4EOWL

Crystal structure of a disease-associated anti-human gm-csf autoantibody mb007
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
211
Chain Sequence
SVLTQPPSASGTPGQSVNISCSGSSSNIGNSYVYWYQQLPGTAPKLLIYRNNRRPSGVPDRFSGSKSDTSASLAISGLRSEDEADYYCATWDDSLSGRLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MB007 human IgG1 Fab fragment heavy chain
publication title Molecular structure of human GM-CSF in complex with a disease-associated anti-human GM-CSF autoantibody and its potential biological implications.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eowL01
4L9LA 2R2BA 4AQOA 3VFMB 4IM8A 1PDKA 3ARDD 1OLLA 2VQ1B 3O3UN 2OI9C 1TETL 2YPLD 2D7TH 2L7JA 5C0ND 1G7MA 1KULA 1BVKB 2CIKB 2I5YL 1FORH 5H94B 1H5BC 3QUYC 4XTRD 5F6HJ 3S35L 4LRIC 1FV1A 2DTSA 4KZDL 4QXUL 4ZFOA 1TENA 4H8WH 5D7IE 5K9KB 5BOZG 4Y16A 4XNMA 2NY0B 2OJEA 4KTEH 2EDJA 4AQ1B 3HPLA 3RWJA 1WWAX 3QDJB 1A1OB 2QSCL 4NQXB 5IROC 5ISZE 1EA9C 4ONGH 5KSAA 5ILTL 3M1BA 1U3ZA 3D48R 4YK4B 3VXOA 1P6AB 4LCWE 2AK4D 1YEIL 5D7JB 3TA3D 5I1LA 4F9LC 3U9PH 2H2SD 2F53D 3NN8A 2ESVD 3QUMB 4MQ7A 4UQ3B 5C0GA 3VGDA 4HIHA 5DJZA 5GGRY 1D5ZA 3IETB 4X6DA 4GKSA 5BCAA 2O61B 5J3HC 4U1MA 3WXVH 1VEMA 1KJ3L 4R7NA 3S5LA 3ULVL 4I0PA 4TUKH 5J13B 2VE6B 4HXAH 1U3HA 4LCCB 1C8PA 3P0YH 4UT7L 4Z7OF 2VABB 4QEGA 4WI2A 5IK3B 4KVCH 4N0UA 3QUZB 5BV7H 2JLLA 2VR9A 5I16B 2FYYB 5IEKB 3G5ZB 3U30B 1IVLA 5F9AC 3QCVL 1A6ZA 1EBAA 3O3DB 4NQVA 1W2KT 3QDGE 1N6QL 3TNMA 4LQFL 1JFQH 3IRPX 4KQ4H 1ZHBA 3DI2B 5HGHA 4YQXL 2H1PH 1QSFA 3IYLW 1XF3B 4PGCB 5IFJB 1SY6L 3MV11 5F9OH 1MY5A 1KPUA 4XBPA 1L6XA 5T3ZL 4KQ3H 5T3XE 5JW3L 4MAYB 5GS0H 1TJHL 2OCFD 2FSEA 2KQMA 3Q6GL 5CILH 5LGHL 1RUAL 2OL3A 3EOBB 5INCA 2Q20A 