4EOWL

Crystal structure of a disease-associated anti-human gm-csf autoantibody mb007
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
211
Chain Sequence
b'SVLTQPPSASGTPGQSVNISCSGSSSNIGNSYVYWYQQLPGTAPKLLIYRNNRRPSGVPDRFSGSKSDTSASLAISGLRSEDEADYYCATWDDSLSGRLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MB007 human IgG1 Fab fragment heavy chain
publication title Molecular structure of human GM-CSF in complex with a disease-associated anti-human GM-CSF autoantibody and its potential biological implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowL01
1QBAA 4P5TA 3FONB 1R3IH 3MZGB 4MCYB 4QHNB 3K74B 4G42B 2JCCA 3S34H 2SEBA 5B8CA 2VH5L 5C08E 1F58H 2V17H 4JRXE 3UXFA 4S10A 3O4LE 5GS1A 5I8CB 5FOJA 4JG0H 1NKRA 5DWUH 5GJSH 2K9UA 3KPOB 4HS3A 3T0DA 3LIZL 2H3NA 3MLWL 2EEAA 1IL1A 5D7SL 4GRMA 5IP4A 1MELA 1S7SA 4WFFD 3DGGA 3UC0H 1BFVL 1BZ7A 5EBLB 4E42A 1HDMA 5EUKB 4LLAA 2BHYA 4KVCH 2LV4A 2VLKB 2YD5A 4C56D 1U8MA 1PG7W 4WDIB 4WUUD 1LK3L 2EH7H 3C2SA 1J8HA 4XNZC 1MIEL 1RIUH 3ULVH 4MAYC 3B8YA 3H42L 1ND0B 2BZDA 2OR7A 4MB5A 3MJ8B 3AMLA 5D1ZA 4V1DE 1JWSA 5DJYB 3WL9B 4L3AA 1YEEL 3QJHB 5K9JL 4X4YB 1F4WL 2APVA 2ERJB 1CK0L 5GPRA 2EE2A 4WI4A 5C6TL 5C0IB 2OJEB 3P9LB 2IPTL 4YHYC 1ORSB 3DUSB 2ENSA 3UTZA 3QQ4A 1NLBL 4OD3H 2XTJD 1ED3A 4CAGA 2IFGA 4ZSOA 1I7RA 4P59H 5C09D 4MDJA 2I9TB 1BQLH 5T5FH 1BJMA 1KTDB 4UTBH 4Y8AA 4NYLB 4AH2A 4MXQC 1Q1JH 3QUZC 1N6VA 3TZVC 1D5ZB 3CFIC 1OD9A 3C6LD 4HH9B 3FFCA 2R0ZH 1BLNB 2X40A 5IBUB 1C16A 5CD3A 2Z0BA 2HKHL 4RWHA 5H35A 4CU7A 2Q86A 3NZ8B 1KPVB 3ARDB 4NQDB 5GISH 5F3HB 4LU5L 4KDVA 4HMCA 3C87A 3KYNB 5H2BA 3AS2A 1BBDH 1IVLA 3BN9D 4I3RL 1X4YA 1CXLA 4L9LC 3X3GH 5B4MC 4X9HA 4JY6B 4QOKB 3GMRA 3L95B 5HPOA 1WT5A 3V4UH 3SJVB 1UADC 3GSVB 1NFDA 3ARBB 2DWDA 2YD3A 4OZHE 1S7TA 2DTSA 1A21A 1OW0A 1ZGLM 3SPVB 5HGBB 5E9DD 4KROC 5BZDA 1T4KB 3GJFB 5F8RC 1TETH 1WEJL 3BGMA 5EC1B 5C2BL 1WGOA 2B4CL 5D1QB 4POZC 2CQVA 5DFVC 4OM1L 3T77B 1BVLA 1S5IH 1HNFA 2VNCA 5ITFB 3LRSB 4ZO7A 4L5FL 2ZPKL 2W0PA 1IRAY 4GW5A 5B38A 3SKJL 1KJVA 43CAA 5CGMA 5DHVB 3MNWB 1UM4H 4QWWC 5SX4I 1E4XI 2DJUA 5J3HC 4RSVA 4E5XB 5DQ9B 3NCJH 4F37K 5EO9A 4EUPB 1EEYA 2JJTA 3SEPA 3TVMA 4QRPA 5TGBB 1LQSR 3DX6A 4XVUC 1I75A 5EU6D 2OS7A 3MXVH 4EOWH 4OGXL 1UH2A 1G9NH 1F2XK 2VZSA 1EBPA 3MLSH 4DEPC 3CFJA 5JUEH 1G6RH 4ISVA 2HLAA 2R2EA 5FCUL 4ODHH 4NO3A 5ANMA 4Z7QF 1LWRA 4OF3A 3CPLA 1H3TA 3KPLB 2FX8H 2ZCKH 4RFNB 5HSFA 3OMZA 5I73C 3HI5L 3PWVB 5DK2A 3T4AA 4I0PA 2YN3A 4JR9L 2BNQB 3MXWH 1LP9E 2F5BL 5C0AB 1T66C 3IDJB 4F2MA 2WP3O 2HFFB 1FNSL 3BD5A 5K9QG 2NYYC 2Y6SD 4X8JB 2Y06H 3WNNA 3P0VH 1KCVL 4TVPL 4R0LB 4GMSL 1CS6A 4JO3L 1FFNA 4XC3L 2VSDA 4PJAE 3MLVH 3L1OH 2OSLA 4LCWE 5MERB 3REVA 2C4FU 2DI7A 1HHIA 3GKWL 2FIKB 3HE6A 4CMMB 4UBDC 4U6VH 4PJGA 5EH1A 3HC4L 3GK8H 3L3GB 5C0BE 4D9QE 3TNNB 2XY2A 3F7QA 5KG9B 2DQDL 4ZPVB 1L7IH 2E9JA 1IGMH 3SCMC 4R7DA 5IVXA 3EYQD 4LHUA 1UWGL 3FJTA 3FO2B 2A1WL 3F7YB 3ILPB 4KZDH 1P9MA 3B2VL 1S5HB 4J3VA 3DBXB 1NUNB 3VMOA 1SYSA 5IGXL 1BD2D 1TCMA 1BGXH 4OCXH 5CIPH 1PYWA 2AJVH 1XGQB 4I18B 4U6HB 5FKPB 1NL0L 3AM8C 2WBJD 5F7HA 5HI5C 3LZFH 4YX2H 3CFCH 2IF7A 4JFEB 5F1NB 3NMEA 5KSAD 5E4EC 5J6GA 4TUKH 3KNBB 3HNTL 2FB4L 5TE6L 5FFLA 3WFDL 1M7DA 3WSQL 3TBSB 5EBMA 3NN8B 4JHWH 1R5IA 5T3ZE 3QDGE 5BQ7A 5FHBL 3ZHKA 2CLZA 4R7NA 4DZBB 2ARJA 1RK0B 3T2NH 1IMHC 3C60A 3DX7B 4DVBB 3U83A 2CIKB 3KS0J 3ZYOA 4R2GD 2AGJL 3WJLC 4BUHA 3CLEH 2XFXA 3SDCA 2XACC 2AK1H 2DQCH 4U1IB 2E5EA 2GY7B 5FO9A 4F9PC 3QA3A 4HS6B 7FABH 5HYJB 1HHGB 1NCDH 1Y6KR 1YDPB 4M1CC 4YAQA 3GMQB 5E2TH 1YY9D 3EOAB 3HC3L 3THMH 1FPTL 2DL2A 3FQTA 1FG2B 3GEWB 4HPOH 4M61B 3P4NA 3QIBD 3UO1L 4S0TD 2LTQB 1CICB 1MHEA 3GMLB 5E5MA 3MGOB 1U3HD 3BKJH 1JHTA 3JV5A 3IYLW 3FT2A 3BFOA 4OLYL 4N0CD 2IJ0C 4HCRL 5DVMA 4IRJC 1WBZB 3IDNB 2NY3D 1MFAL 4P9HH 4JHAH 1I1FB 1E27A 1FNHA 4XPBL 3ZL4L 4PP2B 3C9NA 2ATKA 3B9KB 5T3XE 1C5DB 1OT1A 1YECH 3RAJH 3WEXA 2OK0H 2MHAB 2FH6A 4GT7A 2XZAH 3ILQD 2H8PB 4OCLC 2ICEB 3MJ9A 1FE8L 4GAGL 2BSSA 4M5YL 2YWYA 1J1PH 4XPTH 1JYXA 1T83A 2JCCB 3MOBL 1NGPH 4IJ3B 5TH2A 3WJJA 5I15L 4AYFA 4RWYL 2NY4D 4PJBB 3GI8H 1A4JA 2EDWA 4KTYA 4A2LA 3S37L 4NKQB 1S7SB 4U1MB 4QY8A 1UQSB 1BZ7B 5I8KL 3ZDYF 4E42B 1HDMB 3DRQA 4OFVA 5IMKA 1U8MB 3PDDA 4K07A 4JHBA 4HUWA 1FBIL 2I07A 4LP5A 4PJ9B 4Y19E 5F1IA 5KN5B 2ICES 5DQDL 1GGIL 3HLAB 2DN7A 3V0AC 4APQC 2YRLA 3L5WA 4ETQB 5C2UB 4BSJA 4ZUSB 2QSVA 2VDLH 3DV6A 2RAMA 2CKBL 3KYOB 4X0KA 1RFDL 5EUOA 3O0RH 4CDHA 1B6UA 2GY5A 3UTZB 3QQ4B 5ERWB 2DWEA 3EHBC 3E8UH 1N3NA 1ED3B 4R26L 5D6DC 4LCYA 4ZSOB 3UBXB 1I7RB 3C5JA 1YYLH 3T0EE 3MODL 1PX3A 4MDJB 2F8VA 3C8DA 3PV6A 2B8OT 4HFWA 4TSAH 4FZEH 4Q6IC 5EZOL 2VJXA 5DJAB 4AH2B 1KYOK 5D70H 2AJSH 2PXYC 5F72S 1NBQA 2JCCF 3V6FA 1CFSA 5I2IA 4HUXA 3DRTB 2ZUQC 3QFJB 3PHSA 3QIUC 5CD3B 4AIXA 4Z5RB 3MBED 4YWGH 3O3BB 3O3EA 4KRNA 5DD5L 3RGVC 1PG7X 4DK3A 1NCAH 5H2BB 1JFQL 5J13C 3PP4L 5GRJH 2HWZL 3QI9B 1DQDL 3CVHH 1S9VB 2VLJA 1VDGA 2YD6A 2UZIL 4F7PA 2NXYC 2MJWA 3GMRB 4UDUA 5BVPH 4LSVH 3ARPA 5I18L 1CN4A 1NFDB 1P5VA 4X5XA 4LLMA 4OFIA 3WS3A 2ESVB 2DWDB 3PDOA 5CGYC 4PGZA 3PF2A 4N68A 3VD9A 5BZDB 3NCCB 5E8PB 