1ZKAA

Nf-kb relb forms an intertwined homodimer, y300s mutant
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
110
structure length
110
Chain Sequence
b'LVPRGSHMNTSELRICRINKESGPCTGGEELSLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor RelB
publication title NF-kappaB RelB forms an intertwined homodimer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 2
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zkaA00
5C6TH 5GSRB 1WTGT 1BIIB 3DURB 2MQ0A 2H6PB 3KYKH 4FQHA 5LVEA 5TE6L 2YPVL 1U93A 4P59H 4YBHA 2FX8L 3L3HB 2Y23A 3ISWA 1IAIH 3BT2H 4K07A 1O0VA 1IGTA 1F90L 5FYLL 5EN2A 5ABDE 2VL5A 4JFFE 5DO2D 1OQOA 1CF8L 3RWDA 1XGUB 3U79A 4OZIA 2H2PD 4JAMB 4RFEB 1VGEL 5JO5B 4HWZA 3L3IB 1RZJC 4HC1A 3LQAH 1KB5H 1RURH 4JPWH 3I50H 5HDBE 3V6OC 4OGXL 2R2EB 3QXAA 5H2BB 1CR9L 3BZFA 5IGXL 2A1WL 2Y6SD 5E08L 5E6IC 1E4XL 4JFEA 3T0EC 1S3KL 3QG6A 4X98A 1S7UA 4XMKH 3BHBB 5DHXB 2RHEA 4U1LA 3BP4B 1NCWL 5EZIL 3GKWL 1YEFH 4BH8A 4WWKB 3HI5L 3MRJB 1D9KD 1UWXK 2W9EH 5I8KH 3VFTB 3MZGB 1J86A 1NANH 2VXTL 4P9HL 4Y4FC 2OYPA 3UYRH 3SE3C 2XQYK 3TIDA 1QR1A 3JTTA 1T80A 3FHAA 1B0WA 4XMLH 1G9ML 3AXLB 1R0AH 5DURD 5AZ2H 5I66B 2VO5A 4DTGL 5IFAH 1F00I 1I3GL 2FJGA 4N90D 1F4AA 4U0RC 2V2TB 3T0VA 3KHOA 4Y5VB 3MV9D 3PDOA 1YNLL 4ZPVB 1YYMH 1YMMB 3QUMA 3VXTB 5GRJH 3GMPB 4PYHA 5B39G 1S9YA 4JFZL 4JKPL 1SJVA 4HD9A 1E6OH 5JW3L 1GAFH 5HBBA 3BRFA 5E94A 4KHXL 4HEPG 1IQWL 5IG7B 1I7UA 3QCVL 3OHXB 2IAMA 1OD7A 4JKWA 4OLYL 3CK0L 3JTSA 2KZWA 3GNMH 4OD1H 5HHMD 4L4TA 4ONFH 4YBLB 1AXSB 3TC9A 1T5XB 2AEPH 4C58B 4K94L 1EGJL 2P24B 1AGFB 1MCWW 2P47B 3IU3A 1H15B 5EDXA 4P5TB 2DAVA 2VQ1B 4JPKH 3E6HB 1NC4B 1UWGL 4G6ML 4JO1H 1AE6H 1MJ8H 4RSVA 4JFYA 1FJ1A 1AFVH 2R9HC 3RGHA 2YD1A 1A02N 2X70B 4F37K 3FO0L 4PGCA 4G42B 5J1SC 3H9HB 1IGFH 5DEGB 4U6TA 4LPUA 4XNMB 4P5MB 1YDPA 3RZCC 4M93C 1U8IA 4X9IA 3AY4A 4AQ1B 3MCKA 3EGSA 1A0QL 2X4UB 4HIEA 3L9RA 2DKSA 3LEVL 3BKYL 5JMOC 5HDBF 4H26A 4M5YH 3BH9B 3S4SB 1JNNL 1F2QA 4ALAL 4HKBB 2WBKA 2AP2A 5TE6H 4PBWD 3QDJD 5T1KB 3JUYA 3N0PB 2FX8H 3VGBA 1NUFA 5EU4A 2MKWA 3CSBA 1A5FL 1JGUL 3UPRB 4BUHA 2DQDL 4Q9RH 4UZGA 5GRVL 3WL9A 2QR0A 4FFVC 5F21B 1OPGL 3BN9D 3NPSC 1BBJA 3PNWA 1HYSD 3ARYA 3V52H 4RAUA 5CIPA 2F58L 3MJ9L 4G80A 4HWBH 5GS2D 3CFDA 3LMJH 4LQFL 2OK0L 3DNKA 4Z7VB 1XGTB 3L95B 2C3XA 2FIKB 5IMOB 3NIDE 4APQC 1EJOH 1JHLH 3QDGD 4KKLD 2X41A 3S35X 1G7IB 4XXCC 4EIZC 4YHPA 3RKDD 2VISA 2IAND 5DRZA 1HCFX 3SE9L 3GSQB 4P57A 2HRPL 3SDDC 3BQUC 4P46A 5IJVB 5F93C 1XGQA 4E9LA 2HTLC 3KJ6H 3NABH 3DBXB 4LEOB 4DTGH 1UACL 4QRUB 4LCCC 5DRWA 5CEYB 2HFFB 2NY2C 2YD2A 4XWOD 1G6RL 1T0MB 1UJ3B 4GRLB 5BRZD 4HFWA 2P5WA 1NDGA 3GSVB 1YNLH 4DKDC 4I18C 4N1EA 4LVHB 3EYVB 3BESR 4CADA 5CD5C 3BUYA 4OKVB 3RY6A 4QGYA 3BPOB 4FP8L 3DHMA 4Q7DA 1YQ2A 5E2JA 3ZE0E 4L29B 2AQ2A 2VLKB 5FYJE 1NMBL 5JW3H 3C5ZB 1ZHNA 3UX9B 2GIYA 3NH7H 1LEGA 4KHXH 4XXDA 5LQBL 1IQWH 5C8JB 4UB0L 5TDNB 5I8CA 4JFDA 1HWGB 2ICEA 3QIWC 1FRGH 2I9TB 5HHXH 1FCCA 2Z4QB 1QRKA 2FO4B 5I1KL 4Z7VE 3K7UA 1T7YA 1UB5A 3HKFA 3DO7B 1KLGA 4MQXC 2EH7H 1B0GA 3GDBA 4R97C 1ZV5A 3MV11 2PNDA 1RY7B 2DI7A 1H3UA 2H26B 4JO2H 4LP5A 5GS0H 3OG4B 4IJ3B 4P2QD 1JWSA 5E0QA 1WITA 3HPLA 5J3HC 4NUJA 3WO4B 3QXDB 1PLGL 2AS5M 4G6MH 1UWGH 1HHHB 4BQBA 3BIKB 4PRIE 4QTHA 4RFOL 2AGJH 3EZ8A 4OGZA 2BNQB 3SO3C 2C1OA 1YECL 3CFEB 3TBSA 1FQ9C 4F7EB 4OZGE 4Z7OE 1F11B 5ECJE 2P44B 5E95B 3S9DB 4TUKH 3CFBA 4Y16B 2HVJB 3VFMB 4Z95L 1IZJA 1KCSH 2AKRA 2VIRA 5FO9B 3QULB 4F7PB 2CJUL 2VLKE 4JDVA 4ZDHB 3I6LE 3TJHC 1TCRA 3GIVA 4J6RH 4M5ZL 4PJFA 4DKFH 1BQHG 3NIDF 1FCGA 3H3BC 1P69B 1YN7A 1S7TB 3GK8H 4GAJL 5DMIL 3SY0B 5DQ9B 3NA9H 3QIBB 2WBJA 2ED7A 2NMSA 3DX6B 4WENB 2DQCL 2DQGL 4F15B 2DBLH 4WO4D 4H0HB 4DW2L 4NKDB 4EVNB 4G5ZL 5C0DB 4LHQB 4OLEA 1Z3GH 4RX4A 1IRAY 2GSGA 2X9XA 4EN3B 4BUGA 2BY3A 3PGCA 4S2SA 4FTVE 1M05A 1DUZA 2AK4B 3CJJA 1R3IH 3TJEH 2ZJSL 3WUZA 2BNQE 1TVDA 4I0CC 1DQML 4IDJL 4JO3L 1N3NB 2ITDA 3STLA 4U4BA 3GSUB 1YEKL 1S7XB 1CU4H 5IM7A 3PWPA 1K8IB 5CZVL 1XR9B 1BECA 3ZE0F 5DMGC 3UZQA 2P5ED 1S5HB 4K2UH 1BFTA 1NUNB 3ILQC 3ROLA 3SE9H 3LEYH 3L5WB 5JOFB 4N0CD 4V2CB 1T22A 5T33H 4Y4KD 3VWKA 4H5SA 4YGVA 4JG1L 1UZ6E 2MCPH 5C08B 3IFLL 3X12A 3ZYZA 2Q86B 1UACH 1RJZA 4XH2B 4Z7VF 4PLNC 4MWFB 5CLWA 2R1XB 3B3IB 1DSFL 3DUSB 1KXTB 5LAXB 5I1HH 3G5ZA 3ARGA 3OAZH 1WF5A 5CJBA 3DVNA 5B8CC 2ZSWA 4NFCA 1WBZB 1X44A 1FH5H 4XRCB 5DZLA 3THML 1U3HC 1BGXL 3T4YB 5I75C 3IJYB 2Z92B 4ZO7A 2P8PA 1I1AA 3IB4A 4NQCA 1SM3H 5HJ3A 1EMTL 1XT5A 5GGVL 1UCBL 2VDMH 1IGYA 2AQ1A 4UB0H 1QFHA 5JW4M 4F57L 4LVNB 3TA3C 2D31A 1DUYA 2IPKA 1XH3B 4OZGF 4JKMA 4Z7OF 2AK4E 5C0JB 4X6CA 5DEFA 2UYLA 5MERA 1D5IH 1CD8A 3FFCB 4Z76A 3LOWA 2VMFA 1EO8L 3SDCA 1JNHB 3QDHA 4QRPB 5CJOL 4Z7UB 1QFWI 4I5BA 1DFBH 2GJJA 1LE5B 2YC1A 5DJ8B 1MI5B 2HYMA 5EA0L 5I1EL 5FF6B 5C0AE 5ID0B 4OCRL 1E27A 5JZ7C 4BFIA 5CP7B 3GSNH 1GPOL 3O3DB 1C7TA 3DECA 4OCMC 2A74B 5C08E 1UM4L 5HYJB 1Z0NA 5BVPL 1KJMA 1RZGB 5AYUL 2NXYB 5IVNA 3BZ4A 4W4OA 3VFVB 1CICC 3L3OA 4RISH 5ESQB 5D7KE 5CJQL 3WFHB 1ZHKB 3PIQA 2HAZA 3VH8A 3MLZH 4R6UA 1T3FB 4Y0GA 3WLWC 5EWIH 4DGVL 3IT8D 3LHPL 4GT7A 1DL7H 1P7QB 2JCCB 3P30L 4NC2B 