4EOWL

Crystal structure of a disease-associated anti-human gm-csf autoantibody mb007
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
211
Chain Sequence
SVLTQPPSASGTPGQSVNISCSGSSSNIGNSYVYWYQQLPGTAPKLLIYRNNRRPSGVPDRFSGSKSDTSASLAISGLRSEDEADYYCATWDDSLSGRLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of human GM-CSF in complex with a disease-associated anti-human GM-CSF autoantibody and its potential biological implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MB007 human IgG1 Fab fragment heavy chain
total genus 45
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowL01
3HMWH 5IKCA 1YEKL 1T21B 4WGVB 1NDMA 3D85B 1BPVA 2C5DC 3NA4A 1EK3A 4LLQA 1R24A 2Q3AA 5L2KD 3X12A 1DBBL 3E3QC 1UQSB 5LG1A 5BRZA 5B8CB 5FEBA 2O93L 2HFGL 1S9XB 2P8MA 2AK4E 2F54B 3MRPB 3CSGA 4WTXA 5L2KB 3G5VB 2D7NA 5DRZB 2HMID 4P2OC 4RRPA 2B0SH 1L7TH 4PTTA 4S2SA 3KPSA 1WC7B 2FX9H 1M71B 5GGTA 2FATL 4N1EA 3UJTH 4XH2B 4ACPA 5D7LE 4F33A 3TCLB 3ALXA 3PGDB 4FZ8L 2H6PB 3HI6L 4NBXB 5CIPA 3WNMA 4OD3H 2P5WB 2EDXA 3QUYA 4JVWA 1R0AL 2DKUA 1EFXD 5T5NF 3MREA 4NNXB 4JDTL 3D2UB 5GS1C 4WENB 5E08H 2G5RA 3IXTA 5ID1B 4UIKH 1DUYB 1NBYB 4GSDH 1MLCB 1HOCB 3MYJA 4MNHA 3W9DA 2IPTH 3U0WL 5BW7A 2RHEA 4PJ8D 3EHBC 4HWBA 4EN3A 4K3EH 3WJLC 1BZ9B 2GYSA 4PGJA 5EORL 5E7BA 2RFXB 4PJFA 3BZFA 5HJ3B 5HD8C 1FLRH 4TVPH 3WIIH 4U7SA 1KPUB 2PNDA 3ARTA 4ZFOA 4O2CA 5JW4N 3UTSE 2VLMD 3QFJB 4NNPL 4KK5C 4HLZH 3GKWL 1YEDB 1YN6A 3MV01 3ZDXE 1IM9A 3O4LE 4JFFB 5TF1L 4B41A 1NBVL 1BD2A 5C0ND 3B5HA 1YUHA 4X83A 1U8NA 3GIZL 1F4HA 4PY7A 2VR5A 3C60A 1K3ZA 1ZLVH 2FJFA 1EZVY 4PBXA 5F70A 3MV9A 6CGTA 1JV5B 2W9LA 5KVFL 1OM3L 1W0WA 3SE4A 1ZLUH 3OKMA 2VWEE 2GJZA 4ODWA 1OT1A 4LBEB 4Z95H 3C8KB 2FO1A 5E8PB 4PP2A 1EEZB 3VXMA 4LVNB 3PIQB 5F71A 4QHNA 1T1XB 4AM0B 5KN5A 4PJ9A 4KKAD 3MR9B 1U95A 1MOEA 4LKCB 4PGZA 2X1OA 3K8MA 4YO0B 4LIQL 3MREB 3L3KA 4LARH 4XB7A 4O5LL 2WIIB 4FN0A 5DS8A 3V8CA 2XQBL 4WRLA 1KNOA 3B43A 4RAHA 3SE8H 4XH2A 1IAKA 5F7DA 2A77L 1X6NA 3X13A 3P77A 4WFGE 2Z0BA 3MXVL 4MAYC 4XVUC 3PWUA 4L9LB 5LAXA 5T5NG 3G9VA 3ROOA 1QNZH 2PR4H 1FCGA 3C87A 1JGLL 1B88A 1XGQA 3ESVF 3Q6FA 4PV8A 3C5ZC 4POZC 1XF3B 5E56A 1Z9SA 2XA8H 4DUXA 2V2TB 3U46B 3DJ9A 3MLZH 2BFVH 5FYLD 2H26A 4OZFB 3BMWA 3BO8A 3CVHA 3L3JB 1ZGLB 1KCRH 4DTGH 4M1DH 4JO2L 4RISL 5IMKB 1JNHA 4J3VA 4P59L 4GKZB 2IPUG 3SOBL 4OZ4A 5K9JH 4YHLH 1WITA 2YXFA 1BFVH 3A6OA 4JFDB 5FK9A 3ROLA 4MQXD 2PYED 2Z92B 3EW3B 3F7YA 5KOMC 4XVUD 1NC2B 4PJGB 2P8PA 3T0ED 1G9MC 43C9B 1P4IL 1DE4A 4NRYA 3Q1SH 3AB0B 4YX2L 3C09C 1I9IH 4RX4D 4ZO6A 3SDDD 1AO7B 3HPJA 4MA7H 5D6CA 3TH4T 4NKDA 2BSRB 2LABA 1QBMH 2PYEA 2DF3A 4FNLL 1RJCA 2ZJSL 4PJCF 5DK0B 1RZ7H 2CLVB 4JVPA 1JZ5A 3MRRA 5IHUH 1IQDA 3LEXA 1EJ6A 2XWBB 1DTUA 4Y7MA 5EU6E 3ARFA 1WF5A 3PDDA 2ERJC 5GRYA 5BS0A 5ALBH 4HBCL 4YH6A 4ELMA 4M00A 5CEZE 4CBPA 3WKMH 3DX8A 2K9UA 2MCPL 1NJ9B 4WI3A 5EZOH 1GGBL 5AD0B 1VEOA 4LU5H 5DJ6A 5JIKA 1EMTH 4LRIA 3M17A 3UAJC 1K5NA 2WUCL 5DVKA 1J1PH 1MSPA 4KI5F 2W9EH 4XX1G 3IAQA 4EN3C 3DI2B 1QKZL 3ETBF 4Z5RB 2XTLA 3SPVA 5TE7H 3ARFC 4L4TD 1UEYA 5DFWH 2EXWD 1F42A 3BPCB 1Z3GH 3VRJA 1JFQL 3LZFL 4KVCH 4MNQB 1I1FB 3DGGA 1FGVH 1YPZB 1INDH 4K71B 3CFEB 5K59F 1OCWH 1AD9A 4TN9A 5GGVL 5AZEL 3REWA 3VWJC 7FABL 5DHYA 1OAYH 5C07E 3WIHL 3EYQC 1GZPA 4KRLB 1DQDH 1NFIA 1JHLH 3HC4L 3GUTB 3BH9A 5GRVL 3VGAB 1S7WA 5ACZB 4JFYB 3WNLA 2HA1A 2XKNA 1E4KC 1AIFB 1A6ZA 3RKPA 3BKJL 3IFOB 1I1AB 3MRGA 1U3YA 4LQFH 3LH2H 4G7VH 2AXFB 1EV2E 2Q7YB 4P2QD 5DJDB 3MBED 4NNPH 4G80A 3HNVH 4WGWB 4MB5A 3QFJD 4L3EE 1YPZF 2PW2B 4QTIL 1WFUA 2IH1A 5JMOC 2QLVB 1OAKH 4OLXL 3SDXE 1JPTL 5J13B 2H45A 5ICZB 3W0WD 3VXUE 3EO9H 2VKXA 1F4WL 4EOWL 3WE6B 2J12B 2R1XB 4M6OH 5J13C 3L6FB 1OAZL 4JGJA 5JLZA 1TVBB 1S78D 4GW5A 5D5MB 2B39A 3UX9B 5D1QC 5E2TH 1MJJA 3MGTB 2BSSA 2A0LD 2DWDA 1YYMH 1O5DT 4C58B 4ZUTA 1ERNA 1LNUA 4OUUB 4YGVB 1KJMB 3JSSA 1ZANH 1YEJL 2P24B 4JFFD 4JHAL 3HZVA 8FABB 3NCYS 1KPVB 3CK0L 3VGAC 2A83A 3EHBD 1P7QA 4TSAH 1XEDA 4E0RB 2X89D 4LARL 5A3ID 4FQCL 2R1XA 5EBGA 1SVZA 3VWJB 3FZUD 4DWHA 4YBQC 4LOUC 3JUZA 1EVTC 4K71C 3MYZA 1WIUA 4N8CH 4F9LC 4D0DA 3S4SG 5K9OB 5EH1A 1XZ0B 2A77H 4YHIA 2R0LH 5B4MD 5DGQA 4JFQA 1HWGB 2ATPB 4FABH 1U6AL 4RGMB 1YNKH 3MRCB 5E4EC 3VWKA 2NY1D 4RNRB 4Z7VE 4NKOA 1IC7L 2CKNA 3GIVA 4MNGE 2XKNB 4PLJD 5AYQA 2DMBA 4DZBA 5DRXA 4HIEA 5E6YA 5IESH 4ZD3L 3BH9B 4LKXB 2E7HA 4Z7NE 3VFPB 2APBA 4MB4A 5HDBF 1A6AB 3JTTB 1OSZA 3ARDC 1S7RA 5I2IB 3C8DA 5D2NA 4H26B 5GSRB 1NDGB 3V7AG 4ZXBA 1CXHA 5ICZA 5EU3A 4GG8B 4WY7L 2FEDC 4KRPB 4DZ8A 2NLJA 5HVHB 5F7KC 1J18A 4HLZG 2BRRL 4OCMC 1GCFA 3WXVH 3THML 2FHFA 3KXFB 3BYTA 1H3PH 4B7LA 3GBNH 5I17A 1F45A 3S34H 3T2OA 1XGYH 3BD3A 2C26A 1SMAA 4Z7VA 3L3IA 4MDIA 4NZUL 1AFVH 1K2DB 2XZAL 3V6FA 3RY6C 1UT9A 2ESVA 1TENA 3JWDL 1RJYB 1FFNA 2QHRH 5J6HA 1TJHH 2IMMA 3LHPL 4YDLC 1ROWA 2DBLH 2P46B 2VZSA 3VD7A 1IC5H 4RA3A 4UNUA 5C0BA 2AS5M 1CU4L 1T1XA 1ORQA 4P2QA 1I85A 2GJ6A 5SV3A 4LASH 1QLRB 1DN0B 1KJ2B 3C8KA 2D9CA 3HFML 4DKDC 2QQNL 5ANMB 1Q0YH 1E4JA 1JWMB 4YGAB 1DBAL 2DWEA 3V6OA 2EH7L 4NQVB 1CR9H 3RX5A 4XCYB 5DSCB 2BVEA 1F6AB 5F6HI 3B2UC 2G60H 3GSNL 5DO2D 4Y16A 