2W07A 5IKCA 1FZKA 1FFPA 3BN3B 3BGMB 3DURA 3W81A 5DA4A 3RZCA 2AI0L 4NHCL 5GGVL 5DJ6B 1KJ2A 3C5SA 4PB9L 3RRQA 5GXBB 1F3DH 3VD3A 3D39A 1XGUA 3RU8H 5IMOA 2VKWA 4GW5B 4RRPG 2ITDB 5B38B 1KJVB 43CAB 4JO1L 2A0LC 3VFPB 1AQDA 1HH6A 1X44A 2XQYK 4Q0XL 5EO9B 1HE7A 4AQ1B 4Y5XA 1EEYB 1MQKH 3G6DH 3TVMB 1V3JA 5INDB 4CVWA 2ZJSH 5GQBA 5TPWH 2IBZX 4ZAKC 4LIQH 4F7CA 4KJPD 2QADD 1G6VK 2E7MA 1AJ7H 1MJUL 4YZFF 5GS2H 3MA7B 4FZ8H 3UTSD 4F15B 3MJ7B 3CFJB 4FOMA 2HLAB 2PR4L 1R0AL 3GDBA 5IBLD 4ZOEA 1Q94B 4NO3B 3TJEL 5E99L 4FQXD 1EV2E 4PLKD 1NEZA 1SEQH 3BE1H 3MROA 4F80A 5ESAB 3U0TB 4P4KD 4WFFE 4X6BA 3KWWA 4GRLC 2Z8WC 3T4AB 5IFAL 4I0PB 4C56E 1P7QD 3ROLA 2DRUA 4WUUE 2D9QB 4XX1E 4F2MB 1NFDF 1CXFA 2EIEA 4N8PA 5BMFL 4OAWA 1C7TA 3W9EA 4ZUTB 5IB1A 3DNKA 1FFNB 4XWOD 2OSLB 5F96L 3REVB 3RJDA 3QAZC 4HUKB 4RMUA 1CXKA 1HHIB 4O2EA 3TF7C 1DBJL 3K1KC 5ALBL 1EXUA 1NMCC 1HZHL 1JWUA 1PKQA 2OJZH 3TJHC 4WWID 1YMHB 2IBBA 2V9TA 2ZCLH 2XTJE 3QEUA 2W9EH 2NZ9D 1RJLB 3OPZH 3KPRB 5C09E 5IVXB 1CDCA 4MAUL 1U8QA 4E41B 4WEBH 3ULVD 4R4ND 3T0EC 2P42B 4F57H 4HT1H 5HXMA 1SYSB 3MLXL 2R29L 1ZE3C 5L6YH 1MHPL 3Q3GB 4HGWB 1PYWB 5FF6A 4GG6A 5IWLC 1CGXA 4MAYA 1DL7H 3UDWC 5HYSG 4DJMA 5I1IL 1H5BA 3QUYC 3KS0H 5F7FA 3HS0A 5KVMC 2AQ2A 1BFSA 4N8CH 1W0VB 3R4DA 2HN7A 3EFDH 3FFDB 5JIPA 1P7KA 1DJSA 4CJ1A 3BX7C 5T3ZL 1CFQA 3TBTB 3DSNA 4WHDA 1M7DB 5LGKA 4NCC1 1FYTB 4KKBD 1R5IB 4ZS6C 3CLFH 4U6YA 5EG6C 5BQ7B 1OAKL 5GRXG 2CLZB 4R7NB 5E9DE 1Z9MA 3DJ9A 1F45A 5MEPA 3C60B 4GRWE 3QHZH 2E7LC 1J18A 1N5YL 3RHWK 3EYOB 3UMTA 2PYEA 5CUSL 4EN3A 1T04A 3HUJB 4HIHA 3M45A 4PGBA 5JHDA 5DHYA 3SDCB 4PJEE 2UV3A 2X4QB 5FO9B 3MRCA 3TZVA 3QUZA 3LKQA 3MLZH 4MB4A 1TVHB 2YUWA 1JGDA 3CDYA 2JB5L 3TH2T 5T1KA 3QXAA 3V4VH 4DGVH 4LVNB 3O3AA 4NN7B 1H3XA 5IVXF 1K6QL 3CX2A 3FL7A 1P1ZA 2XQYG 1LE5A 1R6VA 2N7AA 5EU6E 1MHEB 1K4DA 2IPUK 4Z95H 3W11D 5E5MB 2X9YA 2YD8A 3SO3B 3I85A 3MJ6A 4OSUH 3OSKA 5D7JC 3VXRD 4X80L 3PWPA 3IXAB 3GSUA 5DMIH 3VDBA 5ENWA 3NA9L 3FT2B 4MNHB 3BP6A 4NDMB 1ZLSH 3BO8A 2FCBA 5TF1L 3I75A 2YXMA 3QPQD 4CU6A 3MCKA 1E27B 5T3XL 1FIEA 5EZIH 3C9NB 4LSRH 5EOCJ 5FUOH 2ATKB 2DBLL 4N5ED 4R97B 4MA1C 3IFNH 3UBXG 1SBSH 3WEXB 4EJ1C 5CAYB 1R3KB 3Q6GL 4WENB 1HILA 2NR6D 3HB3D 3CX5K 3W9DA 3O3DA 2HFEB 3Q6FA 3IB4A 2R0KL 4PJ8B 2Q6WA 3UJIL 5LXGL 2P5WA 4KRPB 4OLVH 4YC2C 5GGQH 3L5XH 2EO9A 2OM5A 3HUJF 1EZVY 3TYFA 2QSCH 1NPUA 3MZTA 2YPVH 3NTCL 2YPLD 1A6WH 3X12A 4U05A 2GJZB 3HE7C 4IRZH 1A4JB 3N1QC 3L3HA 1WITA 3B9EA 3EKCA 1K8DA 1F3RB 4QY8B 5I0DA 4L1DA 1RHFA 4JANA 2RCSH 4ZFZB 3A67L 2F9BT 5IMKB 4PJXE 5C08A 1DDHA 4JRXA 1A0QH 5C0DA 1MHHB 1QVOA 3O4LA 1ZLWH 5GRUL 2VN4A 5FUCE 2XTJC 5CSZB 5I9QB 5KVDL 2X70A 2I07B 2NY5L 2HLFD 2BRRH 3UROR 1BD2E 1S7UB 5EU5B 1QRND 2MKLC 3INUH 4LSSH 4RBPK 2CSPA 4NKDA 3N1FC 3LN4B 3L5WB 2EECA 3CXHJ 3R8QA 3OKEA 3LS5L 3QQ9D 2EKSB 3C6LC 4OZIE 5KOVC 2NY6D 1FVCB 12E8L 1IC1A 2B2XL 4LARL 1YA5A 3ZO0A 4DAGL 4Q9QL 4I13B 1GC1H 1QRKA 3BZDA 1BAFH 2PKDA 4ZOAA 3T3PE 1DFBH 5B38G 4IEFB 1NC2D 3DWTA 4V1DA 2DWEB 2JJVA 2YA1A 1SM3L 1JPST 3BN9C 3BP7A 5GSRB 5FAAA 2APXA 4RCAA 3FQRA 2OR8A 5CS7A 4HFWB 4O5LH 5DFTA 5SWZD 4NC1E 3SCMA 2UWEB 4W81A 4DUWA 4YDVA 3F12B 3AS0A 3UTQA 2GTZA 5LKNA 1RJZA 3V6FB 5I2IB 4HUXB 3JWOH 2B5IC 1RU9L 4X6CB 4ZPTA 4WRLA 5BVJA 3O3EB 2LVEA 1IAIH 1IGJA 4DKDC 3U2SB 4OD1H 5F7YC 1WIOA 2WMPA 4G8FA 4HWBL 1OAZL 4UDUB 2ZKHL 4TNWF 2E27H 2BVPB 3T0WA 2F58H 4X5XB 3WS3B 4LLMB 4PJ7E 2YOCA 1CGVA 2YZ1A 5D2NB 1L6XA 4XVTL 1M71A 5IFJB 4OZ4A 1JGLL 2IPUG 1RURL 5IKCB 1FZKB 3ZKMD 2X4UB 4LLYA 4H8WL 1CGWA 5IOPA 2LABA 5K9KA 3HMWH 1KJ2B 3C5SB 1VACA 4KK5C 5IVNA 1KACB 4XMPL 1FNLA 2HRLA 2CR3A 3LEXB 3WXVL 4M7KH 5EUOF 1A14H 1XGUB 5FUZL 4K2UL 3I2CH 4UOW1 2GFBA 4F9PA 1HH6B 5IB3A 1KJ3L 2XQBH 4NPYB 4Y5XB 1LO2L 4GMTH 4U1LA 4JCMA 3QEGL 1PDKA 4XCNA 4QTIL 4M1DL 4F7CB 4JY5L 3ARUA 4WU7A 2DMBA 4Q2ZB 2UWEF 3WDJA 3SDDC 1KJMB 1V3MA 1LK2A 3VFUB 4XPHL 4EDXB 4MA7L 3MRRA 4BK5A 4HKJB 4HJJH 2QL1A 2PTUA 4PTTA 4JKPL 1NEZB 3MROB 4X6BB 3QJFB 4GLRH 5EOTA 3TWCL 4IRJA 3RPKA 1LNUB 3ROLB 5JOEA 3ZKXB 1N8ZA 4HXAH 2DB8A 3V0WL 4UU9B 1CQKA 4KI5D 3NFSL 4U1HA 4Q97A 2X05A 3BQUD 1JRHL 3PWUA 3EYQC 2ILLA 4OAWB 4UAOB 1VGEH 1HWGB 5FUCC 3ULUH 5AAWA 1RI8A 5IB1B 2I27N 5L2KE 5HHOD 1LP9A 1I9RL 1FNEA 2L0DA 4JQVC 1N0LA 3OX8A 1N0XL 4LPCA 1TENA 4HUVA 4O2EB 5CJ5A 2YKLH 4HK3N 3QPXL 1O7SA 5L7XH 5EZLA 1PKQB 2WBJC 4HD9A 5J7CC 2DD8L 1D7FA 3QUXD 3ZT5A 5MI0B 1GGYA 5J57B 1J0IA 2E7BA 4UT9H 4ONGL 3VFGH 3QEUB 4KTEH 2F53A 4S0SD 5KSAC 4PJAA 3WIHH 2K7QA 4LCWA 5BCAA 2C3GA 2LU7A 4C54A 3MLUH 1U8QB 2VITA 5HGGS 1OB1B 3JWDC 4HG4J 1KN4L 5C0BA 5ECJE 3H2WA 3R1GH 4X9IA 4GG6B 1QUNA 5A3ID 3GMOA 4NC1C 4XNZB 4LSUH 4XNYL 2FSEB 5T33H 3OR7A 3CC5B 4NGHL 3EBAA 1H3VA 2D7TH 1UB6A 4Z7VE 1H5BB 1UH3A 1I1CA 1NKOA 4APQA 5TDNA 1JIBA 1T7ZA 4N1HB 4AT6B 3B2UD 1P7KB 1QTYT 3AS1A 3C09C 4DQOH 1CL7H 4KUZH 3PV7A 1MCKA 1CFQB 1WWAX 4PR5B 4WTWA 2O61B 3DVGB 5F7LB 5L0QC 1YY9C 1RZIA 4M5ZH 5FK9A 1A5FH 2HKFL 4JPWH 4YGAB 4BH7A 3GFUA 4CUCA 3IKKA 3QIBC 4W70A 1K2DB 2PYEB 3OKNB 4EN3B 1T04B 2R1YB 4HIHB 4L4TB 1E6JL 4QHKJ 2CXGA 1LD9A 4PG9A 3GI9H 4G80A 4Q6IA 2N7BA 5BOPA 1XGPA 3CFDA 5EA0L 3MRCB 