3I3DA 5JUEH 1QYGH 3OKMA 5D7JD 4OFIA 3PJSB 3FQXB 3EFDH 1L7TH 2JB5L 3FFCE 4JGMA 3CPLA 5EOCH 1VFAB 4QRPE 1DBAH 1UZ6F 1FYTB 3N85L 4Z7UE 3GFUA 3ZKSD 4IMKC 1MI5E 2LTQC 1FDLH 3OX8B 3ZYJA 3GM0A 4LRIA 4DVRL 3AGVA 2DTML 4XCCH 1LD9B 5EIQA 4FNLL 2R0ZH 2ZCLH 4IDJH 5HYJE 4JRYA 4A6YL 3NFPB 2IADB 1A6PA 2DQJL 5CZVH 5ICZB 5D9SA 4KDWA 4JY6B 3BGMB 4MA7H 3SKNB 1CT8A 1UEYA 1C12A 2BJML 3P2TA 4I48B 4P3WA 4UMGA 2VC2H 5BZWA 3GMQA 3MLWH 1K4CB 1OP3K 2VDQL 4PJHB 5JLZA 2PO6D 3PL6D 5ITFA 3IFLH 4ZODA 5T1DL 4NN6C 5DVMA 2C4XA 5DFVC 4GFTB 4RZCA 2FATH 4OCLC 5C0EA 1GIGL 2JCCE 4DAGL 4QXTB 5F70A 5DJYA 3TNMB 1CD0A 5BVJA 1G7PB 5EU6D 5D5MB 4AEIL 4HK0B 3KYMB 1U8OA 1UG9A 4OIBA 5DUPL 1S5IH 1FYTE 3TV3H 4AM0A 1WCBB 5IR1A 1EMTH 3WLBA 1CFTB 4MX7B 4JPVL 3KWWA 4J8RA 4G7YL 3WKNA 5EUOB 2VZTA 3EYUH 4LARL 4WJ5B 1QLEL 5TQ0H 3QDMB 2E3VA 5C07E 1BD2D 1R3KB 4HKXA 2J3SA 2AVGA 4X5WB 3BO8A 2H1PH 4ZNEA 2CKBH 3CVIL 1XGRB 4WEBL 3BPCA 1YN6B 3DTXA 2OL3L 3EOTH 5GSRA 3DURA 2H6PA 2OI9C 4D3CH 3L3HA 1K3IA 1BZQK 4UAOB 2EH8L 5BS0B 2XG4A 1DR9A 1KF9B 2Z0BA 5D7SH 3H0TB 3H3PH 1XGUA 2IAMC 1OWWA 3OR6B 4MJID 5L2KE 3BKJL 2CH8A 3LB6C 4JAMA 3MOBH 3QEQB 3HC3L 4RFEA 4A6YB 1KTDB 1Z6JT 5JO5A 1CL7L 5CGYD 3L3IA 3O9WC 1QFWM 5C92A 4Z7UF 3QZWB 5EH1A 1J05B 1X5AA 1LO3H 3F7VB 2GFBB 1ZGLP 1FO0B 1KCVL 2R2EA 1PAMA 5CJQH 5H2BA 5D5ME 2WUBL 1MJ7H 5LBSH 4PLJD 3GJFK 5I76B 1HH6A 4JFXA 4N0RA 4MZ3A 5IB5B 3M17B 5FA3B 3BHBA 4M4RA 2G60L 4DGVH 3BP4A 3LHPH 5I0ZA 3BW9B 4WWKA 2AAVA 1EHNA 3MRJA 4GAFB 5DS8B 4TSBL 5EUOE 3TWCL 1OF2B 4FFWC 4NC0B 3QDME 5DFTA 3VFTA 5I1JH 4KDVA 2Z31D 4NP4H 3AY4C 4MA3B 3S37L 2AK1L 4U31A 1AHWB 1FVCB 1IAKB 1XGYH 3AXLA 5C0BB 4LSSH 3O6KH 5DD5L 2IFGA 4U1HB 5I66A 1KIPB 1OTTC 2BSRB 4KTDL 3UJTL 1KV3A 1A4KB 3SDYH 2V2TA 3MODL 4XP5L 4XC3L 3SQOL 2HG5B 2JCCF 2ZPKH 4Y5VA 5BS0E 4ZPVA 1IT9H 2YKLL 5L0QC 2WIMA 1YMMA 3UMTA 1FN4B 1W0WB 2RFXB 3VXTA 3CMOL 3QQNA 1KT2B 3GMPA 1Q9KB 3QEQE 3CUPB 3VD3A 4JHZA 4Z5RB 5KTEH 1ZT7B 5J11B 2G2RB 1JZ3A 5IG7A 4P2RD 3JXAA 1U6AL 3OHXA 1EEQA 3FT4B 2NZ9D 3HZKB 4PUBL 3VXSB 3CZFB 3TH3T 2DD8L 4PB0L 1CGSH 2RAMA 4R26L 1CFBA 1RUAL 3DI3B 4HJ0D 1W72H 4ZOEA 1AXSA 1IAII 1S9KC 2R8SH 4DAGH 5TDOB 1T5XA 4NRZB 1J1OL 2FB4H 2CO7B 2P24A 1AGFA 4OJFL 1H15A 1BQSA 2DQHL 2XA3A 3RDTD 4I0PD 2ARWA 4P5TA 2XICA 2VQ1A 4XPTH 1IAMA 1NC4A 3E6HA 1B4JL 4CMMB 3V5DB 4WTZA 4H88L 1BM3H 1V7NH 1R3HB 3KPLB 2X70A 4G42A 2I27N 4POZC 3H9HA 5C0BE 5DEGA 4HS8L 2CMRL 4P46C 2HLFD 3BEWA 4P5MA 4XNMA 5D1ZB 1MWAH 3PDDA 1HQ4B 4KK9D 4BSVA 5HYEA 2AI0L 1NGXB 4TUOB 4ZSOE 2DI9A 2X4UA 1RZ7H 2ICWJ 3RP1A 4DKEH 5A1AA 5HY9B 3CVIH 3QNZB 1OGAD 3U1SL 2OL3H 3QWRD 3BH9A 3S4SA 3A6BH 5E9DB 1FAIH 4NWUH 5D5MF 1AR1D 5FYKH 4HKBA 3RY6C 1P7KB 3FMGL 1FGVL 4NM8L 4GW4B 1NANI 4P3DB 3GMRB 1DEDA 3VXSE 3KYOB 4JHBA 4BK5A 5EUOF 4ELKB 3UPRA 1ADQL 2DIBA 5F1IB 2W60B 3BKJH 4Z6AT 1ZE3C 4DVBB 4L1HA 3HC3H 5GGQL 3DMMB 4IDLA 3MCG1 2WWKO 4PP1C 1A7QH 2MCG1 2VZSA 4B41A 1KCVH 4JGJA 1FV1A 2YD3A 4GH7B 1FL5B 1NKOA 2F53B 1EVTC 3L7EB 1XGTA 4Z7VA 3L95A 4GAYB 2FIKA 3IDJB 5IMOA 1L6XA 2EIDA 3MLYH 1D7FA 4LSUH 1SJEB 3UJIH 3VWJD 3ARBB 1NCAL 1G7IA 4XTRD 1YEEL 2EEDA 5DHVH 3RA7L 5KJRH 4N8PA 3V0AC 5GPRA 2ZSVB 4JHWL 3L3GB 1EGJA 1UC6A 3P4OB 3GSQA 3BE1L 4LASL 1VFBB 2YPLD 3VFUB 5IJVA 1CFQA 3DBXA 12E8L 4MS8C 3ARED 4LEOA 4YBQD 3ABZA 5DD5H 5AZEH 3LKQB 4QRUA 3TF7C 3QQ4B 5CEYA 2PYFB 2HFFA 3OKLB 3HNVH 3R8BB 3WNMA 2H3NB 1T0MA 1UJ3A 1FNAA 1EJ6A 4GRLA 4LMQE 4XC3H 3U4BL 3GSVA 2CRMA 2C7UB 1QBLH 3EYVA 5D1XD 4QHLA 1KTKE 4OKVA 3U9UB 3AFLA 1ITCA 3QAZC 4P99A 4L29A 2VLKA 5IBLD 3IFNL 3MOQA 3HPJB 1LK3L 3C5ZA 5D96B 4YC2B 1OTSD 4ELME 3O3UN 1GGCL 5C8JA 1HDMB 1QSVA 5TDNA 4Y5YB 4WI6A 3IAGC 3AC0A 4PB0H 2I9TA 1I1CA 4LSDA 2Z4QA 2F53E 5KVGH 3WIIL 4XPHL 2FO4A 1OLLA 1C5DB 3FJTA 3ZDXE 3GRWA 1X6NA 1YNKH 5JA9A 3ULUD 3DO7A 2R15A 3R8QA 3PHOB 1EFXD 4GLRH 2IQ9H 4ODSL 2H26A 3HUJE 4OJFH 3TIEB 2QQKH 1TJGL 1GZPB 1XZ0B 1EHAA 4RIRB 3QXDA 3D1MC 4Y4HA 3BIKA 4WGWB 4KVNH 1CD1B 2BNQA 4KROC 3CFEA 1OM3L 1OAQL 3VWKC 4WDIA 4C4KT 4OB5L 4F7EA 4XPFL 1I7ZB 3LN9A 1F11A 5GS2H 1QD0A 1MRCH 4XGZB 3VXUB 4PY8J 3V0VB 5DK2B 4Y16A 5EPMB 4YX2H 5F89B 2HVJA 3BKCL 3VFMA 1TDQA 2X1QA 5FO9A 3T3ME 4F7PA 2VXUH 4RWHA 1QOKA 4EOWL 4M4PA 4QRRB 2E7BA 4WUUE 2KQMA 4QT5B 1YZZA 3CAFA 5F7UA 2NCMA 1GC1H 4OLVL 4NUGL 4MNQB 1I1AC 4UIKH 1EAPB 2EC8A 4DQOL 1MQKL 1ADQH 5D7LB 3WIHH 3BRGC 4JQIH 5DQ9A 3SY0A 2VTFA 2JE8A 3QIBA 2VDKL 4GMTL 3DX6A 1J12A 3G04B 3FB6A 3I3BA 4NQVB 5JIIA 2CK0H 3J8F7 4NJ9H 1K3ZA 3EYOB 4QXGH 1PW3A 4NKDA 5C0DA 4EVNA 5HSFA 4PRAA 4Y19D 3SDCC 2NY6B 4EN3A 4KWUA 4DUXA 4OGYH 1MCOH 2AK4A 3BH8B 5JXAL 5KSUA 1I9RL 1T66C 1MFEH 2ESVB 1HXYB 2WINB 1N3NA 1KN4H 3MRQB 3RBGA 4NHUB 4R90H 3GSUA 3QFJB 4YNYB 5IKCB 1S7XA 1P5UA 1K8IA 2EDXA 3KR3H 1XR9A 5F6HI 2EE3A 2XN9B 5I1LB 5I1GH 1F8TL 1TENA 4XBEL 1S5HA 4G6FD 3VXUE 1TNNA 3BGFC 3L5WA 4ZO9A 5JOFA 1KEGL 3I2CL 4ELMF 4JVWA 5E6ID 5AEAA 4O2FB 1W0VB 4W4OC 4XVJL 5JOEA 3T0ED 1P9MA 2OMNA 4XMPL 5C08A 5IVXB 2EDLA 1NBZB 3L5JA 4QRRE 4ZOBA 2Q86A 5EU3B 4JN2A 3MLRL 4XH2A 4M62H 4MWFA 1IC7H 3ZDXF 4K9EC 3SGEH 1NCDH 2R1XA 3B3IA 3S34L 3DUUB 2WMPA 2D7PA 2XWJA 1AIFB 5DD3H 2NY7L 1NGZB 5LAXA 4Y4FD 