1ZKAA

Nf-kb relb forms an intertwined homodimer, y300s mutant
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
110
structure length
110
Chain Sequence
LVPRGSHMNTSELRICRINKESGPCTGGEELSLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription factor RelB
publication title NF-kappaB RelB forms an intertwined homodimer.
pubmed doi rcsb
source organism Mus musculus
total genus 2
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zkaA00
2NY4D 2YS4A 1R5VA 3KDMB 3LY6A 4WJ5A 2V5YA 1TTUA 3MUGB 4KHTH 1V3MA 1UVQB 4XAWH 2R69H 3O81A 1MPAH 5B21A 3V6ZB 3OR7A 3S96A 1UEMA 1K8DA 1J18A 2J5LB 2JF1A 4WI8A 3UMTA 2ZSWB 3I9GH 5F96H 4MCZA 5FUOL 3B9KC 1HHHB 5IK3A 1OCWH 3SJVB 4YHKL 4B41A 1DN0B 1JNJA 1JL8A 1INEH 4XCCL 3UJIH 1SYSB 5T1LD 5J6HB 3QIUD 4RISH 1P1ZB 4YGVB 5I8EB 4G9DB 1KCKA 3O8XD 5JPMB 1PKOA 3FQTB 3FO2B 3E3QC 2EKJA 3A67L 1M7IA 4OI7A 1T7WA 1N0XL 4L8SB 5JLZB 3OJ2C 3EJYC 4JDVA 5JXAL 3RHWK 2DL2A 3B9EA 1HILB 3OKDB 1MAMH 3KYOB 2VE6A 4G6FB 4LQ1A 4KI5D 4WU5B 4F7TB 3MGOA 4JHZA 2E9WA 2YUZA 1WBYA 1V7ML 3SGDI 1AQDA 4Y16C 2OJEB 2PYEE 3PWVB 5DUPH 2IFGA 4QOKE 4ZFOB 1KNOB 1UACL 2A0LD 2GJZA 4XNXL 5TE6L 2APVA 5IEHA 3WUWB 2CUMA 3DETC 4TVPL 1OP5H 1BZ7A 4GW5B 5JHDA 3EYVA 1MREL 3OG6B 4L4TA 3IDUA 1ROWA 2JJUA 1W72A 1NLDH 2X1PA 3LD8C 3KYKH 4NO2A 2BHUA 3QPQC 2C1PA 3MRCA 4G6FD 2BCKB 4WWKC 4G7YH 1G7IA 1NGXB 4NSKA 5E1AA 1UC6A 3F12B 3FO1A 3ROOB 3KPNB 5CGYD 4R3SA 1NCCH 1EEZA 1A9BA 5FDWB 1Z9MA 1MHEA 3OXSA 2LTQC 2CO7B 1IC5H 2FYYA 4YPGA 2W65B 2C3HA 3FMGH 1OAZH 3D39B 1BFVL 3QJHB 1GHFL 5DEGB 2N7AA 3OF6A 4IHOA 5IGXL 2ENYA 5BS0B 1KCVL 2BMKA 2ZUXA 3T0EC 3CSYB 5CJQH 2VITB 4U6XA 4LEXH 1P7QA 1T03L 3WJJC 2D03H 3RVUD 2O61B 2X7LB 5C9JB 3RAJH 4UINH 2H2SC 3LIZL 4N68A 5IB2A 2BNUB 1JPSL 1P6FA 4LPVA 4ZFGH 2W1NA 4RFNB 4LHUG 3B8SA 3WIIH 5GRWA 3TJEH 4XPHH 1NMBL 4U4BA 3D39D 5L2KA 5E5MB 1UM6H 2LABA 1CE6B 2VISA 1DVFB 1VADA 2AGJH 3L3IA 1SEQL 1ADQH 4HKXB 4O02L 5BS0D 5E9DE 1S8DB 5FHAH 5EBMB 1FNSH 2AABL 2MHAA 4V2BA 1ZT7B 4PJCB 4M3KB 1CZ8L 5B8CC 4R97B 4P2YA 1PKQE 2YC1A 1HSAB 3IAQA 4DW2H 4OT1L 5I0DA 5DS8B 4R4FL 1UB5B 3IYLW 2D7QA 3ECBA 1H3PH 1TQCB 4R4ND 1ZS8A 5IG7B 2J12B 3ULUL 4KROC 1AXSA 1Q0XL 2V2WB 5HHOA 4XBEH 3PL6C 4GW1B 2NY6C 1QSZA 3L7EB 4U1NB 1DVFD 4U6HB 4PJDE 3VFTB 3QXAA 3RY5A 3QUMA 1H3UA 2AJSH 3JV4B 1ZLWH 2V5TA 3HRPA 4XH2B 2MFNA 3IJYA 4YIQA 1LE9A 3IDIB 4ELME 5C0IB 5FO9A 4FMFA 3VH8A 4Z95L 2DLFH 3RY4A 3KPQA 4LNRA 1LEGB 4PJHA 1MQKH 3EZJB 1N64L 1C1EL 5INCB 4ZTOL 4WVRA 4WUKH 2AXHA 4WJ5B 5IW6A 1R5VB 2EDFA 3EO1B 4PRPE 1JE6A 4WHYG 4HKBB 3UC0L 1LEIB 3ARYA 3NCEB 2VIRA 3M8OL 5ILTH 4MCZB 4UT7H 1KB5B 1KCUH 2BVOA 3PQYE 5IK3B 3SDAA 2E7LC 3OPZL 3UZQA 2NTFA 5E8PA 1U8PA 4XTRD 1A7OH 3QEQD 4DAGL 2PYEA 4QOKA 5BZWA 2QHRH 4F9LA 3TA3A 5I15L 2VQTA 4NP4L 2BXYA 1UH3A 4ZXBC 3STLA 2AJZB 3EFDH 2ID5A 4H20H 5GPRA 4OM1L 4LPTA 3QCVL 4U1JB 3DGGB 1TLKA 2VZSA 1DLHB 1J1XH 2GEEA 2OL3L 1REIA 5GJSH 2EDOA 3OAUH 2VE6B 3FQWA 9CGTA 3P11H 5BRZB 1RZ7L 4FZ8H 3UBXG 4EOWH 1WBYB 1T3FA 4HD9A 2VC2L 5J1AA 3VFNB 3E2HC 1HKLH 2W0FA 2H6PA 1V7NH 3MLYH 4HH8A 2GJZB 15C8H 3HNSL 1IQWL 3P0GB 1BZ7B 1QLFA 5JHDB 1LO3H 1H3GA 1JF5A 1FRGH 1W0WA 4I3SL 4WHTB 1CGVA 5JIHA 2Z8SA 4XB7A 5D6DC 4GG8A 1N5YL 1WJ3A 1XF2A 5BV7H 2C1PB 3CU7A 3MRCB 1H0DB 1VFAB 2K7QA 3HC4L 4HQQH 3U7AA 2ZUYA 5BRZD 1NC2A 3BIAX 4ACPA 5JUEL 1I8MA 1NBYA 5E1AB 3MRDA 3FO1B 3VXSE 1UADC 1BBJA 4R3SB 3GJFH 3JXAA 1DL7L 2OJZL 3H3KA 1EEZB 4N5ED 3DUHA 3FQRA 2R1WA 1D9KC 1QSFA 1D5ZA 5ITBL 1MHEB 4HBCH 4LVOB 4LMQI 1RIHH 3S7GA 2FYYB 1FSKB 4FQHA 5JHDD 4K8RH 2ICEA 4RWYH 4YPGB 3SDXE 4KWUA 4NKMA 5K9JH 1UG9A 1FH5L 4XXCA 3OHXB 1OP3K 2LV4A 3TO2A 2A6KA 4Y5XA 1HYSC 3U2SA 3QXVA 4M6OL 5E9DA 2BMKB 2FB4H 4XHQA 2VJXA 1H15B 4XRCA 2W60B 3DUSA 4U6XB 2KZWA 1L4IA 4W4OA 3HA0A 1E4WH 1T2XA 2MPAH 3TN0A 2P24A 1LEKA 4OZIF 2MQ0A 4PJBE 1OP3H 2CRMA 2N4IA 4GMTH 3UZEA 4RGNB 2PKDA 1T0PB 5IJKA 1P4BH 3EKCA 4WUUE 1IRAY 5L2KB 4KPHH 4R26L 2DJSA 4UT9H 4PJDA 1VADB 3L3IB 4ZSOA 2ZUQC 1YEIL 5C6WH 2XFXA 2YWYA 4XZUA 5GGVL 2MHAB 4GAYA 5E70A 1NCUA 2A38A 2MCG1 5CP3H 2YC1B 4O00A 3H8NA 1CCZA 4QYOB 1RUPH 1W8OA 5IBTH 3H9SE 4AL8L 4RGND 3IRZA 2BSRA 3HNTL 2WW8A 1X6NA 3O2DH 4GRWB 5C0EA 4JJ5A 1OTSD 4KK5D 5DDHA 4XCNB 3BN9C 1CGUA 1AXSB 4ZTPH 4PRPA 5L2KD 5TFSL 2VXTH 4XHJC 1RQ5A 3GMPA 5FA4A 2P42B 4PYHA 4CUCA 3GI9H 5MI0C 5AUMB 1QRNE 3EYSH 3QXAB 3OKMA 5FYJD 4XWGL 3OJVC 4OTXL 5DHVA 4MX7A 4P3CH 3K0WA 4KTEH 3TH3T 3WS3A 3PQYA 4YE4L 3ORJA 4IJ3B 5HGAA 3IJYB 4JFDA 4JPWH 4UAOC 4YIQB 4G6AD 3WXWL 3MRKA 3WMSA 2OR9L 4UB0H 3W9EA 5FO9B 4HPOL 2BVQA 3WFEL 1B4RA 1JTOA 1IGYA 4IRZH 3KPQB 4LNRB 4PJHB 4QRUA 2A6IB 1FBIL 2NY1C 3QUZC 3ES6A 3WDJA 4JG1L 3MOQA 1QYGL 5EWIL 4HS3A 4LSTL 5IHUL 3UBXI 4M6ML 4YXLL 4F7EA 1H5BA 1TJGL 3U4AA 5DMKA 1A7QH 2W38A 1SJVA 3TT3L 4LOUD 3WXVL 4XNQA 3G6JF 3K4DA 2UWEE 3T3PE 3CXDH 5D8JH 4AY0A 2K1MA 4S1DC 5A2KH 5F44A 4Z7OF 2NTFB 2EDWA 1CYGA 1YDPA 4MJ4A 3WFDH 1A1OB 2PYEB 1UYWH 3MRPB 1T20A 4JHWH 4XNUH 4QOKB 25C8L 3BISA 5JIIA 1MRFH 3TA3B 3IXTA 4KK9C 1I3GL 3PHOB 2ICWJ 1FO0L 5J1TC 3MSPA 3SQBA 5KN5A 4PP1C 1T7YA 4HAFA 4XPAH 1ZGLA 1MCCA 2IH1A 4NO5A 4OF0A 5F1IA 1IAII 4P23C 3EJZD 