UQ3B 1A4AA 3Q6GL 1C16B 1JSYA 1CGYA 4DFHA 2BK8A 1U8MA 1A9BB 3WXVL 1SXNA 2VH5L 2HXAA 4O58L 3U9PH 3ZKQD 2QMKA 3HLAB 4PV8A 1BPVA 5JW4M 2M2DA 2PYEE 1R5VB 3FU9A 2O61B 1U8PA 4RFNB 2JIXB 3U46B 1WBXB 3SE3C 2Y7LA 3CBRA 3HKZA 1ETA1 4QYOB 3WFHA 2FJFB 1JZGA 1SDDA 3NUKA 1ANUA 2OMNA 4B9IA 1E4WL 5CEZD 3BMVA 2GBTA 2NTSP 4G9FE 4NN5C 3WL9B 1FFPA 2R9HD 2N59A 1WA2X 4L3CB 1MCDA 3F64A 3QC6X 1ZA6A 3ZGIA 4CSZA 1Z3RA 4DPAX 5KVDE 3HG4A 4Q6IC 2V7NA 1KY6A 1KDJA 5LG6A 3JV5A 1BQLL 3ULUL 1BMWA 1T0NA 1Q9WB 2C9PA 3SO5A 3X3FH 2R56H 1T4WA 3ZPDA 3T2NL 3UBXB 4FQ2H 4Y8AA 2GPZA 1DBJH 1MG3C 1RU9H 2PO6D 1MDAA 2JKXA 2W65B 3OHXB 2W9DH 1OWWA 1NSNL 3ZTNH 2MNWA 1K3IA 3QJUB 3L7FA 1UCBL 4JLRA 2GBAA 3BEWA 3GZQA 4U6VL 1D7DA 1SEBA 2Z93B 4O51B 1E6JL 4OLUH 2OAAA 3L7EA 1G87A 4H44C 5CP7B 1JGVH 5JDJA 3DJRA 1ADQL 1QRNA 5ICZB 2YUZA 3BKCH 5AW8B 5EUOF 4ECNA 1PY4A 3QDJA 1WVZA 4HEME 3BAJA 1FGVH 5DEZA 3I74A 1ITBB 2I25N 4IRJC 5D1QD 3BFOA 1OAXL 3VNZA 1TTCA 4TVPD 5KVEL 1XL4A 4ODWA 3NEOA 4UU9A 1R3JB 4LEBA 4UT7H 3PRZA 1FC2D 4RAVA 2CPCA 3RZCA 3UTPE 3P0YL 3ABLB 2G5RA 5J9PA 5C0AA 2E8YA 3HEIB 5C0NC 1SYVB 4PWGA 1YEDA 4CBPA 4DVBB 6FABH 3NH7L 3TFKD 1XF1A 5ITBL 1AR1B 1T04A 5D2NB 2LU5A 1AQDA 3PQYD 2FJHB 4AYEC 4JFDB 3AWEA 1E3XA 2DH2A 2OCCB 4B27A 3QIBD 3GYRA 3QZWB 1IFHH 1RZJC 2WC7A 5MEQB 1CL7I 4ZXBB 3CZFA 3IFNH 2NYYC 3F7PC 4WJ5A 1ED3B 5C07A 1ZHKB 3RX5A 2HH0L 4H1LG 5DA0B 1FV1B 2WLIA 5IWLC 2WM0A 5EOTA 3AY2A 1CLVA 2VERA 3O3DB 4FL4B 4HXAH 5KJRL 3WS3A 4LAJH 3K0YA 2PCPB 4B95C 2B2XL 3BD5A 2W5PA 2VLJA 4IIQA 4NENA 2QQQA 3LQZB 3P11L 2ZG2A 4MBRA 5TK2A 1LK3L 3DGGB 5EN2A 2UZXB 3BXNA 4NOBA 1XIWD 3LHPL 2NZ9D 4MDJA 1OAQH 4BFOA 3P4MB 1W0VB 5T3ZL 2PCYA 1EZVY 5FAAA 4OCYL 4E9SA 