3HUJF 5D7LE 2V5RA 3NBNA 2F19L 5FDWB 5GGVY 5DQDH 4X4ZA 1WBZA 4QKXB 2OS7A 5J57B 1JRHL 4W6XB 4XRCA 2VLRD 3LEXB 3UZVB 1INDL 5JOPE 1UH4A 4X7FC 5ACLA 3BN3B 3IJYA 2Z92A 5J8OA 5FHBH 4PRBB 5I71B 2JJUA 5C09B 4H8WC 3ZT7A 3MUGB 1RD6A 1XH3A 1ORSB 1KJ2H 3C09C 5C0JA 3DSFL 4XPHH 5J1AB 5CILL 2ESVE 2O5ZL 4JJ5B 2ZCHH 4LRIC 3FFCA 4V1DD 1J0ZA 1CDJA 4G7VH 4G6JL 4EI6B 1JNHA 1U8MB 3QFJE 4QRPA 4Z7UA 1X7QB 2JJVA 3T3MF 2XN9E 1LE5A 1MI5A 1OSPH 3MLTB 1TJGH 1NCUA 5FF6A 2EDYA 4J12A 2QQNH 1EBPA 5ID0A 4JY5L 1WUNT 5CP7A 3D18B 3O3DA 3TZVB 4ZMAT 4KJYB 2YBRA 2C3HA 1A7BA 2A74A 5IVXE 5HYJA 5T3XL 4X4YB 1RZGA 4OB5H 2R29L 4QRTB 3KPSA 4NO5B 4QXWA 4OZHB 4P2YA 3VFVA 3D25B 5ESQA 1JYXA 1F5WA 1FZKB 2FZ3B 3W82A 4OM1L 4LPXA 3VDAA 5BO1H 2DMCA 4HCRL 3WFHA 1ZHKA 2R9HD 4LIQH 3SPVB 1UWEH 4MAYB 4BM7A 1ZWIB 1JGVL 1MFBL 1N0XL 3QPQC 3RZCD 1BJ8A 1MAMH 5C09E 1P7QA 2JCCA 4Q9BA 2NW3B 3M1BB 2WUCL 1J1XL 4FQXB 4UTAL 2ORBL 3L3DB 4EXKA 3A6CH 1AKJB 4UILH 1J5OL 3FQXA 3UAJC 3V4UL 5CP3H 4GMTH 5C0IB 1VFAA 5FM8A 5IHUH 3C2AH 1FYTA 4L3EB 5F9DC 1RAMA 2XACC 2DQUL 1P84J 3DIFB 2BVYA 3BPNB 1I8KA 1MCQA 2ATKB 4YHYB 1LD9A 5J13B 3CLEL 3BYYA 2QHRL 35C8L 3NFPA 1ZLVH 4FFVD 2IADA 4LSPH 4TVSa 5ICZA 3VD4A 2DMBA 3MUHL 3CGTA 1F4XL 3SKNA 3A67H 4OZHE 1S7QB 4I48A 1A6WL 4XPGL 4XBEH 4X9BA 1U8KB 1KEGH 3MCLL 1H3XA 3C87A 5T5FH 4JPIB 1K4CA 3E8UL 4XVJH 1JNJA 1QFOA 1HKLL 3D3VB 4PJHA 5JW5B 4XMPH 1BVKB 3MRBB 3RFZC 4APQD 3GJEB 4CJ1A 5C0GB 3P9LB 4XP4L 3F7QA 4QXTA 4N5UA 1RIUH 5DT1L 2NY7H 5KAQF 3CU1A 4WWKC 4K7PX 3TNMA 1G7PA 4ODHH 3SDDD 3PP4L 3BQUD 4IOFD 3TO4B 4EQ3A 2Z8VC 1PKQB 4HK0A 2C3GA 4FQ1L 3KYMA 2DLFL 5EORL 2HFGL 1IZKA 2QEJA 4JM2B 3MLPA 1WCBA 5IB3B 5IVXF 1CFTA 2GY5A 3B83A 2NY2D 4MX7A 2DMKA 1BOGB 1WBYB 3INUH 3T2QA 4NHCL 2ADJB 5F7LB 4WJ5A 3QDMA 3UZEA 1R3KA 5CD5D 4LLVA 4X5WA 4XNXH 5I16B 5SWZE 4Y5VC 2NQCA 1XGRA 2EIZA 5H35B 4CW1B 1YN6A 2XXCB 4OTXL 1J88A 2XKNB 1MFNA 1LWRA 2BMKB 3MV8B 2CGRH 2PF6A 3G6AB 3QIWD 1WIUA 5GGUB 3WSQH 5BS0A 2W59A 3D3VE 3EO9H 4CU8A 4G9DB 1FGNH 4JANB 1T0NA 3H0TA 2ZG1A 4XVTH 3BKMH 3OR6A 4HQQL 4MQXD 3ZDZE 5JDSB 3GMNB 2R29H 3QEQA 4DN4L 4A6YA 2A6KB 1T5WB 3HG1E 1UKSA 1PFCA 3MA7B 3QZWA 1J05A 3QSKB 3D2UA 5J3HD 3ZKXB 5AG8A 1FO0A 4OM1H 1AQDA 3AB0B 4PRPD 4HCRH 3CSPA 1PKQE 1SQ2N 3M17A 5FA3A 1TZHA 4AEHH 4P5TC 2QQLL 1MFBH 1N0XH 4P2OB 4MYWB 3FO1A 2BVEA 2ZWLT 3BW9A 3O2DL 3RJQB 5DS8A 1AH1A 1J1XH 2HMIC 5AUMA 1PDKA 1OF2A 5IW3A 5CEXB 2Y9RT 2ENYA 2VDLH 1IC4L 4OZHF 1J5OH 3LQZA 4MA3A 1AHWA 4M7ZB 3TJHD 4P9HC 5C0BA 4PTTB 1BPVA 3HE7B 1LDSA 3MRLB 4U1HA 1JZ4A 1KIPA 2BSRA 3P0YL 3MV8E 2HT4C 1A4KA 2Y36L 4JO4L 3DWTA 1YY8B 1BZ9B 1G9MC 2HG5A 5GS3A 3BSZL 4I77H 2HT2C 5FECB 5KVDL 1UM5H 1W0WA 2RFXA 4JG0H 1VFUA 1KT2A 3HZVB 1Q9KA 4OSUL 4FQCL 1LDPL 2BSSB 4U6XB 3CUPA 1JGLH 1OAXL 3LS4L 4ODTL 3DRTB 4Z5RA 2YMXL 1JJUA 2A6JB 1ZT7A 3MCLH 3UXFA 4WW2B 2G2RA 1IEBB 5CEZD 2XPGB 2IG2L 1LO2H 3FT4A 3E8UH 4N8CL 3HZKA 3VXSA 1JWMB 2VLJA 4XP1H 2G75B 2W9LA 4L8SB 3CXDH 4YFLI 2IALB 4CDHA 2NY0B 4U6HB 4TRPL 5EOQH 2VN4A 1VADB 3SKJL 3UYPA 3ZSSA 5TDOA 4NRZA 3NA4A 4PS4H 1X3DA 3ILQD 1E4WL 2ED8A 3KG5A 4BELD 2P8LB 2VDNL 3FRPA 2V2WB 4P9MH 4CMMA 3V5DA 5IOPB 4PJ5D 1R3HA 3KPLA 2PXYB 4I3GA 1PZUB 1FFOB 2YD6A 5D1ZA 1C5CL 4X7EC 3RJDA 1LGVA 3RAJL 5DC4B 3MPCA 3ZDZF 3T1FB 3LN4B 1T7VA 4LPWA 4XHJC 4B7LA 1HQ4A 5BCAA 1Z0MA 1NGXA 4TUOA 5FYJU 4B5EA 1MRFH 4K23H 4OZFG 1UJ3C 4GRLC 5HY9A 4NFBA 3QNZA 5KW9L 4Z8FH 4DGIH 2EC9U 3DYOA 1U3HD 4LVHC 1X5IA 5E9DA 5D2NB 4KAQH 1ZANL 4RGMB 1P7KA 3BPOC 4U1NB 4M8QB 4GW4A 3RIFK 4JM2F 4P3DA 3TYGL 3UTZB 4TPRH 3GMRA 4KPHH 2BDNL 3KYOA 2ZCKH 3AS0A 4ELKA 2PYEB 1FIGH 4YHZL 4LCUB 4WHDA 3G5XB 2W60A 1PY9A 5C7XL 4DVBA 1ZGLM 3DMMA 3ZKMC 1H5BB 3KHQA 4HXBL 4IRJA 5HGDB 1TQCB 3WNKA 3VW3L 5JZ7D 4RAHA 1F3DH 3L3KB 5DD1L 5CD3B 4TULL 1FL5A 2P1YA 1Z9MA 2BY2A 4IJ3C 4BSJA 1BJ1J 5F88B 3L7EA 4O58L 4Z18A 2QQLH 4GAYA 4LCYB 3WO4C 2VL4A 3IDJA 3QJHB 1PSKL 1MREL 4Y4HC 3O2DH 1SJEA 1HKFA 3ARBA 2AXJA 4GOSA 1P4IL 3PUCA 1CICD 4HF5L 3GSWA 1WAAE 2V7NB 2ZSVA 3MGTB 3L3GA 3NCBB 2G9HB 4UV7H 3ULUL 1RZ8B 3J7HA 3P4OA 2GK0A 5HHPB 3LDBB 3QG7L 3U36B 1VFBA 3VFUA 1ERNA 5D2NE 3GO1H 3TCLB 3WLWD 3OJVC 1UM6L 5HYIA 3P0YH 5C86A 2PYFA 3OKLA 4RGNE 3QO1B 4OQTL 3UTQB 1JNLH 2CRZA 2FECL 2H3NA 4NDMB 2IMNA 3RBSA 1A22B 2C7UA 1YEIH 3CLFH 3QCUL 3WE6B 1U9KA 5KVDH 3U9UA 4P3CL 1O7SA 4OSUH 3TT1L 3JWDL 3LH2H 1YJDL 1OAXH 1T1WB 2X89D 3QIBC 3HPJA 2YMXH 2ICWB 3GJFB 4U1GB 4N0YH 3U0WL 1VENA 4F15C 1A3RL 4N8CH 1UYWH 1U36A 4YDKH 5E8OB 4BQCA 5JQ6L 4EN3C 3FAXA 4I9WD 2NXZB 4O4YL 3NGBC 2DQEH 4KRPB 1MEXH 3GHBH 3PHOA 4LGSB 2Q8AL 2IFFL 3LPFA 3TIEA 2MOVA 4M7KH 1GZPA 5IIEB 3MRPB 1XZ0A 4RIRA 4DUWA 4WW2F 4EXPX 1A9EB 3UROR 4PJ9B 1CD1A 1RFDL 4MXVE 4UOJA 5IQ9B 5LWYL 5DFVD 4KUCD 4JFED 1U8PA 1P9MC 2WWMC 3SDAB 4QNPE 1JPTL 1I7ZA 4GSDL 4BFEA 4XGZA 1IKNA 1R6VA 3KLAB 4O02H 1DN0B 3VXUA 5IP4A 3STZB 3V0VA 2DN7A 4WFED 5DK2A 5E03A 3BWUC 4G6KL 5EPMA 4NT6B 5F89A 2YPKB 4Z78B 5DXWA 1IEAB 3NCEB 4Q6YA 1RZJL 4R0LB 4R8WL 3ARZA 3MLXH 1ZANH 5CLTA 4QRRA 4QT5A 3EYFB 1MRDH 5HD8C 1KPRB 5D2LB 1DBBL 1QUNA 4YDVB 2UY6A 3SGDI 4IIQC 1HSBB 4XNZB 4MNQA 4EUPG 1M7DB 3N1PC 3BWAB 1EAPA 4CRPA 3QPXH 