1IC4H 4HC1A 1A6TB 1WZ1H 1HKFA 1DBBH 2A77H 2M8XA 3FQWB 2DMBA 5IW3A 4EI6A 3OKOA 3VXSA 1CLZH 1UZ6F 1OWWA 1T3FB 2PYED 5J1AB 1UJTA 3I84A 2W0FB 4QOKD 2H6PB 4N0UE 3ZTJG 1JP5A 3TA3D 4BELD 3SDCC 1DSFL 3X3FH 4IRSC 2Q8AH 3SDXA 1QLFB 2HN7A 2MOVA 1IM9B 3PIQA 5DA0B 4L8BA 1CDHA 3LKSA 1Q72L 5CEZE 4MB3A 5DJCB 1R3HB 5FB8B 1A1NA 4JEGB 1DBJL 4JDZA 2IG2H 1I8MB 3KLHD 2EC9T 3BSZH 3MRDB 4ONFL 1HOCA 4FQIL 1BBJB 3ZO0A 4LPUA 1G6RA 2IBZX 5BXFB 3CVHH 1C12B 1I1FA 4TUOB 5JPNB 3FQRB 2R1WB 1JNHA 1D5ZB 1RD6A 2X05A 3MFFB 4X6FB 3RWJB 2OSLB 3BGFC 3CSGA 4D0BB 2VAAB 4FQHB 3OKYA 5E8DL 5IBUG 1IM9D 1ZSDA 3EDFA 4K3GA 5BJTA 3S37H 2P5EA 3NPSC 1QUNA 2GCYB 3TO2B 2A6KB 4Y5XB 3M17A 3U2SB 5E9DB 4GRLA 5L8JB 1Q1JL 1CFTA 2HH0H 3STZA 1MY5A 3DUSB 1BZ9A 1PKQB 3HZMB 2X1QA 1INDL 5E8OA 3SE3C 1WBXA 2P24B 5DQ9B 2NXZB 1SBSH 2YD4A 5ISZE 3HB3C 4PJGF 3ARBC 1T1WB 4Y5VA 3JTSA 3H7LA 2FBJL 5FGCE 1S3KH 3MA7A 4PJDB 1ZWIA 2NYYC 5E9DD 1XIWC 3TBTA 1RUQL 4Z5RB 4WFHE 3V0AC 3O11B 2XFXB 4GAYB 1RHHA 2R0ZH 4ZG1A 3MLXL 2OP4H 2MKWA 3O3DA 1Z0MA 1NCWH 2I9LA 4HLZH 5FYLL 2BSRB 1JZ8A 1FG9C 2BDNL 2B1AH 2WUBL 4BQBA 4G6KL 4L9LA 1SHMA 5DDHB 4P9HL 2RJMA 4NFCA 4PRPB 5DUBB 1T7XA 4Q9RH 3AMKA 4ZODA 4IRJB 3GMPB 2Y6SC 5FA4B 1BOGA 3O4LE 5DZNA 4QHUA 3MBXL 1IILE 2UWEA 1CBVH 3WS3B 3PQYB 3RVXC 3VFWA 4EZMA 4L5FL 5FYKU 2Z0BA 3MRKB 3LZFH 4FXKA 3W9EB 2BVQB 4XVTH 1A21A 4QRUB 4GQPH 1RIUH 5HGGS 4QRSA 5GXBB 2QL1A 3HZYB 3QXDB 4H5SB 1A5FH 2VAJA 4L1DA 2OXHA 3ES6B 4ZAKC 3T65B 4HS3B 4QGYA 3V7MA 3PGCA 1CXEA 4Y4HA 4PRPD 4F7EB 1H5BB 2NR6D 4IRJD 1S9XA 5DMKB 2DRUA 3BD4A 4Q97A 3TP4A 5TDPA 2X4SA 1WWWX 3PQYD 3VGAB 2VSCA 1DBAL 5F8QC 4IMKA 3SBWC 3VD4A 1I9RL 4MA1C 1N26A 1DLFL 2YOCA 1NH6A 5AWNH 5ADOH 3PV6B 1YDPB 4P2OA 3ZSTA 4GBXA 1T20B 3GSXA 3V5HA 1U8KA 5BW7C 5GS1A 5I1AB 3IXTB 3FQXA 3HE6A 4Z7VE 5KJRH 4E0RA 4PLJC 1EA9C 2YPVL 5KN5B 1KUMA 1HYRC 2B5IC 2DAVA 3S36H 1ZGLB 4X7EC 2IH1B 4NO5B 4S10A 3UZVB 3TFKC 5F1IB 4DGYL 1QO3A 3ESUF 3RPKA 4Z0BH 1YUHA 1CDGA 5JOPE 2DMKA 2Y72A 4Z78A 4I13B 4G42B 4DUWA 3OKOB 4JREB 4XPBH 3VXSB 1AD9A 2DN7A 4QHLA 1AE6H 4KXZH 1RUML 5T33L 1WIUA 1F3JA 4JY4A 1FZOA 3HN3A 2VR4A 2H3NB 5GRJH 3SDXB 2HN7B 5I30L 3PIQB 4DFHA 3VG9B 5C6TL 3EYFA 4YHNB 3ELAT 1FZJA 1NCBL 4LSUL 1WAAA 4UQ3A 1X5LA 3C2AL 1A1NB 4P5TA 4JDZB 4K23L 1R3JA 2PO6B 3KPTA 4HKJB 3VXSD 3HC3L 1OTTD 3MTRA 1UM5L 1HOCB 1KPRB 4XNMB 2W0PA 1G6RB 4NKQB 1I1FB 5ISZA 4PJBB 3W5MA 3WV0A 1JNHB 2R4SH 2EDBA 5DVLA 3T1WA 4J4PA 4PJEE 4PJIE 1CFQB 4YHLH 1WEJH 1I7RB 2ZUVA 4WEBL 4NO3A 3MACH 5BJTB 4WUUB 5DD0L 4HIJA 2VB5A 2ADGB 3SGKC 3IAGC 2BSSA 5T3XE 1KULA 4GRLB 1JMXA 3I6GA 4Z7WA 2YPLE 4K3EH 3VGGA 4YHPA 1JWMA 3STZB 2PO6D 1BZ9B 3MJ9A 3GRWL 4MQSB 4N0CC 5E8OB 1WBXB 1KLUA 4M7KH 3CFBA 3VJ6A 1CD1B 2VLLA 4MS8C 3LMJL 3H9SB 1JHKL 1IGML 1PG7L 3BIBX 4OLVL 4S2SA 2R2HA 3TZVA 4Y5VB 3JTSB 4K2UH 2ZOLA 2FGZA 1Q9WA 4WUUD 5HDBE 1MH5B 4L3CA 1N4XH 3WO4B 2XQBH 3O4LA 4ODHL 2RAMA 4PRHA 1QRNB 1ZWIB 4PJ8C 3CLEH 4NNPH 5FFLA 1ZEAL 1LHZA 1U3HA 1HHIA 5GGSY 1RHHB 1G0DA 4NRXA 5J1SC 1N0LA 5JW4N 5EULV 4Q9QL 4MSWA 4C59B 4NCDA 3O3DB 3H9SD 4GUPA 5A2LH 1J1OH 1J1PH 3BFOA 4M1DL 4XBPA 2V17H 1MJUH 1EGJA 1VCAA 4UI2A 3OKLA 4X6DE 4KHTL 4WEMB 1NKRA 4XAWL 4JM2B 4RX4D 1J05A 3MRFB 1W2KT 1MPAL 4H8WL 1HIMH 2EEBA 4D3CH 5BQ7A 2VLRA 4JQVC 5HYQB 1QRND 5F96L 4QHUB 2R0WL 2LE9A 3H3BC 4X7TB 5D70H 1A6ZB 3QFJA 3NABL 1OCWL 2IQAB 2UWEB 3NCYS 2DQDH 3MO1A 2ADFH 4DQOH 4YUEH 3AC0A 1QG3A 1GAFH 2HLAA 4XB8A 4DTGH 1INEL 3UJIL 1EHXA 4FXKB 1UB6A 1BHGA 4RISL 1BAFH 2CH8A 2ERJC 3ZT6A 5HVWA 4OGAD 3KPRE 4O4YH 4QRSB 1G9NH 2EZ0C 3FFDA 4M8QA 2R2BA 4JM2D 4K9EH 3PGCB 3EZ8A 3MBEA 3GSNA 4ZUTA 4Z7VA 4E9LA 5D1XC 4XVJL 3HMWH 1VKXA 1OARL 5TDPB 4BZ1H 4KC3B 4QXTA 1KJ3H 2X4SB 4JR9L 4XPGL 1AXTH 4WGWB 4LCWA 4QLRA 1DQML 4EIGB 1AFVL 3WSQH 1DQDH 1CWVA 3SGJC 3AY4C 5TPWL 4HULB 5ACLA 4N0UB 4F15B 4FFVC 3V5HB 1F4YL 3G9VA 1U8KB 2X09A 5GS1B 1CR9L 1LDPH 3FQXB 3HE6B 4M61A 3TPUA 4E0RB 5EA0H 4CMMA 3QCUH 5CIPH 1IARB 3RNKB 3QNZA 3KYKL 1A4JB 2EDEA 4YDJA 1NCDH 2DTSA 4N1EA 1QO3B 1FG2A 3SHSA 1YUHB 4G7YL 5EU3A 1PY9A 2GW5A 4YR6B 2AJ3A 3C60C 1BVKB 4C56A 5I8KH 4HUUA 2P8MA 5HBBA 5D2NA 3L5XL 4L4VE 5H2BA 1IT9H 2JJSC 2CLZA 4JFQA 5AD0A 1IC5L 3QQNA 1F3JB 4JY4B 4K7PH 1FZOB 3DSFH 3CMOH 3HE6D 5HI3D 5JTWA 5IF0A 1CL7H 1A2YA 3BZFA 3FMGL 4P46C 2OCFD 4LP5A 4JZJA 2FDBP 4PJXA 5CEZD 2PTUA 2BVUA 1RZGB 1FZJB 4QTIH 1MFAL 1AGBA 3OJMB 4UQ3B 4ZUUA 5JA9A 2YPLA 5CJQL 4D0DA 1U8MA 4K8RC 4P5TB 1J86A 4GSDH 5SWQA 3TH2T 5DMYA 1R3LA 2VMFA 2WWMD 1GJIA 1NEZB 4ZFGL 5ISZB 4WHDA 1ACZA 2CKNA 3S6CA 2P47B 3WIIL 3RIAF 4XPHL 1OGAE 1OM3H 4M5YH 1VPOH 1UM6L 2NQCA 3OAZK 4DGIH 5FGCB 2H9GA 3I50H 1ADQL 4J3WA 2BSSB 1R0AH 1F4XL 5F9DC 4KDWA 5ITFB 3I6GB 3DV4B 1CXFA 4P5TD 4YHPB 1JWMB 4LLUA 1YPZE 2EDDA 1KPUA 5DYOA 3WFHA 4DW2L 3WJLC 5C7XL 2ZCKH 1QNZH 4WY7H 4LGPB 1KLUB 3CFBB 1IL1A 2VLLB 3OAZH 5ISZD 2BRRH 4DK6A 4WV1A 1H3PL 1EPFA 5IFJA 5CCKL 4J4PD 4GJTB 4Z8FH 3PABA 2R2HB 4X6DA 3V6OC 4FOMA 4TRPH 1MHCA 2DB8A 3KLAA 1YEKH 2VH5H 4XBEL 3MV7A 2EXWD 4G5ZL 4L3CB 4MD0A 4HWBL 3FHAA 3O4LB 35C8L 5DZLA 4WFHD 3U0WH 4ORZC 3V4UL 1MFCL 4WI4A 5JDJA 1HHIB 4NRXB 2ZCHH 5K93A 2WP3T 1TTGA 3HZKA 4QHMA 3MRRA 