4ALAC

Structure of dengue virus diii in complex with fab 2h12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
92
structure length
78
Chain Sequence
AMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTRLITANPVVTKKEEPVNIEAEPPFGNIVIGIKALKINW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus 3
total genus 10
structure length 78
sequence length 92
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4alaC00
3N40F 1S6NA 4BZ2A 4BZ1A 5B1CA 4AL8C 4GSXA 2JSFA 1URZA 3N43F 4X42A 2I69A 3UZEC 1SVBA 3MUUA 4L5FE 5LCVA 1OK8A 4GT0A 1OKEA 5IZ7A 2JV6A 1Z3RA 4UTBA 4ALAC 2HG0A 1Z66A 2V33A 3J27A 3VTTA 3N44F 4UTCA 1RERA 3C6EA 3N42F 2JQMA 5KVDE 1ZTXE 5LBSA 5AAWC 3J2PA 1TG8A 4FFZA 2R69A 5KVEE 1UZGA 5IREA 4UTAA 4UT6A 1OANA 3IRCA 2ALAA 5H37A 5GZOA 2R29A 2H0PA 3WE1A 3C5XA 1PJWA 5LBVA 5GZNA 5AAMC 3UZVA 5JHMA 2GG1A 4FG0A 5JHLA 2P5PA 3P54A 3N41F 3UAJA 5KVGE 3UYPB 4UT9A 4AM0Q 3G7TA 4FFYA 5KVFE 3UZQB
chains in the Genus database with same CATH superfamily
2EIEA 4GW1A 1VEOA 3IDYC 5HJBA 1BECA 1LO4H 1ZLWK 4ZMPA 3QBTB 4URKA 5C0BA 5HJ3B 2A77H 2KQMA 2WYZA 5BZDB 2BNRE 1JGVH 2LLGA 1KJVA 1MJJA 1KZYA 4HJJL 4PY8I 2BC4B 4RAVB 2YMOA 2B7DT 1T7XA 1FFNB 3SDCB 3WL9A 5CN2A 5DTFA 2HB0A 4MYPA 5E94A 4G7YH 1SYVB 3FB6A 4A7SA 4ZO8A 1VGEH 2VDNB 3MRQA 3OMAB 2EDHA 3ARQA 5F89A 2E3VA 4JPSA 3LIUA 4F8QA 4ZW8A 2J88H 1KBWA 1ZS8A 5I1AA 2WBWB 3P0VL 1FNEB 2DV6A 4EPSA 3K71A 1D7CA 2OSLA 2FT6A 5SWSD 1XFPA 2V5YA 1JZDC 2Y07L 2ZUQC 3QIBC 1LEKA 2H2SD 3TN0A 1KEML 5CGBA 3T77A 3ULVF 1BZ7A 3LQAH 3MLWL 5E2JA 2EXWC 3S4SG 3D05A 4GRWF 4X99B 3UPRB 4IIQC 4DKEL 5AZ2H 4DKFH 3GMQB 3CUPB 3PAYA 3Q8AA 2N0MA 5FB8A 1FN4A 1T0OA 1EXHA 3AT0A 2ZUTA 1ETA1 3FZUD 1NIFA 2BSSA 4M8UA 2VLJD 4KV5F 3CZKA 1C12A 4DKDC 4WV1B 1PSKH 3VO0A 5JHDD 5DMYA 3H53A 4KMLB 4L3FA 1MVUB 4FFZA 4NKDB 5DR5H 4PJAA 3QIWB 4IK6A 2NZ9C 3HPLB 1FNGB 3C5JA 3FSOA 1YN7A 2XZQH 2XVLA 4NUQA 5F1IB 2ARWA 4G9FE 4U1HA 2IQ9L 2R9HC 3MRNB 4WKXA 4UAOB 2CKBH 5EWIH 4X9HA 3QJTB 4PLJC 1ANUA 3V4PB 1WHPA 5IESL 3ARRA 4OLYH 1FI8C 1ZT7A 4LHQB 4JK0D 1CLYH 3BSZH 4WNSA 5LHDA 4ZS7L 2J1XA 2DTSA 5IIEA 5L9DL 1BVKA 4W9FC 3BC9A 4P99A 4TSAL 3QDME 4GG6B 1OIOA 3IGKA 5EZLB 3RAJL 2IAND 2A6KB 1S9YB 4HUKB 4HKXB 1GJWA 2WBJD 4OLZL 3L81A 4K94L 4EIUA 2AK4A 3V5KA 3BSGA 5FA3A 3DETC 1UWGL 3VGDA 2JJWA 1NGPL 4I48A 4ZMOA 3V0JA 5C0CA 4ORGB 5CSZA 3VXSB 1I7TA 5E8NB 1VFOA 2OI9B 4DPBX 4U1GC 2IIJA 4RNRB 4PJBF 4JY6B 4H26A 3EFFB 2C7FA 4FFWC 4X5XB 4N2AA 3EZJB 1CICA 2LGNA 3CK0H 2Z7UA 4YDVA 3EOYG 5DRZA 5C09B 3TS8A 2VDKB 3U82B 1JF1B 1E6JL 3L3HA 1N5AA 2LAAA 4LVNC 1FL3B 5C0GA 3QEQE 1SOSA 4FYTA 5JIIA 1RZJH 1CLZH 5E4AA 4UANA 2VDRL 4NBZB 3D25A 3NJLA 4P4KD 5ESVB 2DKSA 3WKYA 4NKMA 3KCPB 4FG6D 2B59A 3JQOB 1P4UA 1S78C 3U9WA 4LSRH 1KOAA 3AU1A 4ISVB 4KKAC 3K0YA 4CMHC 1T0NB 1ZSDB 3UTZA 2IG2H 4DTGL 1U8KB 4HUXA 3EGSB 3A23A 2Z92B 4ZOAA 4H2AA 4B9IA 2NW2A 3T8VA 1UZ6F 4K73A 4YHOH 1I1CA 2I7OA 3G5XA 3GNMH 4XNUL 3O3EB 1DQJB 1KB3A 1TZHB 8FABB 4DP6X 2MNJB 3EOBB 3T0ED 2Y4SA 3CDYA 1WBZB 5CJQL 1EHAA 3RRQA 3VFNA 4EQ2A 4M1GL 2BIQA 3HE6B 3OLGA 4E5XB 2MCMA 1K8IB 5IB3A 4ELMB 5I71B 4QOKD 2R0LH 4Q14A 4K7PL 2EVJA 4X7FC 1COBA 5E1IA 3FFDB 3FB5A 2BK8A 4U1IA 4LLQB 1GGBH 4L3CB 4OZIA 4G3YH 3MOAH 4TUJA 3WDHA 3W11C 4P2OB 4KXAA 1Q0EA 2VXVL 4RRPG 4DP5X 3TBTB 2ZX9A 3EG9B 2IDTA 3BFOA 1I1FA 5CEZE 1EHLH 1YEGH 4LEOA 2D03L 3P9MA 4FFZH 3GSOB 5AG8A 2EDNA 3N44B 1IC1A 2P8MA 1XF2B 4YSOA 5DC0A 1BIIB 2HKHL 2YPKA 1IT9H 4UZGA 4U33A 4Z7UE 5EZOL 2X7LB 3QA3A 1KBGL 3IFOA 3OPUA 2WLIB 1ZS2A 3SE3C 1K5NA 3QQ9C 2K3TA 1CGUA 3HG5A 4TUKL 3WFHB 1CFQB 1M2VB 2R2EB 3F12B 2QPEB 4AJ0A 5I1LB 4G5AA 1IGYB 1CBVL 3IDNB 2Y0SA 5C07E 4DQAA 4PJCA 3PYCA 4M6NL 3QRGH 1MWOA 2QMKA 3NCMA 1Q0XH 3HR5B 4PUBL 1PEZA 3NSCA 5ES4B 4R4NC 4RISH 5D7IB 1JAEA 3ULUC 4CDGC 4K7FA 1OAYL 5JHLL 2EDQA 3BAEL 3QUZC 4R5TA 5AKRA 4P5TA 5LAXB 1RUML 3UAAA 2YS4A 1H19A 3ZZLA 1IE5A 3MFGB 2X4NA 4WTQA 1W72H 1JNHA 1FVCA 3DDGA 1TO5A 3KPRE 4JFUA 5D6DC 2V2TA 2P45B 1E5ZA 1GKEA 2DJMA 3LD8B 3RILA 3RKPA 1KCRH 2HLFC 2TRYA 4KTEL 1QA9A 1J9TA 3OGOE 3PFQA 1DQIA 2YUXA 4NC0B 1A4AA 4N8VA 3SKUD 2YGVA 4LLWA 4KZ0A 1EZVX 3FXIC 4P46B 2FO1A 4HWEH 1A7NH 4A66A 4OFYA 3UZEA 2Y5QA 1DEDA 4UI2A 2F8VA 4JFYA 2F53D 1ZIAA 4H7VA 5IQ9A 1FE8L 4YSUA 2E7LA 4POYA 4Y2DA 4HUWA 2EDMA 3IDMA 2HP4A 2BCKB 5E2TL 5CJ5A 2FJGB 2DIAA 4NNYA 3RVTD 4CADA 3HLAA 3WXWH 1XEUA 2C9XA 2EEBA 1N2RA 1QLEB 2GUOA 4HALA 1PZUB 1ZE3C 4EI5B 4P57A 1U8QA 5IOPA 2NXZB 3RB7A 3VXME 1YC8A 1XDTT 2CD0A 5TFSL 3O45B 3TA3D 4TUUA 3ASOB 3KBEA 4QNPE 4HUVA 1AGDA 1DBJH 5ACMA 4P4RB 4ZTEA 3JT2A 1AD0A 4YK4C 3Q6FB 3DVGB 5D1QE 3B7TA 1SY6L 1NMBL 1M9WA 5E03A 3PWJA 2J55A 3SD5A 1QEWB 4NO0A 1UA6H 3R1GL 5L4JA 3ATAA 1ORSB 4U1JB 1AYRA 4JM2B 4N4YB 2YD6A 2PPFA 2ZG2A 2NY7H 3U7WL 1ZLEA 4ONFL 1S7XA 3MRKB 2GC7C 5GGUB 1KPUB 4N6RA 1HSBB 1BGXL 4PRAB 4PJ5D 5DF0A 1ZXKA 2XA3A 1AZVA 4L5FH 5AUMA 1HL8A 2UY6A 1AS8A 3ABLB 5MEND 1N0LA 5I82A 2UVFA 1J11A 2Q6WA 1AC0A 1PF3A 3GZOA 4PJ9A 3PWLB 3MRFA 2XA8L 4KK6D 3VFRA 3TT1L 1AOHA 1UD4A 4H25B 4NZ8A 3EO9H 1L9OA 2X4OA 1RZGB 4PRNB 3JVGC 2EVIA 2BPBA 3VD7A 3QH3B 4D9QD 4ORZC 1XH1A 1LP9E 3MUGB 4Z7WA 2WTRB 