4ALAC

Structure of dengue virus diii in complex with fab 2h12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
92
structure length
78
Chain Sequence
b'AMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTRLITANPVVTKKEEPVNIEAEPPFGNIVIGIKALKINW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
molecule tags Immune system
source organism Dengue virus 3
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
total genus 10
structure length 78
sequence length 92
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4alaC00
1PJWA 2JSFA 4GSXA 3UZQB 3UZVA 5KVGE 3UAJA 5KVDE 3J27A 2JQMA 3P54A 1Z66A 4GT0A 1URZA 4X42A 2V33A 5B1CA 5LCVA 4AM0Q 4BZ1A 5JHMA 4FFZA 3C5XA 4FG0A 3C6EA 2R69A 5LBSA 5JHLA 1UZGA 2HG0A 4UTCA 5IREA 3MUUA 1OKEA 1RERA 3WE1A 3N43F 1ZTXE 5AAMC 2JV6A 3IRCA 5GZNA 3UYPB 4FFYA 3VTTA 1OANA 4UTAA 5GZOA 5KVEE 4UTBA 3N44F 1SVBA 2H0PA 5H37A 1OK8A 1TG8A 5LBVA 2R29A 4BZ2A 3UZEC 3N40F 1S6NA 4L5FE 2I69A 4UT9A 5IZ7A 2GG1A 5AAWC 1Z3RA 4UT6A 2P5PA 4ALAC 2ALAA 5KVFE 3N41F 3N42F 3J2PA 4AL8C 3G7TA
chains in the Genus database with same CATH superfamily
1DQTA 4M7LH 1NLBH 1LXMA 3QUMH 4R2GC 4GS7B 3BKCH 4W4NA 3ATBA 3JV5A 4BCZA 5EBWA 4KFZC 1NFKA 3J07A 4KY2A 5HYIA 5TFSH 1QQDB 1NMCB 2GT9A 2J72A 1QTPA 2HKHL 3TP4A 3A47A 3A3YB 2X1XR 3DRQA 2AANA 3EH2A 1XF2B 1F8TH 2XWDA 3O2WL 3AREA 4YHYB 2VSKB 2IH9A 1RCYA 4MQXC 4ZFGL 1H3GA 2VJ0A 3CX5J 2CO3A 4XXCC 3ZE1F 4Z7AA 1NC4D 4Q14A 5FECA 3IPEA 4F8PA 4PG2A 3GBML 1F90H 3QZMA 5CJXC 3IDYB 1RZFH 2V2TB 3VI3A 5D6DA 4OJDH 1J8HB 1D5ZA 4N68A 3BZ4B 1B2YA 2A9AA 1MCJA 2FUQA 3RWHB 3GMLB 4UT9L 4KXBA 4Z7UA 5IGXH 2FLRT 2A74A 4XOBA 1N3NA 3D5OF 1GOHA 3VD9A 5DXWA 3VD7A 1KCUL 1F58L 2UWEF 1UZ6F 3L13A 4ETYA 1AG0A 4HKJB 1E4XI 4LGRB 4NRYA 4BZ2H 1WIUA 1CD9B 3ATFA 3FTWA 1ZRUA 2LU5A 3MRHB 1M1XA 4LLMA 1TMCB 5C0CE 1QSFB 4UILL 1QTSA 2UX7A 3Q3GA 1WO2A 3IVKB 2CR0A 3L48A 3N2JA 2CRMA 4YSPA 3BD4A 4LVEA 2L7UA 1QFPA 1BA9A 1DJYA 5D70L 4UOW1 5AVSB 3JV6A 3NK4A 3IFPB 5HJ3B 5LGHH 4FHJA 5FR3A 3GUTA 1IC4H 3D85D 1MNUH 4LAQH 3UTOA 4LARL 1KXQE 3SN6N 3CDZA 4TSBH 3QJSB 1EXUB 2F74B 3GGWA 1D5XB 5GISH 4YXHH 2Y24A 3Q5OA 3BDYH 4ZZKA 3UTPE 1ORSB 4JZJA 2QR0B 1AXTL 1H0DA 4X6DF 1MWAB 4OIAA 1UA6H 3VRJA 3DYMA 4GXUM 1ZVNA 2CMRH 2HMID 4H4NA 4PWEA 5AW7B 25C8H 3TVMD 1KEMH 3IDIA 5DD0L 1CGTA 3T2NH 1CE6B 2ADGB 3CFDB 3I50H 4IRSC 3RZCC 2DJMA 3ZIMA 5KBKA 3RPBA 3UPRB 4L37A 4FNPA 3X3FH 4Y1AE 1T04B 3ZT6A 4OKVA 2QPEB 1F00I 3UTTE 2HJFA 2YIHA 1JYXA 1FL6A 4XO8A 4AIZB 1J5HA 3OPZL 2ICWB 4JPKH 5ADPH 5AKTA 5IOPA 2EIKB 5K9JH 4LESA 1IBYA 2XY2A 2G4GA 4PWJA 2FHCA 3S3JA 4HG4K 4U1SB 4BYHA 5T5FH 4NGHL 3MBXH 1IILE 2VSCA 4ZW7A 2YXVA 3D85A 4YQXH 3C60B 4ANKA 4ZNCD 1K72A 3WUWG 4X6FA 1IGML 3NCBB 5AZEH 3P0VL 1T6WA 3F58H 4OZHF 5L8LB 1TKWB 4MHHG 4CBPA 5BOZG 2R69L 4LLYA 1F2QA 1BBJB 3IMTA 2A9DA 3BWSA 1HJCA 4NZUL 4UQEA 1AE6L 3OB0H 5KSBF 2D7NA 3I6LE 5DJ2A 2Z64C 3DURB 2LFGA 4LSDA 4E5XB 2B0SH 3HNSL 1PZSA 1KEGH 1MFMA 3MV01 1O5DT 1BGXH 4O2EA 4AQEB 3WTTA 5ACLA 3GK8L 4RIRB 4MASA 1KGIA 1UT2A 3QXDB 1S6NA 1VSCA 2I69A 3HKFA 4IU3A 3I74A 2BOBB 3B5HA 3ZE2E 1PJ9A 3AM8C 5HPOA 4JFZH 1SXNA 3OXSA 3GTVA 2H7WA 1MH5B 2COVD 4RVBA 5F7LB 4ZX3A 3FFCA 35C8H 2WSPA 4XP6L 4NQEE 3V6ZB 1AY1H 4G43B 5T8IA 1WWCA 3I6GA 3VQ1C 2WZPA 4OI8A 2HVKA 4JKPH 1BSIA 1UADC 4OUUB 2W8CA 1ZXKA 4JZOA 1OCOB 3AS0A 3UZEC 1KCWA 4ZPTA 4GEIA 5I9QC 1NFDF 3GNML 1B6UA 2HFEA 1A14H 3KBFA 3L1FA 4FXGC 2ZAHA 4HJSA 3K91A 3RKDD 3OJDA 1TTBA 2QADB 5IEHA 4FGMA 2OK0L 2IJ0C 1NIDA 1FFPB 1L7IH 4UF7C 4K07A 1RLWA 1ZA6B 3RP1A 43C9A 4RFOH 3S3CB 3PHQB 3D0AA 3Q8EA 2WVVA 3BP7A 3QIBA 3FU0A 5E9DE 1CDHA 4B9PA 4JRYA 4L37B 2G2RA 4FC3E 2BSSB 5KS9E 5FUOH 4JGMA 5EF3A 1I9RL 1W91A 1XT5A 3J27A 2JQMA 4PJHE 3QCUL 3D39E 1T2XA 3AQZA 4TULH 3QA3B 1Q94A 5F9WC 4OZIE 3V4VH 3IDMA 2J8HA 3HW7A 1RZGA 3NFPA 3WEMA 1UT1A 3RVUD 1V7NL 3NK3A 3QCTH 4ZSOA 3TH3T 2APXA 1NEPA 3DSFH 3FB7A 4MD5A 3K1DA 3AG3B 1IBBA 3GXPA 1HXYA 4TM9A 5FKPA 3ECUA 2WGXA 1VEOA 4M43L 3TO4C 3P0YL 3FB5A 3EYQD 2J2ZB 3QDJE 4Q58C 4JDVA 1A3ZA 3QA3A 5F7FA 2JQAA 2GIXA 3KDMA 5C0CD 1S7UA 1U33A 2CWRA 3O3DA 4I1PA 4EVNA 1IGCL 5F3BA 3MV11 1I3GH 4N22A 3U7WL 5CLXA 4Z7OF 2NNCA 5G2NA 2K6ZA 3B3BA 2XTJB 1AD0B 4FFWD 3BKML 2HH0L 1FPTH 3I2CL 2MTPA 1RY7B 4L0YA 3P4LA 1FZMB 5LXGH 2CGZA 4N85A 2OL3B 1I7UB 4W4OA 3X11B 3V52H 7CGTA 3C5ZD 1XIWB 4HJGA 3IU4H 5F6HI 1M53A 4JDTH 5E6ID 3M17B 4NYLA 1X7TA 3CX5K 1P1ZB 1EO8L 1MFCL 1KLGA 2G0LA 2JJSA 4MCZA 1H9DA 1YEJL 4A37A 3NZHH 1KV3A 4JS7A 5HGDB 3KPRE 1U95B 3D50A 4X9HA 4F33A 5J56B 3TOPA 4KVCH 5DMYA 2ODIA 3BQVA 3DHPA 5KW9H 3JT0A 4XO9A 5DMGC 3KS0H 3ZSTA 5I8OL 3LQAL 3O9WB 2PTTB 2NXZC 2YLKA 3GSRA 4AOFA 1H5BB 1H3WM 2I32A 4L4JA 1EXGA 1FH5H 3Q2VA 4RAUA 5E2TL 4Z7VB 1T5XB 4KROB 4APQD 2O6FA 5LN8A 5HGDA 3PHQA 4OGAD 5CP3H 2VAAA 3NG5A 3ESPA 2H3KA 3BDXA 5JIHA 3IF1B 2FECL 2R2HA 2Y1ZA 3P9LB 4GBXB 3BZEA 3OR7B 5CZVL 3V5DA 2Z0UA 3KPRD 3FUHA 2QGDA 5CWSA 4MFHA 4B3EA 4A55A 4I48A 5LBSA 4EDWL 3EO1B 3OG4B 4YL4A 4GI6A 5IREA 1TJHL 5IEKA 1IFGA 1XZ0B 3BWZA 4FXLA 1J7VR 2MFNA 2G60H 1A7NH 3HR6A 2EXTA 3WUWA 1BBDL 4FQIL 1UWXK 4TF4A 3EJYC 1XGYL 3G9VA 2A1WL 3QVAA 1NEZB 1WAEA 1S8DB 3MFFA 