2X4RA 4Q97A 15C8H 5D7LA 1JE6A 1OAUL 4LVNC 4YLQT 2XFXB 5E2VL 1WAAF 4FZ8H 1P7HL 3G04A 1F02I 4NQVA 1KOAA 2F8OA 3TN0B 1A6UL 3EO0B 3EYOA 3TT3L 3CFJB 1IGCH 4XPAH 4LCWB 4FABH 2EDFA 5DD1H 3MJGX 3HNSL 2CLVB 4TQEL 4YDIH 1U3YA 2J7LA 3BH8A 4KQ4L 2ESVA 1HXYA 2OXGA 2IAMD 2WINA 3MRQA 3LB6D 4NHUA 1MNUH 3OJMB 3QFJA 5IKCA 1OP9A 4I8DA 4YNYA 1P4IH 1DQQB 4AMKH 2XN9A 5I1LA 4HF5H 4PRHB 1PKOA 3FB7B 4L4TD 4WI8A 5KSAB 3Q48A 3V4PH 4ESKA 2H32H 1RUKL 4O2FA 1W0VA 2KQNA 1CE1H 5IMMB 1X4ZA 3W2DL 5IVXA 3KYNB 4PJ8C 3CDGB 4U2YA 1NBZA 5EU3A 1WT5A 3A0OA 5D2LE 3H6JA 2FDBP 2B0SL 3CH1B 1MUJB 3DUUA 3T2OA 4FFWD 4NNYB 4XC1H 1MIML 1AIFA 1NGZA 3LPGA 3O3AB 4ODWB 4P3CH 5FDWA 2FEDC 1EFQA 3MLVL 2QLVB 3LEXA 3U4EB 3B43A 5K33A 5C6WH 1OTTD 4PRBA 3O45B 5BV7B 4MXVF 4LCWE 3MUGA 2QSVA 3BUTA 1MHPH 1ORSA 3HMWH 4HBCH 4HFUH 4QNPF 3IVKB 5J1AA 3P77A 1I3VA 4LBEB 1UXWB 1LP9E 4JJ5A 3ARDB 3MNZA 3CDCA 4O4YH 5DJ2B 1AC0A 3K46A 4EI6A 5JTWA 2IFFH 1U8MA 5IFHH 1X7QA 3V8OA 2FD6H 4PRHE 1CDHA 2Q20A 3MLTA 3MZTA 5GS1B 4XCNB 2ED9A 4BFBD 1CFNB 3D18A 3TZVA 4FA8A 1ZEAH 3IAQA 4KJYA 5ANMB 1CLCA 4BKLB 4PGDA 1MCBA 1RFDH 3D87B 4X4YA 1MY5A 2HWZH 2HKHL 1IJ9A 3O6ML 4QRTA 4NO5A 2LABA 5IMLB 3C5JB 4ONGH 4HGWB 2UUDH 1Y6NR 3D25A 3Q1SH 3HNTH 3MJ8B 5B3JE 1MELA 4I3SH 1OP5K 5GZOC 1FZKA 2A77H 2FZ3A 5HDLA 5JHLL 3O4LB 5KOMC 1RZJH 5J1TC 1CXLA 1L0XA 3SPVA 5F7YC 4MAYA 2D03L 1S7WB 4QYOB 4P46D 2AXHA 2EDNA 1AR2A 5DR5L 3SDXA 4X8JB 1M7IB 3LVEA 4HPYH 3BDBA 3KXFE 3CVHH 2NW3A 3M1BA 3WXVH 2ARJB 5C0RL 4FQXA 1HZHL 3L3DA 5L9DH 5E2VH 1AKJA 5IB2B 2P5WD 1RZFH 4JHAL 1IILE 4JB9L 3KS0J 3PP3K 1OAKH 5C0IA 1SVZA 3SGKA 3SGEI 1WJ3A 4PGEB 4HPOL 4M1DH 4L3EA 4Y1AB 1KEMH 25C8H 2VWEE 3STBA 1C1EH 3DIFA 1MHHB 1E6JH 1RUML 2GW5A 1W8OA 2ITCB 4S10A 5D2LF 3Q6GL 1N4XL 2ATKA 4X4XB 2EDOA 2VLMD 1TETH 4KQ4H 5ANME 4WVRA 4JFDD 4UAOC 3OG6B 3MOAL 4GXUM 2AJVL 2R0WH 3VG9C 4I13B 2EXWC 4PP1D 3V6ZA 1BVLB 4P49A 1S7QA 4QGTA 3NVQA 1RZKC 5CJ5A 1PJ9A 4PYGA 1UCTA 2FJHB 4JJHA 4JPIA 4L4JA 3O4LE 4MJ2A 3D3VA 1MWAB 5F97E 3W2DH 5JW5A 4K8RC 1BVKA 3MRBA 3WFCH 2VDOH 1N5AB 3GJEA 1LP9F 2QTEA 5C0GA 3S88H 3P9LA 5CCKL 2C1PB 1WZLA 3MRNB 2IPUK 3VJ6B 5EIVA 1ZHBB 4W68A 1G9EA 3HMXL 2NPLX 5TF0A 5J0BA 3ZHLA 3TO4A 1PKQA 1KC5H 2ICCA 4GBXB 2DRUA 4KHTH 3MLVH 2L0DA 4JFPB 5IV2B 4Y1AE 4AL8H 4JM2A 1GL4B 4QO1A 5IB3A 2PW2B 1EO5A 1I1YB 1AHWC 4MXWL 1BOGA 1WBYA 5GISL 2BSTB 2ADJA 3MV9B 1BAFL 2UY7A 5A40E 5ESVB 5F9WB 3O2WH 5I16A 1DCLA 4NCDA 5B3JF 5H35A 4CW1A 5HDQH 2GY7B 4YWGL 3QO0B 2XKNA 3S7GA 1FVEB 5GJTL 2O5YH 2WBJD 5LXGH 2WW8A 4HKJB 2FHCA 4UTBH 3MV8A 1BFVL 1N6VA 4Z0XA 1QEWB 1X6LA 3G6AA 3ZTNL 2W9DH 5GGUA 3DXAB 2VR9A 1D5MB 2ZUWA 5J11C 4RX4D 4G9DA 2XKUA 1V8HA 4JANA 3VFGL 2K1MA 1D6VL 4X9FA 2IBGA 5TE7L 2DQIL 5JDSA 3MACH 3K2MC 3GMNA 3ARRA 1T5WA 3P4LA 5HI4C 1G7QB 1BHGA 5FYKE 3MA7A 3PWPD 3S3PA 4ZS6C 5GHWL 5JHLH 1QSEB 3WD5L 4JZJB 4Z9KB 4LGPB 2R2BB 2M8XA 2BXYA 4KROD 5E8EB 2CRYA 3RNQB 1K8DB 2QSTA 2D03H 3VWKD 2ADIB 4P48A 3VRIB 4P2OA 1WGOA 5CEZL 1DN2A 3FONB 3O8XB 1SBBA 3VXNB 3LKRB 3QJFA 4K3JH 5C0RH 3EOAB 3MV9E 4HT1L 2D9CA 5D1ZC 1OT1A 5CEXA 4Y2DD 2A38A 1GCFA 2OTPA 5J06A 4JB9H 4JVUA 4ZTPH 1FL3B 4WI2A 4XNQA 3ARGD 2WSKA 1CIUA 1T2QL 1EHLL 2AJXL 4PTTA 2V9TA 3HE7A 3FZUD 1DQDL 3MRLA 3AS2A 5SV4A 1JK8B 1RHFA 1XCTB 2P48B 2YUWA 2FH6A 2JJTA 4WGVB 2AQ3A 2X2YA 4HJGB 1FG2B 1HH9B 1YY8A 1I1AD 1N59B 4LLAA 4NQCD 1BZ9A 1JRHI 3DXAE 3G6JB 4G3YH 1KLFA 5ELIA 4ORZC 5DF0A 4HKZB 2DOCA 1PGRB 4JRXB 1OAYH 4UQ2B 4K7FB 3I9GL 2NX5B 3MOAH 5FECA 3DI2B 5IQ7L 3HZVA 3LRHA 2DL9A 4X80H 2BSSA 3O6LL 3QHTC 5TGBB 1SYSB 3VXMB 1XR8B 3HC4L 3CFCL 3DRTA 3RTQB 2A6JA 4FQ2L 4L8BB 3DMMC 3SDCD 4HIHB 4WW2A 2E6QA 1IEBA 3T0AA 1FNEB 2NLJB 2XPGA 3MV7B 4IRJC 1JWMA 1T66D 2G75A 4L8SA 1MFAH 4U7SA 3U7WH 2IALA 3QQ3B 4U6HA 2UVEA 1VADA 4XB8A 5CCKH 4OIAA 3K81A 4GMSH 4IHOB 1DQTA 4JDTH 4YDLB 2J5LB 4KJWD 4NKIH 3MLUL 3HMXH 3ARBC 1RJCA 1PYWB 2P8LA 4NKOB 2V2WA 4HLZG 3VGFA 4KU1A 1AJ7L 5IOPA 1ITBB 3I02B 2Y5EA 2LU4A 2PXYA 3RHWF 1NL0L 2BHZA 1FFOA 4FMKA 4TNWF 5CBEB 4FFYH 4JKLA 1J8HA 1V05A 3SGJA 1J0IA 3CZJA 4DZBB 2RB8A 1YPZB 4Y2OA 5FHAH 3G6JE 3RQ3A 1WAAA 2VXSL 4M7LH 4RRPG 4JRXE 5FO7B 4HWEL 4UNTA 4ZYKB 2DDQL 4WTZG 4YWGH 5H94B 1V3MA 5K9QG 5FM5O 5A3IC 5D2NA 4E5XB 2XZAL 4HV8B 3VA6A 4U1NA 6FABH 1T6VN 1BFVH 4KKLC 2NTSP 3K0WA 5F9OL 3UTZA 4XNYL 4M6ML 3MV7E 1UVQB 5K9JH 5D96C 2H8PB 2PYEA 2D7TH 3O81A 4LCUA 5KSBB 3G5XA 2W91A 2WAHA 4N0FB 1A6VL 3B8YA 1G0DA 3GSRA 3NZHL 3BPLC 1H5BA 5IMKA 1JZ6A 5HGDA 3JWOL 4MCZB 1IM3B 4LAJH 1YQVH 3L3KA 5CD3A 3SOBL 4MSWB 4LHUG 2VAAB 1Q0YL 5F88A 1FZJB 2Y4SA 4LCYA 3IFOB 4PJGE 3QJHA 3EYSL 5FFLA 4FQJL 3KJ4B 1YPZE 3WFDH 1NBVL 1TJHL 3OWEA 1FNSH 3UTPE 2V7NA 3MGTA 5B22A 1J8KA 2G9HA 3WBDA 2DJ4A 4KY1L 5MEQB 1RZ8A 1NSNL 1IKNC 2DM7A 3HAEH 3NCYS 3U36A 2GK2A 1KJ2B 4PB9L 1F6LL 4MD5B 4U05A 3TCLA 1AQKH 4NJAL 3QPQD 3HTLX 4LP4A 5INDB 4HZAA 3WHXB 3OL2A 3QO1A 4WIQA 3UTQA 4FXGB 4HC1L 4BYHA 4BQ9A 4NDMA 3ULVL 3I84A 1LVEA 1B6DA 2Y7QB 4NQSB 3V5HB 5KVEL 3WE6A 5KSBE 2YSSB 3RGVB 3UAJD 5E70A 3F6IA 3B9DA 5IQ7H 5BZDB 4QY8B 3O6LH 1WIOA 1SEQH 3JV5A 1T1WA 3V5KB 5T5NF 4EBQH 5F96L 1AGCB 1R5VB 2ICWA 3GJFA 2X7LB 4P2QE 2GQHA 5D72H 3T0BA 