5FV2A 2NY2B 3VWJC 1M6UA 4TTGA 1PSKL 2V8MA 4X4XA 4LFHD 5DHVA 2LLLA 5ENWA 4WI2A 4KKBC 4MD4B 4HHAB 3E6HA 3T0BA 4MZ2A 3RPIB 3VWKB 2DJ4A 5HHPB 5I75C 1J18A 3WHE1 3BESR 3EKCA 2JCCF 4GSQA 4H25B 2R0WL 5DTFB 1PZ5B 5FGBA 4KZDL 2ITCA 2X6MA 3HHRB 1U6AL 3MBXL 4J4PC 1XFPA 3ECVA 4O2CB 3U1SH 4URKA 1HHGA 5KVGH 3S35L 3FO1A 5EULV 2NT0A 4OLYH 3LNIA 2OK0H 2OXHB 2CK0L 3TYGL 4TUJB 2Z9TA 3REWB 2CNZA 2HYMA 3C2SA 4OFVA 2WQWA 5KYYA 3D05A 3KYMA 2ZOKB 4OZHB 4AXWB 3EYOB 4F20A 1MOEA 4HG4K 1QWUA 3MRNB 1KTKE 1WITA 4AE0A 3V4UH 3TC9A 4P3DB 5D7IF 3RUGA 4B5ZA 3GD1C 4W6XB 4GP4B 4XP5H 4CN1A 1B88A 1WO2A 3QDGB 3UABA 3VFOA 5D1ZC 4L8CB 1EHXA 4MS6A 3K4AA 1DDHA 1A0QL 3QZLA 5CD5D 1AGDB 1NC4B 3P9MB 1GYVA 2NXZC 1LM8V 3PWNB 1RV6X 4I77L 3FC8A 4ENED 1MRFH 3QWQB 3G5VA 3PHOB 4I3RH 3UAEA 4EVNA 2WOBA 4K3JH 1VFMA 3QNXA 3DROB 4EDXA 1IM3D 1TEGA 2H47C 1TTGA 5DEFA 3U7WH 1KCRL 1R33A 2PP9A 5EZPA 3ECUA 5DRWA 3QHZH 4L8SA 3N3EA 4JO2H 2GY5A 4Y4HA 1AD0A 5E94B 4ZJ9A 4NIYE 5BRZE 3ZE1F 2Z8VC 4KKCC 2VR7A 1EO7A 3QARA 1L6ZA 3MBWA 1RZJL 1H8NA 1CIUA 1E5AA 5DZ9A 1X6NA 3BP6B 4LHUG 5HPOA 5L4JA 2BNRE 3OV6A 3QJSB 3J8F7 1SJVA 4N2FA 1A3RL 1G7JB 3IN2A 2J1YA 3RWHA 3Q9PA 4WJG3 3SJVD 3LKSA 3QI9B 3I2CL 1UH3A 3AT8A 2YHGA 3M8OH 1ZV2A 2Z91A 4LOUD 3TASA 3IFPA 3DJTA 4IDJL 5HDBF 1U3HB 4X8CA 1G7IB 1QSFD 3VXRA 3B6SB 1YEIH 3ZOAA 2XWTB 2FWOB 3S96B 2LGNA 2IDTA 1F45A 3W82A 1SOQA 4HHGA 3SDYL 4XO9A 3EDJA 1HIML 2G9HB 5HTSA 4B60A 4J6RH 4LLUB 2CBOA 1Q90A 3T1WA 3P3UA 4TRPL 1XSOA 4G9DB 2K0RA 4JPKH 5FCUL 3IJ9A 2YAHA 3V6OA 1WTGT 1K2DB 1YDPB 3MNZA 5TE6H 1UT9A 3DNKA 1DVUA 3B7RL 2V2XA 3QJFB 4Y1TA 3MRMB 4PQXA 3FFOA 3X3GL 2X9WA 4I1RA 3X14A 3MNDA 1JPTL 4ABWA 3T0WA 1T89C 5KW9H 3N40P 2HG0A 1H5BB 1Z5LA 