1P9MA 2DLFL 3MLUH 4X9BA 4NJAH 4GUPB 1OAUL 5KAQF 5KS9F 4Y88A 4WUKL 4R8WH 3OKLB 4CVXA 4LCCB 5FA3A 2CRZA 1J05B 1QZ1A 2W0KA 3WFBL 5BQ7B 1R3IL 3O4LD 4EBQH 3RKPA 2BFVH 4M8VA 4UT7L 1KCUL 4JGJA 3MO1B 5C0GB 4XNZC 5IUSA 3S4SB 5GRUH 1UB6B 3AXLA 3H9ZA 2FX9H 5DI8A 2QHRL 1O0VA 4LHQB 4NQEE 1EZVX 1ONQA 1V05A 2IAMD 4Z7VB 4ZUTB 3EFDL 4OZGF 2BOCA 5CJOH 2ILLA 3B9KA 4Q6YA 4UV4H 1D5BB 1VKXB 1S7VA 1J1XL 1MVUB 3EDJA 2DICA 2F9BT 1KN4H 2JCCE 3OAUL 1U41A 3IRPX 2R0KL 4PY8J 4JVUA 1IGCH 2B8OT 3KJ4B 4FZ8L 5E24E 2HT4D 4LKXB 5IQ9A 4L4VA 4MJ2A 1V7NL 3MLYL 4G8EA 3VWJC 15C8L 1MCRA 2FCBA 5ID0A 1EHAA 5JR1H 4LARH 1MLBB 1PQZA 3MV11 1LO3L 3QISA 1N3NA 1FRGL 3UTQB 4CMMB 3ARGD 3V9FA 3BRDA 5H37H 3TESA 1CXKA 3L3OB 3QNZB 3UAJD 5BV7L 1T5XA 4YDJB 3RIFF 1FG2B 4AENA 4HQQL 5EU3B 5JOPD 1HDMA 1FC2D 4ALAL 4C56B 2ZP0T 5ADPH 2FL5A 4IEFB 4U2ZA 1CGSH 4HUUB 3GGWA 5JHLH 3RIAK 4PJ9C 1C7TA 3FT2B 5CJ8A 2OK0H 2IADA 3QO0A 3BD3A 5LBSL 4FZEL 5H2BB 1J0YA 4QO1A 5FKPA 4JFQB 2PXYC 4HBCL 4TUJA 1U58A 4PJEB 4PJIB 1B90A 5B38A 4JFPA 1J9CT 3U48A 3FN3A 5IF0B 3VGEA 5I18H 1A2YB 3BZFB 1R5IA 4YBQC 4JZJB 1IGTA 4UIKL 2P1YA 2FB4L 1E6OH 3VGHA 4HMCA 1FGVL 2YPLB 4IDJL 4D0DB 1U8MB 2I60H 1E4WL 5CHNA 5SWQB 1JVKA 3G5VB 3JTTA 3MOAL 1JK8B 1WT5A 1GGCH 3PDGA 5F9OH 3FT3B 1T1YA 2DQGH 5MEQA 1TENA 4KPHL 5C0BA 1DR9A 4ZO6A 2H9GB 5FDYA 3T0EA 5T3XD 1GC1H 4GAGH 4FNLH 3TO4A 2YPLD 3SO5A 4O58H 2DQHH 1BIIB 4LLUB 4PJHF 1KB5H 1KPUB 5DYOB 4CVWA 3DRTA 3MLZH 2VYRE 1FNHA 2CUIA 1I8KB 4UV7L 2VDNH 1WIPA 1IL1B 1OAQH 2XA8H 3DIFA 3KPLA 4ERSH 2XZQL 4WV1B 5GRXG 1T7VA 3X3GH 3O2DL 2NY5H 4RNRA 4AYFA 4X6DB 4FMKA 5EO9A 2HFGL 5EORL 4LQFL 2Q6WB 4G9FE 3KLAB 3DNKA 5E95B 4D2NA 3A6CL 3DGCR 4MD0B 3GI9L 4HK0A 5E2UH 4YWGH 3EYSL 3GMQA 1YEGH 2OTUA 1NJ9A 4XBGA 5IJVA 3ZYZA 1OSPL 5CZXD 5ETUA 3D9AH 2H32A 4JPWL 1K6QH 5D7IA 4LKCB 3IB4A 3EHBD 3HZKB 3RVWD 3MRRB 4IRZL 3ZKQD 5LQBH 1H8OA 2QQQA 2C4XA 3KPRB 1MHHA 1TPXB 4NQEA 1EVTC 3PL6A 4CVXB 5FA3B 3V8OA 3VXTB 3MV8E 1MJ8L 4UILH 1M1SA 4G43A 3FB6A 4PY7B 1IAIM 5FYKE 2YMXH 5D5MF 3CXDL 5D8JL 2NNAA 3NIFF 3S8WA 1D5XA 4CDGC 4OKVB 3TIEB 4ZFZA 5L9DL 3PHQA 1EBAA 1ZK9A 3G04B 4XP5L 3R8QA 3WFDL 1KGCE 1D5IH 3N9GH 1UYWL 4JHWL 4XNUL 4TOYL 3KPRD 3GHEL 12E8H 3L95A 4M7LH 5IBLD 4DK3A 4OB5H 4ZUSA 4HIEA 3EAKA 3RIFK 1S7QB 4OGZA 3DX6A 3Q5YA 1XF4A 1JIBA 1HCFX 1C16A 3BJLA 2E7LA 1IC4L 1FV1A 1QLEL 1MY7A 4JFOA 1DBBL 2A77L 5D7SH 4RFOL 4HLJA 4H1LB 2XA3A 4DEPB 1CLZL 4PRIE 1Q0YL 4HZLA 3U79A 1KTDA 3VDCA 3VDAA 2V2XA 1CF8H 4L4VB 3ZE1F 3QRGH 1G7LB 2PYFA 3CCHA 1TVHA 1WCQA 3ULSA 2NPLX 5ID0B 2Q76A 3MV9E 1A6VL 1PQZB 5ICYA 1QBMH 1TCRA 2B20A 4XPTH 1YEEH 3GFUA 2LFGA 4TPRH 3LN4B 1KN2H 4OLUH 4DKEL 1Y0LA 1QFPA 3CUPA 5HHVL 3ROLA 3MA9L 4JRYE 5FYJH 2IG2L 1HDMB 1LWRA 5EU4A 2FL5B 2VSDA 3IF1B 1G7JB 4L4VD 2Q3AA 1XFPA 4LSSL 5FKPB 3T4AA 5HXMA 2CJUL 2OM5A 1BD2A 3WNLA 4LFHG 4TSAL 1U58B 4MXWL 4WW2C 1FNLA 4YO0B 5B38B 1CQYA 3MXVL 4JFPB 4GRWH 4XX1G 1WSST 1OGAB 4PV9B 5DT1H 3S37L 2NW2A 4N0RA 4C83A 4JPKH 2YD3A 5T3ZE 1IGTB 3PNWA 3UJTH 4JY6A 5F3BA 2GSGA 2EDTA 5HDLA 4OCXH 2HH0L 1YPZB 1TETH 4KKBC 2KH2B 3F7VA 1N8ZA 4Q0XH 5D2LE 1D9KA 1BX2B 1B0GA 1SBSL 4LDEB 5MP6H 3OQ3B 5JW5A 4XNYL 1T1YB 4HMEA 1CDBA 5FOBB 5EUOA 4G8IB 2VDMH 4G9FA 1OGAD 5MEQB 4K3HA 5C0BB 4U1SA 3ARVA 3CVIH 4JFZL 3SEPA 1Q9OA 5IM7B 1II4E 3L6FA 3OAYH 4UTAL 2I25N 2J8OA 3FL7A 5FM5O 3TO4B 1AY1L 4NNYA 2R0ZL 1G9MH 2DKMA 2MQCA 2OP4L 2Y7QA 3CK0H 4LNVA 2DBLL 1BFSA 2H45A 1M05A 2NY3C 3WL9B 3DRTB 2R2EA 3NCJH 3UJJH 5GJTL 5I1IH 3KPLB 3TYFA 3DIFB 5KVEL 5DFTA 2VO5A 2DJUA 1ZHKA 1F90H 4Y4KB 2DI9A 2B1AL 4QCIB 4D9LH 5EO9B 5I1CL 1ZTXL 5GS0L 3IDJB 3HI5H 5HYFA 1EUTA 3W81A 5F7WC 4RAVA 1JNNH 1U8JA 1G7HA 1ZANH 3TO4D 1NJ9B 1KT2A 1QHPA 1FCCA 5ETUB 3PWLA 5D7IB 1EMTH 1QBLL 3LZFL 4HDIB 2ORBH 4XVTL 1PG7X 2G9HA 2Y23A 3QHTC 5E0QA 1AR1D 4Y4KD 1QFWM 1MHHB 4WU7A 2YA1A 3W9DB 4NQEB 5D7JB 1I9JH 2J6EA 3TNMA 1SJHA 3HS0B 4I48A 1BP3B 3OKNA 1MCSA 4HFWA 4X6CE 3LOWA 4G43B 3SKNB 1JGVH 3FB6B 3PWPE 4FHBD 5CWSB 3VFVB 3KR3L 2CLVB 1I9IH 1U8QA 1D5XB 2APWA 5KSVA 2JCCB 1DBMH 3BPLC 5I74B 1LMKA 3O6LL 3O2WL 3PF2A 4RSVA 1AD0A 3P4NA 3MREA 5AWNL 4D94A 3QUZA 3ZKXC 5C92A 1F4WL 1QBBA 2R8SH 5ANMA 1T22B 4LSRH 4NQED 3L95B 5D7JD 1UH4A 2QQLH 4ZUSB 6FABH 5KJRL 4QHNA 1WF5A 3V5DA 5BOZG 3S36L 1HNFA 4HT1H 4UMGA 4JDTH 5F93C 3U4BL 4Z0BL 1FV1B 1U3JA 3EBAA 1CD9B 4NQXA 4JFEE 4KRPB 4F2MA 4XPBL 4CNIB 3QNXA 1AE6L 4HLZG 5HGDA 1KTDB 2V2XB 4A2MA 1HHGB 2XZAL 3ZL4H 2LU4A 2PYFB 3U9PH 2GAZA 3BIKA 4QGTA 4EUPG 5GRJL 1XF5B 3DLQR 2D7TH 4JKLA 5BZDA 2Q76B 3C5SA 1JGLL 3QULB 3MLTA 3L5IA 4P5KA 1L7TH 4ZQKA 1TCRB 5ESVA 3FAXA 2FH6A 4P23A 4R7DA 1Y0LB 1ZAGA 3CUPB 2I26N 3ROLB 3FOLB 5KSBE 4P59L 3F8UB 1B0RA 4I77H 4B53A 4KRPD 2NY4C 1MCOL 3HPJA 4HGWB 5EU4B 4R96A 5D2LA 1BBDL 4MNGE 1BJMA 4Z77A 4MJ6A 5JNYA 2R4SL 1IEBB 1MCWW 4IRSA 4YHLL 1BD2B 1A47A 3CGTA 5AZ2L 4JCLA 3ZE0E 1I4FA 5EIQA 3QXUA 4JFXA 4UOW1 2NW2B 3H7BA 1XEDA 4C83B 3X14A 1RZKH 1RVFH 3PNWB 3BAEH 3QIUC 1J0KA 4MD5A 4JY6B 5F3BB 4DKFL 4NUJA 2SEBA 3KPOB 3JWDH 5IVZA 1YJDH 4K3EL 3O8XC 5DHVH 3RA7L 1BMGA 2F74A 4Z9KB 3X11A 5KSBF 4HW6A 4M7KL 3RP1A 1FNEB 1N8ZB 1OL0A 3F7VB 4N0YH 3ILPB 1B0GB 4MHHI 2VDLH 