3MLZL 3DROB 3SOBH 5IHZA 4XWGL 1X5JA 5EU6B 1XIWB 1EHAA 1CGYA 4O2FA 5F89A 3BISA 4OF3A 5A16B 5DYOA 3IS0X 4OZFB 4DK6A 3LN9A 2BY2A 1JYWA 4D9QE 1Q9KA 2GTWB 2Z31B 3NCCB 2F58H 4GKNB 4YGVA 1MHPL 4M61B 4W6WB 4M9OA 1UA6L 5BQ7A 1ZA3A 4OI8A 3W9DA 1NLDH 1BWWA 2K7QA 2VZVA 2DQEH 4PUBL 5I74C 1IZJA 1NCWH 1KLGA 5I2IA 4UU9B 4U6XA 4UNVA 4ODBD 1RZJC 1IC7L 2XZAL 4QNPF 5GXBB 3MV8B 3E2HB 3NPSB 3P4LA 3T3PF 2N7AA 2B4CH 1YEKL 4HEPG 4KPHH 2VIRB 2P7TB 3UYPA 3T4AA 3DRTB 1WF5A 4IJ3C 4Y16D 5IMMB 4WW2F 5AD0B 2Z8VC 2ZUXA 3WE6B 1A2YB 3LQZB 3JV4A 1C12B 5IESH 5KSAD 2EDQA 1ZK9A 5GGRB 1T5XB 3SGEI 2MQ3A 3JV5A 1F4YH 4FQHB 3ARZA 5KSBA 1YEJH 1PZ5A 5C70A 1UQSB 4XNQA 3RWFB 1CBVH 2F19H 2W59A 1DBKL 1FDLH 4XB7A 4QHNB 1D9KB 1IM9A 2WNGA 2OX5A 1G0XA 4I0PD 2VXSL 5ENWA 4MB3A 1U3HD 1RJLB 3SE9H 4Y2DC 1G7QB 1CDHA 4YHYC 1FAIL 4DKDC 4ZYKB 3ABZA 1IC1A 4HS8L 4LSUL 3TBWA 4HIXL 4M6NL 3Q48A 2EDLA 2R0ZL 4ALAL 1UH4A 3HB3D 3DMMC 4XTRC 5DHVA 4ZUWA 1A3LH 1WGOA 4LSRH 4GAYB 4KGJA 1L7TH 3QIUB 2M26A 4OIBA 5FYKD 5EU3B 3IXTB 4KC3B 4U2YA 5GIRB 3PWJB 4JY6B 4OM1L 4ODHL 4ZNEA 1QSFD 3CDCA 4PJ5E 1MCRA 1P7QB 1BM3H 3W9EA 4XVTH 4HKZB 2DICA 3OWEA 4OFVA 1WC7B 2PYEB 1QPPA 4LVHC 4XVSL 1LNUA 3SO5A 2BZDA 4AH2A 5E7FA 3IXAA 2AKRB 1YY9D 4UV7H 1KEGH 3TZVA 3GBNL 2GK2A 3MV9B 5CBEB 1MFAL 4PRPD 1X5AA 3HG1A 4KTDH 3T3ME 3ZDYF 1M71A 4IOIA 1T03L 4PJCA 5JOPD 5FM4A 3UTPE 2QL1A 4GXVL 2EDTA 4V1DB 3X13A 3MXVH 3FN0H 2YD1A 1OT2A 1T7VA 5ETUA 1YQVL 2J3SA 2AK1L 4EI5A 5IVXF 4K7PH 5CSZB 2CR3A 4MA8L 2ADIB 4W6YB 5HHQA 1HHJB 4M4PA 5H35A 3CDGA 4XC3L 3RHWF 2W9DH 1J1OH 4P3DB 5EH1A 1GGYA 4JPWH 1KXQE 1K4CA 1OLZA 4JG0L 5CFHA 3AXLA 4OF8A 2AGJL 2GJ6E 3C5ZB 4WI9A 4XAWH 1QFWI 3GNMH 4GSDH 3WO3B 1GZPA 1LO3H 1RHHA 3IDMA 2A6DB 