1NC2A 1UM6H 1KCVH 3GMLA 4C56A 1OCCB 4YBLC 5DJCA 3P3SA 4IMKA 4ERSH 1A3LL 2OYMA 2L4OA 4HMCA 3WKMH 2X2IA 5D7IE 3VRLE 5LJYH 2C9SA 5I17A 1MPAH 2COQA 5GS0D 3O2WL 4G70B 4O4YH 3RLSA 4LOVA 1I9JL 2QQQA 3VG0H 2HKAA 2XYBA 4KKCD 5F9OL 4TTDD 3QORA 1NFDF 2EE0A 1YMMD 2K78A 3VE0B 4JLRA 4WI3A 1YDPA 2BJML 4UQBA 4ABVA 3OZ9H 1A6WL 4L8BA 4XE5B 3RY6A 2ETWA 4TM9A 4ZMVA 2XTLA 5BQ7A 1KSRA 1JERA 1KXQA 3GD1C 5BS0A 2ENYA 3ZTNL 2X1OA 1AHKA 2BFGA 3APCA 1IAKB 2DQEH 4ZAKC 2EDYA 2ESVD 4NRYA 4XBGB 4QTIL 3QFGA 2DQUH 4Q2ZA 2MMXA 4EVNB 3G6DL 1ET5A 2AQNA 3UTSB 1GPOL 4GFTB 2HFTA 1KIQA 1EBAA 1GH7A 4JFDA 3U4EB 2FWOB 4Z7VB 5C08A 5AAPA 4YMPA 3LKSA 5AB2A 4F27A 4B9PA 2A0LC 2JKTM 4N2MA 4IBVA 1AXSB 4WFFD 5I15H 1TQCB 2DQFB 1BZOA 2PO6A 3SYAA 1XBDA 1F58H 1E5YA 3O0LA 4NUMA 2ZYSA 3V4VB 4JRXD 5FYLD 1ASQA 5DMKB 5I0DA 1J87A 3UAEA 3SKJH 3ZKMD 3FUNA 3IFPA 4PJAF 3OKMA 4N0UA 4AEEA 2EC9T 2R1WA 4HXAL 4HKZA 4HWNA 1JN6A 4MQ7A 5B7FA 1QFWL 5D7JA 3I6LD 2H2PC 3FT0A 4NN5C 4PW3A 5JPNB 1HI6B 3KWXA 3ATBA 4KKBC 1CU4L 2PCXA 1EUTA 2PPAA 2EXWD 1DUYA 1X4XA 2P5EA 5F2FA 4OKVA 2X3CA 4ZPVA 4QHNA 4L4VD 2E6PA 2D2OA 4R7DA 2VLMD 3QUMA 2A9CA 1GTFA 1IU1A 3G5YB 3IMBA 4J3OC 2N56A 1DJHA 3FFCB 1DVXA 4XB7A 2OCJA 5SWZB 5H35B 3QO0B 5HDBB 5B38A 3WYRA 2R29L 4NWTL 3S5ZA 2W07A 5EO9A 3BUBA 3EJCA 4PPTA 3CSYB 4ODTH 5PCYA 5J0BA 5ECJE 4UT6H 1WFUA 2ZOOA 4H8UA 3L7EA 3QDJB 2BHFA 4IM8A 4B6ZA 3F5WA 4FCHA 1KCKA 1KCWA 2IDQA 2F54E 2NZ9D 3IKCA 5EBLA 2VXSH 4F37K 1KB9K 4B5EA 2ICWB 3KPPA 4WSGA 2BS8A 2R9HD 4NSKA 2OTPA 1MQ8A 3CVBA 4PLJD 4YFEA 2ZXWB 5GSRB 3O6FA 3BCFA 3GPSA 1IKNC 2RCSH 3HN3A 5FUCE 2WZAA 3B7YA 3C5SB 4HJIA 3FAWA 1UA7A 4IKKA 1XR8A 1ZHBB 5TH2B 5K69A 3VD4A 3EBHA 3K5SA 4IQHA 3O4LD 4IRZA 5IMMA 4ZTOH 5KVDL 2J73A 2EDBA 1TQSA 2VR8A 4LSPL 3TBYA 4LL9A 1LDPL 3MLZH 2EICA 3LIZA 2F08A 2VL5B 4LAJH 1MFUA 2QQNL 4XNDA 1BX2A 3CFMA 1NDMB 2NTSP 5GISH 4LVEA 3DETD 3GXPA 4A04A 1ZHKB 3P0GB 4PCYA 5F3FA 4BXVA 1W0YT 5EEUA 2EYSA 2NXYB 1UM5H 5JOPE 4JN1H 2W65A 4UTAA 1AKJA 4OUUA 5B3JF 3W9DA 1G43A 4PY8J 4MX7A 1AVAA 1QPXA 4U1LB 4AQAB 4FFWD 1JGEB 3KNBA 4NZTH 4CSZA 1U33A 3MGOB 3NH7L 5E6RB 2CBOA 4Z3HA 1R3HA 3E3QE 2AC0A 2EUZA 1G7MA 3UTSE 5C6PB 2IH8A 4A6YB 2UZIL 4Z7VE 1QWHA 3HUJB 5GGSB 3O6LL 3KPQB 4KMTH 4PGJA 1LD9B 1MWAA 1XZ0B 4PJDA 4WQOA 1GS6X 1OARH 3QPXL 4XB8A 1OT4A 3VI4B 5FLVA 3MMEB 4TMPA 3M17A 3KH4A 4KKAD 5I73B 4KRLB 5C92A 4OZIF 5ADPH 2IBZX 3PXLA 5IK3A 3HZKA 2DQ6A 4N0FB 1TITA 4NFDA 4QGTA 5F88B 1MCPL 2G0LA 4MMXA 3MRLB 4EDXB 1TFPA 2E56A 5KVGE 1OAQL 2G75A 5FHBH 4KITB 3OF6A 2Z35B 2W38A 5ENWB 1KGXA 5FAAA 5FHAH 1TSHA 2FO8A 3F7YB 2AQPA 2JXMB 5J1AB 1PJ9A 1J05B 1NCCL 1FORH 5EO0B 2VXQL 4XNYL 3IGAA 5I6KA 2Z6FA 4W70A 1ZLUK 3D87B 1GYWA 2IWKA 1DQDL 5EU6E 1FJ1A 2YQ2A 3L45A 1P84K 3BUPA 1MG3C 4RMSA 4F8LA 3MA9L 1SGKA 5B1KA 1E9OB 4S1SH 5AOLA 4U1KA 1JD9A 5DJZB 4M8QA 1S4IA 1YEDB 4PJCF 5HDBE 4QT5A 1JRHL 4PS3A 3IDJA 1FYTD 2HPOA 3I6KA 3BE1H 3W11D 4U6HA 4POZC 3TEZA 4XZUB 4BH7A 4YNYB 4PJHA 4N5EC 1TU2A 4WO4C 4QRRA 2K8MA 2V7HA 3H3PL 3SYOA 5CLYA 1CLOL 1DBML 5CEZL 3C2AH 1KCSH 2CHDA 4XMLH 4BSWA 2V3EA 4F7CA 1I1AC 4LL4A 5AW6B 3LV3A 2X4SB 4JFOA 2AS5M 4XBPA 2ZUVA 2OL3L 4APXB 5GZOC 1MLBB 1AO7B 3O11A 3V4PL 3IAPA 1UB6A 4NRXB 1OF2B 4PCSA 2OK0L 3QQ9D 4J6RH 1RK0A 2GFBB 2DYPD 2KYIA 2B8OT 3ZGIA 5F1OB 1RLBA 2W0FA 1HFUA 2C9PA 3QWQB 3RNQB 5DHVB 5C7XL 5CD3B 4HSAC 4IRZH 3EUDA 4YDJA 2WB7A 2F19H 2FWUA 1MAKA 3P2BA 1HHKA 4R4ND 5GIRB 2CCVA 3ZE2B 4N86A 3ULUD 1LK3H 2NY3C 2BNQD 2GHZA 3L3JA 4KH2A 4Q9BA 3EJZC 5ANMA 1DANT 1IEAB 3ZW3A 2UZXA 3QUZD 2AJVH 2WJ7A 4FI7A 4MJ6A 4UYPA 4YVNA 3UFIA 1INQA 2C5DC 2APXA 1MFVA 4AVHA 4G7VL 5GZNA 4J7RA 5JIPA 1LE5B 2GCYA 2JIXA 4N2HA 3H42L 2X0WA 3VXRB 1IAOA 2KPNA 4JFVA 4C8XA 3ET9F 3JXAA 1PNCA 4UTAH 2YEQA 3GXNA 3K72B 2EYTB 3V0DA 3K6OA 4G2AA 1FVEA 3ZLQC 1UWYA 3BD4A 4WI9A 3WFBH 4GRLC 2MWCA 3VYPA 5AKTA 2VDKL 3KDMB 2EDLA 2PYEE 2VN4A 2X9YA 3LKQA 3QJRB 3IS1X 4I9WD 3KPSD 3MAWA 1E9QB 1AZCA 1BXVA 1JUFA 2UZPA 3R18A 4PV9A 4KMQA 1IGJB 1AJ7L 1QFPA 1BBDL 1NUGA 2APFA 4Z23A 1MWAH 3BW9A 1S9XB 5GGTL 2AV7A 3NA4A 3BJ91 3ZGHA 2CLZA 5F9JB 2GTZB 4PFEA 1A66A 4HIIA 1MNUH 3QDAA 1QVOA 2ZTBA 4NP4H 1E50A 5INDB 3C2SA 1R3LA 4NEHB 3RFRA 4HHGA 4J4PC 1OGAB 1WZLA 4JDTL 2AEQH 2X70B 2ARJA 1W0WB 3BVDB 3LQZA 3FH8A 5D7LE 4QYOB 2V0AA 1UM4H 2OMYB 1K6QL 2J8HA 3MJ8A 2JJSC 4X50A 4M48L 1C1EH 1PZ5B 3KBFA 1JYVA 4DZ8B 3ULSA 2IALA 3W5MA 4BFIA 4F5CE 1JNJA 2P48B 1G7HB 3QZBA 5C6WH 1RXLA 4KI1A 4XP6H 4OLEA 35C8H 3K4AA 1G6RB 2DPKA 1DQML 4PI0A 4OF0A 5TPWL 4AT6A 4HZLB 4A67A 3MV11 5T1KA 4ELKA 1KGIA 3B6SB 3GI8L 2XQBL 4BEIA 3QJFB 4Z7WF 3PJNA 3O4OC 5FF6A 3RFZB 3C6LC 2GUYA 1GKOA 1FC2D 4N3TA 3SKMA 3DOSA 1JGIA 3MLTA 4N2EA 4CU6A 3BZ4B 1IFHH 2DKMA 3FQXA 2XTJB 3BSHA 4LCWD 3PABB 1D9KA 3UCRA 3TBCA 2Y36H 4Y1AB 5BW7A 1M7UA 3S34L 3UJIL 3CSPA 5FPIA 3D4GA 3GBMH 4Q9RL 3IDGA 1M2OA 3I3DA 2AAVA 3FUIA 2IMMA 4PJ6A 3BMWA 1I82A 1AO7E 2WM0A 4PIBA 2UV3A 3WFDL 4TSCH 4LVOB 5I1CH 4GPVA 3B7UX 4KXZI 2P28B 5B1JA 4NQEE 3S37H 3SKNA 3HG3A 1EGJL 4XC3L 4HLJA 3KLAA 4NLAA 4NQCD 2E7DA 4QO1B 4UQAA 1DLFH 5EHFA 2WVVA 4RCAA 1HL4A 2UWEA 3UYOD 1PDKB 3DHJA 4UM8A 4QRQB 4FG0A 3BVUA 1UOVA 5IM7A 3GMPA 