4HV8A 4UTAH 3OGCB 1DN0B 2PXYA 3LKQB 3QDGA 3O81A 3O9WA 2VZUA 1JGDB 4AIOA 3PL6B 3QIUA 4DOHE 5T1KB 4PYHA 2NY3C 4DKFH 2NY0B 3UJTL 3QHFH 1KB5L 2FIRT 3O3AB 3IFOB 3RGVA 5FECA 4FMKA 4ONFH 1P1ZB 3OQ3B 3MUHL 1LE5B 5EOCH 3RL2A 1K9TA 1MPAL 1K4DB 1JZ7A 5GS3A 1AGDB 4HWNA 1YQVH 2XA3A 1ZGLA 5DDHA 5HJ3B 4J7RA 1LEGA 4ZUUB 4GG6F 1K3ZA 1UCTA 4HKZB 2V7NA 3RTQB 5T1LD 1C5CL 5DD1L 2DQGH 3BP6B 2A77H 4K7FA 5A2JH 2EDQA 3PHOB 1MCJA 4KROB 5CZKA 1QR4A 4M02A 1KCLA 4L3ED 2NY4C 3MCKB 2VDNL 4OQTH 4KGJA 4UIMA 4FFVC 3SKMA 5CCKH 3MYZA 1QR1A 4NWUH 5DFWH 1C08A 1RZ8B 4FTVE 3VFNA 1YN6A 3HZYB 5GS0C 3NA4A 5DGRA 3UYPA 1HILB 3P11L 3X13A 3O3DB 5KVGL 4WWKD 3D0LA 7CGTA 2Q6WB 2P5WB 3QCUL 4LRIC 4X7DC 1JRHI 4X4XA 1MAML 4NQCB 1IKFH 3TYFB 2APFA 5F89B 1KPUB 2HRPH 1DVFC 1YC7A 4O2CB 2ZG3A 3N9GL 5CZVL 2O5ZL 1YQ2A 2VL4A 1K8DB 2YA2A 1S7WA 1G7LA 2FZ3A 1Q9LB 3ARFB 5SV3A 5C08B 1DDHB 3S3PA 2XRAL 1QVOB 1A9EA 3O4LB 1NGQL 4GRLA 5I73B 3ULVE 1XZ0A 2LAAA 1FV1A 5AUMA 5IESL 1JBJA 3OKLA 2G60L 1EJOH 4MQSB 1I9JL 25C8H 1WF5A 1JNLL 4NKDB 4K3JL 3X17A 2IAMD 3HPJA 3OKEB 1FSKB 4HAFA 4WCYH 3LPGA 3ZLQC 2E8YA 4Y19A 1GGBH 1TNMA 2P8MB 5KOMC 2DQIL 1FFOA 4EDWL 4NQXA 3N85H 1MJ7H 2ZWLT 3C5ZA 3LKPA 3BP7B 2H2PD 2GHWB 3ARWA 4ZOBA 3FQRB 3A0OA 3OKMA 1EGJL 1P84K 1I3RA 3W5NA 4X5WA 2BMKB 3D3VD 1YNKH 1TNNA 3PGDA 4CNIB 4YDVB 3HRZA 1GXEA 4YEFA 2AABH 2GTZB 1HHHA 4QYOA 1NSNL 3SGDH 1WTLA 3T0EA 1IFHH 1KEML 1RV6X 1VFMA 5BVJB 2A6KA 2AJXH 4A2MA 1XF2A 1IGJB 1CVRA 3J8F7 4MDIA 5IWLA 1EFXB 1HQRA 1NEZG 5FM5M 2Z31D 3L5HA 4K94C 3A6OA 4GKSA 1M4KA 4AZ8A 3F62A 4G8FB 4WI5A 3KR3H 3QUYA 1ZA3A 4ZNEE 2BHUA 2Q3ZA 2OYPA 3MBXL 1J5OL 4X9GA 1ZT4A 1NAKH 4QRRE 3VXRE 3STZA 5E2UL 2OL3H 3NCMA 4HWEL 1CBVL 4LLYB 4OB5H 4OGAD 3I9GH 5HHXL 3QNXA 5K9KB 2VZ3A 1FNFA 2FD6H 4NM4H 3MC0A 3SQOL 2WIIA 2CKNA 5EBWA 2E7LA 4OZHB 1NEUA 1X5LA 3BUYA 4FQXC 1O0VA 5EC2B 4PLKC 3U9UA 2GFBB 1D9KD 2CUHA 2MKWA 5IB3B 4JY4A 4KDTC 4HF5H 1QSVA 4W6YB 3CSYA 3QULA 4U1LB 3V95A 1AY1H 5FO7B 4X9FA 4IOFD 3RDTC 1MH5A 4WU7B 4FFZH 1RAMA 4FXGA 3TIEA 1CFNA 1LK2B 3I3EA 1WAAE 4N0FA 2ED9A 5E8OB 2A9ML 3FN3A 1FP5A 2D03H 4F9LC 1CDYA 3WIFA 2YPLE 3VD5A 1CGUA 5D7JA 2EDYA 4G7VH 4PTTB 2MCPL 5IUSA 2R69H 4OTXL 5FB8A 1HI6A 3HI1A 2IG2H 4P46B 5EOTB 3MNZA 4A6YA 2P5EB 2EYRA 1K8IB 1N8ZB 2ZUTA 2W65A 3CXDH 4JLRB 1ONQA 3PABA 2JJSC 2EC9U 3PWUB 4AIZB 1A6AA 2YRZA 1QRNE 1WZ1L 4OT1H 3ULVC 1RUQH 4NQSA 3WFEH 4C56A 1J1XL 4LSQL 4UIKH 4KZEH 1LP9B 1YYMH 2V5SA 3OX8B 5HHNA 1J8KA 1EEUA 1I4FA 4YDKH 4OZHF 5DEGA 5EZLB 3IS0X 1A1OA 1DBAL 2EYTA 4YHLL 3K8LA 1I8IA 5HVHC 1DUZA 3FZUC 4JFPB 5KS9E 3VD4A 1ZEAH 5KZCB 4KVNH 3U36A 4WI2A 4Z0XB 1BZQK 5FA4B 1JMZA 3IDXL 5FYKL 4GXVL 2XOTA 2IMNA 5SWZE 1JF5A 3P4OA 1V05A 1MCOH 4D9LH 4PLOB 4LSDA 1AXTL 5I8OH 4ZS7H 4AENB 5DQJA 3U0PB 3DSFH 4HJGA 5C09A 3BGAA 3OR7B 2ICWI 1QHOA 2P4AB 1WICA 3L3DA 1UB6B 2HT2D 4FXKB 3OGOE 1OP3H 4JO2H 1ZTXL 3SE8H 4R9HA 3LH2H 4PREA 3D69A 4R96B 2VIRB 5DMKB 2CDEA 3C6LA 3MRHA 4Z7OE 3MFGB 2IALB 1B0WA 5JO5A 1RZIB 2PN5A 1H8NA 2C5DC 3VWJD 3KPPA 1INDH 1FDLH 4ACPA 1CF8L 1MJJB 4LEOA 4DGYH 2ADFL 4XNUH 4G9FD 3M07A 5JW3H 3W11C 1GYAA 4HDIA 3JWNC 5HVGB 5DUMH 4XCCH 1LP9F 1I1YB 2AJUH 3RWEA 1LD9B 2WBKA 3PWNA 4G80B 5CJQL 2ATPA 1P4BL 1XGPB 2NY1D 3CFDB 4JZJB 4YHKL 4ZNCD 4HV8B 3AREB 2ZCHL 1T2QH 1MAKA 3O9WB 1YY8A 3NH7L 1BQHB 5E9DA 2ZUQB 2Y36L 3EJYD 3QPQC 5FYJU 2J6EA 4B7LA 2EO1A 3LS4H 2CK2A 3QEQD 4RAVB 4FNLL 5CZXD 4PJAF 3O2VL 1JPTL 4QT5B 3RGVB 3RNKB 3QEHA 5J13B 3FCTA 4PJEA 2JJWA 3BW9B 1UM6L 5ACLA 3RL2B 1ZGLB 5C9JA 4GLRI 4BQBA 1F4XH 1LEGB 4PB0H 2NR6C 1U91A 2V7NB 1AIFA 3CSPA 1G9NC 4XT1C 4OCSH 4K7FB 4M6ML 3U79A 2GQHA 5EU6A 2AXFA 2NTSP 4HIXH 2VMFA 1BIIB 1L7TL 2IMMA 4BFIA 4RGMC 4KFZC 2E9WA 4HX1A 4LMQI 2C26A 1S9YB 4OZFH 1W8NA 4UIMB 3TESA 2FL5A 4O4YH 1QR1B 5C0CD 4EI5D 1H8OA 4OF7A 1MI5D 3T2PA 3MR9A 3DYOA 3VE0A 4HC1H 3PWJB 4D8PA 1MWAL 2D31A 1DQLL 1MHCA 2BOCA 3D0LB 2EDTA 4Y88A 3B3IA 1I3VA 1V7NH 4X4XB 5HHOE 3HMXL 3RX5A 5HVFB 4CW1B 5HHQA 2DKSA 1F6AA 1PY4A 1YMMD 3BWAA 1LO3L 2ARJQ 2R8SL 8CGTA 3BDYL 2AW2A 4ODTL 3SDDA 3QZWG 4U1KA 4ELMA 1IC5L 5E08L 4KVCL 4OM0H 5TDOA 3BJLA 4U4BA 5EZJA 2NY6C 1FAKT 1S7WB 5GGTA 2G5BA 3MV7D 3NCYP 1FFQA 1WZLA 3SGKC 1A9EB 5L88H 2VDPH 2C7UA 1XZ0B 1MVUA 2CJUL 4BQ8A 1FV1B 4U1SA 1YJDH 2NXZC 3CUPA 1IGFH 2C3XA 3QUML 3ULUD 1T0NA 4HWZA 4KJQD 1OAXL 1MCIA 1CL7I 2FH8A 3I84A 3DO7B 4PJXA 2NY7H 1ZT1A 3HPJB 1TQCB 5FOBB 3KPTA 4OD3L 4Y19B 4K8RH 4DW2L 4JQVA 5F9DC 1BD2A 3C8KA 4P59L 1N59A 4M7JL 2YBRB 4XCFL 1GAFH 2VDKL 3M17A 4NQXB 4TYUA 3C5ZB 3LKPB 1IT9L 1UJ3C 3QWOB 3CFBA 3MRKA 1HIML 2W1NA 4OLZL 4XPGL 2WBJA 1CDHA 5FIEA 3TYGL 3GKZA 3S3JA 4OZIA 1GJIA 1QQDB 5J6HA 1I3RB 4X5WB 5DURB 5KSAA 3OAYK 4X7TB 4ZTOL 3HRZB 5EWIH 5GZOD 4FQHA 4RIRA 1QFHA 2XZQL 4HGKC 4KKCC 4LHJB 3B5HA 1EHNA 1JHKL 3UAJD 3T0EB 1X5FA 3QCVH 3U7YL 1OAUH 2A6KB 4ONHA 2H1PH 1F97A 3HC0A 1FYHB 4JKWA 3FQWA 4MDIB 4MJ5A 1AP2B 4P5TD 5CEZH 4DFIA 1G7MB 2Z91A 3K0WA 1DBBH 1EGJA 1D6VL 2GTWA 2VXUL 5LAXB 2NNAA 1ULVA 3TO2A 3QUYB 1ZA3B 3IS1X 4M1GL 5BJTA 3IFPA 3NPZB 5C0RH 4AEHL 3MACL 3TCXA 2NX5D 5K93A 1EAJA 1PKOA 2O5YL 3STZB 4GKOA 3D85D 4X6DE 3B5TA 4MJ6B 2YK1H 1FZMB 4Y89A 3CDFA 5I8EA 