3IKCB 2J5LC 1C5DA 5JW5B 1UFUA 5C8JA 2Y1VA 4HWZA 4JJHA 4G9FB 4KI5C 1N4XL 4HCRA 2H1PH 3H6JA 2YA2A 1F4AA 1XGRA 2Q8BH 4BFIA 3TT1H 4U1SB 1XR8A 2YKLL 2J4WH 3QQ4A 1BEYH 3CLEL 1BLNA 4QXUH 5CS7A 1FORL 4XP1H 4OFVA 3CU1A 4NNYB 2DD8L 4W6WB 3RPIA 1ZVYA 2Y7QB 4WDIA 4HGMA 2R2EB 4AQOA 2AKRA 3ARBA 1GCFA 1J1OL 4Q6IB 4L8SC 2V17L 1MJUL 2E27H 1ZHKB 5DMGD 2DLTA 1YY8A 3HAEA 3MCLL 2GTWB 4G9FD 1HYSD 3MV8B 1HIML 3QFDB 1KJ2A 5CBEA 5CD3B 1XIWA 3SKMA 4X6CA 5D70L 3M1BA 5CGYC 5HVGB 4MXQD 3PWPA 1U8JB 4NQUA 1KT2B 2ADFL 2NX5A 4DQOL 3PWLB 1HQ4B 5A16A 4HC1H 4DTGL 3AU1A 2C3VA 1J12A 3K2MC 4UT6H 1K2DA 4U1GC 2G9HB 2V6HA 3GBML 1IE5A 3VD3A 1XF3A 4P9ML 4O4YL 1G9NL 4AEEA 2DIJA 4YFLI 4WU7B 4K9EL 3MV8D 4JQIH 1FVCA 1L9NA 3U7YL 3TNMB 1SJHB 4I48B 3OKNB 5E4EB 4HFWB 3HMWL 4NDMA 2IPUG 1IMHC 4JM4L 5FYKD 4OZFG 3V4PH 2EYTB 2DTMH 5F7HA 2BRQA 4ISVA 2EEDA 1N6QH 2AXFA 2A9NL 3WSQL 1DQDL 1KGCD 4PRIB 1AD0B 3MREB 3KLDA 4FFWC 5C0JA 3WKNA 3QUZB 1A0QL 4ZAKA 1G0YR 3LPGA 1G6RH 4Z18A 3FTGA 3BN9D 3KPSE 5HHME 5HYIA 5K59F 1YEDB 4QRTA 4APQA 5HPOA 4BK4A 4QHNB 3V5DB 1WAAF 3LVEA 1EO8H 4N9OB 2N7BA 1KEML 1EBPA 2BVEA 3MOBH 1MI5E 4HWUA 1F45A 1NCDL 4LIQL 4PGCA 2FHFA 2V5RA 5K33A 4NKIL 3SBWA 4JPIB 4RFNC 3BP4B 4JRYB 5JXEC 4R4NC 3THMH 5IQ7H 2XQYG 3QDGE 4F2MB 4PRID 3EDEA 3QNXB 5HGDB 4NWTH 1IT9L 3BX7C 3QUZD 4HWEH 1ED3A 1LK3H 2RR3A 4LLQA 2XACC 1DVFC 5BW7A 3VFUA 4X4ZA 2GAZB 3BIKB 3DSFL 3CMOL 5JQ6L 2G60H 4RMSA 1CL7L 4PGEB 3MLTB 1LD9A 3P4LA 4ZQKB 4OFIA 4QRQB 5ESVB 1DZBA 4BH7B 4Z7WF 4WCYH 1YEHL 4JRYD 1OLZA 1FP5A 1B0RB 3MUJA 1N6UA 5GGUA 3UP1A 3FRPG 4R96B 5D2LB 1VA9A 4YX2H 1ZVHA 4XP6H 2GFBB 2P44B 3O3EB 1NFIA 4LK4A 1NFDA 3CLFH 2JELH 5FUCC 4JAMA 4PP1D 4F7CA 4MLSA 1OM3L 1I4FB 4M5YL 2CIKB 5LXGH 4P57A 2X6MA 4DGIL 3I50L 5T3ZD 4YXKH 4XTRC 3I85A 3QG7H 1FFOB 5I1GH 4NUJB 2L0DA 2HP4A 2F74B 4FP8H 3X11B 3GSRA 2ZCKL 1J0IA 1GC1C 1A8JH 1RZFH 5L7XH 3B5TA 2BRRL 3RVVD 2DIBA 1FCGA 1C5DB 4Z8FL 4UOJA 2HT2D 4TRPL 5C8JB 2K9UA 5DGQA 5IHZA 4HWZB 2VH5L 1RULH 1X5ZA 4M48H 2QADB 3NPSB 1RJLA 2IPTL 3P30L 4BFIB 8FABA 2OS7A 3QQ4B 3WIHH 3G6DH 1BLNB 4JVPA 2NY5C 4F3FB 5KG9A 2FZ3B 4FQQA 2ZCHL 4Q7DA 3RPIB 2F54A 2F5BH 4KTDH 1MFBH 4WDIB 4FFYL 2QBWA 3MNWB 3K74B 2VKWA 1KJVA 4NJAL 1Z9LA 1PX3A 1HH6A 1PLGH 4R8WL 4FFZH 1DDHB 3HAEB 1H3XA 3D25A 2QADD 3GMRA 2X9YA 4RMUA 1CLOL 5I76A 1KJ2B 4PJ8A 5CBEB 5EU7C 1XIWB 4Y5YA 3SKMB 4X6CB 4EBQL 2R4RH 3E6HA 3PWPB 3NTCL 3WFCH 4FA8A 5I6XB 2J2ZA 2AQ3A 4N5EC 5CEZH 1YZZA 4M3JA 3LQMA 3S35H 5A16B 1PEZA 5GIRA 1NGQL 2C3VB 2D3VA 5GRUL 3HB3D 5E6YA 5EZJA 1K2DB 3L7FA 5ACMA 5FHBH 1CXLA 1XF3B 5GRYA 1HE7A 1AGCA 4MZ3A 3LPFA 2V9QA 4JQVA 4W6YB 1MIEH 5CJOL 3QZWB 1XIWD 4LCUA 3PWPD 4NDMB 2E7BA 4FQLH 2ITDB 3BO8A 4DUXA 4KTYA 1CFSA 3RX7A 1IGCL 3P4OA 3CFJA 3QDGA 4JFEB 2X5PA 5K9OA 3PHSA 3ULVF 2DDQH 1F97A 4AIZB 1QPXA 1DFBL 4J3XA 5C0JB 1ZLVK 2VXVL 3VXOA 5C71A 3CD4A 3ZHLA 4TQEL 1XF1A 1IFHH 2GITB 3F7QA 1AXIB 1SY6L 2W9EH 5I75B 5J3HD 3RUGA 4PJXF 3K3QA 3KYNA 5D1XA 4QRTB 1RU9L 5J11B 4APQB 2A74A 5C3TA 4Q2ZB 1VFMA 4JANA 1Q8MA 2GHWB 1ZLVH 4YHOH 4RGNC 2MCPH 4NC0B 1ZKAA 1MCIA 4MA1B 4JFED 1AGFB 4XX1E 1CGSL 2Y5EA 3AY4A 1OTSC 1EO7A 4KK5C 5JHLL 5AAWA 4FG6C 2OK0L 3MJ9H 3VFRB 4HFUL 4MNGB 4LLQB 4XXDA 4XVUC 1AQKH 3SO3B 3WUWG 2FX7L 1LNUA 1F42A 5GGTL 1ORSA 3NH7L 4APQD 3D69A 2DQFB 5CMAA 4G6AC 3RWIA 1SYVA 1DANT 1OB1A 1E6OL 1JGUH 4V1DA 5DWUH 2I60L 5GGUB 4G3YL 1AIFA 1RY7B 4G6JH 4KGJA 3RU8H 2JJSA 3JSSA 4ZD3L 5D71H 4LOUC 5F9OL 1IC7L 4HS6B 5MEPA 4QXWA 2XKNA 5SX5K 5I8OH 4P46A 1EGJH 2J7LA 3GJFA 2N1KA 2D7PA 1YMHB 4FQ2H 3FOMA 5DD1H 1NSNH 4YGAB 4P57B 1UZ8B 3AVEA 3ZYIA 2AXJA 3LH2L 4HK3N 5C3LD 2X4OB 1CL7I 4X4XB 4I3GA 1T89C 4O58L 2EC9U 1LO0H 3PGFH 4OFKA 5C0CA 4G7VH 2IMMA 4CW1A 5DD5H 2VDNL 3WDIA 1OAQL 1KLGB 2XA8L 4PJ7F 3X3GL 5TQ2L 1UJ3C 2VXSH 1G9MC 3OR6B 3S37X 3EJZC 3ME0A 1D6VL 2Z4QA 5IHZB 1W0VA 4LASL 2QR0A 1ZLSH 3VRLE 3EOYG 5E2UL 3L5JA 4YWGL 3AUVA 3ULUF 3GSNH 4M62H 1YEGL 1N7MH 1BOYA 4N8CH 4TYUA 5JZ7D 3GKZA 3X13A 4OGYH 5J12B 5GGQL 2B1HH 3IFOA 3D9AL 5ACZB 1K6QL 4WFEE 4P4RA 3TA3C 3WJLA 4JB9H 2XTJE 4EQ2A 1YEJH 5EFIB 5LQBL 5IVXF 1KJVB 3EO9L 3VXRE 2VDKL 1HH6B 1CDCA 1TZHB 1F3RB 3M07A 1MEXH 1NL0H 4OZ4A 4JO4H 3D25B 2AV7A 2FH8A 3GMRB 5I76B 2GK0B 3KLHC 4Y5YB 1VB9A 4GXVH 1Q38A 4ZPTA 4X4ME 1W72L 2F5AL 2FJGA 1HHKB 2GI7A 4M7ZC 2DYPA 1MJJA 5GIRB 1I85C 4TULH 4K7FB 1IEHA 1OVZA 5EZJB 3N9GL 3L7FB 5K9QI 1NCTA 4PGBA 4GW4A 3K46A 1DBKH 1MCQA 4PYGA 2IFFH 1YN7B 1AGCB 2GUOA 3KPSB 2WWKT 5HHMB 1XZ0B 3QCTL 2ICWI 1MCNA 4FS0A 3KAAA 2D0HA 1IEAA 2HRPL 4LCUB 2KPNA 3WD5L 2XXMB 3BO8B 5FM5M 5T3XH 3ARRA 4GAFB 4I4WA 2PTVA 5D7SL 3P4OB 3QDGB 5K9OB 5I2IB 4PJAE 1U92A 3LS5H 2PW1A 4L4JA 4XXCC 1BIHA 3TBVA 1Z9OA 3VXME 3ISWA 2HMIC 1E6JH 3NIDF 2JB5H 2IALA 1MCDA 3T4YB 3KPSD 5HHMD 1QBML 2P7TA 1JZ4A 1VFOA 3KYNB 3BVNA 4HV8A 2RFXB 4XPTL 1YEEL 4POZD 3V0WH 2A74B 1KN2L 4JANB 3DO3A 1DEDA 1MI5D 1KBGH 1MWAA 3U1SH 4X5XB 1ZOXA 4PG9B 5EZLA 4JRXE 3C8DA 3U9UA 3QDGD 4OD2B 4H88H 1RIVL 3BD5A 3O2VL 3VWJA 5JOFA 5C0DA 3F7PC 1VGKA 4DUVA 4XXDB 3RWCB 2HJLA 1K5NA 5GGSA 5MENE 1YQVH 4AK1A 3I3DA 1LNUB 3HMXL 4BQCA 3S36X 1KENH 3HCVA 5CJ5A 4JPKL 3RWIB 1KLFA 4QXGL 5FAAA 3BMWA 