2BO0A 1NFAA 5KSBB 3L6FB 2IGFH 3RA7H 1LNUB 2C7UB 3LS5L 1UURA 4LLVB 2EDOA 4JAMB 4WWKB 1MLCA 4FQXC 5J6GB 3WFEL 1A4KB 1OCWH 2C3VB 4BK8A 2ZKHL 4QYAA 3PDDA 4BQ9A 3QUYC 4IU3A 4C83A 1T22B 1TZIB 1IGCL 5DD5L 3SZ6A 4Z7OF 2K8QA 2NY2B 5DC4B 4OSUH 3TESA 3IK2A 4OFYD 1GC1H 2OKMA 4AGQA 4ZSOA 5C3TA 3L54A 2BVQB 4EI6B 5EA0H 4DGVH 1D6EA 3BWAA 3RWHA 4Y2DD 2ZUWA 2FNWA 2AQ1A 2WQ8A 1FZOB 1KTDB 2W0KA 3PWNB 5DWPA 1D5ZB 2D31A 3FQNA 1RUAL 3AGVA 1BHGA 1T4WA 1SLXA 3D48R 3ARFC 5BRPA 1AIZA 1UCTA 1MFDH 5HHOA 2QL1A 2E7HA 4IOIB 1SDYA 4Z0XB 2A0LD 3N43B 3RUGE 3DX7A 2YEZA 2WINB 5GGVY 4IEFA 4TQIA 3BZFA 3TVMA 1TPXB 4NM8L 5DWUL 3LX9A 3FQYA 3HS9A 4MNQA 1KWGA 1H3PL 2G5RA 4JDZA 5J06A 1WBXB 1RUQL 1WD9A 2VDOH 4XOCA 4DWHA 4ZW3A 2WXQA 3LSOA 5PAZA 2WQXA 3QR2A 2GAZB 1UYWL 2YIHA 5JOEA 1WZKA 1ZIBA 5DO2C 5F9WB 1K4CB 4G11A 1IBGH 2IGLA 3IF1B 4KKBD 5CEXA 1UEYA 1G1YA 2R7EB 3DV4B 4W9KC 4KJPC 3RI5K 2JB5L 2X0UA 3E80A 4YHLL 4R5XA 3Q44A 3OKOB 2VOTA 4AIZB 3LOWA 2OW6A 4U0RC 1JYWA 3KLHC 1L9RA 5EORH 1M57B 3IAGC 1XCQA 2XWXA 4JY5H 3SE8H 3NIFF 4MA3A 2FJUB 4X4KA 4GO6B 1R5IB 4APQC 2MCPL 4A2HA 4FJ6A 4KJYA 1JJUA 1XMEB 5L8KB 4AZUA 4YHYB 4I3SH 3HB3C 1A6VH 2WXNA 3N0AA 4K3HA 4FNSA 3L3IA 1XGQA 3FYEB 3NIDF 4MD4A 3SCMB 3ZZQA 3ZT5A 3I9GH 3OKDB 3PV6B 5CLZA 4D8PA 3UOAB 4O51B 5DJYB 1G7QA 4N2GA 3DVNA 4IBWA 3P73A 1NBVH 1OM9A 2DQIH 4YBHA 3I9PA 2PP8A 1C8PA 1HAWA 3QORD 2OMWB 1BD2B 1EMTH 2R69L 3OLIA 3N50A 1A9EA 4OZ4B 3U9PL 5HYJE 3WOVA 2ZP9A 4LSQL 2XKUA 5IT2H 2FH8A 1T3FA 5E6IA 2L7QA 2NUPA 3EOAB 4LBEB 2VABB 1Y0LB 4HMEA 2Y7QB 5CP7B 3RI5F 3T04D 3RNKA 1SXNA 2H0FA 4Y9BA 5IKCA 4BK5C 1SM3H 4DPAX 2O5XH 4PJGE 3T2NH 3P77A 2DQCH 2WWKT 4PJEB 2E9JA 4L8CB 2R4SL 1T1XB 5FIEA 4ANWA 2BP0A 2C1PB 4WCYL 2H1PH 4JFDD 1H3TA 1WA0X 2B4CC 2G3ZA 4XNXH 5DJDB 5LNGA 4XMXA 2AK1H 2X4QA 3NACH 5E95B 2PXYC 4KVNL 3JV4A 3CVCA 4KZCA 2RHEA 4PBWD 4HUUA 5EOQH 4AEFA 3AU0A 3T0AA 3FH5A 1IGFH 5C0AB 4K3EL 2LLLA 4A2FA 2LW3A 1QR4A 2ADIB 1GA2A 4ABQA 1GOFA 3U46B 3TEWA 2J4WL 2BOCA 2KLRA 2AERT 5EULV 1MAJA 1TCMA 2D7TL 1TTAA 2FO4B 4MB3A 3ISRA 1MREL 4HHWA 4DP9X 3OPZL 2Y1VA 1KIUB 3VH8A 1KB5A 2F5AH 3V7MA 1I8LC 4TLUA 4I77L 3I02B 4M7LL 3B3IB 2ZKMX 4UNUA 3V0FA 2BCMA 3ARGC 1IAMA 4FQQA 4KJQD 2OR9L 3BUTA 2AJZA 4GAYB 4PGBA 5CU9A 2O93L 5MEQA 1JHKH 4PJHF 1YYML 4WEBL 1PS3A 3PWVB 4WFED 3MV9A 1MCOH 5J89A 5EO1A 1HH6A 2OTUB 2KLTA 4PY7A 4HOXA 1DZ0A 3ETSA 3AM8A 3MRBA 4AE1A 2J25A 2HVBA 5JW3L 2QV2A 2JKSA 1MUJB 4AUUA 2AZAA 1YECH 2NR6A 3O6KL 3OGCB 1FO0H 3FQRB 4BKTC 3UAJC 4X6DE 1BQSA 4M7KL 4OFPA 5F7UA 4G5ZL 4PJFF 4WW2B 3VSTA 3PWPA 3THML 2CO2A 4MJID 2C26A 5EU5A 3KLDA 3FHAA 3SDYH 3WJJC 3SQBB 3QJSB 2ORBH 3QNYA 3T09A 4H20L 3BYTA 3AG2B 4FXTA 1ZLVK 5AAWA 2R2HA 4BFEA 4YHNA 5J1TC 3OBAA 1UCBH 2MHAA 1HOCA 1UFGA 1YMHB 1GYAA 2HFFB 3RDTB 4N8UA 2WUCL 3FTXA 3D30A 4LLUA 4E41A 4POZD 3FU7B 3QFJB 4KKLC 4N5ED 4DO6A 1OAKH 2BHUA 4B60A 2EP6A 4GQ9H 3S35L 3ALWA 2NY5H 4WWOA 5IJBC 1XMWA 2H0JA 2FHFA 2IWEA 1UUNA 2N59A 3DTUB 4H44C 1KIPA 1M53A 2X1XR 1L4IA 1I1AD 3HPJB 5KVFE 1OOAA 3PJSA 4MMZA 4TNEA 4EZJA 5D1ZC 2O61A 3H0TB 5GZOD 3QCVH 3LKNB 1FNLA 1Q72L 1W8NA 4FULA 1A6TB 2V17L 4NRZA 4BFJA 3P9LB 2VDLB 3DA0A 2GJZA 1GIGH 2FZ3B 3BPCA 3DBSA 5HHMB 2IOIA 1AZZC 1HDMB 4NOFA 1OB0A 4PMEA 2WW8A 2CHXA 2JKLA 7CGTA 5KS9B 2PCFB 3SGJC 4GKLA 3SPCA 4N2FA 4Q89A 2E0PA 1R3JB 5D1XA 3REVA 2NY3D 2HX7A 3OHXA 3SYQA 5I16B 3EJZD 4PJEE 2PABA 4NO5B 4UT9L 3M1BB 1VB9A 4JG0L 3G04A 4KZDL 3IN2A 3MNVA 5LXGH 1TKWA 4X80L 2HFEA 4IGBC 4OKDA 1QD0A 4MLIA 5IJKA 4JFHD 4K94C 3SDXA 2I7SA 5ABAA 1SJXA 1Z3GH 4HC1L 2W59A 5C0AE 1J7VR 1SBSH 2Y7SA 3M46A 4UQ3B 5DMIL 4ZK8A 4D0CB 3LS4H 4JDVA 1ZK9A 2PYFB 4P9MH 4TPRH 1VHPA 1UACH 2OMXB 4KAQL 4U05A 2JQMA 2Z4QA 4A6YL 5BRZE 3OF6D 1B2YA 2EVHA 3WNOA 4HSCX 2DMHA 4A37A 5JA9A 3G6JF 3UTQB 1GVIA 1YYLH 4RBPK 5GRZA 1KB5H 1RPUA 3PPEA 1WFJA 3RY5A 2WQSA 3QISA 3S35X 5ICYB 1OP4A 3D06A 1T03L 3FB8B 2IQAA 3HAEA 3WHXA 2YD2A 1H9VA 1M3IA 1T1WA 2BX5A 1AR2A 1XD0A 1YEIH 1PLBA 4DGYH 1YNKH 2X42A 3B2UC 4YGVA 4QXTB 1OWWA 2WXIA 3PUUA 1UKTA 4RFEA 3MRRA 1OTSC 3CZUB 1I3VA 3U6RA 4NQXB 4EKXA 2PR9A 3QIBA 4FKEA 1B4TA 2Y2WA 1F97A 2GEEA 1E5UI 2Y72A 5D8JH 3IMWA 3SGKA 5DU7A 4M3JA 1WBYA 5DQDL 1A14H 1LVEA 3MZTA 3S5LA 1D7DA 5E1HB 1KLUB 1RHFA 1KB9J 1YEKH 1MIEL 2GI7A 1IBZA 3KD4A 1O9VA 4P2RB 2IFGA 4PP2A 4MXWH 2FEJA 25C8H 2UWEF 1U42A 3I84A 4P3WA 5EF1A 3AG1B 5BV7B 3C6LD 1IAIH 3NP3A 1YG9A 4HGKC 2I27N 4YUEH 4ACTA 5EFIB 1QSFA 4K2UL 4L4TD 2YK1H 3QFJE 1NAMA 1G7JB 1NCGA 1ZA3B 4JN2B 4YDKL 4TN9A 4XAKE 7PCYA 4P3CH 1PX8A 4PHXA 3SBPA 3LZOA 5I24A 4NCC2 1JYXA 1ICTA 4UNIA 1V05A 3SGEI 2AJSH 3BPOC 3A5VA 4A2DA 6PAZA 3IJYA 1DSFH 1AY1L 2WQVA 3IT8D 3MLXH 4ZMTA 1HHGB 4PBVC 1N8ZB 4XCYB 1QWNA 3SY0A 3VRIA 2JKJA 1OK8A 1JXKA 1SYSA 2IPKB 4ZUWB 4FQ2H 4F7TA 3CLFL 3MGTB 1JWUB 3WUZA 1U95A 3BP6A 3IU4L 4HFWB 2FECI 5K9KA 3HFMH 1DFBL 3BGMB 1BQ5A 4O9HL 5CZRA 4GO8A 3T0BA 1GOGA 4X9YA 2PPCA 1IL1A 5IQ7H 4BFNA 4XO5A 3IDIA 5DRNA 3ZDXE 3LJ3A 4LASH 3LH8A 4Y16C 3HG0A 5I6OA 1I4FB 4MKMA 5EOCH 4FQXD 3LPGA 3DX6B 4I88A 4NN6B 4LRIC 4ZQKB 4GP8B 3EYVB 4P23A 3GGWA 4JHVA 2Q3AA 4XAWL 4G43B 3MLSL 1S3KL 4GAJL 3KR3L 1ZA6B 3MLRL 2CGZA 3QUYD 