3GSUB 2CUAA 3LS5H 2ED7A 5LB1A 1WC7A 4Y9FA 4ZAKA 5AOKA 4F5CA 2VDLH 1AO7A 4XODA 3SOBL 5HGAB 2FEEL 4AEEA 3O0RH 5F1SA 5AKSA 1TQBC 2FX7L 4LRNL 4N2LA 3NDZE 3DURA 1I31A 4K94L 2UY7A 3MRHA 3VXUE 2A74B 4HGWB 1ESOA 3O2VH 1Y6MR 1F3JB 4MWFB 2RCSL 4MAUH 1VPOH 3NPSB 3L3HB 1M7DA 3O2DA 5K1VA 1UM6L 1TR7A 1L9RA 3C8HA 5KAQG 2A83B 3SDXE 1SZNA 4XH2A 3RIAK 2YEQA 3UGUA 3SDAB 3V7AG 5H37H 4GT0A 4JFSA 5CU9A 2QKSA 2P49B 43C9A 4ERSH 3BEVA 3MTRA 4MAYA 3PAYA 4U49A 2H6UA 3KLKA 1E6OL 4UIKL 4WW2A 1U8KB 4YHLL 3IJHA 3QIWC 4GLRI 3TLRA 1O5DT 2XTJC 4U7KA 1F6AB 4KUZL 4PG2A 3DO7B 1NINA 2VQUA 1KTLA 3JWOL 1U92A 2NY4C 5DVOA 5DZLA 3D06A 3O8XD 3HG3A 1VENA 3IDGB 4GBXC 4MQSB 4P2QD 5IT2L 4JDVB 3PWUB 4YE4H 5IESL 1KCKA 5HHNB 3VCLA 3OD3A 5BV7C 4NQXA 5HYSA 2N4IA 1CFVL 3VXTB 4OLWH 2D31B 1CD9B 4AGOA 4J3UA 3DC0A 1JNLL 4AYGA 1I1YB 3VI4F 5GZND 5B7FA 3NFPA 1DBBL 4EMZA 1A9EA 3AXHA 2PTVA 4NZDA 4ATTA 1AKPA 2MQ0A 1TQWA 1XGPA 4YPGB 4DQOL 3GI8L 3VX0A 1FZKA 3RVUD 1A6TB 3MGOA 3QNYB 3ZDYF 3P73B 2F18A 4N0YH 2DQUH 1AGEA 1AQKL 2K4WA 1N18A 3KNBB 3UYPA 4B96A 2VR3A 5C2BH 1GGCH 1KELH 2HLFD 3NAAH 2YBRA 5F9DC 3DXAD 1BG9A 4DKEH 4JO1H 3VE0B 2E5EA 3WNNA 4M6MH 3A47A 1T03L 1ACYL 5KYUA 1U8NB 1U95B 2CGRH 3NJJA 8PAZA 5M7QA 3WD5H 1FNLA 2BZCA 2QV4A 4P5RA 2XN1A 1A7QH 2AXJA 3BYTA 2V5RA 2G60L 1P4IH 2V6HA 3IVKA 4I9WE 4AQEA 4FTVB 2JNZA 4RFOH 4YHOH 4K55A 4MB1A 4NGHL 3THML 3MACH 4GG6F 3MJ9A 1OEZW 3F04A 1NL0H 2FZ3A 1DEEB 3MV11 1SUHA 4NB7A 4F9LA 3RWFA 3T0EA 5L6YH 1Q72H 1WH0A 4Z95L 2WMPB 5KVFL 4WO4D 3PV6A 3VXQB 3SZKC 5D70H 1RERA 4TL4A 4Y16D 2H8PA 5H2BA 1ZEAL 2ZPKH 3SBWA 5C0FB 2APFA 1A5FL 4YSSA 2X87A 4ZMQA 3MV9D 3HUJA 1SJXA 4N1EA 1UH4A 1NC2D 3L9BA 1IJNA 5FOJA 4BHUI 4BKLA 1D6VH 