4XC3H 1SYVB 3UJTL 3TBYB 5GZND 1OB1B 1JWUB 3CC5A 2R1XA 3VG0H 3QUML 4RGOH 3H3PH 1TETL 4PJ9A 2E6PA 2EKSA 1RZKC 3Q1SH 4JLRB 2JIXB 3FO0H 2NR6C 4IRJC 4L3AA 4OLWH 5GS2D 2AS5M 2UYLB 4KZEL 1YJDC 4LCIH 2YWZA 2HTKC 2OYPA 1GH7A 3K1DA 4KVCH 4Y4FD 4P46B 3CSBA 5GSRA 2VDML 4X80L 3N1PC 1I3RA 3WEXA 3FOMB 3REWA 3A6BH 3DURA 4HJGB 4E41A 1X7QA 4KMQA 3LQAH 5D7IF 4PLNC 4CL7A 2CK0H 1XGYH 4CN6A 1G9ML 3V8CA 4CGTA 4OV6F 3OGOE 3UJJL 2JIXD 4CW1B 1H5BC 1JF1B 2DWEB 2ZPKL 5DK0A 2YN3A 1QFHA 2Z8WC 4G8GE 4PTUA 3D0LA 5EG6C 3C6SB 2X41A 4P46D 5EPMA 4LHJB 3VGAC 4KV5F 1W0VB 3WYRA 4DFIA 1T5WB 3KPMA 4U1IA 2APXA 1JNNL 3SOBL 4BH8A 2PCPB 4QHKJ 2EDXA 4X4MA 1OF2A 3EOAA 2JK5B 5CEXA 4P4RB 3OZ9H 1EMTL 5IMMA 5ABDE 2ORBL 2Q20A 4D8PA 4H1LH 4NN7B 3K81A 43CAA 1UWXK 4NC1E 2DI8A 1I1CA 4BSVB 1FFNA 1I9JL 2AV7B 1Y6NR 3WLBA 4JREC 3CDCA 4F8QA 3NZ8A 1OTTC 4OCRH 4BM7A 1CFNA 2RCSH 2X44D 4LVHB 1OSZA 4FQ1L 4EUPA 2ARJA 4NKOA 4J3TA 1UWXH 4K3DH 4M03A 5HYSB 4PJAA 5CSZA 3VG9C 1TJIH 1GGBL 2OTWA 4PGBB 2AXGA 3SE8H 2NY0B 3VXMA 1IZJA 4LSRL 2A73A 4Y1AE 4KJPD 3U46B 4KFZC 4O2EB 2QQLL 6FABL 4HIIA 3DECA 2PO6C 4MAUH 2HFTA 4NQDE 4JDTL 4PUBH 1IEAB 4KHXH 4C54A 4JRXA 4KDTC 3QDJA 2QSCL 4JZNA 5E5UB 1FAKT 1U92B 4OBSA 3Q0HA 2PW1B 4H0IA 5E94A 4KJWD 2NY0D 3TBVB 3W2DL 3DSNA 3FB8B 2IALB 2D7TL 2FSEA 4E5XA 1CU4H 1D6EA 3JV6A 1BM3L 2P7TB 3OJDB 1L7TL 4HV8B 3BVNB 3IDGA 4M6NH 4MCYA 5EO0A 5HPMA 3MCG1 1OWRM 5C08E 1MWAB 5ERWB 3NFNB 1UCBL 4XCYA 5EZLB 2IPKA 3U9UB 5JW3H 2FIKA 2BVYA 1IKFL 3ARQA 3WO4C 3JWOH 5C09A 4HBQA 5C0DB 1S7RB 1VGKB 2CDEA 4XVSL 3VA6A 4JGUA 5EUOF 4N8VG 5C1MB 1K5NB 5GGSB 5IMOA 3BP5B 1Q94B 5M95B 1FL5A 5ALBH 3LS4L 2XXCB 3HCVB 4KUCF 1ACYH 1BVZA 4OCMC 1RVFL 1TVBB 3BAEL 2Y36L 3HRZB 1HH9A 3CC5B 3JWDL 2R1XB 2MKLC 2WUCL 4HUXA 3CDYA 3MROA 4JFFA 4PJ9B 4JM2C 2X89D 2EKSB 1S7UA 4WWID 2M1KA 4KMTH 4P2CG 4K7PX 4G8GA 2YXFA 4N9GA 4ZFFA 4WW2A 3QEGL 5CZKA 2O5XH 5DRXA 5IIEA 5GSRB 1MRDH 4HGKC 3D85A 1I3RB 2Q8BL 3TT1L 2Z9TA 3REWB 2J4WL 3DURB 4HIHA 1BEYL 4E41B 4XAKE 1X7QB 3C6LB 2R23A 3O6KL 2H2PD 4JO2L 1DUZA 2F53A 4NFBA 2XTJB 4TNVF 5DTFB 2X4RA 4P49A 5DK0B 4OZFA 1VEOA 1QQDA 1BGXH 4ZOEA 4GS7B 1FO0A 1GGIL 1M6OB 2ENSA 4IMKC 1QFWH 1MHPH 1WBZA 4CJ1A 3C6LD 4HUKB 3L3KA 2R0LL 2OL3B 4WFED 1WZMA 1QFOA 4HC1L 3EYOB 1NC4A 5GS1C 1X5XA 2XTJD 4UT6L 3HE6C 3PV7A 4KK6D 3ZDXF 2DIAA 4BQ9A 3IXAA 3VXRD 43CAB 1F13A 3P73B 1OQOA 2YR3A 5BMFH 1C5CH 3KHQA 4Y1AA 3UTSE 3WBDA 4ZUWB 4NQDA 4Z7UE 3WLBB 2WWMC 1U93A 3RX8A 3V4PL 1CFNB 1SEBA 2DTML 4BSJA 2VL5A 1DQQA 1OP9A 2A83A 4CBPA 5GGRB 4R90H 1W0YT 4HUMB 2ZWLT 4PRAA 2GJ6A 4PJAB 1FL6A 3I75A 5CSZB 2OTWB 4AQ1B 2AXGB 4XCEA 3VXMB 2R56H 1UXSA 5EC2A 4ZUVA 3TH4T 4P5TC 3VI3E 4HIIB 4R7NB 3O6FB 4LF3B 3OSKA 3H0TA 1KG0A 3QHFH 3VXUE 3IS1X 3IDXL 5J13B 4JRXB 2PUQT 3W0WE 3THML 3QDHA 2VRAA 3K2UL 4KZDL 2DF3A 5ESQA 1ZT1A 3AMLA 4PJ5E 2VLJE 3IAPA 3MRNA 1LK3L 5DD3L 2EXWC 5KVGL 5E94B 1Z3GL 3VXMD 3MCKA 3EYQC 3QPXH 1F02I 4MDIA 5AYUH 2APBA 2G60L 5MENB 1A6WH 1JN6A 2FSEB 5DJ8B 4E5XB 1A3RH 1D6EB 3QA3A 3JV6B 3O6FD 3IDGB 4PFEA 4WI9A 1KXVC 2IBGA 3IS0X 4OI9A 4YDVA 2DQCH 3OB0H 4JRXD 3T1FA 1B0WA 2VNCA 4NQSA 2IPKB 3BUYA 1GOFA 3JV5A 1LO4H 2FIKB 4M9OA 3O3AB 4XP6L 4DZBA 1UEYA 2E6JA 2NY2B 2CDEB 3BH9A 5MEND 3CLFL 5B3JF 2JELL 1NGPH 4J7RA 3EYUH 2XKSA 3LN9A 1FL5B 4P2RE 4ONGH 5FO8B 4Q9BA 5EH1A 3QG7L 4X83A 1HH9B 4TNVK 4RMVA 1Z5LA 3RWDA 4HUXB 5FYKH 1EJOH 3MROB 4LCCC 1T04B 1JI2A 1HXMB 2IAMC 4X9IA 5ALCH 2DKUA 5LWYH 1S7UB 5DJ0B 2Q87A 5L7XL 1U91A 4LLAA 3CAFA 1NCAL 2NY2D 4G8GB 1RURH 2AK4E 4WW2B 1MNUH 5B22A 4NCC2 3WFZA 1EXUB 1OQXA 2FJFA 5DRXB 3V4VH 5SWSE 1FLRH 1RULL 5IIEB 2AJXH 4M48L 1DQTA 1H3TA 4OQTH 2J6EH 1A14H 5F88A 5AEAA 4AEIL 1N2RA 3O8XA 3GI8H 3KDMA 2DQTL 2PNDA 2R23B 4MYWB 3VGDA 2F5BL 4KTDL 4XC1H 5JIPA 2HJFB 5C6PB 4CVZB 1G1CA 3Q6GH 2X4RB 2P8PB 2FGWL 3RTQC 3ARGC 4G8GD 4BUHA 2BNRE 4FFZL 5IOPB 1ZVSA 1DP0A 4OZFB 1QQDB 4QWWD 3UAJC 1FYHB 5L8LB 3BPCA 2EDHA 3UTSA 4OLEA 3S34H 4ENEC 4WNQA 1FO0B 2XZCL 5GISL 5KANG 5IESH 4YGVA 5I8EA 3KJ4C 1WBZB 2R4RL 4G9DA 4OZHE 3T3MF 3B2UD 3L3KB 5DJ2A 1N5AA 3FQTA 5DK2B 2E7CA 2DKSA 3FO2A 1U95A 4M5ZH 1NC4B 3VE0B 4X7CC 2J8UE 4L8SA 2DWDA 4Q58C 5JLZA 3GIZH 5J7CC 3CX2A 3PXHA 2EE2A 3ARPA 1IVLA 1I7TA 1HINL 5FCUL 3KYOA 1ZHLB 4Y1AB 3B2VH 5DEFA 4U2YA 3EO0A 2X9XA 1MIEL 3RRQA 4CU6A 4NQDB 1BWMA 3NCMA 4ZFOA 5D72H 2WBWB 3V2AR 4KKNA 43C9A 1QSVA 3VXUA 1SEBB 4C58B 4YC2B 1E28B 4K71B 1DQQB 1FNFA 1ZHBA 1NC4D 4O2FA 2A83B 1PYWB 2OTPA 2DDQL 4NZDA 4PRAB 4PY8I 3FB5A 3HUJE 4PGZA 1FL6B 5GRVK 4JZJC 1QBAA 3DUUA 2DM2A 3NVQA 3B8YA 2ZCLH 2BCKA 2VLME 1IFHL 2YRLA 3KWWA 4Y1AD 1F58L 1NGXA 4IM8A 3G5ZA 1UXSB 5EC2B 4ZUVB 3F12A 3ROOA 4NQDD 4AG4H 1S78D 4PJFE 4ODWA 3H0TB 1KG0B 5C08B 3LV3A 5FV1L 3O6ML 2XG5A 1UM4H 3IU4L 1BQHA 5KW9H 4S0TD 4NZUH 3QJHA 4Z76B 1ZT1B 1M7XA 3CFCH 3TCLA 1FPTH 4NM4H 2YHGA 5ICZA 3QIBA 3MRNB 3K8LA 1NFDF 3MX0A 3MNZA 3O41B 4HWNA 3CSYA 3MCKB 1AQKL 4MDIB 4KJQD 1CK0H 1X3DA 2VDPH 1JN6B 5CZXC 3DI3B 3QA3B 1KFAH 5D9SA 2JKXA 3FN0L 3RVWC 4L1HA 4HCRH 5C08D 1JGUL 4R4BA 4YDVB 5JXEA 1AGDA 3BKCH 1AHWB 3T1FB 1QEWB 3NCCB 4DOHE 1P4IH 4NQSB 3BUYB 5BO1L 2EH7H 1CE6A 3PJSA 1DVFA 3O0RL 1F11A 3SCMA 