4ALAC

Structure of dengue virus diii in complex with fab 2h12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
92
structure length
78
Chain Sequence
AMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTRLITANPVVTKKEEPVNIEAEPPFGNIVIGIKALKINW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus 3
molecule tags Immune system
total genus 10
structure length 78
sequence length 92
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4alaC00
1SVBA 5LCVA 4X42A 1OK8A 4FFZA 5KVDE 5KVFE 5KVEE 1RERA 4FFYA 3WE1A 4ALAC 4UTCA 2V33A 4UT9A 3N44F 5H37A 4UT6A 3UAJA 4UTBA 2JV6A 3C6EA 3N43F 4GSXA 5IREA 5JHLA 1OANA 3IRCA 4BZ1A 4UTAA 4L5FE 1UZGA 3J27A 4AM0Q 1OKEA 2I69A 1URZA 3N41F 4FG0A 4GT0A 2HG0A 5LBVA 3P54A 2P5PA 3UZVA 1Z3RA 1TG8A 2R29A 1PJWA 3VTTA 3MUUA 3C5XA 5IZ7A 4AL8C 2H0PA 3J2PA 3UZEC 2JQMA 2GG1A 2R69A 5GZOA 3UZQB 5GZNA 5AAWC 3G7TA 5KVGE 4BZ2A 3UYPB 1S6NA 2JSFA 2ALAA 1ZTXE 5B1CA 1Z66A 3N42F 5LBSA 5JHMA 5AAMC 3N40F
chains in the Genus database with same CATH superfamily
3D0VA 1MRFH 2XQYG 5LCVA 1UA6H 3TVMA 1RHHA 4J7RA 4RLDA 3BGFC 3QQDA 2HMID 3ARFB 4Z7WB 1XV8A 2ZXQA 4BYHA 5LNDA 2OL3H 2ICWB 3M1OA 2FB4H 1DQMH 2ZF8A 1OF2A 1FNHA 1D5RA 2IVFC 5HYIA 4KK9D 1K72A 3D4YA 5CZXD 1Q9KB 3MNMA 4LLDA 4OAWB 4QYAA 1HTYA 2NR6A 4ZFZB 4KKLC 5DC2A 5ICXB 4M8QA 5J06A 1HCZA 2KYIA 5F9OL 3O8XB 1XF2B 4I9XA 3HVNA 4HSAC 3DLQR 5DHEA 2BVQA 3HHMA 3SCMB 5DI8A 3LNHA 5IBUG 3DHMA 4I2XB 3GO1H 3KCPA 3BKCH 4JVPA 5CSGA 2BP3A 1JGUH 5IQMA 5AKVA 2J20A 5FYJD 5JQ6L 2X44D 2AQTA 2BK8A 4X9GA 4DZ8B 3HG1A 1JHTA 4RQQB 3IMTA 4X50A 1KPVB 2VTFA 4QO1B 1LJMA 4KRPC 5JPMA 2Z1PA 2CDEA 5HI4C 4IMLB 4MJIE 4PJ9C 1XH1A 3HJ0A 4AQAA 3P0VH 4IKJA 4ATWA 3IJ7A 3BN3B 3O6KL 2GTWA 1FE8L 2XNAB 5GGRB 3VFMB 3T6VA 4K07A 3D85B 1WFUA 3IFLL 3RUGA 1CDHA 2MPAL 2H3KA 4NS0A 5DHVA 4NPJA 1LHZA 1CLCA 4Y5XA 2O5YH 4IU2A 4AGNA 3L8QA 2KL6A 1OE1A 1QHOA 1UM5H 4M5SA 5ADPH 4E0RA 1EJ6A 3F12A 2FGWL 4HALA 4LU5H 5CD3B 3TBSB 3X1BA 2YZ1A 3IPEA 5EUOB 1OVZA 3D34A 3LKSB 4WEUD 3ULUF 4BM7A 2DTSA 4LLMB 1FGVL 3CV5A 4WI7A 1CI3M 4HD9A 2XWTA 2W07B 3QHFL 2YSSA 4EUPG 3TV3L 2A0LD 5D7SH 3SDXE 1W0VA 4BZ2A 3RTQA 3AQYA 3AREA 4QRUA 4NP4L 4NPYA 1P6WA 5J1AA 3NJHA 1DDTA 3EKCA 4KMQA 4AQ8A 2VDOB 2ZKMX 3SZKC 2CKBH 1G4RA 5LWYH 2VABB 1T20B 5DZ9A 1A4JB 1BFVH 2E7DA 1LO4L 2WVVB 3SO3C 2AV7A 4AV4A 2V7NB 3EYFA 2WLLA 2LLLA 1U93A 3LOWA 3QUXA 5IUSA 2P47B 2H6UA 3QFJA 1NCIA 1H19A 2ZYRA 2UY7A 32C2B 3UADA 1TVDA 5D5MA 3VG0H 5JNYA 2YRPA 3L4WA 1NMAL 3O2DA 1J87A 1SUHA 1WV7T 1BVOA 1V05A 4DUXA 4O5LH 2K6WA 2VXUL 4UIMB 1FC1A 3BAXA 3DHPA 1E6JH 3M88A 3NA4A 4UILL 2VMEA 3BW9A 2WO2B 2ZQKA 4Z7VF 3BAJA 3EGDB 2WBJB 3ULUC 3AXLA 4YL9A 4LL9A 1MHPL 1C5DA 3SE3C 3ZMNA 2F58L 4G7VL 3P2TA 4XI5D 3WTYA 3QHZH 3GSXA 4XWGH 4W9LC 1UASA 1VPOL 4KUZH 2EDHA 5GSRA 5LKNA 4MWFA 2YUZA 1CPUA 1N3NA 4P23D 5I1AA 5FB8A 4H20L 2JB5H 5IQLA 1IBGH 3EJUA 5CEXB 2DLFL 3UEQA 4LBAA 3ZR6A 4JM2F 3ZKMD 4POZC 4IU3A 5FUOL 2BSED 4ONFL 2GK2A 1QTYT 3VQ1C 4PJIA 4EMZA 4XH2B 4H1LH 1AR1B 5FLVA 4E9SA 4AC2A 3E80A 3CLFL 4JJ5B 4LVOC 3AQXA 4HH9A 4RNRA 4L1SA 2EKSB 3Q44A 1NSNH 2XJKA 3TT3L 3MODH 1E27B 4Z7NB 4XCFH 3BSHA 2IAND 4DW2H 2F53B 1QATA 4KKAD 4HFWB 5DRNA 3D0LB 3WS3B 3FAWA 4RGOL 5HSFA 5J4MA 1JNLL 5C0GB 3EBAA 5CEYB 5E6RB 1A3RL 2O93L 4IIQB 1QUNA 3RP1A 1B90A 1DBBL 2C9AA 2X6CA 2EUWA 5C6TH 1ODAA 4O58H 4GG6A 2UZYB 4OGYH 3BQUC 4EI6A 2QPDB 4H8PA 2VR4A 3TURA 1PLGL 5I30L 1ZIBA 1GRWA 5GS1C 2WB1A 2WQSA 1XIWC 5GS2H 3QE5A 1YEFL 4WKZA 4E2OA 3BP7A 4Y5YB 3ULVD 3BPLC 1ZDSA 3CXDL 3QEGH 4KOBA 3T8MA 2KS0A 1E9OA 4I1RA 4L4TB 3VFVA 4R7DA 4FQXC 3ILQD 1EFXD 4OLVL 4AL8H 4A04A 2ETWA 1GYCA 4QXGL 4U3SB 2FH8A 1KEGL 2V3EA 1DQJA 5DYOA 1M3IA 5D7KD 3EH1A 4N8CH 3UTZB 1GW6A 3IDYC 2AEPH 4JFXB 2VUKA 5D96B 3RPIB 1RUQH 5AW6B 3HAEA 5CP3H 5FYKH 3OKOB 4X5WB 2F8OA 4H0HB 1T3FA 3APDA 1AYOA 1VAHA 5I2IA 1AQ8A 1QR4A 3F00A 5KANI 2VSDA 4NQEE 1QW9A 3VXMA 4BZ1H 1E5YA 2VC2L 1AKJB 2E7BA 3QI9D 5F9AC 1OLZA 3DSNB 4NBYB 2NY5L 5FGCE 2ZYSA 3B8YA 3TZVA 2XT1B 2G5UA 2VLRE 3QIWC 3O3DB 4EKJA 5JO5A 1TU2A 1DVTA 3LQZA 3U2IA 4NQVB 3E9TA 2GFBA 3RJDA 4KZDH 2VDNL 2FUTA 2X89D 1NC4B 4KZEL 5EA0H 5ISZB 2DWTA 1OP4A 4QTIL 3D2TA 2WKOA 4K3JH 4ZW8A 4TSBL 1NGXB 4N1HB 3K71B 2Q7YA 4A7TA 4TUKL 3KG5A 1TCRB 2IWEA 3LN4A 3SQBB 3VXPB 1XGUA 1S5HB 3FN9A 2KC0A 3E6FA 5BS0E 3SJVE 3GI9L 2AGJL 2I69A 1EANA 4G8EB 2I5YL 3BUPA 2OSLB 3CBJB 3PUUA 5B3JE 3GBNL 4QOKE 5EFIB 1LGVA 3EUUA 3MBXL 2WANA 5CILL 4RMSA 3EJCA 4PCKA 3T2OA 1R9FA 3DX8B 5LCVL 2X2JA 2Z4TA 1JAEA 1E9PB 3FU7A 2C3VB 1UH3A 2X4PA 1XAKA 2HX7A 2UZXB 3Q43A 4NKMB 4QHMB 4UDUB 3G6JF 3PJSB 2EEBA 3VI4E 4XNYH 2ZXCA 2XYBA 4QXTA 2J1KA 1X9LA 5C6WH 1ZK9A 3DRQA 2VKWA 5DFVD 3E38A 4WENB 4IEFA 3VMNA 5DEZA 3OKMA 2RJMA 4F7CB 1TTBA 1T5WA 4U05A 3DO7A 3CZUB 4IRJB 3BH4A 1P53A 3LQAH 2FJUB 5BRZE 3WDIA 2BSSA 4KU1A 4WHTA 4KRPD 3ARZA 4JM4L 5KYYA 3RWGA 4PJ9D 3KLHC 4M48H 4FFYH 4FKKA 1ECZA 3GPSA 2BOCA 3QAQA 3O4LA 4PRHD 4ZUSA 5EC1B 2IQ9H 1MJJA 1T2QH 4OIIH 3I50L 1UD3A 3P3TA 1T4KB 4GRWB 3L4VA 5FOBB 1TR7A 4FZ8H 4QHUB 4UT6H 2YAPA 1BZ8A 2H0EA 5AVTB 5L4FA 3B37A 2YXFA 1MUJB 2FHBA 5L88H 3DOSB 3MLUL 4JPQA 5SX4I 4TNWK 2HJFB 1U0QA 