3D2UB 3MUHL 3VFSB 5GSVB 4BXSV 4OLVL 3OG4B 4OF3A 3PWUB 4AL8H 2XNAA 1IQWL 2H32A 3X12B 5JOFA 3ASNB 4HAFA 3L4ZA 3H2PA 3BZEB 2VSDA 5DDHA 1J8HD 4Z3GA 1MW3A 4CNIA 1BLIA 1N59A 3B9AA 4FXKB 4B50A 1ED3B 1SVZA 2EEAA 4WU7A 5E2WH 3PL6C 1MHCA 1PJWA 5LBVA 1DBBL 4XX1G 1NBZA 4WTXA 1MAMH 4XC1H 1U8CB 1JGLH 1NJ9B 2GG1A 1CXHA 1YNTA 4OCNC 2XY1A 3MRIA 5D2LA 3TZVC 2P5PA 3FT4B 1P84J 1UH2A 3C08L 3CH1A 3CVHB 4LLDA 4NZUH 4P5MA 1UGNA 5IB4A 3SYCA 1ZTMA 3IGFA 3UC0L 4QCIA 3QDGA 4OFKA 2Z3FA 1GAFH 4LRNH 2JELH 2GVYA 2Y6SC 3HAEH 2QLVB 4IOSD 1WUNT 3IU3A 4KDVA 4KJWC 3NSFA 4AXWA 3L1OL 5DVOA 1XXDC 1V7NL 1FG2A 2ITDB 3LNFA 4EDWH 3AQYA 5DO2D 3WIIH 5EIQA 4X2UA 4Y4HA 3LZLA 5FGCE 3U7YH 1IM9A 5DJ8A 3UERA 1AE6L 4MBRA 4X4YA 3EJTA 3TPUB 3HHSA 3SBRA 5F1NA 1G6RL 2NT0A 3KPOA 4HIHA 1UTDA 1G0XA 4JFFB 1BJ1H 4K8RL 1DLHB 5D93C 5DLML 3B1TA 5DMGD 4MJ5B 5AOZA 4XT1C 2Q87A 3EJYC 2FVNA 1PYWB 3TFKC 1G87A 1HQRA 1PKQA 1CF8H 1PZSA 4APQD 3VX0A 2EKSA 2DDQH 3HBGA 2HUEA 3NOIA 3KLKA 4LSDA 2XN9B 3IFNL 3GSNL 2QADB 3HS0C 2O5ZH 2YWYA 4HJSA 3G08A 1VZHA 4W6YB 5DUBB 2VDPH 1CO1A 3VMNA 3BDXA 3W38A 1I7UA 4OV5A 4D3CL 3OAUL 4Q74A 4JFXB 3K2UH 1MY7A 1U3HB 1RIVH 3B8SA 3U0PB 3QT2A 4A7QA 3H54A 2GJ6A 1NCDL 1H6UA 4I2XE 2FHCA 1NLDL 4OFIA 1T2QH 4DCQA 2B1AL 1JI1A 4X8GA 2QELA 3B8YA 2FX9L 1L7IL 2C9RA 2W60A 4FNLL 5ALBH 4B9FA 5BZWB 3RE0A 3BZ5A 1OE2A 2WUBL 1QOKA 2UXTA 3CLWA 4GMTL 4YHML 1XL4A 1PD0A 2D0GA 3CZFA 4GEIA 5E4EB 4FL4B 1WSST 1RJCA 4XXWC 1SEQH 2WANA 4JFEA 5LAPA 4FQIH 3BRDA 5JHDE 4ZJ9A 3CFTA 5AVWB 3F7RA 2CGYA 4GRWB 5L7XH 4K07A 2VDQB 5HHVH 2PXYD 4ZFQA 5I5MA 4WI0B 1FFTB 1GZPB 2VLKA 5HVWA 2FJFB 5J6SA 4R97B 1YSOA 2C3WA 3VTAA 1PQZB 2H32H 4HPYL 3N6YA 2E27H 1D5BA 2JCCE 2CXKA 2BRQA 1Q9WA 5MEOA 1OB1A 1KEGH 3QQXA 4LKCB 1IAIM 1OP5H 3IEAA 1DUZA 3O2DL 3IWUA 1KCUL 3TOPA 5JORB 5E8OA 3PIQB 4JPWH 1NDGA 3WUWB 1YN6B 3QWNA 5CILH 4YEEA 1TJHH 5E8DL 1MKFA 2FIKA 3ZTEA 4H88H 5E4OA 4QDGA 1JWMB 1KJ2B 1F02I 4H1LA 3MRGB 3BIKB 1TVBA 5FGRA 4NCC1 2IANE 4N9GB 3ARGD 1HTYA 4OM1L 1IV8A 1T7VA 1BQKA 2HJKB 2OJEB 5FO9B 4RSVA 4QF1B 4WFHE 3WIHL 4Y5XA 3ZIMA 2CMRH 3IBOA 2OXHA 3WXVH 1CG9B 1RK1B 1X4YA 2PMZA 2Q9OA 3GDBA 4YLCA 1KXHA 5AVUB 4U3HA 1XH2A 4TQ8A 2ZYHA 5L6YH 4PJ7E 5MEPB 3UAJD 5K93A 1P5UA 1GMIA 3FQWA 4ODHL 4HS3A 3VFWA 5I8CB 3FO2A 1KT2A 2ZOWA 4G1EB 3VYNA 4CC1A 5HSFA 1GY2A 4WIQA 4H5SB 4ANUA 1M4KA 2P5WD 4EXPX 1H15B 1TYRA 1SYVA 2LV4A 2XWJB 1CXEA 5ESQB 3IDUA 3FCTB 3CAFA 2BDNH 1N8OE 3O3AB 3GTTA 1UD8A 3BQUC 3CVDA 2P42B 1PY9A 4FQCH 2PP7A 2NY1B 1HNYA 2GSMB 4QWWD 5AVRB 3RWCB 3QZWA 4XPFH 2R0KL 4DFHA 4PJBB 1FZKB 1S9WB 2R23A 4KKLD 4X6BA 3DX9B 4OIIH 1UOLA 2MKLC 4CVZB 1FP5A 5HHXL 4Z7AA 1HINL 4ZTPH 2QQKL 1XIWB 1PZBA 2B0SL 5CLWA 2MH4A 1B3IA 3WGUB 2ICEC 3HE7C 4HX1B 3RKDC 4UM9A 5ACZA 3CXFA 4HS8L 4NB7A 5D1ZD 4OGQC 1FL6B 3H4FA 4OFDA 4OVUA 1SVCP 3FB7B 4PG9B 3NN8B 1MCFA 3EGDB 1CLVA 1A1OB 1IAII 3OMIB 5F97E 2VUKA 1AGEA 5E8EB 3T0EE 3NFNA 3DPDA 1T89A 3JTTA 4YDNA 1B9KA 1NGWB 4U3CA 3Q8FA 1KJ3H 1YRKA 5TDNB 1O6SA 1UZ8B 4AK1A 2E76C 3W81A 2XIIA 4E9QA 4Y88A 1JPSH 1SXBA 4QOKE 5B7EA 4BE6A 2Z4TA 1E4WH 3RWDA 3V6OE 3QIWA 1U21A 5IV2B 1JXJA 1DN0B 2IFFL 3G6AA 1MCQA 4G8IB 5E1QA 3MODL 4M5YL 1H6FA 2AJYH 5JUEL 4XWOC 1OP9A 1A5FH 2BP8A 4TSBH 5T1LB 3WELA 3LEYL 3ULVE 3ZSTA 3ZUCA 2NY4B 1CGXA 1VZGA 4NQSA 5CR8A 4OIFA 1MZYA 4IGBD 4MJHA 5CMAB 1KLGA 5AG9A 2HKFL 3E1ZA 1QHPA 4UQEA 3UABA 3WO4C 4WGKA 5IB1B 2DWDA 3V0EA 4MCNA 3HRZC 2GIMA 3IMTA 4Q0XL 1JTPA 4ZAKA 4GG6A 4PU2A 4BZ2A 4MXVE 1WJ3A 3AWGA 4PM1A 5AAMA 4BZ1A 1CIUA 1X6LA 4AVIA 2P80A 1GGCH 2F58H 1S9YA 3TYGH 4YX2L 1NANH 3MV9D 2A6JB 1HXYA 1OQOA 1YPZA 1RHHA 1WPCA 3ZHKA 4HKBA 2GITA 4J3WA 5C0RH 3N9GL 5TJWK 4PSRA 3WE6A 5TE7L 3QK0A 3VXSA 4H1LH 1QW8A 3Q6GH 1E7UA 1U8OB 1BAFL 1NCWL 4JY6A 3WUWG 4OTXL 1O0VA 4PLOB 1D5IL 3FO1B 4V2BA 3L2LA 2OMTA 3QQ4A 2DJSA 3SDCC 3B2UD 1OP5K 2HH0L 4ALAC 1L0YA 1U6AH 4XMKL 2FR4A 2J6EA 1OTSD 1QSEB 1EO5A 1FL3A 1E7VA 3KCWA 4R8WH 3QQNA 4F9LC 1E8YA 3X17A 1X7QA 4ODUB 3MCKB 4C59B 1AZNA 4YL9A 3GMOA 1P5VA 4Y1TA 4JREB 4QHKJ 1YY8B 4UB0H 1MSPA 4FFTA 1QTPA 1U8PA 1ZSDA 1S5HA 2CPCA 2FTAA 1CR9L 3MOBH 4G8AC 4HBCL 2XV0A 4ZXBB 3QIUA 4LSVH 2J8UA 1OPOA 4O2FB 4YC2B 1JZ7A 2Z92A 3SJVD 1FIGL 1MFEH 3MCG1 4MRCA 3MV8B 3JTSB 4DESA 3CFNA 5FW7A 4I0PA 5J6HA 5SWQA 1MJ8L 1E4XL 4MBOA 1IC7H 1TZHA 5CHNB 1EFXD 2HAZA 3VFMB 4FYQA 4KK5C 5GRVK 4WV1C 2ZG3A 4TS6A 3QZPA 1E4KC 1DO6A 2P8LB 3NPSB 4GXUM 4PRHD 5B3NA 1M1XA 3HE6A 4E5XA 2ENSA 1K8IA 4ELMA 4W93A 2C8NA 3OXSB 2DLFL 5D1XD 4MDJB 2NSQA 3UTTB 5C8JB 1KUMA 2JQZA 2YPVA 1V3JA 4W9HC 1NL0L 3QUGA 4X5PA 5E2UH 1FH5H 5KBMA 4WJ5B 4K5LA 4OB5L 4XVSH 4LGPB 4LLQA 2J72A 3GK8H 4HCRL 1OAZL 1U3YA 4LSUL 3CZNA 1J9SA 2VDLL 4JUSA 5I1HL 2QHLA 4GB9A 2EE3A 4TVPL 1AIFB 2EIMB 2YFOA 2I9LA 3TBTA 1ZHLB 4LFHD 2WLYA 3Q2CA 2YAHA 1JFQL 3JT0A 5F8QC 2B15A 5SX5H 4PRID 1OPGL 2J6WA 1BYOA 4Y16D 4HXBL 4FQLL 4FZEH 2CKBB 2ZAIA 4L3EB 3AAZB 5D7SH 4X9GA 4L0ZA 1S7WB 5IHHA 2IWGA 1WG3A 2WIIA 5MI0B 4G8EA 3CFDB 4PTUA 2VIRB 2X1PA 2FJHB 3B9DA 4X5LA 5H4YA 2X7LA 3ENEA 3FF7A 3TWCH 4PJ5E 1S7QB 2DICA 4J6IA 1FVDB 4M6AA 2XZCL 2YC1B 2RJMA 3SDDA 3VA6A 1M2VA 3SDAB 5MENE 5K9OB 3NCFB 4HCGA 1NBQA 5I8KH 1IRAY 