1DBJL 1TFHA 4A2LA 1EXUA 1SY6H 4OGAC 2APBA 3G6JF 5E8OA 4IEFB 1IARB 2DF3A 2JIXB 5DWUL 1F4WH 3R0MA 5E99H 1AP2B 1XIWB 5ADOH 4HMEA 4OD3H 4YIQB 1WFOA 3R06B 1HOCB 1GHFL 2DLTA 5MI0B 5D6CA 5IIEA 1XGPB 3MRPA 5J12B 5JA8B 2J4WH 4MA8L 5KVFL 1A9EA 1CTNA 4HUNB 4PJ9A 4ONHB 3UC0H 3UJJH 4NBYB 5SX4H 3WNNA 5IQ9A 5I8OL 1HHGB 2F5AH 1IKFL 3SDAA 1XFPA 3O41B 3ZHKA 3KLAA 1TVHB 1I3UA 1WT5C 1DN0A 2VXSH 1FLRL 2ERJB 4WWKD 1LNUB 3STZA 5KVMC 5IWLA 5JHDA 5IROA 4HWEH 5CKAA 4NT6A 2YPKA 4Z78A 1IEAA 5EUKB 1UB6B 8FABB 4R0LA 2HRLA 4HIIB 4W4NA 5GGTH 4LNRB 1T1XB 4HWNA 4F33B 3EYFA 4PJGF 4BZ2L 5EBMB 4R9HA 5D2LA 4IM8A 3GIZH 1HSBA 4OQTA 3VFSB 3FN0L 2CIIB 1QKZL 3CSGA 1S8DB 4YE4H 1M7DA 3S97C 5I71C 5LJYH 4I1NB 2R56L 4ZUUB 1YPZF 4N0CC 1ZVYA 5JR1L 2XFXA 4LLWB 1JPSL 1A6VH 3IDYB 1S9VB 2RCSH 3NZHH 4R2GB 3BP6B 3PWJB 1Q94B 1Q0XL 1YMMD 4N68A 4XCEB 3TN0A 3EO0A 3CFJA 4LIQE 4OCWL 3EJZC 2R2HB 4LCWA 3EUUA 2CLVA 1HIML 1WC7B 5I15H 5A16A 1AGDB 5MP6H 1FVDB 3KPNB 4RGOH 4O5LH 5KSBF 1INEH 1LO5B 2RR3A 4N1CA 1DQQA 1HEZB 1NGWB 5I9QB 2FGZA 3F58L 1KCKA 4PRHA 5KSAA 3FB7A 3V7MA 5J4MA 1K6QL 4KY1H 3WIFB 3T04D 3TLRA 2X4SB 3TNNB 5IMMA 4H1LH 1I9JH 2FYYB 4P5TD 2LQRA 4XPBL 3KYNA 4XHQA 1ETZB 3CDGA 4EI5B 5DJZB 1NC4D 2Q8BL 4PG2A 5C71A 3U7AA 5SX5H 3P11L 3VGDA 1QBMH 2XA8H 5JXEA 2HMID 4JKKA 3CH1A 2CLRB 4MAYC 1MUJA 4PLKC 4NNYA 5C9JB 3BYTA 1W2KT 4TVPH 1LEKB 2B2XL 2FGWL 4U3XA 3O3AA 4ODWA 2FL5B 4FQXC 4PFEA 1CGYA 1B90A 3U4EA 1PZ5B 4DKAA 3G6DL 4WY7H 3O45A 3OAYK 3SGKC 1JMZA 4QTIL 1DBJH 2EDHA 1NMAL 1H3GA 5TE4L 3IVKA 1YEJL 1KPUB 1YNTB 3MR9B 2HT2D 4OZFB 4LBEA 5DWUH 1UXWA 5E2TH 3MV01 3ARDA 4B53A 4YXLL 5DJ2A 2PCPB 4G8GB 3TPUB 2VQTA 4YHYC 1KIQB 5J13C 1T0PB 3RIAF 3ZTJH 3DX7B 4WHTB 4KMTL 1JPST 2EZ0C 5DRNB 1TTGA 5GS1A 1QHPA 4XCNA 5FYJD 4J2XA 1CFNA 5KVFH 3FQUB 3QUMH 5ANMA 3QXVA 3UPCA 2GKIA 3WNOA 4L4VB 3X3FL 4XVSL 2WK2A 5KN5B 4NNPL 3KPOB 5ITBH 3U46B 2APTA 1QNZH 2A83B 1RK1B 5H37H 1KULA 5IMLA 3C5JA 2Z9TA 5F71A 3WFEL 4PJIB 4NZUL 3D85B 3MJ8A 4MGXA 4MDIB 2CRIA 5D71H 4GG6E 1Q1JH 3HC0B 1PG7H 2H2SC 5LCVH 3SBWA 1S7WA 3TO4C 4QYOA 3ARSA 4X8JA 1M7IA 4KUZL 4F8QA 5F3BB 4B0MM 3DYMA 4JM2C 4XHJD 4AH2B 3UBXI 2B5IB 1L6ZA 5AG9A 2ARJA 4YHML 4R4BB 3PXJA 1T1ZB 4U1MA 1PY4A 4AIXA 4GRLD 1JPSH 1ZTXL 4LLYA 2F5BL 1H8OA 5E4IA 4CU6A 2FECI 2DB8A 4PGEA 4X5LA 4LKCB 5SV3A 4Y1AA 5ALCL 2B7DT 3OKEB 1NAMH 2UZIL 2VLKD 1MHHA 5D70L 3O0RL 8CGTA 1DQJB 1HIMH 2ITCA 3C5ZD 4X4XA 2OJZL 1TZIB 1FFNB 4UDTB 4L4VE 1DVFB 3DETC 4X99B 3ZKMD 5F44A 2ZOLB 3LKSB 4UNVA 5TPWL 4JZNB 4PJIE 2JKXA 1A14L 5D6DC 4XZUB 5EU6E 1X5JA 2FJHA 3P0VH 1MWAA 1JYWA 1QP1A 2Y06L 4PG9B 4XPBH 1T7WA 3ZKXC 4MXQD 2Q8BH 1GGBH 3AB0C 4Y4HD 3RWIB 4RBPK 1E28B 1HXMB 1EH9A 3ELAT 2BNQD 2C1PA 2FR4B 3BFOA 3MRNA 3VJ6A 5IHLB 1ZHBA 4P5KB 2JB6B 1FBIH 3QQ9C 1CBVL 3UPAA 1BD2E 4PR5B 2M2DA 4NC1C 4LLMB 1MCEA 4GBXA 2I9LB 4Y16D 3NTCL 4JFPA 5IV2A 1IVLA 2E7HA 1NCBH 5GGSB 2PW2A 4E42B 1N5YL 4ZUTB 3BX7C 4HGMA 5EBGA 1CLOH 4K3EL 2YUXA 3HE7C 4PY8I 5JW4R 2EYRA 5H37G 5ESVA 2JJTC 1IBGH 3K80A 5MEPB 4YXLH 3WXWL 1FORL 4MJIE 5IEHB 3LCYA 4GXVL 4Z0BH 4GG6F 5E1AB 4OLXL 5GS0C 1JTOA 1FVEA 3QIBD 4LGRB 2DM2A 1NGPH 3BDXA 1I9IL 4HKJA 3S3JA 1KFAL 3ZL4H 1QEWA 3DXAA 4EUPB 1D5MA 4YHIB 1FC2D 4WW2C 2PR4L 4EN3D 3VG0L 4LSQH 3EZJB 2VXQL 2B1HH 3T1WA 5EU7C 2V5SA 5FUCE 2AK4D 2BC4B 1M1SA 4L8SC 2A9NL 4AIZB 1VPOL 4KKAC 5F1OB 4OI8A 1XEDA 1JN6B 2AJYH 3PWLB 1A64A 2AJUL 2XTJB 2IGFH 4CBPA 1A8JH 1QSEA 4IOIB 4JZJA 2R2BA 5DJAB 1CQYA 3GMLB 4XBPB 2J8UB 5E8EA 3RNQA 1K8DA 2ADIA 1I7TB 3VRIA 3DOSA 3FONA 3O8XA 4KUZH 3V2AR 2WWMD 5C08D 5T3ZL 5FK9B 3VXNA 3LKRA 2PXYC 1N64H 3EOAA 2DQTL 4M9PA 3QZWG 2X1WL 1UFUA 1HYRC 4PJIF 3SGJC 1KCLA 2XT1B 3VMNA 2XRAL 2NZ9C 1ZA6B 1F58L 1FL3A 4K3GA 5K93A 2VDRL 3AAZB 3OQ3B 5D7KD 1OCWH 3VCLB 3QHFL 5HD8D 1JK8A 1XCTA 1U0QA 4HJ0C 4CVUA 3U4AA 2V7HB 3O2VH 4S1SL 4HJGA 5L8JB 1FG2A 4P2RE 5D2NC 3O0RH 1HH9A 4M9OA 1N59A 4RGMC 1IQDB 3G6JA 1A1NA 4HKZA 3FQWB 5I1IH 4JRXA 4UQ2A 4K7FA 2OX5A 2NX5A 2VSCA 4K9EL 2XV6B 3EOYG 3WMSA 4DWHA 1GXEA 3MBXH 3RPKA 2DLIA 5TGBA 4ETQB 2FX9L 3FFCD 5I30H 3VXMA 1AY1H 1XR8A 2RIKA 3MJ6A 1JIBA 3RTQA 1ACYH 4L8BA 5FGRA 4GAGH 4HIHA 4QRPD 4E41B 2Z93B 3IXTA 1FNEA 1H5BC 1WV7T 2NLJA 2XTJE 3MV7A 3PGFL 2BRRL 1TQCC 1MI5D 5HI3C 2EIBA 5DYOB 3L5XL 3MRGB 1S9XB 2J8UE 3QQ3A 3DYPA 3QRGH 1MCCA 1WEJH 5IESL 2CQVA 2J6EA 5HYJD 4IHOA 4WI9A 4JDZB 2K3TA 4LSVH 1IL1B 3X11B 1PYWA 4NKOA 2NXYD 4TSAL 3BZEB 1L9MA 5E2UL 4HAFA 1IMHC 5DJ6B 5BXFB 1MPAH 3NTCH 1R3JB 4OFKA 1SMOA 3UO1H 1VKXB 3WIHA 3LDBC 3SE8L 1D6EB 5CBEA 3BZDA 2WQ8A 2Z35B 2BOCB 5HHOB 4ACPA 1YPZA 1UA6L 4LDLB 2OBGA 1P7QD 2R0KL 5D1XB 5IT2H 2LE9A 1HN1A 5FO7A 2ZOKB 3B2VH 2FEDD 4ZYKA 4GXVH 5I19L 1DJSA 4J4PA 5H94A 5GGRB 1QR4A 4NM4L 4E5XA 2VABB 5DVOA 4M1GL 4HV8A 1AC6A 3K8KA 1TJIL 1FYTD 2BCKB 4XTRC 4G9FB 4QF1B 1UVQA 3NPZB 1HHIB 5FKAB 2H8PA 5DD0L 1A3LH 2PTVA 3HI1B 3KNBA 4U1GC 4N8VB 1LILA 5KSBA 3GBMH 4N0FA 5IB4B 3SKOB 2H32B 1FP5A 4UQ3B 1XF1A 4TSCL 1ZLSL 3AREC 4MCZA 5GQBA 1HCVA 2NXZC 4MJ6B 4KRPC 1IM3A 4OUOA 4YHOH 4MSWA 3HR5B 3SKUD 4JM4H 3U6RB 1FZJA 3IFOA 3MGAA 4U1SB 1DBMH 4U3HA 2J88H 4PJ9C 2R4SL 5HHOE 1T7XA 1EAJA 1KJ3H 2QSCL 1FPTL 1OTSC 