3P0VL 5I1IH 4LARL 3U4AA 2A9DA 1B0GA 2VXSL 4Z77B 1OD9A 4DK6A 2VDRH 1VSCA 1FFNB 4XT1C 3B5HA 3JT2A 3ARTA 2O6PA 1O0VA 2XKNA 4ADGA 1UA7A 1GSKA 4R6UA 1FIGL 3VGAB 3RZCC 1NJ9A 2Y6SD 2FSEA 3MV8A 4GRWB 2WIIB 4Z76A 3EFOA 5I19H 2IDFA 2PWEA 1GMIA 3CFKA 5LBVA 3S34L 3BH4A 1GJWA 4WK0B 1OHQA 1KEML 1KBBA 2E7HA 2V9RA 4APXA 1QTPA 5EUOB 2ZYHA 1DBMH 3QRGH 1WZMA 1ZOXA 4FC3E 4F8NA 5TH2B 3WYRA 2HRPH 1KPRB 2X12A 3BO8A 3I9IA 2ARJQ 3L81A 1N9PA 1KIPA 1E4XH 4MJID 4N5ED 3FULA 3ZN6A 1BJMA 1CS6A 5I6PA 5DJ8B 2A99A 1BVLA 3VFMA 3ZYJA 4WI7A 5JW3H 2CALA 3IMUA 1A7RH 1RVFH 1A4JA 1CLCA 1PKQE 4PY7A 4NN5B 5BUGA 4JE4B 4ZUUA 1QFUH 2E9GA 3CZGA 4G8GE 3CFCL 2C1OB 4IIQC 3LRKA 1XX9C 1CGSL 5GGVY 1KC5H 1OCRB 2WVVB 3LXAA 5G4NA 1QHPA 5SWSA 1I3GH 3B7TA 3MRIA 4KMTH 4ALAC 2AQNA 2M1KA 2C9QA 2A6KA 1AG6A 1CFMA 1JPST 3H3PH 4JO3L 3R4RA 2JKWA 1WGVA 2YRPA 4P3CH 2HAZA 1RK0A 5MEPA 4FF9A 1IE5A 3FPXA 1RZKH 4BFIB 3BPNB 2DTMH 3PXLA 1MVUA 2N0KA 2UXFA 4XP6H 2B77A 5FGBC 3T71A 4EUPA 4WHTB 2LHAA 2X1XR 4Y19B 5D2LA 4EDWH 4KZEL 1ZS2A 2WNGA 1YQVL 4HOZA 1KJ2H 2ZP8A 4G83A 3RWDA 3DSFH 3KPRB 1EFXA 2JB6A 1U2CA 4QF1B 5F70A 1BOGA 2LABA 5JLZB 2UWEB 3OPUA 4OZ4B 4PJ7B 4OJDH 3U7YH 2JWYA 4JHAH 1HCVA 4IRJB 4F24A 1VDGA 3D85D 2B14A 4X7CC 1BX2A 4P59H 1I8MA 1OO2A 4X7TA 4H5SA 5JZ7D 4M9PA 5EEVA 2BHFA 2NXYD 2JCCB 3C5ZD 5T3XH 1RUPH 4IOIA 4Z7NF 5GS2H 1CGVA 1THAA 1OKEA 4FQHA 1BZOA 1KYFA 1RMFH 4D0BA 4PRAA 2VW6A 1NCDH 2P5ED 3OKMA 4XE5B 5C0CA 3C5XA 1EBPA 4LAQL 4J3BA 4CDGC 1BIIA 4QO1A 3TBSB 3GJFK 2WZ5A 2QZ5A 3QCVH 2I32A 4NBYB 3RNQA 5AG9A 1F6FB 3N85H 4S1QL 4ZZFA 2G2NA 3V4VH 3DUUB 2ZD0A 1YNTF 3PV7A 1X5JA 4JO8A 4PB9H 5TQ2L 3Q1EA 1KGYE 4M7JL 4PJ5A 3O4LA 5EC2B 3JT0A 3VFTA 3VD5A 2EQDA 3G6JE 