4EOWL

Crystal structure of a disease-associated anti-human gm-csf autoantibody mb007
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
211
Chain Sequence
SVLTQPPSASGTPGQSVNISCSGSSSNIGNSYVYWYQQLPGTAPKLLIYRNNRRPSGVPDRFSGSKSDTSASLAISGLRSEDEADYYCATWDDSLSGRLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MB007 human IgG1 Fab fragment heavy chain
publication title Molecular structure of human GM-CSF in complex with a disease-associated anti-human GM-CSF autoantibody and its potential biological implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowL01
4HCRA 2A6JB 4KUZH 1KULA 2DM4A 2J8UF 2R15A 5D7JA 5HJ3B 2EXWD 5CZVL 4CJ1A 3KHQA 1T1XA 3TM6A 3UTZA 1JI1A 2QADD 3D9AH 1HNGA 1V3LA 3MLSH 1H8OA 1KG0B 4I9WE 4QY8A 2DD8H 1CLYL 4QXTB 4JG0H 2H1PH 3I6KA 4W81A 4F7EA 1AHWB 5ETUB 3WEXB 1EMTH 3B9KD 1R3HB 3LD8C 3QG7L 1B4JH 4L9LB 1H5BB 1FNGA 2YA0A 1DQML 4N1EA 2X7LB 4FZ8L 2GEEA 3I3EA 4E41B 2B39A 4OCXH 2P1YA 2AJXH 1RZKH 3ARGA 1A02N 4ZFOB 4CMHC 1E4KA 5FOBA 3V5HA 1LK3L 1JE6A 3RWHA 4WWKC 2PR4H 2FZ3B 4OF0A 3O81A 2LTQB 3PHQB 1Y18B 4Y16C 4ZMAT 4OGAD 4JM2C 1QRKA 3ARXA 4NQEA 4X6EA 3W39A 3I84A 5I1JL 4UT9L 2YUXA 4U1SA 4P49A 4NWUL 5DQJB 1I7ZA 2AGJL 3L3OA 2E7MA 3MRBA 1F3DJ 1IT9H 4PRDB 4JRYB 5EU4B 1WCBB 4CN6A 4D8PA 1UA6H 3QULA 3QJFA 1KIRB 4K3JH 4XH2A 4YHMH 3JBG7 4OKVA 4I0KA 1CLZH 3ZLQC 3OKYA 4XNXL 2MHAA 4G42A 1I3RA 1T7XA 1MREH 3JV4A 5I73C 5J1AB 2WUBH 1G7JB 2FJFB 2X4UB 4K94C 5KVEL 2A6IB 2A74B 1MOEA 5EBMA 5KTEH 1GC1H 1GAFL 3RU8H 1G7QA 3UYPA 1VERA 4CDHA 3FAXA 1UB6B 4AH2B 2RQ8A 3DGGB 4HUXB 1QLFB 1J10A 3MNWB 2EXYD 1Q0XH 3LKQA 4M6NH 1UJ3C 3NIGE 4NZRH 1IGIL 5DUBB 4Y0GA 2ED7A 4J3VA 3MRFB 5E8PB 3FCTB 4RX4A 1FVCB 2E6PA 4NQEE 3QQ9C 3UJJL 2HP4A 5I17A 4MNHA 4S1DD 3LY6A 3SKUD 3EO9L 1QEWB 3BOVA 1REIA 5DJ0A 2IANA 3QCUH 4GKSB 2ADFL 4OLVH 1XR9A 3NFPA 2GW5A 5I1HH 2GY7B 4GBXA 3QFDB 3X11B 4FFWC 5KSAC 3WXWL 5JOFB 2AXHA 4QHKJ 4K3DH 3V4PH 1CFVH 4RWYL 1G7LA 3TBSB 4KKCC 4ZD3L 3HMWL 4BZ2L 3BFOA 4PGCB 4NO0B 1JGEA 1AI1H 1X5LA 3GHEL 3PQYA 3MCG1 4QHNA 2CIKA 2NZ9C 3HAEG 1FIEA 4N1HB 3SPVA 4WTZA 4ZNCD 1MJ7L 4MB3A 5DMYA 2WIIA 2GJ6B 1MAML 5GHWH 5C0BB 5BRZB 4G6FB 1YPZF 2KBGA 4CJ0A 4M7ZC 1U8NA 2VL5B 2JIXD 4JM2B 3C09B 2IANE 4KKBD 4ZDHB 1BEYL 1AFVH 2AJUL 1MF2H 2Q8BL 1OTTD 4GKOA 4N0UB 5C0GA 5KW9L 3CUPB 4KFZC 5CINH 5HYSG 2XN9B 5D2NA 4G8EB 3CSYB 2PUQT 3BN3B 5DMIL 1D9KB 3VXSD 5DJ2A 4F2MB 3ARDB 1IFHH 3VXMA 1T0MA 3MV7E 3QFJB 4S1SH 4PJCA 5D6DC 3NIFF 1J8HA 4RZCA 1IGCH 3L9RA 5I73B 4R7NA 4FNLL 3PQYE 5L9DL 4OI8A 1AR1D 4RISL 5F9DC 3SGDI 4UOW1 2OP4H 4LCWD 2VRAA 4CU6A 1E6OL 1LP9E 5F96L 4H25A 5E2WH 1HQ4A 3GSVA 4PG9B 2F74A 3V5DB 4JFOA 1OF2A 1MFBL 4ODSL 2VLRD 3H6JA 2YXFA 4WO4A 4DUVA 1MCJA 1QQDB 2IG2H 3C5JA 4HS8L 5MEOA 2F5BL 3P73B 4DZBB 2OK0L 4PRIB 3V6FB 3H3KA 4IRZH 3T2NH 2ZCHH 3IDXH 5GJTL 2JJVA 2XQBL 4KVNL 5FKAA 4G7VL 3JV0A 5FIEA 1UGNA 5I8EB 1HILA 5DJAA 4POZD 3CZJA 2Y07L 1KJ2H 1KSRA 1WZKA 3C6SB 1B88A 2Z9TA 1BZ7B 1EX0A 4NN7B 5D2NE 3EFFB 3MC0A 1NCUA 3VGGA 3L6FA 4TUJA 4J6RL 4BH8B 1OW0C 4TRPH 3SE8L 5LXGH 5DYOB 1KJVA 2OTUA 1E4JA 2EH8L 3VXME 5DD0H 2K1MA 1DUZB 4UIMA 3MYZA 1NMAH 4PJCE 1S7QB 4MJ6A 1U8LB 2CKBB 4IRJC 4JAMB 4N1CA 4WI6A 3W0WB 1VFBA 2JK5A 3NFNA 2J8HA 4Y5XC 3KPMA 4UAOB 1RSFA 8FABA 3VXRA 1UM4L 3ZE2E 2YA1A 4LVNC 3O9WD 3MRRA 5ECJE 3QEQD 5E1AA 3D85A 4XCFL 4ZOAA 4KMQA 4XNQB 4NRXB 5FGRA 4BFIA 1KXVC 1Y6MR 3DRQA 4PB0H 1RIHH 5IV2B 4M62L 4X99B 5ENWB 2YPVH 1WEJL 1IQWL 1INQB 2V7NA 1H0DA 1JHKL 1CF8L 3B4NA 1U3HC 3BHBA 5ESQA 3TZVD 5J56B 5ESVB 3P9LA 5DS8B 3QHTC 1OP5K 4OQTA 3LN9A 1KGCD 4B5EA 1UVQA 1U8IA 1INEH 1XEDA 1RK0B 2HVJB 1JYWA 1MCIA 2BZDA 3HAEB 4GRWB 1OGAA 4HWBA 4H5SA 4NQCB 4PRNB 3UCRA 3AGVA 35C8H 2UWEA 1N6QL 3SO3C 4XBEL 1QFPA 1QP1A 4NC1C 3EJZC 2PTVA 4Z0XB 2F9BT 4HQQL 4M9OA 3D0VB 3TPUB 3L5XH 3O2WH 3RVVD 5I18L 4K3EH 3TIEA 1S7RA 3N50A 3QXTA 4JQVA 1NAKL 1RJCA 3KXFA 4URTB 2DWDA 1U92B 5HYSB 1KCSL 1FG2B 2FIKA 1QR1A 3BYTA 1DLHB 3A67L 5CEXA 4POYA 1UQSA 1DR9A 3OPZH 1DBML 1S7VB 3DGCR 1T0NA 3RZCA 1KIQB 4ZO7A 1NAMH 4P3CL 2R1XB 4RAUB 4KTYA 4HD9A 1F4AA 3S34H 1T1WA 3NCBB 1JRHI 4WV1A 2Z31D 3WLWD 1MCCA 3RY6A 1KENH 2CR6A 3LVEA 4WGVB 1N7MH 4P9ML 1TDQA 4F15B 3OGOE 1YECH 1FNSH 5CCKH 1B6UA 1OGAE 1QUNA 3SDCB 1XGTB 3TA3D 4J4PD 5C2BL 1QLEL 4I5BB 2DJSA 2UWEE 4KUCF 4PRPB 4OCYL 3QIWC 3E6FA 4PJDA 3Q5TA 4ODTH 3S97C 3DYOA 4ZUWB 1M7DA 5IR1B 2LU7A 2DQTL 5C0IA 4P4KC 1TVHB 5T1LD 3RWDA 1P5UA 2VR5A 4P46A 1U3YA 3DSFH 3LQZA 2ZG1A 1YC7A 1A7NH 4Y2OA 5EZJA 3FB5B 1T03L 1NCAL 1P7KB 4IOFD 3QUYB 5IP4A 1SM3L 2XTJB 3K2MC 4KJQC 4XTRC 1PJ9A 5CUSH 3IAPA 3HI5L 1VSCA 4MZ3A 5HGBA 2VDKL 3MJ8B 4UTAH 4QGTA 3BKCL 2Q7YB 1EO7A 2H3NA 3DX8A 3GKWL 1OLLA 4G43B 4NKIH 1KC5H 1X7QB 2DJ4A 2E7LC 4LCYB 2ORBL 4RFOH 4P2QB 4XPAH 4O9HH 4XCNA 4NQVA 2AI0H 1U3HB 4MXWL 1XFPA 1ETZA 5ESAA 2AXJA 5D93B 1R3IH 3HB3D 4IOSD 3DO7A 1FCGA 2DM2A 4HKBB 4JFZL 4P9HC 2AV7A 4LEOA 1UYWH 1KCVH 3MRDA 4DZ8A 4YPJA 2EZ0D 2XZQH 1CICA 2ADGB 4PJIB 2ZP0T 4PJDE 3NTCL 2CDGA 4ODHL 1YMMB 4MJ5B 4Y16A 1MIML 4ZQKB 5KVDH 1O0VA 1HXMB 4LPCA 3BQUB 3CVHH 4FTVA 3OF6D 4D3CL 4YHKH 1FGVL 4XAWH 1F11B 4DVBB 4LU5H 4OF6A 2APFA 4PJIF 5DUMH 