1S8DA 5DZOA 5EBMA 1FJ1A 2AK4A 1IAOB 4PJCA 2XI9A 4MVBD 4YNYA 3VI4E 5I8OL 3EOTL 3DHJA 5I71B 4XMPH 4FQ2L 4RA3A 2E9BA 2C5DC 2WV3A 3HAEH 4ZS6D 1Q9LA 2W07A 4TVSa 3HE7D 3TC9A 4GMSH 1KJ2H 4U1HA 3NBNA 5J56B 1Z5LB 5IWLC 2RIKA 3RWDB 1TPXC 3NOIA 1LO0L 3N85L 2KQNA 5KVMC 1NEZG 2B4CL 3L7EA 4U6HA 4U1NA 3VFTA 1T66D 3OGCA 2BOBA 2VXSL 3O45A 3IDIA 2H26B 1MCPH 2FJFB 4ZNEA 1ZLSL 5A2JH 3OKKB 3GSNL 3OKEA 1N7ML 3QEQA 1T7ZA 5E99L 4OZHA 4OBRA 4XAKD 5INCA 3N1FC 5F88B 2CGRH 1N2RB 1UA6L 4OGYL 4CMHC 2YK1L 2ADIA 4Z6AT 2OX5A 3EO1A 4HKBA 1LEIA 1YEJL 3F7YB 2J8UA 1U6AL 1NDGB 1OOAA 1KB5A 1MEXL 1ZVSB 2Y25A 4QF1A 3BPCB 1JNLH 4JO4L 3UTSB 4WNQB 2DLIA 2AK1L 3E8UH 4S1QH 4DEPC 4Z7UB 1KIRA 4YBLB 5FF6A 4GXVL 3FONA 5D1ZB 4LLVA 5DJ2B 5KSAB 1N5AB 2W91A 5B4MD 3LQZB 2D0GA 1U95B 1MF2L 2AJZA 3K80A 2CIIA 4HF5H 4MNQE 4U1JA 2DWDB 1B2WH 3DGGA 2ARJQ 5F7KC 1DLHA 1I7TB 1RMFH 3RUGF 1OP5K 3ULVL 3UTSD 4J3SA 3U0TB 5BRZA 4LLYA 1UT9A 5DEFB 4M1GH 1WUNT 4EJ1C 3EO0B 4Q9CA 3VFNA 3LEVH 1KEGH 5HYJE 5D1ZD 1YYLL 3HLAB 4HXBH 1J5OH 3EGSA 5DK3A 5KSAD 43C9B 3VXUB 3GHBL 4K94H 1KACB 5GRZA 2WQRA 5T3XL 3Q5OA 3GKWL 2E3VA 5F89B 2W9DL 1ZHBB 4O2FB 4RAUB 5F7EH 4U1GB 3S4SG 4WHTA 1SVCP 1P6AB 3FB5B 2VLJB 4NQCE 1DJSA 2Y07H 5KVFH 2CXGA 3DUUB 4YDKH 3MXWH 1E6JL 1H0DA 1VFAA 3KWWB 1EO5A 3G5ZB 2QEJA 1TDQA 1A7NH 2ZUWA 3V0WL 3IT8D 4M4PA 4DZ8A 2DM3A 4ODWB 3U1SL 3O4OC 4HUWA 3MRQB 3VXUD 2R29H 4LRNH 3LV3B 1WT5C 4F7PA 4Z7NF 3W0WD 4LAJH 1BQHB 5E6IB 4KQ4H 2B2XH 4ODUB 3SGDH 3N1GC 3OHXA 2VLJD 3TCLB 2NZIA 5ICZB 1IBGH 3QIBB 5EZOL 1TCMA 1CG9A 3BEVA 3MNZB 4UZGA 1FVDB 3D0VA 1H15A 1YQVL 5D6CA 2W60A 3TO4C 4MJIE 1MRCH 1DTUA 3U30B 5DMIL 4P2RB 3T8XA 4LPXA 1A7RH 4CVUA 5D9SB 5JIKA 1I1AB 3JWOC 3TWCH 4XC3L 1GOHA 4OIIH 5EBWA 5DJ6A 5C86A 4XCFH 2XY2A 4R4BB 1AR1C 4Y4KC 1VENA 1AGDB 1NAMA 5E6ID 2XN9E 2EEAA 5EOQH 3P77A 4FFWD 3L3JA 2KBGA 3Q1SL 1ZT4A 2AEPH 3PJSB 3FO0L 3QIBD 4J12A 1RAMA 1F11B 3Q5TA 3SCMB 5AZEH 1FJ1B 4AM0A 4YXHH 1WC7B 2AK4B 4HS8L 4YNYB 4X6EA 5DO2D 2VN7A 4DN4L 4O5LH 3BP7A 4P2RD 4QYOA 2C4FU 1I1AD 3ZDZF 4UU9A 1Q9LB 4LCYB 5A1AA 2HLFD 3CPLA 1ZLWK 3LQAL 4U1HB 5JXED 2CK0L 1VEPA 1XGYL 4AZ8A 4XCNA 4POYA 3DARA 3U0PB 5DRZB 5D7JC 1DN2A 3TEUA 5AUMA 3SCMD 4OCWH 3OGCB 1KTLB 1XCQB 4W70A 4JY5L 2BOBB 4PIRF 2AK4D 2BNRB 3O45B 3QDAA 2X10A 4I9WE 5SWSD 3ZKSD 5I66B 1KJMB 4WI3A 5I74C 2A6IA 3OKEB 3QEQB 1WISA 1T89A 4OZHB 3ZKMC 3G08A 4NZRL 1ITCA 4MXVF 4TSCH 5FK9B 1NDMB 2VDOH 3C5ZB 2ADIB 4OLZL 4F33B 1B6DA 1CLYL 1IAIL 3DBXA 4UOW0 1AC6A 2EIDA 3L9RB 4MNQA 2J8UB 4GQ9H 3DPBA 1UJ3A 1QA9A 3N1QC 2BNRD 1CE1H 3HR6A 3NACL 4YZFF 4QF1B 4ZOAA 1SQ2N 4KRPC 2LU7A 4AEHH 1FFRA 3G5XA 3JWNC 1A1OA 1KIRB 5FF6B 4OCRL 1PVHA 2GIYA 3MRPA 5KTEL 5GS3A 3FONB 4HPYH 4LLVB 1L0QA 4I0PB 3LHPH 2HAZA 3C5ZD 2GT9A 3VW3H 1MOEA 3PHOA 1E4JA 4URTB 1P7HL 4K3DL 1RZJH 2CIIB 1U8HB 5DR5H 3MLRH 3HUJB 3P0YH 3RKDD 3L3GA 3HFMH 2BVPB 5E2TH 1WTLA 1I8IA 1A6TA 1JFQH 5GS2H 2NXYB 1HZHH 4LLYB 4UDTA 4CN1A 2F8OA 2D4FA 1M71A 4MAUL 3VXQB 2HKFH 3BKJL 3H9HA 4L8DB 4PJFB 4W68A 4I0PD 1IKNC 3EGSB 2ZJSL 4N8VA 5B3NA 1UWGH 2Y06H 5GHWH 1I85A 1IM9A 2D0FA 1PAMA 3GJFK 4OM0H 5M7QA 1UWEH 5T1DH 1HWGB 3G6AB 5DJCA 2K7PA 1R3HA 3MUZ1 2DQUH 5FB8A 1FC1A 2VLMD 2NXYD 1CU4L 1ETZB 4J6RL 4TOYH 4M6NL 4OZIE 3ZZ1A 4DZ8B 5BXFA 3VGBA 1C12A 4TUOA 3NIGF 5JPNA 2F15A 2ED7A 4HUWB 4S0SD 3RWJA 3MFFA 4X6FA 4D0BA 2OSLA 2YD2A 4WIQA 4F7PB 4U6VH 4EDWH 2VAAA 4H1LG 5DMGC 4RDQF 2XN9A 3BP6A 2AJYH 5HHXL 4YHKH 3S88L 2GCYA 3S5LA 3JWOL 4U05A 4Y8AA 1CG9B 3BEVB 1I8LC 3D0VB 4MXQC 4NNXB 2OQJA 5EU6E 3T0XA 5D6CB 1XGQB 5LCVH 2W9LA 3IVKB 5EU5A 5ALBL 2ZUSA 1PKQA 5FEBA 3HZMA 4W4NA 1ACYL 3T8XB 4PRBA 3IFLH 5DQ9A 3ZDYF 4LSDA 3V52L 1T1WA 3B9VA 4RZCA 5EBWB 5DJ6B 2ZNXA 4Q6IC 3RDTA 2DQJL 1N0XH 3U83A 3IDMB 1NAMB 4OF7A 1J8HE 3P77B 5LGJB 5LGKA 1JWSB 2YPKB 3L3JB 4KMTL 1ZT4B 2R9HD 1ITBB 4Z5RA 3DO7A 1X5KA 3DX9B 3O11A 4C4KO 1L6XA 4AM0B 2O5XL 2BY2A 4CAGA 2UY6A 5B38G 4X6EB 4ELMA 3N1MC 3BP7B 4XNXH 5SV3A 4UU9B 4YHIA 3CIQA 3CPLB 5C0ND 3FRUB 3F7RA 4MLIA 3ZKND 3GSUB 4FG6D 2D7NA 5CILL 5DUBA 4BZ2L 3G6JE 5LKNA 4IRJA 5CBAB 1RHFA 5E8NB 1BREA 4P48A 4XVUD 5C0RL 1AR2A 1RSFA 3NAAL 4OIAA 5E4EC 5C9KA 1L6ZA 4YFLF 1FIGL 1BGXL 4Z7OE 4FQXA 2Z31D 1RUAH 5IVNA 1QFWL 1MHPL 3DROA 1OLLA 3ALWA 4NM8H 1MIMH 4H0GA 3G08B 1EAPB 3HZYA 3QXDA 1BFVH 4H5SA 4NOBA 3S3SA 2Z8VC 4JKPL 3CFDB 3T65A 5IFAH 1Y18A 2V9TA 2YA0A 3QG6A 1HSBB 5D7LE 2BNQE 1OPGL 2ITCB 3DBXB 1PZUB 1AC0A 3EOBB 1T83A 4U31A 3QHZL 4NRYA 2OBGA 4MNQB 1H8SA 1MCEA 4M43H 1UJ3B 4DGVL 1QA9B 1INQA 5BMFL 1C5CL 1FIEA 3LIZH 3TYGL 3U36B 4JO1H 1JPSH 1UZ6E 2HFFB 2MNUA 4NHCH 1CFVH 3PV6A 5EBGA 4EVNA 3INUL 1LP9F 3G5XB 3GNML 2WINB 5HYJB 5I9QB 3TBSA 4XGZB 2R15A 3VMNA 1QVOA 4WW1A 2GT9B 5I1AA 4CADA 1SEQH 1MWAH 1PSKL 4HH9B 5MHSE 1ZE3C 3EFFA 2AABH 1N59A 4EIZC 4MNQD 1CZ8H 2JJTA 4NQCB 2XY1A 1X5HA 1JYNA 3LEYL 3L3GB 2R56L 1I8IB 4R4FH 2IBZY 4G42A 5F1KC 4UDTB 5F7DB 4OZIA 1M71B 4TUKH 2XRAH 5TDNA 5HYJD 3H9HB 4QRRE 3S35X 3SN6N 4N8VB 3RVVC 3AROA 2H3NA 5FCSH 3UO1H 3T04D 4M7ZB 4HZAA 1OGTA 4V2CB 2HT2C 2ARWA 5B39B 3U7WL 4YHNA 1RJZA 4NQCD 3QUYB 5I19H 4QEGA 1HI6A 4Z95H 1B9ZA 3NN8A 3RWFA 5EU6A 1A6WL 1N64H 1A3RL 4MJIB 4HKJA 