2DBJA 4GRWE 5CJQH 3B5GA 1W8NA 5FHAH 4AZ8A 1NMBH 1N3NA 1QOKA 2R0WH 3F8UB 2Y1VA 4PJBA 1AQKL 3IU4L 4JKKA 2FX8L 35C8L 3NVQA 3G5YB 1M05A 2J6EH 2AVGA 3DHJA 3QA3B 5FK9B 3DX9A 1D6VL 3MCKA 3PQYA 4QT5B 1I1FA 3RBGA 2DM3A 4MB5A 1AP2A 2AJVH 2XNAB 4HJJL 4JB9H 4QRQA 5C09E 5IM7A 4PY8I 3PNWA 1CGTA 4KDTC 1KG0B 5K9JH 4WI3A 1JNHB 5HHOE 1IM3A 3R06B 3UROR 1QEWA 3SGDI 4K7FA 1IM9D 1B0RA 1TTGA 1PG7H 5EBWB 3EFFA 3VMOA 1KLFA 3MYJB 1CVSC 1KOAA 2Z92A 1AGBB 3TYFB 1GC1H 3WLWD 2J12B 4OLVH 4Z9KB 4JREB 5D7KE 4NDMB 4F8TA 4ELMB 1VERA 1XF2A 4D0DA 4J8RA 5KN5A 4NQCB 1AKJA 4KRPB 5K9OA 5KSVB 1A02N 1S5IH 3QNXA 4NWTL 4JRWA 5H8DA 2DL2A 2W65A 3HC0B 3GGWA 1HEZB 4CJ0A 5IMKA 4NO2A 4Y16C 3ZKSD 1KYOK 5DMKA 3LRHA 4LARH 4A6YH 2V5SA 4BFIB 3QO1B 2A73A 3FQWA 4LSDA 5EIVA 3QDGB 3ZKNC 4OZGB 3PHQA 2VXUH 1BFVH 1A14L 2EDXA 2RFXB 2I07B 3MBEC 3LZFL 3DYOA 2BNQB 1QNZH 3SKMA 3TZVD 1RK1B 4WENB 1ZEAL 3HG1D 5C6PB 3KLAB 3V2AR 3OKEA 2BVPB 4LP5A 2XFXA 5EC1B 2ILLA 5C08D 4PJXF 2B1HH 1DUZB 2A83B 4NT6B 4U6HB 5DEFA 5HHVH 3IJHB 3GSQA 3VFWA 2PR4L 3PL6C 5EIIB 1XF1A 3BPLC 3PV6A 2PXYD 5FF6B 1SEQH 4EI5D 2EE9A 2NY6D 1DBJL 1FLRH 3TVMA 2F74A 4JFQA 3HPJA 1KELL 5DK2A 1TZHB 5AAWA 2RB8A 4OFDA 3DSFL 5C0BA 2B7DT 3BKCL 1AHWC 2NY4B 3QXAB 1EAJA 5C0CB 5SX5H 3MUJA 4I3GA 3ARRA 5E8EB 1QSEE 1UENA 1TZIA 3NTCH 3MLYH 4J4PA 1KIUA 4WHTA 4G9FA 1ACYL 3DECA 1MJUH 3ZTJG 1H3WM 4HV8B 4Z7UB 2JE8A 1LE5B 2EYRB 4PJGA 5C07A 1MNUH 5JHDA 4PBWD 2ZG3A 1JV5A 4Q2ZA 3LHPH 3P77B 3MRNB 4XC1H 3RA7H 4DWHA 4L29A 1YY9C 1N5AA 3PQYD 3EYQD 1FP5A 4M8QA 4NRYA 3GMOB 4F7CA 4QRTB 1A4KA 4J2XA 4M6OL 4F80A 3BDBA 4NOFA 5IB5A 5DUMH 3OR7B 4MDJA 2QQNH 5E4IA 2MSPA 3C5JA 3B2UD 3VFVB 2JB6B 5BRZB 1QKZH 3F7YA 4Z76B 3RWHB 3SKOA 2Y6SD 4F2MB 1RK0B 