3MRGB 2FX7L 3S36X 3UTSD 1H8NA 4ONHB 3MO1B 2AERT 4XMLL 3MUZ1 2IAMB 4X9IA 5HXMA 1Z9LA 5HYQB 1HXYA 3CFEA 4MCZB 4HUUA 1FNLA 3QUXB 3BWAB 4NUGH 4OB5L 4C83A 1QFHA 1DCLA 2F19L 4RGNE 3ZTJH 3T0EA 3U79A 2EDLA 1DN2A 1IC4H 5HHQB 4JZOB 4FHBD 3IFLH 5E00B 5IEKA 2OR8A 4Y2DA 1K8DB 5JQHC 3BJLA 3O3BB 1JPST 1I4FB 1UJ3A 4OGYL 3ZDXE 4L4VB 4ZFFB 1YMHA 2X44D 1CI5A 2DAVA 3G6DH 2V2TA 5F70A 3VW3H 2YBRB 1RHFA 4FTVE 5BV7H 3GHBH 2BXYA 3P4MB 4M7LL 3PDDA 4FP8H 4X98B 3ZDZE 2JCCB 1N3NB 3K81A 3RWCB 5HY9B 2OI9C 3OZ9H 4XGZA 1YY9C 1ZT7B 4GG8A 4CW1B 4NCC2 1FNHA 4WI7A 3CIQA 2YPKA 4E0RA 2BRQA 2R2EA 1WZLA 4XPGL 2Y06H 4HJJH 1CQYA 1XGPB 4NQDD 3WNKA 5LQBH 3HPJA 4M7JL 4OM0H 5D70L 1NDMB 4M1CD 3ULVC 5BZWB 5K9KA 3G5YA 2JCCF 4OIIH 2X42A 2AJSH 1Q9OA 5FECA 1U8PB 2KZWA 5DFTA 2X1XR 3L95A 1H3PL 3T0EE 5D7KE 3MMEA 2GK2A 4MA8H 2X4SB 3D2UD 3LKRB 1MQKL 4XZUA 4PLKC 5C3TA 4XCCH 2C7UB 4QYOB 1AGDA 2QQNH 4I18C 5I30L 1IAMA 4X7TB 4NNPL 3V5KB 1TJIH 4YLQT 3QA3A 2QTEA 4FQLH 2EYSB 3RWFA 4EI5C 1DUYB 5FB8B 3KPOB 1FFRA 4NGHL 2PXYD 5CSGA 2HVKB 4X6BA 4N0FB 3TCLB 3VJ6A 1BFTA 4C56D 2Z92B 3VFNB 3NA9L 2W0LA 4AL8L 2FLBT 3LV3A 4NP4L 3UEZA 5CHNA 1C16A 3L3HB 5F7LB 2ATKB 3CPLB 3N1PC 2BY2A 3GMQB 1RZ7H 1I8IB 2W9EL 3CFIC 4FFZL 1HH9A 1RULH 3TBTB 3IFPA 9CGTA 2VLKD 4PJ5B 2DN7A 2OQJA 4M1GL 5D9SB 3TWCL 2IFFH 2B4CC 3TESA 3U46B 5HDLA 1MCNA 2EDFA 1QOKA 1MCOL 2K7QA 3ZYJA 3QPQC 1B0GB 1ZEAH 1Z6JT 2DDQH 1U91B 3RVWD 3DO3A 3GJFA 3LN5A 3AS0A 4ISVB 1TTUA 2BMKB 3TH2T 2A6KB 2ZKHH 4H8WC 5DZNA 3SDAB 4GW1A 2VITB 4IRSD 1RUKH 4PJ9C 2WIMA 4PP1C 3MBXL 5CJOH 5FYKE 1O7VA 3JTTA 2WV3A 2E3VA 3QDMA 2VN4A 2X70A 1HCVA 1KBGH 3MLTB 2DM3A 3T3PF 3KPRB 1OAKH 1G6RH 1KTDA 3LQAH 5C07B 1Z9OA 4UBDD 4JE4B 4WHCA 1CGTA 1TQBB 1VDGA 1DSFH 2ID5A 4YFLF 3U4EB 5HGDA 1MLCA 3B5TA 3BPNC 5L2KB 4LRNH 1D5IL 43C9A 5B38G 5HHOD 3UC0H 4CVUA 1J9CT 1RJZA 5BJTB 1VPOL 1G9ML 1DVFC 4ONFL 4HJ0C 4NN6B 1CFSA 2AJYH 2HTKC 2V17L 4IRJA 3RTQB 1ZWIB 2ZSWA 2DLHA 3O0RL 2CIIB 3ALXA 1FIGL 2BNRB 2FWOA 1TZHA 4Y5XA 4P2RB 4YXLH 3ZL4H 5CEZE 1MHEB 3G6JB 3NIDF 1IGJA 3CFDA 5CMAA 2EDQA 5BXFA 2Z91A 5CJBA 4U1LA 3V6ZB 4R97C 5DURB 3G5XA 1S9YA 4DVRL 3HRPA 2BFVH 1BJ1H 1WBZB 2X10A 3QDME 5EWIL 4UINH 4EXKA 1F4YL 2JB5L 3V79C 3D5OF 4OD3L 2GKIA 3MRJB 1BWMA 2WBJA 1SJHA 2R2BB 3LB6D 2Y6SD 4OLEA 4DKFH 4KGJA 1LEIA 2VXTL 1A7RL 4NOBA 4FZEH 5ALCL 4P0DA 4NC2B 4I4WB 3D39B 1NGXB 4DEPC 3PABA 1IRAY 1MHPH 1B0RA 4MXQD 3ECBB 1CG9A 3MACL 1MNUL 5IB5A 3QCTH 3QIUC 3UTTA 5CSZB 1YEKH 3VI3F 4HS3B 1CD0A 2ENYA 1F4WL 5DEGA 5FOJA 5CZVH 2SEBB 1DFBL 1W8OA 5TE4L 3ARFC 3Q0HA 1WWWX 5JA9A 5IGXH 4YWGH 3I50L 1F8TH 3HNVH 4OCSL 4ETQA 1CGVA 1MHHA 3MFFB 3DUSB 4M61A 1E28A 3ULUF 2CMRH 3MRNA 5AUMA 1FNFA 1CLYH 3FOLA 4XNZC 1XH3A 4NQED 3V4VH 5SV4A 4M93C 2DQHH 4KH2A 3BP7A 2EKJA 1RZIA 3QG7H 4HS6B 5MERB 2P8LA 4NHUA 1DQMH 4WW2B 5GRJL 3HC3H 1J87A 1CFQA 2FEEL 4H1LG 1M7IA 1K2DA 4XP6H 1A6AB 3IJYA 5ERWB 5GS1C 3ISWA 5C6TL 2YMXL 4HF5H 3K2UL 4X4MA 3R4DA 5FA3B 1IEHA 2IPUK 5GGTH 4P5KB 5ACLA 2ZOKB 3KLAA 5CIPB 1ZLSL 1CTNA 2HTLD 3SE9H 4N5UA 4OLUL 3RWGB 4JM4L 4Y89A 4WW2F 1FDLL 4M5YL 3UTTE 3VU2A 2CRZA 3QSKB 3W9DA 4RFNC 4NWUH 4P23C 3QIWA 2EC9T 4NC1E 3MUJA 4NNXA 5T1KB 4AM0A 3ESUF 1E27A 1EXUB 5C3LD 1W72L 1CGUA 3QDJD 2R2HA 1GOHA 4P57B 3VMNA 2YEZB 1C5DA 5B38B 1XR8A 2EH7L 2WBWB 4PRAB 1G9NC 5F9OH 2GJJA 4OM1H 5KVEH 2X9YA 4EUPH 5JPMA 5TQ0H 1M05B 3OJVC 2QR0B 3ILQD 5KG9B 4X4ME 2FYYB 1CFNB 3MCKA 5DWUL 2FL5A 5GZOC 1WCQA 3RKDC 4OGXH 2B2XL 3ARYA 2H2SD 4ZUVB 4D0DA 4PRBB 3HR5A 1UCBL 2QEJA 4FQXD 5CJQL 4HXAL 4XX1G 3WFBL 3MV7D 1EUTA 3KPPA 1T04A 3UJJH 1U9KA 3PQYD 3EO9H 2AK4B 3A6CL 1FC2D 5CZKA 1S7XB 5LGKA 4V1DD 5DR5L 3T0BA 4BQBA 3LPFA 4YK4B 2VKXA 4WI9A 4LPUA 4LKCB 3M17A 3V7AG 2BVOA 5BQ7B 3ZE1E 5I1LA 2AEQL 1BFOB 1IC7H 1BX2B 1WQVT 3MLVL 1XCTB 3NH7L 3TNNB 4TSBL 3WXWH 4XPBL 2PF6A 4L3ED 1JWUB 5E2UL 5JXEC 3S35L 2YR3A 4JFFB 4ZD3H 1S7SA 2X9XA 4MJIB 2Z35B 1CZ8H 3MXVH 3PWLB 2V5SA 1ZA6B 3LS5H 1DLFL 5ELIA 1WFTA 4K8RC 4QLRA 4UILL 2DMBA 4OZ4A 1ZLUH 1Y6NR 2DIJA 1MJ7H 3L5HA 5H2BB 4NSKB 2VE6B 4MD0A 1CN4A 4GXVH 2VABB 3CFJB 4NZUL 1MWAB 2OSLA 4DKDC 2EICA 4JKMA 3OKNA 2F58L 3WSQL 3U6RB 4Q7DA 3VRLE 2R8SL 5EC2B 3JWNC 3C9NB 4J2XA 1YEDB 1BD2A 2AJUH 3SKOB 2Q8BH 2H32A 4O51B 4Z7VB 1IM9A 3EBAA 4U2YA 2YD1A 4I77L 4LHUD 3LKSB 5T1DH 5L2JA 1CDGA 3FB6A 4H1LB 4HX1A 4ZFZB 4WO4D 3W9EB 2AJ3A 5DMIH 1ZVSA 2VAAA 4RDQG 3VGFA 2PYFA 2ZUVA 2BVQB 4ZPVB 3PWJA 5HI3D 4OF7A 4LSSH 3V7MA 3HLAA 5FDYA 4YHPB 4EOWL 4XC3H 3OV6A 3TF7C 5D1QD 3WMSA 2E27H 4Y1AA 5TQ2L 1BPVA 1CT8B 2B1AH 4RGMB 5E1HB 1P84K 1N5YH 5DT1L 5F96H 2WP3T 4JFXA 4BQ8A 5ITBL 3LEXB 3WIIL 1RI8A 2NTFA 2GSIB 4LBEA 5F7DA 5IHZA 1X4YA 4HS8H 4D9LL 1ZHNA 2OK0H 4HUVB 3FQUB 1A3RL 4JPVH 3B3IB 4KROB 2XQBH 2D31A 4S1QH 1ACYH 4MA1C 4ERSL 3O2DA 2XNAB 1NGYB 3HFMH 2ITCB 3BPCB 4EI5A 5HGGS 3SDDC 5F9AC 2C4XA 4J6RH 3DETD 4MX7B 3SE8H 5SWSA 5JIPA 2C1PB 2FHBA 3VFVA 3BE1H 3NCEB 4OF8A 5F1NA 2OL3B 4ZPTA 2YSSA 2NYYD 3GI9L 4E41D 4JPIA 3BKML 3LDBC 1HHIA 5HI4D 4DFHA 1SEBA 3O8XC 4LAQH 1ZAGA 2ICCA 1NBZA 4JFPA 3ULVE 3KJ4B 2OZ4A 2OYPA 1JNNL 4Y1AE 4KRPD 1KCUL 3SCMD 4WNQB 4QF1A 4DCQB 2AXFB 4OAWA 1A22B 2ADJA 2JJSA 4MNGA 5JO5B 