4RFNB 1CK0H 5DLMH 5GZOD 4MD4B 3HLAB 3SDAC 5MEQA 4R4NC 2YK1H 2VDRH 1T20B 5IWLC 3QHFH 2P7TB 1R24B 4MD5A 5IROC 3QH3B 4IRSB 2NTFA 3C60B 5L8KB 4HUKB 2J8UF 5INDA 4KZEL 3FQNB 3WHXA 5C0FA 4R0LC 3SQBA 5HYFA 3LIZL 4FXGA 4G9FE 3M8OH 2Y7QA 5TH2B 3NCJH 2YSSA 3RGVA 1MJUL 4XNZC 4K9EH 3QDMD 5IFJB 2NY1B 1V3KA 4JFFB 4QY8A 3U0PB 3BD5A 3IKKA 2FX9H 3OPZH 3V5KA 4CVXB 4WWID 1AGCA 3KPQB 1R5VA 4MNHB 2X7LA 3F7PC 5EBWB 1OQXA 1NLDL 2OMBA 3PGFH 2FIRT 3TN0C 1YJDC 2F15A 5BOZG 1UGNA 4OLZL 2B4CL 2JIXA 4H8WH 4KZDH 1VB9A 1H3PL 4Z77B 5BS0D 1AP2A 5DJXB 4WUKL 2CIKB 4O51B 1U8NB 4QHMB 2EXWD 3NZ8B 3WNLA 5DFWH 3IDIA 2CUMA 4YIQA 2XWTB 3QEQD 4M7JH 2HKFL 3K1KC 5DHYB 3R06A 1HOCA 3EJYC 4W70A 1XGPA 4ZFGL 4DOHB 5E6IB 5DTFB 5I1AB 1LEIB 5KSAC 2HFTA 5DGRA 3D2UD 4K8RD 3OAUL 1CI5A 1WWWX 4MB3A 4ONHA 2CDGB 3BDYL 1IFHH 3VXPA 1HHGA 1CZ8L 5HGHB 1G1CA 3S8WA 2XQYG 2MTPA 3VU2A 3O41A 4PG2C 1TVHA 1ZMYA 1LNUA 4I3RL 5DUBB 5JXEC 3KLDA 5CBAB 5EUKA 3X3GL 1UB6A 8FABA 4K3DL 4LNRA 3RUGE 1T1XA 4XNUL 4F33A 1CQKA 1KXVC 4W6YB 3D0VB 1TJIH 5EBMA 5C0BD 1G9NC 1AD9B 1MF2L 4JVPA 3VFSA 2CIIA 5DD0H 1MAJA 1S8DA 5BV7C 4ZUUA 3DX8B 1NC2A 4LCIH 4LLWA 4H20H 3PGDB 4KVCL 1S9VA 4KQ3L 3BP6A 2R4RL 1Q94A 3PWJA 4X4MA 1X5YA 3ARDC 1J1PH 1F4HA 1GRWA 1X5KA 4R7NB 2R2HA 1DANU 3V6OE 1J0KA 4DOHE 1WC7A 2AXGB 2VWEC 1JZ8A 2W65B 5EZOL 5GS1C 2OP4L 1TVBB 2QADB 3VXSD 1AGDA 1IC1A 1FVDA 3KPNA 3TBYB 2VLJD 3IETB 1LO5A 5C3LD 5HI4D 1YY9C 3VFRB 1HEZA 1NGWA 4RMTA 3IJHB 1N6QL 1P4BL 1F6FB 1DZBA 2A0LC 4IMLB 4ZS6D 3WIFA 5T1LB 1F4YH 4GKZB 4YZFE 2X4SA 3TNNA 4KRMB 2FYYA 1ETZA 4EI5A 5I1CH 5DJZA 1B2WL 1AO7B 3GEWB 5FYJL 4M43L 4CMHB 5KAQG 3SBWC 2CLRA 5C9JA 2GJ6B 5D1ZD 3E0GA 3GI9L 5J6HB 1NCTA 3IJSB 1LEKA 1NEZB 3V79C 5SX4I 4KTEH 3BMWA 2NY5H 4V1DE 1RIHH 5ESAB 5ADPH 2FL5A 5HGGS 3RL2B 2NYYD 3NCMA 4PJDB 3MXVL 3HFML 4YHLL 3ORJA 1PZ5A 1CDIA 5DSCB 3WHE0 5E9DD 1MCJA 4J1UB 3D9AH 4NSKB 2VH5H 2KKQA 5ALBL 1FZOB 4KKCC 4OCXL 2EO1A 4X8XA 4MQTB 1HINH 3MR9A 3IFPB 1HWHB 4OZFA 1H3PH 4KC3B 3TH4T 4PBXA 1TZGL 2BOBA 4KJQC 4YQXH 2PCPA 4G8GA 3TPUA 5CKGA 3IDMB 1KIQA 1YYLH 3W39B 4DN3L 4QOKB 3DX7A 4WHTA 3MFFB 4Q6IA 3DMMD 3R1GH 5DRNA 3RUGF 4P23B 3RWCB 4RWYL 4OFYA 4IRJD 2Y07L 4HJJH 2O5XL 4FXKB 5DVKA 4I4WB 3FQUA 1G0YR 1QG3A 3RWJB 1EUTA 1BF8A 2WBWB 3QUZB 4L4VA 1N2RB 4HMCA 5KN5A 3VE0B 1AO7E 3ET9F 3KPOA 4WFFD 3U46A 4KK5C 2A83A 3OB8A 2YPVH 2EDTA 2GJ6E 4PJIA 3D85A 1L0QA 4F58L 4ZOAA 3ARBD 4MDIA 5C2UB 3SKMB 1UH2A 1K5NB 1F90H 1RZIB 2A6IA 4LHUB 5FYLH 3HC0A 4H0IA 2OLDA 3GRWL 4PJDE 1CF8H 4C59B 3FFDB 1J9CT 1UEMA 4NO2B 3OR7B 4GBXC 1VGEH 1B0RB 4X7SL 4F2MB 3JBG7 5ILTL 5F3BA 2AJZB 5F6IB 3REVB 4AH2A 4K55A 2DWDB 4R4BA 4OGXH 4NO3A 1CR9H 5IGXH 2A1WH 5E08H 1E4XH 4KVCH 1H3WM 3DRQB 5I74B 1S3KH 2R4RH 3IRZA 5F9WC 5A3ID 2EC9T 4LKCA 4YZFF 4QOKE 2NR6C 5EZIH 1NCWH 2I60L 3GKWH 3E1F1 4ZAKB 3OKEA 1T2XA 3HI5H 4PGZA 3ARFB 4BQ6A 3ZE2E 2LU3A 1A2YB 1DQJA 2D0GA 2P49B 4P9HH 2VXTH 4UINL 2KZ1B 1U8HB 1TZIA 5FYKU 1FFNA 4UDTA 2YD8A 4HZLB 1DVFA 1OTUC 4IOFC 4PRIB 4X99A 5T1MB 1G9MH 4X6BB 4JR9L 1Q9OB 2ZOLA 3NFSL 1C08B 2EDJA 3LKSA 2Q1EA 4JZNA 3BOVA 1I3GH 1X5GA 4OZGB 4ERSL 3ULSB 4XZUA 2E7LA 1D5XB 1N8ZB 2PETA 2VE6A 1DQLL 1QLRB 4LAQL 3IDXL 3QFDB 4YXHL 4D9LL 1H3TA 1KCUL 4PG9A 2V17L 1KGCE 2R1YB 4L8DB 3RWIA 1SMAA 4JZJC 3OMZA 1E28A 4JQXA 4JFZH 1HXMA 4JKPH 4ODXA 5ETUB 2FR4A 1TQBB 5ICXB 5DUML 1RUPL 3LKNB 4P5KA 2JB6A 3GI9H 2X9YA 5FUOL 3V0WL 3O8XC 3QCVH 4PR5A 5F7FA 2HTKC 4OLYH 1MIEL 3CK0H 4LLMA 3VXUD 1CDCA 3PQYB 2I9LA 4FFZL 2JJSA 1RULL 4NOFA 4E42A 4ZUTA 4WI3A 4HG4K 2WLYA 4QRRD 4K94H 1EGJH 4GW5B 1ORQB 1WFUA 3QEUB 4UT7L 5MEPA 4MNQD 4BZ1L 4FTVB 4X9HA 5IEHA 3MRHB 1J18A 3IU4L 1RVFL 4HH9B 4DN3H 4HS6B 5E1AA 3SJVB 5D7LD 3FO0H 1CXIA 5E56A 4PJDF 4UV4L 3NIGE 1KJVB 2FLBT 2VZ3A 4OGAD 4EUPA 3QUYB 5B4MC 3RTQC 1A0QH 2XYCA 5IBUG 2NY6D 3LEVH 1NCNA 3BKYH 4RMQA 2AERT 2B8OT 4KMLB 4ZTOL 1JNNH 4ALAH 1VEMA 2BC4A 2ESVD 3GKZA 4AIZA 1MY7A 4HEME 3HAEB 3T77B 3TGXA 1OWRM 3D39B 1MCHA 1JN6A 3QFJD 3PWLA 1LO4L 4URTB 2XN9D 1A5FH 3G5YB 4A2MA 1JGUH 3ZE2F 2J5LC 4IOIA 5DVNA 2DQDH 4ZUWB 1LO0L 3PQYE 5CINL 1VERA 1B4RA 5DJAA 1CWVA 3GMLA 4XBPA 2J8UA 1GC1C 3OV6A 4X6FB 1CLYL 1OPGH 3OJDB 5FK9A 3WUWG 2IJ0C 4OF0A 1JHKL 1T4KB 2X40A 4PV9B 5DMKB 3WDHA 2F58H 3GHEL 1ZA6A 3MJ9H 1RUQL 4OUUB 4D0CB 3W5MA 4LQFH 2OK0H 3HB3C 3SJVE 4KFZC 2F8XC 3AAZA 3VCLA 3K8MA 3JV6B 1U8QB 2HJKA 2XZCL 1A7OL 4J4PC 2V7HA 1I9EA 5ISZB 3TA3B 4JFQB 5BJTB 1KIRB 4ZFZB 3BRDA 4TOYL 1IQDA 5AWNL 3QUKB 4WFGD 4M6OL 5C0AB 3FQWA 3NMEA 1G7HB 3CCHB 2HRPH 3V9FA 4CUCA 1YMHB 5F1KC 3ZZ1A 1TMCB 3IKCB 4OM0L 4LPCA 4ETQA 1TTFA 4HG4J 2GJZB 3D39E 3EJZD 5EZLB 3LKPB 3K3QA 4Y2DA 1G6RH 4E41A 2Z93A 3LPWA 3VMPA 5DYOA 4PLOB 2YZ1A 3MRGA 1S9XA 4UT9L 4FP8H 3TZVD 2A73A 2ILLA 2OQJB 3K4AA 1NMBH 1EZVY 2DLEA 4JDZA 1RUPH 5LQBH 4JFHE 3V0WH 1BEYL 3KJ4C 1IL1A 3X11A 3AMKA 3UTTB 1CGUA 3NIGF 1MIEH 3BZEA 1NPUA 3T2NL 5DJ6A 5I1KH 2BVPB 1G7JB 4DCQB 3C8DA 1R3JA 4LL9A 4HDIB 1RULH 2Q6WB 1VKXA 1D6EA 2VZUA 1OD9A 1L7IL 2H45A 1U42A 4JFOB 2Z35A 4MAYD 4C55A 1A7NL 5ISZE 4PLKD 2BOCA 5HHOA 4I0KA 4MJ5B 3O11A 3OZ9L 4ZS7L 1K4DB 1PLGH 4BZ1H 3H42L 2ZOKA 3HHRB 4RFOH 4FQXD 5L8LB 5GGRA 1UKQA 3CNKA 