2G5BA 4FXGA 4OZGA 2YXMA 4E42B 1X5HA 1M9SA 2XG5A 3D69A 4LCUB 4HYTB 4BZ2H 2OI9C 2OQJA 3HR5A 4BZ1H 2AJ3A 1JPFB 1OE1A 5EPMA 1XVSA 3PL6D 1FWXA 2YSSB 4JG5A 2ZCHL 4D9QE 1PX3A 5C0FA 1NMAL 4E9LA 3SPIA 3AG4B 3ZKXB 5BXFB 3US9A 5TE6H 3UJJL 1CT8B 1HHHB 5HHQA 4L9LA 4UINH 3DMMA 5LAXA 1UEMA 4GXVL 4OQTL 4RAUB 2BSED 2ZYRA 3II1A 3MKGA 3QCTH 4FDWA 3SZKC 2WTPA 3TTSA 4G7RB 3FNKA 1K2DA 32C2B 1FGNL 3HI6H 1TVHB 1ZK5A 3PHQA 4W9DC 2ZOKB 2FX8H 1OCRB 2OZ4A 2G3XA 2Y6SD 2NYKA 3VQ2C 3QC5X 4KJWD 2ZUUA 5TQ2L 1YMME 5A1AA 4JO1H 2EUXA 4IJ3B 4GW1B 2PWDA 4JO3H 5C0BB 1JE6A 2J6EH 4RQQB 2CGRL 4KROB 1OD7A 5GJTH 1KJVB 1MJJB 3HS8A 1TLMA 1U30A 2ESVE 4Y8DC 1WAEA 1NFDB 2FQGA 5DTFB 3WL9B 3VD3A 3WNJA 3FB6B 3OR7A 5BZXA 4RWYL 3MRQB 4DUXA 1WE5A 3V0WH 1YEEL 2WLLA 4Y2OA 5C6TH 5D1QC 1I7RA 1DJZA 2X5PA 5ANHA 3TFKD 1MHPH 3MV8E 5I71C 2ED8A 2O5NA 4J3OH 1G0YR 1ZS8B 3L9RA 3MRDA 4LHUD 4NUPA 5I1AB 4R9HA 1A22B 3K71B 1Y18A 1FA4A 3QCUL 5BVPL 2OSLB 3TN0B 1LEKB 4E9VA 1PKOA 4KXBA 3O0RH 1QO3A 3T77B 5FYLE 1BZ7B 1XGYL 3PRZA 4FQPA 1JZFA 4IRJC 4P2OC 4GKSA 3EFDH 2DJUA 3OSKA 4J39A 1RZFH 1M7XA 2GW5A 1QZ1A 1RVFH 5FB8B 4ZD3H 5KTEH 3BT2L 1S7RA 2DD8H 2BSSB 3I6LE 3IMRA 2PLTA 1MCLA 2XN2A 1GZHA 4J2QA 1ORSA 1BWMA 1O6VA 4I1PA 3H85A 1X5MA 1C12B 2YPVH 3GIVB 3I3BA 4HAKA 3GS4A 4IU2B 4XP9L 5T33L 2F8XC 4YXLL 3P69A 3HI5H 3KPTA 4L4VE 4CC4C 2VLME 4PJAB 3GLZA 5BOZG 2E47A 4L2YA 5E7FA 3TBVA 3KXFD 5D2NB 5SX4I 3C5JB 1YN7B 4R4BB 1LTXA 4BDVA 1Q4NX 5IQMA 3GMMA 3FJTA 3LRMA 1WEJL 3EGXB 1P7QA 2ZX8A 1AQKL 2O6DA 3DXAA 1U91B 2AFNA 2YEVB 3X11B 4EIGB 4PLKD 1G84A 1ZT7B 2CR3A 3CX2A 3Q8BA 1OKEA 2YRPA 1DQVA 5I2IA 3ISYA 5GGQH 4PRNA 1HXMA 5HGBA 2APVA 3VXUD 3VD0A 1R47A 5IIEB 3DHUA 1BVKB 2WLMA 1F4XH 4W9LC 2CIKA 2BWIA 4GAAA 3VXOA 2OMUA 3QJUB 5E08L 5EN3A 5DK2B 4AITA 5I1IL 2UYLA 2Y06L 3BKJH 5SX5K 3H3KA 2MSPA 4UMGA 1JNNL 4IOFD 5AZEH 3Q9PA 3ILQC 3R4RA 4U6XB 3T2LA 3F7LA 1OSYA 3VACA 1SOXA 1Y6NR 5C2BH 4NQQA 5DYOA 2AK4B 5F3BA 3V5KB 4JKPH 3O4LE 5FA3B 2W92A 2OPCA 2XQ0A 2ZXGA 4U2YA 1ZRUA 1W72B 4I48B 5FDYA 5C0CB 1BYPA 5CSZB 1I7TB 4P46C 3ZE1F 4OM0H 2DQTL 1CD1A 5CSBA 3H1ZA 3CVHL 4H26B 3EYOA 2NYZA 2BNRD 4XP5L 5IW1A 1CICB 3NABL 4YDVB 4HJEA 4DUVA 2HX8A 4GT7A 4HUNB 2X9XA 2OZ4H 4KY1H 4YSRA 3L3HB 4KQ4L 4EVNA 2B1HL 1N5AB 2PP9A 5C0GB 1ADQL 2G4EA 4QRPB 1UB5A 5CAYB 2Q7NA 4EI5C 2NXZC 4JKLA 4ZFGL 3D25B 1AP2A 1HE8A 2P9RA 3NVQA 1WP6A 3SQOH 4NKMB 3QUXB 3QAQA 2XQYA 2B59B 5E1GA 3MO1A 2BOBA 3C5ZC 1T1ZB 2DQMA 3AU1B 4M00A 4WUKH 4CKQA 3UTZB 3LZQA 2ZZUT 4FMKA 4GSDH 3ELAT 4AIOA 2D0HA 2ZICA 3V95A 3V5HA 2CJTA 2NW2B 3BQUD 3VWJB 4HT1L 1P0SE 3D6GA 1KDJA 3MV7A 5E2VL 2EINB 3G5XB 3PHOA 5IBLC 2H8PA 4JM2C 1A7PL 3ZHFA 4V2CB 1OSPL 2FX7L 3VFNB 4ANKA 1TJGH 1MELA 1R3KA 1U8JA 3ZVVA 4AH2A 1SDAB 2A9NL 2CXGA 4QIRA 2D9QB 1IC5L 2JI2A 3HE7D 3RKDD 5IB3B 4S0SD 1FFPA 5A3IC 4ONGL 1CDYA 3QHZH 2V6HA 2XFXA 4PB9L 4R3SA 5IFAL 1XV8A 2GBTA 4EOWL 3FB5B 4U1IB 3WHE1 4KUCF 2DL2A 3OR6A 4CMMA 3CHRA 3FFCA 4OZIB 2M83A 3DO7A 1H9DA 1MRCL 4TUJB 3QO0A 4YBQC 3RWGA 1YO4A 4LCIL 1DFXA 4EZKA 4JPVH 1I8MA 4PJAE 1R3IH 1U92B 3BD5A 5CBAA 5FUCC 2ZQKA 1I1FB 4YIQA 5KJRL 5IROA 1YPZF 3RVUC 2VLKD 4LEOB 2P7TA 3P9MB 4W68A 3V8CA 4F8PA 3FTZA 5LNDA 1VENA 1BZEA 3D7PA 2P8MB 3RX8A 1C16A 2CLRA 1Q0YL 4QRBA 4LPTA 1FYTE 1MZZA 4YHZH 4UQ9A 5EIIA 2YPKB 1BM3L 5B7MA 1F3DH 4X7TA 3WFCH 3ULVL 3JWDL 3QA3B 3IFOB 1L7TH 1UHVA 1CXFA 2ZOUA 5DUMH 5T5FL 1CB4A 1K5NB 5DVLA 2VDQL 6FABH 3A67L 3DSFL 1ZHBA 4CGTA 1TJIL 3NDYE 5HI5C 1FUNA 2W88A 4PJCB 3U1QA 2WQUA 1YNLL 1B3JA 2ZOTA 3BYYA 3ZRSA 2WVTA 2XUWA 2NX5D 1PCSA 3HG1D 3H9SD 1YHPA 2ADJA 4K7FB 4MAUL 1EXGA 5JR1H 4UAHA 4B9GA 2IDCA 3EDFA 4P5TB 3GBLA 3E3QC 3TNMA 3GIZL 2J8UF 3UPAA 1TJMA 4J3OF 2BIIA 4FOMA 1KJ2L 1IBFA 4O5LH 4YPJA 2X4NB 4HCFA 1FVCB 1JNHB 2V2TB 1FGVL 1VCAA 2UXGA 4O2EA 4FYSA 2BERA 4P05A 2BNQE 2QQLL 1QA9B 4DNLA 4HPHA 4CRPA 4U1LA 4K9EH 1A64A 3L3DA 1A1MA 1GGTA 3CMOL 4N8VB 3GLEA 1T20A 3L1EA 3QJVB 4LLWB 3NEEA 3DOHA 4OGYH 3EYSH 3HHRB 2ICES 5J9PA 1LD9A 3Q05A 5CO1A 4OH2A 1NEZA 1XZ0A 4HEMA 4X6EB 3I9AA 4YE4H 4KX9A 5LBSH 4JFYB 3VI4A 5IQ9B 3MUZ1 1DEEA 4Y2DB 4HUWB 5JPNC 3IDMB 1DVSA 5IGXH 5FWRA 4ILDA 4NNYB 2ZNWA 4UUJA 4CADB 3HLAB 1IZKA 3NRPA 4M1CC 1N2RB 4OJDH 2GUOB 3JSSA 2ZPKH 5IOPB 1U8QB 5B3JE 1KYOK 3HZYA 5HY9A 1Q9OA 1IC4H 3F7YA 1E9PA 2K7QA 3K5RA 4HUVB 1AGDB 5EO0A 5IJDC 4KK5D 1AD0B 3FO0L 1J5DA 2EVFA 3BKCL 3LNGA 4NWUH 3ZL4L 4PEEA 1WQVT 3VB9A 2ZJSL 2EH8L 3MLVL 2YKLL 1H3UA 4DPCX 1SN5A 3QIWD 4PWGA 4NO0B 4FQJL 4UTBA 4XCFL 1HILA 1E9OA 4AKOA 3T3PF 4AEHH 1WO2A 2G9KA 1KNOA 2Z9TA 4OZGF 1JHTA 3UGUA 1BFTA 1FDLH 4WUUB 5B3SB 4LOFA 1S7XB 3UZQA 4LP8A 3ZKNC 3PAVA 4FFYH 3ZTJH 2GEQA 1RUKH 4XRCA 3RZCA 4N6RB 3WTVA 3UBFA 3AABA 4Y5YB 1RULH 3NJFA 1CD9B 4G1MA 5HYSA 4PD4K 4XPGH 1ZT1A 3Q1SL 1N0LB 3DECA 2ZWZA 2Q6WB 1DVYA 3GEWB 4RMBA 4PJ9B 3N1GC 1N26A 4M6ML 5LNEA 3MRFB 3VFRB 5JQ6H 2PN5A 2DM3A 3OB8A 1AFVH 4PWIA 3ES6A 2X4OB 2XX1A 1ZGLM 4LCWE 1MLBA 4ZFFB 4NRXA 4OD1L 1UASA 2QPFA 2VJ0A 3NESA 5JZ7C 1IILE 4A63A 2A4EA 3OKYA 3HNSH 4FX5A 3VA2C 4Z7WB 4PJCE 3ARBA 1NC2B 1HX0A 3RNQA 2AV1B 3GMLB 4C56B 2RFXA 1IBYA 3W0WA 3WTWA 4AOFA 1WK0A 1C5BL 3LYRA 3M45A 3MYZA 1TF4A 3VXSD 