5JHLH 4P2OD 4X0KB 4TULH 5H94A 1FO0L 3PE9A 3IAQA 3P77A 1EGJL 3LH2H 1OGAD 3VDCA 3GBNL 3WUZA 4GW4B 2QKIB 1WBXB 3QO0B 2X5PA 1BM3L 4TYUA 1CE1H 3M1BB 1WWAX 4YX2L 3BXNA 4M62H 4JY4A 4QOKA 2ZCKL 1NUNB 4RCAA 1AR2A 4YIQA 5BVPH 4MB4A 1BBJB 1Q72H 1A6VL 1C08A 3BP6A 3KYAA 2QQKL 5GS2D 4X4XB 3PWPA 2I24N 2GJZA 3GSUB 1C1EH 4LAJH 3UPRB 3QQ4A 4L4TB 3KJ6L 4LLQB 1KTLB 4G3YL 2VJXA 5SWSE 1PG7H 3NN8B 3GBLA 4FQQA 4RMVA 4YHZH 3UZEA 2BOBA 3IF1B 2ZUWA 4R6UA 4AT6A 3GMRA 1S9XB 3MZGB 2XKNA 4ORZC 4EN3C 3DXAD 1ES0B 3D0LB 1N64L 1EEQA 3QUMH 1PAMA 3DIFA 1N6QH 1JK8B 4XBEH 2ERJB 2XA8L 2B5IC 3L3KA 1U93B 2NW3A 1JNHA 4FQJL 4Y8DC 4JPKL 2HFEB 2FHFA 4K55A 1ZHKA 2VDOL 4WFFE 3OR6B 4E42A 2AJVH 4LCIL 2O5YH 1UENA 2LABA 4WHTA 3NAAH 4JRXB 1EFXD 5DRWB 3QEUA 2ESVA 2OJEB 2DI8A 4N0YH 5D8JL 3RA7L 1JWSB 4QOKE 3TJEH 1NC4D 4M00A 1Z2KA 1KB5H 4Q6YA 1UG9A 2UVFA 5E8NB 5IVXA 2XZZA 4G9DA 5F9WB 3VCLB 1L0YA 3RVXC 1RUPH 2Q20A 4YXHH 4YPGA 3L7FB 4LSRH 3BZ4B 2CDFB 2W92A 3OJDB 4J3SA 4UNVA 2MCPL 4OFVA 3D6GA 3PP3K 3E0GA 1ZT1B 5CJXC 3T0DA 3D1MC 1OAUL 2MWCA 4RDQF 4PUBL 2NLJA 4KKLC 2C3VA 4PJEF 4XVTL 1QPXA 4OCYH 5E8EB 1VADB 2X4RA 4L8CA 5CEZL 2FATL 1F3JA 4Q0XH 2R4RL 2X1QA 5EC1B 3C08L 1VKXA 1LO4H 1GOGA 4BSJA 4EKXA 2NW2B 1TVDA 1VGKA 4LOUD 4XXDA 1MHCA 1PDKA 4WTWA 2XKSA 5DVOA 5EO9A 4YHIB 4S10A 5I1GL 3VXPB 2HJFA 2IBZY 4WWKD 3E8UL 3O3DB 3WUWA 3DHJA 4JCLA 1XF2B 1OT1A 5E56A 4JM2D 1FAKT 2FNBA 1NFIA 2GSGA 4F7CA 3TO2A 1H15B 1XF3B 5DI8B 4FTVD 5IVXE 1YDPA 2VUYA 4R7DA 4HG4K 2XN9D 2VZOA 2DQIL 4WTXA 1FYHB 5IB4A 3OKMB 2W9DL 3C5ZC 1WTGT 4U3HA 3PV6B 5MEPB 5GS1A 2BNQA 3B83A 4J3WA 2Q8AL 4KV5E 1S3KH 1X5GA 3QFJD 2OCFD 1NSNH 2GT9A 4FXGA 5BS0B 4LSVL 1JJUA 4UUJA 1TETL 1L6ZA 1MFDH 5DDHA 3V52L 1WZMA 4U49A 1V5JA 3RVUC 5C0FB 5K9QI 3L7EA 1HEZB 4NQSA 5GRXG 4Z5RA 3RGVB 1IKFH 3CH8A 3QUZB 4M02A 4W6WB 4UDTA 1WAAF 3PNWB 3PHOB 1FH5H 3DUUA 4XRCB 3AUVA 4TOYH 3WHE0 1NANI 2XWTA 3MNVA 1A2YB 5GRYA 4HULB 4GMTL 3QXWA 3PIQA 1OAZH 1FL6B 1AP2B 3O6KH 5T33H 3QQ9D 1Q1JH 4GKNB 4HLJA 1V7NL 3FHQA 5KAQG 4OV6F 1E4WL 2DQUL 3SDXA 4C55A 5SX5H 4M3KB 2F19H 1AC0A 3VXOB 2JJUA 5FM5O 3MLZL 3KWWB 4I3SL 2BNQE 2VZ1A 5BMFH 4MHHI 3NACH 1MQ8A 4HCRH 1UEMA 3CZFA 3MJGX 4GAJH 3U30C 1CXEA 1ZGLA 1HKLH 1ZSDA 3QO1B 1RURL 1U2CA 4FFWD 5KSAD 1VHPA 1YN6A 3OWEA 2BVEA 1X5XA 3ZYOA 3W0WD 4KKCD 2V5RA 5HVHB 5HBBA 4LCUA 3MLWH 1FZMA 4TUKL 1I9EA 3QXVA 5DHXB 5C08B 1GPOH 1I7TA 5L7XH 1A64A 2NZ9D 5IFHH 5D7SH 4Y19A 1XIWC 1GSMA 4XPGH 1IAIL 4DOHB 4NT6A 1X3DA 4LK4A 3RAJH 4GG6B 5D6CA 4JPWH 5GGQL 1JTPA 2F15A 3SGKC 2RFXB 5D5MF 4U33A 3WFDL 5ICZB 3HCVA 3SDXE 2LV4A 3QUKA 3DI3B 4OD1H 3P40A 3KYNA 3BSZL 1BAFL 4U6HB 1HZHH 1U58B 3FB8A 3SDYH 4YHYB 2G5RA 1FV1B 2XACC 3IU4L 4GG6F 3C5ZB 4NQCD 2KL6A 4K7PY 4OT1L 2MQ0A 1P7QA 1T4KA 4DFIA 4GUPB 4NQUA 2J5LB 1HN1A 3VFSA 2E7CA 5IQ9B 1NEUA 1T3FA 3H7BB 1XGRA 4F58H 1HSBA 3QXDA 2X09A 3LSOB 2J8UA 4ZS6C 1YEJL 5DC0A 1CDUA 4NGHH 3B6SA 1A8JH 4R8WL 1E4XL 3RIFF 3MJ6A 2I60L 4XVUD 1WWBX 2EDKA 5ANMB 3VE0A 1MCPL 2A83B 4HAGA 1I1FA 1EAPB 1JZ5A 4OIBA 4AL8H 3QDMD 3P9MA 5TE7H 5GS0L 1KN2L 3IXAB 1FNEB 2EIZB 4HZAA 5F7WC 3JUZA 1YEFL 1MFNA 4NN5B 5E99L 4OJFH 5HJ3A 5IK3B 2APVA 5J6HB 4KDWA 4MZ2A 4M1GH 3MV8B 3P4LA 3ZSTA 1MRCL 4BFBD 3P0VH 4I48B 1KG0A 3AY4C 3ZDYF 2Y25A 1Q8MA 2E9IA 3IKCB 5I71B 2APBA 2MPAL 3CJJA 4U1JA 3BH8B 5DK0B 1TXKA 2NZIA 4PRPD 1AHWA 5ETUA 4PJXA 3WEXA 1R3HA 5I1IL 4L9LA 2NNAB 4FXLA 1SEQL 5KANI 5EO0A 3O2VH 5H35A 2F8OA 4YHOH 4GO6B 3VH8G 3BGFC 4ZFOA 4W6XB 3REVB 2VXQL 4ZUUB 1AE6L 43CAB 4JFQB 2R23A 5F7YC 3V4UH 5JDSB 3PHQA 3R0MA 1Y18A 4XNYH 2NY5L 1A4KA 3VFTB 5JW4R 1KT2A 1NUGA 4DWHA 1VPOH 5M94B 5E03A 1G9MH 3TO4B 1AGFB 4I3RL 4Y88A 4KTDL 5F44A 5B21A 3FQWB 4FFYL 4P2QD 4PTUB 5J11B 3WFCH 1U3HD 2V17H 3EOBB 5FYJL 4HT1L 2P42B 4PRDA 4JRYA 5KVGL 1CGYA 4O58L 3IDUA 1FIGH 1U42A 2NY7H 1K4CB 3TC9A 4PJXE 3VWKB 1YMMD 2ZUYA 4QHLB 4DVRH 4PGEA 2FJFA 2WLZA 5EWIH 2Q6WB 2A6IA 2A74A 1F4YH 4NO5B 2DQJL 4LHQB 5EIVA 1Q9WB 1UB6A 4AH2A 3ZHLA 1KJ2B 2VXTH 4NJAH 1X5KA 5I0ZA 2F53A 4IOIB 5DUBA 3F7YA 3FL7A 2FO4B 3MRFA 5E8PA 1FVCA 4H26A 1U3ZA 4HPOL 1YNLH 5D2LB 5BZDB 2AKRA 4LSUL 4DW2L 1KFAH 3HZYB 1F4WH 3DSNA 3CLFH 4JRYE 1DFBH 1QKZH 1K85A 3I50H 4MS8C 1UCTA 2EYTA 5DFVC 3BKJH 3X11A 4LDLB 4F7PA 1LE9B 5FFLA 2XIDA 3EGSB 5D2LF 1WFOA 4M43L 4EEEA 12E8L 3BW9B 4L4VD 4GRLB 4CNIB 3CFBA 1S9KC 3ULSA 4OLXL 4GMSL 2PETA 1YPZA 2E8ZA 1UWXK 3BDBA 1J5OH 3V6BR 1AGCA 1N8ZB 1CR9H 4PGCA 1H3TA 4HIXL 2LVCA 4P4KD 3VFPA 5EPMA 3OAUL 5K59F 5FK9A 4WW1A 1RUML 3MOBH 3U4AA 5C6TH 2XPGB 1LK2B 1AY1L 2GITA 4NNYA 2F53E 3LEVL 1FFNB 1M71A 1JGVL 3GSXB 1ZLSH 5J12B 5BRZA 5C0BA 4RMRA 4KJQD 4XTRD 4M7KH 4DN4L 4JM4H 4JFHE 3ESVF 2X40A 3K3QA 3OKEA 1KEML 1NGWA 5ACZB 3WE6B 4RFEA 5CJXA 1JI2A 3CFKA 5IJVB 2VIRA 4Y4KC 5KS9E 3FQRB 1RZJH 3NPZB 3ZTJG 3KS0J 5E7FA 2OBGA 3EFDL 1M6OB 1T66C 3O6FA 4OLYH 2IH1B 3AMKA 4KZDL 5F97E 3ARWA 3ARZA 5F9JA 1JV5A 3G6AB 4G8EA 5JOPE 2JJTA 4JFYB 3VH8B 1D9KA 1IQDA 3TJHC 1HQRB 1I9RL 4F2MA 4GQ9H 3ARDA 1FP5A 1SYVA 5EBWB 2QQQA 3PGDB 5TPWH 1PSKL 4OQTH 1YPZE 3GSQB 4MD5B 2Z93B 1ODAA 3ARPA 1BOGB 2EH7H 4MJ2A 2L4OA 4XP5H 2UYLB 4R90L 3HC0B 3DMMB 4FXKB 3MRMA 4Z7NE 4JHAH 4QRQB 1OGTB 