1ZKAA

Nf-kb relb forms an intertwined homodimer, y300s mutant
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
110
structure length
110
Chain Sequence
LVPRGSHMNTSELRICRINKESGPCTGGEELSLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NF-kappaB RelB forms an intertwined homodimer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription factor RelB
total genus 2
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zkaA00
4NRXA 5D7JC 3OKDA 3BKJL 2B0SL 4YHZH 3K8MA 3VXSD 1DEEB 1A9BA 3R0NA 4YX2L 5TDOA 1ZANL 2YD3A 1OAKL 3BH9B 2D03L 4QWWD 5KOMC 4BM7A 5E00B 1U8JA 1QHPA 5K33A 4Y5YB 5E8OB 4JN1H 1MHHA 5KS9F 2ICWI 4FQQA 4EI5A 4ZUVB 4DW2L 4U1JA 3SDCB 3CSYB 4LPYA 2B4CL 4L8CB 2OJZL 2ORBH 3FTGA 3HZYA 3B2VL 4NO2A 1LP9E 3LEXA 5E56A 5JXED 2H45A 3S35L 1MCOL 4GBXD 3MV7D 3OR7A 1JUFB 4YUEL 2WBJC 4ZAKD 2MCPH 4OCNC 5JDSB 5HXMA 1TZIB 1P4LB 4XPFH 4XC1L 4LCWB 4P5KB 3PWVA 5ICYA 2IPUK 1N7ML 5TF0A 1OAZH 3VRIB 4PJIF 3MRMB 4WFFE 1U6AL 4KC3B 5D2NA 1ACZA 2HRPL 4EI5C 5DK2A 1F6AA 3KPOB 5CBEA 3V4VL 1CDYA 1C1EL 3MRGA 1U3YA 2EDQA 1XMWA 3MR9A 1AFVL 2Y07H 5GJTH 3LN9A 4FQLH 1AGEA 3AMKA 5LJYH 1A8JH 4YDLB 3GSOA 4RGNE 1NBYA 2VLLB 1TJHL 2P8LA 1N3NB 4WTZG 5DRXA 3RPIB 2P7TA 2VRAA 4G8GD 4FXKB 4JO3H 4LSVL 3ECBA 2HFEA 4PY7B 1IEAA 3HR6A 4P99A 3QHZH 5DHVA 4FQXB 3MROA 4BZ2L 4RX4D 3D85A 1XR9B 1ZHKB 5DHYB 1T3FB 4G5ZL 4L4TE 3IDXL 1MAMH 5D5MA 2AI0H 3RHWF 4K9EH 3M8OH 2WP3O 1FL6B 3DXAB 4KKLC 4C83A 3T0DA 4NO5A 2FDBP 2XY2A 4K9EC 1FPTL 3PV7A 2HTLC 2NLJB 5AD0B 4WW2C 4ZFZA 2F8VA 3BI9X 3U7YL 4WTWA 4PGJA 4M7KH 1P1ZA 3OAYK 4GXUN 2YSSB 4P3CH 3BPNC 3DROA 4O2EB 5SWSB 1NBZA 5CJOL 5I16A 3PGDB 2QSCH 5I75C 2X4TB 3V5DA 1PG7L 1BVLA 2C1OA 5D1ZD 2EH7L 1Z3GL 4PJFA 1HEZB 1FYTE 5FO9A 3NABH 2H1PH 1SVZA 5IFAH 1NUNB 1AH1A 1D6EB 1UKSA 1Z0MA 3K2MC 3V5DB 3ZKMC 2YZ1A 1KLGB 1FO0A 5EZOL 1M7DB 3INUL 3QWOA 5E1AB 5HHVL 5AUMB 4PS4L 2V5RA 1N64H 5F9WB 2BSTB 1FVCA 3TJHD 1K4CB 3CDGA 4D0BA 1MJ8L 1IILE 4S2SB 4GMTH 3CLFL 2FNBA 2P5WD 1F4XH 1UC6A 4CAGA 4G9FB 4CNIA 4UQ2B 3TM6A 4Z0BH 1FVCB 1YNKL 4XNQB 5HVGB 2R1WB 4LARL 3BAEH 5FDWA 5T3XD 2A9NL 2W1NA 4PRAA 5D7IA 4NJ9L 1CDGA 3MV9A 2E6PA 4KJWC 3PQYD 3QIUD 1E6OH 5J13B 4UQ2A 5FYKL 5KSBF 3G6AA 1T22A 1ZWIA 1CD8A 2VYRE 4GMTL 1ZHBB 1T5WA 2Q76B 3LRGA 3WL9A 1QFHA 3HRZA 4WHDA 4UMGA 2D2OA 5IEHB 3MRJB 2D0GA 1MFEL 4DVBB 2XKNB 5TDPA 2P4AB 4HF5H 1MI5D 5JLZB 3SQOH 4U1HA 3VE0A 3LH2H 1QEWB 2WBJB 3WSQL 4PRPB 1MHPH 5C92A 1VACB 4YGVA 4HKJB 4K8RL 4OFKA 4QO1A 4YFLF 4DKAA 1MJ8H 4JJ5A 4BH7A 1V3KA 5M7QA 4OZIB 4UAOB 3C60C 3STLA 3IU4L 1BZ7B 3QIWD 3KYOA 1NLDH 2VAJA 2RQ8A 5C0BD 1HSBB 3GIVA 4M7KL 1CDBA 3MJ9L 2J88H 3DXAA 4C83B 4XNXH 1FSKB 1TQBC 4NSKB 3DSFH 5IT2L 1P4IH 3O9WA 3QPQC 5DR5H 1UJTA 4C59B 1K8DB 1ZT1A 3QEGL 5DJ6B 2HWZH 3VI3E 3O9WD 1HSBA 5F3BA 4PFEA 4EKXA 2EIDA 4OGXH 5KVEL 1RZGB 1B2WL 2WINB 3UC0H 1XCTA 1DVFC 1FG2A 2JK5A 3RGVD 3T1FA 4HX1A 1WC7B 2V9TA 5CJ8A 5M94B 3VXUA 3QXDA 5FYJH 3P77A 5KVDH 2J88L 2X89D 3QI9D 2CRIA 2EE2A 1J0YA 3O8XC 3RDTB 2CH8A 2P43B 3T0WA 4U1GC 3RJDA 4L9DA 4MJ5A 4W4NA 5JMOC 3VG9C 3QXAA 3SQOL 4ZUWB 1AD9B 4GKOA 1T0MA 3QISA 3HAEG 3EFFB 5CLTA 3SDAA 3BKMH 5KSVB 5FK9B 2P44B 1OGAB 3DMMC 1LK3H 4H25B 4X9HA 1N6VA 5ALBH 2ZSWB 3KPNB 2O5ZL 3OBAA 2Q3AA 3W9DB 1K8IB 5FHBL 3FFCA 3ARBB 1ITBB 3RVXD 3S3PA 4PJXF 1ED3B 3AAZA 3ZE0E 4YDLC 3WDIA 4F9LC 4UU9B 4OQ1A 2J3SA 3CU1A 2ZOKB 2P5EB 4JREB 2OJEB 2F8XC 2XA8H 3QZWG 3WUZA 4XCFL 5DJAB 4ZS7L 4QRPD 4CMMA 1KJ2B 1ZGLA 1MHPL 2X1PA 3CFBB 4J3TA 3UP1A 1UH4A 3L9RA 1PSKL 1VFUA 5DQJB 5HBBA 5EU3A 1II4E 3G6AB 3BUYA 4TPRL 5F1SA 4OD3H 3AREB 5E99H 2NXYD 1X5XA 9CGTA 3MV7E 5CHNA 4YXLH 3QJHB 1BFOA 3HE7B 4OKVA 1EUUA 2DB8A 3ILPB 5IEHA 2AJUH 4MNQE 2ZKHL 3EOTH 3PDOA 4LCUA 1JGUH 3M1BB 5DFVC 3Q48A 3O4OB 2AJYL 3DUHA 2LU7A 3LRSB 1FBIL 4LASH 1C7SA 4WVRA 5F44A 2EZ0D 4OQTA 4KI1A 4S1RL 4G9FE 4TVPD 5JW4Q 3B9VA 4IIQB 1AD0B 3QCUH 4P4RA 2A9ML 3UJJL 5D1XC 2VQ1A 2YEZA 2A77L 2B4CC 4ONOA 4OZIA 5J1TC 2BNQE 2HVKA 4X4ME 4ETYA 3SJVD 4GJTB 3DBXA 5KSAB 1RFDH 2FJFA 2NW3B 4IDJL 3NIDF 1C5CL 4O2CA 3S6CA 4YBLB 3TN0B 4PRDA 3SCMB 4F7PA 5J6GB 3NZHH 1SHMA 1TITA 1Y6NR 1K8DA 1ZT1B 2IMMA 3IXTB 5DJ6A 3RRQA 2XN9D 3GMPB 2JELH 4KROD 4TVSa 3VMPA 1I9EA 3LS5L 3LHPH 3FO2A 3LEYH 5IIEB 3U9UB 3E2HC 4FG6C 1JZ2A 5EU5A 3Q5TA 1JZ6A 1HXMA 4Y2DC 1T03L 4ZPVB 3SDCA 4Z7WB 2WIIB 4MSWB 1YPZF 1N7MH 3O41A 4NBZB 3LEVL 3CGTA 3SEPA 5IBUB 2A6KB 3HLAA 4S1QH 1MPAL 3RY4A 4PJIB 4FTVE 3T77A 4OF7A 4PJGE 2WMPA 1NFKA 4XXDB 3T0XA 5SWSD 3MRQA 4OZFB 1QSFB 3TPUA 3BQUB 1S5IL 4I18B 4WEBL 1P5VA 4KH2A 3UYRL 5GSRB 2V5SA 3BWAA 3KYNB 3L3DB 4LVNC 1IMHC 3RDTC 2ZUYA 3TBVB 1HINL 5FO8B 3NCYP 4KV5F 4Q9CA 4PJHB 3EGSA 4GKSA 4ORGA 4BYHA 1MIEH 1BZQK 3HFMH 5C0GA 5E2UH 1RI8A 4KV5E 3OKLB 1A3RH 5ANME 4LLQA 4LLUA 3TBVA 1OAXH 2HAZA 5DQJA 4MDIB 1NUDA 3W0WE 4LHUG 4L1HA 4GS7C 2ZSVA 4PJCF 1N5YH 4PV9A 3GI9L 1I9IL 2C1PA 3U9PH 4M48L 1U95B 5A2JH 1UFUA 3RIFF 3ROLA 2BHUA 1NCWL 1YC8A 2FIKB 1Q0YL 1QSEE 3WD5L 3DGGA 3OXRA 3EYVA 1TQBB 3MLXH 4YPJA 3OAZH 1T2XA 2YK1L 3QSKB 3C87A 4PJGA 3CVHH 5F6HI 4HIIB 3SPVB 1AR1C 1P7KB 3W81A 3ZSSA 1A3RL 4WCYL 1ZTXL 1B90A 1FC2D 2LTQC 2D7PA 2CUHA 2R29L 3QUML 