2EE6A 1E8YA 4JQXC 2D3JA 4LSQL 5HHOD 4CADB 2B1AL 3VE0A 4M6MH 1U2YA 2VZ1A 3QWRD 4WDIB 4YDJB 4KQ3L 4LF3B 2ISDA 3UEZA 3R4RA 3CSBA 3RGHA 2WQUA 4NOBA 1WA0X 4ALAL 5JPNA 4OFPA 4PW4A 4OGXH 3FO0L 1A7QH 1CBVH 2ZAHA 4HSCX 2R83A 3N43B 1D7CA 1LEIB 3EDKA 1A21A 3MLYH 4K2UH 3VO0A 2BOLA 4P46C 4PP2A 4JO4L 4OCSH 2NQDA 1IEAB 1GMIA 1AJ7L 2P3YA 3IE9A 4Y1AA 5DHYB 3RZCA 1MZYA 4H2AA 5IEKA 4Z3EA 1GZHA 2NCMA 1N2RB 1HSAB 2A9MH 4CDGC 2A4ZA 2QVTA 2HFEA 1A6AA 4FFZL 4MHHG 5DQ9A 4OFDA 1ET5A 3NZ8A 4M29A 2OFQA 4BZ2L 5AQ0A 4DHLA 2APBA 2E9IA 4JE4B 5F1NA 3ESPA 4HDIB 1EAPA 2IOMA 3E7JA 3DIFA 4ZUUB 4BDVA 4UDTA 3K74B 4DP6X 2H9GA 4ONHB 4ANUA 4XP1L 3MV7A 4TVPL 5AWNL 1KYOK 5IVXA 1WC7B 4CVXB 1LEGB 4V1DD 3RWEB 1YYLH 2FIKA 2HRGA 2FSDA 2NQCA 4OCWH 4NERA 2R9HC 4UINH 3QR1A 5ID0B 3FTGA 3FUMA 4FNLH 3MRIA 4ODWA 1P5UA 2DY2A 5AKRA 5DJ2A 3MUHL 4X0KB 4DO6A 4G6KL 3ULUD 3AMLA 3S4SB 4WWOA 3ES6A 3O2DL 2VERN 2HWZL 2TSBA 3KYKL 4J3UA 3FONA 3IDIB 3WS6A 1UQSA 2B7DT 2VLLA 4L3FA 4MASA 4I0PC 4BGDA 1AO7D 1OSZB 3C8DA 1VFAB 4GW5A 4W9FC 1WIOA 5J57B 3NSXA 2ZXBA 1QW8A 1NFKA 5FM5O 2QV4A 2Y7LA 1YPZE 4OZHB 1C7TA 2BO0A 3TO4B 2FYYB 5AZEL 2CA3A 3FNKA 2L8AA 4JKLA 4L8DB 4P2RB 3NPZB 4XO5A 5KN5B 5HDQL 5F0JB 3LKPB 1KBGL 3GS0A 1DQKA 4XPHH 1HE7A 2BXYA 5I1EL 3RG1C 1UD4A 1LILA 2J4WH 1S7RA 3MACL 1A0QH 1DFBL 3UCQA 2OV0A 1QLEH 2UWEA 4X7EC 1A14H 3V0HA 3VWKC 3E1F1 2QQLL 5A6MA 2FLBT 4Y9FA 1QACA 1RL1A 2AXWA 3PGCA 1A7RL 1U30A 1RJLB 2NYKA 3QG6A 5B1JC 1YMMA 5C07A 1JI2A 4OCLC 2QHRH 5E8PA 3ARTA 3EADA 4FCHA 4NUJB 2DMHA 1ZE3C 2J5LC 3HC4L 3OXSA 3U2JA 5JW4Q 1CE1H 1OOAA 3KCWA 3GSQB 4P2AA 4ERSH 3VXUB 1AXSA 1QBMH 2X1PA 1XIWD 4S1QL 5FM8A 3ZDYB 4AGOA 3MLXH 3B9VA 3P4NB 5E03A 1VDGA 3RVXD 3BWUF 3VTMA 3VQMA 3UMTA 2E86A 5E5UB 4JBSA 3LKRB 5KSUA 2G30A 4HIHB 3DX9B 5FYLE 4JM2D 5EOCL 4BD4A 2BNQE 5MEPA 1A6WH 3LAFA 1NFDA 2ZX6A 5FF6B 4IKIA 2IDUA 1SMDA 4LOVA 2XI9A 6PCYA 3OG4B 2VLKD 3KBEA 3GEFA 1WUZA 3GMMA 3OR7A 3IXAA 2WOYA 5TTRA 3U0TB 3MRNA 2YA2A 1QEWB 1HILA 3WJLA 3T2PA 5EBLA 1WLHA 3B2PA 3WKMH 3IMRA 1KDIA 4JDVA 3D51A 2BVEA 5K9OA 4UAHA 1JGLL 2HUEA 1MRDL 5GS3A 2Y25A 3Q6GL 2Z34A 1GGYA 2Q76A 3VXRD 5IKCB 3PE9A 3ARDA 3VG9B 1XR9A 1A7BA 2WBWB 4MJ6A 2HN7B 2DV6A 4LPUA 5I0WA 4PU2A 1J10A 5EORH 4YNYB 2FNWA 1YJDH 4Y4FB 4WWKC 1C7SA 1JPEA 4CUCA 3CFKB 1KACB 2YXWA 4DP2X 3N1QC 4YC2B 3SKMB 5A2JH 4YHPB 1L9TA 4Q97A 5KSBE 3D1MC 1XH3B 3KMDA 1LM8V 3K81A 5TQ0L 1JRHL 2FDBP 4LLQB 3VGHA 1QFWI 1LO3H 4RGNE 5E4EB 3ARVA 2SODB 4LSTH 1MIML 2OTWB 5F88A 5DMYA 1R3LB 1JVKA 3GB7B 3S2AA 4NC0B 1R5IB 4P4KB 3MLSH 3MRRB 2HFGH 3B1TA 3NPSC 4J39A 2VH5H 1R3JA 5HYJD 4LVNC 4N2BA 2NLJA 3AT8A 1C16A 4YHOH 3E1ZA 4APXB 1XGTB 3R7RA 5B8CA 1FL5B 1MHEA 3D9AL 3QDJB 4P9HL 1RUPH 3IFOA 2WLKA 3MV9D 1HXMB 1OSPL 2PW2B 4HZLB 4M7ZB 4X5XA 5AOKA 5EWIL 3H9SA 3OTTA 4HIIA 4PY8I 3VMPA 1RFDH 2PPEA 2HJKB 4N28A 4YHIB 4QAWA 1KB3A 1QOKA 4RIRB 4WY7L 4MB5A 2PPAA 2R15A 1TENA 4LPTA 2O4EA 1TZAA 4K0OA 2VW4A 4KK5C 4BQCA 1JWMB 3VDBA 4FC3E 3V6ZA 2LOEA 1KDJA 1UENA 5IB1A 5IF0A 1IAIL 2NSMA 3P11H 3HRZC 5MERB 3UABA 1Q72L 1OGSA 2J3SA 3FCGA 3PP3K 3NCJH 1ZLUH 3W2DH 4F9LA 1JXJA 1S3RA 12E8H 1FNSH 2P42B 2WPGA 4GSXA 5D1ZC 5F3HB 4FA8A 1IBHA 2E59A 1CLYH 3CK0H 4WEMB 2DQTH 2YAEA 4ZMWA 3UZVB 5J6HB 3P77A 3HAEG 4UNIA 2H8PA 1ACYL 2C3HA 2MKLC 4PJ8A 4XMPL 3RGVB 2NNRA 3WLWC 1SN5A 4WFED 2D7QA 4PJFA 4OLUH 3VW3L 2DEYX 4WO0A 3ZZ1A 3H3PL 4PR5B 1SOSA 4ELMA 1IC7L 1U8MB 5JYLA 3WFCL 4L0YA 1JWUA 2XTJE 2IMNA 4X99A 1HAWA 2WWMC 3I75B 5I6XC 1MPAL 3KJ4C 1KTBA 4QRQB 4YHYC 2JB6A 2CLVB 5F3BB 2EECA 1F4YL 1G7HA 4KFMA 2YAMA 2VM9A 4JS7A 5K9KA 2GBTA 1X7TA 2VR7A 2Q9OA 1T1ZA 1DQQA 2IANE 1I9RH 3ATFA 5C2UB 5GSVA 4G8GB 4E42B 4KY1L 3CQQA 1IU1A 2B77A 3ZOAA 3LXUX 4FYSA 3RVWC 3SY0A 1IFGA 2RFXA 4J3OG 3RI5F 4XVTL 3VTTA 4P46D 3B2UC 3GLZA 5G4OA 1EV2E 4IDLA 4CW1B 4MX7A 5D2LA 4JZJC 1KBKA 4HWZA 1GSMA 3W0WB 4AE0A 1Q8MA 4JRYA 4IK6A 1LK2A 1ETZB 1UHVA 1FFPA 2D03L 1UM6H 4FNQA 1U42A 4N3UA 3OC8A 3WFBH 1WA2X 4M03A 1XF3A 1KFAL 3JWNH 5AZUA 3UTTA 5T1KB 1TNNA 4A6YB 3ULVE 4PRDB 1RIUL 3SKNB 4LKXA 3T0EB 5EUKB 3FQRB 3K8MA 3EJPA 3UROR 4UT9H 3Q06A 2PWHA 4X6CE 1MI5B 4RAVB 4O9HL 3POHA 5KYXA 5DJDA 3O41B 1CXHA 4ZAKD 1X4YA 1YY9C 2NY7H 4E36A 4KDTA 5D7KE 5KBNC 1MFDL 2X87A 2R9HD 3EFOB 4G11A 2XX1A 1DLFL 3U1SH 2EDXA 4IHBA 3WBDA 1IGIL 2ZOWA 1R3IL 4MMXA 4ODHL 1N8ZB 1UA7A 3OM3B 4HPOL 4K7PH 3LIZL 3VXQB 2X4QB 3B5HA 1UCTA 2FBJH 2O6PA 3BAKA 4OSUL 5DVPA 3X3GL 2R0LH 1SJXA 2BDNL 2ZCLH 4U7SA 5K1JA 1TIUA 3GMPB 1OHZA 2DEWX 1G94A 4I0PD 1CLOL 1NFIB 4U1SA 5E5MB 2KZWA 4FG2A 2VRQA 1B0RB 1FH5H 1OW0A 5IGXL 3DPBA 1LP9E 1EERB 2BWDA 2B0SH 2HVBA 2YMOA 2ZX5A 4K9EC 3NBNA 1NDMB 4DPAX 2R51A 4HYTB 2D0HA 4KKZA 5I6LA 1J8HA 4P4RB 3O3BB 4XMXA 1PZAA 1XAUA 2M83A 2D2OA 3CZEA 5EF2A 1B0GA 2V5MA 1JGEA 2WVSA 4XPTL 5DD3L 3NA9L 4ZSOA 4B50A 3BO8B 1A5FH 2R27A 2BNUA 1M71B 1YUKB 3AZUA 3T04D 3U4EB 3B9DA 4C58B 1IGCL 2JIXB 3VFUA 5A2BA 3MUGA 4F9PA 1KGUA 1WFNA 2JKIS 4MXWL 5KBKA 2VXTH 2AJYL 3VFGH 1A2YB 4PJ7E 2K3HA 2NMSA 4G1EA 2CNYA 1WD8A 5F1IA 5I75C 4U6HA 5T3ZD 4HUUB 2IPKB 3DV6A 2CE6A 3IAGC 2APSA 3VRIB 3QJHB 5IUCA 2GY5A 3A67L 1J5CA 5ILTL 4JO2L 5HPMB 2FEEI 3RWFB 3U82B 4XN5A 2A6DB 