4HWBH 3NMEA 3LCYA 1S7UB 1Z5LB 1VB9A 4F3FB 3VWJC 3ARBB 5HDBF 1G7HB 4HIEB 5ICYA 7FABL 4LKXA 4PG9A 3V5DA 2BJML 4ELMB 2B2XH 4X6CB 5C0BE 4YNYA 4L8SC 2FSEB 1UCBH 4L1DA 5CJQH 3OB8A 3STBA 2WUCL 1HI6A 4N9GA 5CILL 3V6FA 3LMJH 5EN2A 1JNLH 3L3GA 4PJ5D 3DV4B 5I8EA 1N6UA 1A21A 4XBPA 4EDWL 3VGAB 1LILA 3VI4F 3M8OL 5KSBB 3C6SA 4ELMF 3GSNA 4X6CF 2ATPB 1J05A 1HOCA 3G04B 1KJ3H 1ZMYA 4G6JL 4O2CB 1ULVA 3RY5A 2FR4B 3DTXA 5DYOA 1CXIA 4KPHL 4OV5B 3HNSL 4CRPA 3NH7H 1IGMH 3SQBA 2VZTA 4TVPE 1U8LA 3QNYA 5DZLA 4LL9A 2KQNA 2DWEB 1R3JA 5ICXA 1BQLL 5KSBF 5IMOA 3KPRD 3C6LC 3L3IA 3MGAA 3H9SD 2PO6C 1Z9MA 1YQVL 1HHHB 1X4ZA 3NCYP 1BVZA 1OWRM 2YWZA 1YY9D 5L2KD 1Y0LB 4OZFA 4MD4A 2QSCH 4Z0BL 2BC4B 5D7IB 2C26A 1MJJA 4LEXL 4YHNB 5IIEA 1JL8A 2AEPL 5FKPB 5E4EC 2RB8A 3IT8D 4NYLB 5D1XC 5AZEH 5T3XE 1G7IA 3ULVD 1NBVH 1WBYB 2R8SH 1QD0A 4YO0B 3E1F1 4KMLB 4OZGB 5DMKB 5D7IF 4G8GB 1ZANL 5TGBA 4K7PL 4NDMA 1KEGL 3CVHB 4WIQA 5A16B 4K71C 3DARA 4HC1A 5ISZB 4LLAA 3HAEA 4U6XB 5E9DA 3MLXH 4PLKD 5HYJA 1S5IH 4QNPF 3WN5C 5AG9A 2A77L 3QEHA 4UIKL 1P4IL 3PGCB 4OZGF 4ZXBC 3SGKA 4RBPK 5I2IB 4QHMA 3C8KB 5MI0B 2O5XL 3HE6B 4NOFA 5SWSD 25C8L 4CU7A 5DT1H 4N5EC 2EDRA 2J3SA 4N8CH 2A1WL 3AMLA 3WIIH 5ITBH 3WDHA 5HYSA 5ITFB 5KOVC 5IBTL 3NA4A 2A9NH 4KI5C 5C0RH 3DLQR 3LS4H 3IJSA 3IETB 5IBLC 1S7VA 5EOQL 5IMMB 1KIQA 2G60H 2NXZB 2R1XA 3FB7A 4RAUA 5AAWA 1JYVA 1NCCL 1Z3GL 1DZBA 3LQAC 2VH5L 4ERSH 5BV7B 5I1KH 4KMTL 4XPTL 3LZFH 3QHFL 5CD3A 2VKWA 1G7MB 1R5WA 3SGEI 2X1PA 4ODBD 5E9DE 3QPQD 4X5XB 1MH5A 5HYJE 3SDCA 1XGTA 4PGDA 4LIQE 4I5BA 2I07B 2IQAB 5A1AA 5T1MA 4PJ9D 5C0CE 4PP1D 3HMXA 4P5MB 3VFRB 3GI9H 1TZGL 5IR1A 5ADPL 4ODUB 2ICWB 1TVHA 2YC1B 2XWBA 3GGWA 5C7XL 2QADB 4I0PC 3BJ91 4Q9RH 3B8YA 2PO6B 3F65A 2IGFL 3SGDH 1YYML 3O3EA 3JTSA 3JWDL 3NBNA 4DTGH 3FB5A 3VXQB 3WFHA 3PJSA 1ONQB 3QUYA 4WHDA 1SBSL 1AD9B 4X5LA 3AY4A 3B9KB 4I13B 4LLDB 1WLHA 1JTTA 1S9VA 2R56L 3I02A 4ACPA 1FL3B 4X7FC 4UZGA 1RIVH 5EFIB 3T4YB 4YX2H 1DVFD 1PG7W 3BH9B 1X7QA 2DQCL 4HJ0D 1ND0B 4JDZB 2HTKD 5C8JB 4JN2B 2QQKH 4LQFL 3U48A 4B53A 1DE4B 1NCBH 1Z0MA 2VDNL 3EYSL 5E8OB 4I8DA 2YOCA 3UPCA 3MREA 1JYXA 3KJ6H 1H8SA 1BQHG 2PW2B 4K71B 5F6HJ 3WIHA 3LN4B 2YN3A 1II4E 3WLBB 3SEPA 1BVKA 3BUTA 1HSAA 2XZAL 4ZQKA 4NQXB 5IF0A 4J3TA 1HXMA 3BQUA 3U0TB 5INCB 5J6GB 1LDSA 4JPKH 1JF5A 1L7IH 2IALB 5I6XB 3BT2H 4DVBA 3UBXG 5FYKH 4W4OC 4ONHA 4XP1L 4U1HB 3D25B 1E6JL 2IAMA 4KJYA 5DQ9B 3LEYH 4KQ3L 5HYQA 2AK4D 5KVFL 4HIJA 3QIUD 1G1YA 3MRKA 3QUXA 1EEZB 3N06B 1JF1A 1A1NA 2DBLL 4YJZL 3KDMB 1S7TA 2BVPB 1RZFH 3ARFD 1G6RB 4RBPH 4H88L 5C2UB 1WVZA 4Y4FC 1RHHA 4O02L 1P7HL 5D7LD 1FVDA 4LHJB 1PY4A 4CVZB 4DJMA 1BP3B 1I4FA 3WD5L 2LFGA 2B20A 1SJEB 4ZFFA 4XVTH 4Y4HB 1HYRC 2CO6B 4EUPG 5B8CC 3ZYIA 1OB1A 2CUIA 5CEZH 2FATH 3RNKB 1CE6B 2R4RH 3GJFH 4I2XB 4X98A 4MQ7B 3RWCA 5HY9A 1NGQH 1CK0L 1R3LB 3E2HB 1F3DH 1B6DA 1HHKA 1XGPA 4ZFOL 3IRZA 3S5LG 3Q6GL 3LRGA 4XI5C 4CUCA 3QPXL 1ZLWH 3HZKB 1U8PA 4MAYC 2AAVA 4N8VA 4P23D 1FRGL 1I9IH 5J13C 4B50A 3QNXA 5F7KC 1UB5B 1YZZA 1JRHH 3S35X 4Z7OE 3ZKNC 1J0KA 3LPGA 2BSSA 4OLZL 1O7SA 4AEIL 4K23L 4PREA 4DN3H 2EYRA 5GGVY 1J0IA 1W0VB 5E6IC 4QYOA 2JIXB 3VD9A 4G8IA 4LSQL 1I9JL 1WGOA 4LSVH 5LVEA 1U95A 1EO5A 2EYSA 4U05A 1WWCA 3NGBC 1RJLB 3TBVB 2VDML 1A1OA 4PJ8C 4HK3N 2JTDA 5CEYA 4CDGC 5FB8A 2CGRL 2PTTB 4U0RB 4XMKH 4JJ5A 3DBXB 5DJDB 3MYJB 5GGVH 2C4FU 3VXSB 3TCLA 1YEEL 3OXSA 4JREB 2Z92A 3N85L 5TF1H 3RKDD 1GIGH 4HXBH 3QEGL 4UV4L 4OSUH 2XZCL 1CL7L 5E4IA 4WY7H 5FUZH 2L7JA 1G1CA 3WS3A 5LKNA 1I1CA 2VZ3A 4R4NC 1FN4B 3RVTC 1BQHB 1F00I 3GMQA 5TDOB 5TFSH 5CBAA 4HFUL 2AV1B 3NZHH 3B9VA 5FYLE 1SMAA 1E4WH 5IESL 5I9QB 4MYWB 1XF4B 3CC5B 3U46A 5C0DB 3QHZL 5JUEL 4X6DE 3MLZH 4TPRL 1A7PH 5IJKA 1U91A 4OLWL 1C12A 5IW1B 3SJVA 3UYRL 2D4FA 1XF5B 4ISVA 3V8CA 2EEDA 4U1GC 3RL2B 1UZ8A 2ICEB 3SDAA 1FFQA 1Q0YL 1KLUB 3UBXB 5JXED 1OP3K 4XC1L 2W65A 5FO7A 5DUPL 5DA4A 3WXVL 3PXHA 2DLFL 4MLIA 5IHUH 4PJ7A 4G5ZL 5C07A 4GW5B 3UYOD 2HFTA 3TBWA 1V7MH 1DANT 4K8RD 1SY6A 2YZ1A 3MA9L 4XPFL 3DVIA 4PJGB 4QRPA 2NY2C 4JDVB 3MV9E 1T2JA 4XPHL 4JB9L 4TNVK 4HHAA 3MCLL 5IT2L 1MRDH 4H20H 4NPYA 2FJHB 1QYGL 1P84J 5GGQH 5DMJB 3C60C 5HHVH 5JW4M 2IF7A 3HR6A 2Q3ZA 3RTQA 1IGYB 2VISB 4HIIB 2BY3A 1LQSR 4PJGF 4BSWB 3EDJA 3T3PE 4EUPB 5K93A 4MQSB 3BISA 1BAFH 3QEQB 2APXA 1GGUA 1NFDF 3HUJB 3SJVE 4NUJB 1DBJL 3K74B 2VDLH 4FMKA 4RAVA 4LP4A 4UI2A 3ME0A 1UC6A 3OAYK 2I26N 5IM7A 1T83C 2HLFD 1A9BB 1QFUL 4C58B 1FC1A 3JV5A 4MJ4A 1PVHA 3K7UA 4U31A 4PJ7E 3WKML 1N5AA 3S5LB 3QIBC 3HUJF 4Q6IC 2R2BA 2J4WH 4R2GC 1TCMA 3TN0C 2EDNA 1HHJB 4QRPE 4CVWA 2I60H 4NM8L 1U8HB 1J1PL 3X14A 3F8UB 3NIDE 4UQ2A 3WNMA 1VACA 1EJ6A 5CSZA 5FDWB 5L0QC 2V2WB 4JGJA 4QRSB 4HS3A 3GMLB 4PRHA 1W0YT 4JZJB 5F6HI 5E99H 1HDMB 5I0DA 3GMPB 3ZKMC 1V3KA 4P9HH 1HH6A 3VD5A 3PWVA 3GSOA 2EECA 5I75B 5FM4A 4DUXA 3INUH 2CLVB 4Z7UA 5FA4B 3TT1H 5T3XL 1A1MB 2H41A 4BKLB 3U2SA 3H42H 3SDDD 5F3BB 2HLAA 3CDCA 3OG4B 5DJYB 5IVZB 2MPAH 4KAQL 3IDGB 3RDTC 5B3JE 5I1IH 4QTIH 4HS6A 3GMOB 1UXWB 4WW2A 3TYGL 4ORGB 5EH1A 4L3CA 2ITDA 2BOCA 3O8XD 3VGEA 3VI3E 1U8KB 2G5BB 2R0KL 1UACL 3LHPL 2Z31B 1EBPA 2DLTA 1IMHC 2CKBL 2KKQA 1MPAL 