5I9QC 4JRXA 1D5BB 1YYML 1S9WB 3HZVB 4GAGL 1S7VB 4I13B 4X7SH 4NCC1 3QEQA 4OLUH 4QRQB 1TVHA 4FXGA 1MCFA 4U33A 4YHYC 1JNHB 4PLJC 1FFPA 4TQEL 4ZPVB 2BSTB 1GGCL 4ZODA 4KKBD 2LTQB 3GMNA 1I4FA 4LCIL 5HTSA 1NCUA 4Z76B 1INQA 3D3VD 4X6EA 3TYFB 3IFLL 3VXNB 2NY7H 5F7NC 3TM6A 4U31A 3BRDA 4U1HA 4MS8D 4CKVX 4S1DC 5TPWH 1D7FA 3LQAC 5LKNA 1A7BA 3CVHH 2X5PA 3G5XA 3CLEH 3T2NH 3U0TB 2E7LA 2P8PB 4PJGA 4HUWB 5F6HJ 1AR2A 1G9ML 1NCCH 2AVGA 3BQUB 4FFYL 4IDJL 4FQIH 3OXRB 2W0FB 4GAJL 4TNVK 5JXEC 1DQML 2HLFC 3L7EA 4HAGA 3QDHA 2R29L 4P46A 2VAAA 4EBQL 3QFJA 1Y6KR 5F7LB 3WUWA 3ZZ1A 1R0AH 4PJAB 1UCTA 2I5YL 1YN7A 2HP4A 2JJTC 2BHZA 2CUHA 5E9DB 4I4WB 4WI8A 5CMAB 2VDKH 2GSGB 2G5BB 4HK3N 4XAKD 4ETQA 4JHWL 1XGYL 3DXAE 2VXQH 3QO0B 4GXVL 1Q72L 4PJHF 1BZ7B 4UQ3A 5DJCA 2EKJA 2GJZB 3C2AH 2OZ4H 4NQVA 3WFDH 5E8DH 3ULSB 4MQSB 5D7KD 1A64A 1BAFH 4PREA 1G84A 3FHQA 2EDEA 1U36A 3MRJB 3MRNA 2EDLA 1FL5A 4MWFA 5GS1B 5GS0D 3D6GA 2Q6WA 4PFEA 1HNGA 1OB1B 1FFOA 4N8PA 1FIGL 4BYHA 2CRYA 4X80H 2J2ZA 5E2VL 1H3XA 1KFAL 4PRIE 4K9EH 4UTBL 5KJRH 4KMTH 1T80A 2HKHH 4U05A 4C55A 1IKFL 2DL2A 4DKEH 4M1DL 3BUTA 4GRLD 3QHTC 1CFQA 4I0PA 4IHOB 3D39B 5IVZB 2EDKA 5FXCH 5SX5H 1G7IA 3CVIL 1YEGL 5TE6L 3TESA 3BP4A 3RDTD 1XIWA 4KI5D 5HVGB 3PL6C 1A7RL 3NCCB 4LVHC 3KXFD 4PLOB 3MLWL 3V4VH 1Z9MA 5I1CH 2ED8A 3TH2T 1ZSDB 3DHJA 4DOHE 1F6LL 4F2MB 4NOBA 3DO7A 3MOQA 4Y4HA 2V2WA 4EI5D 3UTPD 4BH8B 3ZE0F 3KYKH 5KVDL 5FGBC 1I85C 3GSOB 3LDBC 3VI4F 5GHWH 5FYKE 1KN2L 2XG4A 4FTVD 1GGIH 1V7NH 1S7SB 3DOSA 4PPTA 4AEIL 5DHYB 5HBBA 2VERN 3D3VA 1MF2L 3CFIC 3ZKNC 3BESR 1QSED 5CP7A 5L8LB 4FG6D 3E8UH 4MNQA 1VADA 1SJVA 1QO3A 1U8JA 5I30H 2VL5A 4OLWL 3GHBL 4OD3L 4LF3A 1G0YR 4N8VA 4L1HA 5GGSA 5MEQB 4ZUSB 1RZKL 3O6LH 4M4RA 1XGUB 3PXJA 1TZIB 3H7BB 1RY7B 2X4RB 3VWKC 3SGDI 4D9LH 5E8NA 5ERWB 5EO0B 5GRWA 1OGTA 1D9KB 5TPWL 3LQAL 5HHVL 1B0GA 4BZ2L 5TE4L 4UDTA 2P5WD 1CD8A 3NTCH 3SE3A 3ME0A 3TBYB 2YPVL 1R3JA 4IOFC 5K9JL 4PGBA 2AJYL 4WUUB 2DQDH 3SGKC 2PW1B 1H0DB 5KN5B 1IKNC 4OB5L 4PRHA 4P23C 4PG9A 4U49A 2DWDB 4HC1H 4FA8A 3NH7H 3Q6GH 4Y5VC 4YDKL 3O6FA 5JZ7C 2XQYG 4RBPK 1QHPA 4G5ZL 1KFAH 4LHQB 1F4AA 5DJZB 3L6FA 2LFGA 2CIKA 5LWYL 5D72H 5IGXL 1CDIA 3HLAB 3H9SB 1B2WL 5L6YL 5FYJL 3KYNA 5D1XB 1DQDL 3MOBL 1IAIL 3QEHA 1U8HB 1KULA 1OTUC 3V5HA 2HRLA 1GPOL 1KIQA 3ZKSD 2B20A 3MUJA 4UU9A 3G5ZB 4G6FD 4P2RD 1OW0C 2P7TA 1HHJA 5F1IA 3MJ7B 2HLAB 2HT3C 2I25N 4QRUB 4XMKH 3PV6A 1PX3A 2JCCE 3CDGB 3RJQB 1MHCA 3GB7A 4JDVB 2L4OA 3WCYA 2CJUH 1MIML 3CVHL 1V7NL 1T04A 3LCYA 1ZGLA 4M9OA 3HE7C 1RUMH 5CEXB 5DO2C 1U8JB 1UA6H 2CDFA 4OD2A 3B2VL 1LILA 3ZTNL 3SDDC 1YEFH 4H8WL 4A2MA 2UY6A 4PB0L 1P2CA 1WISA 2R9HD 4IS6A 5AG8A 5E2UH 3VD5A 4JPWL 5KSBB 5IB3B 2GTWB 4PP1C 5A16B 3VFVA 2FWOA 3CLFL 4RFOL 3PP3H 5I1KL 1UEMA 4JHWH 4QT5B 2A74B 4LLMB 5KZCB 3INUH 5IQ9B 5HVFB 1DUZA 3IJYB 4G7YL 4HW6A 4NGHL 3H2WA 3FT3B 4J12A 1YMHB 2OMNA 1N4XH 2PKDA 2WSKA 3QUZD 4NQTA 4GXUM 2AJYH 2DD8H 1JPST 3L3KB 4GG8A 2YA2A 3WFDL 3VGEA 3FB8B 4ELMB 5CJOL 4M6ML 4PJGE 3IRPX 2GT9B 3K2MC 1ETZA 2JJSC 3ZSTA 2AGJL 4L3CA 1FNGB 1QKZH 1GAFL 1EEZA 3VXMB 3WFHA 1BQHG 4KKAC 2HWZL 4PRIB 1C5BH 1ZA3B 4AENB 3BPOB 3L9RB 3HAEG 3BX7C 2R4RL 1GL4B 3TBWB 3GEWB 5IFAH 1H8SA 2FSEB 1NGPL 4NKOB 4MQ7B 4GT7A 3TIDA 2NQCA 2DTSA 4CJ1A 4PJIE 4LRNH 1S5HB 3EYSH 4MXWL 3S4SA 1EPFA 1AO7D 3Q5TA 1PY4A 3D39E 4M6AA 1YEIL 1HI6B 5LGKA 4AG4L 3NCJL 4R2GB 3FN3A 3QSKB 5EDXA 4YBQD 4ZFOB 4N0UA 1RI8A 3RZCB 4XAWH 1GC1H 1P2CB 5C0JA 3QIBD 3TV3H 3VD4A 5C0RH 4XNUH 1C12A 4NRXA 5T1MA 2IPKB 2OX5A 1FH5L 3OF6D 5JHLH 5T3XL 4XPFH 3SCMC 1AQDB 2CUMA 1TZHA 1A14H 2D4FA 3U4EA 4BSWB 4F58L 1LP9F 3IT8D 1T4KB 1BQHA 4OLVL 4YNYB 3UBXI 3CH8A 4DKAA 4LASL 3QNXA 1HKLL 3PGFL 4FQXD 4MDIB 1LD9A 3WIFA 5ADOH 3X13B 2C4FU 2X7LA 3DYMA 4R26L 5KW9L 1YN7B 1FBIL 1UJ3A 3OKOA 5D7IE 5HHQA 1EO8H 1KB5L 5DRNA 1SMOA 1JUFB 2V7HB 4N0CD 4YAQB 5BZWA 4UOW0 3ELAT 4Y19D 4Y5VA 5FO7B 3N0PB 1A9BA 1NAKL 1VSCA 2X4TB 1A7PL 1A6PA 1HWHB 2X4UB 5J1SC 5C09A 4CMHB 1DVFD 1XF5B 3VFWB 5ETUB 3WS3A 1CFQB 1B3JA 3V79C 3C60D 4PG9B 1P4LA 4S0SD 3BZ4A 1EHLH 1LO0L 3H42L 3HNTL 1EHAA 1AY1H 1YY8A 3KYOB 4NHCL 5EN2B 1FZMB 4WI2A 3SKOB 4IEFB 3F58H 3ZTJG 5MEPA 5AUMB 4G8IA 3GSRA 4QNPF 1WLHA 3DGGB 3QDMB 4C56D 4JPKH 4ZAKC 4PRPE 3QEUB 4K7PL 5BO1H 3UTSB 4MD4B 3QCVH 4AEHL 4OIIH 1NGYB 3RWFA 3THMH 5HJ3A 4RX4A 4H25A 2W60B 3WHXA 3TNMA 3TJHC 2RR3A 5JDSB 3P73A 1L6ZA 3RUGE 1CICA 3O2DL 4N0CC 1G9MH 1NCCL 1NGQH 2XZAH 5BOZG 1SM3L 4ZUUA 5JOPE 1JNNL 4J3XA 1L7TL 3EBAA 3S88H 1L0XA 4U3HA 2XI9A 3T65B 3UTTE 4P5MA 1FNEB 5TQ2L 4OAWA 4PRHE 4TSBH 1A1NB 2YUZA 3UC0L 4MXWH 3Q48A 2VLRB 1NPUA 1PW3A 3ARZA 3ARGB 1P9MC 5BVJB 5CINL 5CLWA 3R1GL 3PL6B 4P4KB 1G6RL 3MJ8B 3NCEB 3RVVC 2BNQB 4NWUL 1A1OA 1BVKB 4NN7C 4M6NH 1G7PB 1WC7A 3B2VH 3ZTNH 4ZUSA 4WI7A 4LDOB 4UDUB 3U0TA 1ACZA 1NGXB 1TNNA 2VQTA 4PGCB 1QO3B 5D7LB 4GO6B 4M7LH 3FO1A 2Q7YA 1XCTB 3O45B 4MHHG 5IB1B 2AXHA 2UWEA 4JFDA 3DVNA 5FECB 1KIUA 4IRZL 1FRGH 3BDBA 3ZYZA 4LSTL 1I3UA 2I5YH 3HC0B 1IILE 1LDPL 3TT1H 3HI5H 4HV8A 1JFQH 3STLB 2VLJD 4R3SB 2OR9H 3WFBH 3DARA 3NABL 3AMLA 1GZQB 3QQNA 5DTFB 3L5WA 1IGJA 4KJWC 4FFYH 4IDJH 4D9RD 5B3JF 2JB5L 3WN5C 1BVLA 