3GJEB 2A6JA 3FUFA 4IDJL 1SLXA 3P4OB 1BQLL 1I9IL 2Z31D 4EXKA 1P69B 3ARUA 4JPWH 2XVKA 1J12A 4OLYL 2HG5A 1QTPA 4OF3A 4Z7UE 1BW8A 4F8OA 3TCLA 3KNBA 1NBVL 1KB9K 1KCBA 4F3FB 5DJAB 3GIZL 1PTZA 4DEPB 1BYNA 1JG9A 15C8L 5IHZA 4PRHE 2K4WA 3FB8A 2NQ3A 1EBAA 2P5ED 4I3RL 4JLRA 3UO1L 3MU3A 4AQEA 2IQAA 3P73B 4K3EL 4ZFGH 1R0AH 1E9QA 3PP4L 4LARH 4ODSH 2A9DA 5E1GA 3TTYA 4ZW3A 4X6DA 1OP9A 3WTTA 1OAXH 4FJYA 4KHXL 4L29A 43C9B 1FGNH 1ZD6A 2A77H 5FGBA 3MBWB 1ILUA 5I0DA 4P3WA 3FTVA 3PWPA 3SEPA 3UOAB 3AS1A 5HHOE 1I1AC 4GBXC 4UUJA 3P0GB 3TN0D 3WFEH 3FFOA 2Y07H 2E7MA 3FB5B 3PQYE 5E7FA 3TIEB 5AW8B 1H6UA 3EZ8A 4QAMB 3JZ7A 2ENJA 5DK3A 1QBBA 3BPCA 5ANMB 4H13C 4J3VA 2IFGA 1KCVH 3EW3B 2J8UA 4JQIA 3SPVB 3O9WA 4L8CA 4WWKD 1GSKA 3FH5A 4NJ9L 1GTFA 4OBSA 1L0QA 2KDGA 4FXLA 1BF5A 1V7NL 3FK3A 4QLWA 3GLDA 4G80B 4IM8A 1JV2B 2EADA 3FO9A 4N6QA 3OGOE 2QQNH 1H15B 1D6VH 3RIKA 1EHNA 2BHZA 3L3JA 1JDAA 2ZCZA 4QHNB 1AG6A 3US1A 3JVFC 2TAAA 3OB0H 3QDME 4NNPH 5K93A 4WNQB 2XWXA 4BFIA 1SBSL 4PW3A 5GGQH 3K7UA 2A6IB 4PCYA 4U1JB 5DFAA 1IZJA 2AJSL 1EIBA 1JPGB 1XB3A 1ORSB 1K8IB 3DHJA 5TJWK 5BRQA 5D7IA 4ZMPA 2PYFB 1BFOA 1P9MA 4L3ED 3VUAA 5E95B 5A6LA 4OZFG 3IWVA 1MCPH 3PAYA 2VRKA 5F44A 1B3IA 2PYEE 3HPLA 4OKVB 3CNKA 3EYQC 4I18A 4IJ3C 4OZGE 3Q5OA 2D9QB 2OMYB 1F11B 5E00A 2HTLC 3NTCL 1JPTL 3HZMB 3K0YA 2EE0A 4S11A 4AIOA 1O9WA 1TPXC 5EEVA 4EDXA 1J5HA 1JPFB 1FVEA 1NCGA 2IGFL 2XWZA 2ZXDA 1TVBA 3BZDA 4L05A 1IGTA 2JCCF 3ZRCC 3ULUE 1DJYA 3E2HB 3WSQH 2ZIDA 3SO5A 5CJXA 5M95B 3HBPA 4AMXA 1MW3A 3U7YL 3MLRL 1C08A 3MRKA 1SM3L 3BDYH 5KSBB 4WVRA 4O51B 4FQ1L 5CP7A 5BMFH 4TLSA 3HPJB 4W6XB 3DDFA 3OAYH 3RTLA 1BG1A 1BZ9A 4YDNA 5KJ7E 5ID1B 3U0WH 2QTVA 3JWDL 4ODTH 3S36H 2ZYIA 4HXAH 1QA9B 2IOIA 3CSTA 3PABB 1YZZA 5DS2A 4OFYA 1FIGL 3U6XS 4XXCA 5LG1A 2WWMD 5CIPH 1OCWH 43CAA 4RFNB 1FORH 3H6JA 3ZE1F 4PRBA 3MLZH 2X7LB 4NKOA 4EN3D 5BQ7A 2FJFA 2LV4A 2Z7WA 1M9SA 2BVUA 1B0WA 1AGBB 5TDPB 3U6RB 2P5WD 1PYWB 1FCCA 1FYTA 1FVCA 1ZGLB 4Y2DC 3CAFA 4NNYA 4UF7C 2GQHA 3LD8B 5E9DA 3FCTA 5IOPA 4KI1A 4G5AA 1N4XL 1H5BB 3B2UD 2YD7A 3GZQA 4W9DC 3DYPA 3DKHA 3WEXB 1T1XB 1G7MB 3GKWL 1BVLA 1BPVA 1CBJA 4NQXA 2WWKO 4ZPTB 2G75B 3U36B 1UT9A 5D1XC 3AG2B 3TTSA 1RUMH 4IQHA 4JR9L 4XXWA 2N4IA 5HGGS 3IGKA 3RKPA 1BD2A 1Z5YD 3DUHA 4C56D 3BAIA 3TH4T 2B8OT 5C9KA 5IJCC 5E56A 2L7EA 1RZJC 2O6EA 2VDKL 2QL1A 2PXYC 1NIDA 2VMCA 3I6KB 4A7QA 4R7NB 1GGBH 2ATKB 5TE7L 1F90L 3C5ZC 5EZLA 1DN0A 1G9EA 3O11B 3S97C 2VO8A 4H26A 1A47A 1E4WL 1I7UA 1U58A 3B5TA 4GEJA 3FFDB 1AR2A 3ME0A 4CKVX 3NJFA 1UWGH 2RA1A 3UAEA 3WY1A 4TV3A 2AQPA 2DRUA 2X5PA 5SX4H 1WAAF 1MFCL 3L3GA 3T4YB 1P84J 1KIRA 4L48A 1EO7A 3HG4A 5F9OH 1DVFD 4XHJC 2Q3AA 1QG3A 2B2XH 4X4YA 1VFBB 2VISA 4DF9A 4MXVF 3LEVL 4F2ME 4UNVA 2RCSH 4NJAL 3OHXA 5E6IA 4CMMB 4YXHH 3UZEC 1MFBH 2OMZB 4JFFA 2OJZL 3B6SA 5F6HJ 1AZUA 2BY1A 1BJ8A 3NIGF 3FO2A 4NKQB 3MZTA 4WWNA 2FK9A 4NYLB 3MRBB 3TBTB 5JLZB 7CGTA 5HHNB 3F3HA 4G9FE 3JWOL 4XTRD 2VLJD 1DLHA 1EFXB 4FE9A 4GUPA 4EKXA 1KOAA 1D9KC 4FQPA 2GTQA 4JY6A 3VYPA 2GK0B 2JJTA 5IIEB 3B7YA 1BXVA 2YWZA 3PCYA 1LE9A 3FQUA 2IH9A 4AIXA 4YBQC 1DL7L 3IDMB 3S48A 3VXNA 3IU3A 4HPYH 4JN2A 1A4CA 4B95C 1UB5A 4BK5A 3VU2A 3TJHC 5HYJE 1CVRA 1PZ5A 3MRGA 1IKFL 1ROCA 3LKOB 1DZ0A 2XQYK 3MNWA 3K2MC 4JO3H 1CD9B 4JFYA 1PEWA 1YUHA 3LEXB 5LN4A 3V7AE 3P9LB 1CLZL 1ZA3B 3ROLA 3L08A 3OAYK 3NN8B 5DF0A 3D07A 1HHGB 3TESA 2ADJB 1QSEA 4W1TA 5DTFA 5E0FA 4MS6A 5DT1L 2FX7L 1Q94A 4HS8H 1KJMB 2J1XA 3W9EA 2OTUA 4HS3B 3RUGF 1UOVA 4W9CC 4PJHA 1HI6B 1GZPB 2JXMB 4Z8FH 2WXKA 1EXUB 4JANA 3Q1EA 1S78C 1WIUA 4WFEE 3U9WA 3IMSA 2I9LB 3ZL4L 3V6FA 1MOEA 1NBQA 3ZKSD 4J23A 4ODUB 5HD8C 5BOJA 3MNVA 4WI6A 1AANA 1HHKA 1HIMH 1J5DA 3SGKA 3T1FA 2EVHA 2VDLB 3KPMA 1OAYL 2BVPB 3RVVC 1AIZA 1DE4A 3QJFB 1OIOA 3FF7A 1E6OH 1ZANH 4KJPC 5DJZA 4APQC 1QFHA 1VGKB 1T80A 1OAUH 1ULVA 4G6ML 1G9ML 1FBIH 2OP4L 2X12A 2OTPA 1EZVY 3CMOL 1HVXA 3BIKB 3BEWB 1N6QL 3IFNH 1M7UA 3O3EA 2E74C 4M5ZL 3WFHA 4D9RD 1D2OA 1U3NA 2YBGA 4Q52A 1T2JA 4MS8C 1U8NA 4PV8B 1QQDB 4Z7UB 3MNZA 5BJTA 4TQPA 1PQZA 3WENA 4OZIE 3L13A 1R4XA 2DB8A 4J1UB 3IJEA 4LP5A 2GABA 2BCKB 4PRHB 3MVSA 1FZOB 5D5MF 5FUOH 4JQIL 4DO5A 4A1RA 3FN3A 3KPPA 3Q01A 3WG7B 3RIAK 5EZJA 5JIQA 4NIYE 5MP6H 5LXVA 5CJOH 4HIJA 3BC9A 4LCWD 2LU3A 5AW5B 4S0SD 2YPVA 3CHSA 3RJOA 3VCLA 5EU6D 4KY2A 3FU3A 2JJSC 4E68A 3WFZA 2ADGA 3WD5L 1ASOA 1BZOA 3WKYA 5I1JH 1HHIA 1R3KA 1E3XA 1FVDA 3K2UL 2QVIA 2VDQB 5IVZB 3AGWA 1EWHA 3GMRA 2DJ4A 3NJXA 3V0FA 3V5HB 3GHBH 3TNNB 2LQRA 1X4ZA 1QWNA 2HTLD 4PI2A 2BVOB 2R59A 3ETSA 3NT0A 2PWGA 2VIRB 3FL7A 1FLRH 3HN5A 4JRXD 2NY2D 4GMTH 4MB1A 5DZVA 3MOQA 5H37G 4RDQF 1PF3A 3RWJA 1ZRUA 3HNVL 3TF7C 3FN0L 4NI6A 4Q9RL 1E7UA 3RWDA 2YARA 4JKKA 1XH0A 1AP2A 1XCWA 4RSVA 3WJJC 1FZJB 5EU5A 4UQBA 5LG6A 3WN6A 3P9MA 2X6AA 3M45A 2UX7A 3GUTA 1U8QA 3V4UH 3WNPA 4QRPA 4ZUTB 3WY4A 5IROD 2IAMD 1UWEL 1QFWH 2ED9A 4P0DA 1I9EA 1YNLH 5EPMA 2J88H 3H3BC 1DSFL 3C5SB 3QIUC 4XVJH 4LCCA 4CAGA 3EHBD 2C8NA 4KVNL 4PY7B 5E2WL 2F54B 4V1DB 2Y23A 3MLWH 4GG6F 4Y19D 1W8OA 2XWBA 4IBWA 1DBKL 3V5KA 4K9JA 3FQWB 4B9IA 1E4KC 3SDDA 2OW6A 4MQXD 4MJ2A 2IDSA 5HDBF 2BRRL 5L4JA 3B7UX 5D7LA 5I1IL 