5D72L 5HHQB 5ID0A 1NEZG 3C6LD 3OJMB 4P9MH 2BY0A 3DRTB 2R1YB 3PIQB 3RWHB 4LLWB 3RVTC 3VWJD 5J7CC 5DVOA 4R4BB 3U36B 4XHJC 4KTEH 2R56L 1VEMA 4X4ZA 5JW3H 1J8HB 1J7VR 5HGBA 1T7WA 5ADOL 3H2WA 5GGTL 1BD2A 1F97A 4XBGA 3O2WH 2F58H 1BFSA 1KJ2H 1PD6A 5D8JH 1R5IB 3JTSA 4HXAL 5EO9A 3KPPB 2NY5L 2W91A 3UTQB 1L0QA 2UZYB 4PRHD 4S1DD 2Q7YA 4V1DE 4YHML 4EDXB 5ESAA 5L6YL 3HUJF 4UTBL 4BUGA 1GZPA 3UAJD 2OP4L 2FSEA 5HHVH 1S7TA 1QQDB 1EHAA 5IBTL 1ACYL 4XCCH 1JNHA 2D4FA 4HS8L 1NCWH 1KN2L 4IIQC 1FAKT 4KJWD 1NUFA 3C09C 5FV2A 1A21A 3BUTA 4RAVA 5A3ID 3BW9A 1NCUA 3JXAA 3MNZA 3ARFD 5CZKA 5C0DB 2NY4C 5JW5A 4ODSH 2I9LB 2HJKA 4DZ8B 5CEXB 3QCVL 4IRSB 1NBYB 3O4LE 3H0TA 1L9MA 1HH9A 3GMOB 1MCKA 3WO4C 5DRXB 1NAMA 3RPIA 4D9QD 4PJBF 4MDJA 4AT6A 4LSUL 1E4KA 2AQ2A 2Z92A 3H3BC 5E4EC 4PJBE 5CD3A 3QIWB 4NUJB 2ADGB 2NY7H 2OZ4A 2VDQL 3QFDB 4QF1B 2I26N 1RUQL 2I24N 3P4OA 4LRNH 3Q6GL 4X8XA 2FZ3B 5KTEL 5JUEL 1JNNH 3MLUL 3T65A 2GY5A 2GTZA 1U92B 2UWEE 1CFNA 2AV7A 3EYFA 3OGOE 3UBXA 4OZIF 4BFIB 4JFED 1G7JA 3B4NA 1NKRA 3IFOB 5D1XB 3U4AA 4PRPA 2R9HD 2DQUH 1N6QL 3KVQA 1LP9F 2HT2C 4Y1AA 5F88B 1KJMB 2V2WB 4AG4L 3GBNL 1AGFA 4H0GA 4O58L 1YECH 3BIKB 4Y5VC 4MVBD 5H37H 5IW6B 5D96B 3IJYA 3CXHK 1ZOXA 2BXZA 5LGJB 2C7UA 3SCMC 2ATPA 3H9YA 1RMFL 1NEUA 3AUVA 4JANA 5IHLB 1T21B 3IFNL 2AV1B 1KC5L 4U49A 1I8LC 2ZUXA 4XC1H 3MV9E 1EBAA 1MSPA 3RKPA 1NDMB 1JRHL 5DS8B 4TUOB 3LN4B 4Y2OA 3BQUD 2HT2D 4N1HB 4OZFG 3FB7B 3T2PA 4DGYL 4U2YA 1T21A 2AV1A 4K3DL 1MRDH 3OZ9L 4NHUA 2AJSL 4N0FA 2XZAH 4G6MH 4N9GA 1WC7A 4F7MB 1V8HA 1ZXQA 3LN4A 4RA3A 2X6MA 3TYFB 1NCAH 2C4XA 1KLUB 4ZUUA 1FNSH 3OKYA 1U58A 3FB6B 2IGFH 2R1XB 4Z7VE 1T6VN 2YUVA 4HCRH 4CW1B 4OKDA 4BZ2H 2Z93A 5FUZL 4WHTB 5BV7H 3MLYL 2VB5A 4ZSOB 3NBNA 2CQVA 2M8XA 1Q9WB 3QNYA 4HMDA 2HKHL 4LCCC 5DZOA 4RAUB 2VWEC 1MJUL 3VGDA 3BKJH 4G6KH 4U1LB 1HQRA 1YJDH 4ZFOA 1RK1A 4WUUD 4FQ2H 4HC1H 2BVOB 1YJDC 3BSZH 5TDNB 1UWXH 4JCMA 2GJZA 4YWGL 3ULUL 3H42L 4I0PA 2B1HL 5F8QC 2FRGP 5IHUH 2HTLD 4G8FA 3KDMA 2MFNA 2X09A 5IWLC 3HE6B 1H15B 2AERT 3SE9H 1J5OL 2WWKO 3QG6A 2DLHA 3EJZC 4U1HB 2WK2A 3LB6D 5C0JA 4JM2C 1IAKB 1NEZA 3JWDL 3L9RB 3X14A 4NQSA 4YBQD 3V9FA 1NUGA 2GHWB 1A22B 2X4QB 3QG6B 2Q86B 1MFDH 4JFOA 4HG4J 1T0NB 2NY2C 1TVHA 5JLZA 4PBVC 3IJHB 2D4DA 4PUBL 3UZVB 1CICA 3W9EB 3IT8D 3P4MA 4JFFE 4XBPB 1EAJA 2H2PD 3F62A 5KVMC 1CFBA 2XNAB 1M71A 4XH2B 4NO3A 2DKMA 4J8RA 2CDFA 4D9RE 4NDMA 1Q94B 1TVHB 4OZGE 3DYPA 4PJBA 4XC3L 4Z78A 4LASL 3UDWC 1HOCA 2ICWB 3O3AA 4P4KC 3GSWA 1I8MB 1HKLL 3OX8A 1FGVH 4NIKB 2ADJA 4MQTB 2ED7A 4NSKA 4NDMB 4X6BB 2NR6C 4NJAL 3OPZL 1GYAA 5DSCB 1G1YA 5IROA 1CXHA 5T1LA 2VLKE 4WFGD 3P0YH 3CVHB 4WW1B 5GGSA 5DA4A 2C3GA 5FB8A 3QH3B 4NCC2 4GW1B 4I0KA 5D7LA 3MRCA 1KELH 4PGBB 5KVGH 2AP2A 4K07A 1RZ8B 1XAUA 5KN5B 5BV7B 5I1IL 1JZ4A 2J5LC 4KUCF 4ONHB 1LP9A 1H3WM 3BWUC 1ZSDA 3HAEB 3U4EB 5E8NA 1IEHA 4R7DA 1C5DA 3TIDA 4JB9H 1UZ6F 1ZLUK 5CINL 3MX0A 4OLYL 1EZVX 4HKBA 4OLVH 2W59A 4N1EA 4JGMA 3NFSL 1NAMH 2HVJB 4A6YB 2P5EA 3MLZL 4XP9H 2X4SA 4RRPA 5C09E 4N0YL 3V0VA 3VFUB 5B3NA 2QQKL 4KZEH 1PZ5B 1W0VA 4ODUA 5JIIA 3OKLA 4XI5C 25C8H 1RULL 2CMRH 3TNNB 2MQCA 3K8LA 3MREB 3KPMA 4U1MA 3BT2H 3FT3A 4LAQL 4NWTL 3RVWC 1KXTB 3DGGB 3MOBL 3Q5OA 3MFFA 4M6OH 5GISH 4H25A 2VIRA 2EDLA 3T2NL 5C3LD 5GRZA 1CGYA 1U8OA 5DD1H 2A38A 1VEPA 2QQLL 5HY9B 5KS9B 2WNGA 1ZHNB 3AGVA 2BVQA 1KENH 3BGMB 3SKNA 3OB8A 2GFBA 2VIRB 4DJMA 4GUPB 2R23B 3RVVD 2X70B 4R4FH 4BKLA 2AEQH 5E2JA 4MD0B 1IEBA 4HUWA 1BQLL 4NO0A 2Q8BH 1RUML 1CTNA 5MEOA 2EYTA 1ZVSB 4NQUA 5D2LB 3RI5F 3L95B 3DJ9A 2C3XA 3WHE1 4F9LA 2DQHL 4JRXD 1FGVL 4M4RA 5GGTH 4PJ7E 3BPOB 1AC6A 1YMHB 4LU5H 2O5ZH 4DKFH 1NFIB 5EC2B 4RNRB 5JIHA 1F5WA 1HILA 4UV4L 4JM2B 3QUYA 1YEEH 3GIVB 5DEZA 4UTBH 3U2SA 4NKQB 5E6YA 5HYSB 4QRUA 1WIOA 5JW3L 4MXVE 1ACYH 4MZ3A 3HCVA 1JMXA 2EDTA 4MSWA 1S7QA 3TCLB 2XZQL 4GMSL 1RY7B 1MLCA 4XZUB 2EC9T 4GLRI 4NQDD 3U9UA 4S11A 5I1DA 4LCCB 3T0EC 4D0CB 5DURD 1T1WA 4P9ML 3ME0A 3LAFA 2R2BB 4XCEA 3BKCL 4XPFL 4P4KB 3OKNA 1XGPB 4KTEL 4OCWH 5IB4B 5T3XE 4PRDB 3E6FB 4XCCL 2AJXL 3X3GH 3CPLB 3FN3A 2ORBL 4LLYA 1G0XA 3IXTA 4KKBC 4XVTL 4ZPTB 2R4RH 3O3EB 5C0DA 2IWGA 1CFVL 1JK8B 3QUZC 3FFCD 5D7KE 4XAKD 2A6IB 3QUZD 4F33B 4HGKC 3GNMH 4JFFD 1LVEA 3DYOA 1PYWA 4KVCL 3RNQB 1F4HA 4KPHH 4K7PX 2FHFA 1MCCA 1O7VA 4OCWL 1A4JA 2EDWA 3I6LD 2VLKB 1QRND 3LN5A 3MJ7B 4R97B 1KIQA 4Y16A 4CU7A 4Q2ZA 2DI8A 3C60B 5L9DL 5TQ2H 1MPAH 1G9ML 1N6QH 3RZCC 4GAYB 3D18A 4GXVL 1WCBA 3JWOH 4OZFA 4KQ4H 1KIRB 1KIQB 4Y16B 5H35A 1IGFL 2MNUA 1X5AA 3TA3D 3ABZA 1T66C 4D0DB 2VO5A 1RZ7H 2GTZB 4XAKE 4U3HA 4Y4HB 1QYGL 5SWQB 4GAFB 3C5JA 1ORQA 4NT6A 4LQFH 3VD5A 2IPTL 1CD0A 3JV4B 5B3JF 2X9WA 2VZ1A 3QIBD 3BD3A 4L8SB 4XNUH 4Y1AB 3MZTA 4KKCC 3TCXA 3GJEA 5FGBA 4OI9A 1Y18A 2P24A 1KF9B 1A1OA 3O8XB 4PG2A 1UCBL 1CLYL 4O58H 2P8PB 3MLUH 3DHJA 3S88H 3MRFB 2YD8A 2DIJA 3K1KC 3VJ6B 4ELMF 2LV4A 3MRKB 5FM5O 3ARTA 3HI1A 4JO3L 1EMTL 2J5LB 4L4VD 1KPVB 4RNRA 4WHTA 4M1GH 1OP5K 2X4OB 2E7LA 2EKSA 5FFLA 4YNYA 5EZLB 2F5AL 3ROOA 1FIEA 3IDIA 5DJ2B 3WEXB 2OR7A 1OTTC 4ZUTA 3KGRA 1CGSL 3NIDE 2EDOA 3NCMA 5E24E 1GZPB 1PKQB 4NZUH 1S7QB 3N1GC 4YBQC 3RWFA 5KS9E 4BSVB 5K9OB 