2NY5C 1MZZA 5C0JA 2AXFB 4XC1L 4G82A 1KCKA 3GLEA 2WTRA 3K72B 5FYJE 2BRRH 2ORBH 43CAA 1EAQA 2CCVA 3TX4A 5D2LA 3VWKA 4GIPD 3EYUH 4DK5A 3ARWA 2Z3FA 3AY2A 2NY3D 4NJAH 3AWEA 4AYSA 4YGVB 3QYNA 3DOSA 1WSST 4OLYH 5I15L 4IYKA 4L48A 4NAQA 2QQLH 4UM9D 2FATH 9PCYA 3NEEA 5HYQA 3QDME 4FA7B 5L2JA 4EDXA 4HULB 3ERXA 1L9SA 1RSFA 1W8OA 1XF2A 2PXYA 3EGXA 4G8GA 4I85A 1OP5K 4X4XB 1RVFH 2FEDD 3V9CA 1JPGB 2Q86A 3EJUA 2Y3AA 1AS8A 4TNFA 4M93C 2CBOA 1S2EA 3T0BA 4JM2B 2XN1A 5D2LB 4BSVB 1PS3A 5HJGA 4LOVA 2X3AA 1MFEH 1P84K 1MEXL 1OCWH 2JELL 2ISDA 4KHXL 2GI0A 4CGTA 2F19H 5FOBA 5IZ7A 5CO1A 1FZOA 1PDKB 3VXRB 1CGYA 2AJXL 4PUBH 2V0AA 3EYSH 4KY1H 4MAYA 4QXGH 2EEFA 1TZAA 2CDEB 1TSHA 4LRIA 3B7YA 5F7DB 3US9A 1MJJA 3SDXB 1EZVX 2WSKA 4JRXE 3IMWA 1EEZA 1G6RA 3TO4A 1E9QB 2VLME 3QNZA 1AZUA 4Y16B 3CFCL 2DLIA 3F12B 5FO2A 1PNDA 2BVPB 4UTBA 5ALBL 4A6YH 5E4EB 5IJKC 4WI0A 2B4CH 4X6BA 4MMXC 2PETA 4JVUA 1FYTD 3VXTA 4NQCB 1SOSA 2ZONA 4O2FB 2XQ0A 4AJ0A 1C7SA 3IKCB 4FNQA 1UD8A 2HX8A 3B6SA 1R5WB 2BY1A 1A3RH 4ES9A 3ZKXB 5AD0A 2VMFA 1T20B 3MMEA 2PCPB 4G3YL 4RNRA 1KXQA 3ISWA 3UJTH 4GEJA 1DBJL 1YQVH 1Z2KA 32C2B 5L8KB 4WKZB 1CIUA 2DKMA 5E4AA 4HISA 4PJCF 1NFDB 4HSQA 3CZKA 2NDFA 1WGVA 3LXCA 2PWGA 2ED9A 5L6YH 4ODUB 3RIAF 2H8PB 3MUY1 1Y1DA 1AJ7H 1NGWA 5B1AB 3EXJA 1SHXA 4DTGL 2A6KA 1ZHLB 3QNXA 4NLAA 4CMMA 3LVEA 4OAWB 5KSUB 2UZPA 4TS6A 1BG9A 4O2FA 3BSZH 1ROCA 3LRSA 2GEQA 2LU7A 3N50A 2OXGA 5DT1H 3WJLA 2W9EL 2BP0A 1I3RA 4G6AC 2QKIA 1I8LA 2DQFA 2GTWB 2PCPA 4GRWE 4JFUA 4PTUA 3T8VA 4WEEA 3HNVL 3O6MH 5FHAH 4K3JL 4XI5C 2EIDA 1OPOA 2WZ0A 1UZGA 3FJTA 3S48A 3SOTA 1S3KH 4HKJA 2ED7A 2X4UB 1P4UA 5EU6D 3VFUA 4B7IA 1PFOA 1FGVH 2MTAA 2YGNA 4XPBH 2R29A 5JZ7D 2P7TB 1IE5A 1A6ZA 4EOWH 1VFAB 2BIMA 4JFTA 3DTUB 5IVZB 2N59A 1ZD6A 3BQUC 3OMAB 3J2PA 4Z8FH 3GMMA 3OF6D 3DX9A 3S96A 5LGHL 5JW5B 3NIDB 2I9LB 4GRWB 1X5YA 4LAQL 1MNUL 4PHXA 2QQQA 3MLVL 4NO3B 2E74C 4L05A 4NBXB 5DQJB 2KS0A 2ZE0A 3MNDA 2W9DL 1N6VA 4HIHA 1OP4A 1HDMA 5FF6A 5CBAB 4NKMB 3LRLA 2N1TE 3T3PB 2XZCH 1CYGA 4RWHA 1M1SA 5D7IB 1WZLA 5G55A 3HC0B 5J4MA 4BK5C 4HBQA 3BEVA 3N42F 4JQIA 4NQCD 4AQEA 2YPLE 2Z7ZA 4B0MB 1NFDE 3HBPA 5GGVL 4RZCA 3BPLB 1JE6A 4LQFH 2OR8A 2N0MA 1S3RA 1SXCA 3G6JA 3T0EC 1Z5LA 2B9BA 4N5EC 4FRWA 3SDAA 5I30L 2H3NB 1JV5A 1CGVA 3TBBA 1ML0A 1JHKH 1DQIA 3NIGB 1D7DA 5JHDE 1DLFL 3QPKA 4L8CA 3GIZH 1QYGL 2KL6A 3C9NA 4LNRB 3FO9A 4QLRA 3SYOA 2FX8L 1A1MA 3NQIA 5E2UH 2P8MA 3E6FA 4JFHD 5DJ8B 2YD9A 4RGND 5BVPH 4IBTA 4U1GB 5KOVC 1OP9A 2BP8A 2CDFB 1AIFB 3RUGE 2Y5QA 4F8LA 5GZOD 4PI0A 5E2VL 5CKGA 3I6SA 4JR9L 1J5DA 2GVYA 4PTTA 5EN2B 1U58A 2FK9A 3V0IA 2HFEB 5BQ7B 5IROD 1BLNB 3BFWA 3MLWL 3EIFA 1NAMH 2ZCHH 4KVNH 2IQ9H 3ULVE 5C9JB 1N6QH 5GS3A 2EXYC 3LZFH 2YRBA 3RWCA 4AYBA 3OHXA 2YBRA 3ARZA 3EFOA 4UOJA 4HEME 5INDB 2X0WA 5LUMA 3QNYA 1I8AA 5D2LE 3ZTCC 1AGBB 1JGEB 2RFXA 2XPYA 3ECVA 2EDDA 4M5ZH 1T3FB 4LP8A 2TAAA 1JNNL 3DYOA 3KBPA 3KLQA 1GC1L 5KSVB 2EEBA 5JOPE 4A2HA 1SY6H 4J6IA 2PPEA 1B6DA 1NIAA 1NFIA 3CDZB 2CKBH 3ZDXB 5C0FA 1WFNA 3PNWB 3RVVD 1EFQA 2Q87A 3L5WB 3MC0A 1HWHB 3L9RB 3OKKB 1E28A 1L5GA 1PY9A 3MI6A 1XGUA 3D09A 1M4KA 4C56D 2YFNA 4E5XA 4MD0B 2P8PB 5H35B 1L9MA 4JKPL 1LQBC 2HT3C 4O2EB 1DEDA 4P06A 3IDNA 1DVFA 5DZNA 5GZOA 1KV7A 5BOPA 1P6WA 4PLKC 1HKLL 1DCLA 3DX6A 3ZSSA 5DRZB 1BXUA 1PY4A 5ALCL 2QHRL 4BKTC 3NEOA 1YHPA 2YPLB 4KMQA 4I0PC 1QPKA 1LP9F 1NOAA 4QOKE 3N91A 3ZTEA 1N7MH 4KKLC 3KS0J 1BMWA 4OZFG 1U93B 3IE4A 4ZMZA 1UM6L 3D25B 4ENEC 5IB1A 1OM3L 3WE6B 5CEZH 2L7QA 2Z91B 1GGUA 1MUJB 4NO5A 4ZAKC 3ULUE 1O9ZA 3KWVA 1BIIA 3LV3A 3R4RA 5HGAB 1U4EA 4HD5A 4JDEA 3HPLB 2FHBA 4LCIL 1KIQA 1S7VA 1ANUA 1TJIH 4M6ML 3WJJA 5K33A 3BVNA 3LNIA 2BS9A 3FUNA 3BPOC 1U8KB 3ARDB 1QBAA 1U9KA 4YHPA 3UFIA 2FSEB 1BFSA 3PCYA 4U1IA 3CZLA 3TBVA 3EH5B 5FX3A 2IAAC 2OXHA 4BXSV 4LSUH 2D03L 4Z7VE 1KFAH 1A7OL 4YVNA 4A6YA 4N4YB 4EI0A 4RGOH 4WWOA 4NC2B 4XN7A 4W70A 3V4UL 3FB7B 4JCLA 3A0OA 4Q56A 3QQXA 3WEAA 4M43H 1CCZA 4LEXH 3PGDB 4K8RL 5IP4A 5AOKA 5KVEE 3BO8A 1KBWA 3MLTB 5FYLH 1SOQA 3KGUA 2CR6A 5I5IA 1QNZL 3ZGIA 4XNMB 3S3SA 3LXUX 2JXMB 2FSEA 2KZBA 4XMUA 4NUJA 3SDXE 2WWMC 3D9AH 5BVJB 3FUIA 3TXAA 2VN4A 4P59H 3IWVA 3D0LB 3VGHA 1BG1A 1HNYA 2X87A 3ME0B 2GC4C 1BZQK 1KELL 3QXAA 5FYKE 4JM2C 2KQMA 3VXQB 3MA7B 1EJ6A 5ECGA 4ZI8A 1HYSD 1JK8A 1NIBA 2BVOA 1SJEA 2JJWA 1IAKB 1T2QH 1AC0A 3MR9A 4LIQL 5CGTA 5TDOA 3WE1A 4EKXA 5IMKB 1BYOA 5EULV 1V3JA 3MNMA 4LSVH 5DRXA 4W9FC 4E9XA 3RWGA 2NTFA 3DX8B 1RIUH 2P5WB 1CGWA 2WLIB 3ARYA 3VA2C 1AGDB 4YHIA 3TZVC 4PRDA 4I0PA 3MODH 4KQ0A 2CJUH 3DKHA 4C57C 4WO0A 4IBQA 5L9DL 1JMZA 4AUJA 3INUL 1F18A 1X4YA 3VDCA 7FABL 3DYPA 1NINA 3GSUA 5B3NA 5MEPA 1M2VA 4ZDHA 2GEEA 1U8PB 1MJ8L 3ATEA 3H3BC 1KIRA 2VR9A 5HJBA 2J88H 1L4IA 5DU7A 4KKZA 2AXGB 5CZRA 1I75A 3PABA 3SGDH 5AALA 1E5YA 1U8OB 2ZOKA 3MRCA 5GS2H 3EFDH 1W72L 2XN9B 1NMCC 2E7DA 3BLPX 2E47A 4R84A 1G7JB 4FXKC 4YGVA 3VRIA 2WWKT 5IVXA 3B7RL 3LS4L 1EO5A 4U05A 1M71B 1F86A 2R0ZH 3TA4D 4E9QA 3KCPA 3VFSA 4J3TA 4ZW6A 1NC4A 3K80A 4IIZA 1P2CA 5SWZA 3ULAB 5BUAA 3NIGF 3OKOB 4A39A 3S3BB 4D0CB 4Y4HA 2EE3A 4GRWH 1Z6JT 1X3DA 2YQ3A 3SD2A 4G9FB 3RFZC 3ARBB 1C7TA 1R4XA 3QXVA 4UQIM 4OQTL 3B9KB 