3IDJA 4P5KA 1JNJA 2IQ9H 4MA7L 5CIPA 3EDFA 3TA3B 4FQ1H 4KQ4H 5A2LH 3QXUA 3RWGA 3ULUE 4QRRA 3MROB 2EE2A 2G2RB 5GGRA 2ADIA 3QDGE 5EO1B 3C5SB 3ARVA 2EEAA 5T1LB 2R1YA 4PJFB 3ZT5A 4PRHE 1TENA 4I3RH 5J57B 1FE8H 4J23A 3MLUL 2HMID 1C7SA 1F6AA 5TE6L 4QHUA 4Z7UE 4O58H 2F53D 4I0PA 1NMCB 4PJHB 4QXUL 1K4DA 5LCVL 3F6IA 2IFGA 2HRPL 3SGJC 1T7ZA 3O3UN 5BS0D 4JFHD 4Q9QL 3S36L 1UWGH 5CGTA 2D4DA 1C8PA 4CVXA 3RHWK 2W0PA 4YXKH 1V3MA 3GBML 3AS3A 4GLRI 4EN3D 5DHYB 1R24B 4NIKB 2R0LH 1FVEA 4R26L 3MBEA 4PRAA 4KI5E 4R4BB 3P0YL 1MUJB 3P0GB 1QSZA 3QUZD 2QR0A 4PJHF 5KG9A 2ZUQB 5I19L 3DYMA 4LIQL 5E5RB 2D7MA 1ORSB 1NPUA 2ZPKL 3OKLB 4ZUVA 1T89C 4QRRE 3RI5F 3ULVH 5I16A 4ZAKA 3NCJH 3G5VB 4QTHA 3BRFA 4XP4H 1F4HA 2DB8A 3ZKXC 5A2FA 2CK0H 5HHXH 2DQFB 4Z8FL 1DQQB 3X13B 2DRUA 4LSUH 1S7XA 4HIHB 5L0QB 1A6PA 3FT4B 3MZTA 4OIAA 4RMSA 4YDJB 3RVXD 1J18A 3AB0B 2G75B 1JGUH 3MLRL 3BWUC 3HZVA 3UTSB 5GISL 2XA3A 3GB7B 3LKOB 4YC2B 4HG4J 3O2DH 1JWUA 3L5WB 1CVRA 2COQA 3U7WL 3GMNB 3HE7C 3DX7A 4F9PC 3HPLA 3PDOA 4KKLD 3VXNB 4GMSH 4MJIA 2Z35A 4FQ2L 3UTPE 3PWLA 1NUFA 3WJLA 1G0DA 1DN0B 4IMKA 5MP6L 1JHTA 3EDDA 4MQXD 3WCYA 3W5MA 1A7OL 4IJ3C 3LRSB 1DBKL 1A0QH 5H2BA 4NSKA 4FABH 5MENA 2AEIT 3MJ7B 3PV7A 3ZTNL 1QBBA 2OZ4H 3B2VL 4Y4FA 3F12A 4DN4H 4S0TD 5GIRB 3U6RA 3GI8H 4DKAA 4QEGA 3C9NA 3X3FH 2B4CH 3QUMB 4K2UH 2KDGA 3D3VA 3EO1B 5JR1H 5EU3A 1JPTH 3F5WB 4EIZC 3U83A 5F1SA 5FO9A 1IJ9A 4AEFA 3C2AL 1JVKA 2BSRA 4H8WH 2VMFA 3C5ZD 5JORA 2RJMA 5DEFA 4WI2A 4NZTL 3PUCA 1I9RH 4MCYB 1ZLVK 1PEZA 2WINB 2NY0C 2DKMA 5DJ8B 2VTFA 4Y8AA 4MJIE 2BVQA 1TZIB 1AGBB 2DBJA 3NPSB 3SY0B 2UV3A 1WF5A 4YHPA 2QV2A 1KLGA 3RVUD 1CCZA 1KB5B 2W0KA 3OKDA 3WIHL 1OQOA 4F33B 1I8MA 4U1IB 5L8JB 3D2UB 5MENE 1IZJA 5E70A 2BJMH 5D7JC 4HDIB 1SJVA 5E2VL 5BOZG 2FD6L 3PP4H 4XBGB 4IMLA 1P4LB 1XGQB 2NQCA 1K8IB 5E6IA 5HGAA 3BVNB 3D3VE 3CXDL 2X4TB 4LGPB 3KLHD 3CMOL 2PXYB 1TVBB 1MFAL 4ODWB 3MV8D 4HPYL 1CU4H 1DBAL 5I8OH 2ZCLL 3JV6B 1CXKA 2VQ1B 3BPCA 1PLGL 1H3GA 1G84A 4PJ8A 5EU5B 5DLML 1D5BB 1D7FA 2BHYA 1NBYA 4G6JH 4AIZB 4MX7A 5KN5A 3IDMB 1GHFL 3OXRA 4JVUA 3BZEB 4GSDH 5CJ5A 3S88H 2OL3A 4X9HA 1WV7T 5E2JA 1E4KC 1UADC 3FKUS 3O11B 4EVNA 2VLKB 3K4DA 1YQVH 1FFPB 3OGCB 4P3DA 1BJ8A 2EE9A 5JO5A 1GYAA 3PL6A 4X0KA 3HRZB 1CIUA 3RIAK 5E9DD 1XIWD 2VXSL 5SWQA 1I1AC 1OVZA 3QO0A 1T2QL 4IRSB 1FNAA 1U8MA 5C0CD 1UXSA 2AEPH 4RGOH 3S8WA 1WZ1H 1Q94A 5T5NG 2J8OA 4R0LB 4M1DL 1BBJA 3AAZB 4WCYL 5F88A 4X4XA 3R1GL 4AEHL 1ZANH 5GSVB 2E9JA 1KEGH 5EU7E 5HHOB 1KTLA 5BCAA 1CD1A 4KK9C 5L6YL 1XAUA 3LAFA 3U4BH 2DMKA 1XGYH 5IFJB 1TJHL 1S9XA 4TQEH 2EE3A 3MUGB 1UWEL 4W6YB 3D0LA 5HHNB 5CSBA 5TDPB 2X4QB 2E9BA 1PG7X 3F62A 2FEDD 2XQYK 1A9EA 3QWQB 1XT5A 5JIKA 2JELL 3C60A 4JG1H 2B1HL 3HZMA 4ZS6D 3KPSA 4UU9A 4PG2C 2R69L 5DF0A 2B0SL 2XICA 2Y5TB 3KYOA 2UZYB 3TYFA 3GK8H 4WTZG 1EVTC 5D72L 3WKNA 1JWSA 4BH7A 1QVOB 1T1XB 4X6FA 4DGVL 3UTZB 32C2A 5FHBL 3CVIH 4GBXC 4H0HB 1TQCC 4K9EH 4PJEA 3AXLA 3NABL 2NXYB 4I3GA 4HMEA 1JYNA 1NCCH 2GTZA 5BW7C 1RPQA 3I6KB 3KYMB 3L7FA 3N9GL 2CDFA 1P6AB 3OJDA 5HVFB 3GSWB 3WDIA 4Q6IA 4PP2B 5FCUH 4F7EB 3FQNA 3HI6L 3KR3H 3H3PL 4AG4H 3TN0A 1F97A 4GRLD 1ZT1A 3MOAL 2E9WA 1BLNA 1FSKC 4NWTH 2DQGL 5GJSL 4LARH 1G9NH 4S1RL 5AWNH 1G9MC 5GRUH 3RHWF 3TBYB 3ARGB 3MA7A 6FABH 1VADA 5SV3A 5DD5H 2FX8H 2BRRL 2CKNA 2I9TA 1EO8L 5HDQH 3V5HB 1N59A 3KPSE 1SVZA 1BGXH 1MI5D 3JWDH 3I2CH 4NQEB 2UY7A 2EO9A 3G5ZA 4U1SB 4WI4A 1I7ZB 1XF2A 1SY6L 2EE6A 3L3OB 4DKEL 1DQTA 2V5YA 3MRBB 2R56H 2QSQA 5J89A 1XF3A 4JY5H 4PJEE 1U6AL 3RDTA 2DQCH 4D8PB 4JKWA 3QCVL 3QULB 4G9FD 5F93C 3MXWH 3QJFB 4XH2B 4LQFH 4OKVB 4AEEA 1EZVX 2P8MA 3VD7A 3WNLA 4FN0A 3VG9B 2DYPA 3O4LA 5FF6B 1I3RB 3JV4B 1HKFA 4APQC 1AO7A 5TF0A 5B3NA 3LIZH 2F54D 3ARQA 4UT6L 4U1KA 5EBMB 1OSPL 5EG6C 3AS1A 2IBZX 1G7QB 3OSKA 3QISA 2Q7NA 2IBBA 5IG7B 1HEZA 1FLRH 2Y23A 4JVPA 4YHLL 1WC7B 4YBLC 5K9OA 2DL9A 3NFSL 3PNWA 5LGHH 3S7GA 3EOYG 2HG5A 4XRCA 2DTMH 3QDJB 5I17B 1MAKA 4MNHB 4D0CA 3Q5OA 3AREC 4GS7C 1YN7A 2VZSA 3TVMC 1FL6A 4PTTA 3MTRA 1CGSL 5EB9A 4HWUA 4GKNA 1NGPH 4JO1H 1ADQA 4U2ZA 5T5NF 1XR9B 3NFPB 2FJGA 3VFWB 3VXTA 4JGMA 1FGNH 1JN6A 3ULUL 3OAZH 1TQCB 4POUB 3S37X 3VXOA 5IWLA 1JMZA 4M48L 3O4LE 1PZUB 2KZ1B 1NCWH 4MS8D 1AO7E 5F7FA 3EYOA 3QO1A 3MV7B 15C8L 3MGOA 3LQMA 5F3HB 1JWMB 1N26A 2W0FA 3FO9A 1T89A 3PQYB 3WD5H 1QFWL 3V0VA 4WUUA 3SPVB 1OTSC 1RZJC 4V1DB 3QB7C 5ILTL 5EZOH 5FV2A 1LP9B 1L4IA 5D5MA 5C08A 4ZODA 1NL0H 1OPGH 3ZE0E 1U8NB 3DVGB 3NVQA 3UJIL 5CBEA 4L3EB 1DQLL 4LVHC 2DTSA 2Y36H 1CBVL 2VSCA 3VG0L 1L7TH 1VEOA 3OKOA 2IPTL 2P8PA 2AS5M 4NKDA 3MRHA 1LP9F 5F7UA 1A6TA 2WSKA 5ICZA 2GTWA 4GOSA 1T5WA 4Y4KD 3UO1H 4F9PA 2JB6B 5D2NB 1L6XA 4MA3A 5E94A 4HV8B 1T66D 5DJ2B 3WO4B 5MEQB 2CD0A 3B9AA 2CDEA 3MV9D 1JFQL 1TIUA 4U1MA 2KH2B 4NO3B 2EIEA 4RZCB 3TJHD 3EO0A 3L9RB 4R7NB 4LLYA 2DLGA 4KWUA 4GUPA 1AD0B 1ITBB 4WUUE 4RNRB 1MAJA 3MRLA 4JQXA 4A2MA 3VGHA 1A4JA 4JQVC 4DQOL 3DNKA 5D5ME 1HQ4B 3GSVB 5C08E 2F74B 3P11H 1R3KB 1LO5A 2CGRH 3LSOA 1OF2B 4JFOB 4KK6C 4X7EC 3H9HB 4PBVC 1FFOA 4TN9A 2FX9L 4KHTH 3DRTB 4WO4B 5MEOB 3VWJD 3C5JB 4M6OL 5ANMA 4EJ1C 3RZCC 4GXUN 3IXTB 2A83A 1I85A 5KJRH 1YEIL 3IFNL 4LSTL 