2I25N 1DVFD 2QEJA 2YD7A 2A77H 3VXUE 8CGTA 1FP5A 5FEBA 2GT9B 4K2UH 5I15L 4YHPB 4DEPC 1QG3A 4N9OB 3RVWD 5J1AA 4P3CL 1KB5H 5EBWA 1VPOH 4ZTPL 3S37H 1Q9WA 1KV3A 3QNYB 4L4VE 3CFDA 4LHUB 1CDCA 3WD5H 3L5WA 4X5WA 2VC2H 4HH8A 4X6CE 4EOWL 2BVYA 4QKXB 2HA1A 4RWHA 5D2NB 1BX2B 1HHGB 3OAUL 3IJHA 2CRZA 3G04B 1F4YH 1QQDA 5LAXB 1ZTXH 3MACL 5KZCD 5JDSA 3SY0B 1EO7A 2DL2A 5F70A 4HIXH 2WZPD 4BELD 1GIGL 2RCSH 2KZWA 3H9HB 1U8KA 2DWEA 2A0LD 2D7TL 4HUXB 4N8PA 3WFHB 3SJVA 5FXCH 4LNRA 1XF4A 1LGVA 4WO4D 1TTFA 4RA0C 2C26A 4P46A 3VFTB 5FGCB 3ESUF 1JTPA 3HC4H 1S5HA 1WF5A 5IG7B 5A3IC 3DRQA 3GZKA 5C3TA 1XGTA 4AY0A 4FXLA 2FEEI 4M8QA 4JKPH 1DUYB 5BRZB 4LSDA 2C7UB 1WZKA 2YHGA 5T5FL 1H5BB 4PGEB 1J1XH 3ARSA 5A40E 4Q0XH 2KQNA 1IC1A 3HG1D 3QO1A 4PJ5E 5HVWA 1OSZA 4R4NC 2FBOJ 3LS4H 5I19L 3JWDH 3EYSL 3TBYA 4M8QB 1YNTB 4JO4H 3DURB 3BD5A 3DVFA 4N0UE 5K59F 5C9JB 5AUMA 5BW7A 1A7BA 5GGRB 4YHOL 5IB3A 3SDXB 1AQKH 2FX8H 2UUDK 1VESA 3V52L 4X5LA 1C7TA 1A7OL 5KVDL 4J3UA 2CPCA 4OFIA 2IC2A 2FGWL 3MOAL 2XIDA 3NFPA 5D7LB 2NW2B 3SKOA 1D6EA 3IF1A 3BDYH 4PJXB 5HYEA 5I16B 5MI0C 2WUBL 3O11A 3QDMB 4Z18A 2BVEA 4A6YH 4PRBA 5AZEH 3VFOA 2JTDA 2NNAB 2WW8A 5ILTH 2EIEA 1XF3B 5JDJA 3PABB 1B2WH 4L8SC 1K9TA 3UC0L 1P53A 1CLZH 2GJ6A 3ARDC 3D9AL 4ZTOH 4XRCA 4HS6A 3TN0C 5IVZB 1FL5B 3IETB 3T2OA 3B5HA 4IMLA 1EIBA 2I60H 3JTTB 2D31B 5HHMB 5I1KH 1TTUA 1PX3A 2PO6D 1MJJB 5DR5L 3DWTA 5F6IB 1NAML 1KNOA 1H15A 2D3VA 1W72L 4H1LH 1QFWM 4H88L 3C2SA 5C0JB 4M6NL 5CKAA 4WNQA 3GI8L 4LGPB 4CN1A 4UILL 3E8UH 5E9DB 3T2QA 4G8FB 1QSFE 3LEXB 3ZTNL 3TN0D 3QCUL 3UJJH 1H3XA 4LAQH 3PF2A 1A4KA 2YA0A 4I3RL 3P4MB 5CCKH 4DCQA 4UNTA 4U7KA 5D7SL 4HSQA 1UB5A 2UZIL 4KRNA 4ZFOB 4M3JA 4JHWL 5ACZA 1MIML 1ORSA 4MB5A 4KXZI 5B38G 4XP9L 2GJZB 4I18C 3BYYA 3FCTB 4X7SH 4WWKD 5IK3A 2QQKH 1FZOA 3FQUB 1BBDL 5TF1H 3VH8A 1RU9H 5EA0L 2J2ZA 2Z35B 5CCKL 1UB6A 5DJ0A 3CVIH 1ZLUH 1BLNB 1WIPA 4EI5D 4YHYC 3VXOB 5IMMB 3CZFA 5DEFA 3QYCA 2OL3A 5HGAB 1UB6B 5EH1A 3WFCH 2GIYA 1FBIH 4WWKA 5BS0E 4HFUL 2XRAL 3OHXA 4LPVA 3FO0L 4PJFB 3U7YH 4V2BA 3HC0B 5DHXB 3TJHC 1IM3B 5I1KL 5C9KA 4OGAC 4LKCB 5B22A 1NDMA 4KGJA 2MHAA 3ULUC 1G6RL 1M7DA 3QWOB 4JVUA 4TQEL 2F9BT 2UZIH 3G6JE 1PG7H 1B0WA 3UPRA 3F65A 4MJ6A 4Y4HD 3ARED 3EBAA 4ZOEA 3SDAD 5DA0B 2NX5B 4M6NH 1QFOA 5D5MF 1OW0C 5TF1L 4LVOB 5EBMA 1R24A 4V1DA 1CE1L 5DUBA 1IL1B 5D6CB 1KCSH 5L8KB 3ULVE 3FN0H 4TUJA 3BUYB 4NWUL 1KIPB 4OFYD 3X13A 1V3JA 4ELKB 4H88H 4ERSH 4P3DB 2F53B 3G5XB 4E0RB 1BP3B 1HCFX 2Y6SD 2XN9E 3D18B 3UROR 5EIVA 3V7AG 5INCA 2Z0BA 4FN0A 2FWOA 2IG2L 1OTSD 5F7FA 1BQHB 4WTXA 3HI6H 1JF6A 1T5XA 1CXIA 4NZJA 4KI5D 1P4BL 5ICZA 3TFKC 3TO2B 4F58H 1MCIA 1MJ7L 3TESA 3VDBA 2VDNL 2ZUWA 4PJ5A 3FN0L 4OCXL 5INCB 1AXTH 4UUJB 4MLIA 3WFBL 1CD1A 2EIZB 4KKBD 5E8EA 3U4BH 4Y2DD 3QBTB 4LCIL 12E8L 1M7XA 4OTXL 5D5ME 1N4XH 1I1FA 4NGHH 4NO0B 1TJIL 4ZUSB 4NZTH 3S4SA 4HIEB 4LHJB 2JJVA 1GCFA 5IV2B 4MAYB 1MCFA 1OLZA 1SY6L 2Y4SA 1T1YA 3BEVB 5FYKE 4MNHB 3UCRA 4OLEA 4ODWA 2BY2A 1CE6A 5LQBL 5EC2A 1S78D 1YNKH 2IBZX 5HVFB 3TVMD 1E4KC 3DVGB 4OZHB 5DGRA 4QY8B 5DF0A 5DMGC 5B39G 3GSVA 3OB0H 4U6YB 4MNHA 5D7IE 4OI7A 2GYSA 4GBXA 4QNPF 1J0ZA 2FJHA 2HYMA 5AAMA 3NAAH 1NGXA 1MFCL 3V6FA 2DD8L 4F9PA 5E2WH 4EXPX 3BGMA 5KSBB 2JIXB 3CMGA 3BN9C 3ILQD 4BKLB 1U8IA 4TSBL 4U1IB 1FIGL 2YD2A 3CSYA 4OUUB 2I9TA 1OOAA 4WHYH 3KR3L 2H3NB 4O2CB 3WIHA 1KBGH 1UXSA 2X42A 5BZWA 2D7QA 3AFLA 1NCDH 1FDLH 1S7RA 3VFMA 1BOYA 3VMNA 1CT8A 1QSFD 1ETZA 2P47B 4GRMA 4JM4L 4Y4KA 4Y4FA 4J2XA 2BVTA 5DJXA 4QHNA 4YHYB 3H8NA 4Z6AT 3O0RH 2RR3A 4K2UL 4MA3B 2NX5A 4OCYH 4M1GL 4X6DE 4JQIH 4APQD 3U7AA 2E7BA 2G5RA 5D70H 4V1DB 4PRID 5IQ7H 5CMAA 3RIFK 3MJ7A 1DBMH 4J4PD 3DX8A 2YC1B 3S37L 4HPYH 3I6KB 4JRYE 5CJOH 4XT1C 3ELAT 1PLGL 3T1WA 1U95A 2VISB 3GBML 1MCNA 4YIQB 1RHFA 2CRYA 3LCYA 1O7SA 3DETC 2YKLL 3H7BA 4WJ5B 3T08A 3VRJA 1EMTH 1WAAF 5KJRH 1CDIA 3WN5A 4LVOC 1U2CA 5CSBA 5C9JA 1I1AD 1T4KB 1KB5L 1V7ML 3V4VH 3KWWB 4QXWA 3GIZH 2YPLA 4F7TA 1U91B 2VDQH 1K4DA 2D7NA 1JNJA 3VG9B 3RGVC 5DJAA 5HHMD 4XVJL 5K9KA 2ICEB 4XGZB 1REIA 4L4VB 1G84A 3TT3H 3MRFA 3MMEA 1JNNL 1WVZA 2BJML 2AJ3A 1J1XL 2XG4A 1RJZB 5C2BH 4PJXA 1MQKH 2EDFA 3V4UL 2FYYB 5B39A 3VXSB 1BVLB 4XNYH 3VXTA 2YZ8A 1AGBB 1NDGA 2XA8L 2NY7L 1L9NA 2M1KA 4ALAL 3SO3C 3ROOB 2OTWA 2BOCB 1J88A 3IKKA 3ZYZA 1WEJH 4GKNB 3BJLA 3QO0B 4PREB 3S5LG 5GJSL 1CLOL 1NMBL 4QLRA 3Q6FA 4PLOB 4Z9KB 1F4WH 5IJVB 2ENYA 2MOVA 3TBSB 5A43C 4YR6B 1GHFL 3CDGB 1F3JA 3OMZA 4XMLH 5JR1L 1DBAL 3IRPX 7CGTA 2OJZH 1FFNA 2W0PA 2J8UA 4F2MA 3HE7D 2ID5A 5T3XL 3HE7C 4RBPK 2VDOH 1UH2A 3QUYC 2XA3A 5LXGH 3IU3B 4IOIB 1BM3L 3BXNA 1A47A 4HJGA 4G6ML 3SCMA 1A7NH 4B53A 4XRCB 4EDXA 4CRPA 1DSFH 1A2YA 1XT5A 4FQJL 5IVXF 4EI6A 3EYQC 1U2HA 4NO2B 4XMLL 1RUPH 5JR1H 1UZ8B 1A14L 2C3VB 2Q8AH 1RIUL 4JM2D 3TBTA 3FHAA 1A5FL 1CDUA 3LPWA 5DJ2A 5E2VH 3WEXA 5MENA 4LLYB 1TJGL 1HQ4B 1YNLL 3HRZB 1OWWA 1CGSH 2HTKD 1OF2A 1HH6A 1WZMA 1HXYB 1IM9B 4QOKD 3HZVB 3MV8A 5IESL 1WEJL 3TEUA 3MLPA 3UTSE 3QXWA 4X4XB 2CKBL 3TO4D 4CMHC 5FAAA 4ZG1A 3GGWA 3EDFA 2VISA 1RJYB 4UV4H 1JRHI 2UZXB 4ZO6A 5I17A 3CZJA 1J18A 3PHOB 2BOBB 2A0LC 5C2BL 4OFYA 4UTAH 2NXZC 1Y6MR 4LFHD 