2NXYC 4MHHI 2D4DA 2WXKA 4NUGH 4OLWL 5I17B 1CS6A 4XO8A 5EZIH 1PL3A 3MXWL 4KQ3H 1OW0C 3H7BA 4LSSL 3BN9D 4JJHA 1OGPA 1Q1JL 4QRSA 3DI2B 3P3TA 4NQCE 3B9KA 5C09D 3CVIL 5H4ZA 1MI5A 4JLRB 1MIMH 4NAJA 3AS2A 3EW3B 1LE5A 5BO1H 1CJYA 4L8BB 1G9NL 5G4OA 3B2XA 5BQ7B 5A2BA 2IWFA 4S1QH 1DBAH 5BS0B 4DP0X 1NCNA 4MA1B 3QHTC 1EJOL 5GS0L 4FTVA 4HDIA 4NRYB 5G2NA 1TSRA 3RWJA 1CI5A 4Q2ZB 2EC9U 4WNQA 1KIQB 1LO4L 3K4DA 1NCBH 5C08B 1X9UA 5TTRA 4X42A 2A77L 4UF7C 5GRYA 1UJTA 3LKSB 5HGGS 3S96A 1LMIA 3IAQA 4AC4A 2XJKA 1GXEA 2NSXA 3RIKA 4HGWA 3GO1H 1VCBC 2PO6B 5CN3A 2FYYA 3DARA 2DMGA 4R0LA 5E99L 4N8VG 4I18A 5I0WA 4BSVA 1ZTXH 3CFCH 1QFUH 3HE6D 1BSIA 4JHWL 1AS7A 2Z7YA 4LKXA 2J88L 3IFPB 2BFVH 3OKMB 1VADA 3CX5K 3D08A 1JHLH 1SBBA 1W0WA 4N0UB 2R1WB 4HKZB 5I0YA 5I1EL 5KVEH 3Q06A 3BDYH 4MZRA 2CK0L 4O02L 1RLWA 5E51A 3T9WA 5D7JB 1BLNA 1NUFA 3QS2A 3JWOH 3D18A 4YPGB 3LQAL 4JL2A 2NY6B 2NNRA 3T6WA 1DUYB 5AVQB 2P5EB 4P2OD 2HLEB 3SOTA 4HOMA 4ZPVB 2EILB 2YOCA 4QHNB 3AQXA 5AL0A 2OJZH 5FYLL 4DKFL 4F15C 4ZYKA 3EXLA 4FKKA 2XY2A 3EBGA 1CZ8H 4R7DB 4N0RA 2F5BH 1JTOA 3RL2A 1NAKH 1TLKA 5KW9H 1MRFH 2VC2H 2WAHA 3G9VA 5KYXA 4UTBH 3TTYA 3NGBB 2WTOA 4H8WH 5IQNA 4OCYL 5B38B 3ARYA 2W07B 4OBSA 5EO9B 2WMPA 4OIBA 4RFOH 3FS9A 3N0PB 1BCIA 2M26A 5KSVA 1N6QH 4KUZL 2GTQA 3F5WB 3IPEA 3LMJL 1U41A 1LLAA 4FA6A 5ELIA 1J48A 3IKCB 3IXAA 3LHPH 5EBLB 1BZQK 1FRGH 3ZTCC 3UG3A 1TOXA 2CKBL 5EC1B 4NSKB 4IBYA 3REWB 1SJMA 3X14A 4OI7A 2MPAL 2ZD0A 4J28A 5DZNA 5C9JA 3JZ7A 3O6FB 1RSYA 4Z3IA 1CLYL 3DYMA 3BSZL 1AR1B 3EDDA 3LKPA 1XR8B 2VKWA 3UDWA 3AREC 3KYKL 4P04A 4F9PA 3VD1A 2YD5A 3V52H 2GHWB 2YUWA 3ABZA 5IMMB 4EBQL 3VB8A 3U30B 4QO1A 3NIFB 4KK8C 4AM0Q 2OR7A 4YJZL 3TBYB 1JVOA 4KRPB 4C4KT 4OFVA 3K6IA 3WNPA 1R17A 3L6FA 1HESA 3PREA 3IS0X 1BX2B 2EKJA 2XWDA 4JAMA 4HG4K 5FM5O 4XVOA 1A4KA 2C3VA 5IVXA 1FZJA 1VERA 3NIDB 3PGDB 4XBMA 1QBLL 4LT7A 5T1DL 4TNWK 2WIMA 4MGXA 4P46D 4P49A 5DD0L 5F7KC 2R4RL 2W65B 1KXQE 3B5GA 3FK3A 5BS0E 1AKJB 4OUUB 3W9DB 4MX7B 2BVQA 1AQ8A 3DI3B 1FLRH 3NA9L 1XL6A 3KNBB 4FLQA 1AZBA 3FTWA 1G7MB 4BINA 1XH3A 2L3BA 3PWNA 4ZMWA 1S7SA 2HRLA 4H0GA 4JFDE 1WA1X 1BA9A 2IGTA 4EI5D 2NXZD 1MWAB 2W94A 1A0QL 3KLLA 3M17B 2X28A 3P0VH 5CD5D 1WIPA 2WINA 3ZKSD 2QSVA 4NFBA 3GS0A 3HZKB 1LO3H 4JJOA 2EZ0C 2VQTA 4MMXB 2ZWSA 9CGTA 1R34A 4OI9A 1ERNA 1NM4A 2ZSVB 3MLWH 3X1BA 5A43C 4DKEH 4HIJA 2ZWYA 1IX2A 4OUOA 3GNML 5HHPA 4MA8H 3OXRA 1Q1PA 5IBLD 2GAZA 3RFZC 5KZCB 1OLZA 3IGAB 4JM2D 4LU5L 3CSGA 2AGJH 4GG8A 4Z78B 4WWPA 3AROA 4CL7A 3ARTA 1MQKL 3DV4A 3N1QC 3ZYOA 2X4RA 5FGBA 3EHBB 4WFEE 2WXLA 5FDWB 5I1DA 2R0LL 3MJ9A 1OP3H 4HFUH 3AY4C 3RVVC 4U1KB 2DTMH 1X5AA 4G3YL 4QT5B 3MOAL 5CM1A 4XP1H 3IDJB 3I6KB 2DEXX 4J5VA 1JZGA 4U6HB 4N8CL 3WEOA 4LVOC 4BH7B 4PJHB 4WHYG 3W9EA 3JTBA 2DQHL 1EHLL 4L37A 1YEGL 1TU2B 4MKTA 4PG2A 4FFZL 4QRRB 2V7HB 4RIRA 1WAAE 3RVUD 3W39A 5CEYA 3VRJA 4DAGH 1DDTA 3BLKA 4BSWB 1KLFA 4JRYA 1OV8A 3DJTA 3FQ1A 1L0QA 1IT9L 3PV6A 1DANU 4TSAH 5B38G 4XXDA 3LV3B 4NQDA 3E0GA 4JFOB 4XBPB 3TPKA 3O11B 3RAJH 1UB6B 4MSWB 3A4DA 4P9HL 1RK0B 3CZEA 4X7DC 4WWKC 1F4YH 2Z0UA 3ZE0B 4A7GA 1BD2A 2W0FB 4KH9A 4AQ1A 3EDKA 3HC4L 1EJFA 3DDFA 4I4WA 3QRGL 1UWGH 2K6WA 2GC4C 2VAAA 1Q0XL 1JGUL 1QHQA 2NY2C 3LPFA 4YDJB 5AKVA 4EZLA 3Q1EA 1A7OH 1HHKB 5CP7A 4V33A 1HHIA 3KBPA 3UBXI 3L3JB 1TMCB 3CSTA 3IB4A 5ANMB 3WJLC 5GGRA 2UZXB 2XCMC 4MJ6B 3ZDZF 4M5SA 4S1RH 1INQB 4L8CA 1ZY9A 3UTSD 1WFOA 2VR5A 5KANI 4OBRA 2GCYB 4ATWA 4LQFH 2JIXB 5LUMA 1F6FB 4B0MM 4V1DA 1KCRL 1E6OL 1IAOB 5D4HA 5F8RC 1L9TA 4ODWA 4JKKA 3VSUA 2VDRH 4R26H 4OZFA 1NWPA 2D3JA 4M61A 1FVEB 5AWNL 5AENA 2CO6A 2FD6H 3EO0A 3D52A 2QTVA 1VA9A 3LKQB 4HWEL 1A7NL 3HTLX 4JFHE 2FO4A 3TONA 4QKTA 4PJDE 1QUPA 1JUFB 4ZMLA 3E6HA 1YLBB 3WY3A 4HJGB 4Z3JA 3CCHA 1UXWB 3BW9B 4NAMA 2AV7B 2CLZB 1ET7A 2F7RA 4XNUH 5F9WC 5ITFB 3DO3A 1NCJA 1XGRA 2E75C 2FBOJ 2YLHA 1QVOB 4HIIB 5I74B 3UJTH 3WXWL 4M5ZH 1R3LB 2VDOB 4M1CD 1SY6A 3ZJAA 2X10A 2ARJB 3LQZB 4ADJA 1KXVA 3PWVA 3V4UL 5L0QC 5AVVB 3WD5H 2OTUA 4X8JA 1HNGA 1MUJA 3BUYA 1DBJL 3FFCD 5BJTB 5SWZD 5D6CB 3ULSB 3HS0A 3VFUA 4N68A 4BFIB 5CJXA 4YSSA 1I9IL 1B2WL 2IDSA 2ID5A 4EI0A 2PWEA 4PGDA 4BUQA 2QFPA 3AS3A 3QDJD 3CXDH 4AT6B 3BN3B 1S9KC 3JUYA 3QWOA 5T1KB 4ELKB 4YHYC 1QUNA 3AS1A 3MJ9H 1NCTA 1CFNA 3SCMC 2D03H 3Q5OA 3G6JB 2NY7L 5D4QA 3IN0A 2DYRB 3SKMB 4YH6A 3ZKND 1YMHA 3NK4A 4R7LA 2WBKA 3FQXB 1MCNA 2FEDC 2HKHH 4AGOA 5CLTA 1LQBC 4IBLT 1D9KB 4ZRGA 3MN8A 4YXKH 4TUKH 4OF8A 1AOZA 5HGDA 4PRPA 5DRWA 1OP3K 3CDFA 3UP6A 3LKOA 1LEIA 4BFRA 3EO9L 4M6NH 4H8VA 1QRNA 4ZT1A 1J18A 4PMFA 3AXLA 3LKNA 4PUBH 1BG1A 3R8QA 3ZE0E 1UD5A 3SKNB 5JZ7D 5ICXA 1C08A 1P7HL 2W81C 2YZ8A 3DJSA 3KLAB 2ZX6A 3QI9A 1JK9A 2DQGL 2WVVB 2GQHA 2UWEB 2QPDB 3QYCA 4UM8B 2OV0A 3WKML 4F7EA 5IM7B 5DZPA 3GMPB 1JZ8A 1XF4A 4AENA 2X12A 1MEXH 1MPAL 4O4YL 2DLIA 4DPRA 1ZD6A 4LCYA 2ZXBA 4PJIE 3VG0L 2EABA 2VZ1A 4MXQC 1AHWA 2EJ1A 3EAKA 1MLCB 1WFIA 4YZWA 4YHIA 1K8DA 3F7QA 4K9JA 4IU3B 4C83B 1HQ4B 3Q01A 3IFLH 1LXMA 5EG6C 1MCEA 5CS7A 3FUEA 2D7NA 2JKXA 4ZSOB 5GS1B 1HL5A 3TEXA 1WLHA 4DP1X 1NGYA 2DQEL 2OSXA 2BVTA 1D6EB 3BWAB 3RWHB 4M8VA 1N4XH 2OMVA 2DQUL 3C75A 2D31B 1FE8H 3FQNB 