2PO6A 3MJGX 1MCKA 3FO9A 4PJGE 3CDFA 1KPRA 1T6WA 4XNMA 4WTWA 4QY8B 4PJBA 4L8CA 4PLOB 2FECI 4KDTA 4RQQB 2DQCL 3UC0H 1CFQA 1I7RA 3I2CL 2AJVH 1XGTB 4X99B 1KCRL 2XN9B 3BP6B 1J8HA 4WUUA 5ICXA 2QADC 2ADGA 3QUYD 3S5LB 3OPZH 4HJ0D 3W82A 5CUSH 1B4JL 3RWGA 2VZVA 4DAGH 2OQJB 4MJID 3KS0J 5EU5B 1D5MA 3AS3A 5D1QB 3C08H 4W81A 4PRBB 1CD1A 4QNPF 4NP4H 3H9SA 4RZCB 5FECA 3RDTB 3QCVH 3DVIA 1DQLL 1EJOL 3O9WD 4RX4A 2XN9D 4ZPVA 1MH5A 2OL3H 5I1EH 1EJ6A 3G6JA 3S97C 5BVPH 3FN9A 5TE4H 5LWYL 1MCWM 3ARZA 4ODVL 2JB6A 1QRNA 2HMID 4Y2DB 4MA7H 3DO7B 1RURL 5KSUA 4J23A 2VOTA 4ESKA 1MNUL 5I6XC 2HKHL 2X2YA 3V4VL 1FLRL 2WZPD 4RMRA 4ELMB 5D1QD 3R8BB 3X17A 2OMNA 3P2TA 4AEFA 4YHIB 1W8NA 1QTYT 2J6EL 5EBLA 4HXAL 4JFHE 3GI8L 3RDTD 4MWFA 5ECJE 4JM2A 4NN6B 4OJFL 5D7LA 3MRFA 5JORA 1GZQA 4EUPH 3MLVH 5J3HC 3LKNA 5HYQA 2BY3A 4Y2DD 2CO6B 4X7TA 1A6ZA 2WANA 2NY7H 2FATH 3V7AE 2IQAA 2GJJA 3IJHB 4I9WD 2OJZH 3GK8H 4LSQL 2HVJA 4FQXB 3S34L 5TF1H 1Z2KA 4X6BB 3NFSH 4W6XB 3ARDC 4LVNB 2OZ4A 3DROB 3MRHA 4B5EA 2ED8A 1X5GA 5SX4H 3K8MA 5GSVA 4LP4A 1CXIA 1Y18B 4UDUB 3QG6B 4M5ZL 3QBTB 1HXYA 1ZGLM 1F4HA 5I75C 2UUDH 3QQ3A 1QR4A 2GQHA 4GOSA 3WIHA 4NRYB 5J11C 4APQC 4IIQC 1QSEE 2HTKD 3VWKC 4NUGL 2OI9B 4F57L 1UKTA 1INQB 1FFPB 4FQXD 1QRKA 3KYMA 3D3VE 2VXQL 1G7QA 3MLPA 3VGFA 5IROC 2QV2A 4EVNB 2E7HA 1FDLL 5I1HL 5D72L 2VZ3A 3EDDA 3TJHD 2XNAB 3TBSB 4N0UA 5AYQA 4R26H 1QFWI 4LIQE 1QVOB 4WW1B 4CADB 4TTDD 3SO3C 1A64A 3EFFB 2YRPA 4CKVX 1N59B 3TPKA 3RNKA 1SVZA 1A4JA 1AGEA 3LAFA 4TSBH 5CD5C 4ZO7A 4K94C 2ZCLL 1EEQA 1NEUA 4YR6A 2QKIA 1BVKA 3PP3H 2P8LA 5T5NG 1WQVT 2Z92A 1NBVH 2HJKA 3LB6D 4AG4L 4OZIB 1MCHA 1GVIA 1X5FA 2AEQH 2ZG3A 1S9WB 5TDNB 4BA8A 5GRVL 5TFSH 2IANE 4LEOA 5ENWB 1UM4L 4Z7QF 2VDRL 4XWGH 3P9WB 4OTXH 5KW9L 1OGTB 1DUYA 4PTTA 4ZYKB 5FIEA 4XPFL 4YE4H 5C07E 4NM4L 2VZTA 4NFDA 1RJZB 3BDXA 3UX9B 1RZGA 3WXWH 2WLZA 2WSKA 3GBNL 2E9JA 4HPOH 1HI6B 2Q1EA 5A3ID 5JZ7C 3NN8B 3TCXA 3RWFB 1CK0L 5EU6B 2QQNL 2AVGA 1FBIH 1KFAL 4XP9H 3KHOA 1CTNA 1NEZA 1QYGH 3C8HA 3FO9B 1JPTL 3MRGA 5EWIH 3HI6L 4HCRL 4L8CB 3FFCE 4OCNC 2IPUK 4AIXA 3BKCL 4NT6A 1J10A 3SJVE 3C09B 1J8HB 5ICXB 4MQXD 3P9LA 1X9QA 2PTTB 1CDYA 1LQSR 2F58L 5ITFA 3RWGB 5EU6D 3DV4A 4GG6F 5J12C 4XMPL 3SKJL 1AP2B 4OZFH 3PGDB 2LVCA 1AH1A 2X1OA 1D5MB 3GEWB 3IFPA 1QPPA 1I3GH 1F8TH 4GMSL 1FO0H 5H35B 5HGHA 2BJMH 3QAZB 1DE4B 3NA9L 3DYPA 4XP4L 5FECB 5JW4M 3SDYH 5E2VL 4OUUB 1AO7E 2F19L 5CGTA 1J8HD 4ZPVB 2A6DA 1E27A 2XQYK 3G6JB 1WWCA 5DFVD 2JB6B 3A0OA 3EW3B 3LRSA 4Y5YC 1NGYA 4KI5F 2HT3D 5KSUB 5I1JL 1A3LL 3U6RA 4LSPL 4M1CD 1BQUA 1T0MB 4XWOD 4GLRH 2X4QA 3C9NB 5GS0D 2GTZA 3UYRL 1NUGA 1U9KA 5LGHH 5EBLB 5F71A 1DQJB 4NQVB 2CGRL 2JJWA 1RZ8A 4WFFE 4MWFB 4LPCA 5C0AE 1Q72H 4LCCA 3VXNB 3RY6C 2R69L 1JZ2A 5D7LB 1FVEA 2IAMA 5JORB 2BNQB 1GZQB 2CDGB 2DLGA 3GSOA 3LKNB 3I9GL 4OD1H 4POZC 4ONFH 4GXUN 3KG5A 3GO1H 3MRLA 5C0GA 1JNLL 3QUXC 2HVJB 4R0LC 2DS4A 3S4SA 5JMRA 5E8DH 3MGTA 3MRHB 1GYAA 3D39E 4M7JH 5DGRA 5EOCJ 5GSVB 5J8OA 1XH3B 5D7LD 2BNQD 4C55A 2A9MH 1HXYB 3RGVB 4HF5L 3QQ3B 3RTQA 3ARGA 1B2WL 4KGLA 1D5BA 1JHTA 1MVUA 1INDH 1RMFL 5GZNC 1MAML 3HAEG 3GSQB 4FQCH 5A40E 1U8LB 2XICA 3KYMB 4M1GL 1RZJC 1G7QB 5A2FA 4LKXA 2FBJH 1KPVA 3LEVL 1KEGL 5DUPL 1J87A 4QRRB 4OF8A 1Z0NA 1JYVA 4K94L 1CVSC 3TNNA 4F80A 1MLBA 3DI2B 5MHSD 1RUQH 5F7EL 3RGVD 4Y4FC 3UTQA 4D0CA 2FEDD 1U3YA 2Y07L 5KVFL 1NLDL 1KYOJ 3L3OA 1MFDH 4LGSB 1K85A 1AGEB 4I18C 1I75A 2QKIB 3MV01 1EV2E 3ZE2F 2P8LB 2IWGA 4KDVA 3SPVB 2Z92B 3QZWG 2BDNH 2HJKB 2HTLD 2R39A 3FT2A 1HWHB 1NCCL 4G6KH 1HEZA 1NGWA 4QRRD 2IEPA 4LRNL 4LEOB 2QSQA 4PJEA 4PJIA 4P0DA 1PY4A 2N56A 4KQ4L 3GB7A 1DUYB 4PTTB 1OAZL 1Y6KR 5GGRY 3QXTA 1WITA 4PJCF 4AJ0A 1XGUB 1YNLH 5EIVA 3S3JA 4WFGE 5IMKB 4XI5D 2FWOA 4LEXL 2D03L 3G5VA 3RAJL 4UINL 2VWEE 4LLDA 3TWCL 3DV6A 3RZCA 3MRGB 4WRLA 3RVTD 1QR1A 1JK8A 5JOEA 4OIIL 3EUUA 1UKSA 3FT3A 3PWJA 3TJEL 3ZTNH 1AO7A 4NT6B 4OCYH 1S5HA 5EOQL 3IJSA 4U49A 1R3KB 3P9LB 2AGJL 1NCNA 5AZEL 2ATKA 1I9RH 5FHAL 1FNSL 2EYSA 1DLFH 3MJ7B 3I02B 1G7MA 4NN5B 4QTHB 1BIIA 2BC4B 4DN3H 2R1YA 5E8EB 1M7DA 1I8KA 5KS9E 3IFPB 5HD8D 1KC5H 3E6FB 5HGHB 4NN7C 2XWBA 2YPVH 3QWOA 3RL2A 4DJMA 2Q6WA 1DCLA 1FQ9C 5GGVY 4KJPC 2C3GA 2A6DB 3QI9A 1E27B 4RBPK 3TGXA 3EYQD 1FAIH 2L7UA 2AJSL 3LRSB 1NGYB 3V6BR 4YDLB 3ABZA 3U6RB 4LKCA 4LVHC 4EXKA 2X4QB 4J8RA 2GTZB 3T2PA 2DI7A 4RAHA 1MQKL 2D9CA 3OXRA 4RBPH 4JFHD 1EZVY 4ONOA 5IWLA 1RZ8B 3KPRA 3MYZA 2VKXA 4TSCL 1I1YA 4HJJH 4L4TE 5C6TH 4OV5B 4QHKI 1T0NA 4RRPG 2EXYD 4KJWC 2NY0C 4OZGE 1NCBH 4BYHA 4YHYB 4LSUH 3VXTA 4H25A 4MB5A 1FVEB 2IAMB 4ELKB 3GSOB 2I24N 4PY7A 5ILTL 5C0FA 1QSEB 2E7MA 5ID1A 3HC3H 2AI0H 5CJXC 1UM5H 5EDXA 5IEKA 3MRLB 4OKVA 5E03A 3TIEA 3VFSA 1G7PB 1ZMYA 2FIRT 3D3VB 3UTPE 3G04A 1IGFH 1A7OL 4KK8D 4NZTH 3DMMB 4GRMB 4WEBH 1S9YB 3FZUD 3MGTB 5F3HA 5LJYH 1PG7W 2MTPA 1F5WA 2FLRT 3T0DA 5KOMC 2YUXA 1SBBA 1S7QA 3ZYJA 4H20L 3MLRL 3RTQB 3ARGB 3P0YL 1QSED 3WN5B 1JHTB 4ETQB 5J6GB 5E2TL 2YUVA 1URLA 1JFQL 5GJSL 1VACA 3LMJH 2JLLA 3P11L 1JHKH 1HZHL 1IGMH 3D3VD 4H1LA 2VERN 4X98A 4EOWL 3VRJB 3DMMD 2HKFL 1KPVB 1HKLL 4NPYA 1LE5A 1G7LA 1RI8A 2IANB 1NFKA 2CRIA 3TNNB 4G6MH 4B7IA 1ZEAH 