4HDIB 3GIZL 1OSZB 3K81A 4XNYL 5ICXB 3HPLA 5JXEC 2H32A 1WFTA 3D2UB 4PJAF 4FXKA 4GRWE 5MEQB 4U3CA 1R6VA 4M1CD 1TIUA 2O5XH 4TRPL 2A6JB 4YQXH 1BPVA 1CXFA 4Y4HA 1XEDA 1CFQB 1BHGA 5EO0A 4K23L 1JZ7A 2EC8A 4HUNB 3BQUC 1J05A 1GGBH 2NY1B 2F54B 1CYGA 1AXSB 4FFYH 2VITB 4OLXL 3QXDB 3RAJH 5HDBE 2VZTA 4LVNB 2WAHA 3QT2A 4Z77B 3SGJA 4JFXB 1SEBB 1WBZB 3RTQB 4XP6H 1S8DA 3T3MF 2CMRL 4OLVL 4LEXH 2VXQH 1PY9A 3BPOC 5GGUA 2AKRB 4WDIB 4PG2C 1KPUA 4HK3J 3KYMA 3ZKXB 3WUWB 4NWUH 4U31A 1BOGA 3EDJA 3VI4E 2W9DL 3EZJB 1G7QB 3P9WB 2B5IC 3EKCA 4YAQA 1U9KA 3O2VH 4Z5RB 4F2MB 1RVFL 2NYYC 2D31A 4GW5A 1YMMA 1G9NH 2I9LA 5DJYA 4E41D 1T22B 5GS1C 2ZUVA 1T1XA 5DVKA 2BNQA 2PN5A 2GITA 2X1XR 5FUCE 4Y16C 5GGVL 2IPTH 1KSRA 3VWKA 4LMQE 2N7AA 1Q9LB 1PSKH 2OMNA 1OT2A 3G5ZB 4WUUA 5E1HB 2DQIL 3L3GA 4ONFL 1RIHL 1OY3B 5DMIH 3RZCA 2D9CA 3QRFM 4UT6L 2XQBL 4ODHH 3ZDYF 1QVOA 3B5GA 3HZMB 1QEWA 3PWPA 4I0PB 1A6ZB 2X4NA 4TSCL 2FH6A 5DYOA 4O2FB 3GMNA 1MCLA 4LEXL 4E41E 4QHLA 1BEYH 2ESVA 2AJYH 3STLB 4HIEA 2PW2A 3EO1B 1T0PB 5I17B 1NC4D 1A3LL 2JLLA 4NGHL 3TNMB 1JIBA 3IS1X 4NQSB 5AZEL 3GRWL 5TE7H 3HKFA 1SY6H 2CRMA 1QFPA 3L5IA 3RAJL 2B1AH 2NR6D 1AXTL 4LLVA 4LCYA 4ONGL 5F72S 1DUZB 1CE1H 4HIHB 3BP5B 4QOKB 1RZKC 2ATKA 3AY4A 4IRSC 1UM4L 2R0KL 4JRYA 4JG1H 4F7CB 3K3QA 1AO7E 4M9PA 1MFCH 3RQ3A 4ESKA 3WS6C 1S7VB 2DQHH 5ELIA 5E0QA 3MRCB 1OLLA 2Z8SA 4BZ1H 2QSTA 3FRPG 3H7LA 1F11A 4PJ8C 1JPTL 3ZKND 4O9HH 3CFCL 3OGCA 4URTB 3VFRA 5FO9B 1H3TA 3KPNA 5IVOA 2OCFD 1MNUH 3BPLC 5HGAA 3HZKA 2NY6C 3KPSD 4RMTA 4U1SB 4WDIA 1NGZB 2XWTA 2COQA 2DRUA 3BPCA 2AABL 3BQUA 1S9KC 5EOCJ 2XQBH 1NL0H 3I75B 3L3HB 1NPUA 3I02A 1YUHB 4JQVA 2VDPL 3ZHKA 3MV8E 3ZL4H 2R29H 4GG6E 4I5BB 5EB9A 1AJ7L 2E8ZA 1GOGA 4H0IA 5IQ7L 1OGTA 1OM3H 5DUPH 5ITFB 2IPKA 2DQFA 1BBJA 2AXFB 5H2BA 4RMQA 5EZJA 4HWBA 2VXTL 1BVKB 4FQXC 4X4YA 2AJSH 4RDQF 3WFCL 5MP6L 2FR4B 1MCHA 3V7MA 15C8H 2BVOA 4ZXBB 3SGKC 4CMMB 5H2BB 1HSAA 5C0RL 3U7WL 3DGCR 3ULUF 2FR4A 3KPTA 3SBWC 4IIQA 1A9EA 1BQHA 2GCYB 1QR1A 3I3EA 4ZO9A 4BQ9A 3NIFF 3QJHA 3NA9L 3DOSA 1DEEA 4M00A 4JRXE 1WZ1H 4KGLA 3T4AA 3BP4A 5BRZE 4MHHI 4NQCA 2X5PA 4QRTA 2AW2A 4L8DB 2A74B 3MQIA 1J8HA 1NGQL 1MQKL 4RZCA 2YRZA 4U1NB 2J8OA 2CR3A 1U0QA 3MOQA 4FQCL 1R0AL 3SKMA 5JNYB 4CVZB 2DLEA 2ZCLH 4UNUA 4WW1A 4HIHA 5ERWB 5HGDA 3FTGB 5I18H 2Z4QA 3OKOB 1JCKA 2VKXA 4LPCA 3RL1B 4DVRH 2ITDA 2D0FA 1R3KA 5EOCH 4NZRH 3K4ZA 3H9ZA 4X8JA 3Q6GH 3TP4A 4F57L 3PWPE 2BDNH 3W5MA 1LP9B 3OKOA 4MA3A 1S7WA 2NZIA 1DQQA 4LCWA 1KN2H 3HC0A 4FFVC 1VPOL 2ZCHH 4HHAA 1D5MB 1HQ4A 1GGTA 1UWEH 2NMSA 5DMYA 4UAOC 1ETZB 3CAFA 4EEEA 1ZGLM 3W0WD 1VFBA 3MUGA 1MRFL 1X6NA 1A5FH 1G6RA 1OTUD 5FB8B 3WKNA 3DX8B 4FXGA 1QSFA 5IBLC 4MNGE 2NY5H 2AGJH 1DBJL 4G6AD 4JRYD 2VLKD 1WTLA 2DN7A 2M2DA 3ARFA 2NY1D 1RZFL 1TENA 3WIHL 3TBWA 4KK5D 3H9SD 2G9HA 4IRJC 1WZLA 4FQHA 4AH2A 4TTDD 4R7DB 5IT2H 5JOEA 3V95A 5E2VL 3MCLH 2HJLB 4I0PC 1U8PB 1QRKA 4AMKL 3SDXF 2QHRH 2IFFL 5CGYC 1YZZA 4GLRH 1TXKA 1LEIB 3LKOB 1CS6A 4G80A 1B4RA 1NC4A 1MRDL 4HKZB 1RZIA 4G6FD 4FABL 3NH7H 4PY8J 1CFNB 3OKEB 3RIAF 5IESH 4BFIA 5F6HJ 4I1NB 3FMGH 4ZFZB 5GS2H 2VLRE 3GHBL 1RUPL 4KAQL 5D1ZB 2RJMA 2P8PA 3S9DB 2ENSA 5E94A 2RGSA 2BXYA 1D6VL 4I4WA 2FGWH 1INDL 3RWGA 1J12A 1AGFB 1DBAH 3EYSH 2PTTB 4OLZL 1PZUB 3KPRA 3CVHL 3OZ9H 5E7BA 2X4OA 3MMEB 4YLQT 3VWKC 1FVEB 1DFBH 1FH5H 1U8OB 5JOFA 2BC4B 4MMXC 5KAQG 4PJEE 3Q6FB 5D7IF 2EDXA 3DVGA 4OZHA 5HVHB 2X41A 2FX7L 4KUZL 2WQRA 4KY1H 3UTTA 4D9LL 5C86A 4NQCB 2V9RA 2V5MA 5IWLA 2BOCA 3PP3K 4GH7B 4PP1D 3UJTH 3AREC 4YZFF 4YAQB 4JZJA 1VFAB 4UIKH 2ZOLA 4AG4H 3QQ3A 4L4TB 3QWRD 1NFDE 1ES0A 4LLWA 4MAUH 3SDCD 2R1WA 2DQJH 3L5JA 2MCPL 4XNMA 4Z7UE 4JRXA 4DKEL 2PXYD 4CW1A 1XZ0A 1L0XA 5EU4A 4QHUA 5H8DA 2WQ8A 2BRRL 4G42B 2DKSA 1UWEL 1EHXA 2BNUA 5D9SB 1EFXB 2DIAA 3MBEC 3UTQA 2C3VA 4OLZH 5J0BA 3B2VH 3ARBC 1NSNL 4WUUE 2WANA 1LEGB 2F74B 3A6CH 2Q3ZA 4MNQD 5EU4B 3LD8C 2X7LB 2VE6A 5AG8A 4WW2A 4AIOA 1ZA3B 3MNWA 3QIUB 1M6OA 2HN7A 5C0FB 3C6SB 2VDLH 4HH9A 4JREC 4XVJH 5KSAC 1NMAH 1TZIA 2GSIA 5IHZA 5E00A 4RMUA 1UKTA 5DYOB 4YDKH 3NCCB 1FL3A 1CF8H 1H3UA 1T03H 1B0RB 1QBMH 1FFNB 1RJYA 3B3IA 2JIXD 5GIRB 2EE9A 2IPUG 4QYOB 4P2RD 5C0IB 3RZWA 2R2HB 4DGVH 1NCDL 5C0BB 2Z8RA 2DJUA 3BO8A 3E6FA 3MXWH 5SX4H 1U92A 1KXQE 1F6LL 1B0RA 1DEDA 2XKSA 4G7YL 5FOBA 1KACB 3NZHL 5LVEA 3I85A 3GRWA 5HHOD 4EIZC 2CD0A 3O0RL 1BIIA 1YPZA 1T1ZA 1VKXB 5ISZD 3MLVL 1DUZA 4EDWL 2Y36H 1BJ1J 4J12A 5IG7A 4O2FA 2W60B 5E6ZA 3RNQA 1XF5A 3W11D 2GEEA 4K7PY 3LRHA 3HS0A 5D5MB 2QSCL 1IC7L 3WFHA 1EO5A 3RWEB 4NRZB 5GQBA 4RISH 3SDDA 1S7VA 4ZS6D 3B43A 1H3PL 4X6BA 4QRPA 1MEXH 2P48B 2DIBA 2VLLA 3OQ3B 2BFVH 3V6OA 5A2LH 2P7TB 4WFGE 1RJCA 3DMMA 1KEMH 4N8CH 1FC1A 5FM4A 5L8LB 2NNAA 3QUZB 1DE4B 5FA4B 5E6ID 5HI4D 1CG9A 4DAGH 3ZZ1A 1J1OH 4BFGA 3S97C 3IXAA 1GGIH 4XMPH 4C55A 1QO3B 3UJTL 2XXMB 2DMBA 5GGUB 4FQQB 4GRLD 4P23D 4KHXH 1HDMB 4KJPD 4XCFH 1WWAX 1TPXC 5TE6L 4HPYL 2OTWB 1WK0A 2A6JA 5J6HA 4QHMA 4EN3C 1PEZA 1S7SB 1CGUA 1DR9A 2YRLA 3P0VH 4GW5B 4PGCA 2DYPD 5JZ7C 1G7MA 1SEQL 1A7RL 3SDYH 4JN1L 5EU6A 3ARBD 3SKOB 4ZFOL 3N1MC 4IOSD 2VITA 3EFDL 4N8VB 5SV3A 1U3HD 3F58H 3B9AA 5INDA 1F3DJ 4U1JB 5CFHA 