1RURL 1T0MB 5LWYH 4M48L 2GAZB 3KL0A 5D7IB 4BH8A 3KJ6L 2QADB 4YSTA 4IBVA 3HZYA 1TYEB 4RWHA 3LEYL 4JDEB 3ZZQA 3UO1L 2K9FB 4Y88A 3ILEA 1JXGA 4JCWA 4KAQH 4L8SC 1WZ1L 2JKNA 4LSVH 4Y4HC 5EZLA 1PCSA 3QPQD 4G6MH 5I0YA 5IOKA 2HN7A 3NFNA 4LSDA 1RZ7H 1PLAA 3ARWA 3FFCE 2N01B 4Y2DB 4ZFGL 5F8QC 4ZT1A 1G1KA 4Y4FB 1A2YB 7FABH 4HKJA 4PIRF 3CAFA 1WCBB 3INOA 3AU1B 2DM7A 2AQQA 2DQCH 1BBDL 3FUDA 1GGTA 1UTDA 5IGXL 2ESVD 5I1LB 1NICA 4AT6A 5DC2A 1OSEA 1L9MA 5JQ6L 3K8LA 1FNGB 2H1PH 5ALBL 1UD3A 2NOYA 3JWNE 3MYJB 4ALAL 5MENE 1I4FB 1JNNL 1OE1A 5B3JE 3BGFB 4OM0L 1I8KB 2BSEA 3FNKA 1KJMA 4L5FH 3II2A 3PDDA 3GQFA 4OLVL 4LVHB 5IB1B 1DUYA 1OT4A 4NP4H 5DS2A 2ITEA 3H9HB 4RQQA 5HJBA 3FONB 3A4EA 4N2CA 1KYAA 5F0MB 2EILB 3BLKA 1IM9B 2HTLC 1OF2B 2WVTA 3OZ9L 5FW6A 5IW6A 3V6OC 2XICA 1MUJB 3PU7A 1A4KA 4WWKA 4AMWA 4HUVA 1SMOA 5I23A 3L3JA 4PJ8B 1HEJC 3F6JA 1FHGA 3L3DB 4U1KA 5HDBB 4X42A 2D0GA 3FO0L 2E9IA 4EE2A 1JDDA 1QFWL 3V6ZB 3FK3A 3SQOL 4APQA 3UJTH 2WWMC 3G04B 2J1WA 2HT3C 1A1NA 3C8KA 1IIIA 4V1DA 3HZVB 3F62A 4IEFA 4ZAKC 3NZ8A 1DEDA 2UV3A 3C87A 1RPUA 1MCBA 3WO4B 2PP8A 4PRHA 1T2QL 4B7LA 2GTQA 3BPCA 3CLFH 3I75A 4FLQA 3NG5A 1ZSDB 4TVPL 1MI5D 5C0BA 4LQFH 4L4TB 1XWVA 3MO1B 1VGEH 2QDVA 4FKKA 1RZ8B 3LIZL 4ZMXA 4PS4H 1BJ1H 5IMMA 3K5SA 3NTCL 1G7LB 1ILUA 2L7UA 3L2MA 3DVNA 2JTDA 3IDMB 4YXLH 2A73B 5L4IA 3W0WD 1QACA 4LLVA 5IFAH 3GMPB 5KN5B 3DIFB 2CDGB 2Z1PA 4QHPA 4JVWA 4IBYA 3T0DA 1QTSA 1R3IH 4U6HA 4U1MA 3MGTB 3BI9X 3FXIC 3N9GH 4JPSA 1A7BA 2IAMA 1N3NB 2B5IB 4UV7L 4AEHH 4FA7B 2AXGA 3UX9B 1LO0L 5C7ZA 5D7JA 1M9SA 4H7VA 5GS1B 5CSZB 1LO4L 4PJDA 5ABAA 3GMQA 4N2OA 4MAYC 1XQ4A 3OB0K 4WW2C 5F6IC 4D0DA 4LEXL 1KFAH 2NNAB 1H3PH 6PCYA 1YC7A 1UM4H 3S48A 5CN3A 