3O3DB 1UA6L 4N2CA 1GW0A 1XGYH 4XB3A 3WUWB 1S7TA 2WWMD 4Z7UF 4X6CB 3ZRFC 2W60B 3A22A 2DLEA 5F1SA 4LAJH 1E8WA 4LCYB 4QGYA 4FOMA 1CF8H 2PUQT 2QLYA 2WZ5A 4HMEA 3WFCH 4LVHB 4MS6A 4Z3TA 1BZDA 3L3GB 3EDKA 4HCRL 1GMEA 5JIQA 2BZ7A 2C7FA 4M48H 1H3TA 3HS9A 4M7JH 4OIBA 1U4FA 1D7BA 4G9FA 4L4VA 1DQJB 3MNWA 3IS0X 5AEAA 4P2YA 4IOFC 4OBSA 3RJQB 1G6RL 4R96A 4W9KC 3W0WD 3MAWA 3HE6D 3GJFB 4M8QB 4PJ5D 3P1VA 1G7QA 3CZFB 3GHEH 1Q0YL 4L8DA 5D7IF 5IVXE 3PP4L 4AC2A 1A5FH 3GSWB 1DR9A 4XMWA 5BS0A 3VWJA 3EOYG 4PJEF 4H1LB 3L4WA 3HMWL 4BV1A 4QUOA 4OF5A 2WBXA 1O6TA 3GHBL 4I77H 4WWNA 3TBSB 1T20A 3BUBA 3MMEB 5EZLA 3EOTL 1TG8A 1GGYA 2XV0A 2OMBA 3FQRA 5K59F 2Y6SD 1F1DA 3FONB 2K9FB 2QTVA 4NQDA 3QXTA 8PAZA 2WMPB 1EX0A 4RDQF 4ZFFA 1OTUD 1BV8A 3MLUH 5CGMA 4KUZH 4BFFA 1AGDA 4DO6A 1CI5A 5D7SL 4DHLA 3PWNA 2AZUA 4E42A 5DCCA 4OFVA 2CHDA 3OHXC 4ODXA 1BXXA 3QUHA 2VMJA 3HI1B 4W6WB 1FNGB 1WISA 1PZUB 5F9JB 3OAYK 4ESKA 4HV8B 2IDFA 4JDZA 1MHCB 2L04A 4ZXBC 4HHWA 5AW3B 4ZMVA 3EJZC 1HHHA 4JW3A 4N0CC 3OKDA 4HX1B 4TVPH 5C08E 3MRBA 4M9PA 1MJJB 3G5ZA 4HQQH 3V6OA 5KZCB 3JWDH 4TUKH 4CSTA 3CE1A 2J6EL 3ABLB 1T6BX 3RB7A 4YSUA 5C0ND 2ICCA 2O93L 5CZXC 1DJZA 1NIFA 2AQSA 4MDIA 2IAMA 1HXKA 4HUVB 2BHUA 3OMNB 1BLIA 3CFQA 3MU3A 5E70A 1C5BH 4TV3A 4JDZB 4XMXA 2BFGA 1NQBA 2NYYC 2UY6B 3GNMH 4NIYE 3I6KB 2NY2D 3DK0A 3P4NB 1QAWA 2RBLA 2ZWLT 5HHOD 1HINH 4NNPH 2GJJA 3FOLB 3Q1EA 3NH7L 1WCBA 4HGMA 4XHJC 4F24A 1CXIA 4R0LA 3CN3A 2YD7A 4CSZA 5FECB 1YEDB 1ECZA 3RX9A 2P8LB 2OK0H 4W6YB 1YEHH 1WVZA 3L3HB 2VISA 1F3DH 1K4DA 2YD8A 2F53D 3OKEA 4NHCH 2MJWA 3LIZA 4OF7A 3ASNB 3STLA 2Z4QA 2IMMA 2WIIB 3B7UX 4XPTL 1DFXA 5F71A 1NPNA 4GSQA 4IM8A 4P3WA 2ESVA 3SE6A 4Y5VB 4B9KC 3VI3F 5FUOL 1ESOA 1G9NL 3LDBC 1PZAA 3MO1B 4WF7A 1OW0A 3U0TA 2Q3AA 5IB2B 2Y5EA 5BV7L 1KENH 1CFTA 1Z5YD 4BFEA 3CXFA 4ZUUA 3VFPA 1OP3H 5I18L 5D8JL 2X0UA 1YNLL 2VDOH 3EUDA 1LDSA 3GZQA 5EA0H 3DJSA 1PKQE 3MGTA 4OCSL 3AWGA 3CC1A 5BMFL 4OZIB 3GKZA 4XMVA 2XNAB 3VJ6B 1XCXA 2EEAA 3L17A 5F0MB 2VZ1A 3KYNA 3MRNB 3P9WB 3FRPB 4MKMA 3BMWA 1P4IH 3HG3A 3L6FB 3S4SA 1QLEL 4G2AA 2I60H 3CSYA 1I8LC 5FAAA 3VH8G 4U1NB 2PW1A 4PG9A 5FFOA 1AGFA 2H32H 3VYNA 4F20A 1ND0B 4FQQA 3VFTB 4KO6A 3ZJAA 3GSQA 4ES8A 2VW7A 5HYJA 3NRQA 1MCBA 4WFGE 1E9OB 2WBJA 4RGNE 4Z0BH 1CR9H 1YMMA 2GUYA 3SB3A 3ZQ9A 4BRJA 3O8XB 2DLFL 1VFBA 4K5LA 2A4ZA 3DV4A 1V7MH 4RRPM 1XGQA 2GJZB 4LL4A 3ECBB 5H4YA 2DL9A 4HSAC 4FYQA 5JXAL 1RFDH 3IGAB 1XSJA 5E8PA 3V52L 4MMXB 4P2RD 1FO0L 2XQBL 1QLFB 1PLCA 5D5ME 3PAYA 1JSYA 3KJ6H 1C9SA 4MMZB 2C3HA 1EANA 3KPLB 4PREB 1H3XA 3G5WA 3MRDB 3NA9L 1TQBB 4XHJD 3PIQB 3KHQA 2CO4A 3ULVF 2Y7OA 5E9DD 1HL4A 5J89A 2EVJA 2D9CA 2MPVA 4ICWA 43C9B 3C09B 2IV8A 1CBVH 4G8IB 5E2VH 4U1GC 1ONQA 2W0FA 1BQHB 1S4IA 4Y19A 4ADGA 3LQAH 4Z7QB 3VI4A 3C5ZC 4PP2B 4HJ0C 3RVXC 3WS3A 4L29A 3CBRA 2XPGB 3EGDA 2DWDA 4AQ8C 2B14A 3GT6A 1UB5B 3VRLE 3T2LA 4JFOA 1AP2B 2IOIA 2HLAB 2KPWA 2UYLB 3O6FA 3E6FB 1F13A 1USZA 3NABH 4PS8A 4P23B 3RPKA 1H8SA 4L23A 1GR7A 5JXEC 3HB3C 5I0DA 5EZOL 1UM4L 3P3SA 3LKSB 5CEXA 5IT2H 5CILH 4GKNA 1MCWW 3PFUA 5I1EL 2VDRH 4UIMB 4YUEL 2ZF8A 3F84A 3SGEH 5ES4B 4ALAH 3DIVA 1UXSA 2DMKA 3HG5A 4GFTB 2O5XH 4IKIA 1OAYL 2C1PB 3FNKA 3QIUC 4MX7B 4FNSA 4XAKE 4JKLA 4NUMA 4WK2B 3LKQB 3O3BB 5EU4B 3GMRA 1GHFL 4DP5X 5FA3B 4P2OA 4PGEA 4FG2A 3MRGB 3GMNA 2VXTL 1QMUA 1FQ9C 5D7IA 3LZRA 5SWSA 4MQ7A 4XRCB 1R3JA 2CKBB 1OOAA 4XCNB 1F5WA 4NQEB 1UWYA 1WTGT 5TGBA 1O6SA 1Z9MA 4D0BB 4KKRA 2LU4A 5GS0H 3WDIA 4FI8A 2HP4A 4AGOA 4A67A 1N7ML 1AQKL 1A1OA 3QEGL 4WSKA 3BOVA 5I28A 4U1HA 2A7BA 1W72B 3T04D 2OA9A 3OKYA 2WAQA 2H1LM 1E9OA 5GGSB 5IHZB 3WFZA 2IC2A 1Q9KB 5DFTA 4MCZB 3KWUA 1Z0MA 5EZJB 1ZA6A 3EJYD 4NC1C 1WCQA 5IJCC 3L95A 5IB1B 2E59A 2IXQB 4XPHH 1S7WB 1ZTXH 3KPTA 4GI9A 1SOKA 4F1SA 5E9NA 5IM7B 3W82A 3ZBMA 1JK8B 2J25A 3C60D 1DFBH 3HPJB 4X4YA 2O5ZH 1UA3A 5HI3C 3OAUL 3KPQB 3MLRL 1SFDA 1RURL 3TWCL 1VKXA 5KSAC 3TJHC 5EC1A 2FUTA 3IXAB 1IGTA 2H0JA 2I25N 5ITBH 4BSWB 2Q8BL 1A8ZA 1I1YB 2P48B 2V9RA 4K2UH 4K3HA 3REVA 2WO2B 2MIZA 3K6SA 1Q9LA 4EI6B 4K94H 4Y0GA 1MAKA 2BHFA 2UZYB 1Q1JH 4B5ZA 4GRMA 3C6LD 4ZFOL 4GUCA 4Q2ZA 3MCYA 4PJ7E 3TEYA 1X7SA 4NBYB 4KQ3L 1HXYB 3QWRA 2BNUA 1T66C 4N20A 1W0VA 3JTTB 2VAJA 2ED6A 2NQCA 4Z5RB 1A47A 3TGXA 4M8UA 2WXGA 3HN3A 5L88H 3B2DC 3HLKA 4R2GD 2WWNA 1WFIA 3D8MA 1FIGH 4H2AA 5AAPA 1YDPA 4ABVA 4ZTPL 2ITEA 4D0DA 2DDQL 4L1BA 2B7DT 4OJCA 4OQ1A 2C5DC 2J8UE 5CCKL 2WBJC 2BXZA 4NFCA 2YMXH 3ARGA 1VPOL 2WM0A 4FF9A 3EJRA 5DR5H 1YYLL 4PJFA 4UYQA 2X4NA 5PAZA 3TONA 2EIZB 3HFFA 4CC0A 2G2RB 3KPOA 4OZIF 1IC7L 2IDTA 3HG2A 1T1YA 4DGVH 4C56A 2FNWA 3L3IA 2DQTH 4NZJA 5DRXB 5D1XA 2RALA 4KQ4L 1BVNT 1AJ7L 1VA9A 5I75C 5KEZA 5HBBA 3NJJA 5DVNA 2DI8A 3P30L 4BZ2L 4DTGH 5A7BA 1D5MB 4I3RL 4KH9A 2AP2A 3CUPB 3SO3C 4KRNA 1CD1B 3WLWC 3D2TA 1I8KA 2EDEA 4FQXD 5E94B 4WNSA 5LKNA 5DLMH 3SHSA 3CFBA 4PBWD 3ARGB 1VADB 2GG1A 3ZHNA 3CXHK 1R0AL 1WZMA 5D70H 2MCG1 1D5IL 2Z31B 3WAJA 5HGHB 1AGEB 1TZOA 1T0NA 3QG7L 4WO4C 4B53A 2F5AH 4HT1L 1HH9B 1GPOL 4MYWB 5F96H 5C7XL 2OX5B 1FN4B 3MBEB 4KKBD 1JGIA 1W72H 2MCPL 3OKMB 4AYID 3EFFA 2COQA 2FEJA 1S7UB 4QIRA 1FBIH 2CGRL 4G8GE 3RIAK 2ADYA 2O6CA 1LO3H 5DD6A 