5DC4B 5A43C 1MFCL 2YRLA 5FKAB 4Z7WF 5IMLA 4WV1C 2FEEI 5DJAB 4X8JA 4GS7B 3IXAA 1FNEA 4K7PX 4HFUH 2NY6C 4MB5A 3L6FB 5J6HA 4FQIL 1CGXA 4ZS7L 2VDPL 3O41A 2FIRT 2VDQH 3FO2B 4W68A 1KELL 4QRPD 2OR9L 1KJVB 4I48A 5JUEH 4KTEH 3I3DA 4MJ6B 4L29A 3IKCA 3BH8A 1QBLL 3PHSA 1VFBB 4P46C 2JK5B 1PYWA 1Q0YH 3NFNB 2HT3C 1GZPA 4PPTA 1GGIL 8FABB 2ZUSA 5DXWA 3G9AB 5AG8A 5HGHA 3NZ8B 3D18B 1JUFA 3OKKA 1MJUL 3C6LD 1OSZA 2PO6D 3MRRB 5KBNC 5E1AB 5CWSA 4BFIB 3E6HA 3MA9H 5ANME 2RBLA 3DRQB 4ZUUA 3GNML 5EBGA 3EOTH 2NX5D 4L4JA 2PN5A 2V7NB 1H0DB 1NANH 2FH8A 1I1YB 5HD8C 5IB2B 2V2XB 1GGCL 5ESQB 5DQDL 5EZIH 2VC2L 4RA3A 4RGNC 3CK0L 3P9LB 1ZTXL 2P5EA 3TO4A 5IEHB 1FYTA 5D1XD 3FQWA 2OLDA 5DRXB 3GSRB 4DUWA 4KRPB 4PTUA 3SCMB 1MWAL 3WFEH 1UH2A 3GM0A 4YDLC 4UTBH 4P2OB 4M6MH 1QO3A 1CICC 1AXSA 3BD5A 1KNOA 3STZA 1MEXL 2VXUL 1QR4A 3IDIA 1OGAB 1HINL 4FRWA 2PYED 3A0OA 4H5SB 2LAGB 4LASH 1RZ8A 1DBJH 1BBDH 1EVUA 2IMMA 4PJBB 3B5GA 4X7SH 3VWKA 3QDGD 4ONGL 4YDVA 3V2AR 2WM0A 4Q74A 2VLJA 4QHLA 1I1AA 1MJ8H 1UZ6F 1RZGA 5I66A 2ZOLA 2X4NA 1MCLA 4MDJA 4PJAB 2Q6WA 1NJ9A 4ELKB 3TIEB 4MSWA 3WKMH 2CJUH 4ZXBD 3TV3L 4L5FH 3CDGA 2DWDB 4PJBF 4TVPH 2QSVA 3D87B 1FG9C 4LSPH 3QWOA 2BK8A 5HHME 1FZOA 4S1DC 5CEXB 4IOIA 4N5ED 4NM8H 3DXAB 1GGBL 2FO4A 1FZKB 1TCRB 4PJAF 4JHWL 2P5EE 3O6ML 1XF1A 2CLRB 1FYTE 4KI5D 3T0EC 4MAUL 5D2LA 1AGEB 1T1WB 4WI3A 5IBLD 5F7EH 1CFTB 1IBGL 3OX8B 3HZYA 4Y2DC 4OI7A 2BDNH 4BJLA 3BP4A 5JXAL 1YEGL 1MCHA 3P4NA 1U8OA 2XFXA 4LPYA 1MY5A 1EFXB 3T04D 5T3XH 2J6EL 5FGBA 3E6FB 4PJDB 2DI9A 4G6KL 1M7DB 3BW9A 2WW8A 2D7PA 4PG2A 1NC4B 2VLJE 2OM5A 3RWDB 3GSNH 4Y4HD 3VFGH 2RAMA 1C7TA 4KAQH 3ELAT 5IQ7L 2P24B 5EIIB 4X4YA 1JHLL 2RGSA 3FJTA 3UXFA 2HFGL 1ZA3A 2YK1L 2OL3L 4LPXA 3LHPH 1UACH 5EA0H 1OAQH 5EZLA 4PJDF 3MV01 4X80L 5J4MA 5DZOA 4M5ZL 1F6FB 5BW7A 4TTDC 1G0YR 4MA7H 5HGBB 4YAQB 4AMKL 4KHXH 2H3NB 1CWVA 3EAKA 1FZJA 3AM8A 4HMCA 3LD8B 5D2LE 1J1XH 5ACZA 3FO0H 3PWNA 4K8RL 4XCNB 3UTPD 1ORQA 3JXAA 2P5WA 2ARWA 4OZFH 5ESAB 4XAKE 4RGNB 3FQRA 3BZFB 1A6UH 2H2PC 5AYQA 3DO7B 3BDYH 2D03L 1M6OA 2AV7B 4YZFE 3MLUH 4RMTA 4LEOB 1T7YA 2XOTA 3VFMA 8CGTA 3MRDB 4CMHB 4DZ8B 4X9GA 2BCKB 4O2FB 1RU9L 1CICB 3QJHA 5C9JB 2DQEL 4JFYA 4WWKB 4QXUH 4UNUA 3DX9B 1HQRA 4KC3B 1KTRL 2CDGB 3U7YH 1FAIH 3QWRA 4Y16B 3SKMA 5EBWA 2VQUA 3PGDA 3S36H 1JBJA 1NLDH 3W11C 3GSQA 4FTVB 4ONOA 3FT2B 4MD5A 3IDNB 1BOGA 4HC1H 5I15H 5JLZB 3HAEH 2UZIL 4FXKA 4XWOC 2KQMA 1TTGA 2J7LA 1CLOH 2X89A 1OWWA 4H0GA 4LIQH 4F3FA 1NEZA 2I5YL 4JM2F 2AXGA 4JFDA 1D6VH 4ELMA 2V7HB 4HBCH 2E8YA 4X6CA 1B2WL 1JZ8A 2FSEA 1ACZA 3CFEB 4I0CC 1TNMA 3ZDZF 5IW6B 4APQA 4C83B 4UB0L 3U1SH 2P5WE 5DA0B 2MQ3A 1OAYL 2YD8A 1XGUB 3T0EB 3R8QA 4JQIH 3SQOL 1LEGA 3CD4A 4P99A 2BP3A 3UDWA 3JSSA 5IEKB 4BUHA 5MEND 3G04A 2R29H 3MLRH 1ZV5A 3OMZA 1UJ3B 1FPTH 3QG6B 2A0LC 4KJPC 5MHSE 4NCC1 4ZNEA 1Q9LB 4D94A 5I1EL 4PV8A 2V2TB 1T1ZA 1K6QL 1VGEL 4HWEL 5IMKA 3AREA 4OF5A 4O5LL 4XGZB 4O00A 3TVMA 4G6MH 4GG8B 3L3DB 5D71H 3RFZC 2EIBA 4BA8A 1HHHA 2Z8SA 2YPKB 4E0RB 2R2EB 3BPOC 1CDJA 4JFDE 3VI4E 5FM5M 3QI9C 4GXUM 5BO1L 1Y0LA 4U6VH 3HMXH 4ELME 1A6WH 4X6CE 5DD1H 2BERA 2BC4A 4B7IA 5KSAB 3VXUA 1J8HE 3TZVC 1N0XH 3MPCA 3FFCA 1Q9OB 3TH4T 5FECB 2H45A 4BQ6A 3BMWA 4XI5D 3L95B 1T22A 1DEEB 5EUOB 1IC5H 4MAYD 2PCPA 5D1ZC 3UZQA 4XZUB 1EJOL 1PX4A 4OKDA 3EYVA 5EORL 4HGMA 1MFEH 5A16A 4ODXA 3QXAA 2HN7B 3CU7A 4ZNEE 5ISZA 3QA3B 4NZTH 3JWOL 2WBJC 4M7ZB 5DD3L 5J06A 1CQKA 3RWFB 5E6ID 2XYCA 5EUOF 1W72A 4YUEH 1CDHA 4R3SA 5J1TC 4YGVA 2D0HA 5T5FH 3MNZA 3EYFB 5A2JH 3P9WB 4X6BB 1D6EA 2OJZH 5JHDA 3I75B 4MDIA 4PJ8D 3PWUB 4NRYA 4OUUA 3C8KA 3N1FC 4FS0A 1PD6A 3TT3L 4ODVH 3WIHH 3GMMA 1IGFH 2FBJL 4QCIA 5ALBH 4FFVC 3RZWA 3CSGA 3LV3B 4NJ9L 5CHNB 3VXUE 1C16B 4KUZL 4GAGH 1MCQA 2P46B 3FFCE 5E2VH 1HH9B 4HMDA 3IFPB 4U6YB 4QNPE 3D9AL 2A73A 4R4ND 3VXRE 4RSVA 3RVTD 2QHRL 3MLSL 5F1OB 4GRWF 3ILPA 1TMCB 1XMWA 1EERB 1OHQA 3CMOH 4JG0L 4PS4L 1ZHLA 2R0ZH 3H8NA 1RJYA 3GJFB 3LN5B 5E6YA 5FYKU 3T09A 1ADQL 1M4KA 3KLSA 5ISZE 3I9GH 2C1OB 1LE5B 3QDMB 1NMBH 3HC4H 5KOMC 2X70B 2I07A 1RZKL 4WGWB 1AQDB 1KTDB 4LVOC 3VFRA 1VFUA 2YA2A 4D0BB 4ODUA 2ICWA 4LCCC 4ZOBA 5JHDE 3R06A 3S9DB 2PR4L 4XMPL 3V0WH 3QH3A 4Y5VA 1BVLA 5T3ZE 3MRCA 2D7NA 1RJZB 3FTGA 5FGCE 4KRMB 2Y72A 2VXSH 1ONQA 1AD9A 2HWZH 4LDOB 3B9KA 1CFSB 4LLDA 1HWHB 2RR3A 5I8KL 4IRJB 1FL3A 5EFIA 1IT9L 2ZSWB 2VN7A 3BH9A 1H3WM 1DJSA 1OL0A 4M1DH 3C60D 2FWOB 1TZHB 2H26B 1UA6L 4MNQD 4Y5XB 3P3YA 4JN2A 4YHML 3KXFE 1DE4A 1IGJB 3CFDB 1YEHH 4LVNB 5CMAB 5FHAH 5C0AA 3R1GH 5BXFB 2D7TL 4AEHH 4XNUH 1MREL 3G5XB 1S9YB 5K9JH 1EDQA 2WUBL 4N90D 3H3BC 2F8VA 5FYLH 5L6YH 1LO3H 3WBDA 5KTEL 1GC1L 3C8DA 3RU8L 4FQHB 3LN4A 1UWEH 1SJHB 4K7FB 4XVSH 4L8BA 5GS0C 4J3UA 3OB0K 5D96C 1LEIB 2CQVA 1Q0XL 2OMNA 3CLEH 4M6NL 2OTWB 3VD3A 4NZRL 3QZWA 3QIBD 5INCA 3PABB 4EDXA 2C3XA 1B0RB 4R2GD 1YYLH 3TN0D 1CG9B 1V8HA 3IGAA 5IB5B 3KGRA 1T7VA 3UTTB 3QCUL 3D25A 2R2CA 3MGTB 1PGRB 4BELD 2A6DA 2NPLX 5DEGB 2NY1C 3SO3B 3EOAA 1A47A 1FL5A 4OLVL 1EEZA 4P59H 3X3GH 2W60B 4HUKB 2EC9U 1QA9B 1MHHB 1ZXQA 2XRAH 5FO8B 1OP5H 3NABH 2FGWH 3FN0L 3KDMA 5AUMB 3FOLB 5C0AE 3ZKMD 2BVPA 5M95B 1NCDL 5DRNB 5GGSY 