2MFNA 1H0DA 1DQDL 3FZUC 2X70B 3RWEA 1FIGH 4GT7A 4NQUA 3MRQB 2JCCE 1GIGH 2DQGH 2CPCA 1ZLSH 4X4XB 1P4BL 4P5MA 3BWAA 5T1DH 4CKVX 4HHAB 4X80L 4QTIL 5JIIA 4KFZC 1MCPL 4HF5L 5IQ7H 1ORSA 3IDNA 3HUJF 3RTQA 1HILA 4Y7MA 2OR8A 1LEIB 4PGZA 1U8PA 1HDMB 3Q0HA 4YBQD 1B0GA 4M7LT 2W91A 3SHSA 1BLNB 2Q86A 3MLSL 5EB9A 4XT1C 4K9EC 3QI9A 3OKOA 2C1OB 1KC5L 4NO3B 4I9WE 3GSOA 2DOCA 4YDIH 4KV5F 3P4MB 4G6AD 4HMEA 5D4QA 5SWQB 4B53A 3FO0L 3D39E 2CRMA 3VXNB 4TRPH 3E0GA 2NY2D 2BRRH 3WFEL 3TF7C 1I9JH 1NEUA 1F3JB 4JPKH 1ZWIB 4P3CH 3ZTJH 4RFOL 2WANA 3SQOL 3BPCA 3H0TB 1A4JA 1NFDA 3C5SB 5EOCJ 1G6VK 4R90H 3RVTC 5ALBL 5FO7B 1PKOA 3TN0B 1R3IL 4ZO7A 1B88A 4X5LA 3TO4B 4U6YB 4LK4A 5JXEA 4OF7A 1Q94A 2AV1A 4HWBL 2Y7QB 4PP2B 4S1SH 3AMLA 2J2ZA 4MHHG 2FDBP 3TVMD 4R6UA 4KK8D 3WS6A 1U3YA 3I85A 4H25B 2MPAL 3SO3C 5BXFB 2BSSA 3EYSH 3PWPB 3GUTB 1GGIH 4YE4L 1JHKH 1IGMH 5C0BD 1HHIB 2YHGA 2ERJC 3KR3L 2F5BL 4HS3A 2HN7B 3AS2A 3IT8D 3MJ7B 4JFDB 1E27A 4CVXB 4X99B 1T66D 1M7IA 3STBA 2EYSA 4J4PD 1AI1L 3QEHB 3X12B 3GSNA 4G9FD 4M48L 4JGUA 4UIKH 5F7UA 2FBJH 1FNSH 2GHWB 3DURA 5C07D 5JHDD 5JOFB 2Q3AA 2BY0A 1KN2L 1RIHL 4UTBH 1TVHB 3HZVB 1VGKA 3V4UL 3QPQD 2AJUL 1UC6A 4AIXA 1RURH 1KBGH 4U1HB 2MJWA 3U7YL 3CNKA 4LF3B 5MEND 3ARBA 3RZCC 1J0YA 3LS5L 3J7HA 5HDBF 2VSDA 4X5WA 4E42B 4QLRA 4PBVC 3TYGL 3ZYOA 1C1EH 1CXIA 3EYUH 2OZ4L 3N06B 3BQUC 1XR8B 2YEZA 4NCDA 3C60A 1INEH 2PXYC 5HHME 4QHLA 1F11A 3TT1L 4MNGE 4UINL 3O6LH 1CT8B 4OGYH 2NY6C 4IIQC 4F15B 2WWKO 2H3NA 5IJVA 2AXFA 4PG9B 5L7XH 1VPOL 1F58H 1P5VA 3VG0L 3KYMA 1GL4B 3P9MA 2DBLH 3OKKB 5IB3A 4M02A 5IOPB 1DEEA 1YPZE 4JZJB 4YHNA 5EO9B 1I3RB 3AS1A 5BMFL 4FQ1L 2VLME 1ZSDA 3FFDA 3HS0B 2UWEA 1MELA 5E5RB 3RTQD 3GM0A 4PJIE 1GRWA 1G9MC 