3SDYH 1XBDA 1KXVC 3VD2A 4F5CA 3CPLB 1ZLEA 2ZF9A 5KSBB 1DDHA 1AXSB 1WD9A 1EZVY 5AW9B 3RX7A 5IMLA 3FO2A 4LMQI 3HZMA 1UC6A 4GXVH 1LMIA 4NAMA 3CZNA 1USQA 5AW6B 4HF5H 3W57A 1YEWA 2WKOA 5AOIA 3KYOB 2OX5A 1M42A 5DUJA 2J4WH 1EGJL 4PRPB 4IDJH 5F2FA 1JZGA 2B15A 2C7UB 2CU9A 3CC5A 4YFLI 5LAPA 3QARA 3HCVA 4AKQA 1S8DA 1M57B 2CO7A 2IIJA 5DQ9A 4JRYB 3PREA 3THMH 1J8HE 5LJYH 4R8WL 1EH9A 3GHPA 4LU5H 4JAMA 2NDGA 4U1LB 4CUCA 3RA7H 1JYWA 2NNFA 1A8JH 3HC2A 4FNLL 3F58L 2ATPA 3NGBC 3DHMA 1DVZA 3FT2A 1PCSA 3UBXI 3U9PH 4B5EA 5FIEA 4HGWB 3EOAA 3SDDB 1FLRH 4WJKB 2W60A 1INDL 5JPMB 2WVTA 4PJAE 2GK0A 1HX0A 3RZWA 3II2A 2Q1EA 4JUSA 3W9DA 1Q38A 4FQ1H 5TE4H 3HI6H 1EMTL 3BSZA 3SE3C 3JZ7A 3Q2LA 4Y7MA 1A7QH 4ZO7A 1I1FA 1PEZA 2YA1A 4PJIF 5T1DH 3S34H 1JZ4A 3PP3K 4KVNL 5DEJA 4TNVF 4GNKB 3WKML 3Q6FB 2E86A 4P4RA 3RL1B 1BFVL 1NUNB 4HS3B 2IV9A 4KMLB 3F7RA 3BW9B 2PXYC 5IESH 2VH5L 3HMXH 2APTA 4N28A 4I5BB 4L5FH 2YN3A 4LSSH 1M3IA 3V4VA 3SCMB 4Q6KA 1T0OA 5E1HB 2AKRA 3BCDA 2WLLB 1I3UA 3LTVA 1KYAA 4M1CD 1SVCP 4Y9BA 1EXHA 3UTSD 5DD3H 4LSRH 1MW2A 1HH9A 5TE7L 4ZPVA 1JVLA 3MRBB 4DKEH 1J0ZA 3SKUD 3MACH 1RI8A 2VABB 3M17A 1MCPL 1U2YA 4Y5YB 3ARFA 2GTQA 2BFVH 3CH8A 4IRJA 4JFFA 1Z5HA 4FCHA 2ZKHH 4LPCA 4QTIL 4Y19E 1KPRB 4N5UA 1PD1A 2GSGA 3RILA 4LLUB 2ZUQB 1XGRB 2GI7A 1L7IL 4WWKB 4BCXA 4QO1A 1H6UA 1RLBA 4A7GA 5MP6L 4NN6C 4KRLB 4NOBA 3V6BR 4UQ2A 1ZS8B 3F2LA 3LPFA 5K69A 1SUHA 4Z7UB 4ZS7L 1B3JA 3QIWB 4KMTL 3SDXF 1BZ7B 4YHKH 1HINL 4QRPB 3WFHB 2D4DA 3H2QA 4YHOH 5HTSA 3L81A 4N8VA 3MRPA 1HNFA 4KJWC 1BYNA 1BQHG 1Z5LB 1NGQL 4HOMA 2J57A 1NM4A 1SYVB 2QPDB 4HH9B 3MX0B 3S88L 3NN8A 4FKEA 4PRPA 4LCCC 1DQLH 2JB5H 4B9FA 3CFNA 4XPTH 4JZJC 2F8IA 5CEZL 3MRJB 5BRQA 3UBXG 1ZWIB 1OF2B 2FT7A 3L3OA 1BFTA 4HJJL 3I9PA 1JWSA 2KZ1B 3V7AG 1MFBH 4JZNB 2DJUA 1J8KA 3AREB 4JPVH 4Y5XB 4MJJA 1SLUA 1YNLH 3PDOA 4MA3B 1EXUA 1KGJA 2F74A 3GGWB 1B9KA 4OM0L 2KT6A 5DVLA 5TQ0H 2X4QA 4A7TA 5BMFH 2P80D 4YDKL 3QNZB 2X4PA 4MA8L 4Y16A 1DJWA 2NSXA 4ODSL 2F1BA 4JFEB 2D03H 3DMMB 3BKJH 5DUPH 3V4PB 4IMKA 3N40P 2ZD0A 4UT7L 5INDA 3ES6B 2VDKL 2R8SL 2GW5A 3RTQD 1R9FA 3PYCA 1OPGL 4F57L 2I60L 3CHRA 3A4EA 3UP1A 4AEFA 2E5EA 1CICD 3CZSA 3MREA 2LVEA 1CB4A 1SMAA 2WK2A 3WTUA 3VB8A 4YSSA 4HEMA 4NZTL 1VAHA 4EJ1C 4EUPH 1BOGB 3HZKB 3O2DA 1TZIB 3MRQA 3PUCA 1UB5A 1YNTB 1YY8A 3HN8A 2ALWA 1M05B 4FG4A 4P59L 3AG1B 5DJDA 5T5FA 3K6OA 4J8QA 3KLDA 4GG6B 4ADJA 5E1AA 3CHXA 4JANA 5HHPB 3RWHA 1F42A 3CXDL 4UINL 4DKFH 5L2KE 3QI9D 3VH8A 3DECA 4F91B 5AOLA 2YRPA 5GXBB 2FWLB 1FFNA 1FO0H 5B39G 2BP0B 2C4XA 2Q20A 3EDFA 3JWDC 15C8H 1EBPA 1CXEA 1QZ1A 3KJ6L 1SN2A 4G7YL 4MMXA 4UQ3A 1KLFB 2ARJB 4D3CL 1PLAA 1JV5B 2WTPA 4RMRA 2NR6C 3PGCB 4J1UB 3WELA 4EAEA 4L8CB 1UWFA 5C0GA 3QFJB 4G6KL 2F58L 3WIIH 1ZE3C 5E6ZA 5C86A 1V3LA 3MRGA 1FNEA 2K6WA 2QR0A 4DETA 3PWVB 3R4DA 3C8DA 1F1GA 4FQHB 4XNZC 5KJ4A 3BAYA 3VTAA 7FABH 4RX4D 2AW2A 2Q6WA 2CPCA 2XOTA 4WY7L 4A2DA 1N5AA 1ED3A 1VEPA 3FQ4A 5F97E 3T6WA 1MJ8H 3H9SA 4UIKH 5FB8B 3M1OA 5ANMA 4XC3H 3CHPA 1G6RB 2YMOA 3IDGB 1MVUB 5EOTA 5GS1C 5DQJA 2EADA 4XE0A 1FFOA 3RY6C 1BM7A 1IC4L 2L0DA 3N44F 3GRWA 1QR1B 4P0DA 2EVIA 2DQHL 4P2QD 2D8KA 4LCWA 5E51A 2YBRB 2W65A 1A4JB 3ZLQC 1WLHA 3ARUA 3LS4H 4UZUA 2FBJH 3LZPA 2EXWD 12E8H 4FJ6A 3KYNB 1ZOXA 3MRNA 4ODHL 1FFRA 4OCWL 1YAZA 3WHXA 3ZDYF 1X5XA 1ILSA 3ZGHA 4PP2A 3CVHH 1YMHA 2FDBP 3I50L 4X83A 5HYJD 3KPMA 3VI4F 5B38A 3U6RB 3RVWC 3CIAA 2WUCH 3IDGA 3MRMA 1MW3A 4ACTA 3F85A 3LEYH 1MFAH 3P9MB 4OM1H 3RTLA 3S35X 3ZKNC 1OWWA 2CDGB 2D9QB 3T2PA 2HJLA 4EI5D 3C9NB 3S3DB 3ESMA 3JUYA 3MUZ1 1JGDA 5D6DC 5C0DB 1U91B 1VJSA 2P3YA 5HDBF 3LRSB 4HXAL 4WGWB 3LMJH 1DQQB 4PY8J 5E8DH 4F8OA 4NQDE 3VXUE 2GUOB 4MDJA 3FSAA 1O6SB 1TITA 4WO4D 5E8PB 5EUKA 3G6AB 1XCWA 3FT3A 1G94A 4PJDE 4AG4H 3FO1B 4P2RB 1IGMH 3NZSA 4L3EA 5EO9B 4R5XA 4MQXD 3KPLA 3EJCA 2EO9A 4WU5A 3D69B 2EIBA 1H5BC 4KK6D 4PGEB 5GJTH 4UM8B 3PWPD 3SJVE 5T3ZE 1WIPA 2CO1A 2YZ1A 2V8LA 4YHMH 4I0PB 1IC1A 4UV7H 5KJRH 1ECYA 2RR3A 3H7LA 1OGAB 4CW1A 3DX7B 4KKNA 4L2YA 2A9BA 3SDCD 1QRNA 3LSOB 3OAZH 3QYCA 4KY1L 3EOTH 4NNYB 2A9NL 2IOMA 1BJ1H 1JXFA 2D7TL 4JB9H 5TDPA 3GFUA 2A9MH 5EC1B 1EAPB 3WL9B 4YBQC 5G4OA 3WNJA 5DHYB 1TQCC 2QMKA 1YN6A 4RA3A 3L1OH 4GQZA 1S46A 1FL3B 3DHJA 5HDQL 5T3ZL 2M1KA 2LOEA 3QQNA 4BELD 3QJHB 1YEIH 3FOMB 4PCSA 2XXGA 4PWIA 3AWFA 4HKBB 1FUNA 2VXUL 2FX9H 3ZDWA 4GKSA 3JYCA 4FZ8L 1R24B 1XHHA 3FMGH 3TN0B 5FPIA 5E8NA 5IG7A 2PYFB 5I1AB 5IQ7H 1VCBC 4G6AD 4HQQL 4IBUA 5GRUH 1UZ8B 1SBSH 1UJ3B 1WWWX 4IMLB 4XGZB 3TNMA 2RTTA 4EI5A 1PIGA 5IMMA 1J48A 4PG2C 4U6YA 5EUOB 1PY0A 2DDQH 2UY7A 4R4FL 3VFMB 5JPNA 3R0NA 5C6WH 4GO8A 2OULB 1JV2B 1KT2A 4ZTEA 1PG7H 3WN5C 3NJIA 2CKBA 4XO3A 1KJVA 1N8ZB 1IKOP 3BH4A 4PGZA 4HIIA 5IIEB 2FGWH 3IETB 3QWNA 4GYBA 1BJMA 3GDCA 1KZYA 1IM3D 2ZXDA 2DQTL 2R27A 1N5YL 5BQ7A 1W8EA 5IUCA 5DFVD 1EERB 4HK3N 3OHMB 2KZWA 2QHLA 3QIUA 5JHLH 3WHE1 4DOHE 3X1EA 3SIKA 3RY4A 1URLA 2VDRB 2RQEA 4L4VB 4AZ8A 1JGDB 4MCMA 3TBYB 3GEWB 2EYSB 5KUKA 4G42A 4S10A 5E6RB 4C4KT 2CJSA 4J2QA 5EOCH 1S9YB 3V4VL 3CDGB 4ZXBB 2QQKH 3AMLA 4Q6YA 5MERA 2PR4L 3SQRA 3F6JA 1MW0A 2IDUA 4DT2A 3K2MC 1G9NH 3RYMA 3W11D 3N41B 4GI8A 1DANU 4ODWB 