1YECH 1AKJD 4XAWL 3RGVC 2VABA 4NO0B 1JZ7A 2LTQB 1LHZA 1RU9L 4CKVX 4FOMA 4WV1C 4PGBB 2BCKA 1IC5L 4L3ED 4QF1A 1U93B 4OAWB 5IHBA 1HHIA 5FKAA 3D69B 1RPQA 5D1QB 3HI1A 4N8VA 4Z95H 5F7HA 2HFEB 3TP4A 1K85A 2R2CA 5IB4A 3SKOA 2H32A 3R0NA 2OZ4A 3TO2B 2CJUH 3S3SA 4OLWL 2EKSB 4UQ3A 4M5ZH 4H1LB 2ARJQ 2SEBA 2EZ0D 1MCDA 1JI1A 1LO4H 4X6EB 2V2XB 3UTTE 2P45B 4E0RB 5BMFL 3DV4B 2VXVL 4GAJH 3HR5A 4J3VA 5CINH 2L7UA 3JWOC 4HX1B 2ENSA 5DMIH 1A47A 5MI0C 1EEYB 4N0UB 4FG6D 4QXUL 5J12C 3U6RA 1H0DB 3D3VD 3T65B 3QI9B 4U1SA 2DQGH 2DQCH 3KLHD 5FEBA 1I3RB 4DW2H 1GYAA 4G5ZH 5IEKB 5T3XD 4MD4A 3S5LB 3HLAA 3T2PA 2MPAL 1UENA 3P4NB 4JEGB 4F9PA 5C07B 2H2SD 5GRVK 2ZJSH 2E9WA 4GJTB 1DQMH 4JO3H 2P7TA 1R24A 1QR1B 4F7CA 3QH3A 1RZKL 4IRSA 3TO4D 5E8DL 4NQDB 3C60A 2XXMB 2XZCH 3IRPX 1GGIL 1YEKH 2ZUVA 1DBKL 3N9GL 4JM2D 1OGTB 2VLLB 2X1XR 3ESUF 4K8RL 4UDUA 4ZFFB 1FO0L 3ILPB 3KLSA 1EERB 5TDPB 2O93L 5TH2A 4JG1H 3VMOA 5IFJA 3GBNL 4JFFA 4OM0H 3U0PA 1CE6B 3ULVC 3ECBB 3IDYC 2D0FA 3BJ91 4CVXA 5L2KB 3KPQA 4YXKL 4LHJB 4MNHA 2VN7A 2WQRA 4R2GC 5EBWA 1DSFH 1SEBB 1JGEB 2VYRE 2A9ML 3MV8D 4F7TB 3H7BB 4OT1L 4BZYA 4N0UE 4TVPE 2NY4C 2YXMA 3DETD 4Z77A 5DJXA 4JFEE 5EFIB 2CIKA 3THMH 4O51A 1BGXH 1AI1L 1U8NA 3O9WB 3NZ8A 5A43C 1BEYH 5GGVH 1MJJB 1GZQB 1UCBH 2XWTA 1MFDL 2I25N 5DHYA 4AEFA 1Y6KR 4PJ7B 4F57H 2APWA 5I1AA 2WM0A 5DTFA 1LEIA 1YEGL 3OAZK 3ZYIA 2CDGA 1T1YB 5I18L 4GQ9L 4ZUVB 3ARTA 1T21B 4NQDE 1EO8H 3IDUA 4FQLL 5CJOH 3C6LB 5HGHA 5J9PB 1JPGB 1A7NH 1BIIA 4ZOCA 3RY4A 3TBVB 4EI5C 4WEMB 3OZ9H 4P2OD 3QQ9D 5EA0H 5I1EH 3EW3B 2RBLA 2P42B 4OCRH 1T6WA 5DUBA 1NAMB 1GPOH 5CBAA 3NCCB 3WJLA 1UM4H 1FIEA 4XAWH 1KNOB 5BVPH 1K2DB 2AEQL 2D7MA 5IW6B 1RU9H 2YRPA 2LVEA 1XF2B 3D0VA 5AYUH 4GS7B 3F7YB 1AD9A 3HE7D 5GRUL 4Q9QL 3H2WA 2GSIB 1KN2L 3DX8A 5A2KH 1NAKL 1H8NA 2BVQB 5GS0D 2FHBA 4NWTL 3M45A 5EO9B 3VI4E 4R7NA 5EC2B 5MHSD 3P30H 4PJ7E 3PNWB 1VA9A 4OIIL 3PV6B 5JPMB 5F7DB 4JN1L 4Q6IC 2AXGA 2Y25A 2OJEB 2W65A 2OR9L 1IE5A 1PX4A 4IRZL 4QXUH 1TVBA 2JB5H 2RJMA 3G5VB 5IBTL 3TBYA 3VRJB 3CIQA 1CG9B 2NY0D 3N85H 2J8OA 4G8IB 4KKAD 5KS9B 4ODVL 3VFRA 2X4NB 2EEBA 3H7LA 4OKDA 3IJHA 4DVRH 4IMLA 4WI5A 2DI8A 2DTMH 2UZXB 4WTXA 5T1LA 4HLJA 4GKZA 4FNLH 4ZSOB 2ZKHL 4MMXC 4P57B 4A6YH 4BK4A 1MH5B 4MJ4A 3CSYB 5C0CB 1OAZL 1AO7A 2DQJH 1OARL 4AG4L 4RDQF 1XGQB 2PXYD 1RI8A 4KUCF 2BJMH 4K8RH 2JK5B 4HULB 2GJ6A 2E6PA 3H9SB 5C6PB 2ID5A 3O3EB 2ZUUA 5EULV 1J8HD 5J6HA 3IJSA 1NEZA 1KXQE 1GOGA 1CS6A 2VDQH 2XY1A 5ESAA 4FRWA 4LVOB 3RL2A 4R3SB 3BAEL 5T1DH 4YR6B 1F97A 4YJZL 2FX7L 5DSCA 4YXKH 5IF0B 3T3PE 4J1UA 1GIGH 2MHAB 4NSKA 3KPTA 4YO0B 1DLFL 3EDJA 1FZOA 4RRPA 3IFPA 1VEOA 4LQ1A 4ZFOB 4AEIH 5GJSL 3O6FB 5E6ZA 2CD0A 2PYED 4BH7B 5DUPH 3IDMA 3W39A 5KS9E 1ZHLB 4QOKA 1UZ8B 1S7SB 1EIBA 1DVFC 3MFFA 5JQHC 4JQVA 1J0HA 1MFDH 4JPVH 1SBSL 4G7YH 4P23A 1U58B 3RWCA 1PEZA 5ACZB 4LARH 2NW2B 1QLEH 5HI3D 4I4WA 4X0KB 3DARA 2N1KA 3RWJA 5TQ2L 3QUZA 2E7LC 1N2RA 3EAKA 1IM9B 5C0CE 4WEBH 3VE0A 1SJXA 2YXFA 3PHQB 4J3UA 4Q58C 1FNGB 5T1KA 1CDYA 3H9SE 4YHKL 4JQXC 2IPTL 3SKMA 3VI4F 2EH8H 4RMWA 1K5NA 1RZIA 4PJ7F 1NCCL 4LHUA 4MVBC 4ZD3L 4UBDC 1FFQA 2DJUA 2EICA 3FFDA 3MBEB 4NO2A 3OR7A 4F2MA 1B0RA 5AD0B 1CL7H 3OKOB 5DRXB 2JJSC 2XKSA 1TCRB 2AJZA 2EDWA 2K9UA 3REVA 2GTZB 5DC0A 4ELMB 2DWDA 1KN2H 4JFDE 4PJXB 4EKXA 2BFVL 1YN7B 2WUBH 4NGHL 3QAZB 5FKPB 4R4FL 5F7NC 3DRQA 4ZUSB 5EOCJ 1E0OB 2G60H 1JYNA 4M48L 5JW4N 1MSPA 2Z91B 2JF1A 2CR3A 4ZAKA 4UIMB 3ARFA 4TSBH 3L6FB 3TWCH 5GXBB 3HUJB 1T04B 3CC5B 1U8HA 4IRZH 4U6YB 5C2BL 4HIXL 3VFOB 5IBTH 3QHZL 3SGDH 4LRNL 4HZLA 5TF1L 1MCRA 4PRIA 3S37H 2AK1H 4XP9L 5T1MA 4X6BA 2ZUYA 4D9RD 4HUXB 1Q9OA 1JP5A 3C08L 2IBZX 1C08A 4YGAB 3SE4A 1F6AB 2NXZD 3K74B 4J23A 4KTDH 5C0ND 3UJTH 4KRPD 4OZGA 5KOVC 5GRXG 3MODH 3MNWB 3ULSA 3T3PF 4XP5H 1D5XA 3SQOH 1N8ZA 2EDBA 3FHQA 1KCRL 3QFDA 2YKLH 3FB8B 5L88L 1CFVL 2R1YA 4L8DA 3CMOH 4OV6F 5DZOA 1RMFL 4PJ9D 2MNUA 5ETUA 4WUUB 5ICXA 2WBJC 2CXGA 3LKNA 5KS9F 5HXMA 3GB7B 1U6AH 3SDAD 4PJXE 2GT9B 4PUBH 4R4ND 4ORGB 2DD8H 1EA9C 3BAEH 3PQYA 3PE9A 4R26H 5JHDD 1RUAH 4M8VA 5CZXC 2YD7A 4L5FL 4MLSA 1NLBL 4KKBC 3I85A 1J1OH 4C56B 4ZNCD 3UP1A 4GW5A 4C57C 4GKSB 1XMWA 5E5RB 2DQHH 1ORQA 4MQ7B 3QEUA 5BOPA 2YOCA 2YWZA 1F2XK 4NKMB 1HHHA 1B4JH 1RJLB 4FTVA 4H88H 4X6CB 3MRHA 5DEFB 5HHVL 3BMVA 4HH9A 3EIFA 4HS6A 1Y0LB 3SJVA 4F3FB 3LS5L 4FQQB 4HS8H 3PWUB 2CMRH 1Q72L 3G9AB 1MCFA 5C6TL 3TN0D 1KJVA 1E4XI 3JWNC 5K9QI 2APVA 3KYKL 4HH8A 4X9GA 2AI0H 3QUYA 4P59L 5FIEA 2F54B 4LCWD 5TQ2H 4Y2DC 3NIFE 1IAIL 4BFIB 3U1SH 2YEZB 3FCTB 3QULA 3ARGC 3E2HB 4ZDHA 4NM8H 3FMGH 1FGVH 3T77A 3FZUC 3D39A 3IAPA 1ES0B 3P73B 5L2JB 3BGFB 3EJYD 4HS3B 2ADFL 3RHWK 2YWYA 4TNWK 3BZ4B 3G5YA 1S7TA 4PRHD 5KSAD 1UWXH 3LQAL 4ZUWA 1RURL 4JPWL 1JPFB 3ETBF 3T4AB 5GGQH 1WWCA 3PF2A 4UOW0 4X6FA 3PABB 5E4EB 3VH8B 1DE4B 5FGCB 4C56E 4JREB 3FO9B 1I75A 3MNVB 1T4KA 1YEFL 2OM5A 4ODUB 4PV9A 1R5WB 5JXED 2BFVH 1CD9B 3Q3GB 1YEDB 1BLNB 4D0CA 4OUUA 4X6CE 2W9EL 3KYAA 5I8KL 5LGJB 1CDBA 3UYRL 4NNXB 2F74B 3JV6A 1U8QA 3FOMB 1ED3B 4NQTA 2Q7NA 1NCAH 3B4NA 4U1IB 4XMLL 5ISZA 3TA3A 1YEEH 3CFIC 5BJTA 3MUY1 1KIRA 1R0AL 3RA7H 5DK0B 4ZFZA 2XWBB 3C09B 