4OM0L 2GSIA 3RTQD 2P49B 3ULUC 4D0CB 3LN4A 5C07B 1F2XK 2F8XC 1F6LL 2I27N 4Q9QH 3KS0H 1Y6MR 2FHBA 4ENED 2V5MA 3BHBB 3BRGC 4M1DH 5I1DA 3MUHL 4UUJA 1BFOA 2BZDA 1KCSH 4NWUH 2H2PC 3BEWA 3IF1A 1G7JA 1HEZB 4F7MA 2JJVA 1SM3H 5HHOE 1NGWB 2IAND 4H8WH 3FFCB 3WHXA 1JJUA 4U6VL 4EDWL 1RIHL 1R5WB 4YO0A 1J7VR 2R0WH 4K8RL 4RWYL 4OFDA 2AJYL 3NABH 1OGAA 3GB7B 2LU3A 2Q7YA 4PV9A 5K9JL 1CD8A 5C07D 1IJ9A 4U6TA 4PJHE 2ZG1A 3BXNB 3C6LC 5LCVL 3N0PB 3BUTA 1F00I 3UXFA 2XKUA 2FWOB 1YPZA 2VN4A 4XMLH 4EN3B 2WLYA 5MEOB 2MPAL 4E42A 3IFLL 3A6OA 5KS9A 4BSWA 4LLDB 3DV6B 1BX2A 3RZCB 4D9RE 2XTJC 1IGJA 5BVJA 1QR1B 4GRWF 4KK6C 4GMTL 4BQ6A 1A1MB 3FFCD 1JMZA 3PWJB 4XVJH 1I3UA 5I0ZA 5FOBA 4G8IA 2YEZA 1OARH 1P4BL 1VFBA 1AO7B 1S5HB 3SJVD 4JR9H 4XPGH 4A6YA 3IJSB 2VXUH 4GS7C 4UT9L 2DM7A 3B3IB 1DQMH 5IM7A 1NUDA 2ATKB 1CS6A 2EYSB 1S7WA 1AFVH 2LQRA 1G7MB 2ICWB 1OAKH 5TPWH 4EN3D 1OT1A 3QJFB 1F4YH 3WL9A 2R1YB 3RZCD 1M7DB 1RUPL 1CR9H 1WGOA 5IBTL 4NHUA 4IOIA 3F6LA 5I17B 2WM0A 4U6YB 4Y4KA 2XWBB 2XWJA 3QWOB 4QCIA 5FOJA 1E4KC 1J8KA 3RL2B 5C0AB 4OZGA 4H0HB 4IDLA 1AO7D 4ZTPL 4F8TA 3IDJA 2VXTL 3TM6A 3QI9B 5D5ME 3NIFE 4OF3A 1A6AA 4P3CL 5JW4Q 2BSED 4KTEL 5TGBB 3NCFB 3L5XH 3BKYH 1VERA 1UXWA 1R24A 4HDIA 4UB0L 4J8RB 3WE6A 1RUAL 2G75B 1Q9KA 4JQXA 4NM8L 1MIML 2V7HB 4HSQA 3OXRB 4WFFD 4PB0H 1OAYH 1I1YB 5C0AD 1T0NB 5IFAL 3W9DA 5D7JA 1MFAH 4H25B 3SKOA 2GYSA 3HS0A 3QI9D 1A7QL 3UYOD 2AJUH 3SKNA 3O6FC 4M43L 3B5HA 5FXCH 5CWSA 5C0FB 3VFVA 5ID1B 5F70A 2CLVA 3CFKB 3MYJB 3ZMRA 5IEKB 4JO1L 2JCCA 3VFSB 1QSFE 1X5AA 5J13C 5IV2B 1K3ZA 3ARSA 3ZE1E 4NHCL 2EIEA 1CFVL 1PFCA 4CMHB 3CFEA 5F3HB 1NMAH 2ICCA 1T22A 3VCLB 1MRFL 4NYLA 1MWAL 1EFXB 1F4XH 5LAXA 3R0MA 3FAWA 4HUNB 2VQ1B 4XPAL 3HI1A 3OBAA 1QHOA 5AAMA 4XMKH 5C7XH 3RNQB 1WZ1L 5FGSA 1VACB 3WIFA 3HMXA 5CCKH 4CNIA 4X98B 4DVRH 1MCJA 4TUKL 3HPLA 5FO7A 2XRAL 1BVLA 5FKAA 4NPYB 1LE5B 1HHGA 4G5ZH 4NIKB 2M2DA 4HWBH 3UO1L 4KAQH 1XF5A 1SJXA 2NY2C 4ZSOE 3X3FL 2Q8AL 35C8H 1EFXD 4J2XA 3QULA 1JF6A 5HYSG 3V4UH 1MFCH 1NAMH 2GK2A 2GSIB 7FABH 4JKWA 5I19L 4CN4A 3FOLA 3VU2A 5HVHC 1OAUH 5I1DB 3X12A 4UUJB 1BFOB 4HGWA 3BSZL 3ALPA 3BEWB 3KYAA 2P48B 3CVHL 1IKNA 4MJ5A 4F7MB 5CZVH 1IEBA 3OR7B 3WFBH 3S96B 3WHXB 1K8DB 1R3IH 2AJVL 2MMXA 4YHMH 4PJDF 4QWWC 5F7YC 1WWAX 1OHQA 5J4MA 2Q7YB 4JFDE 4MAYC 3MODH 4WFGD 5CUSL 5IB1A 3KPOA 4ELMF 2XV6B 3B2UC 5TJWK 3C08L 4E42B 1FNEA 5KS9B 4BSWB 2H8PA 3OAYK 3ILPA 3O4OB 1IGJB 3G9AB 5BVJB 1WTGT 3IKCA 1M7IB 1JCKA 3F6IA 4WHCA 4NC1C 4JDVB 1EK3A 2YEZB 1VFBB 5I1EL 2CD0A 1CICA 5BVPL 1S3KL 4A6YB 5TE4L 5D5MA 1I8LA 2R0KH 4MA7L 3MGOB 2BK8A 5F6IC 1U8OA 1AQDB 1S7WB 1MAKA 5HYEA 4IOSD 5F7MC 4U7MA 1NAKH 1WV7T 3P4MA 4G8FA 5IEHB 1NCWL 4Q6IA 4NHUB 5EOCH 4IOIB 3EYVB 2C1OA 2XWJB 3OV6A 4L4TB 1FNGA 2RQ8A 1W72B 2GTWA 4OZGB 4NO2B 1YC7A 3MV8A 1TVDA 3MLVL 4Q9RL 3RFZC 3QFDA 5CD3A 1G7IB 5DJYA 4NSKB 5D7KE 1Z6JT 4ALAH 1A6AB 2NY7L 2FATL 1S78C 3CMGA 2WBJA 1CBVL 5LBSH 1H9VA 1A22B 3GK8L 1A9BB 4FZEH 5E5RB 3HKFA 1HQ4A 4YC2C 2BY0A 1KYOK 1UXWB 3R0NA 3L5WA 1R24B 3OXSB 4K71C 5TF1L 3WE6B 1Q9KB 3NFSL 1MFEH 1RIUL 1TQBC 1X5JA 1A5FL 4L4TD 2HVKA 3HR5A 4UIKH 4IHOB 4KH2A 4LU5H 5C2UB 4OQTA 4KJQC 3SKOB 1FGVH 4IDJH 2WIMA 3GDBA 1P7QB 2EYTA 4PPTA 1U36A 3MOAH 5IB2B 1P84J 3OG4B 3UTPD 4HAGA 3DOSA 4EKXA 4PRIA 5ADOL 3CFEB 2P5EE 2VISB 3SDXF 3OF6D 1CN4A 1QFUH 2RHEA 4NYLB 5DRWA 2DQIH 3MV9A 1YEDA 4MVBC 4BFBD 5LAXB 3CNKA 1CXHA 3HI1B 1P7QD 5DC4B 2ADJA 4GAJH 4ZS6C 4TSBL 3BZEA 3HE7C 3MJ8A 4UV7H 5IB5A 4JPIA 3I3BA 3BP4A 1YNKH 4JRYA 5TF0A 3ECBB 2XZQH 3WIFB 1AHWC 1NBVL 4PJBF 1ZS8B 3ZKMD 2HFGH 1XT5A 2AEQL 3HPLB 4GKNA 3KNBA 4LQFH 5EORH 5FO7B 1BVLB 4PGJA 3B43A 5FKAB 1CTOA 5HHOB 1T66C 3A6CH 4MA8H 2RBLA 3QUMB 4PGEA 4UTBH 3JBG7 5I71C 1F3DJ 1OSPH 1UENA 4QRQA 4QKXB 5EC1A 4P9HC 4BH7A 1LE9B 3VH8B 4H26A 4OCLC 1U8NA 4XP9L 3X12B 2WAHA 5IW6B 1CD0A 4MJ5B 5HHOD 1MJ8H 2PF6A 2GFBA 3UYPA 3O3EA 1S7TA 2Z8RA 1VFUA 1WEJL 2X40A 4PG2A 2VIRB 4UQ2A 4S11A 1OTUD 2CIKA 1KXQE 2YD7A 3MACL 1VHPA 2BVOB 1NPUA 3SDAB 5HI5C 5L9DH 3UDWC 1FFOA 4XP5H 5E8PB 1U8PB 5IB1B 5E1HB 1HN1A 1EAJA 5BZWB 5B4MC 3GHEH 3MRIA 3EIFA 5E7BA 4HMDA 4IOFC 2R2CA 5F6HJ 4D9RD 1F8TL 5FUZH 2BJML 2H8PB 3FCTA 3STLB 2Q3ZA 4JM2F 1TNNA 4DWHA 3PUCA 4K2UL 3SDYL 5L0QB 2EE9A 3LKRA 3WLWC 1QLEH 3SDAD 5IB4A 1CICB 2XQBL 2UWEF 3T3PF 4RFOH 5D5MB 4NNPL 4YBLC 1H3WM 1Q0YH 4F3FA 1U8OB 2FZ3A 2RGSA 5D1ZC 2E6QA 5KSAC 3P4MB 3MNWA 1IM3A 3BZDA 4G8FB 2EO1A 2A1WH 4ETYA 5LGHL 1A6VH 1J1PL 2NTSP 2CKBA 3P9MA 1W0WB 2C1OB 1DDHA 4ODTH 3WO3B 1KIUA 1FNGB 4B50A 4DKEH 4GG8B 5HHVH 3V6FA 1XF2B 1CICD 3MA9H 4D3CL 1MQ8A 4OD1L 3BT2H 1NC2B 5DJYB 1OW0C 1A3QA 1NBYB 3LDBB 4U33A 3GO1L 4LGRB 2WBJB 2DQDL 4ZMAT 4YUEL 4LSSH 3VRIA 5AG8A 1QSFB 3IFNH 1GAFL 3VFMA 3L5WB 2CJUH 4TSAH 5GZOD 4MXWH 1BAFL 5F21B 1A7PH 3MXVH 2ICEB 1U2CA 3AB0B 3SDDA 4M7JL 4NKMB 3ZT5A 3BH8A 5CKAA 4QRPE 1ND0A 5K59E 2HVKB 1P4LA 3HR5B 4X7SH 2FO1A 4KKLD 5A2IH 1WAAE 2A9ML 3QZWA 4XRCB 1NC2D 5FGBC 2MQ3A 4NGHH 4BZ1L 2ITDA 3TN0B 1KJ3L 2WBJD 4MA3A 1AXTL 1LEKB 3WCYA 4AIOA 1QSFD 4FQCL 1P5VA 4JFEA 1MAJA 5J9PA 3ARDA 4XNYH 4AIZA 5E6IC 1HK6A 3C5JA 4PREA 3QIBC 3QH3A 3RJDA 3WNOA 5EIIA 1NANH 2GITA 3BPNB