1D3CA 1C08B 4OZGA 4PG2C 4GUOA 3WKMH 3F12A 2APVA 2OTWA 4I5BB 1ZHLA 2BY2A 4ADIA 4RFEA 1OTTD 3ULVE 5HGGS 1UWGL 3EO1B 3IGAB 2CA3A 4W9FC 4Z7WA 4LGSB 4PRIE 2Z4QB 4P23A 2MCAA 5GS3A 1VADA 4BIKA 5C6PB 3GHBL 4JRYE 1ZY9A 4LK4A 2PXYD 4BA8A 1CI5A 1RI8A 1CN4A 3QUML 4C55A 4ZQKA 4NZTL 2DBLH 4IS6B 4KOBA 3BQVA 3S0PA 2VZ3A 4P04A 2UZIL 1KWKA 1XF5B 2F1BA 3D2UD 2OXGA 3ARBD 2O4EA 2CR6A 2WLLB 2XFXA 4TNVF 5EU6E 3MOAL 3TT1H 2HJKB 2X6BA 5BQ7A 4ZUVA 5HD8C 3RVXD 5JMOC 4OUUA 1M4KA 3CDZA 3CVIL 4EI6B 1ID2A 5DC4B 4UM8A 3TYFA 5FF6B 1JDAA 5IREA 2Y5QA 3SPGA 3T8XA 1GC1H 1WBYA 3ARDD 4YNYA 2MNUA 3VI4B 7PCYA 3T65B 2FIKB 4C83B 2Y2YA 2WJ7A 5I17B 4DVRH 3OKDA 4KTDH 3WIHA 2A77H 3VGBA 4KX9A 3FT3B 1NM9A 4WW2F 2CBMA 3HI1B 2VZSA 4GQ9H 3OC5A 4MJJA 3ZDYB 2YD0A 3VB8A 4POZC 1FLRL 2XA3A 4Z0XB 1MJUH 3VFRB 3NQKA 2F7RA 4U1GC 3IRZA 3C5JA 3L16A 1E40A 2VUKA 1N6QH 3MREA 4OBSA 2KBGA 3PGFH 4UT6H 1JPGA 3WN6A 1E28A 2V3EA 4LCWB 5KSAD 4DF9A 4F9LC 3ASNB 4PJEA 3T0EC 4AENA 4ICWA 4WWID 1HU8A 1Z2KA 4I18A 1KEGH 1IIKA 4LPXA 4YHZL 5MP6H 5IHUH 1EHLH 1SVZA 3SBWC 2AHIA 3JTSA 3FB8B 4NT6B 1NDMB 2VXVH 1INEH 1RJYB 3A21A 5KSVB 2Y23A 3GHPA 4UQ2B 4D9RD 4Z18A 5DUJA 2JB5H 1UUSA 3C08H 4R8WL 2K45A 4AEFA 2BSCA 2JV6A 2C9AA 3O2DL 4WNSA 4NQDE 5IY5B 4GG6B 4PGCA 1F8TH 3TH3T 2F54E 3GSOA 4PCSA 1G7MA 4FZEH 1CE6A 1BBJB 1CFNA 5I8OL 3NCFB 3LKNB 1KXVA 4N8CH 1IQDA 1E4HA 5A6MA 4HK0A 2A4ZA 4LSQH 1MCNA 1XGYH 2XPGA 4CVUA 3BH9B 5FO9B 1JDCA 3UC0H 4LLQA 1JFQL 2PABA 2IIJA 4M7LT 3RX7A 3UPRB 3O6FD 3S9DB 2V2WB 1E4XI 3IGFA 1MHCB 4G7SB 5J1AA 1WICA 5BMFH 5JR1H 1NDTA 1CFQA 5JO5A 1DQDL 4RGOL 3NEXA 4Z7QF 1CDUA 3GMMA 1A6ZB 4HPYH 4W93A 1AQ8A 4G8IA 4ZMYA 4B9YA 3ZUNC 4Q9RL 3EGXB 2BZDA 4NS0A 4AE1A 2EUVA 