3KPSA 2X4RB 1P4BH 1UJ3C 5MHSE 3ELAT 2F5AL 3RFZA 3LZRA 2Y6SD 2VUYA 1QBLL 1FA4A 4AYBA 2P9RA 3EBHA 4YIQA 1BX2A 2DQUL 3BLBA 5I8CA 2DD8L 1I7ZB 2QFPA 2VQ1A 3K6OA 2NZ1A 2JKNA 3F84A 1DJHA 1AO7B 2HH0L 3CVIH 2DLIA 4WHYH 4AL8C 3J2PA 4YSOA 4N8PA 4KTYA 1U4EA 1KCSH 3WNOA 5AB9A 5KVEH 1C5BH 2BJMH 4FL4C 5HY9A 1HWHB 3ZT7A 4MD0B 2DKSA 4R4BB 4DFHA 3L1EA 2ZWLT 2IBZY 4MDJB 3ZRFC 4GW4A 3AXIA 2PXYD 5DJYA 3MRMA 1ND0A 1X4XA 4JFEA 4P9ML 5L6YL 1OM3H 3FRPB 3IT8D 2WNWA 4M93C 4HG4J 4WU5A 5IW6A 1AD9B 2CO6A 2R0WH 2YGNA 4L5FL 3WI9A 2ICEA 1U8OA 3MBXH 1OGTB 4QHKJ 2X4UB 3U30B 4C59B 5LXGL 1S7SB 4A2MA 3DMMA 4ABQA 2HLEB 4JNXA 1NCNA 3DPDA 3NJMA 2IH3B 1SEQL 3B2XA 4AYGA 3V52L 1DANT 4C83B 1RULL 1U8CA 2EIEA 4KROC 1DEDA 5DUBA 2WKOF 1SLWA 2BFGA 2PO6C 5EDSA 2VXVL 3T0AA 3UH8A 4FLHA 1HXYA 4Z7VB 2FH6A 2DIAA 2WIMA 2YQ3A 2YMTA 5IJKA 5GGVH 4Z7QE 1IQWL 2R56L 4LEXH 2Q20A 1WHPA 3HNTH 4BCXA 5FECA 2PCYA 4FXKC 3T2NH 4KTEH 4BSJA 3VFSA 1PG7L 2A73B 5JTWA 3SKJH 2R39A 1P4IH 2OXGB 4JM4H 4LMQE 1WFJA 1SEBA 3IPBA 3LKQA 1LL1A 4JZOA 4KRNA 4MJIA 5HHMD 4ADJA 4JPVH 3WNIA 5DJXB 1KJ2B 2GJPA 4M8UA 3VRLE 2XZAL 2ZCKL 4M62H 2WKGA 4BFFA 4E41B 4JM2B 2R1WB 5BVJB 4NAJA 2D31B 2RACA 1VACB 4PW9A 2EO9A 2WZ5A 4AM0Q 1ZVHA 3IDGB 2VLKB 4TQHA 2I9TB 2DL2A 3X2QB 1F4XH 3GXNA 1PZ2A 3QCUH 4GKNA 1U3HA 3MLVH 5ICYB 4LSQH 3TJHD 4Q2ZA 2ZUXA 5IVOA 1OOWA 2VL5B 4FFVC 4OFVA 4KQ3H 3SGJA 5L8JB 1GAFL 3EFDL 4M61A 5FK9A 2H2SD 3LQAC 1EUUA 2DF3A 4N2AA 3QUMB 4C55A 5L7XL 1PZ3A 1T83A 2XSKA 3ABZA 3MFFA 3PAZA 3VXRB 4Z3IA 1KCKA 4BFRA 1QRND 1HEHC 1WK0A 3LZLA 2RHEA 4UOW1 5FIEA 1FHNA 1TFHA 1KJ3H 2NY3C 5EF3A 1EEUA 1PZBA 1XGRA 3OAUL 3ROOA 3SDXA 5EZOL 4A7UA 5HVWA 2X2UA 4MD4A 4LB8A 2AKRA 1KXTA 2HJLA 5AUMA 1D5XA 2BZ7A 3BFQG 3L1FA 1BZQK 4M5YH 2HX8A 4FFZH 3FSVA 4LKCB 3MLTA 2KLRA 3NZHH 3TA3C 2X6UA 2Q6WB 5DSCA 3EOTL 2EDJA 4HISA 1U8KA 1S78D 1FFNA 5TDOA 5INDA 5TK4A 1CFNB 5KVFH 4O4YL 3LTVA 3NQIA 5JDJA 1KN2L 1T1YB 1U92A 1R5VB 2NR6D 4M7LL 1I1FA 4YJZL 5HD8D 4Y0GA 4DOHE 1NKOA 1MWAB 4P5TB 3V4PA 5FO9A 4K15A 4ODXB 4YGVA 3BAWA 3INUH 3MV9B 4QT5A 1MRCH 4KRLB 1T5KA 3D25A 4ODVH 4AXWA 5LDUA 3CX5J 4ZK8A 1PDKB 3VWJA 4X4XB 4XPAL 2P5WE 3DUSA 3H53A 5ECGA 3K6IA 2IWGA 3KLAB 2P8LB 5C0AB 3U0PA 4GI6A 2V3FA 3I85A 3HI1A 3IBOA 2ZICA 3INOA 3ZDXF 1USZA 3T2LA 4LPXA 4U7MA 4C4KT 2Z0UA 1WBYB 2HTKC 1QHQA 4LASL 1KSRA 1RKRA 2B08A 1MQ8A 1MIEL 3BLPX 4LCUB 3WIIH 1IUZA 2XFXB 3BSGA 1HL9A 1DANU 1NGYB 5IVXF 3WEOA 2GJZB 3IDJA 5FHAH 3PXJA 3UCRA 1GH7A 4MXQD 1VGEL 3JZYA 4PJGE 3QH3B 1ZDQA 5EULV 3T3MB 3ZR5A 2DQEH 5I1EH 2Y3AA 2I26N 1Q1JH 3WHXB 2CIKA 1K3ZA 1RZ8B 3C6SA 4EPSA 3MBEB 2A5UA 4PS4L 4G42B 1S8DA 1A7NL 1PJ9A 1K4DA 2DQCH 2GHZA 5ESVB 2IPTH 1X6LA 3X1EA 2MJWA 4OB5L 4Y8AA 3TCTA 1PCXA 3CFJB 5AOMA 1XBRA 2P49B 1C1EL 2R0ZH 5LBVA 4BWWA 4M43L 2YPVL 3NVQA 4P2QD 5FUCC 3RTQD 2WWOA 3G6JB 4U1MA 3RZCC 1T6WA 1X5GA 4ONOA 3WIAA 4BHUI 4Z3GA 4R8WL 4Z9KB 3A4EA 2O72A 4M3JA 3OKKA 3FUHA 2CUHA 3CZJA 2OBGA 1JZEA 2XRAH 4B6ZA 4BFOA 1TJXA 5JQIB 1TNMA 3ORJA 4R0LA 5IW1B 4HS6A 3GSVA 4XPGL 4XC3H 3TBWB 5D2NB 1A25A 3ZGIA 4WRLA 4S1QH 4LRNL 5F9DC 1MCWM 3GHEH 1H9DA 3QUXD 3B3IA 4PRID 4EDWL 5BCAA 4X4ME 1QSFD 2UWEF 5T33L 3FQXA 1M1XB 3PWNA 1ZTXE 1H3PL 2H6OA 3QJTB 4F7PB 5D6CB 4G6AC 4Y4HB 3UFIA 3DX2A 3N42F 4X8JB 1MCOL 1OP5H 2NDFA 2JH2A 3SDYH 5DRWA 4XCCL 4Q9QL 4BSVB 5IB2A 4ZAKB 4AEIL 4O02A 1F1DA 3ISRA 1F00I 1G0YR 2YK1H 2XQBH 3FYEB 1J1XH 3X12B 4OH2A 4TTGA 5JHDB 3VFNB 5GGSA 2AXGB 1AFVH 2W59A 2YKLH 4KKCD 1YDPA 3ZO0A 4JK0D 4HEME 2IJ0C 3EJZC 3HUJB 2G2RB 3QZWB 2D4FA 3S5LA 4NQEA 5TF1H 4ES8A 2DPKA 4KKRA 5C09E 3G9AB 4AQ1B 4PGEA 1MRDH 1Z9NA 2R1YA 3B8SA 1NWPA 1VZGA 2XG4B 4MTMA 5EF0A 2VLRA 4H0GA 1MW2A 1R17A 2JKTM 1R24B 3KXFE 4MMZC 1V8HA 2OR9H 1SNRA 1PZDA 3AQZA 3WN5B 3QARA 3HZYA 3FULA 3QJRB 1JGIA 4AM0A 3ESVF 4U1GB 3H42L 4K7PX 4JKPL 1E4XI 1F56A 1JERA 3ZTNH 3S3BB 2EVIA 3QFDB 1MCJA 3VGDA 1HSBA 4N8UA 4MJ5A 1LO5B 5AVVB 1ZWIB 2C4FT 1MCHA 2E7LA 2EVGA 1P1VA 5GZOC 5BS0A 5DZNA 5ERWB 3SJVA 3NEOA 4LBEA 4UQ3A 5DUPL 5J11C 3RNKA 1QFUH 1IVLA 1ED3B 2CK0H 5DD0H 4NKDB 2BOBB 3J27A 1TOXA 3O45A 4QOKA 2PR4L 4GYBA 3LPGA 3JV4A 4FKEA 4JG1L 2BVYA 4O00A 1XCTB 2Q3ZA 3BCFA 2MCG1 2NYYD 3U4BL 1NBYB 3N40P 5G55A 1YAZA 1SDDB 5CSZA 5GRXG 3DO4A 3MKGA 1KG0A 1HOEA 1YJDC 1EX0A 1S7WB 2ICWI 5HHQB 2R8SL 2YEZB 3VI4A 2EDOA 1MFUA 4JFUA 4S1DC 1TZ8A 3GBML 4XB8A 4AIZB 4QF1A 3MHZA 3L3OB 4N5EC 1NDGB 5EF1A 2NCEA 3MCLH 4JHAL 2AJUH 4AYFB 2R29A 3SB3A 3TT1L 1AI1H 3LZFH 3IGAA 2G5BB 4NB7A 1S9YB 1MVYA 1KLUB 4ORGB 1D5ZB 2Q2LA 5EU3A 3REWA 3HMWL 2P8PA 5BRZA 1ZS2A 3LS4H 5A7EA 1G4MA 5D72H 2VM4A 2Z31B 1RUKL 5DQJB 1PX4A 2Q7NA 3DRTB 5LGKA 4FXGA 2A9NH 2VDML 1HINL 2O30A 2Z93B 1OF0A 1IFHL 3H85A 1YC8A 1S3KH 3FMGL 3MRLA 3OWEA 3QPKA 4NCC2 4UBDD 2H47C 4FQLL 3PY9A 4RDBA 4ZTOH 4I87A 4DQAA 2P5EB 1THCA 2OR8A 5AAMC 2VSKB 1GCYA 3W1ZA 1F3JB 3DOHA 1IC4L 3VXMD 1BGXL 1W0WA 2QKIA 3I3DA 4PTTB 4UQIM 1YN7B 4LCWE 4OIAA 4WJ5B 1HHHB 1A9BB 5EU6E 3FUEA 2M2DA 4UTBH 3ARDC 2BSDA 4HJUA 4JG0H 3MNDA 4EIBA 1FI8C 3GXUB 4GUQA 3TN0B 2AEQH 1ZHKA 3ZLQC 2J57A 1E28A 3RKDC 1ZSHA 2C5DC 1RAMA 4RWYL 2IH1A 4NWTH 3GMOA 2O5XL 4FOMA 2DTMH 3ARGC 2NY3D 4NAMA 1OSYA 1JN6A 4JRXE 