5FYKD 2XPZA 3N91A 4OZFH 3SE4A 2X89A 4LEBA 2N1KA 1XD1A 2K9FB 1KN2H 5F6IB 3AADB 4N22A 4Y5VA 5HHOB 3D09A 4YFDB 3EYFA 1MY5A 3UZVA 1YAIA 3DX7B 2YEZB 2FBJH 1J8HE 1JI2A 2C34A 1F11A 4IEFB 1HK6A 3TH2T 1DO5A 3BZFB 3ECVA 4YO0A 3TVMB 5KG9B 4JE4B 5DZLA 4MNQB 4WW2C 1P4IH 1QSZA 4JDZB 2ZT9C 4DQOL 4M7JH 4C54A 4Q58C 5ECGA 2WWMC 1SY6H 4U6TA 3LSOB 2H1XA 2HXAA 1FO0B 3CH8A 4I7ZC 4LL1A 3JV6A 4RDQF 2CJSA 2LU3A 1T7ZA 5ICUA 3RDTC 4OCRL 3VG9C 3U7WH 2VZSA 1IBBA 2MOVA 4JZNA 2Y7OA 1SNRA 2DF3A 4CBPA 5FKAA 4MAYC 1XCQB 5SV3A 3CJJA 4Y4FA 2I69A 4HJ1A 2DLEA 4MA3B 3JWNH 4PCTA 2J1YA 4G9FA 4IDJH 5DSCA 5AVYB 1G5AA 2FEEI 3SQRA 4ODTL 1AO7D 4KJYB 1ZA3A 2A6DA 1OEZW 2VXSL 3L3IB 2IAMA 1KBBA 1XGQB 3UYRH 4MD4B 5KUMA 5IUCA 4D8PB 3AY2A 1DVFA 3LH9A 3QDMA 1G7QB 4FNQA 1HHGA 4XCYA 3ZK0A 4A39A 3OC8A 1BZ9B 3DVNB 3P73B 2YA1A 3HBQA 5DD3L 1KZQA 4N28A 3D51A 1DR9A 1CTNA 5DVPA 3V6ZA 2Q3ZA 1L9SA 1Z2KA 3N42F 4JQVC 5CINH 5INCA 3BIAX 4A68A 1T3FB 2A73A 4KK8D 5E6IB 2NUPB 3MLZL 3QJOA 2H6OA 2BJMH 4TF4A 3RNKB 3ZL2A 4O2CA 1A6WH 3VXRD 4JFQA 4L4JA 5IKCB 1MCKA 1EDQA 3CGTA 2DN7A 4W4OC 1I4FA 3LN5B 5F7DA 1HYSC 3QARA 3ZTNH 4KZEH 4PSPA 2BP0B 4N0YH 3OMNB 3CHXA 4PV1C 5IB5A 1EXUA 1AACA 1ODAA 4KHTL 3D2UA 3OX8A 3G6DH 2ZKYA 5IEKA 2X4QB 4JN1L 1GPOH 1X5LA 4MWFA 4Y4KB 3JV4B 3QQDA 2CKNA 2FLMA 3P02A 3QEQA 3V5DA 1MHEA 5KSAC 1H5BA 3QNZA 4ADIA 1ZVSA 2RA1A 1DQQA 3VD2A 1DQKA 1A4BA 5F7BA 4QUOA 3BZEA 1HC1A 1I9EA 1WT5A 2BOCB 2QKSA 4KO6A 1UQSA 4LCVA 3MZGB 1Z9NA 1KYOJ 2APSA 1NA8A 2KDYA 4OCLC 4AKPA 2XX0A 1OGAD 3BVVA 5HHOE 2WZPA 3DIDA 3RL1B 3VH8B 3T4AB 1OARL 3QYMA 5J13B 3H4HA 1Z5LA 3A6CH 3WBDA 1KB5B 1U8CA 1I75A 1NJ9A 4RFNB 4DEPB 3QNXA 4LARH 5ADPL 3VD9A 3KAAA 1QFWH 5AW9B 4X0NA 2ZWKA 4FQQB 4MNQE 1S2EA 2W91A 5I26A 2X2HA 2AJZB 2VR9A 3B9VA 4HA1A 4U6VH 5F7MC 5FHBL 5MEQB 1BEYH 4OFQA 5D5ME 4LPYA 3D07A 2GI0A 5FHAL 5EO1B 3IJEA 1NTDA 3HIZA 5JHBA 4FLSA 3IRZA 4PY7B 3MRBB 4NJAL 3C60B 1TR7A 2X40A 4OZHE 4XTRC 2CRYA 3PHSA 3BDBA 3SBWA 3KW7A 5FYJD 3KS0J 4NNXB 2A1WL 3U6XA 4JZJA 1NCHA 1TT6A 3U0WL 3NP4A 4RMTA 1YEJL 4NWTH 3PWPB 4AYBA 2XTJD 2ZKXA 4NXKA 4PD4J 1FQ9C 4FMVA 4V11A 4Y1AD 5EU5B 1H0DA 3QRBA 4S1SL 1P7BA 1XAKA 2F15A 3QUML 3RVVD 2VRAA 3QNYB 3ZDYE 3ZR6A 1P4LB 4JFFA 2FQFA 2R2HB 4MJ5A 4YHNB 1Z66A 2E9IA 2OSWA 2MHAB 1HOCB 2OL3A 3BPLC 4E41B 3QUKA 4K7PY 4PJXA 5A40E 1EZVY 4Z7UA 3LN4B 5DJAA 3CBJB 4ZFOA 2WHVA 2XN9A 1FYHB 3BQVA 1UH4A 2P5WE 3C2AL 2H2SC 5DJ0A 4HJ0D 3WTUA 1TEGA 1KIPB 2C1OA 3OAZH 3DUHA 2Z1KA 3P30L 4KOCA 3PJSB 3KGSA 4MMZB 4CGUB 2DWXA 4DHLA 5C07A 4MZ2A 2QDWA 2O61B 3DOIA 4K23L 3FSZA 1CE1H 3ESUF 4WWKD 4NN6C 2GJZB 2ZCKL 3BPCB 4MDIB 4NZRL 4IRZL 3WMQA 2ENQA 1FNSL 3PY9A 1ETB1 2H47C 2F19L 2NY2D 1LEGA 4KXCA 4WVRA 5BZWA 3MRPB 3UGEA 4PS8A 2CDGB 1BOGA 3B2DC 3LIZL 5D4JA 1HWHB 1D5MA 3KPRA 3M7FB 3TEYA 1O9WA 3OHXB 2AQ3A 5K5YA 2V3DA 4Q52A 4Z5RA 2BXZA 4MNHA 3BLPX 3V7AE 5JYMA 1RURL 4FYRA 1M6OA 1MVFA 3MNVB 4B3VA 4Q7DA 4QR7A 2Q10A 4FXKC 1VAHA 2UZIH 3SDXB 3O6LH 2W9EL 2XXCB 4UTAL 3BH8B 3I2CH 4UDUB 3QPXH 2H9GA 4M5TA 3O8XA 3OV6A 3STZA 3CX5J 2Z4QB 3US1A 1AH1A 5FX3A 6PCYA 5BMFH 1J8SA 3W5NA 3EYQC 2CH8A 3BFQG 3FL7A 3SPVA 3MUJA 1TTGA 1R0AH 1WCBB 3NJHA 3D12B 1NCCH 5EEXA 1MNUL 3BIKA 3UMTA 3BCDA 4XVTL 4NP4L 4Y2LA 4AMKL 2OJEA 4M43L 2ZONA 1DQDH 2IQAB 3HAEB 3D85A 2OXGA 1TJXA 3MV9E 3WHXB 3SY6A 5E5UB 1T1WB 1L6ZA 3NK3A 3VH8G 1RK1A 3EBIA 3WIFA 3AT8A 4JL1A 5I9QB 4Z7QF 4MMYA 4YGVB 3D5OF 3V8OA 1C1EL 1JDAA 2AXWA 2KLSA 4BWWA 1UT1A 4RFEB 3MRRB 5D71H 3U7AA 3U6RB 3QIBB 3VDCA 3ZPDA 3PQYB 3Q13A 5E6SB 1WBYB 4XP6L 3NJIA 4P4KC 1N0XL 4IIQB 2YGOA 3BRGC 5LG6A 2VL4A 4FG6C 1MN4A 3Q2NA 4YSCA 2QADC 3QUHA 4M4RA 5DHDA 1IEBB 4BRVA 5IVOA 4HWZA 4PP2B 5JDSA 3TO4A 3SCMD 3H3PH 1XB6A 2WKLA 1DBMH 1TETL 5CEZH 3UTOA 3O3AA 5HDQL 1MJUH 4WU5A 1IFHL 2AAAA 1U3HC 3LRLA 1QSFB 5DA4A 4PWKA 1XGPA 4G6JL 3POHA 5M94B 1KCBA 2Y36L 1S9WA 4K0OA 4PJBA 2OL3H 2LFEA 3DX9A 2K4WA 3FUMA 4UDTA 5TQ0H 1BD2D 2VDPB 3S3JA 2OK0H 4PH8A 4E9XA 4UOQA 4XHQA 1XIWA 1IQDA 4TUOA 1LP9A 4GXFA 3F6LA 3LB6D 3IJYB 2ZWLT 4X8XA 2XU9A 3BFWA 5DFVC 3SJVE 3ZX1A 4N9OB 3QG6A 3SY0B 4TSCL 3VRIB 3Q2LA 5I1CL 2XIDA 2WCGA 4OLUH 3V6OC 5TK4A 4HG4J 1SYSB 3E9UA 3AACA 3S37L 4F7TB 1DVTA 2AMUA 3GXUB 3FN0H 4FL4C 3FU0A 1U95B 3BP6B 5E8EA 2QGDA 5K9KB 3KBHE 3NT0A 3VQMA 4QXGH 3ULVC 2GJJA 1QFWM 3JWDC 4H8PA 4PRHE 1XCTA 4EN2A 2D2CC 4G59C 1IL1B 3FCBA 4A7UA 1W9XA 3P4OA 2IGFL 3IDIB 4P2YA 5DRNB 5D1XE 4W6XB 1A2YA 1BVZA 5LDUA 1RIUH 4MXQD 1MJ7H 4R97C 2ENPA 5C0AD 3VU1A 1OCWL 2AXJA 4P23B 2AJUL 3GGWB 1T6VN 4DK6A 2YOAA 2C9VA 3RX5A 4YLQT 3SDXE 5EBMB 4OSUL 4K3GA 3ZXAC 2VXTH 1J0JA 1ZT4B 3OB0H 3U9UB 3KZ8A 2XNAB 1RMFL 2FE0A 2H32B 4ZFZB 1A7BA 3HMWH 5JOFB 4DGVL 3FBQA 3M88A 1RV6X 4U1GB 4AK2A 3DK2A 3K46A 1JWSA 5JPMA 1AJ7H 2Z0BA 3GBNL 5DDHB 1NFKA 2V2WA 4N5UA 2QVIA 1SMAA 3MV01 4MD0A 4CNIB 4M9PA 2ZAHA 2JNZA 2RD0A 3LZPA 1N59B 2CBTA 1KY7A 4FZ8H 5L8LB 1YAZA 4ZW7A 2VDMH 1CDBA 1H3XA 4WSJA 4GMSL 3K7UA 2DAVA 2HT4C 5A2KH 1A3QA 3PXJA 1I8UA 1K6QH 5E8PA 3WN5A 5D2LB 3LAFA 1FG9C 1Q90A 3EF7A 4P5MB 1QP1A 3CFBA 5D70H 5IB4B 3WS6A 4DZBA 2VDOL 3QDGB 2NNCA 2ITFA 3GI9L 1WWCA 3IU3B 4AXWB 1DQMH 5TPWH 3ZYZA 1OTUC 1NWOA 4AV0A 1FG2B 