1JWSB 5GRJH 3H3KA 3TO2B 3GGWA 3HG1D 1ZLUK 2EXYC 3AAZA 2YPLA 5BQ7A 3KYAA 2EE2A 4F37F 1KEMH 2PXYD 4TTDC 1RIUL 4XRCB 5H2BA 1E6JH 4X0KB 4D0DB 1J0ZA 3B5GA 1FVEB 2MCPH 3QI9C 3E2HB 1QRNB 3N1PC 3B6SB 5EZLA 3I6KB 4PUBL 4D0BA 1UKTA 1RQ5A 5EOCL 1RIHL 4KAQL 4ETQB 1JPSL 2YBRB 4EEEA 4R96B 1J12A 1CXEA 2BDNL 4X6DB 4J7RA 4P3DB 3RUGB 5A3IC 4OF5A 2MFNA 3H0TB 3RVUC 3V6FB 1CBVL 1DDHA 4ODSH 3VGDA 1KIPB 2J1KA 1KENH 2ZCKH 4F57L 4JGMA 3MO1A 4UB0L 2UWEB 3E1F1 5HHOE 4OTXH 4FFZL 5EZIH 5KJRL 4PREB 1A2YA 4Y4FD 5JDSA 4K94C 1CK0L 1TDQA 2AJ3B 1TZGL 2EEDA 2X6MA 4N1CA 3CNKA 1JP5A 1XF4B 4C56A 1T5WA 2NLJB 4HWEL 1CDJA 2ZKHH 2YD7A 2X4OA 5IHUL 4X6DF 4M7KL 3O6LL 3TO4D 5C0IA 1FG9C 5TGBA 4M6NL 4OB5H 4U1SB 2D7TH 1CN4A 2ESVD 5C08A 2VDMH 4X9HA 2E9JA 2IANE 4WWKC 3V4VL 4ERSH 2H26B 3DROA 1QSEA 3LRHA 5I16B 5A43C 3TNNA 1BIHA 3LN4A 4J3TA 4MJIA 1S8DA 4DQOL 3SJVB 4RNRA 2EIBA 2QQKH 2PXYA 4ODUA 3EGSB 3MLYL 1V5JA 2IJ0C 3DRTA 2W9EL 4HHAB 5KVDH 5E8OA 2WBJA 4NC2B 2AXGB 3QUKB 4J1UA 3K46A 4X6BA 3GSWA 5KG9A 1DBKH 1DBMH 1JHTB 2DQHL 3O3DA 4LSPL 2KL6A 2GITB 3OAYH 4R4ND 4ELMF 4P5TD 1PZ5A 3RWHA 2X7LB 5DVNA 1XF1A 3CFCH 1QFUL 4FHBD 3VFRB 3RNQB 3WD5H 4P9HL 3LH2L 1OP3H 4PRPB 4YDLB 2ZPKH 3SE9L 2CRZA 1NCWH 2R2CA 3EOTL 4WUUE 4MS8C 3SDAC 5CAYB 1WUNT 2DMKA 3O2VH 4KAQH 4P3DA 3RUGA 2F19H 5JORA 2MOVA 5ESAB 3WS6C 4U1MA 1WEJL 2YBRA 1NJ9A 5HI3C 4IMLB 4L4VD 1BQHB 2HRPH 3V0WH 1QR1B 5JO5B 3JWDC 3RNKA 1X5HA 3MRPA 1G7QA 2VLJA 4M8VA 3PIQA 4R4FL 3L3IB 3RZCA 1TZHB 1AQDA 5H94A 2WIMA 3VFWA 4DKFL 4GAFB 2DTML 2G9HB 4HFWB 4WEBH 4X5WA 2V6HA 3OR7B 3K2UH 4JKPH 4X80L 3BGMA 4MAUL 5EU4A 4C83B 4WFEE 4ZO8A 2X9WA 4LSQL 1X9QA 1T1YB 1A9BB 1E27B 2EEBA 4D9LL 4CN1A 2J4WL 3ARDB 4JFED 4OZHB 1CTNA 4WY7H 5DJXB 2EYRB 3RGVB 2XOTA 3VGGA 4EDXA 5BZWB 9CGTA 3QDMA 2ZUVA 5IMLB 1DBAH 4JZOA 1WWBX 2KKQA 3BP6B 2QSCH 1WQVT 4PY8J 1I1AA 1H3TA 1UWGL 5HGAB 4OV6F 1FORH 3RX7A 4QYOA 5I1LA 4RGMC 1J05A 4JZNA 3VFOB 3EOAA 3LRGA 3TCXA 3R06A 1GZPB 1F4YL 4OZFG 4G5ZH 5DQJB 1MLCA 3W9DB 3D25B 1N8ZB 1Q94B 4L5FH 5FM5O 3QWOB 3WYRA 1RJZA 1MCWM 3O9WA 1Z5LA 1DBKL 1DBML 4ODVL 4ODSL 1T0MA 2R0LL 4GG6F 5A16A 5T1LD 2F58L 1MVUB 4GQ9L 4UT6H 3QISA 1WWWX 1S7RB 5I2IA 2ADJA 2Y06L 4NO5A 4NJ9L 3B9KC 1AD0A 4B0MM 5AAMA 1MHPL 1PFCA 4UIMB 5HGDB 4X4MA 1OP9A 5D70L 4AIZA 3TWCL 5DJ0B 5A2KH 4ODXB 3PJSA 2LE9A 3EJJX 3QZWG 2GIYA 2VC2H 2C4XA 4K7PY 4WDIB 2NY0C 3AGVA 3UZQA 3O2VL 5B3JE 5ELIA 4TVPD 4HGKC 5A2IH 3WMSA 4JQVA 2EDTA 3RY5A 1DLHB 4POYA 4FRWA 3HUJA 2NTSP 4ODTH 3EO0B 2KZWA 3LAFA 4QXWA 1S9YB 3BH8B 1E27A 4AQOA 5J11C 3DTXB 1KELL 4PS4L 3W82A 3QUZC 3R0NA 4ZUWA 4WUUD 1YQVL 5FK9B 2VYRE 1KCSH 3GO1L 1IT9H 4NJAL 5E94A 1MH5A 2VZ1A 4JCMA 4BJLA 3CLFH 2R69L 3RL1B 1A6VL 1CWVA 3BE1H 5C70A 1M4KA 1X3DA 1U92A 3ARFB 5AZ2L 1FSKC 4KDTA 2XWJB 1Z6JT 2XTJC 5DZLA 3BIKB 4ZS6C 3G5YA 4M61B 1VERA 4ZTPH 5D2LB 4L4VA 4GMTL 5E2WH 2FZ3A 1ITBB 1D3CA 1U3ZA 1ED3A 2XY1A 4D8PB 2ATKB 3VRLF 3E6HB 1SEQH 3D0LB 3U6RB 2WWMD 3Q1SL 2AQ3A 3IXTB 2Y23A 3I6GA 3O0RH 3IJHA 2IQ9L 2Z4QA 5GZNC 3DVFA 2IAND 3VXQB 4ONHA 3VA6A 3AXLB 4WTZA 3BXNA 4R90H 2ESVE 5H37G 4OCNC 4MLSA 3OKEA 1W72A 1K8DA 4HF5L 4ISVA 1GJIA 1AXSB 2NZIA 2BY3A 3WUWG 2YRLA 4NQXA 4AIZB 2VLLA 3OB8A 1T0NA 2JB6A 3QPQD 3MR9A 4OFPA 4KZEL 3RZWA 2JJTA 4XBPB 4P5KA 3FB6A 3MRRB 1Q8MA 3O6FB 4ZPTB 5HHOD 1IM3A 2DQEH 3AB0C 1RK0A 3FQWB 4QTHB 3O8XD 4Z0BL 4X8JB 5DC0A 4PLNC 2D7QA 3N85L 1NLBL 1UWEL 1JNNH 5TH2B 3HS0B 1M05A 4ODHH 1U8QB 2A1WH 1KTDA 2FH8A 1BBDH 3T04D 4DEPC 1T22A 3OKNA 4P9MH 5KS9A 1M7IB 5ESQA 3BUYB 2V9TA 2ZUYA 1OAQL 3LQZB 5DUML 3LKRB 4B50A 1H3VA 3O6ML 5FUOH 1P1ZB 1NCDH 2CPCA 5FB8B 2NXZD 4IHOA 1OWWA 1GAFH 4HT1H 4F7TA 3OKDB 3KJ6L 3T0BA 1FYHB 4G6KH 1PYWB 5JMRA 5L0QC 3IRZA 1UWGH 2ZG2A 3AS1A 3IFLH 3I3DA 1MWAH 2CH8A 1NGPH 1DLFH 2DQGL 3IDNB 1DANT 4L9LC 4NSKB 3HG1E 4MAYB 5C2UB 5KSBE 1IE5A 3ES6A 2ZSVB 3V4PH 1H0DA 4Z7UA 3TN0C 5LAXB 1L9NA 4PJFF 1T83C 2G2RA 3HZYA 5HGHA 3PL6D 3GRWL 4I3SH 1OLZA 2VLJE 1DE4B 5FM5M 1KLUB 4UQ2A 3D18A 4JKLA 3E6FA 4JFFA 3RQ3A 3TVMA 1CQKA 3ILQC 4XXCC 3VFVB 1OB1A 5IHZA 4HKXB 2A6IB 1IAOA 4NHCH 1KLGB 5INDA 2XXCB 5E6IC 3MLRL 1UACL 4HZLA 3PWJA 1BQUA 3U9PH 4TSBL 4JRWA 4NZTH 5D2NE 4LVNC 1H8NA 3QJFA 2E27H 5HYJB 2GAZA 4OZFA 1S3KL 4U6TA 4LKCA 4JM4L 4MA8H 4PJEE 4AMKL 1TTFA 4UAOC 2HTKC 5DTFA 4FQXA 1MAKA 3WJLA 5JW4Q 4HKJB 1QQDB 1ZVHA 2ICEA 4ZUUB 3LY6A 4UBDD 5IMOB 3ZKMD 1RHHA 4HG4J 2NCMA 1FVCB 4UTAL 5DEZA 4NFDA 2G75B 2OTPA 5F7MC 4IJ3C 2ZNXA 5FUZH 1YEHL 1S5IL 1ZT4A 1DQJB 1CI5A 5FF6A 4QYOB 3JWDH 3BXNB 3C5ZA 4CVUA 1YNKL 1BFSA 4PRHD 3FO1B 5C7XH 1RZFH 5D7LA 3UTTD 4YPJA 4RCAA 1SJHB 3KYMA 4Y19B 2Z31A 1CXKA 1NEZG 3QJHB 2Y9RT 5KSAC 1Q9OA 4N9OB 3STBA 3RGVA 5JOPD 1CD0A 1ZEAH 5FUOL 1T2QH 2OJEB 1BBJA 2WWMC 2W38A 2UYLB 3MRJA 4KDTC 5FFLA 1OT2A 3ZT5A 2I9TB 5DDHB 4DGVL 3NGBC 1MUJA 4U2ZA 2F8OA 1E6JL 4QHMA 4R0LB 3KLAA 4U1NA 4L4TB 3QRGL 3S5LG 1VFBA 4QRRB 1R3LB 3MRBA 5DI8A 1NC4B 4H5SB 2GY7B 2FJGB 1R24B 3RNKB 5JO5A 5CZVH 2NY3D 1G6VK 5IK3A 3OR6A 4Z7OE 3BKJH 1T21A 5CGYD 4LCWB 2EC9U 3GBML 5DVOA 1M6OB 5DD1H 2PCPB 4Z95L 4JY4B 3LMJH 1NMAL 3HHRB 1CGSH 5ERWA 1CE1L 4G3YH 3O4LA 4P2OB 1G9EA 3S3PA 5FGSA 4S2SB 1KPUA 2AQ1A 4NC1E 4CADB 