3QNXB 1FNAA 3P73A 5CJXC 3QIBA 4PJ7A 2WIIB 4NUGH 2PO6C 3LV3B 5EBWB 2QQNH 1KN2H 1WFOA 3PHQA 4L3EE 5LGHL 5C6WH 3WS6C 3BUYB 5D1ZD 1CTNA 2VDQH 4P9HC 2IH3A 2Z93A 3U9UB 1WWBX 4G8GE 2R0LL 4P23D 4XI5D 1B2WL 2MQ3A 3CSYB 3QULB 3X11B 3W5MA 2EZ0C 1G7QA 2Q1EA 4W6WB 4LIQE 3CDGA 2UVFA 4Q6YA 4DCQA 5TQ2L 1MH5B 4NRXB 3I50L 4NNPH 3BQUC 1XF5A 3SKOB 4MXWL 4FXGB 3TIEB 1CFNB 2CIIA 1Q0YH 2FDBP 4FFYL 4N0FB 4ODHL 5GHWL 1GIGL 3NACL 5H37G 1XIWC 4UT7L 3KPMB 4DGIH 3P30L 3V9FA 4Y1AB 4G6KL 4U0RC 1GHFL 5IVZA 1JF1B 5E00B 3MXWL 1VA9A 5FB8B 1HI6B 3T8XB 3H6JA 1C5BL 3WHXA 2EYRB 3B83A 3QUXC 2VZVA 2GK0B 1U8KB 2YSSB 2W65B 3PABB 1JZ5A 2XTLA 2Y72A 4KC3B 4M6NL 4PRDA 1A6AB 2UUDH 1OD7A 3SE4C 1OCWL 2W9DH 3CFEA 2WANA 3BZFB 1S9XA 2OZ4L 3BIAX 4ZOCA 4WUUB 5HHNB 3WHE0 2CUMA 3HI6H 2YMXH 3C6SA 4TOYH 3FO1B 5EORH 1I4FB 4LRIA 1A1OB 2EYTB 4KH2A 1TDQA 1I8IB 5E8EB 2LVCA 4G6JH 1DUZB 3QDJD 1H15B 5E5RB 4PD4K 1UZ8B 1BQHG 3OAUH 5HI3D 3U36B 3BP5B 4YK4B 1DVFA 4OQ1A 2F19L 3IU3A 2DLFL 3SDAC 5L2KA 3B2UC 4ZD3L 5D7KE 4AG4L 4P5KA 5LBSH 4X98B 4Y8DC 1QFUL 5DMGD 3I02B 2PF6A 4ZFFA 1ZLVK 3KLHC 2CLVA 1SY6L 3DOSA 4UV4H 3LZFL 5IJKC 32C2A 5AG8A 1LE9A 2ZOLB 2RQ8A 5C09B 5C0JA 2YUVA 3IDYC 2D7NA 4QRPD 4TUKL 3L3DB 5HGDA 4XBEL 3U0WH 5LGJB 4LRNL 2DKUA 3TP4A 4QF1A 2J5LC 4PREB 4G9DA 2A6IA 1S8DA 4WUKL 5J8OA 2CDEB 3C6LB 3AU1A 4G6MH 5HPMB 4YHNA 4KPHH 4YNYA 5D7IB 3WYRA 4NKOB 5I0ZA 5JO5B 3IJSB 4Z7VA 2CGRH 4GJTB 1KYOJ 1IAIM 4KQ4H 1IM3A 4XVJL 4Y16C 2DS4A 2I60L 5J1SC 1A3RH 1AI1H 2Q76A 2UY6A 1MRFL 1D5MA 1EHLL 5HYQA 1NCWL 4JM4H 1TZGH 4MWFA 4NZDA 1AGBA 2PYFA 3GRWH 4W4NA 4PJIB 2ATPB 1QFWH 5K9OA 5C0GB 5LVEA 5IHLB 1S9WB 2W9LA 4MNQE 4N9OB 3K80A 2B5IB 4O02H 3UCRA 1JTPA 5KSUA 2ZNXA 4GRWB 4KRLB 3R0MA 1KUMA 1SVZA 4JFDD 4X6EB 3HA0A 3QEHB 5IBTH 5JLZA 2ORBH 3HE6D 1LGVA 5DD0H 5FYLH 2CXKA 1MFCL 3IGAA 3KYKL 3FO0H 1CU4H 2OQJA 5C9JB 1DSFH 4AEIH 4XXCC 2E6QA 1U91B 3OJMB 3TFKD 4NT6B 1AIFB 4WWKC 3GBML 4LHUD 3V6BR 2ZUXA 4QXTA 1TQBB 3LQAH 1KB5B 5E2VL 5CILL 2B20A 5EU6B 2AXFB 5JA9A 4FQQA 4BFIB 3CNKA 1NBZA 4LBEA 1M05B 4NO2B 1I8KA 2FL5B 4OBRA 2BNRE 1CT8A 4FQIL 3HG1D 2VXTL 3MR9B 3VE0B 4FQXA 4D8PB 4FP8L 4LF3B 3SDYH 4KDTA 1MHCB 3LSOA 2BOCB 4G8IB 5HYFA 3E6HA 2QJDA 2R4RL 5C0FB 3B3IB 3KJ4B 3TH3T 2HYMA 4QGTA 4XPAL 3GI8L 1R5VB 4X83A 3RDTA 4YUEH 4WY7L 4PJIF 1JN6A 3OXSB 5IHUL 4JM2B 5MP6L 4FTVA 2WP3T 2VABA 4KAQH 1MF2H 2IAMC 3ARVA 3EYUH 4NZUH 5TE7H 4CGTA 1CR9H 1MLCA 5TDOB 5EZJB 4F9LA 1BPVA 3S96B 1Y0LB 2JJUA 1MWAA 4GRWF 1GPOH 2G5BB 4LPYA 1YEGL 3SDXE 4JZNA 4LLDA 4PJEF 1X5ZA 3TT1H 3HMXA 2ARWA 1IAKA 4MX7A 2BNUB 2H2PC 5KTEH 4YFEA 1MVUB 2G2RB 4U1SB 2EIBA 3OF6A 3CUPB 5LWYH 4NNYA 2VDLL 1JWMB 1T0NB 4TULH 4LFHD 2JJSA 4JCLA 4GUPA 4S1SH 4PJXB 2LQRA 1ZT1B 2MQCA 4K7PL 1G1CA 1F90L 1RVFL 1BJ8A 3FRPA 3BH8A 3CH8A 4RFOL 3ZDZE 5EULV 1BD2B 4XNQA 4PGCA 3C8KB 1N59B 5DHVH 5IFHH 1B4JH 3E6FA 5ITBH 4XC1H 1EA9C 3CFBB 3MRKB 4OCYH 2Z31C 4TSAL 2WBJB 1XEDA 4JRYD 4OZIB 3STLB 1I7TB 2AJZA 2A74B 1KC5H 3RUGE 1R3LB 4JKKA 1F11A 4G9FE 1DCLA 3QO1A 3O2WL 1D5BA 4FQHB 4TUJA 5D72L 5FYJH 4OFPA 5JW4N 5I71C 4J3UA 2Q8AL 1ZOXA 1HXYA 1F13A 3VFSA 5A16A 3T0AA 5BV7L 1EAPB 2VDOH 5AD0B 4OGAC 5GGVY 5M95B 4HQQL 5CEYA 3HC0B 3HCVA 3FQWB 4MXVE 3IT8D 2Z91B 2BK8A 4HPYH 1I7ZB 1EUUA 2IQAB 2NNAB 3QEQE 2B1HH 5DR5H 4R2GB 2ICWB 4X7CC 4Z76A 1MIMH 4L1HA 1RIHL 4H20L 5KSBE 1IEAB 2WM0A 1D9KC 5F1OB 2P47B 3WFBH 4YDIH 2BXYA 2Q8BH 1MRDH 4IOFC 4I9WD 2H26A 3A6BL 4CMHB 1XH3A 4PJXF 1KNOB 4P4RA 4J3WA 4ZNEA 1MREL 1HOCA 3P73B 3B5GA 3QIBB 1UC6A 4PJ7B 2ZNWA 4XX1G 3LKRB 3RWDA 4EEEA 3PHQB 4HBCH 5ICYA 2QLVB 1AO7A 5T1MA 3G5ZB 3HZVB 1U3HB 4QRRA 3VXRA 3BPNB 4WHYH 1EO8H 4PRHB 1TZHB 2IH3B 2QSTA 2VC2L 1MI5E 1G7QB 4OZIF 2FEDC 2CK0L 3CDGB 1ZHKA 4NBXB 3VGEA 5LQBL 2J8OA 2VXSH 3D5OF 2V5RA 4WFED 4F3FA 3BGFB 3RIAK 3T3PF 1SQ2N 2VLLA 3D87B 3T4YA 1DTUA 1YMME 4Y2DC 1JNNH 4RA3A 1LHZA 1GGUA 1A6UH 2FHCA 3D25B 1NCCH 1E28B 1TPXC 3L9RA 4PJDB 4PS4L 4POYA 5IM7A 3P4MA 3VFTA 5C3TA 1IQWH 3GIZL 4K23H 1WAAA 3WLBA 4YQXH 5DUBB 3EDJA 3MRPB 2VDRH 4RAHA 4QRQA 2BXZA 1NAML 1KGCE 3QO0A 3FT4A 3KLAA 3IDMA 3CX5J 4PTUA 3MGAA 1IGCH 4ZTPL 1XCQB 4ZXBD 3EDFA 2H2SC 3GJEA 4LMQE 3ULUE 1XGTA 4QRUB 4FQJH 3CAFA 4HGMA 2FLBT 1S9XB 3VXMB 5CKGA 5EN2A 1FVEB 2CDFB 4PJ7F 2FECL 2DQJH 2BY3A 5EIVA 2XG5A 5J9PA 3TBVA 1QRNA 2R23B 1GC1C 1DBKL 1P4LA 3IU3B 5KVFL 1NMAL 4GW1A 1D5XA 2MQ0A 4M62H 4P5KB 2FX9L 2OZ4A 3T08A 3ARGC 3DLQR 4D94A 3D39D 2OP4H 3ES6A 3VXTA 1H3PH 1KLUB 5DK0A 3VXNB 1FHGA 3QWQB 4KXZH 1ZWIA 5KS9A 2CLVB 3SGKA 4YHZH 32C2B 3ABZA 1LE9B 3PWLA 1EEZA 3MFFA 3WV0A 3S88L 2QHRL 2X1PA 3JWOC 1CFTA 2VXQL 2Q3AA 5SWZA 1QA9A 4PJDF 1I3GH 4JE4B 1EMTH 1JGVH 4G9DB 2A6IB 1S8DB 5CIPA 4KHXL 3L3JB 1KPRB 4CVXB 4U1GC 3JTTB 1KFAL 3CLFL 4YNYB 1NGXA 3CCHA 4CN6A 4LAQL 3MBEB 2DI9A 5CZXC 4Z7VB 1CLOH 2NX5E 1E4WH 3MRMB 3FQUA 2X9WA 1UJ3A 4LNRA 3RI5K 1S3KL 1HK6A 1YEIL 5HYQB 4M4PA 4WI8A 4Q9BA 4L3CA 3S36L 4X9BA 3BPCA 1RK1B 2DMKA 2PYFB 5CJOL 5IB5B 2HTLD 4CVZA 1DBMH 1FGVH 1I7UA 2GI7A 3TN0D 4ZFGL 3S4SG 4NBZB 2EH8H 3S98A 5F6HI 1MNUH 1CVSC 1YEKH 5FGCE 4E9LA 4XP1L 3QB7C 1T03H 3BEVB 1CE6A 3O2DH 2XWJB 4Z95L 3PJSB 2ITCB 3T1WA 5L9DL 1JHLL 3L5IA 3IGAB 