3ETTA 1IBGL 4CW1B 3DK0A 4Y4HB 3S37X 5CKAA 1IM9B 2I32A 5CCHE 1SF3A 3RDTD 2NY1C 3UO8B 2NNFA 4WSKA 3CQQA 3HAEG 3HHSB 1I1YB 1QFWI 3QFJD 5F1NB 5FKPB 1BJ8A 3MJ6A 3JBG7 3KPOB 4Z0BH 4AQ8C 5CGYD 4QLWA 4HIHB 5CUSH 5DUJA 1WRFA 5AB1A 3HG4A 2HT2C 3VFPB 5EORL 3ARZA 3SE8L 4JY5L 3RVTC 4LB8A 4HLZH 3GRGA 5EOTA 1QR1A 1GTNA 4Q9RH 1NGXA 1T04A 3FQTB 4O2FA 3HEIB 2HPTA 5KAQF 1PKQB 1CXIA 1I3RA 5GS3A 2EKSB 3IM1A 2VISA 2WO3B 3TA4D 3ZY7A 4AG4L 3LVTA 4O58L 1HU8A 4Z9KB 3TA3C 3WFDH 4I3SL 1FF5A 1A6VL 1OM3H 3L16A 3T2OA 5CHNA 5IWLA 3VI3E 1CXLA 2FLBT 2MQCA 5HHMD 4TVPD 1VEMA 4GP5B 5FM8A 1WICA 3I9GL 4XC3H 1FAIL 8PAZA 2OP4L 3TV8A 2OX5A 1I7UB 4OV5B 3I9IA 3WEMA 1VPOL 1SN0A 3L9EA 2IBZY 3CIAA 5AW0B 2NUTA 4UT7H 5DVMA 2DQIL 2GJ6B 5D7KD 2WV3A 3UTTA 5C8JA 1FHNA 3OQRA 3KEHA 3L95A 1EMTL 3DV6A 3N2JA 2EDFA 5L4IA 4DCQB 3DURA 4G71B 3HC2A 2X38A 3FMGL 5IT2L 2NY4C 2IPUG 4L8SA 3TGXA 1CL7L 1V3KA 2W60B 3SSGA 4GSXA 4JRLA 4PHZA 1OXYA 1ZHLA 3G5ZA 5F6HJ 2NNXA 5FOJA 1Z32X 3CZFB 4LXFA 4GIAA 1SM3L 4RRPM 4RGOH 1UVQA 2DQCL 4R5VA 1HYSD 2DWTA 4JFEB 2BWQA 2JTYA 1S7WA 1AQMA 4XCEA 1T83C 2AK1L 2Y9RT 3G3LA 4Z76A 3NACL 1E8WA 2FJHA 1RUAH 2XBZA 2XZAH 1SQMA 3R06A 3TWYA 1NGQH 3KXFE 2PR4L 5EOQL 3R19A 1X44A 1DYZA 4KKQA 3SDAA 2BS71 5C0NC 3ASWA 3CTTA 1G9NC 3L8QA 1CGYA 5T3XD 1Q9WB 3J27A 5CN1A 1OB1B 5LXVA 1DN2A 5HYIA 5MEOB 3HNTL 4IHOA 2C9UA 5E8OB 4NM8H 5GS0C 1IEHA 1NDGB 3QWRA 2H6PA 4XWGH 1H3PH 1W2KT 4R7VA 3R0MA 4TTDC 4HZ1A 5DZVA 1X5YA 2VR6A 1JIBA 2F5AL 2LABA 4OLXH 3HC3L 4H1LB 5C3IA 5D2LE 3STBA 5HDWA 3OB0K 2IOOA 4RAUA 1BV8A 4QHMA 4B96A 32C2A 1JHKL 3QDGE 4Y5XB 5F7WC 3CFKA 5KSUA 4Z7UF 1F42A 2OXHB 1MCOL 4JREC 3IRCA 4PWHA 4YXHL 1RPKA 1SLVA 4XR8C 2MJWA 3BKYH 4IMLA 4P2RD 3T3ME 4JFWA 4ZXBC 4XTRD 4H2CA 4XMPL 4PW4A 2H0PA 2A2QT 4PREA 1P5UB 4YC2C 4E9WA 4F2ME 1XTLA 4PTTA 3FQWB 3N5AA 2V5SA 4HS3B 3ZYJA 3VFWB 3MSPA 3TBBA 3FO2B 1KT2B 4ZMZA 4RQQA 3FT3B 4JPKL 3C8DA 4CKVX 1U8HB 1I1RA 2L8AA 3GSUA 3B3BA 1M6UA 3LQAC 2ORBL 2VRKA 2TRHA 1NFDA 4BUHA 2N01B 3U0TB 1SEBA 3DX3A 4P2CG 3GSXA 5IG7A 3NPSC 1UCBL 1DVFD 2FNBA 4JFPB 3ZKMC 1ASOA 2K0RA 3ZE1B 4E36A 1B0RA 1ACXA 5I75C 5JXEC 3VAEA 3RHWK 3QZWB 1ZXQA 2Y23A 2R23B 4X6BB 3INUL 4R90H 5E23A 2E5EA 2D4FA 3VW3H 1F45A 3N40F 1JRHI 1SMOA 4HBQA 5E00A 3CN0A 4ICXA 3PHAA 1ILSA 1ID2A 3LZNA 2Q0ZX 5DURB 5FC9A 1RIHH 2WB1A 3VDBA 4TRPH 1CD8A 3IETA 5A2CA 5LGYA 2RGSA 1XEDA 3FT2B 4UM9B 5ACZB 15C8L 4WRLA 3SBQA 3OZLA 4U1MB 5B22A 3QCVL 4HAGA 2FEEL 5I1KL 1MW1A 1AGEB 4P07A 3NFNB 2FUTA 1NKOA 3JTTB 3O2VH 4L1TA 1QBAA 3GIVA 2F74A 1U8IB 4IU2A 4WI4A 3BRFA 3P9WB 5MI0C 1O6SB 1QASA 3D2UD 2VN6A 2R4SH 2WNGA 3PP3H 2JJTC 2EXYC 1RPQA 4R7NA 3RWDB 1JD7A 4HEPA 5H2BA 4X5QA 4EN3A 1AQHA 3G6AB 4HC1A 3MR9A 5D2NA 3LHAA 4R4BA 2B16A 2A74A 4JM4H 3EGXA 2BP8B 3DJRA 4NQTA 4QNPF 1U91A 2V5MA 4JZOA 1SDDA 4NQSB 3X11A 3WLWC 5JO5A 1KLGB 1N64L 2J4WH 1KFAL 4X5WA 3FQ4A 3ZT6A 4I0KA 3RHWF 1Z3GL 2PYEA 2VLKE 5KVDE 4OCWL 3OPZH 2DWDB 1SBSL 5F96L 3ZKXC 2AEOA 3LQMA 4WNJA 3LS4L 4ZAKB 1TZGH 3ZTDC 2L7EA 4GRMA 3NAAH 4TPRL 3FULA 5DK2A 4JFZL 1UACL 3DBXA 4S11A 2FT8A 2JLLA 4GUPA 2DI9A 5E9DA 1P53A 3RB5A 4WFHD 2WCPA 4U6XA 2OR9H 4FLOA 5B8CA 1HXYB 3EYQD 1YPZB 1H3VA 4M93C 1BXAA 1RHHB 1YYMH 1XGZA 4XN2A 5KVGH 1SHXA 4HKBB 1PAZA 2GITB 2HRPH 3KWTA 3ROOA 5CFAA 2VM9A 1W72A 4IJ3C 4BQ8A 3EYUH 3O6MH 1HKFA 1QSVA 3WE6B 1B9ZA 3CPUA 2NX5E 3KLSA 3D3VB 4KROC 3HG1E 3BH9A 3H9SE 4GKZB 4F5CA 3AB0B 2VMCA 4ZX4A 3FPXA 4G5ZH 1YEIL 3WY4A 3ZHLA 5DD1H 4DGYL 2OMTB 2WNXA 3QQ4B 1W15A 2XXFA 4IS6B 4OU3A 4BA8A 2N7AA 2ATAA 1IZJA 4JFFD 4L2LA 1LP9F 2ZG1A 2FR4B 3LZRA 4H1LG 5DEGA 3MRHA 3IXTA 1PIGA 5D8JL 1AZRA 4PW9A 4QRPA 3ZMRA 1A14L 3MBEA 3UBHA 1UKSA 5LGJB 1LO0H 1X7QB 2ZWNA 4W9JC 3GMOB 1P5VB 3D39B 3KMDA 4JQXA 2WUCH 5D7IF 2XN9D 2Q76A 3QUXA 3VRLF 5AALA 1NOLA 1DHKA 2QADD 2GABA 2J7LA 4MB4A 3TN0C 1G9HA 1T1ZA 4WK4B 3FU3A 5J7CC 1U8PB 1S5HB 4MXWL 3KM2A 1INDH 1UD3A 1E2WA 3S35H 3QIUB 3KVDD 2J8UB 1D5RA 4ZQTA 1I3UA 3VWJA 2V7NA 1U3HD 2YK1L 5IHBA 2YARA 3M07A 4PYGA 4DOHB 5K39A 4I0PB 5J6HB 5SWQB 3FCGA 1U9KA 4IRSA 4RMQA 2V17H 4OVVA 1XSIA 4TQHA 2AJSL 2MTAA 3RIFK 4UV4L 4DF9A 1DSFL 3UG5A 1M1XB 1V54B 3FTYA 5DFVD 4PP1C 3RYMA 4TOYH 5IEHB 4HP5A 2H41A 1ZJAA 4GAGL 4P5KA 3QZWG 2K6ZA 3VXQA 4TYUA 3QAZB 4U7MA 3U1PA 1GOHA 3HFML 3PJLA 1GW0A 4P2QA 2O5YL 3AREA 3ULVD 3UTPD 1J5CA 2V9UA 4HCIA 4LPVA 4P9HC 4KZDH 2I9LB 2KDGA 5EBGA 1EEZA 2B9BA 1U92A 2UZYA 4X80H 4LASL 3HZVA 1F41A 1V7ML 2B08A 1FZMA 2FSDA 5JQHC 5EOCL 2F7IA 3L7FB 4HC1H 4N2BA 3RBGA 1EAJA 1DCEA 4HPOL 2JMRA 2GK2A 3FOLA 5DMIH 2WIIB 4G8EB 4I9XA 1HH9A 1QBMH 4PTUB 1DJSA 3S7GA 1HKLL 1XX9C 2AQTA 1QLRA 3MKKA 4JHBA 3RX9A 2CIIB 4QAWA 4AL8L 4KVCH 4YDLB 5GJSH 3SDDB 3PP3K 4GG6E 3T3PB 2VAJA 2G5BB 4FXGB 1T21B 4OZGB 3RUGA 3PXHA 3W57A 2XG5B 3D69B 2OQJB 4JRFA 1KYDA 2F2HA 4UOW0 4E68A 2AJ3B 5E2WL 5EPMB 2GK0A 3FH7A 1CGSH 5AW8B 1CICC 3AMLA 1T03H 1T7WA 2IF7A 1B4JH 5C0FB 2HT4D 1MAML 4XC1L 1JGLL 2ITEA 4AGNA 2QMJA 5HHQB 4L9LB 1PPIA 3DMMB 3JYBA 1HEJC 4U31A 4IKJA 2BY0A 4TULL 3VXSE 1F0LA 4FQHA 3NCJL 3QW9A 1K2DB 3TBSA 1UJ3A 1S9VB 2DM7A 4KI5F 3WIAA 3PHQB 3ZO9A 4UV7H 4XVUC 1U3JA 3E6FA 4LRNL 5DQDH 4BFOA 2R56L 5IJVA 3LH2H 5C09E