2GUYA 4PJFF 1OP5K 1OGAD 1IT9H 4I3GA 2V2TA 4ELMF 2CNZA 3BAEH 4J28A 3MMEA 4NO3B 4LNRB 2CALA 4MNQB 2DQJL 4PGDA 3S88L 4PJBA 1N10A 4AITA 1JXFA 4XP6H 1S9XA 3E8UL 3L4UA 2J8OA 3S3DB 3S3PA 3D05A 2H32B 4I4WB 1Q9LB 4NX0A 5D1QC 1RZ7L 4JL2A 4EIZC 5I19H 4UNTA 1L3NA 3LSOB 2BW5A 3W5MA 1VHPA 5JIKA 2PABA 2X6VA 3O0RL 2VN7A 3S37H 1F97A 4OCXH 2OQJA 3Q2WA 5E8NB 4JFQB 1IQDB 4TL4A 3OKNB 5C0DB 4L3EB 1DLFH 2UZIL 5EIIA 5D2LF 2ZUQC 3QIBA 4JPIA 4O2FA 4Y19E 2C4FU 4BH7B 4U6YB 3D18B 5INCB 1OZTG 4PS8A 4HW6A 3LIZH 2XY1A 1W72A 2JNZA 1S7QB 4OF0A 4HF5L 4AQZA 3V4PL 2BDNH 4ZQKA 3T65A 3JWNC 3L7FA 4TPRL 4PWFA 4UT7H 4B5ZA 4N9OB 2EUZA 5IVNA 3O4LD 1CLOH 4XAWH 5EU4B 4PJ8C 1FNFA 2FIRT 5CWSA 4KKQA 2ZD0A 4UV4H 4AZ8B 5IJVB 4HUXA 5ADOH 4B7LA 3TXAA 1XTLA 4DCQB 2QVKA 4Y4KC 3PWVA 5CSBA 1SJMA 1SRDA 5D1XE 4AOFA 3WXWH 3IDNA 1YPZA 4NKIH 5EOTB 5LHDA 5I5RA 1XT5A 3L4CA 2JTDA 5EOQL 1IGYB 5F7YC 1ETA1 3S3JA 2GJ6D 1LDSA 4YSSA 1D6EA 2JCWA 2X28A 5I6XB 5PCYA 2D73A 4GEIA 1SBBA 4PJCE 4YDZA 1N0LA 3UTPD 4EN3B 2VITB 3QEQD 4X42A 4N2HA 5IQNA 5I71C 1S9VB 3O3UN 4XE5B 5I16B 1W9XA 1NAMA 1GGIH 4FNTA 3ZE1E 5CFAA 5I1HL 3TL5A 2WQRA 4HBCL 5ICZB 3OR6A 4Q6IA 2P5WB 2NXZC 3FTYA 1NWOA 3BUQA 2WKLA 3L5XH 4YO0A 5CHNB 3L9EA 1EEZB 3RZCD 2YQGA 3PNWA 4LEOB 5JXEA 4RAUB 1AGEA 1RZPA 1F1GA 5L4IA 2W1NA 2GKIA 4Y2OA 1PY0A 1P5VA 4YSEA 4Y9CA 5HYSA 2WYHA 1KJVA 4PV9A 4IBYA 1CGYA 1DBAH 3GQFA 3KWVA 3GBDA 3B43A 5DU7A 4DZBB 3GSNH 5E1QA 5AAWA 1HCFX 2E9JA 4P3CH 1N64L 1JYVA 2GI0A 4XN8A 5KSVA 1A4KA 1SJHA 2UY6B 5D6DA 5DJ0A 3VNZA 2I24N 3T8XB 4C56B 5B38B 4NQUA 4XB3A 4DKFH 1RZGA 5CFHA 1KWGA 3OKEA 3V4VH 3UJIH 4G6AD 3GIZH 5IR1B 4QCIA 3KYMA 1G9HA 5IQ7H 15C8H 2CRIA 3MROA 1Z9MA 2BNQA 3FSZA 4W9JC 3RZWA 3CFMA 1P0SE 2CPUA 2PUQT 3MJ7B 3PP4H 2XTSA 3OWRA 3ATBA 4MMXC 1BHGA 4F7TB 4MAZA 5DD5H 3S8GB 3EH5B 4GG8A 5FKAA 3EDFA 4Q56A 1CDCA 3G6AB 2C3WA 2Y7NA 1I4FA 4N20A 4I48B 1EDQA 5IFHL 2R2BA 2ZP9A 5HGHB 2FLRT 2MWCA 4RBPH 3FFCD 4ZO6A 4Y16C 1DBJH 1OTSD 2Q1EA 1YMHB 1WAAE 2WCSA 4O02L 3Q05A 3QT2A 1ONQA 3VFTA 2ENPA 1DVFB 4QKTA 4DVBB 3C9NB 4KVCL 5DLLA 4PTUB 1K3IA 3CFCH 1KFGA 1L5GA 2CO7B 1U3JA 1ASPA 4FNRA 3Q5YA 5DMKA 1ZKAA 3GS4A 3L3IA 4X7FC 1FPTL 2X70B 2TSAA 4JFOA 1YECH 2OMVA 1W6LA 3QJQB 2NXYC 5IBUB 1JYNA 1NCUA 5B39A 5I9QC 2I60L 2IALB 2EYRA 5LGJA 3G5ZB 4L1DA 4NN7B 5A16B 4BKSC 1LD9B 1VCBC 5EMYA 4YXLH 1H8LA 3NIGE 5DUJA 5GZOD 4FQ2L 5KWYC 3H7BA 2VLJB 1W0YT 3FCSB 3NP3A 4XCYB 4A63A 5FO7A 3QZNA 3G5YA 4RZCB 2EVFA 2FEDC 3AG4B 4XMKH 3WY2A 3PDOA 1RPKA 2ADFH 4JX0A 4QI3A 1YMMD 5HI5C 2EYTA 3CDZB 2WYIA 5C07D 1L6ZA 5C8JA 3KPTA 4NQSB 1TETH 2FQDA 1LDPH 3VI3A 2Y1ZA 4DT2A 3UJJL 1AZCA 1BOGA 3PHQA 4F2EA 4JPKL 1CT8B 3GHPA 4ADGA 4H5SB 4FZEL 5I75B 5ESQB 1T03L 4ZRGA 1GZQA 2V6HA 3M86A 1BQSA 4JREB 2VXQA 3FUJA 3I3EA 3QQ3B 4YBLB 4ZUVA 4N5ED 5I73B 4HUWB 3TH2T 5BUGA 4TUJB 2IGFH 2FRGP 3BVDB 2YRLA 1CICC 1IIKA 1A6VL 3I02A 5HYFA 1KGJA 3VD5A 1B3JA 5IMMA 3BDBA 4RAHA 3LXCA 2W60B 1HZHL 4EUPB 5AVUB 3RWIA 1HH9A 4R7LA 1AGDB 1GKOA 4L9LB 3DSFH 1NLBH 5EO0A 1BMZA 4P23A 1UM4H 2E7HA 2QLVB 2R29L 5E8DL 3CZSA 1OANA 3GBLA 3JWDH 4HULB 3ZKQD 5FUZL 3S96A 3NP4A 5E2VL 5FA4A 1Z0MA 1EMTL 3TYGH 3CQPA 1AXTL 5TFSH 4YFDB 3WGVB 2V9UA 1GMEA 1BOYA 3BUYA 5CCHE 3AY2A 1WWWX 2YHGA 1C5CL 2A83A 2WYTA 4B9FA 5K59F 1MCIA 3P3YA 5KUKA 2A6KB 3ARDD 5GPRA 1GPOH 1SUJA 4LVEA 2Y0SA 5ELIA 2VGLM 4XNDA 5HGAA 2IANA 4DP5X 2BIHA 1OV8A 2LTQC 3RKDD 4DTGL 1PKQB 4K71B 1JUFB 1G7QB 3IXTA 4P2QE 4S2SA 4KTDL 2MSPA 2ZOOA 3GTNA 1FF5A 3ARGD 3KH4A 4XNAA 1I3GL 1KIPA 3O3AB 4PM1A 1BLNB 4WV1A 3I2CL 4IBUA 2NT1A 2UUDH 1MCDA 2FJHB 2I7SA 3EO0B 3LZQA 3IS0X 2R69A 4DKAA 1JZ7A 2VZSA 3HHSA 2VE6A 4YHZH 2BRQA 1ES0A 3HG2A 4RFOL 3Q0HA 4KK6C 4X9HA 4TQEH 1D5IH 4PRIE 2BVTA 3VGAC 1RZKL 1J5OH 1QSFE 5D1QD 1GIGL 1I31A 3QG7L 1CLVA 2XYCA 3ZBMA 4X6CA 4F93B 2Y5QA 3PDGA 3N1GC 1E4WH 4LCWB 5EBGA 4JVWA 3H9SD 5I18L 2DWEA 5F6IC 1M7DA 5EU6B 3IJHA 4OCYH 4I18C 3R8BB 5ALBL 1KBBA 2VAAB 4HU8A 5AKTA 2AXFB 3UC2A 1FWXA 4L18A 1I8LA 1JGVH 1N5AA 3FZUD 3V0AC 3C87A 2L7JA 2Z35B 4X7TB 3C2AH 3QPQC 4BXSV 2FECI 4ICXA 3UPCA 4AIEA 4LFHD 2ZX7A 1NIEA 2F19L 4TUOB 1CDYA 4EBQH 2ZWSA 3MPCA 3AWEA 4R9HA 3QI9A 2NY2B 3WELA 2OSWA 1CXIA 2BP5M 1XXDC 4DESA 2XXFA 2FSEA 4NDMA 4HLZG 4PJ8D 2XN9B 3CZGA 2O5ZL 3BWAB 1LO0H 5CCKL 1Z9SA 1WZKA 3U9PL 1W72L 2GT9A 3EGXA 3N9GL 4RVBA 1LP9A 4Y4KD 3D3VD 3QZOA 2BCMA 2LT9A 2RR3A 5GRUH 1TQVA 3E0GA 3RHWK 2QQKH 1OGPA 1UYWL 3CLEH 5FYKE 4Z78B 1RVFH 5KOMC 1J05A 1QNIA 2IAMB 5T1DL 1S7XA 4RESB 4YX2H 3EFFB 5E08L 2V7HA 4C54A 3RWCB 2XPYA 1XF4B 2K4AA 1UURA 1CYGA 3EHBB 1J5IA 3LH9A 2R2EA 3VFWA 1CDGA 4V33A 3ETBF 4DGVL 4ENEC 5T5FA 4EI5B 3ZYJA 5C0JB 4PJ7A 4HGWB 2HLAB 1YQVH 5EC2A 3HI5H 3UBXA 1JTOA 4YAQA 8FABA 4LSSL 4J8RB 1YNTB 4JRYD 3RNQB 3WE6A 4D8OA 1DR9A 2XVLA 5C0EB 4JGNA 3RJQB 4Z3HA 3GSWB 3NACH 4TVUA 4ZFFA 1ACXA 4Z5RB 4OF7A 3MTRA 3VFOA 2VXSH 4WU7A 1NAML 4I7ZC 3JYCA 3LXBA 1GHFH 4HKXB 5EV7A 1S9WB 2JCCB 2ZKXA 3L1OH 4HK0A 1Q9OA 2QT6A 2V2XA 3MR9B 2OZ4A 4QDGA 1DQDL 1Z9PA 5DEFA 1MH5A 3B9KC 4I77L 3DYMA 3T1WA 4G1MA 3L3HB 5BZXA 3LPPA 2HZHA 1RJYA 1ZGLP 3SQOL 2APXA 3MXVL 2WQVA 4X8GA 1KC5H 5B22A 1BQRA 2PXYB 2V37A 3W9DB 4PJ9A 4PJEE 5EIIG 