2KUTA 3ALWA 3H0TA 1B4RA 2OQJB 2DDQH 4DOHB 1RUAL 1J0ZA 1ZVSA 1NCTA 2P8PB 3VFOB 4H26B 5C70A 2M8XA 5D5ME 3DV4A 4QXTB 2EEDA 4O9HH 3BDXA 5DSCA 1PJ9A 1QSED 2QADB 4FQQB 4TSCH 5LJYH 4JFQA 3PE9A 1BX2B 3E3QE 3RFZC 3TIDA 1DEEA 3UTSB 3JTSB 1ZHNA 4NC0B 5HD8D 4MAYD 3LEYH 1LDPH 5E0QA 3RBSA 4XTRC 3WS6A 2FJGA 4Z7VF 3MNVA 4WEUD 2VN7A 1M7IA 4L29B 4P4KB 1A7QH 4IIQC 4R6UA 4Z7NE 1INQA 3DGCR 3E6HB 2YPVL 4QCIA 1MCRA 1P7QB 4WTXA 3ULUC 4S1QH 1VEMA 1JN6B 1RD6A 3BQUA 2W0FA 3H3BC 2D0FA 3HAEB 5GGRB 4FABH 3MRIA 1PQZA 3QDJE 2VAAB 4AEFA 1MLCB 5JXAH 3P0YL 2X5PA 1QLEH 4OIIH 5ICXA 3VFVB 1MWAB 4Z78B 3UPCA 5HHOA 2DAVA 5JHDD 4LSSL 4N8VB 4MXQD 1IAKB 5IR1B 3O4OC 4MX7B 4XAWH 3RKDD 1MCPH 3TZVD 2EE6A 4KK9D 3NCBB 2VR4A 3GB7A 3QUXA 3MRBA 1A7NL 4NNYB 4JFYB 5JDSA 1Z0NA 5HHVH 3OKYA 4GUPB 4E0RA 4O51A 4XAKD 4JJHA 1Q9OA 3GSNL 4YDJA 3SE4A 4Z8FH 1F8TL 1NJ9A 3BPLC 4FS0A 5E94A 1YC8A 2NMSA 3BH8B 5CLTA 5LCVH 3U4BL 3J7HA 4GAYA 4P57A 1UA6L 5JHLH 4DN4H 4PGCB 3DMMD 3NZHH 3PWPD 4P2RD 4W68A 5AWNL 3VDCA 3RVUD 1JGEB 3E6FB 3E2HB 5IJVB 2DQUH 1OWWA 4KGLA 4NO0D 4DWHA 5M7QA 5HVHB 1T22A 4RA0C 2LFGA 4YHIB 5I1CL 1JJUA 2HFGH 5ANME 5EO0A 3V7AG 5DVKA 1QLFA 1QFWI 1XCTA 2QEJA 4KMTL 2GUOA 2JELH 4R4FH 1UKTA 1I1AC 5T1DH 3SDAA 5C7XH 3SGEH 1F11B 2XWTA 3NPSC 4H5SB 4P9ML 5DD6A 5DFVD 1T0PB 3EYFA 2P46B 4YPJA 1FLRH 4J4PC 5CMAA 1HXYB 1A6TA 1CE1H 5A16B 4KTDL 3B9DA 3CK0L 5FV1L 4LPWA 1X5YA 1JUFA 3BSZL 1WC7B 2P45B 5CEYB 4KY1L 4TPRL 4Z0BL 2MTPA 5J3HD 5IJKA 3H8NA 1WBXA 4O00A 3FTGB 2VZ1A 4JFDE 4ZFOA 1T20A 4H1LG 4JG1L 4M48H 4Y4HB 1K5NA 3VCLA 1AGFA 4DN3H 4XVUD 4Z76B 1KCSL 5JPMB 3H7BA 4PJGE 2KBGA 15C8H 2CMRL 1FC2D 1G9MH 2CD0A 5ADPH 1TVBB 3CVHA 1BREA 5E2WH 1KIQB 1EIBA 4F58L 2H26B 3TH4T 2NW2A 5EB9A 5E7BA 3TO4C 1HOCB 2HH0L 6CGTA 5GJTH 2EYSA 3ULVF 4NZTL 3RIFF 1MFEH 1N7MH 1NMBH 5ICYB 1QBLL 1J05A 5IROC 3S5LA 4C4KT 3FN0L 2XQBL 3DYMA 3KHOA 3WCYA 5J11C 1MJ8H 3VXRB 1INEL 4ZDHA 3DVFA 4KHTH 4X6DA 2R2BA 4YBQC 2BVEA 3FAWA 4R4BA 5T1LA 2GJ6A 2NYYD 5EFIB 4MJ4A 1FGNH 1SEBB 2FATH 3HG1E 3E3QC 1CLZH 4LSTL 3B9VA 3LEVL 1JNHB 3G6AA 4L3EA 2EDLA 1A6VL 4F3FB 3OXRA 2VLRD 1MCEA 2VLLB 1BQSA 1TTGA 3QXVA 4G8GA 1MCSA 4JVWA 1LEKA 4M9PA 2H32A 5JQHC 4K7PX 4YJZL 5C8JB 5I74C 8FABA 3L9RB 1HEZA 4XXCA 1MFDL 3SCMD 5A43C 4WWKA 4D3CH 1HSBA 5F7WC 5D8JL 2QTEA 3BMWA 1WCBA 3WLBB 1NUFA 1KEGL 3WKML 1IAOA 1KG0A 4ESKA 2RJMA 4ODUA 4P0DA 4QRQB 5I76B 1UACH 3QO0B 5HI3C 2EXWC 2YPLB 3KLAB 3IDMB 1E6OH 3VI3E 4WVRA 2OR9H 1CD1A 4PTUB 4D0BA 1GGCH 3H3PL 1AGEA 1VGKA 3BPOC 5CJ8A 3GJEB 1XGTB 5HI5D 4WTZA 3MGTA 5DMGC 3ZKNC 4IRSC 5L7XL 1RMFH 4P3CL 2BOBA 5EN2B 5MEOB 4WU5B 5J06A 5JOPD 3RWJA 1BEYL 5J9PB 3RNQA 3TBVB 1XF3A 1UWEH 5TQ0L 3WIHL 1FO0L 1UZ6E 5E1HB 2Z8VC 3QXDB 4XP4H 1P4LB 2VL5B 2BFVH 2X7LA 2IAMA 2R4SL 4D0DA 4GW1B 1A7PL 2WZPD 3SJVD 4JRYE 1D5XB 3O6KL 4UNVA 3ARBD 4YIQB 3R1GL 3IAGC 3ES6B 1A3LH 1CLYL 4WJ5A 4L8CA 3VXTB 5SX5K 4MD4A 3P77A 1AE6L 1ZWIB 5KS9B 1NC2B 4PRIE 4JPKH 1L4IA 2QKIA 3T3MF 2D7TL 3IVKB 2AEQH 1UEYA 2DKMA 5CINL 3GHBH 1EEZB 3MFFB 1A7RL 3EYSL 3GSXA 4RAUB 3HNSH 4NCC2 4EXKA 5SWZB 1QA9B 4YHPA 3VH8B 1FZJB 2VLMD 2OXGA 3T09A 2X1XR 5CIPB 3O8XC 3TV3H 3VD7A 3UTOA 1WAAF 4DTGH 1T1ZB 3MV9D 5IK3A 3CCHB 3ROOA 4IDJH 4Y4FC 4PJHE 1P84J 4HIEA 4YHOH 4UILH 4FQ2H 4LK4A 1ZV5A 1DR9A 4LVEA 1UJ3B 4I9WE 4NQVA 3L3IA 2Z31A 4PJCE 4IRJD 4PV8B 2P24A 2FJHB 4L3CB 3VW3L 3BPCB 1PG7H 1NDMB 3S7GA 4G6AD 1HKLH 1I7UB 2M2DA 3AAZB 3U7WH 4Y4KD 3LD8C 3TFKC 3RVXC 1OAQH 2OTWA 5T5NF 3QHFL 4FN0A 4LCCB 4ALAL 3HAEG 5EDXA 4LLVA 2HTKC 5GGUA 1Y6MR 4ONFL 1VFOA 3VGDA 5EOCL 5MENE 4FQLH 3G04A 3NIFE 2J88L 2VE6A 2Y07L 4NQUA 4OCNC 3F7VA 4JHZA 1R3JB 1T5WA 4HWUA 4NOFA 2VH5H 4N8VG 3NFNB 4WFEE 4S1DD 1L0XA 1C1EL 4MNQA 2PW2A 5KS9F 1ZS8A 2F53D 1D9KA 3LIZH 1ZVSB 3MLWH 2XIDA 1MOEA 4LCWD 5D7SH 3JBG7 1BFVH 3DV4B 2QR0B 1UG9A 5DSCB 1LK3H 2ADJA 4JFQB 4D9QD 4ZMAT 3TIDB 1E0OB 1MIEH 1OARL 3BD3A 1U3YA 1ZHNB 4M93B 2R1WA 3H42H 1JI1A 3LKNA 3ZDXE 1YEEH 3MNVB 1UENA 4APQD 5K9JH 4LCUA 1D3CA 1F4WH 5DF0A 4P5MA 1INQB 1CK0H 4QCIB 1RZJL 1TJHL 4GKZA 4NZRL 2IPTH 4FFWD 3RL1A 1BVKA 4Z7OF 2BNRA 1NLBH 3WXWL 4PGEA 1QSFE 1SYVB 1UB5A 3EHBD 4MD0B 4Y2DA 1V7ML 3IDGA 3QRGL 1OTTC 3MRGA 5HHOB 1GRWA 2VISB 4RGOL 1G7JB 3ZE0E 2V7HB 4UOJA 4U2ZA 2CO7B 3BHBB 3B9AA 3GB7B 4FQCL 5I19L 2HKHH 2L7UA 3NCYS 1P6AB 3MRBB 2DYPD 3QIUD 3GMPA 5JDSB 3S36X 1U95A 3Q0HA 4YR6B 5GGSB 4LU5H 5DUPL 4E0RB 4O51B 4X7FC 4WCYL 5ESQA 3U6RA 1Q9OB 4YDJB 5TF0A 3SDXA 2FWOB 4I3RH 1QKZL 3LY6A 3WDHA 5E94B 3NAAL 1HHJA 4GAYB 4P57B 4K3EL 1H8SA 5I1KL 3NABL 5GSVA 1KCUL 4WW2C 3L3OA 3MRFB 4P2YA 1AQKL 5CGYD 1A6ZB 4JFOA 2BVQA 1T22B 1A7OL 1OGAD 4JAMA 2FO4A 1XCTB 2GUOB 1P2CA 3BKCH 1WEJH 5C2BH 1T5XB 2B4CH 4ZYKA 1NBYB 3FKUS 1W72L 2IPKB 4ENED 4NN6C 1XT5A 2A9NL 3GSRB 3EYFB 3VG0L 4UB0L 4L5FH 2ZPKH 3ARGA 5CMAB 3SKJH 4Z6AT 1S7RB 1RZKC 2D0HA 4GW4A 5HDLA 4N0YL 5CEZE 3KR3L 3RUGA 5JA8B 4G9FA 1Q9KA 1T20B 3VCLB 1K5NB 3WBDA 4QRTB 3QDAA 4ZAKD 5ACZA 5I6XC 3RY6C 3OKDA 4OGXH 2OL3L 3NCFB 2X4PB 2R9HD 5FKAA 3U30C 1N6QL 2CLRB 4YPGB 5BV7B 4LVHC 2FYYA 2XKNB 5FCUH 3T1FA 3QEQA 3FMGL 2NW2B 4OCMC 3CVIL 3H9HB 3KDMA 2OXHA 3RVWD 1NGWA 3HI5H 3BVNB 1ITCA 1U93A 4JQIL 