1LVEA 2K0RA 2NY0B 3VSUA 3QWRD 3CX2A 1RL1A 3X3GH 2SEBB 1VGKA 4CBZA 1FC2D 2AJSH 4KNSA 1WFJA 3D39B 2VITA 2VLJB 5EA0L 1CLYH 5LBGA 3BH8A 1TCRB 4A38A 1JPFB 3DO7B 5DC9B 5I6OA 1U42A 3D12B 1JGLL 1UXWB 2Q76A 1BEYH 1JPSH 5KYNA 4F2MA 2F54A 1FNGA 1RIHH 4XX5A 4GXVL 5DFWH 2DQEL 1MHCA 5LAXA 1OTTC 4PP1D 1NDGA 5J1AB 3VVWA 1HQ4B 4JM4H 5D5MB 1GL4B 1NLDL 1EHLH 3F04A 3FL7A 2P47B 5TDNB 4ZO6A 2F7OA 4DFIA 3GSRB 1EGJH 1Q94B 3LD8C 3ML9A 5T5NG 2BP3A 3GRWL 2DL2A 3MLZL 4Z7VA 1T22A 2J8UB 2VNCA 3IU4L 2Y6TE 1J9CT 1FVEB 3FS9A 4P2AA 1YDPB 4RAHA 4GRLB 2DQCH 4QI3A 1RJYA 4Y5XC 2FX8H 1YEEH 1DVUA 4PS4L 5ELIA 5EEWA 1AHMA 1JP5A 3W0WB 3HBZA 4OCNC 3R06A 3V10A 3ULUC 5DURD 4HC1A 1IBGL 2EDLA 3WNIA 5BW7C 1V27A 3WAKA 2KLRA 5EU5B 3UH8A 3IWUA 5I8OH 1CDJA 1N70A 4U1LA 5T3XH 4OLWL 2R0WH 4RAVB 5D7KE 2NR6A 1LM8V 5JR1L 3RUGF 1K6QH 4C4KO 3DTXB 2BP5M 1PG7W 4G7QB 3QZNA 4XPGH 1JDCA 4LGPB 1TVHA 3LN5A 3L3KB 1W0WA 3CFMA 3BGMA 3OZLA 1MAMH 4YLBA 4DVRL 2PCXA 3TTYA 2JI1A 1V3KA 3O2WH 4W9JC 1JNNH 4XVOA 5LQBH 5I5JA 3UZVB 3VFGH 2CDEA 3E9UA 2R2EA 2H0FA 4H8WL 3RWJB 5SWZB 1CO1A 5J12B 5K9OA 3V4PH 3FTYA 1OSEA 1KGCE 3NCFB 5E23A 4ZFFB 1E8ZA 1DE4A 2CKBL 5A16B 3MV8A 1TTUA 3MYJB 1ZVYA 4Q6IB 1L9NA 1A1NA 1GYVA 4QRTB 3CG8A 1NANI 2CCLA 2F8OA 4KZCA 2X6AA 1V5JA 1TYEB 5IFJB 3ELQA 1UUNA 1ITCA 1EV2E 2BXYA 1VFUA 4OIIH 3LS5H 3MBEC 4FQIH 4EO5A 5KSBA 4PJHA 1PAMA 1XL6A 4MXWH 1BAGA 3B7TA 4HWZB 4S0TD 4AIEA 1OT2A 4RBPK 1UB6B 2R2EB 3QRBA 2AI0L 4GP8B 4HIXH 1P5VA 3QEQB 5AYTA 4ALAL 1OTTD 2NR6D 4ZG1A 5E9DA 3O9WA 1B88A 1OAYH 5J11B 2QHRH 1OAKH 2X4OA 1ZA3B 2ORBL 4F7EA 1HYRC 2EDBA 5D6CA 3BH8B 2O6EA 3HRZB 1TTGA 1I85A 1IAOA 1OEZW 2C3VA 4X6DB 4DO4A 1JNHA 1A6AB 3O3EB 4Y2DD 1NEZG 1OQOA 1X7QB 3VW3H 1B3IA 3M7FB 3IVKA 4P4KB 4BKLA 3PXLA 3ZKQD 1FSKC 4ZMOA 2DM4A 2YD0A 4NO0D 2GB2A 3N44B 3SBWC 1FFQA 1K5NB 4JAMB 2L7JA 4DSYA 4M4RB 4NP4H 3VGAC 2FO1A 1QSEE 4PRID 1AHWB 5EG6C 4FL4C 1KXHA 3EO1A 4LKXB 1WTLA 1YLBB 3GLZA 3E80A 1KUMA 4WV1C 4M03A 3FSZA 3HAEH 4I3SL 1CICB 4H8UA 5DDHA 3T0XA 1T7YA 4BQBA 1ZTXL 2WIMA 2GQHA 3EG9A 1T5WB 4WFGD 2UWEB 4J3WA 4YDNA 1TO5A 5C09D 4A63A 4YHYC 1RURH 1F11B 2ADGA 4HIEB 5BRZA 4O4YH 4NKIL 4NOFA 4OM0H 5TQ0L 2XXMB 1OLLA 2Q7YB 2HT2D 4MA8H 2BNQB 4MA3A 1JDDA 4OW6A 4P4RB 3RL1A 4GG6E 5KVDE 1INQB 4ODTL 2D3JA 1KJ3L 5C07D 5JW4M 4X6BB 1MI5B 3O3AB 3CXHJ 2WP3T 3TZVD 4ZYKB 4EIBA 4JRFA 3S8FB 5I8KL 3AS2A 3RZCD 3RPIA 4S1QL 4HOXA 2BVUA 3MUGB 4KZEH 3OC5A 1QBBA 3MBED 5KSAD 1GKEA 1BAWA 1C16B 4YXKL 4XXDB 1T2JA 4NO2A 3TT3H 5E08H 1J5OL 3APCA 4NZUH 3U79A 5KWYC 2E7BA 5I0XA 4M8VA 1MJ7H 1UTDA 1T83C 5LO7A 1AZCA 1KEGL 4DESA 1MCFA 1Z9SA 4HDIA 4NUGL 4DW2L 2CJUL 5L9DH 1PDKA 4ILDA 2AQNA 5J13C 1NCAH 2IF7A 15C8L 4CVUA 3MREB 3HFMH 4M8RA 3GRGA 3ZQXA 2VLKB 4G7YH 2JFCA 2Y7NA 1INEH 4U4BA 4L5FE 4XP4H 2AQ1A 3DRTA 5A43C 5J6HA 5EF1A 2X4OB 5IHUL 2HRPL 4Q9QL 2PP7A 4JJHA 4MMZA 3VGGA 4GRLD 3SKMB 3RKPA 4LBEB 4WHYH 3IAPA 1GGIH 4HJ1A 3HZYA 4ERSL 3QUKB 1T4KA 2FQFA 2VUOA 4XP9H 2BIIA 2NY3C 4GUOA 1TO4A 5JYMA 2YD1A 3C08H 2ADFL 3HUJE 1Z9PA 3RG1C 3BEVB 3PQYD 4IJ3C 3MDJA 3RRQA 1BQSA 4PEEA 4DVBB 4RZCB 1P5UC 4UBDD 3NA4A 4LLQA 4WWID 3U46A 3BP4B 1VRSA 3U2SB 3MJ8B 2CIIB 2WINA 5C0FB 5JW3H 1J12A 2NY6D 2CLRA 1X5MA 4Y9GA 3T0VA 4Y16D 3UGEA 1CICA 4WENB 4R0LC 2P49B 4ZRGA 1CXHA 1QSFA 3NP3A 4NQXA 1EVTC 1CU4H 4NHUB 5AVWB 2R2CA 2O5YL 4XAKD 1KTLA 4AYFB 3UCQA 2DWEA 1Q1PA 1P4LB 1XB6A 4P23C 3WKPA 4X0NA 4B60A 1WYJA 3VYPA 1EDQA 2DEYX 5I76B 4WJ5B 4MVBC 3RKDC 3ZDXE 2X4UA 2DLTA 4I2XA 4Z6AT 5I30H 2K45A 1HOEA 1KJMB 4H26B 7PCYA 1QLRA 2FSDA 5DS8A 2FEEL 2VR8A 2NY0C 1G6RH 5IOKA 4X7TA 1N0XL 4PLOB 3V6OC 2H32A 4PJCE 3IRZA 3IJSB 4M7KH 2VSMB 1A25A 4MJ6A 4PV9B 4GO6B 4GH7B 3QXWA 1GYCA 5F7HA 2YAMA 1C16A 2P26A 5FGCB 3ZUNC 2CNZA 1CK0L 2X4NB 1OCCB 2JJTC 3PGFL 3DJ9A 1WZKA 4UM9B 3FT3B 4X9BA 4RMQA 4EI5B 5IMMB 2R23A 4L3EB 4J5VA 4JE4B 4ONHA 4O02A 1FNSH 3BGFC 2X3BA 2CD0A 4POZD 2BDNH 3HG4A 5GGUA 3RUGB 5H35A 5JOPD 4J3SA 1KFGA 3BAEH 2ZUWA 2Y36L 2HTLD 1HHKA 1QA9B 2E6PA 1HQRA 5JHDA 1W80A 3GB7B 4GKNB 2G9HB 1LE9A 3VQLA 3V6FA 2NY2C 2BSEA 1RZJH 2XV3A 3DBXA 4N0RA 1E2WA 4J6RL 1JGUL 1QBMH 1FFTB 4NQDD 5IBLC 4LCCA 3VFTA 1FN4A 1UM5L 4ENZA 2QSQA 2J6EH 3IE9A 1X5AA 3S8GB 4G8EA 3SY0A 5T3XE 2DQIL 1D6EB 4JREB 4CU6A 2OCFD 4LCWD 3AITA 3MRFB 5I17B 4R83A 4GY4A 2Z91A 4TXVB 1D9KD 3LEXA 4CKVX 1UD3A 1ETZB 1AIZA 4C83A 3TL5A 4KI5F 2J71A 1BF5A 2IO5A 1OB1B 2PYEA 2R0LH 3ZDYE 4H20L 5DMKB 2XQYG 4GT0A 1GH7A 4B9IA 4LEOB 5SWQA 1WICA 3AU1A 3UBXB 4Y1SA 5IHWA 1ET8A 5EBGA 4N3TA 1XH2A 2KPNA 2D31B 1PX4A 1ZE3H 3FH7A 1RZGB 3H54A 3OBAA 3U4EB 3ZVVA 2OCJA 2OXHB 3HHSB 4HPYH 2BWQA 5CEZD 3ZT5A 4LQ1A 4ZS7H 2J1WA 1CLZH 2WD0A 3KHOA 5T3XD 4AXWA 3D3VE 3K2UH 3MRIB 5C0RL 4X7EC 3BVNB 3TO2A 3U30B 3GXNA 1BPVA 3AC0A 4XH2B 5CXPA 4AEHH 5JTWA 4YSTA 3F7PC 3STZA 1XR9A 4OGYH 5BV7H 4U6YB 3GSNL 3T0ED 2O61A 5F3HB 4NUPA 4KHTL 2MNUA 4K7FB 2DQGH 3M1CA 4PGBA 2PR4H 4X7TB 5E00B 5E24E 1BXVA 1XAKA 1GY1A 1OGSA 1P6FA 3HMXA 5F1NA 3FU5A 1G7IA 1J1PL 5AW0B 4LRIC 4GRMB 4I18C 4OLXL 5IWLA 1H3PH 2XTJC 3MFFB 3QJOA 2YSTA 3QUZD 4WCYL 3RL2A 1QUNA 1PU0A 5AVYB 2CK2A 2DEWX 2QZQA 4CNIA 3KPSE 4HK3J 3PWPA 4JPWL 2RIKA 4AITA 1HSBB 4P4KC 3ARBD 4ORZC 