1ORQB 4P2QB 2BMKB 5L6YH 3B9DA 1VADB 3UPRA 4NHUB 1WIOA 2W9DL 5JNYA 5DD6A 5C07A 4BUGA 2ESVB 4S0TD 5F3BB 1QQDA 2ICEB 1LP9B 3AREB 3AROA 5ID1A 5JHDA 2VDOH 3U30B 5DURD 4NO3B 2BOBA 1QFWI 4LCCA 2W65B 4ZPVA 4I4WA 4G7YH 1TMCB 1IGIH 1NDMB 4EXPX 1CL7I 4YLQT 4NZUH 1I8LA 5M95B 2BC4B 2D7PA 4MD0A 4KKBC 4YHNA 5HHVH 5GRUL 4BZ2H 3OAYK 5BV7H 1WCQA 2X4TA 1XAUA 4KZEH 1YA5A 3HZKB 3ARVA 2HG5A 1LK3H 2G60L 3D25A 4OZGF 3P0GB 1G6RB 1RZFL 2YRZA 3BDXA 4PGDB 4RFNC 5J57B 1T7XA 4HH9B 4FQ2H 3HKFA 4KUCF 1T7VA 3K1KC 3BEWB 4Y2DB 1Q0YL 4LGRB 1J0HA 5D1QD 4JQXA 4O9HH 3WNPA 1VENA 5FDYA 4Q9CA 5CJQH 3IAPA 1P4IH 3VDBA 5I1AA 5FAAA 1AO7E 3D39D 3HG1A 3KWWA 1YNTB 5CZVL 5TF1H 4OGAD 3SKMA 4JGUA 1IQWH 5HDQL 2VR4A 3C5SA 5ECJE 2XNAB 3CFBB 1TCRA 3BP7A 2QTEA 3LMJL 4N0UE 3PP3K 1WTLA 1YNLL 5CP3H 1FH5H 1Q9LA 2C9AA 2YUVA 1YJDL 3VXTA 4RIRB 5DF0A 2EDYA 2YN3A 1MY7A 1QPPA 4WCYL 1YEGH 3CDYA 3D87B 4NKMA 3R8QA 1AQKL 1NCTA 3F7PC 2VLJB 4C57C 1NGWA 5FGRA 5DD0H 4H8WH 1NAKH 3QIWB 1NCBL 1JWSA 3C9NB 3QQ9D 5TDPB 1MJJB 3MGTA 2AJZB 4JFEA 2H32H 5I73C 3QUMA 1A3LL 2OMBA 5HHPA 3LKPA 3HRZB 4LIQH 4JRYB 1MLBB 1NCWL 5DWUH 5C9JA 2YD9A 3VG9C 2GI7A 2HVKA 4KMQA 2YK1H 4BK4A 4ETYA 5C7XL 3DBXA 3WBDA 2UVFA 1DQLL 5C0AA 4XMLL 1NMBL 3P4MB 2R29H 5CEYA 4KV5E 4EBQH 1CD1B 1A7OH 1J10A 1CGSL 1M7IA 5ESQB 4RDQG 3R1GH 5D9SA 5INCA 4ZFZB 3DX7B 4Z7WE 1JK8A 1MCCA 2NZ9C 2XZQL 4JM2F 2IADA 2YEZB 1X5IA 5FO9A 2G9HA 2NX5B 4HFWA 4HSQA 3IDJA 3D5OF 4W4OC 4NQSA 4AK1A 4GS7C 3D2UD 5JIIA 2X4PA 2BNRA 5DMGD 3ZDYE 5F6IC 5KVMC 3P0YH 1CDCA 3EFDH 2YS4A 2UWEE 5HHOB 3BPNB 5CSZB 2D7MA 3O8XA 4YX2H 2WQRA 32C2A 4N9GA 4ELKB 5TQ2H 2ATPA 1F4XL 1LO4H 3K0WA 5E2TL 5C2BL 4XXDA 3MRFB 4FQJH 3BVNA 2FO4A 3AMKA 5K9KA 5D7SH 4OCYH 1J0IA 4NKIL 3DVGB 3L3OB 2Y72A 4N8VB 3BHBA 5CKGA 3LN9A 3E6HA 4OLWH 4G80B 3W2DL 5DFVD 1CLYL 1ZWIA 1NMAH 2P5WE 3M17B 4POZD 4U1GC 3FOMB 5GSVA 3VMPA 1ADQL 4AEHH 3TFKC 4DW2L 3BWUC 5GISH 5KS9F 4Y16D 4JHZA 3JTSB 3VW3H 4WW2C 3TP4A 1DQQB 4LSDA 3WXWH 2NW3A 2Y5EA 1FZOA 4X4YB 5I17B 1J0JA 2A6KA 2NY2C 4TVPE 1KJVB 3ARWA 4ZUWB 2X4UA 2FEEL 3GMQB 1QSEE 3DBXB 5E8DL 3IXAA 1UVQA 1XGTB 1ORSA 3D9AH 1N2RB 2OJEA 3EYVB 3EZ8A 1K8IA 2XKUA 5DFVC 2QR0A 4HWZA 3T3MF 3TA3B 4HPYH 5GGVY 5ESVA 3MUZ1 5TFSH 5DJDA 3V6ZA 1P69B 5F97E 3I02A 3QUMB 5HYQA 2JB5H 5EU5A 5DQ9B 4RMTA 1OD9A 1SEQL 4YFLI 5IJVA 2ADGA 1A3QA 1HQRB 5HYIA 1JF1A 4HX1A 5JOFB 5DFTA 4FQQB 4PV8B 4GKZA 2VDQH 3KXFE 1FZKA 2EKSA 4OGAC 4KI5E 5EBLA 1YDPA 2BDNH 4JAMA 4ZXBD 3UJIL 1I1FA 1A6VH 3GRWH 3P9WB 1BJMA 4GG6A 1MY5A 3MRNB 1T5XA 3FAWA 4I5BB 1LEKA 2A6IA 1XR8B 2CO6B 2NY1B 5IB3A 4JFXA 3KLHC 5DYOA 3QQ4A 5EU4B 4MD0B 4HC1A 3TZVD 2PCPA 4TRPH 3FN9A 3P77B 15C8H 1AP2B 2R2HB 5J56B 3HMXA 1YEFL 4PRID 3T65A 2G2RB 2GW5A 1JYVA 2PO6B 3CMOH 3GGWB 3RDTC 1Q94A 4W6XB 1MCRA 5ICXB 4G6MH 3OG4B 3QUXA 2FJHA 4JFEE 3B3IB 4YHML 1N26A 3LIZL 1JHKH 1WZKA 4U1NB 4X98A 1MJUH 1TZGH 5GS2H 4U7KA 5D7KE 1MHCB 4HUXA 3HMXH 4WFED 4JREC 4JPVL 5F1NB 1HXMA 12E8H 1HHKA 4WNQA 5D7IF 2BMKA 5IFHH 1CFTA 3KPNB 3RRQA 1HHGB 1E4XI 1L7IL 2R1WA 3FCTB 1J11A 5F96H 5HVWA 2Y6SC 2Z93A 2EH8L 2O5ZL 5FB8A 1CVRA 4L8CA 4OZHF 3MLYH 3FT2A 3DXAD 3VW3L 5IEHB 5JW4M 3CSBA 4L4VE 4MDJB 1G6RA 4HS3B 2R69H 3QULA 4WO4A 2CK2A 1LO4L 3VFUB 1NBVH 3DURA 1T2JA 3TYFA 1S8DB 1UXWA 5SV4A 2DJSA 1LEGA 5DQDL 1OLLA 2APVA 4JANA 4PJ5B 1HDMB 4K7FA 3RAJH 3LKSA 2EDWA 4UQ3B 5E2WL 4X9GA 3UROR 1X5XA 3CUPB 1HOCA 1I1AD 4MNHB 4D2NA 4MXVF 2ZKHL 1ZLVK 1I3VA 3BKYL 2DI7A 1HYSD 1RUKL 4QNPE 4V2CB 4YDVA 5C0IB 1X6LA 4XNMB 4QHUB 5ITFB 1MFNA 1CK0H 4AZ8A 4G6FB 3RIAK 3WUWB 4MA3B 1A4JB 1IAOB 5E6ZA 5E8NB 3O4LB 1UXWB 3DLQR 4M7JL 4Y5XB 4M4PA 5FA3B 2A9ML 1OP3K 5HHQB 3F6IA 1NAML 4OCXH 5A2LH 3VD3A 3VH8A 4HH8A 2F74B 4JO1L 3TV3L 3B9VA 4K3JL 1AGDB 3OAUH 4NO2A 1SEBB 5MENB 1AE6L 1M6OA 3D3VB 2EO1A 5CP3A 5TFSL 2AEIT 1QFWL 2P8LB 4JQIL 1F3JA 1R3KA 3EO1B 4XPAH 5DJAB 1NQBA 4AG4H 3EDKA 1MQKH 1J9CT 3N9GH 2V2XB 2VXUH 3ILQD 4HUXB 4LPCA 5F44A 4EQ2A 4LEOB 3DXAA 5EZOL 2NW2A 3B8SA 4XCCH 3RUGF 1ZTXH 1N6QL 2OZ4L 3W11C 3ZDXF 3BN9C 4AIOA 3CGTA 3DPBA 4AYFA 2BHUA 3MBXH 1VPOH 5E95B 3K81A 4P23A 3PWLB 4FFWC 4EUPG 3D2UA 1FORL 1QLFB 1T0PB 5A2FA 2OTWB 4HS3A 5DXWA 4QY8B 2ZJSH 5GJTL 1NLDH 5DMKA 1I3RB 2ZCLH 2D0HA 1BM3H 1JWMA 1OGTB 3BISA 2MCG1 2G75A 4H0HB 1UM4L 3MROA 3TIEB 1EGJA 3ZE0E 1INDL 1DN0A 2VR9A 1MJ8H 2GJJA 4FQIL 4APQA 3C08L 3PWNB 3HMXL 2RFXA 1XMWA 1CE6B 2H8PA 2BY1A 5F7YC 3VMNA 3U46A 3O3AA 2AGJH 4F7TB 1MFCL 5H35B 1T89A 4HMEA 3IETB 4QXTA 5L88L 4NQUA 3ARYA 5J6GB 4BKLA 4QCIB 4JREB 1UKQA 3KS0H 1C8PA 2VC2L 3JVGA 1UYWH 1JIBA 4GKSA 4D9RE 1U8KA 3MLXH 4P57B 5FDWB 4QGYA 2BRQA 3A67L 5C0FA 5K33A 4LLYB 3RDTB 1BECA 1EHLL 3WSQL 3SKUD 1T7YA 4CRPA 5C86A 3PF2A 1J88A 4LQFL 4Y8DC 4JFXB 2DM3A 4ZFFB 5BQ7B 1AJ7H 4PJ7F 1BFVL 1QRKA 4PJCA 4HJ0D 3BGFB 5IB2A 2NY1C 1HIMH 1XH3A 5AG9A 1TFHA 5L2KA 3N9GL 4X7EC 5KTEH 3MNZB 3JTSA 1LK2A 1VGKA 3GMPA 5IW1B 4AENA 3UJJL 2OSLA 3TO4B 2KUTA 4G8EA 2ZUQC 1DFBH 4Z78A 1OTTC 2VUOA 3MLUH 1ZEAL 3QUXD 4LLQB 3TBSA 4A6YA 4RAVA 4FP8H 3BAEH 1HILA 3FB8A 1SJXA 1EFXB 3X11B 4TULL 3LKQA 5T5FH 2NTFB 3UPCA 4OFIA 5T1KB 3QXVA 2X4SB 1PAMA 5F72S 3OG6B 1GGBH 3CH1B 4ODHL 3IXAB 3KPRB 3HUJF 5CBAB 