4MNGE 5KSBA 3TPUA 1QSEE 4JR9H 5I1LB 1U8HA 2F5BH 3S5LB 1V3LA 3LKSA 4OCWL 5CWSB 5T5NG 1ZMYA 4PY8I 5EPMB 5DT1L 4ZDHB 2R2BB 2N56A 3ORJA 1EUTA 3B4NA 4R4BB 5T1LB 4J23A 5HGHA 5C6PB 4GO6B 1KCVH 2R2HA 4TVPH 1Z5LA 1MVFA 4GMSH 5FDYA 2HT4D 4JO3H 4XC3H 5DJXB 3G6AB 4L3EB 3IF1B 3GKWH 4K9EL 4ZXBC 1HINH 3HC4H 1LEKB 3KPSD 2H32B 3U82B 2DQDH 5DRNA 1MI5A 2JIXA 8FABB 1ZHLA 4GSDL 1JZ3A 1UWGH 1QLRA 2QSQA 2A1WH 3SGJC 1T7VA 3VH8G 3B2VH 4Z9KB 2J2ZA 2NQCA 4HK3J 5DEZA 1IAOB 1KG0B 1YMMA 4ODUB 3MQIA 2IFFL 2X4RA 2GK2A 2HVKB 5F8QC 3WUWA 1U8NA 4RZCB 1NGYA 1URLA 5F7EL 5IW3A 1FL3A 5IEKA 1RZFL 1ZKAA 3UEZA 1NL0H 4LSPL 4P49A 2LU4A 2VZTA 4QXGL 4UT6L 5C07D 2CDGB 1DQJA 1YJDC 2DM4A 4XAKE 4YDKL 2BOBB 4R8WL 4IIQA 3RWJB 1KT2A 1NAMB 3HNTH 2FB4H 1OF2B 1XF3B 4RISL 5TE6H 5HYEA 3M8OL 3PWPE 4P2RE 3WFDH 3WSQH 5FDWA 1LO4L 1TJGL 4CADB 4NN5C 4MA3A 5FHBH 4ZS6D 4GBXB 4BQCA 2IAMB 4MZ2A 5JMOC 1UYWL 1QD0A 2ESVD 3K7UA 5I8OL 2AGJH 3VGFA 4WJ5B 3VXUD 4L8CB 1Q9WB 4WGVB 4MD4B 2K7PA 1NFKA 2BJML 2IAND 3G9AB 5KANI 4HEME 5HY9A 3WIHA 1MUJA 4U1NA 3GSXB 3MJ9L 3QFDA 3U48A 2FBJL 3D3VB 3HC3H 3TN0C 1FPTH 2DQFB 1NC4D 2Z9TA 4HEPG 3MCLL 1JK8B 3UO1H 4JFHD 1IGTA 4LEXL 5IK3B 3SE9H 2JF1A 3ROOB 1W8OA 4IOIA 4DGYL 4HIEB 4JREB 1NBVL 5D7JD 1AD0A 4Y5VC 1RZKL 5BRZD 4OLYH 4FHBD 5E1AB 5CP7B 4HCRH 2BVOA 4MS8D 3CMOL 3BZEA 1MFAH 4BFBD 4ZQKA 4XPBH 3ZL4H 1I1AA 1U3JA 1T7XA 5C0EA 2OTWB 4HIIA 2NX5A 3G5XB 5I71B 1WZMA 1I1RA 5ETUB 4HKBA 3MRJB 4LKCA 4LLVB 3D85A 5GGUB 4PGJA 3N1GC 5I75B 1NUDA 3WN5B 3F65A 3PQYA 1FE8H 3G04B 2UUDK 4GAGH 5GGRY 4M5YH 3IXTA 5FYLE 1T5WB 4WHCA 3MOBH 5HD8C 4B41A 5I15H 2HVJA 4RWYH 2BX5A 2VLRE 1D9KB 4QHLA 2DQEL 3HE7D 4P23A 2C1PB 4ODVL 5GRVL 1JPFA 3OG6B 5I8KH 3MOAL 4MQXD 5FXCH 3SE3C 2ADJB 1MEXL 2OMNA 4XXDA 3TO4A 3BXNB 1FBIH 1IAMA 4P2OC 2V5TA 3T0VA 3FO9A 4H88L 2R1WB 4HUMB 5F9WC 1GGIH 5IROA 1GOGA 1ROWA 2VZOA 3GBLA 5D5MA 5D71L 3U4AA 5J12B 1VKXB 2AV1A 3HNVL 4LCUB 3LDBC 4MSWA 4OQTA 3RKDC 3V52L 4KK9C 4GKZB 2CKBH 1JE6A 1RFDH 3RL1B 1C12A 1BVKB 2AERT 3V0VA 5F9OL 5EIQA 1J86A 3TA3C 2JTDA 5JOPE 3BYYA 4JVPA 4I0KA 4PGEB 1UB5B 4R26H 3BDBA 1F2QA 3MODH 3FN9A 4Z18A 3AMKA 1AFVL 1KJ2L 4M7ZC 1BWMA 2QQQA 2GW5A 5EZOH 3DMMC 3SJVE 1FN4A 5B39A 1GZPB 3RVUC 2APWA 4XBGA 4JPVL 1LO0L 4CU8A 1YNLL 2GKIA 3QDJA 3JXAA 3QSKB 2BSRA 3MLYL 3DARA 3GMPB 1XR9A 5DD5H 1U95B 2WWMC 3TNMB 1JFQH 4QXUL 1A8JH 2NTFB 5ESQB 3PP4H 3SDXB 2HWZH 5IG7B 5F1SA 3D2UD 1DQDH 1H0DA 2Z35B 4JDVA 3VXOA 1MCWW 3JSSA 5IQ9B 2UZIH 3ESUF 4HFUL 1HHJB 3UTPE 3GSOB 1X6LA 3VGAB 2VLME 5I18H 5F6IC 1M6OA 1T0MA 1VESA 5DZLA 3MV9E 4HZLA 2VQ1B 4OLUL 4JFOB 1BZ9B 2BVQB 4KQ3L 4JAMB 4HK0B 4ODSL 4Y5YC 1P2CB 3GSNB 3P40A 1HH9B 5L2JA 2IEPA 3EDDA 4ZYKB 5AG9A 4MQ7B 2AI0H 2J1KA 4NHCH 5GGVH 5FYJE 4PB9H 5ICZA 3K81A 3QCVL 1WLHA 1F3DJ 4KK5D 3DI3B 3PDGA 5TE4L 4Q9RL 4JZOB 2WAHA 5C9KA 3BESR 3IU4L 1FL6A 4HW6A 4JO1H 3VRLE 1N64L 1DBBL 3HPLB 4GW4B 1NCBL 3U9PL 3VWJB 4Q0XH 3RUGB 4I4WA 4B50A 5D1XD 4CN4A 3QQ3A 1AHWB 5JR1L 1KLFA 2V2XA 3OKOA 2QQKL 1W72A 5C0AE 3OKDB 4G6FD 4G3YL 2GCYB 1MJUH 2NY1B 4N0RA 3SDDD 1BM3L 4KKLD 3O8XA 5FKAB 1K4CB 4U1GB 2PR4H 2XT1B 1R0AH 3TJEH 2F53E 2FO1A 5E99H 5JOFB 3MUJA 3QEQB 4JFDA 5HDOA 4WTZG 2QQNL 1EDQA 4L9DA 5F7DB 3SDXF 3KDMB 2ZUUA 5KSBB 1ODAA 5IFAH 1ZA6B 3H9YA 3LKSB 3LQAC 1Y18A 2OL3A 4YE4L 3SHSA 4ORGB 1QBML 5BMFH 5HGHB 1EVUA 1Z5LB 3IKCA 1IC4L 5DTFA 3QHTC 5DEFA 2ZUVA 5F96H 4HLZG 3GJFK 3ZDZF 3RWHA 5EBGA 1DBJH 5ALBH 3GSWB 2AAVA 1HZHH 5H37H 4RMWA 3Q1SL 3EOYG 4KJWC 5C0CB 4EI5B 3AB0B 4G8EA 3HG1A 2X89D 1MI5B 2OLDA 4NUJA 1ZHLB 4JFEE 3RUGF 1ZHBA 2VKXA 4MAUH 2B0SL 3ARDC 3T04D 4KUCD 1QEWB 4NM8L 5A2KH 1YMMB 4NO5B 2X4RB 2R29H 3MLXH 5E5UB 3GNML 1FJ1A 1MHPH 3WUWB 3ESVF 4J3OC 3GGWA 1U8NB 4IS6B 1FL3B 2A73A 1CFVL 4TRPL 2ED7A 2PCPA 4MXVF 3ARBC 4F8TA 5I1IH 1DQJB 3MO1A 3MV7B 4U7KA 3UYRL 5DJCA 4NC2B 3KGRA 1OSPL 4IIQB 5KSBF 3A6CL 3V6ZA 2EICA 1KT2B 2OI9C 3ECBB 5D1QC 4KI1A 2YS4A 3CMGA 1UH4A 4ZUVA 5FDWB 1S9KC 3FT3A 4XHJC 1TFHA 1OAKH 4MA3B 4EXPX 1JMXA 1OGAE 5DJ2B 1N5YH 3L5JA 2X4TA 2WNGA 4L8BA 5CUSH 3FOLA 3S9DB 1AGCB 5J4MA 4WW1A 4G7YL 4Y0GA 3ARRA 4UQ2A 3TT3H 1VEOA 5HY9B 1LEIA 3OAYH 3K2UL 1TJIL 3O4OB 1FO0B 2D9CA 1MUJB 4WHTA 5E56A 4I3SL 2EDJA 3DVNA 4U1NB 3EIFA 2JB5H 1G0XA 3QFDB 4BKLA 4JRYA 4XGZB 3LQZB 3V4PL 4NJAL 4G6AC 3EW3B 4GG8A 4Y4KC 1K6QH 3D9AL 5DVNA 4P99A 1QACA 4PRIA 1ZGLP 4HUUB 1Q72L 1PLGL 3R8BB 4RFNC 3BIBX 5J56B 4X80H 5MEQB 4L8SC 1EJ6A 1F3JA 3NA9H 4WW2A 4P5TB 5TF1H 1D6EA 3CIQA 3OZ9L 2SEBB 5B8CB 4S1DC 3ZYJA 5GS1B 4HS8L 4X7SL 4ZQKB 5IBUG 5T3XH 4R0LC 1CDIA 4UINL 4PJHA 4PJBE 4HS3B 4U3CA 5D4QA 2H3NB 5FGSA 1U6AL 3PGFL 3EO9L 2DBLH 2NX5B 4HIIB 5C0EB 1IL1B 1R3HA 4GRMB 4FFVD 2X1OA 3DGGB 3ULUF 3D85B 4WIQA 1UEMA 4PJCA 5DD0L 3Q6GH 2OTUA 1ZVYA 3L7EA 5SWSA 5GS0D 1R5WA 4U7SA 4JQXA 2HFTA 2BSED 5BXFA 2KQMA 2R0KH 3UJIH 5LXGH 1J8HB 2RHEA 1FZOA 3AXLA 2GSIA 3NTCH 5FGCB 2HVJB 4OJFL 1CGTA 5D1ZB 5JW5A 1YEHL 1JWSB 1UKSA 3RA7L 2E7CA 3VU2A 4JFFA 1DVFD 4QHLB 1W0YT 4P23B 2VR5A 5L2KD 3KPSE 2X10A 4OIAA 5MENA 5ILTL 3SO5A 1JPFB 1OY3B 3QG7L 4FFWC 3A67H 5E8NA 5GRWA 2X9XA 4TVSa 1OP5H 1RZGA 3BOVA 5AYQA 5GGSY 2AQ3A 1LDSA 2IGFL 5GRUH 5KVDH 3G6JA 4UV7L 4XP5L 