4E9YA 4XX1E 1KB5H 4KITB 5IB3B 1ZLWH 4CSTA 5JUEH 1MJ7H 2Z64C 2QADB 1RSFA 4HK3N 2H26A 4QTHA 2EC9U 5EU7C 1I9JH 2NX5D 2B5IC 1IAKA 5IM7B 2ZNXA 1R5WA 1X7QA 4IGBC 2EE9A 4DN4H 5H37H 4E5XA 5FYLL 2WXOA 4DSYA 1X7SA 4P2OC 1GGUA 2ESVD 3GM0A 4Z76A 1G1OA 3V9EA 5HHOA 4GP8B 3G5XA 1I3VA 3ZHNA 2UUDK 5ESAA 2YBRB 1Z2KA 3UGUA 4ODBD 3PQYA 1ZHBA 4J12A 4MCZB 5KBPA 4CGUB 1QPPA 3V0WL 4PJHF 4WSKA 4PJAB 4KX7A 3ZHLA 5A2IH 2K9FB 3QRFM 2VCOA 3HFMH 5JW5A 1QAWA 3D87B 3T6ZA 1TJIH 1XGYH 1EJOH 2P7TA 3JSSA 1OGAE 2CJUH 1CFSB 3KPNA 1KLFA 3STLA 2VC2B 1EHLH 5F7BA 1FRGH 1OO2A 5CLYA 5HHMB 4JB9H 4FLQA 5L0QB 2XV6B 2FO4B 3F5WB 3ILPA 3V6BR 3KEDA 2YUXA 3NIFF 3QQ9D 3RILA 5EH1A 4Z23A 3QDMA 3MRCB 2FEDD 3N85L 1BWWA 3QORC 3GFUA 2VDNB 5HI5D 3CPLA 1QLFB 2N7AA 1MJ8L 2JTYA 4PWEA 5GGRY 1WT5A 1CGSH 3L5IA 2AW2A 2MNWA 2VR5A 5CUSL 4A7SA 3DVIA 3QUKB 1IBDA 4YHKL 1BYPA 4CC1A 5JIMA 3CFDB 2WLMA 3KVPA 3UJTH 2D7MA 3CBRA 3X3FL 1Y1DA 2PYEA 4FFWC 3QFGA 1OPGH 4OZGA 1G6RA 5CZVH 2P43B 5L2KB 2DLHA 4KXCA 1QRNB 1WQVT 3AAZA 4GW1B 5FOJA 4EQ3A 1U9KA 1NKGA 5DDHA 4U6VH 3SE3A 1LWRA 3A6BH 3BSZH 4Q9RH 5LQBL 5DMIH 3BH9A 1NCDL 2CHXA 3D0VB 4TULL 2YPLE 4KGJA 2W9EL 3TVMB 1RHHB 4GRLC 4I5BA 5E2UL 5F7UA 4F1SA 2VXQL 4B9GA 3FYIB 4KV5F 3NJJA 2XICA 1E4XH 1U2HA 3SKOA 2EDDA 3IJYA 1CGVA 1QABA 1EGJA 1U3ZA 2YD5A 1OF2B 4OGAC 4Y5VC 4XNBA 4M7JH 4OJCA 4FTVE 1AQDA 3OAZH 3PWPD 5DD6A 4LLDB 5CBAA 2GJ6E 1AY1H 1F4AA 3CFBA 3FSAA 4LK4A 4YXKL 1TZGL 2VUOA 4HKJA 4M8QB 5BV7L 3D0AA 4F15B 1A6TA 1BQ5A 3ZUCA 2BVQB 2E27L 3MRDA 1DBKH 5DI8B 1G9NH 1NUGA 3CVDA 3QEQE 4RFEA 5MI0B 5IQOA 2ATPA 1CTOA 2MNUA 3KCPB 1U36A 2CHZA 4JDTL 1K5WA 1Q38A 1AMXA 3O9WD 3KGTA 2J21A 3Q8CA 2WLZA 3KR3L 4B53A 5DXWA 2F5AH 5FUCE 4LNVA 3HG1B 1JHTB 2E9GA 1USQA 4KNTA 1N7ML 4MCYA 5JPMB 4O2CA 4NUMA 2CDEB 3P30H 3Q6FA 2DD8H 1NCCH 4AQAB 2R0KL 4HJJL 3US0A 2DH2A 5DD1L 1UADC 4X0NA 2GTWB 4L1LA 3BQUA 2JJUA 4GSUA 3ARBB 1ZLVK 2IH8A 1ICTA 2VDPB 4GKLA 2QV2A 2B4CH 2HX9A 3Q48A 4F8QA 1K85A 4OLWH 1U8LA 2YGVA 5GS1A 1HQ4A 1RIHH 1S7VA 1XIWA 3NK3A 4KK6D 5AB2A 2WUCL 4NIKB 3DBXA 2OMBA 3DYOA 3RUGB 4ZZFA 5DHVB 3FSWA 5L6YH 1T66C 4Y5XB 2YAQA 4FLRA 1LNUA 4IU2B 4K94L 4FQXA 4E0RB 1IGFL 4L5FH 3F12B 2EAEA 2R69L 1F8TL 2IEPA 4N86A 1MJUL 1U8HA 5GS0H 2RTTA 4R5VA 4WW1A 3RDTC 4Q9CA 1FN4A 3ULVL 3DGGA 4K5LA 1TTRA 3QPQD 2XWTB 2V5SA 1BXXA 5I8KH 4LSPH 1ADQA 1AC6A 2YSSB 3WCYA 4KJWC 3BP5A 2YD8A 1NGPL 1W0VB 3C09C 3L1GA 3PPSA 4XNUL 3RTQB 3FFCE 3KWXA 4KK8D 3AREB 3DJ9A 4QRUB 5ACLA 3L4TA 4PLJD 4GAYB 4NPYB 5J1AB 5IMKA 5KSAC 4LLVA 2MQCA 4WUKL 2C7UA 3TYFA 4XPBL 4F2MA 5AW0B 5CGYC 4E9XA 1KXVC 3QIWA 4IJTA 3ABMB 1KENH 3Q1SL 3F7LA 2OYKA 3PAVA 5K9JL 1IV8A 2P48B 4WI5A 3BGAA 1MREL 1UGNA 2VM3A 3MUUA 3LHPH 1KBWA 1KELL 2AV7B 2JKXA 2MHAB 3EOAA 3EYFB 3NRQA 4FQJL 2WLLB 3QUXB 1U93B 4U1LA 2KPNA 3ZYIA 4PSPA 1XSOA 3QFJB 2HVKA 1LE5A 4HEPG 2HYMA 2XZAH 4G9FA 2F74B 2UY7B 2EUXA 5JNYB 5D5MB 2BFVL 2FUQA 3IRPX 5DMJB 2EIKB 1IE4A 4OM0L 1Z1WA 4JJOA 1UACL 1JL8A 3MRFA 1INQA 5A3ID 1XF5A 1E40A 1HHJA 5HYQA 4K4KA 4G71B 3BW9B 3N0PB 4AEFA 2NW3A 1HOCA 4ENED 3BH8A 1NUNB 3AXLB 1CGWA 2VDOH 5HYJA 1HKLH 1C5DB 3EGSA 4HX1A 1CN4A 2P1YA 2QLYA 3GRWA 2MIZA 1T04A 2W9LA 3GSXB 1JK9A 3QXVA 2R2CA 2AK1H 1UZ8A 2WXRA 5GSRB 4MWFB 2Z92A 1N3NB 3BN9C 3S34H 2VZVA 5FB8B 5I1AB 1GS6X 3OV6A 4PVMA 4EXPX 3KM2A 4OJAA 1NOLA 5T5FL 5AOZA 3U7WL 5I1KH 1J9TA 4NT6A 3GSUA 5D70L 4FP8H 4IKNA 4XMUA 3AITA 3OAUH 3OAZK 4IU3B 4EIUA 3QZPA 2WN2A 3B9KD 4PMFA 4PJIB 3KZ8A 4NO5A 3TP4A 3GMQA 3LDBB 3VM7A 2CGZA 3IETA 3WNLA 4DKTA 2P80D 3ABLB 4ABWA 4HH9B 3ENEA 1T0NA 1ZT7A 1NGQL 4RNRB 1KYFA 4M6AA 1RPQA 2AZUA 8PAZA 2P44B 3GBEA 3X1NA 2LU7A 3U46A 2VN3A 1A66A 2VL4A 4R4FL 2OZ4L 3O2VL 1N59A 4X7SH 5DRNB 4AWJC 4YFLI 1XD1A 3QSKB 3VAEA 1JHKH 3DXAE 2BHUA 3QAZB 5AYQA 4IGBD 1QUNB 1JOIA 3F83A 1OE3A 1AHWC 3NJIA 1F6AA 4YWGL 2O6DA 3STZA 4CN4A 4GG6B 3ZT5A 2QEJA 4JQXA 25C8L 2HB0A 4EI6B 2LHAA 3SDXF 1WEJL 4HWBH 4KHTL 5HDBB 5I74C 1GCFA 2IGLA 4JFFD 5EEZA 3DROA 1IJNA 3NFSL 2B15A 3TPKA 3HNSH 1OAKH 2B1HH 1QFWM 4WKZB 2XDHA 3IS1X 3BP7B 2FATH 5AVSB 1B6DA 1YEIL 5FFGA 4LSRH 1E9OB 4DEWA 3NCMA 3VFVB 4R7DB 2GIMA 4KQ4H 4P46A 2YUWA 3UYRH 1Q1PA 5DC0A 2EC8A 1DQJB 4IOSD 5DYOB 5GJSL 5IZ7A 5GGTH 4OZIA 5FGSA 4ZW7A 4XO8A 5CLZA 4MAUL 1UWXK 1MFVA 1MY7A 2ZKHH 3PL6C 3HAEB 3LMJL 1NC4A 2EDFA 3HC2A 1T3FB 1YEKL 4U1HA 2DIEA 2XZQL 4GNKB 5D1QE 3UBXG 4AZUA 5I2IB 1EA9C 2ADIA 3VXMB 3K80A 2YD0A 2IG2H 4XZ4A 2AABH 4KGLA 2XZZA 5FM4A 2LVCA 4PWIA 4NZRH 4MKMA 1YEHL 3D50A 3TZVB 1PFOA 3ZKXC 3TEZA 5JO5B 1TU2B 1GYAA 3LQZB 3RL2A 4F80A 2XLLA 1C1EH 1W80A 2P46B 3GXDA 2GFBB 4FFWD 4XRCA 4CILA 1TZIA 4KJYA 4N0FA 1BMWA 3D30A 2FR4B 1QSED 3AWFA 4ZFOA 2OK0H 5E23A 4LIQL 3GXIA 2Q7YB 3GIVA 4LHJB 5E2TL 2WBXA 3JWNE 3A4FA 3LN4B 4PRPB 2VJXA 4NQCE 3BKJH 3O6LL 1XGUB 2D7TH 4WW2C 3E6FB 1FFRA 2WMPA 3MJ8A 4IHOB 2AJXL 4GRLD 1G6RL 4I0PA 4AMKL 1E65A 2WSKA 5TH2A 1F0LA 4LRNH 3VGEA 4I3SL 5HGDA 3P3SA 1WRFA 3DIDA 4HOWA 3D3VE 3UIZA 4E5XG 3ULUL 4HVBA 4OGAD 4L8BA 1IM9D 4B9PA 4BFGA 1EVUA 4QY8A 1UCBH 4JVUA 5C2BH 3FU7B 2LE9A 3L6FA 4DJMA 2X4PB 2ZOKA 2XBZA 4WI3A 1TITA 3MV8E 3VFRA 3QUYC 4HKBA 3L17A 4QYOA 5T5NF 4LCYA 3E8VA 3VWJC 4QXTB 3NGBC 1EGJL 