1CF8L 5LXGL 3C6LC 4ZOEA 3TA3C 5KSVA 1T22B 5KS9B 1CFSB 4U6YA 3PABB 3ZO0A 1LEIA 4N8CL 1CS6A 2V9QA 5F1SA 2IPTL 3U0WH 1BZ9A 5GRJL 3OXSA 3SKJL 2FECL 4NT6A 3VXUD 1UKSA 2BVPA 1HYRC 2NY2B 4PRHB 2RIKA 1N3NA 4GW4A 3BN3B 3WIHH 4P2RA 3SGKA 3TN0D 1AGCB 3NABH 4L3ED 4Y5YC 4PRPD 5GZOC 2AERT 2F5AL 4C56E 3VXPA 4P2QE 3S9DB 3N1QC 4GRLA 5IVXA 2HJLA 1JTOA 3O11B 4Z7QF 4JHBA 4ZTOL 3MLXL 5DQDH 3MUHL 4XCYA 5FO9B 3T08A 5CBEB 3I75A 3E8UL 1MEXL 4U1GB 2IAMC 3RHWK 2ICWJ 3BRGC 4PJDA 3DX7A 1ZKAA 2B0SL 1QFPA 4HKBA 3RDTA 4DQOH 4M9PA 1RMFL 5C07D 2Y36H 4GG6B 5GGRY 2KQNA 5FA4B 4KJYA 1KC5L 5J0BA 2KH2B 1C7SA 1K4DB 1PG7X 3EIFA 1OTUD 3JWNC 3VA2C 3SGDH 4LRIC 1EHXA 1XFPA 2BCKB 4L4TE 2HJFB 4Y1AA 4ZYKB 1KOAA 4FG6C 1TPXC 1RZJH 1X5KA 2HH0H 3BSZL 3NFSL 5IFJB 3H9SA 1MLBA 2FX9L 4X6EB 5E00A 4Y19E 1P4BH 4RQQB 5FO8A 1YECH 2J8HA 3QH3B 3G5YB 4GSDL 4UV4L 3FTGB 4OQTL 4K8RC 1F58H 5I74C 3RU8L 5F6IB 1FIEA 3IU4L 4AH2A 1VEPA 4OUOA 5LBSH 2BSRA 5I8KH 2F8VA 4WUUA 1BLNB 3DMMA 3WIIL 3FQNA 4U4BA 5CEZD 5BXFA 3U0PA 1VGEL 4EUPH 2ARJQ 3DO3A 4U0RC 4PJBB 4O5LH 4I3SL 4K3EL 5GJTH 3FQRB 4HIIB 3QDJB 4JEGB 1DVFC 4P4RB 1QYGL 3U79A 4L3EA 3OJDB 4LGSB 1DANU 1S9VA 1IAIM 3L7FA 4MAYD 4PD4K 3L3JA 2AV7A 1IC7H 4UMGA 4G6AD 2IG2L 5IEKB 3OPZH 1X5YA 2MPAH 4R8WL 3WDHA 5JORB 1DEEA 5IB4B 3T0EE 5IR1A 3SGEH 1TQBB 2DLTA 1MCLA 3P0VH 2HT4D 1J0KA 1QBLH 3UDWC 3FONA 2H1PH 2EIZB 5EBWB 3O3EA 5IROC 1KXQE 4Y16C 4YHKL 1XR8A 1FVEA 4R7NB 4NKMB 4EI6B 4AMKH 3QIWC 3O9WD 1CD1A 4XXDB 2VZOA 4KZDH 3WSQH 4S1RH 1QBML 4HHAA 5CJBA 2EH7H 1ZHBA 4I0PD 2P24A 1FO0A 3C5SB 3QI9A 4W4NA 1MFAH 1RMFH 3LIZH 2WQ8A 2X1QA 2M26A 5ESAA 1R5WB 3T0XA 3MTRA 5B21A 4XBGA 1D5XA 3PWPB 3LOWA 3FTGA 4GRWH 4KRPD 2DIAA 4YK4C 4X4ZA 3EDDA 4JZNB 1LEGB 4WTWA 3VFOA 3S8WA 2NNAB 3H9HA 5EFIB 3FMGL 3KHOA 3QCUL 4LSVL 1AI1L 1QLFA 2LAAA 4W6YB 4XP9L 2IFGA 3OTTA 3EDJA 3WKML 3VD9A 4Y2DC 1DSFL 4HZAA 3DETD 1FFOB 2R2EA 5CHNA 1FIGH 1G7PA 4H88L 4XVSH 3DV6B 1PKQE 2BJML 1FVDB 2E27L 4KHXL 2YD5A 2R1WB 3QNYA 1CF8H 2NY6B 3CFBA 4IIQC 1KB5A 1GOFA 2VQ1A 3S5LA 3GUTA 2BVOA 1UZ6E 1YQ2A 4LCWA 1DR9A 4E0RA 2P8LA 4P2RE 1CR9L 2A6DB 1FL3A 3MJ9H 3KPPB 4UUJA 1Z3GL 2YSSB 3O4LD 5ADOL 1A7QH 4OIIL 3MRIB 4GLRI 2NY4D 1JHKL 1NGWB 4UT6L 5GRZA 3TBVA 5EZJA 2VLME 4Y2DA 2E6JA 1F3DH 5C0EA 3DNKA 4YHOH 3K8KA 5CKAA 4MA1C 5FUCE 1TITA 4K55A 5CZKA 4P5TA 2PETA 4IBLT 2YUXA 2OI9B 2Y6SD 4MMZC 3GFUA 4M43L 1WT5C 5GGUA 3CPLB 3P3YA 1WZ1L 3ULVH 4HJJL 3U4AA 2XNAA 1BD2B 5GGSB 1X7QB 3JWOL 4PJFE 3P11L 1J1OL 1YDPB 2NY6D 3EJZD 2ILLA 2HMIC 1YEEH 2CKBB 3MLSH 3LS5L 1MVFA 2KBGA 2F5BH 1FZMA 1VKXA 2ITDA 3V5DA 5JZ7D 4XWGL 1AKJD 3ARBC 5D7LD 3UTTA 4F80A 4RQQA 3SE8L 2VXSL 5JIHA 1R3HA 1NCBH 5D71H 5C09B 5IMMB 1RD6A 4NHUA 3OHXA 4KZDL 2C3VA 3P4MA 5CEYB 2PTTB 2PYFB 1PSKL 1RIVH 1MUJB 3MV11 5I66B 1A5FH 2JCCF 2ZOKA 3NCFB 2I27N 4R0LC 4ONGH 3K2UL 4HGWB 4JKPL 4S1QH 3ZT7A 1D5BA 4CMMB 1HXYB 4M5ZH 4LFHG 5CJQL 4YIQA 1QG3A 1NH6A 3FB7A 4FTVE 4JRYA 5C9JB 5JPNB 5FYKD 2V7HA 3KPLB 2VLRA 2CLZB 3MXWL 5HHXH 5F3HA 5KSAB 3UTPE 4ZSOE 3TZVC 2VJXA 4BSJA 4X98B 5DRXB 4ZOAA 1PKQB 3C6SB 3TZVB 4Z7NF 2X2YA 1N7MH 3UBXG 5FECA 2YMXL 1U8MA 4NZRH 5GGRB 3QDAA 1EJOH 1CFNB 4UBDC 4UUJB 1T1WA 4LSUH 2Y5TB 4L4TA 2VAJA 1AXTL 4QEGA 3OX8A 1FG2A 1SY6H 5CGMA 1CLZH 3PWUB 3S37X 2VKWA 1NGXA 3WFZA 5K9OA 4U1KA 4XI5D 4PJ7A 3FO0H 4YC2B 4PD4J 5EWIL 4UAOB 3QNYB 4N68A 4I2XB 2GTZA 3R0MA 5IVXE 1ITCA 1LP9E 4F8QA 2WV3A 5T1KA 3S36L 3ZKXC 1MAJA 2H1PL 5MEOB 1FNEA 2FEDD 3S88L 3STLA 1GOGA 3A6CH 3NH7L 3Q6GL 5IHBA 3PUCA 5F7EH 4QOKE 3W81A 3QP3A 3HI5L 1N0XH 3MLTB 1C7TA 3O3BB 2DI9A 3L9RA 4OTXL 5IB5A 5HDLA 2XV6B 1NSNL 1QEWA 4HXAH 2OK0H 1II4E 1OL0A 3IKKA 1I3GH 3TN0B 1XCTA 3O45A 4LEOA 3G6AB 1BOGB 4XPTH 1CBVH 4LDEB 4OF0A 1AQKH 2CLZA 5TDOA 1B4RA 1I7UB 2OTUB 1S7QA 2VLLB 3I3BA 2IQAA 3UTZA 2QR0B 3VE0A 4KKCC 1DVFA 1KN2H 5I1GH 4Q6IA 4FFWD 4JQVC 5EC2B 5IB1A 5CJXA 1RZKH 3PHSA 4HCRL 4FQ2L 5KAQG 2IANB 4NWUH 4XAKE 2R2BA 3AM8A 3RAJL 4XCCL 4UQ2B 2DQUL 1A6UH 2NW3B 2OR8A 3H6JA 1NFDA 3X14B 2ZCLL 3OGCB 4MNQD 1GYAA 2X4NB 3QWRD 1IAKB 2WUBH 4JG0H 4JFYA 5HGHB 5JA9A 3VWJA 3PL6A 2IEPA 3OV6A 4OM0H 4S1SH 4XVTL 1CDUA 4AY0A 1D5ZA 2VLKA 2NY6C 2VISA 3EJZC 5JUEH 2OS7A 3BKML 4OCSL 3U1SH 1Y18B 4BK5A 2OR9L 4ZTOH 1RU9L 1S9WA 4LCWD 1NAMH 4OCXL 3KDMB 3MV8D 4NDMB 1KEML 4MJIE 1WBXB 1DQLH 1JPGB 2ITCB 3D3VE 4K3GA 5D1ZD 4Z6AT 2Q87A 5D1XD 1A6WL 3BQUA 3BAEL 2AEWA 5HHMD 4ZNCD 5J9PB 2IQ9H 3W5NA 4UOJA 4EKXA 2B4CL 1F2XK 1IC5L 1QACA 1Y0LA 1IL1A 4KJQC 4MD4A 4YQXH 4ALAH 4NZTL 5T33L 1RZIA 3IGAA 3QAZC 3QXUA 3AU1B 4HUVA 4K9EC 2YD4A 3BZ4B 2J88H 4UOW1 1CTOA 2J6EA 5EBMB 5DK2B 5CILL 5DK3A 4RAVB 3SY0A 1XF5A 3VGHA 3QQ3A 5MEPB 1N5YL 3BIKA 1INEL 1O7SA 2PN5A 4FQ1L 4HUUB 4G8EB 5D8JH 4GXVH 2CLVA 1LE9B 1NL0H 3RPIB 1E4WH 5KOVC 3GKWH 2XY2A 1YYLL 3VFMB 2FJHB 2CUIA 1MI5E 2NXYC 3PQYB 4Y1AB 3CFEA 4HEME 1AGDA 4NO2B 3CFCL 4AT6A 3KYMB 4MJ4A 4Y19A 3P9LA 5DRNB 3RBSA 2VO5A 4G9DB 4UT9H 4NNXA 4H0IA 4OM1L 4ENEC 2VE6A 1TQBC 3SQOL 5FA3A 1KCVH 3AUVA 5EC1B 4F7MA 5LGJA 5IESL 1FAKT 3U9UA 2R0KL 1B90A 4ZPTA 3V7AE 1KIRA 3MRHB 2BVTA 3EYUL 4XPTL 3N50A 2V2TA 1G1CA 4M61A 1JZ6A 4JZJA 4YXLH 1AGCA 1I7ZB 3QIUA 4TYUA 4QRSB 3N1GC 1H5BA 