1CVRA 4RZKA 3PL6C 2OSLB 1ES0B 3SE4C 2E3VA 3Q8BA 2HG0A 3B9KA 5BJTB 3NT0A 3B9EA 4WWKC 3MJ6A 1HS6A 1S9YA 4NN6B 4PRDB 5F0JB 3QXAB 1HIML 2FT8A 2DIEA 2NY1B 4WTQA 4MXQC 1SM3L 1RKRA 2X6VA 5EU6A 2D7MA 1HQRB 2QVFB 2W59A 5JHDB 1JZHA 4LSTL 4MD5B 4L0ZA 3GF8A 2ICWJ 1U8IA 4KRPB 3WIHH 3MPCA 1LE9B 3VFWB 2CUHA 4JO5A 4XWGH 5ILTL 3T0EA 4X5RA 3KWWB 1P9MA 1EWHA 4NRZB 5G5DA 5GS1A 1QVOA 3HE7B 3O9WC 1AANA 3OXSB 4K23L 2KQNA 5K9QG 5AVRB 2OL3L 4OT1H 3VWKD 4OY9A 1LO2L 1ZLUH 2V17L 4KXDA 3U4BH 2V4LA 4Q97A 2F7QA 2ZOKB 5C70A 1LHZA 4I9WD 3V6OE 2D73A 2DZEA 1DJXA 4L3AA 5IJDC 3A24A 2IANB 4L8DB 5T5NF 2EXSA 5E8EA 2Y0SA 5KYYA 5ACZA 2J7LA 1KIPB 1DJSA 1G9NC 4F2FA 3T4YA 1R6VA 1VKXB 1IL1A 5EO0B 4PJ9C 4NKOB 3DOHA 3LAFA 3UAAA 5E4IA 5C71A 3X11A 3ZR5A 4AGMA 2BS8A 3HE7A 3DTDA 5HSFA 3RFZA 3IJEB 4LGSB 1MCOH 4XPGL 3QIUD 1O9WA 2F58H 5K1NA 2HXAA 3REVB 4MJIA 4BJLA 4MCNA 1HL9A 4PJ7B 1E6JH 4DVRH 3EFDL 1IM3A 3HLAA 2W5PA 1OAXL 3VFVA 4WY7H 4DZ8A 1G7PB 1XF3B 5DMIL 3BP5B 4PW4A 1SJEB 1TIUA 2ZKWA 3GS7A 1S7QA 1WUZA 4TQEL 5C3LD 3WXWL 1I9JL 5B1JC 3SY6A 3SPCA 1E27B 4WI8A 5DHVA 4DKDC 3PDOB 4Z23A 1BREA 4FFTA 3TO4D 4KXAA 3V0GA 2W91A 2MQGA 2X4QB 2C3XA 1PEWA 5E00A 1BVKA 4OCRH 4OIIL 3EYFA 3RE0A 5HD8C 3TPKA 4Z77A 4I5BA 1AKPA 5CD3A 4FN0A 2JKRM 4OAWA 1SHMA 2AQTA 3QDMD 4IBSA 1EVUA 4EDXB 3PHOA 4JQXC 1AHKA 1ZDSA 2PXYB 1WE5A 2J44A 1G9HA 3CVHL 3EGXB 5ETUA 5ICZA 1TTFA 4AMKL 3WTSA 3SDCA 1OAZL 2DQ6A 1CLOL 1ZJAA 3EH3B 3I3EA 2PN5A 2B8OT 1CURA 1FGNL 5A16A 2Y4SA 3OSKA 4FG6C 6FABH 1Y6NR 4JFWA 2P8LA 1ZGLM 5KYUA 4BXVA 3A6OA 2V9TA 1I9IH 1K4DB 5D5MF 4HXBL 5IFAL 1G7QB 1XH1A 1A6ZB 5I1LB 2WXNA 4MMYA 1KTKE 1O9VA 4JO2L 4AEEA 4UQ2B 4AY0A 3RWDA 3MLVH 5JXEA 2EDWA 2OZ4H 4W1TA 2BJML 4I88A 4N0YH 1EHAA 1A6PA 1GGCL 1HE7A 4NZFA 4N25A 5C7ZA 2O5ZL 3T6VA 3IGUA 3ARPA 3UTTA 4FFYL 4I18A 1G5AA 2OYKA 1RUPH 1X44A 1MCRA 3RGVB 4LHQB 5FO8B 4FLHA 1E9QA 1SMOA 4PJCA 5GJTL 3QH3A 2QKIC 4Y1AA 1N4XH 5EPMB 2Z7WA 1TVHB 4WV1B 5D7SH 5DWPA 3HNTH 3LIZH 2FQGA 4WEBH 2X1OA 5I6PA 4K71B 1I1AC 4MMYB 1Q1JL 2ARWA 1YEKH 1JPST 1DDTA 3FRPA 2HRLA 4IRJC 4FFVD 2A9NH 4IRZA 3MV8D 3OKDB 4HX1A 4QWWD 5HYSG 2APSA 4JB9L 4RETB 4X42A 1M7IA 1L7TH 4Y2NA 3OQRA 5TF0A 3C6EA 4HUXA 2QPFA 4ONGL 1MREH 1MVUA 1XEUA 1VACB 1MDTA 4BSVA 2BNQA 3BIAX 3FO0L 1A1NB 4O00A 3QJUB 3T4AB 5HDQH 1OM9A 1JCVA 3FZUC 2XLLA 2OMYA 1T4KB 4K3DL 1ZSDA 4S1QH 4EUPB 3STLB 4H5SB 4HG4J 1QQDA 3S35L 3WDJA 4HVBA 2UWEA 3OJVC 1CBJA 1C5BL 2PTVA 1BWWA 2QV4A 4YPGA 1P53A 2ZUYA 4H7VA 5TH2A 4HZAA 5EZLB 4MZRA 1LO0H 1ZHBB 2WSDA 2DQDH 4FTVB 4JK0D 4UYPA 4J8RA 1X5KA 4BFIB 1MJ7L 4ZOAA 1E5CA 4YBQD 2WKGA 2QMJA 1LWHA 3ILQD 3U2JA 1BLNA 3OTTA 2Y06H 4NN5B 1BAFH 3U7YL 2DYRB 4KWUA 3SO5A 1JZ8A 1T03L 3IGKA 3P30H 2HJKA 1M7DB 2OPCA 3MGTB 1J9SA 4AIOA 1GOGA 2IOOA 5E95B 4AENB 1Z9SB 3BAKA 2NY7H 3EH4B 3D33A 1MXDA 4U0RC 4PJIE 5GS0D 3VA6A 3VWJC 1IGIH 5D1XD 5C0JB 1ADQH 3E8UH 2XZQH 1EQWA 1HL5A 2RH0A 1NCDL 2LE9A 4NENA 1DBKL 4PV1C 4X99B 1JYVA 4BEIA 3LYRA 1OW0C 3QG7H 3NIDE 3OR6A 3PAVA 5GRWA 4DPAX 3QDJD 4S1RL 3DUHA 5D9SB 1BX2A 5BPPA 2EDNA 2VJ8A 5EU7C 1G7HA 2EE6A 3VI3B 4XP9L 3OKLA 1OSZB 2V37A 3KE0A 5CP3A 1NIEA 2VDOL 3HUJF 4TUUA 2P8PA 2AF2A 2QQKL 4ZUVA 1IEHA 2FWOA 4N0UA 1NL0L 2A6KB 3QNXB 4HBCH 1LK3L 1FZKA 1OHQA 1DVFB 3QO0B 5F7YC 2V3DA 2EE2A 5I1DB 6CGTA 2V9QA 1Y18A 4PRIA 5BW7A 4OZHB 3JWOL 1Y6MR 5KVMC 2X41A 3QB7C 4NQCE 4ZUWB 3BIBX 3P4NA 5C09B 2F8XC 3EGSA 2ZOOA 5JW3L 2G75A 4OD3L 4X4ME 2HVBA 4BZ1L 2R23B 5I8EA 4AIXA 3ZE2F 1GRWA 4UT6L 3EF4A 4X98B 5I1HL 3VD0A 4R90L 3WN5B 2UZIL 3SE4A 5D72L 5MI0C 3U30C 1NKRA 3WLBB 1NCCL 1O7SA 2XU9A 5SV3A 1A66A 4IKLA 5J9PA 4Z0BL 2VWEC 3QC6X 1WA2X 5I74C 3PWPE 4Y2OB 4DEPC 3TCLA 3DI2B 1V7ML 4AX3A 2QKSA 3IGAA 3IDXH 2KBGA 3KJ4B 4PWHA 4ZXBD 5SX4H 2RCSL 2ZX7A 4TNVK 5DJAA 2PYFA 2H1XA 4LHUA 4F7KA 3FBKA 5AAMC 3H42H 3EYVA 2DWDB 3KL0A 2PPAA 2MEJB 2J73A 2XQBH 1IAIL 5I0ZA 4MBRA 4M7LT 3JWNE 3ZE2B 3LKRB 1GSMA 1A9BB 2P1YA 2E7CA 1F4XH 3BKCL 4MAZA 1EUTA 3KPSA 5AUMB 2W0KA 5KVDH 2GTZB 1P7QD 2HFTA 4Y9EA 4U1SA 1T5KA 3SPGA 1PZ3A 2BERA 2XN0A 2VZVA 4IMKC 1CMOA 1THCA 2H2SD 3VFRA 1BP3B 1U8HA 2B1HL 4FTVA 4IW4C 4Y9CA 1RZIB 1HXMB 2R0WL 1ET5A 3SDAB 1G1CA 3EJPA 4ICXA 4ZFGH 5I6KA 1E67A 2YUZA 5FGBA 1HILA 4OD2A 3X13B 2DKSA 2MOQA 5FYJU 1CT8A 2Z8SA 4JKMA 5CJQL 1OP3K 1E6OH 3DMMA 3EHBC 1C5CL 1J88A 3NSYA 4NWUH 4NFDA 1A6UL 2Y36H 4ZW8A 1KTJA 1X5IA 3DV4B 3NFNA 3ZL2A 2WQRA 4YIQB 3VFGL 4HWEH 3E6HB 3AY4C 2B59B 3VGFA 1UM4H 3S7GA 1JGUH 2V2WB 2YS4A 3ROLB 2AK4A 3FUDA 4K7PH 2WLHA 4FFYA 5D7JB 1OANA 1WRFA 2AAVA 3HI5H 3KWXA 3KXFD 1D5XA 4LDCA 4QOKD 3LZOA 1GGBL 3AACA 2A6DB 4RFNC 4E9TA 2K3TA 1WBXA 5CP7B 2NUPA 4N0UB 3QEQE 5E6IA 3QNYB 1IUZA 2XT1B 3U25A 2VXTH 4ZAKB 5LN4A 3S96B 5JHMA 3QGVA 3LZQA 4QTFA 1IT9H 1MG3C 4UZGA 4KK9C 4YC2C 1N18A 2AQQA 2AERT 1KIQB 1S7VB 2R56H 3RL2B 4YSAA 3H9YA 5AW8B 3NCEB 4HHGA 2BSCA 4JGJA 5DHXB 3UCRA 3MA9H 5A2JH 1OAKL 5JIKA 4L29B 2ADJA 4YHZL 5DMKA 1RZKL 3L3IB 4HWNA 5EIQA 3GI9L 4U1HB 5IW6A 2P5WD 1WDAA 2EQDA 2VDOB 4PJGF 4QY8A 4RWYL 4F2EA 1XBRA 1CXFA 1WT5A 2CJTA 1JZFA 2QFPA 4BH7B 3BDYL 2JB5L 5IQ9B 2GIMA 4WW2C 1AXTH 5SWZE 4LASH 4Y4KA 4O5LH 2NZ9D 3G5VB 2VW6A 1X4ZA 1SNRA 2Q6WB 4AV4A 2IFGA 4DP9X 