2NY5H 1TIUA 3LPWA 4D9RD 1MQ8A 4TVPD 5I16A 4EUPG 5A2FA 1YZZA 2P7TA 2AV1B 2CRMA 1U8PA 3IRZA 2EDNA 4JN1L 4K3HA 5C1MB 3IFLL 4XPFL 4YO0A 1WZKA 4MSWB 3WHE1 3LS5H 2F5AL 5C07E 3BI9X 4OZFA 12E8H 4LARH 2B2XH 3FFCB 5CGTA 3SKUD 4DAGH 4F33A 1PVHA 1C12B 1C16B 4DUVA 3QFJE 5H35B 3CD4A 3HTLX 4M6AA 2Q86B 3VG9B 1SM3H 3DIFA 4K7PY 4PIRF 4ZXBA 4N90D 5J0BA 1NLDL 3QRFM 3BWUC 2I9LA 5B39B 1AKJA 2B39A 2ESVE 4XBGB 4OUUA 3SGJA 1NFIA 1J10A 3ARTA 1S7TB 1IZJA 2E8ZA 1QSFA 3VXUE 4BSVA 1QG3A 1RU9H 3KPQA 3QDJB 2IANE 4HXBL 5FYKU 1VFBA 2HG5A 2LTQC 1ZLVH 1PSKL 4NWTL 4ENEC 2IQ9L 3X3FL 1BVLB 1H0DB 4JDVB 4MJ2A 4HWBH 1OAZH 2ZKHH 5IFHL 4OLXL 2ICWJ 3EDKA 4WHYG 3WNKA 4JFHE 4K71B 1KBGL 4XVTH 2D7QA 4YBHA 2UZYB 3FB5A 1JGLH 3ZSSA 4QRPB 5D5MF 1RURH 3B9KC 3DX6B 3K8MA 5BRZE 2AJ3A 4H8WH 4IM8A 1U8JA 3WIIL 1BOYA 5E8DL 2APTA 2R9HC 3G9VA 4IHOA 4XMPH 3WXVH 1IC7L 5BW7C 3VJ6A 4ISVB 5JIIA 1TCRA 4TQEL 2R2EB 4K2UH 2RBLA 5ANMB 2W0KA 4BSWA 3EGSA 3CPLB 1KJ3H 4IJ3C 3RVWC 4I4WB 1LO2H 3QQ3B 5DK2B 3QEGH 4Z7NF 2P43B 4QTIH 4M1DH 1D5IL 1CQYA 1X5JA 4HZAA 1I8MA 1M1SA 2V2XB 4GQ9L 4JY5H 3RDTD 1W72B 4V2CB 4G5ZL 3D18A 2DM3A 3TN0A 3UPRA 4FTVD 3EOTL 4XPHH 4MA7H 3AUVA 4N0UA 3BKYL 3DTXA 2HT4C 4Z7WE 4PJ9C 4JFDB 4Y5VA 4OI9A 4BZYA 3ZHLA 4JN2A 5D2LE 5I1HL 4TTGA 4AY0A 3HE6B 3MUGA 1LMKA 3TWCH 4MHHG 3GSQA 5EU3A 4PJGB 3V0WH 3OF6D 1Y18B 2OL3B 1XAUA 3NFSH 2X4SA 1JRHH 5IHZA 4K3DL 4R7DB 4PUBL 3KPRE 4LHUB 2BC4A 2JB6A 3IKCB 2WW8A 2FNBA 4MNGA 4E41E 5DEFB 1QSEA 3CXHK 1E4JA 1I9RH 1N0XH 1J0HA 3UTTD 3RWHB 4F7EA 3QPXH 4LLWA 1A6UL 4KKAD 3IJYA 1MRCL 4G8EB 3HG1B 4MCZA 4NKIL 3FZUD 1NGZA 4ONGH 3V6OE 5HYIA 1IQWL 4NUJB 2X6MA 4PPTA 2FLRT 5DJ8A 3TEUA 1ZHBB 5J6GB 4O2FA 4RQQA 4J6RL 1J7VR 1KIPA 2W91A 3P9WB 3OBAA 2RR3A 1KN4H 5D93B 2AEWA 3SE3A 3QI9C 1FJ1B 5EBMB 3GGWB 5TDPA 3O45A 4P2OA 2ARJB 3DUHA 4YHML 1HN1A 2A73B 4XNYH 2PCPB 5F3BA 4NGHH 3QXTA 3MO1B 3U1SL 2N1KA 4NRZA 4XP9L 4KRMB 4Q74A 4OV5A 2XZCL 4HIJA 2XFXB 2R1XA 3MRDA 2RIKA 3QA3B 2YEZA 3FB6A 2H9GA 3Q5OA 1EO7A 4PJGF 2B1AL 4YAQB 4ODWA 2ZG1A 3LHPL 3MUZ1 3WFCH 1EFXD 1MCBA 4ZUVB 5DS8A 5KVEL 1JYNA 2HKFH 3NFPA 2BY1A 1Z3GL 3FQTB 4L9LA 3P4NB 3JUZA 1UM5L 2X4TB 4L8BB 2EDXA 4YHZL 1AO7D 1E6JH 4WW1B 3C08L 1FORL 3RWFA 5I1DA 4QRRD 3DMMA 1JHTB 3EOBA 4P2RA 3TVMC 5EA0H 4EBQL 2MMXA 1AR2A 4OGYL 4JVUA 1LEIB 4NO0A 4GKNA 4PBXA 5I30L 1MCLA 4MS8C 5IQ7L 3UJTH 1MFNA 1KB5H 4IMKC 2WWKO 1F42A 1X5GA 2WUCL 2R56L 1PZ5A 2C4FT 1MPAH 2RFXA 3HZKA 4ELME 1BVZA 1F3JB 3TLRA 1C5CH 5DD1H 1FLTX 4WW2B 1P4IH 3HR5A 1RZ7L 2BSSB 4YXKL 1D6EB 2YN5A 1ADQL 4I2XA 1G9MC 4Y5YA 4YFLI 5TH2B 4F7TA 3VFRA 1CG9A 1X5IA 2VDNH 3QNZA 1X6NA 4K3GA 2PTTA 4GXUN 3ZKSD 4NN6B 3MOQA 3VI3F 4I3GA 4MJID 4EKXA 3MMEA 5DJ0A 3RPIA 4UMGA 4MQXC 3FONA 3CH1A 4PJCB 2EDKA 2OTUB 3JV0A 3RWIA 3DRQB 4M7LL 3GRWA 2P5ED 3P11H 3N1PC 3B8SA 5KVGH 5BXFB 4HUWB 1AH1A 5AEAA 5I8CA 3QCUH 3KPOA 3BT2L 5F1IB 1FZOB 3AXLB 1MAMH 5I6XB 4LQFL 2BY0A 1UZ6F 4U0QB 5JW5B 1P9MC 1CDBA 1CGSL 4P2CG 3N9GH 5CZVH 2O5ZH 1IM9D 1A6PA 2VLKA 1FRGL 2DM7A 4WDIA 3DV6B 3V5HA 1XR8A 4X0KB 2VDML 5E8NB 5EUOB 3OL2A 3S3SA 1MFBL 2XRAH 5CKAA 1RZGB 1KSRA 2F8OA 4LASL 3V6OC 5C3LD 2FX7L 1ND0A 3BKML 4HG4K 1NGQH 2VLRA 3HRPA 1PX4A 4ZG1A 1N3NB 4LCYB 3C5JB 5ADOL 5IESH 1FAIL 1PEZA 2G60H 1F4YL 2NXZD 1I9JH 2V5YA 3PV6B 2P7TB 1JNLH 1U8PB 2UYLA 4K3JH 5C0IA 1IJ9A 5DRZA 3P9LA 1GVIA 4WW2F 5JQ6L 4YO0B 2UWEE 5GRYA 5I1GL 3P0GB 1N26A 4OZFB 4JEGB 1CFSB 2BERA 2VUYA 4JB9L 4F33B 1A9BA 1NCNA 4XVSL 4X6CE 1QSZA 3C60C 3GZKA 2FBOJ 2DQIH 4EDWH 5AZEL 3FB8A 1KB9K 3KJ6L 5IT2L 2EC8A 4ZXBB 4QKXB 3SDCC 3NGBB 3SOBH 3AM8A 1YUHA 2I5YL 2VLJB 5KANG 4TNVF 2VO5A 4BH8A 4PJCF 1EGJH 4F7PB 4YFDB 3RVVD 4OFKA 1BLNA 2FR4A 1JYVA 2XZZA 3PDOB 5D2NE 1KPVA 1NSNH 4LVNC 4BSVB 4NN7C 3WMSA 4XP6L 3KYNA 2FJFA 4KKCD 4PJFE 4HMEA 1FFPB 1VFBB 1U9KA 2HG5B 1IBGL 4JY6A 4X6FA 3DURB 3L95A 3RZCB 1OQXA 5C92A 3SJVA 3NIFF 4MA8L 1KELL 3ARBA 3MV01 3D39B 2V9RA 4BFEA 3S37X 5IMOB 3ARED 1ITBB 3WJLA 2P49B 3MBXH 5HGBA 1J5OH 4TNWK 1AQDB 1T4KA 5D1XC 1EO5A 1LVEA 1CI5A 3FB5B 1UXSA 4LHUG 5D1QA 5T1DL 4DKAA 2EE9A 1WQVT 1NDGA 4A6YL 4HWEH 1CBVH 6FABH 1UCBL 1U8JB 5D96B 5HHXH 1CE1L 3SQOH 4KKLC 3MNWA 4DKEL 3ARSA 3MV9A 2PO6D 4E5XA 1PY9A 5DQ9A 1TCRB 4PJ8C 1CFBA 4KRPC 1Q0XL 2YR3A 4BSWB 3ZDXF 3EGSB 5TGBA 3WJJC 5F9AC 1OWRM 3KWWB 2DIAA 3ZE2E 4C59B 4JFZL 1MCQA 4LVOB 1Z9SA 2EZ0D 4LQ1A 4H1LH 1I9IL 1X5KA 1I8MB 4M00A 5FHAL 1UT9A 3D18B 3TN0B 3UPRB 5ADPL 4Y4KA 2DIBA 5GRVK 4M8QA 2HA1A 2J4WL 3S97C 2A9MH 1XGYL 1XIWD 3KPLA 3W9EB 3DTXB 4LCIH 1RULL 5I9QC 3KYMA 3CFKA 1NANI 2XN9D 4NFDA 2KQNA 4L8SA 2MCPH 4Y5VB 4YXLL 4OTXH 5C0AA 1WV7T 3IDJA 3CZJA 1DE4A 1EXUB 3ZE0F 3GSQB 1JWUB 2WINA 1L9MA 5AYUL 2X4SB 4D9RE 4LFHG 4TVPE 3ARQA 4BZ2L 1VHPA 2Y7QA 1DQMH 5MERA 1WZ1H 2JB6B 2DBJA 4MNGB 2FIKA 3QH3A 1J1XH 1QSEB 4LSQH 4RRPA 2MPAL 4XMLL 3L3GA 1RIVL 5FF6B 5HDQL 5KG9A 4ZPVA 4LLWB 4EI6A 1DBAH 4YHLH 4MAYB 3IJYB 3FO2A 4MCZB 3VFWA 1NGZB 5JMRA 3HS0B 4N90E 1EERB 4OLWL 3DBXA 4R90L 5DJ8B 3SDAD 2ZOKA 4O2FB 2HN7B 3IDXH 4RQQB 2AQ1A 5FYKH 4GXVH 1KIPB 3O6LH 1X5HA 1XGQA 4NJ9L 4U6HA 2W60A 4YHYB 1AXTH 4CBPA 3WNOA 5TDPB 3KLHD 4U6YB 2J6EL 2CH8A 4RMQA 4XNXL 4JFEA 5D6DA 4PP1D 