2GK0B 1D5MA 1IAII 1I8LA 4K3DL 4EBQL 1G6RA 3HA0A 5DTFB 5EBLB 1XH3B 2IJ0C 3V4PL 1PKQA 3WNPA 5JA8B 3BP7B 1X5ZA 2WWKO 3Q3GA 4JDTH 2YKLH 1RZIB 1OM3H 2P8LB 4NHUB 3MOAH 2NY5C 4NKQB 1MCEA 1A14L 1AI1L 2CSPA 5IVNA 1IC1A 2DQGH 4JZNB 1CFQB 2NY3C 1M7IB 4ZTOH 5I76B 1I3GH 1K2DB 2DOCA 3KLDA 3RDTD 2FB4H 4OFKA 3EW3B 3LKNA 3MODH 3RNKA 5D4QA 3WV0A 3KLAB 2APWA 4MQ7A 5GHWL 3UX9B 3O6LH 1DDHA 1R3LA 5DD6A 4KY1L 4JFEA 2VO5A 4X5WA 4HW6A 4IHOA 1FO0A 2FGZA 1IKNA 2YPLA 1EGJA 4HWZB 4YQXL 2HH0H 2O26U 3QIWB 1SY6H 1W0WB 4K3HA 5CINL 1RUQH 3GIVA 5J7CC 3QP3A 2Y5EA 4P4KB 2NY4C 1E4XI 2B7DT 3H0TA 4HUWB 4PY7A 3QCVH 1E27B 1K3IA 4KI1A 4HKXB 1IFHL 1PKQE 5CP7A 5CP3H 1D5XA 4S1SL 1PFCA 3VGDA 2XWJA 4YH6A 4Z78A 4IIQA 1IGCL 3SGEH 1XR8B 5HVWA 1IAIM 4LP5A 2DQDH 1MCFA 2JIXA 3D48R 5DJZB 5JPMB 2OP4L 1NDGA 4Z76B 3DOSA 3MCKB 4MMZC 2AK1H 2FL5B 3TBVA 5E2WL 4BSVA 1FBIL 3ZKSD 4EQ3A 5E7BA 2PTTA 2WWMC 5CD5C 2R0WL 1KPUB 4YHLH 4JFEE 5IB1A 3MYJA 2IG2L 3KYKL 3OG6B 2BNUA 3UJTL 5ADOH 5EOTA 3KPPB 4IRZL 3T2NL 4ZTPH 3IDXL 3S6CA 1T04B 2HKFL 2YPLE 4GRMB 4WUUD 1CDBA 1PX3A 2VDRH 4JRWA 1LNUB 4IS6A 1KJ2L 3DV6A 3SBWA 4WU5A 4F8TA 4TSAL 3Q1SH 4LSDA 2AV1A 3FAWA 2NY1B 3M17B 1JGLH 4LCWA 2BVOB 3WYRA 1SMOA 2CRMA 4TRPL 5LXGL 4OCMC 3RVWC 5E0QA 3ULUH 4Q9CA 3CC5A 1S5HA 2G9HA 5DD0L 1NMAL 4JVWA 5SWZD 4OBSA 2VLRA 1NKOA 5IW1A 4YE4L 1S7SB 3EZJB 3RL2A 15C8H 1DL7L 1F45A 2JJSC 4HLZH 4A6YB 4O2EB 1MCWW 4G80B 3O45B 1YUHA 3HE7D 1INDL 4NM4H 1QFWH 1BF8A 4Z95H 2K9UA 4OZ4B 1WISA 4D9QD 4GW5A 3RQ3A 3ZT6A 3SHSA 4PB0L 1RIHL 3OKNB 3KS0H 1MCDA 5GGRY 3UJIH 1MCKA 1NFDA 2EIDA 4M8QA 2ARJQ 4LRIC 4O4YL 2R4SH 4Q97A 3H9SB 4OZHA 1IM9B 5CIPH 2D9QB 2F5AH 4LCWE 2ZSVB 4I9WD 1INEL 2QHLA 3BESR 4LLMB 3FB6B 4HIIA 4KRLB 2OI9B 2VUOA 4HX1B 3O9WA 4BSWA 1BF2A 1A7QH 3U9UA 2AJ3B 4U4BA 4EUPA 4CU8A 3QEQA 2O61A 2VLRE 3A6BH 3L1OH 35C8L 4NUJA 1GZQB 4KDTC 1DQDH 3PWJB 3QI9A 4AY0A 1R5VB 3HLAB 2NY0D 1TJGL 4UDUB 3ARTA 3O4OC 3L5XL 3O2WL 1M7XA 1YNTA 3TZVA 4K3EL 1ZGLP 4DQOH 4YGAB 4JFXB 3JUYA 5ID1B 2EDBA 4CGTA 2NTFB 2V5TA 1ZOXA 5IHZB 1HHJA 4OFYD 5D1ZA 3BRDA 1IZKA 3ULVF 1ZHNB 3OPZL 5IB3A 1NFDE 2I27N 2D7QA 4IDLA 5D7JD 3KG5A 2BSTA 4I18B 4JHZA 2D31B 3S34L 2R39A 2VLLA 4OZHE 4HH9A 4BZ1H 2NXYD 3G6JF 3WUWG 1KENL 4EI5B 1NBQA 1HDMA 4OCRH 1YECL 1FNSL 4ZS7H 1WIUA 4D9RE 3MRIB 3QEQE 5SWSB 1IEBA 1UT9A 5TH2A 2CLVA 5HHMD 1MRFH 3VFVB 5FA4A 5C09A 4ZPTB 4ODTL 2YSSB 4JPIB 3F7VA 4WWID 4R4FH 5HHPA 1SEBB 2QBWA 3ARGD 1NBZB 3IDGA 4AIXA 2R1WB 1UXWA 2ADJB 2YD5A 4CMMA 1A7NL 5H94B 1HK6A 3P77B 1U8KA 2Z31A 5HI5C 3CXHK 4ZUTB 1S8DA 3DX6B 3QAZC 4UTAL 2BXZA 5A3ID 1JGDA 3GNMH 3TA3A 4J4PA 3S96A 2EO1A 1XCQB 4HK0A 4JY4B 4QOKB 4WU7A 4NKIL 2UUDK 1KC5L 4YIQB 1I1AD 3MROA 4PJ9B 4FZ8H 1GGCH 4O9HL 4XPAL 2ZUTA 2VC2H 4U3CA 3F6LA 2GJZB 1ZTXH 4KKAC 3QQ4B 1K9TA 3U36A 2LQRA 1JTOA 1UYWL 1AIFA 1KCVL 5EOCL 4LCCA 5F89A 4FQQB 4YBHA 3HS0B 1LK3H 2BOBB 5C09E 3GMRB 2XZQL 3BKYL 3BPNB 1HINH 4PJHA 3RL1A 2XKNB 1LDPL 1QNZL 4F57L 4KK9D 3DIFB 5KVDL 1K5NB 4LFHD 4NFBA 4OD2A 5I1JH 2NW3B 2YZ8A 1JNHB 4UT9H 3B9DA 3CVHL 1DVFB 2AGJH 1R24A 4YHKL 4XAWL 3EZ8A 3ES6A 3REWB 4LU5L 4K9EC 1MUJA 4F9LA 3V6OA 3N1MC 2H2SC 2R9HC 5DUML 3FOMB 1J8KA 5LAXB 1IL1A 4FQXC 4WHTB 4EXPX 4RX4D 4N0CC 1ORSA 5DK2A 4XNXH 3KNBB 2HFFA 4KJWD 3AS2A 2IAND 4R97B 3G5VA 1GGBH 2I25N 5IVXB 4G9DB 5T3ZL 4MWFB 2W1NA 1GAFH 4PV9A 4JO3L 2H6PA 2DQFA 5DMGD 4GBXD 4P5TC 1EH9A 4RIRA 4HIHA 5DSCA 3FT4A 1T1YB 3IFLL 5DVKA 4YDJA 3WIFA 4PJHE 1IGIH 1U3JA 1P1ZA 4ZSOB 3JWDC 3T8XB 3UTSA 4DEPB 2CO7B 2NLJB 1JZ6A 2C3VB 5IVXF 4M8VA 3GB7A 4HSQA 3WNOA 2X4RB 2NCMA 3L5WA 4M03A 1F3JB 5BV7L 3GHBL 2P5WD 4Y5YA 1B0WA 3QIUB 3OZ9L 3KPTA 3VXNA 5IQ7H 1VKXB 3V6OE 2ADFH 1VGKB 5EO9B 1MHCB 4KV5F 5FUCE 3ARFB 2Y06L 2Q86A 1X6LA 1SYSA 3WHE1 1QSEA 2HJFB 2OL3H 4GQPH 1FHGA 3IJHA 4WFHE 1ED3A 4YEEA 5LQBL 5D7LB 4OM0L 4XNZB 4HGKC 4OIIL 4RWYH 2GSGB 3W82A 3BPLC 4F7CB 3HMWH 4BZ2H 4M93B 1EV2E 1YDPB 3VRIA 5GIRA 2C3HA 2YD3A 1WITA 1O5DT 3GHEH 5EU6A 4LNRB 2EDDA 4MA8L 3QUMA 5GS1B 3GRWA 5L8LB 2Z8VC 2GI7A 4XCCL 3VXMD 1MAMH 3UTSE 2VQTA 4WUKL 4FXGB 2QQNL 4ZYKB 1J8HD 1TJIL 4NQDA 2DQEH 4UUJB 3MX0A 4FQLL 5DDHB 3VRJA 3FRUA 2XG4A 4NHCL 3L7EB 5DJ8A 2UUDH 4M4RA 3QQNA 1BZQK 1R6VA 3C8HA 5D1QC 5JNYB 1BEYH 3HG1A 3Q6FA 5GRZA 4RFNB 3SY0A 5KW9H 5GRWA 1TPXC 4P23B 4WEUD 3DUUB 1EFQA 1QSEE 2UZIH 2XWTB 1NGZB 3D2UA 1F13A 3PIQB 4CADA 4ZUSB 3RGHA 1GVIA 4Y7MA 4HDIA 1RZ7L 5AD0B 3ARSA 4Z7VF 5HYFA 3ARED 4XBGA 2IH3B 4UV7L 3TVMD 3ALPA 1KCRL 4FNLH 1AKJA 4XP9L 3SDXB 5L9DH 2IFFL 1K8IA 4P3WA 5EU6E 4EZMA 4RISH 5DVLA 1OAYH 3BVNA 5F1IA 3WL9A 1ZEAL 2PXYA 3CCHB 2DDQL 3CZFB 4ODWA 1E6OH 4DGIL 4ZOEA 1HYSC 1ZGLB 1AHWC 1ZSDB 2Q76B 3JV6A 3GDBA 3PXJA 4WEMB 4C56A 4PGBA 1KJMA 1MFBH 1RQ5A 3ALWA 4L9LC 1H5BC 4ODSH 5EU5A 5FYJE 1D5BA 4F7TB 4NQDE 3AROA 1EK3A 3FFCD 3IDMA 2F5BH 2IBGA 5GJTH 1OAKL 1BD2E 1G6RL 1K6QH 2X1OA 3HG1E 1N2RA 1X5FA 5IOPB 3VXRD 4Q2ZA 4KVNH 3BI9X 4G7VH 1PQZB 4QRTA 1I7TB 4GLRH 2Y07H 4O5LH 1DSFL 3GUTA 3D85D 1OAXL 4OFIA 3FRPA 4LRNL 1FFPA 3OGCA 5F71A 5B39A 4JANA 4NT6B 4N9OB 3BYYA 5I74C 3EIFA 2EH8H 5D6CB 2FO1A 2AJYL 4IRSA 5B4MC 2HJLA 1SJXA 3QQ3B 2X41A 5L88L 3BPLB 4R0LA 3KYNB 2CLZB 3RIFK 