4F1ZA 4M29A 2BIPA 3IETA 5IIEA 5EZPA 3D07A 1J0KA 5L7XH 3BD5A 1NC4B 4PRPD 3H6AA 1NUFA 2CHNA 2IEPA 4AEHL 3C5ZA 2XWZA 4N1CA 3WD5H 3QQ3A 2WW8A 5EH1A 1I85C 1PL3A 4KHTH 1IC5H 1VF5C 5EV7A 5ITBL 1IM9D 3CVIH 5TQ2L 2BZDA 4XT1C 3CMOL 4I3SH 5CGBA 4P99A 3HZVA 3GUFA 5ID1B 2MOVA 1NCGA 3CU1A 2IQAA 4OB5H 1U95A 2EH7L 2XG4A 4UT7H 2VRQA 3VGEA 1IIKA 4KX9A 1ZV5A 5D55A 2WXRA 4PJ6A 1I7RB 2B9AA 4U7MA 3MBXL 3MCLL 3N5AA 2V7NA 4NKIH 3DARA 3AXLA 4JPWH 3TPUB 2IALB 3K8LA 3KLAA 3KPMB 3LKNB 4FMVA 4K5MA 5FW6A 3C8KA 3QZWA 4A7VA 4XCFL 3V0EA 3MRLA 1U6AL 4Q9CA 3PL6B 2PTUA 2WB7A 1KJ3H 3II1A 5JW4Q 3KLLA 3MV9A 5EEUA 3CSGA 3GWJA 1CFVL 4N8VG 3V0DA 4LNVA 4CN4A 3FB8A 5GGRY 1RK1B 1GYWA 2YUWA 5FUCE 3BFOA 3QRFM 1S5IL 1I4FB 3HG1A 5F3BB 3VFVB 3ZRCC 3GHBH 4I77L 4KDTA 4RMBA 3ZKMD 3BVXA 2VLRE 5C08B 5DEGA 1PZCA 1XSIA 3KYMB 4I7ZC 4WI7A 4FERA 4AYMC 4E2OA 4HJTA 1FZMA 1PZBA 3APMA 5MEND 2HT2C 4KROD 3QFGA 5EO9A 3MLUL 4YBLB 4FS0A 2V17H 1IC7H 3U4BL 4QRRA 2XTJE 1B0RA 5ITFA 3NVQA 1KCLA 4F7EB 1ZK9A 1JWMA 2FJHA 3CSPA 1T22B 2CPUA 2J8UA 1HL8A 1LP9E 3H9SD 1IAOB 2C3VB 3KLHC 4JRXA 3WIIL 5H4ZA 3PRZA 2H26A 3DVGB 4JHAH 5F21B 3HHSA 2C9RA 2EH8H 4KDVA 3QS2A 4FFVC 4HUWB 5IW3A 1QSED 4TVPL 2F1AA 5E9AA 1BOYA 1HAWA 1KJ2H 1RERA 2E76C 5ETUB 3JTTA 2HRPH 4Q9QH 1OTUC 4W9LC 4M6NH 1MHPH 3TU6A 5A2LH 4PJFF 3ZO0A 4J3OC 1EHXA 1QWUA 4FXTA 4HT1H 1E6JL 4DOHB 2AITA 5TK2A 3OSVA 2CIKB 4NNXB 1U92B 2MCPH 1OAXH 2DQHH 3NYKA 3KZ8A 4GT7A 3CNKA 4BKSC 1JGVL 5C0EA 1A9VA 5EDSA 4JY4B 3L16A 2YZ8A 2CM5A 1B0WA 1QI4A 2VDLL 4JFSA 1FYTA 2AVGA 1NDMB 3KVDD 2JNZA 3NH7H 3PFQA 4QXTB 2W95A 4X8JB 5CEYB 1RD6A 3D34A 3P3YA 4I18B 4JDVB 4JRXD 4TKWA 3MN8A 5KVFL 1DN2A 1QFWL 1Y0LB 2XBTA 3O6KL 1OAUH 2AJYL 3FT2B 3LEVL 3HC4H 4KRMB 1KPRA 3NJVA 5FOBB 3L5XH 2VAAB 3VUAA 3UBFA 4MAYD 3APNA 3VRIB 3I75A 3IF1A 4HXAH 4WI4A 3WI9A 3W0WA 3E0GA 4YDVB 3KCPB 4NC1E 4OZFB 4JM2D 5E8DL 3T65B 1ZCRA 3TIDA 5IMOA 1KENL 2MWCA 3FT4A 1HYSC 2PW2A 5ESVA 3WSQH 3CH1B 3CN2A 1BXAA 3ZDXF 4L9DA 4KJPC 1G9MC 5DEFA 4ZMTA 2MOGA 5D8JH 1XD1A 3ARVA 4R8WH 5E0QA 2FR4B 1NA8A 1PBYA 5KN5A 1GZPB 3L8QA 3Q6FA 4OLVH 5F9WB 4E9LA 1XF5A 3IFOB 4GS7C 4JE0A 5M7QA 1QBLL 3EBIA 1MY5A 1MDAA 3ZKXC 5AVTB 4RH4A 3MTXA 4PWFA 3BW9A 2HMIC 4HHAA 4G83A 2XWTA 4YDLB 1GS8A 4F33B 3TVMC 4P2CG 1NGXA 3VD1A 1B4LA 2OTUA 2ZSVA 3OX8B 5C08A 4XNZB 3C75A 3B6SB 1R5WA 2YQ2A 5C6TL 2WLNA 4BDVA 2C9UA 2B77A 5MI0B 4A7QA 2VLKA 1MIEL 2MH4A 4Z7WA 5DK0A 1BMGA 2N7BA 3L3GA 3ROOB 5HGBA 1MQ8A 3DX8A 4KH2A 4M1GH 4QRUB 4PJXA 4XE5B 4FA6A 4LSQL 1B2WH 5FKAB 3KD4A 2LLLA 1N4XL 1ND0A 3MV8B 1IAII 3KYKH 4OF3A 4UNUA 1U41A 4MNQB 4WUKH 4AKOA 4J3OD 4OJFL 4ANUA 3W39A 1JRHH 4XZUA 3BVWA 4HUVA 4Y1AB 1OGPA 1S7SA 2NUTA 3FFDA 1AHWC 3JWNH 1DVTA 4JX0A 5T3ZH 3I9AA 4XN2A 1CPUA 3QZBA 2UUDK 1KBKA 3NIGE 4FDWA 4HCFA 4J3VA 3CJJA 1YEIL 3QWOB 1FZOB 4LLDA 3QDMA 4NFBA 5A6MA 3QHFL 2BNRE 2ZXAA 1IZJA 3EUUA 5DZLA 3TEZA 3PQYB 5GGRA 3TCTA 1GJUA 4J7RA 5JQIB 4QJ5B 3UADA 2RD0A 1NCHA 1DSFH 4J4PC 5HGBB 3NFSL 3PE9A 1GZQA 4JG5A 4PJCB 4OLUH 2WMPA 4QHNB 3MJ8A 4O9HL 2CIKA 4NNXA 3NACL 3P77A 4JQVC 4N2DA 2V6HA 1JVKA 5FCSH 1JNHB 4DO5A 3MOQA 5IBUB 3U9WA 4HFUH 3BHBB 5DJXB 4Z76A 1X7QA 4E9RA 3VRJB 1I53A 3V2AR 5GZOC 1Q4NX 1FAKT 2AEQH 2ESVB 1NPJA 2SODB 4O58H 3ETSA 4CVXB 4Y19D 3L3OB 4FYRA 2DI9A 3AM8A 4H20H 4OZHA 5KBNC 5C0AA 1AD9B 3LDBB 2ZXWB 3QRGH 3FSOA 3RWFB 1QSFE 1ZHBA 3VO0A 3UROR 2UZXA 1HHIB 1G84A 4N2EA 3Q05A 5IFHL 3AU0A 3C6LA 3TA3B 2VWEE 3N41F 3NN8B 5ID0A 2X2HA 1AG6A 1T80A 5C0GB 1GIGH 5CBAA 1RK7A 5JHDD 3CSTA 4LZKA 5EIVA 5DC4B 1A7NL 2VKWA 4ZFQA 4NQCA 3UPCA 5FLVA 4PBXA 4AV5A 2IWFA 2FGZA 3HE6C 1UOWA 3UZQA 4YDVA 1W8NA 2BWDA 3QQ9C 1FHNA 3KL5A 1SHSA 5C0RH 3RWJA 2J6WA 1D2PA 3QUZC 5DMJB 1VENA 5B3JE 2YD4A 2GTWA 2VIRA 4MNGB 4WHTB 1E43A 3QUGA 4PJEB 3BIKB 2XWCA 1S9WA 3K7UA 3GMOA 5HI4C 3OKNA 2HJKB 4ZBJA 5CAYB 2HPOA 2XWJA 4NJAL 5C0CB 1ASOA 1J1PH 1JGLH 2P28B 3NAAL 2AJVL 3F3HA 5DHMC 1BIHA 4WIQA 1PIFA 3JWOH 5JIIA 3IJ8A 1OCRB 5GS0L 2FB4L 3C5JB 4S2SA 2QKIB 4WCYH 3QZPA 3FQUA 5BV7C 3U46B 5HDWA 1RVFL 3QEHA 3V6FB 2F54D 4KKLD 3UGXA 4BFBD 1B4TA 1CFTB 2BOLA 5ISZA 2P52A 3CPUA 4GUPA 5A2CA 3MRDA 1TZHB 1TQBC 1W72A 4J4PA 5J3HD 1RP9A 5CUSH 4WI0B 2NCEA 1U3NA 2DJSA 2IPUK 2YGOA 4QYAA 4OCYH 4H0LC 5ESAA 4PRHB 3WEOA 2I07A 3MLXL 3NJFA 2E75C 5B4MD 1FFNB 1CYXA 1MCIA 1JFHA 1U3ZA 2YQBA 4S2SB 5K39A 4FQXB 3H3PH 3FUJA 4L1HA 4GINA 4YFEA 3NSCA 1G0YR 3H9HA 3QEHB 1IAIH 2C9AA 3LNEA 3WY1A 4Z78B 1FDLH 1TETL 4ZFOA 1CLVA 2CA4A 4FTDA 5BUPA 5SWQB 3LXBA 3P77B 4OLWH 1RZ8A 3S37X 5JW4R 3W5MA 1A7PL 3K0WA 1RH8A 4BFGA 1QLRB 5DS8B 3D30A 2VR7A 3TN0D 4Y4FC 5A3IC 5IEHB 1PSKL 1XGTA 5ALBH 3RB5A 4A6YL 4MXQD 5DJZA 4YK4C 4MGXA 3ZIYA 1A2YA 1YJDC 1I7TA 1KDIA 5KYWA 3FQYA 1Y07A 1MQKL 4KQ3H 1EFXA 3ULUD 3UTQB 5KVGL 3LH8A 4KTYA 2BNRD 3D18A 4PPTA 5DJAB 3LX9A 4GAFB 1EA9C 4TUJB 1DBML 1DBJH 1YQVL 2JB6A 1A4KB 4U1JB 2XKUA 3MYZA 5FFLA 2CLZA 5DUBB 1N68A 3CZEA 4L1LA 5CHNB 1ZTMA 4MWFB 1E6OL 2J5WA 1C5CH 4HAKA 3VXPB 4NWUL 1UWGH 3N55A 1FVDA 4M6OH 2W65B 3E1ZA 5F9AC 2ZCLL 3UJIH 4PRNA 1HCFX 2CHZA 4A2FA 2FYYB 1FZJA 3G08A 2CXGA 5LG1A 1YC7A 4ZSOB 4L8SB 2C9VA 3NFNB 3QHZH 2VR5A 3AUVA 4ODHH 2ICEB 3UC2A 3GSNB 4KROC 3WIAA 4WI3A 