5AZ2L 3JV4B 4KJWC 5IFAL 4JHWH 4YPGB 2CUHA 2F54E 4AQOA 5C0AA 4OCYL 1RK0B 4P4KB 3CCHA 2DYPB 3QUXB 3BE1H 4LASH 3VD5A 1LE9B 3OGCB 4PJXF 5T5NG 2Y5TB 3JSSA 3IKCA 4L9LB 1ZVSB 3ARDD 12E8H 4JRYB 2GJZA 3MSPA 5EZLA 3LKPA 1AXIB 3WHE1 3DUSA 3U4BH 2PKDA 3B2UC 1KTLB 4Y8AA 3U30C 1B6UA 2E8YA 1CDUA 3DVIA 3D6GA 1QTYT 4XCFL 5FGCE 2E9JA 5HYSB 3GNML 2OQJA 2E27L 1YY9D 4LPYA 3IFNH 3T4YA 4OD1L 2A2QT 1LK3H 4R96B 1Q9WB 1GGCH 4RZCB 5GGTA 2W0FB 2A0LD 3TVMB 3UTTA 2AEPL 3D0LB 5HHNB 3WIIH 1U3ZA 4RFNC 2BVPA 1G7JA 4MDJB 1KB5B 2X09A 4HDIA 4JPKL 3O4LD 2Q6WA 5J7CC 4F9PC 3NIFF 1MJ8L 1AFVL 4ODSH 4JFOA 5ID1B 2COQA 4IRSC 1IGFL 5DJ8A 5E7BA 3C60C 1II4E 1K4DA 2Z8SA 5SWSB 1ZSDB 4HKXB 2IBBA 1OM3H 1OAQH 5EC1B 4JRYE 4NO0A 3LSOB 2NY1C 2FEEL 2YA0A 4XPFH 1H3VA 4PGBA 3NOIA 4Y1AD 3C5SB 4Y89A 4CL7A 1PEWA 1HHKB 3B6SB 4QHKJ 4KKCD 4OAWA 2YD4A 3D69A 4ONOA 4WHYH 5D1QA 4NCC2 5ENWB 5F3HB 1ZLUH 3BKCH 2HFEA 3F6LA 4FS0A 4KJQD 4U2ZA 3TO2A 4Q9RL 4EOWH 5K9OB 3V6FB 4X6CF 2EKSA 4HUMB 1T3FA 4H1LA 4OLVH 3BP5B 4NUGH 1JZ2A 2ADFH 4X6EA 4EDWL 2V2XA 4E0RA 1F3JB 3DV4A 3DO3A 3N50A 3V52L 4DQOH 1MQKH 2EDKA 4HX1A 3PJSA 1EEYA 4N0UA 2VDKH 1H0DA 3T65A 4KK6C 3ZT6A 1HH6B 1OB1B 2DIAA 3QI9A 4HWBL 4JFXB 4MHHI 3VDBA 1EBAA 3LMJL 4KK5D 1I3RA 4LPTA 3WS3B 5IEKA 4J3OC 1EJOL 1JHLL 1JTPA 3OX8A 1U8JB 5AAMA 3S5LA 3CH8A 2QQQA 5FYKD 3P4NA 5SWSE 5C07A 5JXAH 1I9RH 5C70A 4ZNEE 5SWZB 4GRMB 4NQDA 4GBXD 1A21A 4OLUL 4RA3A 2BNRB 3WJLC 1QA9B 4JY6A 3BGMA 1JBJA 1OGTA 2VLLA 3KJ6L 3NABL 43C9B 3FQRB 2BVUA 2XIDA 1F8TH 4ZFFA 3HE6B 3ILPA 3WKML 4EJ1C 4OCYH 5TDPA 3I2CH 3UTSB 5ICYB 4NQEB 2OSLB 1FLTX 2LFGA 1CE6A 2NR6D 3MLRH 3ECBA 5L2KA 1LMKA 1WISA 3HG1B 2FJFB 3S34H 9CGTA 1ULVA 1BREA 2CLZB 1SEBA 3EDFA 1JGEA 3BEVB 3NH7L 5B21A 3OJ2C 4WFHE 4F7TA 1BVZA 3H7BA 2F19H 3MLSL 5CFHA 1OTUD 2HT3C 1FRGL 3DXAD 5D5MA 3V7AE 1JRHH 4XCFH 1XF5B 5EFIA 5HHXL 3U82B 1INDH 2E27H 3ZSTA 3O9WA 2QADC 2B4CC 2VQUA 3JVGA 1MJJA 1GZQA 4PGJA 2VDPL 2EH7L 4PJ7A 5FCUL 5EUOA 5CAYB 4JO2L 1NMCB 5GS0L 1PBYA 3DSFH 4PRDB 5CILH 2O5ZH 5IBUB 2CR6A 4WHYG 1QSED 1T1YA 1FAKT 1WIPA 4ZUVA 1ZLWH 1T21A 4G6JH 2AGJL 2EO9A 3C6LA 2BNRE 5J9PA 1JPGA 3TBVA 3HRZB 3RVUD 3BEWB 4AZ8A 3O8XD 5EO1B 3RPIB 2OTWB 1ZA3B 4AENB 2HTKD 4CMHC 4JY5H 1NAMA 3UTSE 3LD8B 4NQEE 4BSVB 3OXSB 3BIBX 1JGDB 4TUKL 1KENL 1KNOA 1YMME 1A6AB 1K2DA 5T3XH 5IW6A 4NBZB 1KCSL 1KTDA 1XF2A 5GRYA 5DJ0B 5DDHB 2IF7A 3C8HA 3F7YA 3WUWB 5KSVB 4J6RL 3RIAK 2BVOB 2QJDA 4YBLC 4DKFL 3F7VA 2GFBA 2GSIA 4M61B 4EEEA 1MCLA 5EZJB 3GK8L 5I76A 3MRCB 2BVQA 2E8ZA 5IB5A 4JRXD 3U9PL 5FYLE 3RL1B 4HK3N 1X5XA 3NA9L 3QRFM 1JGVH 2NX5D 3ALXA 1ACZA 5EO9A 5EC2A 4EDWH 3W5NA 4ISVB 2WUCH 2AABL 5FOJA 2DBLL 2MQ3A 3PV6A 3VXMD 5F7DA 5JPMA 2DLHA 5B4MD 3RTQD 4UTAH 1A6TB 4JQVC 2ORBH 2DKUA 1Z3GL 4FMFA 1ZLUK 2OJEA 3VXOB 4P23C 3TH2T 1FV1B 3E6FB 3MV7D 3V4UH 3G5VA 3VRJA 4K71B 1R3IL 3TJEL 1CG9A 1FVCA 1IAKA 4G8IA 3QUZC 5KS9A 1CXEA 2X4NA 4KV5E 3GZKA 3VRLE 2DQUH 5K59E 5F9JB 1IGIL 1CU4L 4LLQB 2YUZA 4CGTA 3CLEH 4K2UL 2QHRH 35C8H 4ZSOA 5FB8B 3LEYL 5CHNB 5E8NB 5T33L 1FN4A 1MH5A 4O2CB 5CGMA 3CSYA 5C0CA 3N1MC 4OLUH 4YUEL 2MCPL 1JYVA 5DJDB 2FBJL 1F4XH 1PG7X 3QEGL 1CFQB 4R7DB 1A6WH 2CDEB 2JK5A 4J3WA 4XPGH 3WKMH 3H9SA 3O3EA 3T0XA 5F6IC 2XNAB 1HKLH 3CZFA 3UTPD 3HB3D 1EVUA 4R3SA 1CYGA 4QHLB 5I1HL 1ZLVK 4YR6A 3N06B 2V6HA 2MJWA 3K4DA 4J4PD 1YUHB 4XP4H 5IF0A 1FH5L 5I74C 2MHAA 5FUZL 2X9WA 3L3JB 1JL8A 4KRNA 4YO0A 1CTOA 4XX1E 5DT1H 3OBAA 5EG6C 4OZ4B 2BHUA 1SM3L 4XVUC 4ZAKC 2VDML 3ARFC 3MLSH 3EOBB 4ZPTB 3PP4H 4ZFOA 1QSFB 3O6FA 4FQ1H 2DLFH 5EORH 4BH7A 2HFGH 1D5IL 1ZHLA 3EDDA 1UZ8A 1S7SA 3F5WB 2VDPH 2X05A 3DROB 5FCUH 3REWB 1U58A 4NHCH 1XAUA 5ACZA 1DFBL 2NW2A 1QRNB 3SE4C 2R39A 4WEUD 4GUPB 4X0KA 2O26U 4G6AD 3RWFB 1AGBB 4Q9CA 4LK4A 1IM9A 4Y4HB 3GSNL 5D8JL 4MAUL 4KXZH 4OTXH 3F65A 1C5BL 3PHQA 3WFZA 1SYVB 2V5MA 4WDIB 1FNGA 3X14B 4LLUB 5MENB 1MCSA 4RGNB 1D3CA 1TQBC 4ZXBB 3C5ZC 2N7AA 2VZVA 3AU1B 4RISL 1KENH 4BSWB 1ZLWK 5F1IA 3C8KB 3MBEA 4HQQH 1E4JA 4DN4H 3ZYOA 5AD0A 3MLZL 3OKOA 5DRXA 4HIJB 4TN9A 3B9VA 2GTZA 4GO6B 5EWIL 4ELMA 4QCIB 2OTUB 4KV5F 1DL7L 3VRLF 1F13A 1NEUA 4PJXA 5K59F 1G6RB 1QSFE 5FKPA 5JUEL 1QYGL 2F53A 4ZUSA 3U9PH 3RGVD 4MXQC 3EFDL 4RAVB 2Z91A 1L7TL 1FNHA 3FB6B 4UIMA 5EOCL 2AABH 1DBAL 3L6FA 5KZCD 3HUJA 1QRNE 2J2ZA 1T04A 4PRAB 4ETYA 3CC5A 4KI1A 1FDLL 1IC4H 4U6YA 3VFOA 3ZMRA 3IDNB 3NGBB 2E6JA 1BFOB 3EO1B 3QUYC 5KSUB 1OP3H 4XCCL 2R0ZL 2ZCLL 4Y16C 4HUXA 2JIXD 5E5MB 1HI6B 1BJMA 1XIWD 1F6AA 3LKQA 1E4KA 5MENE 3QQ4A 1IGIH 2Y36H 4JO4H 2YS4A 3MNWA 3RVWC 4WTWA 4MA7L 3TYFB 3BSZH 3ARXA 2VC2L 3FB8A 3ZDYE 2EDEA 3W11C 4W6WB 3MLWL 2YA1A 4YUEH 4FQCH 1LDPH 3GSNB 2FBJH 3Q0HA 2XZQL 3LS4H 3QEGH 4ODTH 4WUUA 4JN2B 5E00B 3GB7A 2BZDA 1HDMA 4QRSB 2FATL 2IG2H 4G43B 4Y5YA 5FA4B 2GT9A 2CKNA 4KMQA 2XWJB 4ORGA 3VXRB 4MMZC 1L0YA 2IH1B 1C5DA 3QIUB 4TRPH 3TPKA 3SKJH 3BI9X 4D0DB 5FUZH 1S5IL 4IIQB 4C56A 3TV3L 4QHNB 4NBXB 4Y7MA 1E4WH 4GKSA 3V8CA 3AS1A 3RWHB 4MQ7A 2VDNH 3ZO0A 1XF4B 1ZGLB 4NKMA 3DSNA 3EYUL 1EHXA 1RJLA 5TQ0L 3KPMB 1HHJB 3WDJA 2C4FU 1CL7I 1Y0LA 4F3FA 3ULVD 1NC2D 4FQQA 2H1PL 2CKBL 3PWUA 3V4VL 1HSAB 1C5CH 3RAJH 3EOTL 4R2GD 4NCC1 4YDJB 2AJ3B