5MERB 3TCLB 1T89A 4R4FH 3MLRH 3TC9A 1NPUA 3OKLB 5L2JB 2CLRA 2D0HA 1ODAA 1MFEH 2ZP0T 2C1PB 3TNNB 4PJ7A 3S98A 5IIEA 3HMWH 1ONQB 3QI9D 5E6IB 4DKFH 1YJDH 3O4OB 3PGDB 3RGVC 2V9QA 2VDQL 3L95A 1U0QA 4P59L 2EH7L 1MWAL 2E7CA 1JF5A 4ZUVB 2QQKL 3EYQC 5JQ6L 1KB5B 3QHFL 4MA1C 4QGYA 1BVKA 4RIRB 2CIKA 1J1PL 1G1CA 1BEYL 2CK0L 3BD4A 5H94A 4DGVH 5C2UB 1ND0B 4ZS7L 4GFTB 1ZXQA 4W70A 1LDSA 1IBGH 5EWIH 5SX5K 4NPYB 3U0WH 2JK5A 1V05A 1IQWL 5K9KA 3MZGB 3IU3B 1BD2E 4RWHA 5JXED 4JG1L 1AR1D 1MCJA 1NDGB 2L0DA 1A1OA 4NQXA 1WFNA 2QJDA 4X0KB 3S88L 4I3SL 1ZLVK 5AWNH 4AEIL 5EO0B 5JIKA 3BW9B 3ISWA 3MLWH 2R69H 2H6PB 3IKCB 2VXTL 3QUMA 4UQ3A 1I3GH 3IETA 2O61A 4JEGB 4EN3B 2UVEA 4BELD 4LCCA 5I8OH 5M7QA 3MNZB 1ADQA 3ULVE 4AEEA 4NHUB 4Q9QH 1KENH 5IK3A 2VLLB 3RJQB 5IVXB 4XMPH 1DR9A 2MCPH 1ZOXA 3QUZA 2NY2C 4FFYL 5I16A 2FYYA 5IEKA 3ARBD 3G5ZA 4F9PC 3DO3A 5CJ5A 1F45A 4KK6D 2CD0A 3MNWB 3O3DA 4Y8DC 4BSVB 3S36H 3GHEL 3LY6A 3BXNB 3V5DB 4LVOC 3OJDA 2ADFH 3C60D 1GGBH 1YYML 3VI4F 2BJMH 1NAMH 1XF3A 4PGCA 5IFJA 2W9LA 3G08B 4WUKH 3T1WA 2IFFL 3BPOB 2HTLC 3HC3L 3T2QA 1O7VA 4D9LL 2QSVA 3BIBX 5D93B 4HT1H 4MAYA 1NC4B 4HKJA 5T3ZE 2EDRA 4QCIB 3ZTNL 3EOBA 1E6JL 2QEJA 4OD2B 3QJFA 3DROA 4KZDH 4YO0B 3NCFB 1T66C 2FNBA 5DQ9B 1BBDL 5EU6A 1XIWA 4JFHD 4LAQH 3MGTB 4P2QE 3WN5B 5HBBA 1FZKA 4P4KB 1FGVH 1FO0H 2P49B 5I75C 5A16A 2VZ1A 5GISL 3RHWK 3U0TB 2HJKB 4DGIH 3ZHLA 1WLHA 4JR9H 8FABB 2GTWA 2Z31A 4OCSL 5EOTB 2Q8AH 5F7EL 3QPQC 5ILTH 3QNYB 4GKNA 4MJIB 5GRVK 4M61A 4ODTL 3HFML 5HVGB 3MRKB 5CP3H 3RPKA 1A5FL 2CSPA 3LEVL 4UU9A 3WIHH 5T1KB 1DL7H 3VU2A 4OFYA 3TCXA 3HC4L 1J8HB 4CVUA 4LFHD 3QDAA 4MSWB 3T0EB 2FD6L 5DS8B 4NZUH 1W0YT 5CJ8A 4K55A 3DRTA 2GYSA 2NY0D 5IMMA 2IAMB 1P7HL 2BFVL 