4KTEH 3RDTB 1JCKA 4JQIH 1NBVH 4ZS6D 4ZMXA 3PS6A 3TNMB 1UT9A 4Y4HC 1NFIB 1NBZA 1KWKA 1HDMB 1LTXA 2Q0ZX 4GP4B 2AABL 2C3GA 4IRSB 1MFAL 4LOEA 1CC3A 4FJZA 4P5TB 1AGBA 1JGEA 2RFXB 3P69A 4HLZH 3T1FB 1IGYB 1EEYA 4PJ8A 4OH2A 4DPCX 2D2CC 2DOCA 1BZ9B 1CJYA 1ZT7A 3CFBB 5FHBH 1RUQH 1U8IB 3F05A 4S0HA 5FUCC 4GW1B 4NPJA 1M9WA 5KYXB 5BZWA 3NTCL 1IIIA 1JHTA 4LHUD 2X89D 4PH8A 3KGRA 4QD2E 2A6JA 2L3BA 3OJDB 4N3UA 3MLSH 3LKRA 5HYJB 3BJLA 5IFAH 3FO9B 1FFPA 3DO3A 3SE8L 3CFEA 1QHQA 4HJUA 3O81A 4ZAKA 3O2VL 2MNJB 1KG0A 3TN0C 3G5XB 1KIUA 1N9PA 3ETTA 3DXAB 1CFBA 1FI8C 4L3EE 3GINA 4LP5A 2G9HA 4JG1H 4NP9A 3Q06A 3TH2T 4JFDE 1IFHL 4WU7A 1YPZE 1QABA 4FG6D 4NI6A 2Q2EB 4PREA 4HJ0D 1TUPA 5EFIB 2UX6A 1MLBA 4YSRA 1ORSA 4OV6F 4JFHE 3V6ZA 3LIZL 1NC2A 3LKOA 4K3GA 3NZUA 3WS6A 1IZKA 4OCXH 4JO8A 1WK0A 4P9HH 4YIQA 5HHVH 1R24A 4BA8A 1J1XL 3G04A 2XTLA 1L7TL 3PHSA 4FNLH 2NT0A 2R29L 3NJHA 3QUXA 1UUSA 1MREL 2X2JA 3D0VB 4RMWA 5CHNA 2XV2A 1E4XL 2PCFB 4IOFD 2VDQH 2FNBA 1FVDB 2EKSA 4NUQA 1N6QL 1QUPA 1NWOA 4WNJA 3NQKA 4N2NA 2R4RH 5KS9F 2J1ZA 1TMQA 4U7SA 3D2UA 1NCAL 4FABH 1EDYA 5T1DL 3S34L 5CD5D 1B0GA 2CM6A 5DRNA 4WRLA 1MCNA 1JFQH 2L8AA 4KNTA 2QADD 4M5SA 4XI5D 2YPLA 4DAGL 3BE1L 5IW6B 2C9QA 4V1DD 4G9DA 3VXRE 4MLSA 3FW6A 4F58H 1N59B 2YEVB 4MJ5B 4AH2B 2EE9A 4AKPA 2E7LC 4P8QA 3L9EA 3R7RA 1IGYA 1P4BH 3ZHKA 2P24B 4D0DB 4XCNA 3AXIA 4R4NC 5DFAA 3GBDA 1H8LA 5HHNA 5EOQH 5CSGA 3IKKA 4IS6A 3SCMA 2PWFA 2BNQD 5GSVB 2FE0A 1IVLA 3RBGA 3ZTNL 3ULSA 4PM1A 4JY6B 1UZ8A 5D2NC 5DEFB 2JCWA 5CU5A 1B0RB 5ITFB 2BVQB 2ENJA 4GRLC 4WSGA 2WQ8A 1X5FA 5CZXD 2AJSL 4K9EH 4ISVA 4QRTA 4PJ5A 4KK6C 1G9EA 4UNTA 3NP4A 1NL0H 1BQLL 1YMME 5MEOB 1HI6A 3D3VA 1PYWB 4HIJB 4CVWA 2NYYD 2BVEA 3A67L 2WLKA 3GSUB 1DEEB 5ICYB 1R5VB 3PJSA 5FYLD 5I16B 1U8PA 4KC3B 1AGCA 2A74C 3ZZ1A 2Z31A 1NGQH 2ZPKH 5GRJH 4LCIH 1U8MA 1UD6A 3MV9D 4JM4L 4OZGB 4YGAB 5DJCA 3BYTA 5I9QB 2OTWB 1FC1A 1PKOA 4UT6H 5AYUL 5IWLC 1XEDA 5H94B 5JZ7C 5DVOA 2NY5H 5E5RB 3VDAA 1NMAL 1KLGB 2KLSA 3GRWH 3H7BA 3MLZH 3S5ZA 2YGVA 4FXGB 4L3FA 2VLKE 2JCCB 5F7WC 1J5IA 3BP6B 2E9GA 1ZANH 4P4KA 2X4TA 2F53A 3P4MA 2ENQA 5F8QC 4BCYA 5K9KA 4WDIB 2VERN 4IRSD 1TFPA 4OFYD 4N6RA 4QHUB 1EEUA 2EC9T 5GPRA 3IAQA 3BUDA 2QVTA 5GIRA 3SQBB 2NQ3A 1TPXB 3IPFA 5F7AA 4LEXL 2QELA 4OTXL 5DI8B 4BUGA 2EKSB 4M7LL 3CTTA 3KBEA 1LO4H 5FCUL 3SGEI 1FP5A 5D71H 3HHMA 5KYUB 3RWIA 5HHQB 4M7ZC 1NAMB 4JRXB 4XCCL 3UG5A 5JR1H 5EBMA 1NSNH 2FBOJ 2DY2A 5E99H 4IRZL 2W92A 2QVIA 3TVMB 2GITA 2AV1A 4JGUA 3BAEL 5J11C 5ESQA 3TIDB 1E2ZA 1HQ4A 1P0SE 4FEMA 5D5MA 3WEXB 1WFUA 2AAAA 2ITCB 3CH1A 1SEQL 5BRZB 2K70A 4CAGA 4FADA 4LSQH 4OD1L 3TT1H 3EBHA 4F7PA 1R3KA 3POCA 3O11B 1H6TA 5DVKA 5DFVC 1I8IB 3NSXA 2E27H 5CN2A 1M05A 2EILB 4LF3B 1BCIA 1F97A 4ZX4A 4TVSa 3GJFA 2DMCA 2A4CA 1OTSC 4ZUVB 3MODL 4MJ4A 2XVKA 1OXYA 3VB9A 2P45B 1FZKB 5IGXL 3INUH 1MWOA 4ZMAT 2IGLA 4S1DC 3GMMB 2XFXA 3W9DB 4DP1X 4LLDB 2I7OA 1OSPH 3WY4A 3Q6GH 2M26A 5IQOA 3ZT7A 2DM2A 1E4WH 2FZ3A 2Z6FA 4IGBC 4EN3C 4PJBE 4LVNB 3NACH 3CDYA 4RAVA 5J6SA 1D5RA 1GGBH 3BD3A 1SDYA 3GMOB 3WNMA 5A3ID 3VFPB 3PWNB 2A77L 3N0PB 3SQOH 5LGKA 5C0BD 1R33A 1U8LA 3I3DA 2XDHA 4ODVL 1PZDA 4Q0XL 3TIEA 4E41B 1OGTA 1D5ZB 1BVLA 3B2UC 3PWVA 4LP4A 5I1LA 5AAWC 4UCFA 4UB0L 4GLRI 5HYQB 1CDUA 3AFLA 1QI5A 5HDLA 1KIPA 1F41A 5DUML 3TCLB 3DC0A 3SKOA 2PWEA 4WUUA 2R39A 4PP1C 3REWA 5D4JA 3ZMNA 8FABA 3FOLA 3OG6B 2H8PA 4AGLA 4PB9H 3RNQA 1ZT1A 1K4CA 3B9DA 2OI9C 2O6DA 3PL6D 1YUHB 1NGWB 3HUJB 4LEBA 5BOJA 4OCMC 4XMLL 3SE3A 2NXZB 5CLYA 2JQZA 1G4MA 4JLRA 4YDJA 2CMRL 4FXKB 2A3TA 1MI5A 4LFHG 1OGTB 5A2KH 3G6JE 4XBEL 4NN5C 2X4TB 5D7LB 3I3BA 3K71B 1XGQB 3A4AA 3FQNB 1KYOK 4N6RB 4QHUA 4WZ9A 3N1GC 1JD9A 4Y1TA 1UURA 3O4LE 3OPUA 3MTRA 2ZYHA 5GIRB 5AVXB 1JN6A 3S5LG 3SQBA 1PTZA 3QUZB 2DQUL 3WFCL 2FQDA 2V5TA 3UJJH 4OM1L 2PABA 5B38B 3Q1SL 2PR9A 4HUXB 2Q8AL 2C4FU 3NPSB 5HHMD 2WVUA 4X0KA 3CMOH 2RGSA 3FU7A 3OB0K 3SDAD 3OKNB 3WIFA 3VNYA 1KTBA 3VCLA 3VE0A 3W39B 3PWLB 1CDGA 2XWXA 3RVUC 2Z8RA 2JKTM 4JVPA 4OZIA 5D1QD 3RHWK 2VLKD 5F89B 1UD5A 4AQAA 1Z32X 1KTDA 1ZGLB 2DWEB 5GSRA 5SWSD 1BQHA 1WWAX 2WCGA 2X09A 3C2AH 3CHQA 4LSTH 4NB7A 3WIHL 4M1DH 4NQSA 2WO3B 3QUZA 1PPIA 2CZNA 1ULVA 1S9WB 4POUB 2PWDA 3HC3L 4XCFH 4QRQB 2XPGA 2R69H 3G5YA 5DEZA 3ZKSD 5AB0A 4M1CC 4X7DC 2WYHA 4PGCA 4XXCA 2B39A 2V2TA 2BS71 4FTVE 4JHWH 4UV7L 5KJRL 3CLEL 3QFJD 3K5RA 3LZLA 2ZUTA 3MXWH 4MZIA 4IHOA 4APQC 4ORGB 3A23A 2H1PH 2CSPA 2EC9U 3A6BL 1FG2B 1PD6A 4QCIB 4KJYB 4DEWA 2VLJE 4A2EA 4U0QB 4MB5A 4NERA 3FCGA 2J1KA 4PGDB 3G6JB 2YLHA 5FYKH 1Z7JA 3HFML 3NUKA 5CGYC 1HEZB 3DROA 1EIBA 3MOBL 4XP4L 4R0LB 2IBBA 35C8L 1T1XA 5CU9A 3PWUB 1HHJB 1U8LB 3MV7B 3PJNA 4GKZA 5DF0A 3CVCA 5FEBA 4ONFH 1PNCA 1YMMB 5B38G 1JZ6A 2EVHA 1Q72L 2YUXA 3QW9A 2H3XC 5HP5A 1MFUA 4QO1B 3EKCA 2E56A 1MQKH 3JWNC 2FWOB 1QW8A 4FZ8H 4F37K 4G80A 4L4VE 2WXJA 5AAMA 3LV3B 3L3JA 5B7EA 1XAUA 3WFHA 1KTLB 4HOZA 3HG1E 2FCBA 1L6ZA 3MFGB 2ADIA 3VG9B 3VXUA 3TZVB 1J0HA 3K8KA 4DPRA 3WO3B 1I9JH 4H8VA 1MHHA 1QATA 4OV5B 2KYIA 5I76A 1UWGL 3QUYC 2X9WA 4M6OL 2PP8A 4R3SA 2CLZB 3H0TB 5DUBA 4R4FH 3ZXAC 2Z92A 4Q4EA 3N1QC 4DZBB 1ZEAL 1YYMH 4YXLL 3ZTDC 5DJZB 3O4OC 2F61A 3SDAC