1OHQA 5CD5D 3WLBB 4NQDA 4ZUUB 1MI5B 5FA3B 3FFDA 4NQTA 1JHTA 1I9JH 3O6ML 4KWUA 3MREA 3P73B 5BOPA 4PJDF 1IC5L 3RVXC 4UOJA 2CXKA 4PRAB 1N2RA 3ZKQD 5I30H 2DYPA 1HNFA 4NUGH 3VFSB 2MPAL 5B8CA 4TSAH 1R3HB 2IQ9L 5HHPA 2BSTA 2Y6SC 3LKPA 1NBVH 2DI9A 1OM3L 4KKCD 4APQC 4OM0H 5L88L 2V7HB 3WL9B 4XWOC 5CJXC 5DWUL 3VXMB 3MBEB 2R0ZL 5CEYB 2WBJD 3QUMA 4K7PL 1N8ZB 5I1HH 4RFEB 3C09B 4AJ0A 4Z7UA 3N0PB 4LLVB 5F96L 1A1NA 4Q9QL 4X98B 2N56A 4JAMB 2OTPA 2BOBA 4QXUH 4CVWA 5ERWA 4I2XA 3GSRA 2AJZB 3QUKA 3CCHA 4WFHE 4AEFA 1RJLB 4EUPB 4PJHE 3ESVF 5HVHC 5F7YC 3KS0H 3BZDA 4DKFL 4UT9L 5C0AA 1CWVA 4JDVB 3BD4A 4M5ZL 3S34L 3IFOA 4X8JB 1YQVL 1X5JA 4NHCL 3I3BA 1RV6X 1W8OA 4WWID 3QIWC 4ZDHB 3QUXD 3HMXH 1FG2B 4XP5H 2VAAA 4LPWA 1ZA6B 2EH8L 4PV8B 5KSUB 3WNNA 3D3VE 5KN5A 5F1OB 1S9XB 1TVBB 2IH3A 1RD6A 2E9BA 1FORL 4HPOL 3C2AH 4HUMB 2R0LH 1YN7A 4V2CB 1AD9A 3IGAA 3U0PA 1E0OB 4I8DA 3DURA 4JZNA 2R2BA 4QNPE 5FECA 5DS8A 3EUUA 3LMJL 1V7NL 5ACMA 4R9HA 1MVFA 1LDPH 3ARGC 1WZ1L 1AKJB 2ZG2A 5J6HB 3KPLB 3O3DA 3U0PB 5EZOH 4QTHB 4MMZC 4HJ0C 4UDTB 4DFHA 4BK4A 5L7XH 5J89A 3FQXA 4OLWH 3LKOA 4G80B 1OD7A 2EKJA 1MJJA 4UIMB 1CD1B 5DDHA 3KPRD 5D2NE 4K3HA 4IOFD 5ANMB 3R1GH 4KPHL 3CK0H 2DD8H 4L3AA 4M93B 1R5WA 3MRIB 4Y8AA 3RJQB 2RB8A 3MPCA 1TPXB 4DVBA 2FWOB 1GGCL 4ZXBA 2HJLA 5M95B 3VGFA 1BZ9B 1JGUL 1W72H 1KJ3H 4OKVB 1E6OL 4X4YB 3C6LB 5I2IA 1RZIB 2QBWA 1HIMH 3UYOD 1PQZB 4M7LH 4O5LH 2QHLA 1IAII 1LO4H 3RFZC 4KJQC 1ORQB 2CXGA 2CO6B 5IHUL 1AQKL 2FX8L 3IDJA 4PJIE 5FYKD 5HHXL 4QTIL 3EHBD 5D96C 2OJEA 2BZDA 4MD5B 3RGHA 3G9AB 4H0HB 4POUB 1DQDL 4E42B 3O6LH 2GK0A 1G9MH 2HFTA 3VXRE 1HYSD 4JAMA 4NFCA 1AI1L 3JV5A 2AAVA 5I9QC 2JJSA 4TTGA 3EOAA 4PR5B 4CBPA 4ISVA 4EQ2A 5F9AC 3QZWA 2HH0L 5AYUH 5D1QD 3LQAH 5CJQL 1I7TB 3V5KB 2GK0B 5I1EH 3P0YL 4MA1C 3TCLA 5CUSL 4JFZH 3WHXB 1NGWA 1B0GA 3P9MA 1YY8B 3KXFD 5I76B 5IW1B 5CZXC 1YEHL 2GJJA 3PWJB 3THML 2YPKA 2ITDB 2HLFD 4KKAC 1PFCA 2FIRT 1S9YB 4X7TA 1IAIL 4K8RH 2IBGA 4MQ7A 5JIKA 2DDQH 1Q0XH 1MAKA 2YC1A 3EDEA 4YFEA 4M43H 3GSNH 3KLAA 4PJIA 5AWNL 2ARJQ 5DO2C 5IB5B 1GXEA 5DO2D 4TTDC 5HPOA 3VXNA 3DO7A 1EEZB 2R56H 3BMVA 3GFUA 4JY6B 3ZDXE 1GHFH 3MCKB 3RX7A 3QIWA 4K55A 3RTQC 4JPVH 1KJ3L 3CMOH 1A6WH 4NYLB 1B4JH 3NVQA 5T3XH 1P2CA 4AENA 1A3LH 3RHWK 1QR4A 4J7RA 1VKXA 1K3IA 1QFWH 1XGPA 3BFOA 2CDGA 2QADD 1MHEB 4GRLA 2FZ3A 4ZO8A 3PV6B 1LK2A 1YMME 2EYRB 2B1AL 5KAQF 5HD8C 5SV4A 2V17L 3D2UD 1FN4A 2G75B 1F4WL 1NJ9A 3CH1A 3M17A 4OJFH 4Q9BA 4LSTH 3TO2A 5HHXH 4ZYKB 3C8KB 4JVPA 1T89A 1E4XH 2OQJB 1GPOL 1UXWA 3B83A 3TO4A 1D9KB 3CVIL 4LDLB 2Q87A 5DK3A 4P5MA 2DICA 1CD9B 4YXKH 5DI8B 3ARGB 1FE8H 2A6KA 1HHHA 1BGXL 3D87B 4M7LL 4WI7A 3T77B 1SY6A 5GZND 5GHWL 5GS1B 2DQTL 3G5XA 3B5TA 4JPWL 1MRCL 5E2UL 1MCEA 1FCGA 2GI7A 4JKWA 2KDGA 5EFIB 1TTGA 1J8HD 1K2DA 3ZDXF 2A83B 3ZKNC 4I18A 3SPVA 5GRJH 2NQCA 1DLFL 43CAB 1YNTA 5T3ZL 5IGXL 5I0ZA 1AY1L 4YPGA 4F37F 4KTYA 1MVUB 1W0WB 4XMKL 3OKKA 1E4WL 5T1KD 1EEYA 1EA9C 3EO0B 5GRYA 2CK2A 3KPSA 3MXVL 5J6GA 5B39B 3BH8A 4FFYL 4OLXH 4MVBC 5I1GH 3PL6C 2BFVL 1M1SA 4ZNEE 1KFAH 5I0DA 3TYFA 1RVFH 3KNBA 5FO7A 3ZYJA 2CIIB 4K71B 3MLVH 2FJGB 4KK9C 4G9FD 4TVPE 1MCQA 5DGQA 2JCCA 1CLCA 5GS0C 5IMOA 4R4ND 5TQ0L 4LSUH 4R3SA 3QNXB 3DSNA 3SO5A 2OL3H 3C5ZB 2NY6D 2X05A 4W4OC 5DEGB 3U0TB 3UTOA 1FE8L 2Q20A 4Y5YA 5E8OA 3BVNA 4CADA 4K9EL 4Y8DC 4QT5A 4PP2B 3LS5H 5DD1L 1H3PH 1L0YA 3OR6B 4LRNL 2XG5A 5EU7C 4JDTL 2XKUA 1R3KB 3ES6B 2OP4H 3VFSA 4IOIA 3BP7B 2D0HA 3ZTNH 3UTSA 2MKLC 4NKOA 5JPNB 4PRIE 4M7JH 4QCIB 3BVNB 1FLRH 2CLVB 1FL3B 4L4JA 4POZC 1VEOA 2OI9B 3Q1SH 5DMGD 3K7UA 4JM2F 2DJ4A 4HEPG 2H6PB 4X6CA 1BECA 4CGTA 1E28A 1NBVL 3C08L 3FO9B 1IEAB 2DBLL 3PHOA 5BVJB 1GC1C 4QCIA 1UXSB 5HYJA 3IAGC 3MNVB 3OG4B 3RU8L 4JFOB 5EOCL 2C4FT 3C6LC 1IE5A 5JW4M 4M61B 1P2CB 5D9SA 3X3FL 3CFDB 3HHRB 4LHUA 3QDJA 5DK0A 3QUXC 4G43B 5GS0H 1Q38A 2AV7B 1DP0A 3EYFB 4U4BA 3VU2A 1B3JA 4LFHG 5D2LE 4DN3H 1OAQL 3BWAB 5C6WH 1NJ9B 3T0EB 1Q72H 2R4SL 2XZCL 3D6GA 1LMKA 4S1DC 1PJ9A 1FZOB 1L6XA 1U3JA 1MLBB 1HHHB 1YEIH 2Z35A 3CFKB 1UM5H 1AR2A 4TUKH 5I9QB 3IS0X 2SEBA 2GK2A 2R15A 4NBXB 2NX5D 4J6RL 1WISA 1YYMH 4O9HL 1RK0A 4PJAE 5CS7A 2AJXH 1I1CA 3QR2A 3Q1SL 3CU7A 3WNLA 4MA1B 2FYYA 2B0SH 5SWQA 4ZXBC 2BNRE 3DYMA 3NPZB 2FEEL 1P7QB 3CFEA 4MX7A 8FABA 1IGIL 5IM7A 4S1SL 1CR9L 1D9KC 1RMFH 3NGBC 4LVEA 2YD9A 1KN4H 1RUAL 1XF5B 5I1JL 3DVIA 5I1LA 1OGAE 1AXSA 4O02H 4NRXB 3WFDL 1HWGB 2CIKB 4WEUD 2VXSH 3CLEL 3VGBA 4YZFE 4E41A 3B9EA 3QDHA 2H9GB 3RWHA 1EXUB 5A16B 2XYCA 2HVJA 3C5SA 4IRZL 4WGWB 1VA9A 1KPUB 3VFNA 4BSWB 1NDGB 4QRRB 1TQCC 4PJ8D 1EJ6A 1T66D 4L8CA 5DJ8B 1CLOH 2WWMC 2EKSB 3TT3L 1H0DA 4X5XA 1HQRB 5BVPL 5C8JA 2DTMH 2OM5A 3JWDC 4F58L 4G6FB 5C07B 2UY6A 3X3FH 4MCYA 3C9NB 1J5OH 3QJFB 3PJSA 2Z93B 3BN3B 3UDWA 4R90H 3F6IA 1L4IA 1H3GA 3DHMA 3MV7B 4NHUB 2VLJD 4H8WC 4LVHC 2O93L 3NCBB 3MRRA 4MNGB 5KOVC 5MENB 5IJKC 1OP3K 1TZHA 1DQTA 1Y0LB 4YGAB 3FB6A 1FRGH 4PB0L 1X5ZA 3KDMB 1KXVC 4RFEA 3RZCB 4X4XA 3MRRB 1MFBH 3WNPA 3WSQH 4PRIA 5DT1L 5I8KL 2NZ9C 4MGXA 4DN4L 4L1DA 3VWKB 4R26H 5BZDA 1S3KL 3B9KB 3TVMB 3FO1B 2X40A 1A02N 4NO3B 2AJZA 5F88A 3MYJA 4IRJB 4G8GB 3UMTA 4RFNB 1IT9L 4QHLB 