3W3BA 4JRXB 3TH4T 1RPKA 3CFBB 3F84A 2VLLB 2VABB 4FZ8L 5EPMB 3QK0A 3GIVB 2ZSVA 5E99L 4PJBF 1ZVHA 2P42B 1SY6A 4L05A 4UT9A 3VXMB 4FA8A 1JPSL 4KOCA 3VX1A 1MNNA 4UMGA 1XCXA 3FF8A 4K8RC 2X2YA 4YWGH 2J72A 3JWNG 4FHBD 1DL7H 1UXSB 1MFDL 5JORB 1HH6A 4H8WC 5FHAL 3T8MA 4BZ2H 1RULL 1AKJD 1OGAB 3ILQD 3WNPA 1XL6A 1NLDH 4UQAA 1DJXA 2EIZB 3GS7A 3ARGA 1BZDA 3MRRA 1UC6A 3APDA 4QLRA 1S9YB 5CMAB 5KUMA 3ZSSA 1MAML 3N42B 3BSZA 3FH8A 5D1XB 1TSHA 4P57B 3L7FB 3QIUA 1KBGH 4YO0B 4IJ3C 3WNLA 1MQ8A 4BELD 3IS0X 5EU4B 1HYSC 3KBPA 2XRAH 1CG9B 3O6MH 3WI9A 3UMTA 3D51A 1W72H 3MLUH 4HWBH 5AYUL 4ELMF 3MCKA 4NPYA 1MF2H 2YA1A 3ZO0A 4JY5H 5DD5L 2BSSA 1WA0X 1S5IL 2HMIC 2RAMA 2DQ6A 4KKBD 2ZX6A 5DDHA 1P4LA 3GSNL 4F2ME 4LU5H 4F92B 2VZUA 3QCTL 2F8IA 4XCFL 2ICEA 1O9VA 5FYJH 1K8DB 3ZDXE 5D4HA 3T4YA 3V0JA 3V5KA 3CQPA 3DBXA 3D0LB 2A9NL 3CDFA 4TTDC 4XPHH 3WLWC 2X3AA 3QWOA 4AQOA 4EZJA 3WAKA 2BNQD 1FH5H 1YNKL 2RQ8A 3EH5B 4ZS6C 1BEYL 2YEZA 5LN4A 1ZT1A 3AXLA 5L8JB 5HGDB 3CJJA 4M1DL 5JA8B 2WHVA 2J4WL 2BLFA 5IBUG 3ZMNA 1S7SB 1W8NA 2DQDH 3GZPA 1WWAX 3OX8A 1OTSC 3S8GB 4MNGE 4AYMC 2L0DA 4WUKH 2NR6D 2DYPA 1J11A 4I48B 4G5ZL 4MA3B 3U2SA 3EFFB 4FQIH 3FTGB 3DDGA 1MWAH 3WFCL 5KWYC 1J8HD 5H35A 4M56A 4FABL 4WWOA 4FFZL 4JUSA 5E7FA 5J6GA 1X5FA 1S3KH 3FO9B 1E43A 4OCNC 5D2LF 4G72B 1RKRA 4YIQA 2GK0B 4P9HL 3S2AA 4WSJA 2YPLA 3IAPA 3DHUA 3O45A 1P69B 2EC9U 3L9RA 3CCHA 3RJOA 4DERA 1S7XA 1TJXA 1HN1A 1IMHC 1CK0L 3JZ7A 5ADOH 1YNTB 2FB4L 4P4RA 4Q4EA 2XYBA 1ZS8A 1AXSB 1BXVA 5ENWB 3V95A 1MWOA 2JELL 5JW5B 3BFWA 1A6AA 3OXRB 4D9LH 1O9ZA 5IQMA 2BVOB 3JQOB 3PNRB 1ZGLP 4GP8B 1D7BA 2NQ3A 5JHLH 4KHTL 2PO6B 2ITCB 2XN9E 3CZNA 3O3EA 1S9WB 3AS1A 4RRPG 3LRHA 4GG8A 1UWXH 2QKIB 