3D85D 1EUUA 3GSNA 4TRPL 1IFHL 1M7DA 3VXOB 2NY0B 1CE6A 2H8PB 4ISVB 4K7FB 4S1SL 4PJ7E 4JFQB 3JV5A 4HKXA 4KJPC 4NJ9H 5HGAA 1N6VA 4U3XA 3SKJH 3UPAA 4DN4L 3DMMD 4Y4HB 1NGZA 3PXHA 2VL4A 3EYSL 1F3DJ 4ELME 3HPJB 5I74B 1AO7A 5EU6A 2R15A 3JV6A 3MV7B 3AY4A 4HS6A 2XG5A 2EZ0C 3RPKA 1NKOA 3O9WB 3VDAA 2CMRL 4C83A 1NDGA 2CIKB 1JZ3A 1Q1JL 5DD1L 3RY6A 4PJ9B 1D5IL 3A6CL 25C8H 4AJ0A 1TPXB 2FSEA 5DD5H 3IKCB 1EVUA 3SY0B 2XIDA 3VU2A 5E00B 5IF0B 5DJYA 1IZJA 3GMLB 1VFAB 2XA3A 3IJSB 1LE9A 4JR9L 5GIRA 3J8F7 2NY3B 5IBTL 4PY8I 3ULVD 5D7JC 2C3GA 1I75A 2Q20A 3EO1A 5DJAA 5DR5L 3HUJE 1CE1H 4UNTA 3RHWF 4JZOB 2IAMB 5JHLL 3QO1A 2FD6H 5FOBA 4IRSA 3OZ9L 4XP6L 4QWWD 4JFFE 4F7CB 2WBWB 1LO5A 3PQYE 1G7JA 1MI5B 3EOBB 4LSQH 4OQTH 5F9AC 2E9BA 2QADC 4TNVF 3RGVC 2E7MA 2OCFD 4K8RD 4PJFB 2DIBA 1RULL 1IT9L 3NFPA 4LPWA 4NUGL 3I9GH 1ACYH 1TJGH 4PV9A 3QHZL 3MGAA 4IS6B 4QCIA 3W0WE 3GSNB 2ZG1A 4DAGH 3MSPA 1S7SA 4GG6E 2GUOA 2R0KH 3QFJE 4L29B 1HYSC 1YPZA 3CD4A 5IJKC 2CQVA 5SWZE 4NO5B 4JO1H 4LSRL 3MOAH 4O58H 2V2WB 5L9DL 3LKSB 2HT2D 1V3LA 1KIQB 4OM1H 4LPXA 3L7EB 1RUAL 3IDGB 5IHZB 3OL2A 3UTQA 3B83A 4LHUD 1KACB 5ID0A 4KGJA 3MV9B 4BSVA 5F1IB 1EAJA 5GZOD 2ZUQB 5SWQA 5JR1L 4NKQB 5D7IA 2EE6A 4N0RA 4MVBD 5D1ZA 4NFBA 1BJ8A 5CGYC 3DETC 3VJ6B 2XWJA 1A2YB 3CX5K 3IDMB 3TC9A 5KVGL 2Q8AH 5DHVH 1D5MA 1UG9A 4DJMA 4XNQB 1HKFA 1S7WB 3BGFC 1T89C 1X5JA 1F11A 2Y07L 4KK5D 3EZJB 1I8IB 2HFEA 2H3NA 4GKOA 3FOMA 5DUPL 4HIHB 2CDEA 4L8BB 3HAEA 4F15B 4YFLF 2X4SA 4BA8A 3NCYP 5T3ZL 3RVTD 3IVKA 3H7BA 2VXVL 4PGBB 4PJXB 1PG7L 1BZQK 2J8UA 3NVQA 1KCSL 3CCHB 4EIGB 1QVOA 1R5IA 3FB5A 4HKZA 3WLBB 3OKNB 3HUJB 4HMDA 2ICWB 3O6MH 4A6YB 2NXZB 3CK0H 1P7QD 1TQCC 5EU6D 2VL5B 5TH2A 2F9BT 5DJCB 2AXGA 4QGTA 2NR6C 4M93B 4NRZB 2AI0H 4XNMA 1G7QB 1TIUA 2E7LC 3EKCA 4YDIL 1IAIH 3AVEA 1I8MB 1ZHNB 5JW5B 1PJ9A 4KWUA 2HTLD 5HGBB 5DWUL 3BKCL 4KKLD 2AV1B 2PYEE 5INDB 3IDJB 1ND0A 3CIQA 2VDML 3SE3C 4FXLA 4P2YA 1UACH 3MLRH 3I2CL 5HYJE 1WWAX 4Z7UE 5BJTA 1BX2A 1JYXA 4PRDB 5BW7C 1MFCH 1HSBB 4J4PD 4MJ6B 5FYLE 3E2HC 4LSRH 5IKCB 2K1MA 4XWOD 1FNAA 4NRYB 4BQ9A 5IV2A 2XTJE 3VFTB 5EU3B 3F7YB 1NEZA 2X42A 3JWOH 2J5LB 1FJ1B 4EVNB 3ZDZF 3IS1X 3OHXB 1KJ3H 1U3HC 1JCKA 3IDIB 1LE5B 4QRPB 4WFGD 4KV5F 1BWMA 4ZO7A 3WJJA 2WAHA 4JFHD 1F3JB 3QEQB 5E8EA 3OKDA 4PB9L 3K74B 4R96A 5IMLA 5DC9B 1MH5B 3KAAA 1VFMA 4FQHB 5A2JH 4JJ5A 4Y5XC 5CS7A 4MWFB 1NFDF 4XWOC 4JO4H 1HHHA 3SDYH 3WKNA 4HLJA 4M6MH 3FO0L 2DQUH 4Q9QL 3E3QE 3SJVD 1JZ8A 1LEKB 1VEMA 5DMIH 2JIXA 5I18H 4G9FA 2P5EA 2ITCA 3RI5K 1QBAA 2A73A 2Y36L 1X5ZA 5CD3B 1BFTA 3NOIA 5LJYH 2R56H 4H0GA 4MX7A 3QG6A 5ABDE 1J8HB 4WDIA 3ZYIA 3OWEA 4HIHA 4MZ3A 5AYUH 4KI5C 3RVWD 2CDGA 5H37H 2CGRH 1T6VN 1KGCD 3U7WL 3F65A 5L7XL 4U6HA 1B0RB 5IWLA 5EA0L 1V3KA 4ZO9A 2CK0H 5KSUA 5I1IH 3T4YB 2HH0L 3A67H 1BQLL 4PJDE 2JK5B 1MCOL 1T3FA 2DDQL 1FVDA 3UTSD 1W0VA 4Y1AD 3KPQB 1G7LB 1IKFH 4ZMAT 3ULUL 4KQ3L 3QB7C 4PGDA 3STZB 3IU4H 5C0CB 1J5OL 4EDWH 3LRSA 2EE3A 2QBWA 3WO4B 5HY9A 1XGPA 3CFJB 4WV1B 4ZDHB 5SWZB 4MA3A 1IGFH 3TT3H 1YECL 2IAMA 3SOBH 3CXHK 8CGTA 4X9FA 4NUJA 4U6XA 3G04B 3S96B 4BFIA 3FCTA 1MCIA 1VACB 2DBLL 4K8RH 1HCFX 1QRNE 1SJHA 3BP5B 4PJDF 1WICA 2FHCA 3SDCD 5GGQL 4UILH 4AQ1B 4YWGL 3IDYC 5DEFA 1RFDH 1AC0A 2PO6C 1CCZA 2F19L 1QEWB 4F9PC 4XPGH 4XTRD 5EUOB 4Z76A 1C5CL 1FYTA 1LDSA 1I9EA 1WTGT 1W72H 2XPGA 2OJZL 4LFHD 1HK6A 3PWVB 3LN5B 3V8OA 1AGBB 2GFBA 4Y2DD 1DUYA 1NBYA 1A3RH 1R5WA 4MVBC 3MMEA 4Y4KA 5F9WB 3QIBA 1XF4A 2WUBL 4KPHL 2IPKA 5HSFA 3P0VL 1JPFB 1KCUH 2XICA 3QG6B 1RU9H 4W4OA 3NAAH 3EYQD 3RTQA 1T03H 2AK4D 1N2RA 3EYVA 2A73B 1NGZB 2C3XA 2FIRT 5AAWA 3SDDA 3NIDE 1KT2B 2DQFA 1JMXA 4ZOCA 2IALA 3EDEA 5B39B 5TE7L 1NAMA 5EIIA 5F88A 1ZT1A 5IVXF 1JWUB 2IFFH 5L2KE 3ARXA 4KY1L 4PJIA 4ZUVA 5IG7A 4NP4H 1DEDA 4JG0L 1KPVA 4TTGA 5KBNC 1U8LB 4PB9H 4YHLL 4YR6A 4ESKA 5A40E 3VXMD 4U2YA 3F7QA 1RZ8B 4Y4KC 4GBXA 1IGCH 3OSKA 2DYPA 3HG1B 3KLAB 5I8KL 2XZCH 1FNGA 1CDYA 4XMPL 5C08E 4WW2F 1NAMB 5EIIB 2RB8A 1NL0L 3BJ91 3MACH 4OM0L 4QOKB 3UJIH 2FO4B 5LCVH 1MIEL 2YD3A 5KANG 1K8IB 4KJWD 3UZVB 2IPUK 1EEQA 4PTUA 3T2QA 1DBJH 4YE4L 1AH1A 2C1PB 3BSZH 4JRYD 4MJ6A 1UH2A 3LN5A 3MJGX 2GJ6E 4F37K 1CGYA 1FZKB 2B5IB 3MFGB 1AC6A 4YZFE 2GTWA 12E8L 5FO8B 3RVXC 5T3ZE 3MRQB 4J4PA 4HX1B 1JF1B 5JOFA 2W9DH 4TUOA 2NY5C 4HUUA 1VCAA 4ZG1A 2B1AH 1UM6L 3PGCB 1QUNA 3GJFA 5GSVB 4G42B 3SDAD 4PJBE 1I7ZA 4C4KO 1I7TB 4KK6C 1R3IL 3PHQB 3QDGD 3QDJE 4FTVB 2AJXL 1PG7W 5T3XE 1XF3A 1A0QL 1ZHNA 4FOMA 4PG2A 2YUWA 2QHRL 1BBDL 1U8LA 4L3AA 4XPAL 1T5WB 5C0AE 1BVKA 1S9VB 2PUQT 4R4NC 4JO4L 4KKLC 1MCPH 3DRQA 4IOIA 5FCUH 3QUML 3MOBH 2DQEL 1N5AA 2C7UB 2FR4B 5TDNB 2VE6B 3WUZA 5CEZH 4K3JH 4OZHE 1UJ3B 3OKOB 1HHIA 2APXA 2AABL 4HKZB 2ED7A 3TBVB 4MQ7A 4QRRD 4GS7B 3V7MA 1VB9A 1AI1H 5ISZA 2LU7A 1WBYB 3PQYA 2EDFA 1A1MB 2I07A 3I84A 2VXUL 4K8RL 3MMEB 3ARFD 1JYWA 1N59A 5GGTH 4OFYD 1EERB 1CT8A 2BVQA 1LEIB 1A7RH 5B3NA 1F11B 3JZ7A 3LKOA 2VZTA 1FPTL 1ZGLM 4LBEA 2R56L 1B6DA 1V7ML 3RWHB 4R7DA 4E41E 3ARQA 3HE7B 1IAII 1C5DB 2RBLA 4NC0B 4HUNB 2P49B 1EUTA 1C1EH 4XCFL 1LDPH 3HE6C 3TT1L 5KZCD 3SCMD 5D7IB 3V2AR 4UU9B 4UINH 4KROC 1KJ2L 2ICCA 2Z92A 2PF6A 3FHAA 3I50H 