3NAAL 3C5ZD 1NFIA 2YOCA 6FABH 5IBLD 3CJJA 3SDCC 1QVOB 4LSPH 4NJAH 2BY1A 3LMJH 1ZLSL 3HA0A 1A7QL 1U41A 1J10A 5SWZD 4EZMA 1ORSB 3ARRA 3DRQB 4GRLC 2FJHB 3PHSA 4PLKC 4NFDA 3OF6A 4FQ1H 4XC3H 4XPHL 3TZVC 5IVXA 4UQ3B 5IR1A 2H2SC 1T2QL 1IKNC 2AQ3A 5DQDL 5D1ZC 5E2WL 5F7KC 1AKJD 1NBZB 4TPRH 2V2WA 4XP1H 1QLRA 3FONA 6FABL 3ZO0A 5J4MA 5DJ0B 1LILA 4LCCA 4JDZA 2DDQL 3L6FA 4M9OA 5DRZB 5I6XB 5EZIL 1OQXA 1A6VH 2YA2A 4KK9D 3PQYE 3KAAA 5CJXA 5HHOB 2AJUL 1J8HE 4DN4H 4GAJL 2C3HA 2UY7A 4XCYB 1SYVA 3BZFB 1L6ZA 4DK3A 4PJCA 3D39B 2EDJA 4MCZB 1KTLB 4P2RB 5DUBB 4PTTB 5EOQH 3TF7C 1JHLL 1CK0H 4WEMB 5JPMB 1U93A 3PGDA 3NABL 1I1AB 5BXFA 5IB5A 1J1PH 4Z7NE 1ZLSH 3BGFC 4UBDC 2L7JA 1BF2A 2R2EA 4YXLL 2W9LA 4N5UA 4GG8B 2ZUQC 3WLWD 4PS4H 5GSVA 5CD5C 2HKHH 5D7KD 3HZKB 32C2B 1B4JL 3HG1E 3FQTB 4PJ5D 3J7HA 5CHNB 4HXBH 1S3KH 1HKFA 2Y07L 1SVCP 3MSPA 1FFQA 2HT3C 1YY9D 3PXJA 2NY1C 4YHOH 2P45B 4HIJA 1MCDA 3P73A 1MJ7H 3F12A 3U46A 3H7BB 4ELKA 1QLFB 3P0VL 4OF6A 1UACL 1U8MB 1BJ1H 3RWDA 4WI6A 1N5AB 4G9FA 3FB8A 4NT6B 4KAQH 1WV7T 3STZA 3S8WA 1DQLH 3RBSA 3TT1H 3V4PH 3KG5A 4F7TB 1X5LA 5HYQB 3ARDB 5L2KD 4L8BA 4X6EA 3HB3C 3QHTC 4PRHE 3RWDB 4FABH 1I3GL 1EDQA 2PUQT 5HGHB 1I9JL 4G6KL 1I8KA 3E6HA 1YN6A 3STZB 3R06A 3SHSA 3TNNA 2E9WA 3BISA 3PDGA 2XV6B 1UACH 3QUMB 3KXFB 4E5XA 2ZNXA 3D9AH 2CDEA 3NCYS 2E9JA 4L8BB 2W38A 3HI1B 4OAWA 3QXUA 4L4TD 3T4AB 4PJXE 4ZSOE 3GSRB 1A6TA 1HINH 5DMKA 3MYZA 3GO1H 4P2QE 3ZE2E 3VH8G 3BX7C 4ZMAT 5D7JD 4MQXC 1FH5L 4NN7B 4OD1H 2VR4A 4X9IA 3MRBB 1KCUL 3CSPA 1I8MA 1DQJA 3VXOA 5C2UB 2MQ3A 4NKOB 4W70A 4QTIH 3QPXL 4NBYB 3ET9F 3MRNB 3IDGB 4P2OA 4HWNA 4GBXB 3T4YB 3MBED 4U33A 4PJAB 1ZLWK 3HCVB 4LCYB 2GW5A 4DW2H 2CR6A 1D6VH 5ISZA 3GUTA 4CU8A 3GMQA 4KFZC 4LAJH 2A6DB 2X2YA 4JFDE 4X9GA 5HHOA 5ABDE 4PJCE 4GT7A 4MJ5B 2X89A 3QI9A 2OK0L 2VLJA 2XPGA 4RGOL 1PVHA 2XXCB 3OJVC 4YUEH 2IJ0C 1G1CA 5ESVA 1QRNB 3BMWA 3QDGB 2AXJA 3L3DA 3EO9L 3ZKMD 4I3SH 3BEWB 4IM8A 4G6JL 4P2RA 2CDGB 1D5XB 3VFGL 5CP3H 1JWMA 5GZOD 1OCWH 3I75A 1CGWA 4HAGA 4LHQB 1OAUH 1KJVB 4QTHA 5ESVB 5I71C 5HDOA 5C0GB 4NQEB 4YDVB 4QHNB 4JZJC 4CVXB 4DGVL 2APWA 2VKWA 1GH7A 4Q97A 1FSKC 3G6JF 3RWGB 3L3IA 4M6ML 3ARUA 2FB4H 1CZ8H 4UOW1 4YDKL 4EDWH 5DD5L 3KYNA 3TVMC 5CWSA 3PL6D 4M5ZH 1UM6H 2XWTB 3S34H 4HS3B 4AEEA 5I8OH 1LE5B 4P4KA 4LL9A 4NP4H 3QNZA 5DTFA 4UB0H 1FYTB 1FVEA 5GGQH 2H2PC 1CIDA 2EDNA 4PJ8B 2XTJE 1TCRA 1J9CT 5K9JH 1ZVSA 4LOUC 3UPCA 3OXSB 4ZQKA 5JORB 3MXWL 3PDOB 5ILTL 2AJVL 1CFQA 3U36A 4YHLH 3CH1B 3M17B 3QUMH 5D72H 5I8OL 4WHYG 1CLZL 4Y19B 2I5YH 3C5JB 3LRSA 1G7LB 3CFBA 3F7YB 1LD9B 3LV3B 2X4UA 3LQZB 3VA6A 3LKNA 2GFBB 4Z8FL 1IGTA 4R6UA 3PQYA 1AGDB 1MAML 5I66B 2OLDA 4G5ZH 3GSXB 4H26A 3TPKA 4BQCA 2R8SH 5FHAL 1C1EH 1KCVL 4J1UA 4G7VH 2EH7H 2BNUB 1X3DA 3UXFA 3RUGB 5C0AE 5FCUH 4IRZH 3MUY1 4PG9B 3QZWB 2X4PB 2X7LA 2JF1A 4I3SL 2CGRL 5HDQL 4P9HL 5DVMA 4KZDH 5IMKA 3OKKB 2VXSL 3CLEH 4LQ1A 3UTSB 2AS5M 2Z8VC 4PJDB 3HRPA 1GPOH 3PHQB 3A6BL 2QKIA 2XN9B 3SJVE 4LCWD 5F3HA 3V6OC 1VHPA 2HJFA 1JPGA 3T04D 2K7QA 5CLWA 3IDNB 5DJ8A 1UYWH 1QUNA 1N0LA 3ARDD 5L2KB 4G8EA 4H1LG 3BN9D 5C07A 5I1DB 3B9KD 3KXFE 5IKCA 1PKOA 3PJSB 2EDEA 2YPVL 1KYOK 3X3GL 2HKFL 4NN7C 4O51A 4TOYL 4YHIB 1UB5B 1XR8B 2R4RL 4P57B 3EW3B 4QT5B 3MRLB 2JB6B 1U8KB 2HFGH 3H9SA 4GBXC 1KGCD 1HXMB 2VE6B 2VJXA 4MDJB 1INEH 3LY6A 1YY9C 2UWEF 3ECBB 4LARH 3SGEH 1NC4B 1LK2B 5CEZL 4KZDL 3GMNB 4CVUA 4KK8C 5GGQL 3FT4A 3A67L 3U82B 3ZE1F 2WBJA 3L5XL 4HS3A 4CJ0A 4HWZB 3MLWH 5CP7B 5C08E 3L3OB 4LSRL 1BQSA 1JV5A 4AH2B 1FNEB 4GKZB 1CG9B 3SGDI 5LGHH 3KS0J 4RGND 2EE3A 2OL3B 1NAKH 4M4PA 1R3JB 4NC0B 4XI5D 3HS0B 4RAHA 1XH3A 3RBGA 5J06A 3SBWA 1F90L 2BNRD 4CU6A 3D1MC 3QDJB 1KC5H 5DK0B 5T3ZE 2CK0L 4NN5C 1RK0B 1MFBL 3KHQA 4KK8D 1IBGH 3HPLB 1MQ8A 4ZO7A 2BSSA 1UJ3B 4F7MA 5MEQA 1O5DT 5E03A 3TA3A 1OPGL 1MWAA 1FGNH 1KTLA 3EJYD 2VN4A 4I4WB 1MLBA 2ITCB 1U58B 1RZGA 1QSEA 4YXHH 3MC0A 4XB7A 1TNMA 1MELA 2IFFH 5C0CA 2P24B 4WFEE 3SDXA 5K9QG 7FABH 1SBBA 5LWYH 3R1GL 5EBMB 2WBKA 4U6VL 2AVGA 3L5HA 5TGBA 3WKML 4M1DH 2IBBA 3FOMA 3K8KA 4OFVA 2G2RA 1AY1H 5L7XL 1FCCA 4KKNA 5KJRL 3QQ9D 1RZJL 4FFZL 5CILL 3BZ4B 4PRHA 4PRBB 3ULUD 5L2JA 1JN6B 3IFLL 1XF3A 4TVPL 4K3JL 3WIIL 3CUPA 3MXVH 1ERNA 4XNQA 2B7DT 1V7NH 3ARGD 2YPLE 2JKXA 2CIKA 5C1MB 4PYHA 2W0LA 5BJTA 1J0JA 4NO0D 3C9NA 3S88L 2DMCA 3QQ3B 2N4IA 4IS6B 5FCSH 4U6XA 3R8QA 4FA8A 5GRVK 3L3GB 1H3VA 1FO0L 4Y19D 1G6RH 5FYJU 5TDNA 2DQGH 5J1AB 4HJJH 3U7WH 5A2IH 3CDFA 1EEQA 4QOKE 4XPHH 3DARA 1EO8H 1R3HA 4OLWL 3GI8H 3WS3A 5FV1L 4DUVA 3HE6D 5IB2A 5F9OL 3QEHB 2NY2D 4AEIH 4RGNC 1F58L 5CJBA 4OD3L 1OVZA 3BEVA 15C8L 1JZ8A 3E0GA 1QLFA 4BSJA 1BX2A 4WUKL 1CE6B 3P4OB 3FCTA 4RMVA 3IKCA 3MTRA 5EUOF 4U3XA 4MAYD 3L5XH 4X6DA 3GSVB 1XGYH 2ADJB 2GCYA 1J86A 1GRWA 3MLZH 3MGOA 3HMWH 1G7HA 1NAMB 4LOUD 1HHIB 1KELL 3NFSH 4UNVA 1RSFA 3SJVB 2Y5TB 3QRGL 3LKRB 1BFVL 3L3OA 4POYA 1JGLH 2NCMA 1BBDH 2XTLA 4DK6A 3RWIB 2PR4L 3HR5A 4NQED 2NLJA 5AD0A 1T89C 1XGQB 1KCSL 2Y5TA 4NCC1 4CDHA 3GMQB 5JO5A 1FGNL 1F6FB 1T2JA 4NQXA 5KVGL 3HR5B 4JFEE 5CEZD 4HWEH 3QI9B 1NGPL 3CXHJ 1SBSL 2W0KA 1KCUH 1NKOA 5CIPA 3T2NH 1S7XA 4NZRL 1LHZA 5FYLE 2CKBB 2IG2H 5D7LD 