2APWA 3DRQB 1OTUC 1ZXQA 2FX8H 3F04A 2ZX9A 4HXBH 2UXVA 4IEFB 3VWKA 4HHAA 3OKMB 4MBRA 3DO7B 1T5WB 3B4NA 4TNVF 4EO5A 1AE6L 1A9VA 5C92A 5D2LE 1XXFC 4Q4EA 3RRQA 2QKSA 2BSSB 5DK0B 5B1JA 1SY6H 1WTLA 3ZE0B 3ZYOA 3JTBA 4WHTB 3R0NA 4GSQA 4JRYE 2A4CA 5H94B 3S37X 5KYYB 3RWGB 3MOBL 2WWKT 3ZDZE 1INDL 2VZTA 2OAAA 2BOCB 3O4LB 2V3DA 5E6ZA 5IB5A 1A4AA 4ZUSB 1MJJB 5LBSH 5JXAL 5BZDA 1SXZA 5EDXA 3V0IA 5JQHC 5DFTA 1F58H 2ED6A 2VRAA 3OZ9H 4KO6A 6TAAA 1W16A 2FWOA 5DO2C 4Q8BA 4ISVA 1FUNA 2P26A 3VE0B 2FVNA 3P02A 4F5CE 1EHKB 5A1AA 1JIBA 3RVUD 5JPNB 1IJ9A 3QRGH 3FQNA 2NX5E 4NRZA 2E0PA 4XO4A 5DFWH 1WFTA 3PGDB 3OG6B 2ZAGA 1ITBB 1KJ2L 4PP2B 5K39A 4KJWD 1A1OA 4PREA 1FL6A 1ZLSL 3Q8AA 4B5EA 1UKTA 2ESVE 4GRWH 4W4NA 3KW7A 5D71H 4K5PA 4Y1AB 5E4AA 3M46A 3BQVA 5IEKB 2N3JA 5KSAD 1Z3GL 5SX5K 4UOQA 4HJIA 5I1GH 2HFEB 1A6AB 4NUQA 3K4AA 1BIIA 3ZDXB 4MAYC 1Y18A 3G6DH 3SYQA 5DQ9B 5B7FA 1ADQL 3VQ2C 1CU4L 5LUMA 1TT6A 3BT2H 3NZ8B 2X09A 4WO4C 3TFBA 3FRPG 5F1NB 2H1LM 3SSGA 1EAPB 3CVHA 3DIFB 1HCVA 5B3JF 4BDVB 4UDTB 4WWKA 2H9GB 5IHUL 1TXKA 3MTXA 3MV7B 5D93C 2AK4D 1HINH 5IT2H 2AC0A 5IVXB 4AI7A 4FULA 1CDJA 4XNXH 2YRBA 3QJXA 3HZ3A 3I84A 4KKBD 4XP4L 1FO0A 4GSDH 2AF2A 4R2GB 2FIKB 1FP5A 2ZUWA 4XMVA 5J13C 2EDTA 4LO9A 5D8JL 3TOPA 3W39B 4S1SH 3FTGB 1MNUH 2VLMD 4HAFA 1IC4H 2GBUA 1MQKL 3MRIB 4YHNA 4ODWB 4R97C 1ZLDA 5D7LD 3VI4F 3KPSD 1P5UB 4WK2B 5DJ2B 3SOBL 3DBSA 4G3YL 4L2LA 3QP3A 4L8DA 5K69A 3BPNC 3ARRA 3NFNB 3T0WA 4FDWA 3ES6B 5DR5H 2FNBA 5E9NA 1WZMA 2WWNA 4OLXL 3FONB 1NTDA 1UQSB 2VLLB 2VT0A 2A74C 4GW5B 3EJYD 3BP6A 3V2AR 1A7OL 1I85C 5ACMA 4K23H 5HYEA 1OK0A 3BN9D 4P06A 1UC6A 1HU8A 2DL9A 3SOTA 5C0IA 1E2WA 4BWUA 3ESNA 3MRHA 3GRWL 4K3DH 1I1YA 4PN6A 5D9SA 3OPZL 1Z7JA 4BXVA 4JFED 1GGCH 2ITDA 3O4OC 1T0PB 3DK0A 4GAGL 3HRZA 5AYUL 1H6EA 3ZQWA 2YR3A 4GKZA 2W81C 2CDFA 3BIBX 3GTTA 3O0LA 2WC7A 5EB9A 5D1ZA 3ZPDA 3JUZA 3U7AA 5IP4A 1S7RB 3II1A 3AS2A 1T6VN 2A9CA 2UWEB 3T71A 3DMMD 5KJRL 3QISA 3ECQA 3F7VA 2Y22A 1E0OB 4F33A 3N42B 4J6RL 2OXHA 2MMXA 3PGCB 1QNZH 4N8VA 2CLZA 4YSDA 5C7XL 3QG6B 1YMMB 5C07B 1W6WA 4JN1L 2X9WA 3QWNA 4BGLA 4LDCA 5E8PB 3KLKA 2WN3A 2BIQA 2UZIH 2I07A 4NPKA 3GXTA 3N50A 4M9OA 2F8VA 4XNMA 3OXSB 2XQ0A 4AVIA 1B4JL 3B7RL 4OZFB 4JO1L 1XBDA 4GI8A 1AXSB 3GINA 3ZTDC 1SJEA 5CZRA 5E1AA 4H8WH 1YEGL 4PJBF 4AK1A 4NLAA 1UUSA 4BRVA 3P2BA 4D7BA 1E8ZA 1JPSL 1NCWH 4MJID 3KJ6H 4JPSA 3QXAA 1CGXA 5KSUB 1NPJA 5J8OA 3BWZA 4NQDE 3AY4C 1FG2A 5MEPB 4BCYA 5ITBL 4PG9B 4JZJA 5E99L 3LB6C 3GSOA 2BP8A 1NFDB 4F7MA 1TJHL 1PY9A 3I6SA 4UU9A 2EEFA 3GMMB 1PLCA 3B56A 4PJGA 1U3HD 3OR7B 3IXAB 3SYAA 2W80C 3MRNB 1HILB 4P59H 5AL0A 2W5PA 4MKTA 1MF2L 2BXZA 4YK4C 5EBLB 1D5BA 3N04A 4JDVB 3QQ4B 1E90A 3MUJA 1WZ1H 5K9OB 2OMNA 4IRSC 2Q8AL 2HKFL 4XCEA 4ZTPH 3IBEA 3WMQA 5GRJH 5HHXH 1BFTA 2G3MA 3TJPA 2AQ2A 2NOYA 2Q76B 3ARDB 1XR9B 4YHLL 1RJZA 1UD2A 2UYLA 1KGYE 4K73A 2DKMA 4MJ6B 5HI3C 5BZZA 4U1KA 5K59E 4HCRA 4G2AA 2PKDA 4KNUA 4M1GL 1FNGA 1KLGA 3B7SA 4ZXBC 1OWRM 3PGFH 2RBLA 1YPZF 2WUBH 5HHVH 2GI7A 4PEEA 1W8NA 4NN5C 4ZYKA 4R7XA 5I8OH 2DMKA 2PW2A 4OT1H 1DBML 2Y69B 3C08L 5DZLA 5LAXA 4MZIA 4N1EA 5ECJE 3LNDA 4LLUA 3ZZQA 4ZFOL 4YSRA 3QPXH 5F88B 4Y2LA 2YD1A 5CCGE 3B2VH 1S5IH 3FT3A 4X4MA 1R3JB 2JK5A 3QJSB 2NLJB 2EXYD 2XOTA 1C16B 4RWHA 3V5DA 3KDMA 2ENSA 5B8CB 3SE9H 1BPLB 5FA3A 1MHEB 3UTSD 3EYUL 4HV8A 2VDRL 3IFOB 4X5XB 1IL1A 1XSKA 5F3HA 1KMGA 1IAIM 5F9JA 3H9SB 4DGIH 1CWVA 4HIIB 1KTRL 3VWJD 4Z3FA 1VIWA 1AMYA 3EYVA 5TF0A 1RLBA 2JVUA 2YLHA 3C2SA 4QXUH 5B1AB 3V6ZB 5IFHH 5IF0B 3RY6C 5IB1B 3VD2A 4HEMA 3QWOA 2G60L 4DKEH 2ERJB 1MLCA 3V55A 1SJVA 5C09A 3CFQA 4AVJA 2BY2A 3HC3H 4NZTL 1L7IH 1HWWA 3WHE1 4UQ2A 3MJGX 4WUUD 2WINA 2WTRA 1ZHNA 4XPFL 5ANHA 1BG9A 3DTUB 3P77B 4NRYA 4AQOA 2HKHL 1A3LL 2H8PB 1IC1A 3KXFA 5E0QA 4PJ8B 3GI8H 1WS7A 2YN5A 4R96A 3I9GL 2Y7QA 4PJFB 1X5MA 5DGQA 4ELMB 4FQIL 3NRPA 4LQ1A 4UB0L 4GS7C 1JWUB 1VEMA 1WYJA 1WZAA 5DUML 3T2QA 3ECBA 4X99B 2LU4A 3BKYL 4G7RB 4W4OC 1JNNL 1TEGA 4U0RC 2VAJA 1RMFH 3FW6A 5BVPH 1G7HB 4LSUH 3EJSA 1NMBL 1TQCB 5K9KB 2MTPA 1ACZA 4LZKA 1IFRA 1EAJA 2N59A 4JFTA 1O7DC 4ZOBA 1T1ZB 1Q0YH 3CFNA 2A1WH 4LDEB 1DQQB 3LNEA 3QZWG 1G1CA 2EIDA 4AJVA 1FNAA 1AC0A 4B3EA 5GSVB 5EU7E 1KBPA 1DVYA 1XGPA 2K1MA 2J5WA 3WEBA 3ZE2E 3BZ5A 2QHLA 3H4HA 5DLMH 3SY0B 2RFXB 2QGCA 1KCRL 2ILLA 3FQRA 3V95A 3TX4A 4BA8A 2VKXA 3CTTA 5B1KA 4G72B 1HQRA 4F24A 1UUNA 2VDKB 3RB7A 4MX7B 4LOUC 5D2LB 5C08A 3WIFA 1MKFA 1LYQA 3H2WA 2CHDA 1AQHA 4HWZB 5HDRA 1MFAL 1I1AA 1XL4A 3NEEA 4GBXA 4W9ZA 4HIEA 4PJ5E 1LK2B 4L0PB 4AVHA 5JHAA 3NIDB 1FFPB 3QZMA 4GRMA 3UBFA 3MJ9A 3M1BA 1CF8L 1XF3B 1QI3A 3UTTB 1NCOA 1MHHA 2LVEA 4WCYH 3EH2A 1YEJH 3CIQA 1V54B 2NZ9C 2YUVA 3NRFA 3AROA 2MCPH 4LKXB 4QXWA 1HZHH 4BH8A 2NY6C 3B34A 5KYXB 5DJDB 4GQ9H 4FCAA 4Y89A 4UAOB 2NYZA 4NHCH 1KGCE 1T1WA 4N6RA 2BC4A 3MGOA 5IHHA 3VI3F 2QPSA 1NFIA 4L4VD 1ZV5A 5E2VH 1XD0A 3BMWA 1TZHA 2V5TA 3CDYA 1AXTH 3LRLA 3L9RA 5GJTL 5DZOA 5ENWA 3ALPA 3CVHL 4MMXB 5AENA 1OAJA 3FT4A 3GJFK 3NAAL 4PBXA 1I8MB 3O6FC 4HLEA 1A6UL 4G9DA 1FO0L 1SOKA 1QRKA 1N0XH 2ZUVA 3FBKA 3P2DA 2VW7A 4IRZH 3EJQA 1W15A 4A6YH 4ESKA 2L4OA 4ANKA 4PB9H 3V6OC 1OY3B 2X4TA 3F7PC 