3NIFE 3L5IA 4KUCD 3QEHB 3UYRH 5EPMB 1KYOK 4OGYH 1EFXA 3IDGA 1HINH 4OZIA 3KGRA 1NUGA 1RJLA 5JW3L 4HFUL 4EVNA 1A6ZB 1PD6A 4OD2B 5FKAB 5TQ0H 3MGOB 1FP5A 4X4ME 3NCMA 3HI6H 1ZLSL 3ZKMC 4PGCA 1AXTH 4Y5VB 1UM6H 3M8OH 4KHXH 2AQ2A 4KH2A 1ZE3C 2Y25A 1AD0B 1TXKA 4JVUA 4OLZL 1HHIB 4QT5A 1QHOA 2YD1A 4X6CB 3QFDA 5F7DB 3MV9D 5TDNA 1NCAH 3PGDA 4DGYL 4GBXC 4TNWK 1VFOA 2BOCB 5E99L 1A1NA 2W07A 1HH9B 4QHLA 4I77L 4YE4H 4OAWB 5CUSL 4Y4HD 4LP5A 4XWGH 1LGVA 4NO3A 4GMSL 5CZXC 1CGXA 4TQEH 4DK3A 3INUL 4NO0A 4JN1H 4H5SA 3RWDA 3O41B 4JM4H 4MA8L 3D69B 3RIFK 4MHHI 3MNVA 1HH6A 4JPWH 3WN5A 5JR1H 2OQJA 3FOLA 4RFEB 4PJEA 5IT2L 5EC1A 2NY7L 4F7MB 1WT5A 5H2BB 4OZGB 3ZE2E 3W11D 3QHFH 2FCBA 3KG5A 2QL1A 3P9MB 5D6DC 3T1FA 2ICWA 1PQZA 1NGYA 3G6JE 3TIEA 1M1SA 5EO1B 1S5HA 4KJQD 3LDBB 3DO7B 4HS6B 1GGCH 2MSPA 2AABH 3TO2A 5HPOA 1TCRB 3DMMB 3M45A 4DK6A 5MHSD 3A0OA 4UV4H 4LP4A 3U30C 1QBBA 3QUMH 3ARBA 4YO0A 3BUYA 2H3NB 3AREC 2QKIB 4MCZB 1N7ML 5IMKA 3RWCB 1RZJL 3BDYH 4U0QB 4X99B 4LVHB 4Z78B 1NMCC 4GKSB 1GGUA 4GH7B 1RK0B 3FQWA 4QTHA 2VDNL 5E8PA 1T7ZA 4J8RB 3GSUB 1VGKB 1XGQB 3Q6FB 4JO3L 3HA0A 3BRFA 1TETL 4ZYKA 4XAWL 3T8XA 1YMMA 5ICYB 4E5XB 2DLIA 1GGIL 1IJ9A 1PY9A 1C16B 4KTDH 5F21B 5F1KC 3T2NL 4ZSOB 4QHKI 1EBAA 3KPRD 1D9KA 1AXSA 2ADJB 1IEBA 2BOCA 3L95A 3L3HB 1LO2H 1WWCA 4YAQA 4CU7A 1A14L 5B39A 2R1YA 4FNLH 4ODBD 1MVUA 2Q86B 2L0DA 3MRLB 3V0VA 3RTQB 3C8HA 2VOTA 3P9LB 3GSWB 5KG9B 2ZP0T 1FFQA 4YJZL 2WWKT 1FNSL 2FBJL 3MC0A 3QIBB 3T8XB 4ZNEE 2BVYA 1G7IB 1M7XA 3MUGA 3OJ2C 1BMGA 1K9TA 1UXSB 4IRJB 4KK9C 3DRTB 3LQAH 4NN5C 1EAPA 5C6TL 3HC4H 5FM4A 1P9MA 3BZEA 5BRZB 4LHUG 1FYTD 4OCLC 1RAMA 1S7UA 2GAZB 1MNUH 5F8RC 4TTDD 5MERA 3HZMA 4D9QE 1BJ1J 3LV3A 2QSQA 4ALAL 4YQXL 2I9TA 1UB6B 4YXLL 4I48B 3LD8C 3PHOB 1KC5H 4MZ2A 4KK6D 5J4MA 4I1NB 1PEWA 1EO7A 4XGZB 5L2JB 3ZYJA 4JY4A 1DJSA 6FABL 2XACC 2ZSWB 5BV7L 3BWAA 3DTXA 3HLAA 1X4ZA 3DX9B 4OF7A 4WW1B 1JZ4A 1UCBH 5AWNL 1HCVA 1OCWL 5GGVH 5AZEH 2XKSA 4LEXL 2WBJC 4XI5C 1HH6B 1AGEB 3GSUA 1YZZA 1FVCA 2EIDA 2Z93B 2OSLB 4Z9KB 4KUZH 1BZ7A 5CINH 1DLHA 3TO4A 3WS3B 4QHUA 3SDYL 1ZANL 3CU7A 1DDHB 1I4FB 5SWSB 3G6DH 3HNSH 2I9LB 4NZJA 5E6IB 1Y18A 4U6HB 5BMFH 1FO0B 4U1MB 2G5BA 4JN1L 4RMVA 4XZUB 4UDTB 4QWWC 3K8LA 2D4DA 2R8SL 5BS0D 1JNJA 3WFBL 4OSUL 1YJDH 1Q9WA 2H2PD 3MUGB 1A7PH 2YZ8A 1DUZB 4XC3L 3WHE1 4MJ5A 4FZ8H 3F12A 3NFPB 5MP6H 5IBTH 4IRZH 2E5EA 1FGVL 4LNRB 4JB9L 1MAMH 1BM3L 4ONHB 5I9QB 4IOIB 2R2BB 1S7TB 5DRWB 4Z77B 5K9QI 4X8JA 3RKDD 3H7LA 1QSZA 5E1AA 1XR9A 5FOBB 4WEUD 5IR1B 3KHQA 4HK0B 1NBZA 4HC1L 4MMXC 2RCSH 4NIKB 3VRIA 2FDBP 5DRZA 5HI5D 1T1ZA 3I2CH 1LMKA 1AGFB 4D0CB 1FZJA 4DKEL 3P0YL 4APQC 2UY7A 3HNVL 2CK0L 4LKXA 4PIRF 3BYYA 3QEGL 5JOEA 1CZ8L 1KUMA 1KEGL 4RGNB 4IDLA 4XBEL 1JGDB 4O2EB 4DEPB 4NPYA 5HXMA 1HI6A 1OGAE 3LKRA 3D18B 4O9HL 3F5WB 1ZHBB 3NZHL 5KSAD 3U0PB 3ZDYF 3V6ZB 3PDOB 4NCC2 5I66A 1WZLA 3TIDB 2V5MA 4YXHH 1CL7H 2FD6L 3O6FC 2AJ3A 2CR3A 2DDQH 1ZXQA 1T1YA 3B8YA 4LGPB 3HAEB 3SDCC 1S9KC 1KJ2A 5HVHC 2WP3O 2ZOLB 4KRPC 5C0GB 3HB3D 1YYLH 1FC1A 1VKXB 2JB6B 4HDIB 2ORBL 5FYJU 5LWYH 3CSYB 3SBWC 4OZIB 4GW1B 5IFJA 4KDVA 1E4XH 2A2QT 5DJ0A 3B3IA 3IDMA 1K2DA 4Q9QH 1XGRB 4HQQL 1IARB 1FL6A 4FXKB 1Q38A 1NLBH 1UWEH 3N85H 4ZUVB 1MWAA 1E28A 1U3HD 2N7AA 1KCKA 1IM9D 3QDJA 3OQ3B 1P6FA 3QIWD 5LGJB 5E4EB 2W59A 2QADD 3VXRA 4PGEA 3EO0A 5DYOB 1MQ8A 2O5YH 1BD2D 1ZVSB 4WEBL 3REVA 1PZ5B 5I71B 1FSKB 3QFDB 2VITB 3IVKB 1KG0B 1G7MB 2EDDA 1RJZB 2XFXA 1KPRB 1QFUH 1UM4H 5CSBA 3GSRB 3CSPA 3QWRA 3ECBB 4CW1A 3RVUD 3U48A 5D6DA 3OKKB 2BVPB 4OGXL 4YHOL 5C0BD 1SY6L 5FKAA 4G8FA 2DQCL 4ZUTB 2B1AL 3OXRA 3U83A 4UV7H 4RMRA 3VJ6A 1G7HA 1CU4H 1A4KA 4NQCA 3P30L 4F9LA 4NUJB 3S96A 4BFIB 1U8HA 3QZWA 4ZS7H 1MPAH 1UZ8B 4N1HB 4YWGH 1XZ0A 4YHIB 2X4OB 1JF6A 2IH1B 1DBJL 5J3HD 4U7MA 1I7UA 4KDWA 5IW3A 4UTAH 4QRTB 3ULUC 3OGOE 3SKNB 2C1OB 3GMNB 4N0YL 3HE7A 4LPVA 4XBGB 5I76B 4N9GB 3GMLA 2HT3D 2X89A 5C0EB 1MJ7L 5IB5B 4P5MB 5HHPB 4G6JH 2OP4H 1FNFA 2E7BA 3LHPH 4PRAB 1NFIB 4B53A 2CDGB 4XXCA 4I18A 5J89A 3U36A 4NT6B 5DJ2B 1IMHC 3WEXB 1OM3H 1FAIL 1Z0NA 2E6QA 2PTUA 3PP4H 4MX7B 4Q0XL 5F7EL 3TPKA 2R8SH 1MCKA 3LEXB 1SYVA 5DJXA 1L6XA 5JPMA 2DLEA 5D2LE 1IC1A 3WHXB 1QSFD 2FGWH 3MNWA 5E5MA 2ARJA 4OV5A 4BQBA 3VXRB 4OKDA 4N0FA 1ZLSH 1NCNA 4PR5A 1JPFA 3HPLB 4I3RL 5DUPH 5I71C 2NTFA 4L8SA 1U8KB 1OSPL 1KF9B 2EH8H 2YWYA 4M48L 3OKLB 3GRWA 3C5ZD 1FFRA 4JN2B 4WFFE 3DV4A 1CLZL 4NWTL 1RJYA 3O3AB 3VFGL 1A21A 3MCLL 5F93C 5D1QA 4RZCA 2D3VA 4P3CH 2Z31C 3FFDA 5ALCH 4BH8A 3RVXD 5T3ZH 4GW5B 3RWEB 4L3CB 3BP5A 3I50L 1F97A 1ZT1B 4K3DH 4ONFH 5JQHC 1CZ8H 1LQSR 4RAUB 4X6FB 1BAFL 1RURH 3F7VA 1OARH 5C92A 2HG5B 2APTA 1I3RA 1HXYA 2ERJB 3V6OC 2MQ3A 2EDOA 4O51A 3GHEL 1T0MB 3C2AL 2EDQA 2DQIL 5ILTH 3G5XB 5IT2H 3FT3A 3T3ME 4AT6B 2P44B 4RGNE 5C71A 3G9AB 4NQEA 2HN7B 3IDXL 3L5XH 3GNMH 1R3HB 2VDRH 3DIFA 4XPHL 1K5NB 4F3FA 5T1LB 4MSWB 4ENED 5E7FA 5FYKU 3S36X 3O2DH 3ARGA 3ISWA 3RVVD 3SDAB 1FFPB 3H0TA 5DT1H 1IGYB 3VXSA 2DS4A 1SBSH 2BOBB 3CSYA 4P46D 4M5YL 3MRCA 1KB9J 3KWWB 5SWSA 5C0NC 4HK0A 3V52H 3DSFH 4APQB 2H32B 4KTDL 1CDBA 2ARJB 4OV5B 2D31A 3RWJB 4C56B 3GI9H 1W0WB 3MA9H 1TETH 1W8OA 3ULSA 