3IDGA 4K94C 4OB5L 4HS6B 3FMGL 4R4FL 1S7SA 5T1LD 4UV7L 2Z91B 5ISZB 4ERSL 4YDIL 1RZKL 1R0AH 1DQLL 4OFDA 3IF1B 2NZ9D 1FVDA 4HT1H 1QLRB 1YPZE 4NRYA 3D25A 4PGZA 1FO0B 3FQXB 5F9DC 2UWEA 1SJXA 3T0ED 2B1HH 1OARL 2X10A 3CUPB 4H5SB 1OAKH 1UM6L 1B9ZA 5F7UA 4LLMB 1XIWC 4U1SA 4S2SA 5D71L 2EXWD 3I84A 2XACC 4Y7MA 2ICES 1TCRB 2OXHA 4D3CL 3P4LA 5B8CB 1FNLA 1ZWIB 3KPQA 1N59A 1U91A 4MNGA 1JWUA 5JHDD 2GQHA 3O4LD 4MZ2A 1ED3A 1J11A 2V7NA 3AB0C 2GAZB 2I07A 5I30L 1IJ9A 2H1PL 3KPQB 4I3RH 1DANT 4TUJB 4X80H 4TULH 3F7VB 3X12A 4KQ3H 2EE6A 3U1SL 4ETQA 3V6ZB 32C2A 2BX5A 3QEQB 3OB0K 4UB0L 1IKFH 2PTUA 3IVKA 4X6CF 1NC2B 1GGIL 4N5EC 4XNZC 5JXEA 3MLTA 4PJ7F 3VW3L 3OXSA 3MUZ1 4XBPA 5FGCE 5HHNA 1FFPB 3RA7H 3GRWH 5TE7L 1KB5B 1UVQB 4LSQL 4QHKI 1F3DH 5I8EB 5EORL 2XRAH 1EPFA 2BC4A 5IFAL 4Y19A 3BESR 3FB8B 1NGXB 1RU9L 4Q6IB 3LQZA 5C70A 3OX8B 1A9EB 1MCWM 3P4NB 3ULUE 2HG5A 4U1KA 4QXUL 1U8IB 2EECA 1TVDA 3HUJB 1YEDB 1SMAA 1XGQA 2DLGA 4XVUD 3NIFE 5GGSB 1BWMA 2XNAA 4HV8A 5I1GL 4OLUH 1P84J 2BVUA 1P6AB 4OZ4B 4APQB 3MRNA 4OI8A 4QXGL 5EU5B 3ULVC 1I85A 4H8WL 2WIIA 5TFSL 3AS2A 3ZSTA 3N1FC 1WITA 4P2OD 2Y36L 4LVHB 1KUMA 4LBEB 2DQEH 1MHEA 1Q9KA 4PRNB 1R3LB 5BOZG 4Q9QH 4BFEA 2BP3A 4QXTA 3RGVA 3X13B 1WICA 2YPKB 1A6AB 2J4WL 5C0CD 3ZTJH 3D39A 3DO3A 3V6FB 1H8OA 4CVXA 4E0RA 3DO7B 5C0EA 3FO2B 2GSIB 3SDDD 1R3LA 2HLAB 4OCSH 4BZ1L 1ZEAH 2W0FB 3CPLA 4OGYL 1RHHA 3KLAB 4Z7QF 3S36H 1J0IA 3T09A 3GMOA 4B5EA 4ZFFA 5IB1B 1YQVH 4NHCH 1IC4L 4O51B 3RUGE 3KJ6H 4RGNB 1WJ3A 3A6OA 4R8WL 5C0BA 1XFPA 4XPGH 5EDXA 2ZOKA 5DD0H 3I6KA 4MD4A 4EVNA 4HDIA 1WBXB 2HFGL 4MA7L 4JFEB 4LSRH 1DQML 1P7HL 4C58B 1Z5LB 3O2WL 2G9HB 4Y88A 1NAKL 2Y06L 1AO7D 5ACLA 4W6YB 1A7PL 3TWCL 4BH8A 3BPLB 5BS0D 3TZVB 5FYJL 1NMBH 1DBBL 2NY6B 5EO0B 5CEZE 5FDYA 1BFOB 3HE7A 5HY9A 2V6HA 4OCXH 2Q1EA 3GK8L 4Z7VA 4M7LT 3TA3B 3ILPA 4NOFA 5J57B 4L29A 3B2UD 3V8CA 3KWWA 3MLRL 5D6DC 1AGDA 2PKDA 3VWJA 1U8QA 3EFDH 4JJHA 4X6EB 3TZVA 1IRAY 1IGJB 3WBDA 1Q72L 1SYSB 2R4SH 2XZCH 5D7LE 1QFWI 1HI6B 4LLUB 2EYTB 3LOWA 1UM5L 1UYWL 2PNDA 1QA9B 1G9MC 4HC1A 5DEGA 5KW9L 4PJEA 3ARXA 4OIIH 1A7NL 4L3CB 1V05A 4PR5A 1IGTB 1XGUB 3LZFL 4YJZL 1SYSA 1QR1B 4RFNC 4MNQB 3QAZB 1HHJB 5EIIA 2P49B 3NIGE 4H26B 3FHQA 1ES0B 1AFVH 4FFZH 5T1DL 2XZAL 43C9B 3CFIC 2MCG1 5I1CH 1WBYA 3G6DL 1FNGA 5F89A 2JJWA 5DJZB 3GBNH 4MLSA 4XGZA 1W2KT 4JO1L 3C5ZA 1IGIH 5IF0A 1MFAL 3BXNB 5DC0A 4J3SA 5LWYL 4X5WB 5DJYB 3NN8A 4B41A 4NN6C 2G2RB 4HULB 5FKAA 1IM9D 3P9LB 3G04A 4YHIA 1CBVH 3O41B 4Q6IC 2CJUL 3L7FB 1RZJH 4NCDA 3VXNB 4IHOB 1Q9KB 5J3HC 2VDRH 3QCTH 4KMQA 2KZ1B 3OF6D 4U6VH 4C57C 5K59E 3O4LA 1G6VK 5HHPB 4R8WH 1FRGL 3EYOB 4PB0H 1BQHG 4W68A 1C16A 4MWFA 3HMXA 4J4PA 4XPTL 3REVA 3MRMA 1BREA 2J8UB 5EWIL 4I13B 1VENA 4N5ED 4YDVA 3KPOA 2SEBB 5BW7C 1UXWB 4GXVH 3TBWB 2YPLD 3BGFB 3WXVH 1AGCB 5JQ6H 1QZ1A 5CBAB 3H0TB 4ODVL 1KB9J 2O5XL 4DVRL 2EDRA 1EHLL 1PY4A 1QKZH 4YHKL 3VG0H 2ICEA 3BGAA 4GAYA 2Z92B 4U7SA 3AS3A 1VFOA 3LEYL 2JJTC 4LF3B 4P23B 4Q58C 1KIRA 2XQYG 2PYEE 4KJYA 1LO3H 4FZEL 4HJ0D 2CO7B 1NQBA 4JQIL 3IDUA 4EUPH 4AZ8A 5I1AB 5GS3A 2C1PB 1AE6H 2NTSP 5TPWL 4A6YL 1DBML 5E5RB 3E1F1 4PJ9C 3EIFA 4PJ9D 3O3AB 3EJZD 5DRNA 5GXBB 2AK4B 2PXYA 4H1LA 5IBUG 4HIIA 1P84K 4FFWC 1AHWB 2WM0A 2FX9H 4BA8A 3F7PC 5GRJL 3EO9H 3DV4A 3OXRB 5CSGA 4L9LA 1Z9MA 2JE8A 1QA9A 2FEDC 4CKVX 2F5BL 4MQSB 1LO2L 3UJIL 3K46A 2XICA 4L3CA 4BQ6A 4PGBA 5ALCL 1KLGA 2HMIC 2K9UA 5KBNC 1B6DA 1KG0A 1N6UA 4E41B 4L9LB 3G9VA 5E95B 1DL7H 4X7FC 1UCBH 1G7MB 2CKBA 4UT9H 4KVNL 3U4EA 4HJGB 1JNLL 4DKEH 3KPSB 1C08A 3QDMD 1K6QL 5CP3A 2A9MH 3Q5YA 4RBPH 1FNAA 4JZJB 4KMTL 5LCVL 2FX7H 5IMKB 3WLBA 2FCBA 4LIQL 1Q8MA 2ITCA 4PJEF 5T3ZH 3DPBA 5IGXH 1JHTB 1FVDB 4QGYA 1I4FA 1XZ0B 2GITB 3QJFA 1A6UH 1I9RL 3PWNA 1L7TL 3BKML 5J11B 5C0ND 3QQNA 3QAZC 2HLFC 2R0WL 1OL0A 4OSUH 1DANU 1E28B 1CDJA 1GJIA 3LKQA 3CX5K 4I77L 3BDBA 1BZ9A 4LLMA 1QLEH 2DM4A 2Y9RT 3U48A 1TCMA 3TT1L 3BP6B 4AQ1B 5LAXA 5JW5B 4HXBL 4K71C 3OKMA 4IRSD 4OGXL 3BZEB 3QFDA 4QF1A 4NC1C 3U6RB 3HC4L 4TQEH 2ESVB 3V2AR 1F6AB 4WWKC 5CBEB 5EBWB 5FUOH 2YN3A 4KDTC 5I71B 2P46B 4AM0B 1GSMA 5HGGS 3LDBC 3WIFB 3HFML 3RWIA 3F8UB 3U6RA 4NPYA 1XF2B 1ZE3C 3CFKA 4HIXL 2CGRH 4FG6D 4JN2B 4L3EA 4HUWB 4FQIH 3QIUC 1DQDH 3U30B 3UO1H 4NM8H 4TYUA 1HOCB 2ICWA 3AS0A 2XTJB 3O6FD 3HPJA 3G5ZA 1OQOA 1VACA 1EVTC 4YGVB 5IOPA 5DMJB 2OI9C 4S1RH 4R0LA 1ZA6A 4FP8L 4PRPD 4JM2A 1FFRA 1LO4L 2EDBA 4Z77A 4JG0H 4QHKJ 1JPTH 1MF2H 3HC3L 5J56B 3K1DA 4LBEA 1A0QH 4WI8A 3VGAB 2ZZUT 3DVNB 1BQLH 4JRYB 1HHIA 1F11B 3L6FB 4Q0XL 4PJHF 3LEVH 1G9NC 3TIEB 1R24B 5FM5M 1MH5B 4HKXB 4HUVB 1RFDL 1DCLA 1A64A 4XNUL 3NFPB 2J4WH 2ZNWA 2F53E 3TZVD 2FLRT 1K5NB 3F7RA 4K3GA 4G8IA 4KJQD 3S35X 5EORH 2F53A 3GJFB 1MCPH 4PJ9B 3VFNB 1TVBA 1WGOA 2PO6B 1YYLH 1KG0B 2OR8A 4P2QB 1UWGL 1WFUA 1JZ5A 1YEGH 4CNIB 1WBZA 3RTQA 3BH9A 3LD8B 4OGAD 1CDHA 3KYAA 1T20A 2WWKT 1U8JB 3I02B 2X4SB 4K94L 1RZ8A 4N9GB 1IKFL 4BQ8A 2BNQB 1U8NA 3L3KB 4IDJH 2WSKA 5AEAA 1CCZA 1O0VA 2X9XA 4KKAD 4PGCB 5E8PB 4ZNEA 4UU9A 5ITBH 1JF5A 4YO0B 4FZ8H 1QHOA 1PYWB 1ADQH 2A73A 3SDXE 2E6JA 3GMLB 2R1XA 5IB1A 2YR3A 5BJTB 1U8NB 4HWUA 3L3KA 3R0MA 1NC2D 2YS4A 4OCRL 