3K8MA 3FB8B 1UM4H 1ZGLM 1IGTA 2HKHL 3UTQA 5I1AB 1HCFX 1VFAB 2W9LA 4C56E 4XB8A 4XCFH 1BFSA 3WJJC 5HHOA 1P7QB 1KPRA 2VLME 3MLYL 1IAKA 4ZO6A 3VFSB 4YR6B 4UINL 4HFWB 1WEJH 2FECL 1IQWH 5CZXC 5DD3H 3FONB 4TTGA 1F58L 3MUGA 1JHKH 1CF8H 4TSCL 1XGRB 1JZ2A 4DKFL 1HSBB 5K9QG 2E7BA 3DJ9A 4LRIA 1MVUA 4FZEL 5DRZA 1KXQE 3KXFD 4U1NB 3VE0B 4UMGA 3WHXB 2ZNXA 4KK6D 5JPNA 1EEUA 4GFTB 4NJ9H 3P9MB 3RZCD 5CKGA 2HJKA 5IKCB 5AEAA 4LGRB 4KDTA 3IFOA 1QVOA 1RV6X 5IGXL 4YWGL 1YY8B 4HAFA 4MNGE 1F8TL 4HQQH 3HNVL 3BUYB 3RWIA 2QHRH 5JW3L 1BQUA 2CMRL 1U8JB 2NY6D 5I18H 3IVKA 3DVNA 3KYMA 1NAKH 4PS4H 3V4VL 4U1JB 5HHOE 3GSWA 4PB9L 4LLUB 4MHHG 4PP2A 2DQHL 4L1HA 4PJXB 4ZFGL 1ADQH 5A2KH 5C0EA 1IARB 1KCSH 1QLRB 2CRIA 3A67H 3HC3L 5EO0B 1DBMH 3L5IA 5H35B 4P46D 4XP6L 2OR7A 4P3CH 5C71A 3TBYA 3PWPE 4HF5L 2HT3D 5GGTL 3H2WA 4LOUC 1FORL 4MA1B 5C0AD 2R23B 4PJXF 3MV11 4XMPH 3RUGB 3FT3B 4P9MH 5GGUB 5TJWK 3SE9L 4F80A 3RBGA 5J8OA 5DC9B 1A4KB 3SDDB 3U7AA 3K0WA 3C09C 1KT2B 3IU3A 5C2BH 1U8QA 1QLEH 1NC2A 3KPNA 5I74B 4XXCA 3O6FC 3BGMA 2DQTH 5HD8D 5I8KH 4JY6B 4RGND 1BMGA 3LDBB 2JJTC 3ZT7A 3O8XB 3RUGF 2L7UA 4PYGA 5DJ6A 1D9KC 3OR7A 3KPLA 3H9YA 3ARDC 1X5IA 3ARRA 3MLPA 1X9QA 1T03H 1NCAH 1CL7I 1CICD 2ESVE 3RPIB 1SM3H 2D7TH 4X83A 5FF6A 1MCWM 4Y16D 5HPMA 3HI5H 3KAAA 4PGEB 3STLB 5F9OL 3CU1A 2VDKH 1IAOA 3BIKB 4OM1L 2NR6C 1QACA 3BKCH 3P4OB 5TQ0L 4F7MA 3GKWH 3J7HA 3X12B 2IPKA 2ORBH 1K3ZA 4XNMA 2HRLA 4GKZA 4MXWH 5IG7A 1KPVB 4OGXL 1PY9A 3BAEL 1WC7A 4X7DC 4JFZH 2F53B 3GEWB 4J7RA 5ACMA 3F7YB 4RA0C 2CK2A 2P7TA 4H26B 3QDJA 5CS7A 3NTCH 2AKRB 4ODHH 4EN3B 4OZFG 5KS9B 1BIIB 1MIMH 4NN7C 4XB7A 1WICA 1B4RA 2LAAA 5C1MB 3T0ED 2B5IB 3VFWA 5D7KD 4D3CH 1FGVH 1ZT4A 5E5MA 2X4PB 4JFED 2EYTB 4Y2DD 1IC7L 1EEYB 3FN0H 4F7PB 1NCDH 4EBQH 3RNQA 2FX7H 1C5BL 3CFBB 4FQXA 4XMLH 5KS9F 3ULSB 1Q9KB 2WNGA 5DJCA 2YPLD 3MV7A 4LVEA 4GAYA 1CZ8L 3MXVL 4R9HA 5AYUL 1YPZB 3T77A 5F3HA 4C4KO 4UAOC 1JWMA 4WHYH 1AGCB 5C86A 3LS5L 1A14H 1URLA 3VFPB 4OB5H 5CJ8A 5EPMB 3B8SA 5FK9B 5KANG 4WW1B 3HI1A 3K1DA 1EA9C 4V1DA 3TIDB 3MRPB 2GITB 4NNYB 1LP9A 4GXVL 1M71B 4P5TA 5CGYC 4KY1H 3QDJE 3DVGA 1I3VA 3OKEB 1NGWB 3I6LE 1F3RB 4L3EA 4RFEB 3L3JB 4TTDD 2DL2A 4KXZH 4OGYH 3CFKB 4QRUA 2VIRB 3T3MF 4Z7NF 1ITCA 5DHVA 4YQXH 3O6FB 3UROR 1KACB 1W2KT 4OZIB 4M7LH 5F9JB 1JV5B 3BEVB 3ROLB 3SKNB 5T1DL 3S4SA 3ABZA 2VAJA 5J9PB 2JB6A 3QNZA 1SBBA 2H2PD 1F5WA 5JIHA 4HV8A 1IQDB 4J8RB 4TUOA 4BQ9A 4Z77B 4S2SB 5I1DB 5MEQA 5FAAA 3PP3H 1SYVB 2IADB 5FYKD 4NO3A 4LSSL 4M7JH 5D70H 4OZIF 1HIML 1KIPA 4XC3L 5KSUA 1AD0A 4AENA 4RNRA 2E27L 2RCSL 2XY2A 3MRMB 1QBAA 3W11D 2B1AL 4V1DE 4PIRF 4Z7WA 4XVUC 1N5YL 1QSFA 1AQKL 1H3PH 5ICYB 1FBIH 4LKXB 1R3KA 4LHUA 2P44B 4XWOD 4WDIA 4LF3B 2R0WH 4YNYB 3H9HA 2O93L 5TDNB 1MQKH 3DRTA 1LEKB 5IVOA 3KYKH 4EI6B 4L3EE 3UJTH 3WDJA 1HI6B 4N9GB 5F1KC 4BYHA 3KPQA 3IXTA 1OD7A 3RWJB 3SKJL 2J12B 5I30H 4NNPH 1PZ5A 4JPVL 4V2BA 5EN2B 2HKFH 3L3GB 4S1QL 1ACYL 1WT5A 5F8QC 4XBPB 3T65B 4L9DA 3HFML 3GSNB 3VD4A 4TSAH 4F15C 1IEAA 1J05B 1HOCB 4Y19E 5D1QA 2EDYA 5CEZD 3SDCC 4JKPL 4AZ8A 4NKMB 1N6VA 3DTXB 2HT4C 4FG6C 4WFEE 3FO2A 5KSVA 3BE1L 2HA1A 3NA9H 5GSRA 3BO8A 3FQXA 3AU1A 3I6GA 3QNYB 4WFGE 4NP4H 3VFUB 1UKQA 4YE4H 1R3JB 5ICXB 2A0LD 5IMOB 1QRNA 4KJPD 4LAQL 2A6JA 3L3IB 1DL7H 2DICA 4YBQC 2W9EH 1AXIB 1MELA 4FFZH 5JHLL 2EDTA 1INDH 4TULL 3NZ8A 1QSFE 3D18A 4Z7WE 3QUYC 3BD3A 2X2YA 3TWCH 3LH2L 2XTJC 4HZLB 4U7MA 4OZFB 4D9RD 4MD4B 4JJHA 1MJJB 1MCOH 4QXTA 4Z7QF 4NRZB 3N0PB 1CE1L 1YC8A 5IIEB 3U30B 3QI9D 5BVPL 3MBXH 1H5BA 1G7IB 4IRJD 1Q72L 1I1YA 2X7LA 5IB2A 2V2XA 4E41A 1PBYA 4O4YH 5D93C 2N7BA 3OBAA 5IEHA 4KZEL 1C1EL 2J8UE 5DRXA 2V9RA 3GSRA 3MUHL 5TGBB 4NDMB 4OFPA 3SCMA 1R5IB 1YQ2A 4LDEB 4P2OA 5C6PB 1EHLL 1PG7L 4YHZL 4HJGB 2FZ3A 5D1ZD 1D5IH 1XIWB 1DQJB 5E9DB 5F72S 3EKCA 1CYGA 5HYJB 3Q48A 3QUML 3QEHB 3KHOA 1CVSC 1QRNE 4PJBA 3BQUC 3GRWL 5C0CB 2WBJD 4ONFH 5DQJA 5KAQF 1QPPA 1TJGH 5J1SC 2VNCA 4CL7A 2DS4A 4QHMB 2BX5A 4J3XA 4PJAA 3SE3A 3O0RH 2AJVL 5JW5B 5EU4A 4ELKA 3Q2CA 2O5YL 4NFDA 1WCBA 3NAAL 1KIRA 4XCEB 2IAMC 3B9EA 5C09D 2KPNA 3LKPB 4N0YL 2DI7A 4UQ3B 2WAHA 1CFBA 3UTTD 3TJEL 3QUXC 4FFVD 5HVGB 3BD4A 5J1AA 3IJSB 3WJJA 1KB5L 1NKRA 5BVJB 3DXAA 1G7JA 2X4UA 4E41E 1FZKA 1TCRA 2ZWLT 2BY0A 3FB7B 2CLRA 2JB5H 1RUPL 1T21B 3EJZD 4YXHL 4OD3H 1AGEA 4LSRL 3ZHDA 3DGGA 4HUXA 4V2CB 1CFTA 1UZ6E 1QLFA 5CD3B 3OX8A 1NUDA 3MNWA 1R5WB 1A7RH 5ALCH 1ZS8B 1MH5B 5IROA 2AQ2A 4OFDA 4PGDB 4N8VG 1EFXA 3FCTA 4RRPA 3HNTL 4PJBE 4OGZA 5T1MB 3MACH 1MNUH 2BVUA 4Q0XL 1NC4A 1QEWA 2XWBB 3GGWB 4PR5B 2P24A 4PJAE 1LO4L 4GKSA 3RX8A 5EIIA 3LRHA 5TE4H 3O3EB 3JTSB 2DIAA 4OCSH 1W8NA 3WFHB 3PJSB 2MJWA 3QFDA 5JOFA 1FCCA 5ID0B 1S9VB 3I02B 3TBSA 4YAQA 3DXAE 4QHKI 1F02I 3QIWD 4P4RB 2Y7QB 4NO0A 5GRJH 5H37H 3F7PC 5EULV 3DPBA 4NQTA 2X4OB 3BZFA 1BOYA 2YMXH 3K2UH 3BGFB 3MREB 2GJ6A 5EOCH 1MI5B 1S3KL 4WFHD 6CGTA 1P4BL 2E7HA 2BCKA 1NSNL 4O2FA 1X6NA 3BKYH 4OLUH 5C9JA 4WWKA 1MFDL 3DX9A 1LDPH 1FDLH 2VL5A 4M5YH 1JZ4A 1QNZH 1BVKB 4F57H 4JO4L 4JM2A 1HSAB 2JLLA 4ZDHA 5IF0B 1IKFL 2EDEA 4N0UA 1HHGB 3CUPA 1DBBL 3FT2A 4G7YL 3IDNA 4E5XB 4G9FB 1FH5L 4YDIL 5GS0D 1CDYA 2XN9A 5JLZA 4TOYL