5DURD 3S35L 1CZ8H 5MEPB 5F9WB 1F4HA 2FGWL 1TVDA 3SKNA 3LPFA 5D2NC 3ZSTA 1ZTXH 3KNBA 3MUY1 4PGBB 5JHDB 5DHYB 2NCMA 3BEWA 5I1JL 3TBSA 2YEZB 1JTTA 2H9GB 1JV5A 3QUZB 3TZVB 3NN8A 1ZXQA 3PG2A 1PAMA 2Y23A 2DYPA 4X7EC 2AEPL 3QXAB 5DS8B 4S1RL 2R39A 3DX7A 5BS0D 4BZ1L 1CF8H 3QR2A 2ADFH 1U41A 4Y16D 2DLEA 4L9LB 1EFQA 2BVYA 4HS6A 5HYJA 1HHGA 4Y5XC 3RWFB 3GHBL 1ZT7A 2HP4A 3GMQA 3EOBB 3PWPB 4P2RB 4YHKH 1YEJL 3GSUB 1JGUL 2DMCA 2B4CC 5ENWB 2GJ6D 1ZANL 4NO0B 2ZCHH 4YXHL 3BO8B 3T2OA 1ZVHA 3NH7H 1OGAA 2F15A 3GBNL 2Y36H 1HQ4A 5HI4C 4JGJA 5JPNA 4M61A 3I75B 1CXIA 1X7QA 4FNLH 4OCRL 3O2VH 1JPTH 1F6FB 1XMWA 5CSBA 2R0WL 1OPGL 3ZTNL 3MGOA 1UM6H 4UILL 1PZ5B 4AL8L 4G8GD 2EDEA 4YEEA 3UZQA 4PY7A 5HYSA 1M7XA 2P44B 4TUOA 5GGTL 5AZ2L 1E4XL 3W9DB 5DXWA 3ZKXC 3Q6FB 2M26A 1I1FA 3HR5B 5GS2D 1F00I 2HAZA 3ZKQD 4M6MH 3O6ML 2JK5A 2PETA 4F7TB 3B9KA 4ZAKA 4NQCE 1H9VA 1L7TH 1YPZE 3X12B 4Y1AD 3L3HB 5TFSL 2W0LA 3F7PC 2E6JA 3MLTA 2W38A 3HAEH 4DEPB 2H8PA 5BW7A 2ICEA 5DMJB 3QCTL 5DJ0B 3RPIB 3CH1B 3GO1L 2EE3A 4JANB 4I77L 3RWIB 4J8RA 1MWAH 1DQLH 4JRXB 1WFNA 1ADQA 5C0DB 5MI0C 1RUPL 5BZWA 3KPNA 2X70B 4PJBA 3HMXH 2OX5A 3UTTE 1LO3H 2R8SH 4OD2A 4U1MA 2HMIC 3BDYH 1UQSA 3O2DA 1TLKA 4ODTH 3FOMA 35C8L 1IC5H 5E08H 1B0GA 5L8LB 3VI4F 3V5HB 1XR8B 4NRYA 4PJ9A 4BJLA 4TTDD 5KN5A 5DLML 5KSVA 3JWDL 3HLAA 1CIDA 1H5BC 2VLRB 4V1DB 4GS7C 2CJUH 3NIDE 3QUKA 1QYGL 3KPSA 1YEFL 4ETQA 3LAFA 1U2HA 1SHMA 3QUMH 3ZTJG 4ZUSA 5D7KD 3K4ZA 1OAXH 3CSGA 3O6FD 2UYLB 3KYOA 5DRZB 3SCMB 2QV2A 5IV2A 1I8LC 3UTQB 5ERWA 1RJZB 1A9BB 1T2JA 1X9QA 1DLHA 4DW2H 3UBXA 4ZPTB 3S6CA 1UWXK 4FQLL 1F02I 1FC1A 4M7JH 4XCFH 5CSGA 2VDKH 4OF6A 4EN3C 5BO1L 3FB8B 3K8KA 1IT9H 4XPGH 1HIMH 4OLZH 5CD5C 4FG6D 3TYGH 4ERSL 1YUHB 5DJAA 4RX4D 5C07A 4BH8B 3UDWA 1NCUA 5KJRL 3PL6C 3DRTA 3QFJA 4C57C 3DETC 4MLIA 4ZTOH 2FR4B 5E4EB 4Z5RA 2NY0C 3O3BA 4HULB 1AO7E 1M71B 2XZQH 4OZ4B 1JHKH 3GHEL 1VPOL 5CHNA 2FJFB 2X4NA 4EIGB 3U7YH 5KW9L 3QI9A 2E3VA 4RDQF 1S9VA 3OAZH 4NIKB 4X6FB 5SX5H 5IOPB 2O5XL 1PD6A 2BRQA 3ZMRA 1VACB 1D6VH 4F37F 2KL6A 2VXUH 2ESVA 3CU7A 3RTQC 4MMZC 4MZ3A 3VXUA 1FCGA 4M1GH 4MNQD 2AKRA 4XMKL 2IANA 4AEHH 1JNJA 2C1OA 3BAEH 5E8PA 1OM3L 2QQLL 3MACH 2YD9A 3BKCL 2OI9B 3ZYIA 4M6OL 1MLBA 2O5YH 1UXSB 4XCNB 5DJ6A 1NDGB 4HMDA 4WV1C 3D6GA 2KKQA 4EVNA 4X4ME 2ITDA 1NC4A 3MRRB 5SWQA 3VFPA 3MV9B 2XICA 5LGHH 4JO4L 3N0PB 5INDA 2HJLA 4GAJL 4MJIE 2R0LH 5BRZA 5GS0L 5MHSE 4AJ0A 1B2WH 1LO5A 4BA8A 5ISZD 1V3KA 4IRJB 1RUKL 4LDLB 3MA7A 5F6HJ 2P5EE 3HHRB 2FEDD 5TQ2H 3I50H 3MJ7A 4IMKA 2C9AA 4ZO9A 2BNRD 4MXWH 3DYPA 4U1HB 4Y4KB 5GHWH 1Q94A 4FFYH 4M8QB 3ARFC 1GIGH 3NACH 4UT7H 3AGVA 2BP3A 4Y2DD 3P30H 5ESAA 3U0TA 4G6KH 2QBWA 3KYMB 1GHFH 3CFKB 1S7XA 4F7MA 4L8SB 1FNEB 1RUML 3LKOA 3LCYA 5E24E 4HUVB 3KG5A 1DE4B 4JM2D 1IGIL 1C5BH 2WINB 4KKAC 3VXSD 3VGHA 1FSKC 4ZUTA 2N4IA 2F53B 4Z7WA 4M6NH 3HE7A 3HZMA 4PJAB 4O58L 4LCWB 2Y7QB 1OCWH 5D2LA 2H2SD 2DI8A 4ZO8A 2VITB 3QH3B 3LMJL 2OZ4H 5K33A 1HINL 1S78C 5C0BB 1J1OL 3CU1A 5DMYA 5IMMA 1YMHA 4EI6B 3GMOB 1N4XL 1RJLA 3KPRA 2DQHL 2YUXA 3OJ2C 4NP4L 3VFWB 4X5LA 4E41A 2F19H 4APQB 2DLFH 1FH5L 2P1YA 5TDNB 2ZOKB 3RWCA 4ZD3H 4AG4H 1JTOA 3Q3GA 4HGWA 3ARGD 2W60B 1RJCA 1QFUH 4M43L 2G5RA 1T1XA 4M03A 1SY6H 3OB0K 3V6OA 3VRLF 5FK9B 1DLFL 5H94A 4BH7B 5EOQL 5I1EL 3MRNA 1KENL 1W0VA 4TSBL 2AJYL 3SKNB 3FFDA 3LN5A 1QNZL 3BYTA 4XBEH 4LRNH 2Y5TA 4K94L 1QO3A 4PG9B 4Q6IB 4WUKH 3TBTA 3WUZA 3BEWB 1JV5B 2PXYB 3QDGB 1FYTA 1GH7A 5CBEA 4U6XA 5JW4Q 3QIUB 2DYPB 3QWRD 3EYOA 4XRCA 4XVJH 2I60H 1J12A 3HUJA 5FECB 3MLRL 3D2UA 2VXVL 4N1EA 1L9NA 1MRFH 4J3TA 1EHLH 2X4QA 1NCWH 4KK8D 5DZNA 2NXYB 1TVHA 2GJJA 3RVTD 5DDHB 1ZT7B 1BF2A 1ZLUK 1FIGL 2Z8RA 4RDQG 1CGYA 4OI8A 3UJJL 3V7MA 1OGAB 1HQ4B 4J3XA 5JPNB 1X7QB 3MTRA 3ET9F 1SJEA 1RY7B 3SE9L 1CIUA 2XA8L 1ACYL 2RB8A 5DD3L 5B3JE 4LPTA 3IXAA 4PRHD 1MFCH 2DQTL 1HSAA 3SKMB 3KYKH 3OV6A 4MNHA 3F58L 1C08B 1UVQA 4NDMA 3W2DL 4PY7B 5HYSB 4P46C 3VFNB 3WO4C 1YN6B 1R3IL 2JIXD 4L4VD 4TUOB 1JZ6A 3S34L 3X13B 1F58L 2V17L 3GBMH 5D1XA 3UX9B 3E1F1 4JG0L 2XN9E 5DWUL 5GJSL 5E2VH 5IF0A 5CILH 2JK5B 3QIWD 4ZAKB 3UC0L 4MGXA 3QQNA 1R3KA 2VWEE 3MLTB 2UY7A 3H3KA 2EH7L 3STBA 2HFEA 4FQIH 2EDDA 1G7LB 2VXTH 4M3KB 4PJ8A 2AK4D 2FZ3B 1L0QA 4PYGA 4XTRD 4FP8H 1RIUL 4J8RB 3ULVL 1G9EA 3QISA 2Y5EA 2KDGA 5BZWB 1KGCD 3KPNB 2R4RH 4GRLB 4XPAH 1S7QA 2GJZA 5DO2C 5AUMB 1JZ4A 3WFHA 4ONOA 4WY7H 3OKLB 3S35X 2VR9A 5IHUH 4OD2B 5MP6H 2FHBA 3FOMB 4ZFZA 1B0GB 4L8DA 3VXMD 1MHHA 5CSZA 4GAFB 4NRYB 1YEGH 2YWZA 5KSVB 4QXWA 1S7UA 3QAZB 2XNAA 5EU5A 3ZHDA 1FFOB 1BQLL 1NMCB 5T5FL 4MVBD 3QUKB 4UTBL 3KPSB 3LN4A 4DFHA 4AK1A 3K2MC 2X89A 3RVVC 1Q1JL 2EKSA 3OKMB 5LG1A 4Y2OA 1FVCA 2A2QT 2R0ZL 4NHUA 3ALPA 5IV2B 3PGDB 1PGRB 4K7PH 1HHHB 1F90H 1RVFH 2Q7YA 4QYOB 5GISL 4PG2C 1DLHB 1BBDL 4RFOH 5GSRA 3RQ3A 3X3GL 2AVGA 5CJBA 1XF2B 4PRAA 3V4UL 1HQRB 4JZJC 2UWEA 2ZUSA 5FYKD 2W92A 5C07B 4GKSB 3F12A 1XF1A 5BS0E 4ODXA 3AREC 1WCQA 3QBTB 3ELAT 3O9WC 4X6CA 1I1AD 3O2WH 2WUBH 5D72H 4PJBF 2Q8AH 1TETL 1ZT4B 3VWKD 1K85A 4XWGH 4QLRA 5CHNB 4NNXA 4J4PD 2X4NB 5BV7H 4FQ1H 3JZ7A 5ESVA 3U2SA 2GJ6E 4HQQH 1S5IL 4HUNB 5E6ID 5C86A 3PQYD 1EH9A 2BVPA 3DI2B