3VD9A 5BMFH 1B88A 2M26A 5J1SC 3BIBX 5EG6C 1MI5A 5FA3A 5MEPB 5DUML 1KEGH 5CJ5A 4UOW0 3RUGF 2UVEA 3CH8A 4GG8A 4HQQH 3INUH 3UTZB 1P9MC 4EN3B 1JPST 2GJ6D 2H26B 1IAIM 2DQIH 5EBLB 3NTCL 4JPVL 2RFXA 1WCBB 4DCQB 5DWUH 3H3KA 3TNMA 1LNUA 2P5ED 3FRUB 1KPRB 1MWAL 2VXVH 1Z3GH 1A6TB 2A83A 2Q86A 3MGAA 4EN3A 5EU6D 4D9QE 4BH7B 4GQPH 4MD5A 3QEQA 1U8MA 1ZVYA 3BP4B 1VADB 5D2LA 1DBBH 2X4NB 4KRPC 5DD3L 1VB9A 4ELMB 1UGNA 2VL5B 1JVKA 5TQ0H 4CUCA 2DQFB 1YEDA 3O6KH 4RQQA 3Q2CA 4HT1L 3MO1A 1DZBA 2AI0L 4OM0L 4QRQB 3DLQR 5TE4L 3VXUD 2BVQB 2FJFB 5F6IC 1LO5A 3MRKA 2R23A 1NMAL 5F96H 2ADFL 5BVPH 2VQ1B 2YEZB 3B8YA 1BVZA 4P46C 1JYXA 3AU1A 5MEOB 1S9WA 5KSAA 3FQUA 1FFPA 4WY7H 3VFRB 2JIXA 3CSBA 3QG7L 4OZGA 4D3CH 1IAOA 1I7ZB 4NN5B 4ENEC 4YBHA 3VD7A 2VAAB 5JMRA 2CJUH 1A6AA 4PJAA 1TZGL 1SYVB 2O5YL 3BZFA 1P5UA 3NTCH 4KTDH 3VRLF 5B38A 4K3DH 3VWKD 3GUTB 1I1RA 1IVLA 3U30C 5EZIH 1F58H 3GB7B 3QA3B 3IU4H 4QRUB 1YN7B 2R69L 1I7UB 5EC1A 3VXQB 4OCRH 1PKQE 5LBSL 1ZLVK 1U6AH 4NYLA 1F3RB 2VLRD 5C0IA 2F8OA 1YYML 3FQWB 4HCRL 4HV8B 3P2TA 2VC2L 3REWB 1OAQH 5CIPH 1CL7L 2HTKC 3MLYH 1U8PA 2NY5C 2W9EL 2IPKB 2MHAB 3CLFH 5GJSH 4ODUB 4ZYKA 3ARZA 1NLDL 3KPSE 1FFOA 5F97E 3UTTD 5JORA 3RWJB 1WAAE 2YN5A 4ZOCA 4OIIL 2K3TA 2UYLA 1JF1A 2DI7A 1ZS8B 1RUKL 2EXWC 4BZYA 3NCJL 3AREA 4Z7UF 1WBXA 2JB5H 3SQBA 4DN3L 2E5EA 3L1OH 5L2KE 5I6XC 2FGZA 5LXGL 2QSVA 3V0WH 3AY4C 2G60L 3BJ91 3OAUH 5DQDH 4ODVH 4OGYH 3MRDB 1YJDL 2XTJC 1KJ2A 1ZGLB 4J3XA 4U6HA 2BERA 1GIGH 2RCSL 1LO3L 1EEYB 2ILLA 4MA8H 1PW3A 4WENB 2DQUL 1JRHH 1I1AC 1Z9OA 1ZGLP 2NY0C 4ZTPH 4XWOD 4NNYB 4HK0A 2IALB 4H1LB 2PXYB 4IOFC 2H2SD 2ZUQB 4YR6A 5I1LB 5J3HD 4PJFE 4H20L 1JTOA 2W07A 1OD9A 3MJ6A 3WFZA 3OPZH 4Y2DA 5HDLA 2YUXA 3DXAE 1FZKA 2D03H 4GXUM 3MGTB 5F9JA 4RMRA 4DQOL 5EO9B 2VLME 2X44D 4FZEH 3T0AA 5EU7E 1EXUA 3HTLX 4FQCH 4UTAL 4KHTL 4RMSA 2ZCKH 3EOAB 5EU6B 1U3HA 2PTTA 2IANB 4TVPH 5CGTA 4Z7WA 3PXHA 1BAFH 3DBXB 4L4TA 1XCQB 2AXGB 3FKUS 1GC1L 5JOPE 2GJ6B 1NMCC 1U3HB 5EPMA 4OZGB 1QSZA 5F93C 2BDNL 2P5WE 3I6GB 4FRWA 2VLJB 2ARJB 5SX4I 3QI9C 1QRNA 4PRPE 4AEHH 4G3YH 4YFDB 5ECJE 3O4LB 2IAMA 4CL7A 3MRQB 3FO9A 1URLA 4X9BA 4G8EB 3MOBH 4M6OL 1D5XA 4LPXA 1NSNH 2PCPB 4M93C 5GZNC 3AB0B 1KJVA 4KJPC 3V0WL 4N68A 1IAMA 1R3IH 3BP7A 5SWZB 5FK9A 1LEIA 1XR8A 1KLFA 3HNTH 4JKPL 1FNEA 4GKZA 4KZEL 1XF2A 3REVB 1QLEL 5IKCB 2GUOA 3WNOA 4PYGA 1VERA 4AENB 2AK1H 4PB9L 1XF1A 1DN0B 4OFPA 5C7XL 5HYJB 1BGXH 3LIZH 4YK4C 4XBEH 2ZKHH 1EBPA 1CGTA 5BV7L 3MRLA 3QHFH 2G5BA 2ZJSH 3QRGH 3B9DA 4KRPB 3D0VA 4JPWH 1ONQB 3SDAC 2D7MA 3I50L 1BIIB 1SM3L 2QQNH 5H35B 3SE8H 1JV5B 2NY4D 1T4KA 1J05B 3OSKA 4PGEA 4EIGB 4F8TA 5AWNH 5EO1B 1D5BA 2BK8A 1PGRB 4OJFL 4JRWA 1QACA 5C6TH 2OR9L 3DUUB 4R4BA 1U8QB 3JVGA 4L3ED 4ONFH 4PV9B 5SX5H 2H8PB 3U0WH 2VZ3A 2JJSC 4WFFD 1MRCH 1IQDB 4HW6A 1WWWX 4RWYL 3ZKSD 1I3VA 1UQSB 1X5YA 4XP4H 1JPFA 3JWOC 4YHLL 4OSUL 1YEEL 4KI5C 4NQVB 3RUGA 1A7PH 3TWCH 2F54D 1FIGH 1KTDB 1EH9A 1C08B 3G6JB 4U7MA 3SDYL 1Y6KR 3DSFL 5GRXG 1JPFB 3F7YA 3LV3A 4XBEL 1N5YL 3ZE2F 4X6FA 1INDH 1BAFL 1MWAB 2AK4A 2R9HC 4MJ6B 2Q8BL 1KCVH 4NFBA 4YO0A 3I9GL 5HHOE 43C9A 1JYVA 3QULA 5C07D 1T1XB 4N8VA 1OTUC 1DQMH 2XZQH 4M6AA 5FYKU 4JFHD 5KW9H 5E1AA 1PKQA 2DM3A 1V3MA 3X11B 4N8VG 4P9HH 5D2LF 2PXYC 1RIVH 2I5YL 1IZKA 1I4FB 4QHUB 3FQTA 4ODTH 5E9DD 4BSWA 3O9WC 3D3VA 4FTVB 4GRWH 4AT6B 4JG1L 4WO4C 1QBLH 3PP4L 1P4LA 4FMFA 3HNTL 1MIEL 4GO6B 4RDQG 3LKQB 4U6TA 2PCPA 1IC5H 4GG6A 4TN9A 1SJEA 1U8HB 3RPKA 3MA7B 2DQDL 5FF6B 4X0KB 4AM0A 1YPZB 3WS3B 3ARQA 4JPKL 5DC9B 2DTSA 2EDHA 4IRSA 2MMXA 5HSFA 4KRMB 3CSGA 1I1FB 3MA7A 4HQQL 2P8LB 5FF6A 2NTFA 4ZAKB 4X98A 3MO1B 3IKCB 5ITBL 4HGMA 1ADQA 4F3FA 5FGBC 2F5AH 4LSQH 4D94A 5CEYA 5D4QA 5TE4H 2CUMA 2VLRB 5H37G 1LE9B 5DK2B 5BMFL 1X7QB 3LQMA 4RMWA 1I7RA 3D0VB 3BP6A 3D85D 1UA6H 3DMMB 1UWGH 1JJUA 3FT2A 2RHEA 4TULL 3MYJB 1OCWL 4PTUB 5J12B 4JFQB 2GTWB 2NY3D 1ULVA 1RJLA 4K94H 1BD2E 3C2AL 5EO1A 4P9HC 4HGWB 4MB4A 3ZYOA 3KLHC 5C0AB 2EEDA 3RWEA 4YFLI 3RDTA 1ND0A 3RA7L 3WN5C 4QXGH 1EGJL 3H9SE 3E3QE 4JPKH 4XP5L 5C0CB 3IFPB 2ZWLT 5DD5H 5JQHC 2DQDH 4P59L 3QXTA 4NWTH 4WW2F 2E6QA 4ZFGL 3SDAB 5KSVA 4JO2L 5DD6B 1ODAA 4HKXA 1MH5A 2C4FU 3U4BL 2H3NA 3W0WA 4AIZB 4F7EA 3QUKB 5E8NB 3ARPA 3UYPA 5F21B 3VFVA 3P11L 3OWEA 3NACH 1BM3H 5DZNA 3OL2A 4MXVF 3RWCB 2PTVA 3AAZB 3TYGL 2BSRB 3W0WB 2WP3T 5FHBH 2QTEA 4LCWE 1I3RA 4QHMB 1T20B 4TSBH 1FHGA 1A0QL 5ANMA 3FL7A 1KIPA 4C4KT 4NRYB 3ZL4L 3KJ6L 3KLSA 4GOSA 3QPXH 2Y5EA 2HFFB 3EFFA 5IQ9B 3AVEA 4PD4J 4IS6A 1RUKH 1OB1A 4PPTA 4Y4KC 4Y4FC 1BFTA 1EZVY 4M3KB 1U93B 1I3RB 1H0DB 4X5XB 1ZHLB 5L88H 1K8IA 1X6LA 2A73B 2J6EH 1OP3H 1UG9A 1JGDA 3VFUA 1UJ3C 5HJ3B 5MP6H 4G7VL 1WUNT 1R5WB 1WT5A 2V5TA 2O5YH 3MRIA 4JFPA 5L2JB 3T0VA 2F53D 2OSLA 5F1KC 2NYYD 3WIHH 4XWGH 4DGIL 2BHZA 3ZTJG 4Y5XA 3ZT5A 5ITFA 2W65B 5TFSH 2YD4A 1E6JH 5FYJE 5F8RC 4JZOB 4UDTA 1TMCB 4L3EE 3IDJB 5C08B 3LS4L 3GK8H 3HZMA 2PW1A 2ZG1A 4E9LA 2H41A 3NMEA 1TQCB 3R06B 3F58L 4R96A 1N59B 4HLZH 3NH7L 3UTSD 2J7LA 4Y2DB 4E42A 3QWQB 4JFDD 4PJBB 4Z78B 1M05A 4WI3A 1VGKA 3LSOB 2BRQA 2XWJB 3EZ8A 5IB2B 1LO5B 3BSZL 2L0DA 3SKNB 3T65B 5CUSH 4ZTOL 1SQ2N 5I8EA 5IVNA 3S96A