2B59A 1KTCA 3D69A 4M7KL 4PWKA 4TSAL 4XMZA 4LPVA 3DPBB 2NY1C 1E4HA 3FC8A 1QSEE 4RMWA 2ZJSH 2J1WA 4JFPA 1J8HB 3JWDC 5F7MC 4NUGL 3HE7C 4R4NC 2O5NA 2YGPA 2EINB 3Q7JA 4TNVK 4JRXA 3MJ9H 3DJRA 4WWPA 5E4OA 5FWRA 4PLOB 3SDAC 1B0GB 3SJVD 4PJHE 2FX9L 2DQMA 1JGEB 3TNMA 4GSRA 3KW8A 3S5ZA 5IHLB 4ZSOB 4BWTA 1A4BA 2BNUB 4KOCA 1KB9J 1UFGA 3MOAH 4QOKD 4ZUWA 3MRPA 3VFUB 4AYSA 2J6EA 3RWFA 3MUGB 3HBGA 2O6CA 3MYZA 2A6DA 4YPGA 1U4FA 1RK0A 1KCUH 4RRPG 3GK8H 3NIFE 5D7JC 3I74A 4G1EB 5F1IB 4UTAA 4U6HB 1JZGA 3OC5A 1OTTC 1N67A 3GRGA 3QBTB 2KQMA 3DV6B 5B21A 2FGZA 3BIAX 5JYMA 3DETC 5DJAA 3DX1A 4DGYH 4DP7X 3NDZE 4I1NB 4N0CC 4EOWH 4Q0XL 2AVGA 4Q9BA 4Y19A 2CWRA 3LRSA 3FHAA 3Q9QA 3ABGA 3MV01 2A6JB 5MENE 5MEQA 2YWYA 2CCWA 1YLBB 3T0BA 6FABL 5KVGH 1E30A 5BRZD 4FABH 1NBZA 3GLAA 3S35H 2ZKWA 3RU8L 4Y2DA 3HS9A 3IN0A 4YQXL 2HG5B 4C4KO 4LCIL 3TCLB 1DHKA 3KNBB 3VXSE 3JT0A 4NWUH 1M6UA 4X6CF 5IHZB 3LS5H 3VNYA 1MAMH 3FB8B 4JLRB 1MEXH 3G3LA 2OI9B 4HMCA 3CQFA 2IQAB 5LBGA 1E9QB 5EZIL 1N26A 1DN2A 2MOGA 2DI9A 3F58L 5D1XA 1ZHLA 2DQHH 2HRPL 4X6DB 3HE6A 3QB7C 4L29B 4KV5E 2CIIA 2R23A 2VQUA 2XKNA 3R19A 1B9ZA 5DGRA 2CRYA 1NGWA 4RCAA 5T1DH 3TPUA 3PWPB 5E08H 3KAAA 3C5ZA 2AI0L 4UUJB 1KNOA 1BBJA 2IDCA 3GNMH 5C7ZA 4PJCA 4PUBL 4M6NH 4MDIA 3T3PF 1AQKH 2K70A 3CMGA 1L0PA 1Z9LA 1H8OA 1RUAH 4JY5H 3SE6A 3G5WA 3GS7A 4FF9A 3BPCB 4M4RA 2YA0A 2AQNA 3VD0A 5J6SA 2MTAA 5FDWA 2WGXA 2J8UB 4BUQA 2LTQB 3O9WB 4UV7L 4L8CB 4GO8A 3RVTC 2WIIA 1G6VK 1LP9F 4J3SA 3L81A 5KVEE 1FAIL 1R34A 3X14A 2WNKA 3IDXH 4IOIA 3QS2A 3EO9H 1XH2A 1S7TA 4F37K 1QTSA 3FO9B 1IBYA 4JFDE 2OMXA 5CJ5A 3LZNA 4DVRL 4DK5A 5I1LA 4HCRL 2DJMA 3L3JB 4ZODA 1C8QA 4QRAA 5BO1H 1PSKH 4BA0A 4N8VG 4XP5H 2OMYA 1BVKB 3UZEA 1T6BX 4H44C 2ARJA 3CCHA 4BFIB 3CX2A 4I89A 4UQDA 2PF6A 2OL3A 3BZ4A 3DURA 2Y06L 2Y36H 5D7IB 2AK4E 4XVOA 1BFOB 2G2NA 2ZUYA 2C9SA 3U79A 4PJ7F 4MNGE 1E5UI 3QIBD 4EZMA 4OCMC 5C86A 5FYJH 3P3RA 1AGCA 3HPLB 5L9DL 1QZNA 1D9KA 4NZFA 3PJLA 2GEEA 5E00B 5JW4N 1TQTA 4KPHL 3OZLA 2FQGA 3FTWA 1ZTXL 4JFWA 5D7LE 5KW9L 4EDXB 1FVEB 1TVBB 1IGTB 2IIJA 3S8WA 2C9PA 1T22A 3BZFA 1YQ2A 4K5OA 3C6LC 4QIRA 1K2DA 4HFUL 3N41F 1C08B 3MRKB 1K6QL 4ONGL 2ENQA 3TFKD 3PJNA 3HI6H 1BZ9B 1CFMA 3HS0A 1GJUA 4OTXL 4ETYA 1VADA 1KZQA 3R4DA 2XETA 1NC2B 1FZMA 3QC6X 1JVOA 3OX8A 1PD6A 1N6UA 1PZCA 4B9CA 3THML 1V27A 2HLFC 3DARA 43CAB 1VJSA 1D5MA 5F0LB 3I6GA 1ZJBA 4XZUA 2GYSA 2G4GA 4PRBB 1KYAA 4NKOB 3EBIA 4XX5A 4OI7A 5BQ7B 7TAAA 2FJFB 1R46A 2QSCL 3IU4L 4W68A 1W91A 1L7TL 3AMKA 4HH8A 1PG7X 4NM8H 3MUY1 4LSVL 4YZWA 4FMFA 3K6NA 3O6MH 1PBYA 1FYTB 3C60C 1FVCB 3SZ6A 1IM3A 5JXED 4NNYB 1JF5A 3CE1A 5E9DB 3QYNA 3FCTB 5IOPB 2XCMC 4P05A 4H88L 4MB4A 3DTXA 4LOUD 1BVLB 3JT2A 5AW2B 3DJTA 4NQXB 4PJ6A 1NL0H 4CMHB 5I0VA 3EZJB 4APQA 2H2PD 1NCHA 2FTAA 3X13A 3ISYA 3UC0H 5B7MA 1BD2B 5CD5C 2OULB 1NUFA 4QLRA 5E1IA 4X98A 2E47A 4MVBC 4JFZH 4ZX3A 2NZ9D 3Q8FA 4WTZG 2CKBA 3KBPA 2NY6D 2JE8A 5FYLD 2BNQD 5EZLB 1DN0B 3QCVL 1BREA 4HLJA 5F7WC 4H26B 1I7UB 1EO8L 1IC5L 1U58B 1WCBB 4ZX5A 4JHWH 4CNIA 1F1AA 1E8WA 4AKOA 3ME0B 2ZOLA 1IILE 3NABH 5DJ6A 1X5AA 3DX6A 4A7GA 3FSOA 2GUOA 5JW4M 2NY4C 2O61A 3MN8A 1FQ9C 2JELL 3PREA 2B39A 5SWSE 3U6XA 3ZHKA 2B5IB 3L3GB 3BZEA 1KIRB 1FSKB 4OZGF 3O6FD 2YMXH 4YXKH 7FABH 4XBMA 5ETUA 2DDQL 4KH9A 1CTMA 4X4YB 2DZEA 2JJSA 1CL7I 2Q8BL 4F92B 1H3GA 2VISB 4F57L 5I1CL 5E6IB 3OHXB 3HW7A 4MNHA 4JFFB 1AZRA 4YE4H 3B6SB 4YHML 1EDYA 1P84K 3BE1L 4D3CH 3FO2B 4P2QA 5CM1A 5I6KA 1CQYA 1KTLA 3HE7D 3LKOA 3UPRA 4HJJH 5EHFA 1OAZL 1DEEA 1MCKA 1OPOA 4RGND 1DLHB 4GUPB 4D0BA 2DIBA 3R06A 1IBFA 2EH7L 4L8SC 1Y6NR 4H1LA 1B6UA 4JY6B 4HIXL 1Y0LA 2BSCA 5JZ7D 3WJJA 1O6SA 4AENB 4ABVA 1LE9B 3FQUB 4XC1L 3SE8H 3VXNB 3IU3B 4PRIA 4JN2B 1B2WL 1G9NC 1HDMA 1QSFA 1UB5B 1WT5C 4Z0BL 3OMNB 4D9LL 1PZ5B 3H4FA 3HG0A 3MRGB 5HJ3A 3MNWB 1HKFA 4L37A 4K8RH 2VR3A 5D7JD 2ZE0A 3ARFC 4JFYB 1N9PA 1YUHB 3NESA 5FW8A 3UTSE 4WI8A 4H25A 2DWSA 1GL4B 3V0VA 3TCXA 2VQ4A 2J6EL 3QIUA 3ROLB 4Z7OE 1AGFA 1KIQA 2ZCHH 4OIFA 5BXFA 4KKNA 3VD4A 3EJTA 1X5HA 1K5NA 2BNRA 1WP6A 5CINL 5KBLA 4X80L 5KBMA 4QHLA 1E4KA 2EDKA 2QR0A 2F9BT 4NENA 4UTAL 5DTFB 3QO0A 1N19A 2B4CC 4LEEA 3WO4B 2XZCH 4OLZH 1HCYA 4PP1C 3AUVA 1UJ3A 4R90L 3O8XC 1Q94B 4DH2A 3W9EB 2OTUB 3SD2A 4WUUE 3SCMC 4X6EA 3DHUA 4PJHB 2EE2A 5D4HA 3W11D 2F61A 2AXJA 3A6CH 2EXWC 4JANB 4NM4L 2W9DH 5A2AA 3H2QA 4C47A 5KTEL 1BJ1H 1IBBA 2XTJD 4YDIH 3V6FB 5GS0C 3EF7A 1BEYL 1N8OE 2G3NA 1JE6A 2WGNB 1IEBA 2WTPA 2AITA 4DUWA 5BOZG 5JMOC 3MNVB 5CP3A 1HHKB 1TTGA 2H5UA 2CCVA 3T1FB 2D7OA 4WTQA 3KPMB 3GTVA 2GC4C 4N2IA 2X6MA 5JHLA 1DE4B 4M6OH 5CJQL 4BZ1A 5DJZB 4YR6A 4LHUA 5DK2A 1NCBL 2XTLA 1OP3K 2OA9A 4W9HC 5AZ2H 5I5JA 4GAJL 1KTDA 4JG5A 1PL3A 4POYA 4Z7IA 5DC9B 1CE6A 1NEZA 1RZJL 4OFQA 4ZOCA 4M1DL 2WQXA 4MZ3A 4AG4H 4H8UA 3IMUA 3O3EB 4ZDHA 1ZS8A 4G7YH 3WFHB 1U8NB 3NSFA 3ZJAA 1OAQL 1DQLH 4LAQH 1RV6X 1CZ8L 1SVZA 4FYTA 4S1RL 1XQ4A 3MNZB 2PO6A 5BJTB 2ATAA 1PQZB 2R4SL 2AANA 1M56B 1S7UA 3IJEB 2YO3A 5EO1A 4AEHH 2W0PA 1DVUA 3P1VA 3CUPA 4D0DB 3KPPB 2NSQA 2VDLH 2Y1VA 5SWQA 4CC4C 4OQTL 5B4MC 3K2IA 1RD6A 2C1OB 4FXKA 5EZJB 2XBTA 3ZMEA 5GIRA 4HIJB 1Q0XH 2Y5TA 1GR7A 1SYSA 2X10A