2LU3A 3GK8L 2OXGA 1D6EA 4V2BA 2WBJD 1ZTXL 4NQEE 3S37L 1EX0A 5DR5H 3VXTB 4OCWH 1OSPH 4MNGB 3MBEC 3AM8C 2A83B 1U8NB 1Q9KB 2UZIL 3UC0H 2JK5A 5CGTA 3P40A 1T66C 3HI1B 3LPWA 4G8GD 5H8DA 4WHYG 2AKRB 2FH6A 1A8JH 4UT7L 2EXYD 2MNUA 2XWTB 3FO9B 2RQ8A 3CUPA 5IIEA 1J8HE 2I24N 3SQOH 4PJAA 4DUVA 3D1MC 4MLIA 4NC1C 3OB0H 2ZOLA 3VRIB 2Y7QB 3RNQA 2N56A 2UYLA 3WDJA 4OF8A 5HHMB 4URTB 4C4KT 1ZHLB 2EXWC 4HF5H 3T4AB 3FFCE 4QHMB 2NX5E 3BE1L 1TTGA 2BNQD 2COQA 4PJ5D 5CFHA 3BWAB 1G0XA 1V05A 4K7PH 5ITBL 2WBJB 1JZ7A 5FA4A 4P46C 4PY7B 3GBNL 4LNRA 3F5WA 3H9HB 4XCEB 5FHAH 4P2OA 3GSQA 4FZEH 5MENE 3QI9D 4KTYA 1W8NA 4BFGA 1U58A 4WJ5B 5F1NA 4LDLB 2CIIA 4K23H 1BOGA 1FNHA 3G6AA 3IFNL 5CSGA 4BUHA 5I1HL 3L3GA 2VLKE 4U1JA 4BZ1L 4NKIH 2AJZA 3LD8B 4JFEB 2SEBA 1FV1A 3QUYD 3QI9B 4QXGL 4N90D 2H2SD 1EO5A 2YA1A 5D8JL 1DSFH 1AR1C 1OAUH 1Q9KA 2DMCA 1OPGH 2VDPH 4YHZL 1ADQH 3ZDZE 5DUBA 1KTLB 5CD5D 3TPUA 2DICA 5CLTA 3T0EB 4XX1E 2YPLD 4IRJC 5LGHL 3QHZH 5IW6A 1NFDB 5DDHA 5GPRA 3RWFB 1YEJH 3QIBC 3WFCL 1MWAL 1ONQB 4YHPA 4F2MA 2J3SA 3MJ8A 1KNOB 3RTQC 1C5BL 4X7TA 3HFMH 3M1BA 4FQJL 1P7QB 3EYFB 3VG0H 1E6OH 4ZFGH 1J1XH 1IFHH 5LQBL 5HDOA 4TUJA 4XP6H 2DRUA 5TDOB 3HZMB 3JBG7 3UJJH 1MCDA 4DAGL 4XT1C 5EWIH 5JA8B 4LRNL 3ILPB 5T1DL 3BEWA 3FQTA 4KPHH 3NBNA 4KHTL 5ISZE 1RULH 5EOTA 3LKNA 4R4BA 3BD4A 4YFEA 5B4MC 3E0GA 3KR3H 4NN7B 3B9KD 3DX9A 5B8CC 3TA3A 5CZXD 5KVGH 3MCLH 4P4KD 1NMCB 4Y4FA 5F7WC 3DSFL 4UDUA 1FO0H 1R5VA 2WW8A 2YPLB 3ARGC 4BFBD 1AP2A 2R2HA 3MZTA 2EZ0D 1D6VH 3QUYC 3QEGH 3MRLA 4IMKC 3V0VB 1JNLH 1UVQB 1XGTA 1P1ZA 3MPCA 1Z9LA 3G6JF 5HHXL 1A4KB 4HK3J 5FHBL 3QJHA 3QT2A 2PYFA 4I9WE 3LQMA 2I60H 3EDFA 2CKBH 5MERB 2EYSA 5KVFH 1LD9B 2V2XA 3WIFB 3U7YL 2QEJA 3QXAA 3KPSD 3TPUB 4P57A 2R39A 5ALBL 1YMMB 3TVMD 3QEQD 3T0AA 3VXSE 3GIZH 1IM3B 3REWB 3SGJC 4JN2A 4XNXL 4P9HH 1KPRA 1IBGH 3G6JB 5I8OH 5F9OH 1CICD 1JRHI 4NRXB 3TWCH 1RJLB 4LCIH 1RVFL 4LPTA 4A6YL 5F3HB 4MCZA 4ZAKB 5DA0B 3FQUA 4V1DE 4MJ5B 4NP4L 3C60C 2FHBA 2HFFA 1XIWC 3V5KB 5BRZE 5F8QC 5I1KH 1JUFA 5BMFL 1NANH 3BEVA 2HKFL 3FQRA 4HIIA 1KBGL 1M71A 5C1MB 1DFBL 2P47B 5F9JA 4HGWA 3GMRA 2YMXH 4NZRL 3TGXA 5D2LA 2F54D 3HC3L 1NFDE 3NFSH 3NCJH 3GSNH 2AI0L 1J1PL 8FABA 3RWIA 1J7VR 3MA7B 2C3VB 3FT4A 3AS3A 1T4KA 3AFLA 1RK1B 2AJVH 5E9DE 1KELH 3KPPA 3I6LE 4MXVE 4K2UL 2XA8L 4NQDD 4L4VB 4HDIA 4MGXA 4CU6A 3ZE1F 3U2SA 1F4YH 2VDPL 2FYYB 3UYPA 3FRPG 3QCVL 5T1MB 3LPGA 4YHMH 3TNMB 3GI8H 1WIPA 3KPRA 3O81A 4WWKD 5D9SB 4ZFZA 3FRPA 5INCB 1T66D 1ZMYA 3A6BH 4LMQE 4LCCC 5D5ME 3B4NA 1F6FB 5T1DH 3RWIB 4LNVA 5GGTL 1MRFL 1IVLA 3QNZA 3TBYA 1KJ3L 1C08A 1KCRL 4DTGL 4YUEH 3X3GL 1HILB 4WFHE 5LQBH 3P9MA 2HLFD 1JRHL 3GMOA 3VXQA 4TPRL 4KROB 4L29A 4P99A 1XGUA 3SCMB 4F8TA 3CZFA 32C2B 1YC8A 3GMPB 3HE6B 5IW1A 5DJYB 2H41A 5GRUH 5F7UA 3HMWL 1FGNL 3CFKB 3UMTA 4WHTB 4K3HA 4KGLA 2VB5A 1F02I 5C0CD 3RZCC 1S7XA 2CKBL 4M7ZB 7FABH 2LU4A 1QSFB 5CEXA 4P49A 1HNFA 4R2GC 1JL8A 3CC5A 1MRCH 3OF6A 5DMYA 4G8GA 1GC1C 4ZFFA 3BKMH 3U1SL 2IADB 1T6WA 4OCRL 3B9KA 1JNLL 2VAAB 1G7JB 1MI5A 3EOBA 4PV9B 5C3TA 1MF2H 3IJYA 3OKEB 4OJFH 1SVCP 5IQ9A 2HLAA 1W72L 2YR3A 4XHQA 1OTTD 3UDWA 2VABB 2VXVH 5KSVB 3CVIH 3P2TA 3QUXC 1I9RL 4Q0XH 2XQYK 1IGIL 3ALPA 3DX6A 5E6ID 1A6UL 3NPSB 4JM2B 3UP1A 1OAKL 4I3GA 1CGUA 4HWUA 3IJSA 1MCNA 3R06B 4O51B 4P5TC 3CZJA 4TUKL 4NQCD 1ED3B 2V5YA 3D48R 5CJ5A 1FRGL 1IEAB 2IBGA 3TBSB 4JPIA 4KRMB 2ENYA 5KSBF 5GS2D 2GKIA 3U2SB 4I0PB 3NPSC 4JM2C 5EB9A 5EULV 4L8SC 4JPKL 3VFPA 5GRXG 4XCNA 3GB7B 2PO6D 1TJIL 5D6CB 5DA4A 3QUXB 4JE4B 3F58L 1I9JL 3DV4B 4XNZC 1JGUH 5CWSA 5C0DB 1U41A 1AR1D 3PWLA 4NOFA 4OZIE 2DBJA 1D6VL 2B5IC 2YPVH 2AEPH 4O2EA 1RUKH 2VDRL 3P4NA 2GTZB 1CDHA 2VSCA 4M7ZC 4PJEB 3SDDB 3UCRA 1UB6A 4OZ4B 1F4XH 5F7HA 4I5BA 3KDMA 4TNWF 4G8GB 1F4WH 4EOWH 5SX4I 2I60L 1ZLWH 3WFHB 4XPBH 3OJVC 4LF3B 5DJZA 3DUSB 1KENL 3G08B 2E8YA 4HGMA 5KTEL 5J7CC 1EMTL 3RGHA 5SX5K 2ICWI 1YNTA 5EBMA 2OL3L 1KIRB 3MRHA 4I18B 4OF6A 3U9UB 2VXTL 4HWNA 3PWPD 4FQQA 1J8KA 4TUOB 3CDGA 1ZT7A 4LVOC 4N0YH 2K7PA 3H9SE 3IU3B 5FUCC 2WMPA 4XP5H 1MRDL 4P4RA 1MHHA 4JY6B 2FGZA 3S98A 5D1XC 5EO9A 3CFDA 2B2XH 3IF1B 4YPGB 3TCLA 5HPMB 2FLRT 2F53D 3L3DB 4Z8FL 4YDJB 2DQFB 2BNRE 2P5ED 4P2CG 4NDMA 4XB8A 4PTTB 3SJVA 5F9OL 1G9NH 4LSTH 1MNUL 1R5VB 3LN4B 4G9DA 2OZ4A 2QQNH 1Z5LB 1J0YA 4CN4A 4QOKA 1IGTB 5EUOE 4M02A 4KVNL 3QUKA 4J1UB 4P23B 4GKNA 3GNML 2JJUA 1D5ZB 2VLKB 2CRMA 1NC4A 4MJ2A 2P8MB 1I1RA 2CXGA 4P2RB 1N64H 4WUKL 1B4JH 1OY3B 1SQ2N 4NWTH 2UVEA 1OAQH 4FS0A 1MRCL 1HDMA 2Y7QA 1YPZE 3MBEA 4HPOH 3S35X 3QXAB 4IRJD 2KDGA 2Z91B 3CMGA 4M48H 2A1WL 4N8VG 3NFNB 4YR6B 3BW9A 1I9JH 4QRQA 1R3KB 4FFVC 4PJGF 3VWKB 3C60B 4ONFL 1Y6MR 5DC4B 2NXYD 4PJAE 1OQXA 2F8XC 1I8KB 2Q8AL 2HWZH 3BH8A 3QR2A 2J6EH 1F3RB 3IDYB 1F90H 3AC0A 4CVXA 1ZA6B 3OBAA 3MLPA 4XBEH 4K07A 1RIHH 5K9KB 3OZ9H 4FQPA 2O61A 3TYGL 3W9EB 5IVZA 4HULB 1MWAB 5BVPH 3WO4C 5EIVA 1I9IL 1W0VB 1A4JA 5T3XH 2HJLB 3QO0A 4IOSD 4XP4H 1OQOA 3V4UH 1FYTB 5EOCJ 1F58L 4U1IB 4XPHH 1HINL 2YXMA 5EUOF 1QSVA 4M3JA 2D2OA 1EJOL 5E9DA 2CD0A 2FX7H 4JKMA 2WINA 1QLEL 4XRCA 1U58B 3BZDA 2WM0A 3QUYB 4PB0H 4WJ5A 1U93A 2C1OA 2OL3H 2QSCL 3V5KA 3B6SA 1KCUL 3FL7A