5FYLD 2BOCB 5GGSB 4QJ5B 4KKCD 4E0RA 4GQPH 1A8JH 2ZCHL 2WINA 3B8YA 5CKGA 2R4RL 2W88A 5T33L 3D8MA 3H9SE 3U4BH 5I66A 1MFEL 2XZCL 3I3BA 3TL5A 3OG4B 4TOYL 2W0FA 4NO5B 5AW5B 2P8MA 5INCA 4N2DA 2RD0A 3LKOA 4WU5A 4UIMA 4WWKC 3L54A 1MXGA 5HHMD 2VDOH 3QRFM 2EVHA 1JZ7A 2DD8H 3BZEB 4N90D 1RP9A 5KEZA 3NIGB 4PJFF 1F90L 1NCNA 3ZHFA 5EF3A 1HXMA 4W9LC 3K72B 4X6CA 4APQC 3WDIA 4LL1A 5E4IA 1G6RB 1G9MH 1RFDH 1W6WA 2A5UA 2FJUB 1EBAA 1F11B 1EEZA 1OAJA 1V7ML 3PQYB 5F6HJ 3DLQR 5D6DA 1HH9A 4NHCH 2QVMA 1DQJB 4OD3H 4CN4A 1NPJA 1Z3GL 5BW7A 5DD6B 3QIBB 1GS7A 4J8RA 2OR7A 2NY7H 4KUCD 1JTPA 2JKLA 3MRKA 1UWEL 2ROXA 4HEPA 2YBGA 3GO1L 1F4YH 3PWJA 4AM0Q 4I2XB 4ODVH 3MUGB 3NABL 4YHPA 3OKOB 1JF5A 4IKNA 3I02B 2ZOWA 3QJHA 1J9RA 1LP9E 3HMWL 1H8SA 1UD2A 1HI6B 1FBIH 5CD3B 1KPVB 2IAMC 1PZ3A 2A4CA 2X4PA 1S9XB 3POCA 2X4RB 3FQRB 1XIWB 2Y7OA 5D7JC 2XBTA 2WXHA 4CDHA 2G2PA 4Z7VA 3QUMB 1IT9H 2Z31A 2FHBA 3U82B 4ISVA 3WHXA 1R5IA 2QSQA 3N44F 5H94B 1MW2A 3EOBA 4PJCE 3RWHB 1N12A 3SE8L 1QA9A 5I1JL 2BSTA 1OCWL 1BXAA 2COQA 1GHFL 1YEEL 5B39A 4H20H 2GJRA 4MXQD 3WEOA 2WXIA 3QZWG 1NAMH 1D6EB 3UO8B 5EIIB 2XVBA 4C56A 4P23C 1IGIH 3CFMA 3P4OA 1QLFB 5IOPA 1CQKA 2OMYB 3RIFK 4JK0D 4D3CL 4ZMTA 4YAQB 5ICUA 2DQTL 4ODSH 4R5TA 3TS8A 1PX4A 4PJ9A 4ZSOE 1EMTL 4K7PL 5FC9A 3S5LB 4OCSH 3A4AA 3M17B 3B9KA 2WGXA 1FGNH 2EDRA 4HKXA 1DQIA 2VIRB 2J6EL 2ZAIA 1KN2H 3VJ6A 1HWHB 5LAXA 3U2JA 5F1IB 4RIRA 1DQQA 2OLDA 3MX0A 4L8DA 4WIQA 3VSQA 2CO7A 2OL3L 2Y0SA 4GMTL 4QHKJ 4KVNL 3UPCA 2EXWC 2Y06H 4KI5C 1FG2B 4YHIA 1WC7B 1UB6A 3MLSL 4R90L 5HYJE 1FO0H 1CF8L 1KBKA 4BK8A 3QZMA 4PEEA 3VH8B 5B3NA 4FLOA 3CBJB 3FTYA 5GS0C 4O4YL 2QQNL 3C2AL 5IQ9A 1A6VH 2ZSWA 4XXDB 3VMPA 4OCRL 4DEWA 1UYWH 5DMKB