4PBXA 5AD0A 1KFAL 1T2QL 3WE6A 1A2YA 4O5LL 3PWNB 3LQZA 2WIMA 4WFHE 4X6BB 1C12A 4U1SB 3ZDXE 4LEXH 4HIEA 3I3BA 5GGRA 3O2VH 2AJ3B 1T5XA 3HE6C 5TF1H 5D7JD 4FQHA 1OSZB 4Z7NF 3GRWH 3LDBC 1UQSA 1OAKH 3I50L 3PGCB 1MFNA 2PN5A 3RWFA 4W6XB 3OG6B 2B20A 4QHNA 1D9KA 4PJXB 2J8UE 4ERSL 4X8JB 1CIUA 5DA0B 1MCWM 4U3CA 5I73C 1RJLA 5FUZH 1RUAH 1G7QA 4FA8A 1ZLWK 1I9EA 1K8DB 3B9AA 2GITB 4ZYKA 3QUZD 3R0MA 2R2HB 1CN4A 4XH2B 4XNUH 3BJ91 4WO4C 3VD3A 3N85H 1N7ML 4KVNL 5FDWB 4NKIH 4GAYA 4J12A 4K71C 4KDWA 4L4TB 4UT6H 2OJZH 3V6ZB 4LKXB 3QIUA 3TIDB 4DZBB 4ONHA 5CMAB 3ME0A 1A7QL 5EU3A 3IXTA 5GIRA 2BERA 5CCKH 3PWJA 4JY6A 3VXRB 4PRBB 4JHWL 1P7QA 1YNKL 1AR1C 1G7LB 4X7TB 1HOCA 1WC7A 3NPZB 4MAYD 5ID1A 2PYEA 5LKNA 1IC7H 5KVDH 4MNGB 1OAQH 3U36A 3BEWA 2AKRA 32C2B 3DNKA 3GKZA 3MV9A 5CBEA 1QVOB 1N0XL 5EU6D 1XIWD 2BP3A 3N0PB 4YHIB 3VG9C 25C8H 4LPYA 3SDCC 5DUPL 4YX2L 3B4NA 2XZQL 3AREB 2VH5H 4HCRL 2Z31D 4N9GB 1BZ7B 2VAJA 1ES0B 5CSZA 1YEGL 1AGDB 1PX4A 3ARWA 2ADIA 3HNSL 5ANMB 1HHJA 1ZE3C 3QFJB 1EERB 4NZJA 4P3DA 2DLEA 4Q6YA 3WS3B 5DMYA 4WCYL 3KPLB 3AAZB 4OFYD 3C5ZA 3W81A 5JUEH 5GJSL 3IDIB 4ZOCA 4NN5C 2A6DA 2P5WE 4MCZB 2NZ9D 2E6PA 1TVDA 4G6ML 3ARQA 5L8JB 2R8SL 4H26B 5I8EB 3KPQB 4ODVH 1TCRB 3G5YA 4NQEE 4BH8B 2AABH 3QPXL 4PJFF 3QA3A 5FK9A 1A3QA 1FNLA 3E8UL 5KZCD 2R1YA 4OTXH 5E2TH 5D7IA 3LAFA 4PRHE 4QT5A 4CGTA 2NX5B 2QADB 3CXHK 1L0QA 4U1LA 1BQSA 2XNAA 3WD5H 4XPAL 1QRKA 4WFEE 1T89C 2ITCB 1UXSB 5EN2B 3F7RA 5ISZA 1KG0A 1RMFL 4GMTL 1SHMA 1JNHA 4I77H 1AXTL 1KYOJ 3CVIH 2ADJA 1OL0A 3P2TA 1D9KD 4LCWA 3K8KA 5I1KL 3MA7A 5EBWA 4LMQE 4OI9A 4Q58C 3MYJA 3TYFA 1AGBA 4HPOH 4P48A 4FXLA 4CUCA 1E4WH 5FYJH 2AAVA 4TVPH 3ALXA 2ZZUT 4NDMA 4NYLB 3RNKB 2KQNA 3WJJA 5KS9E 5JDSB 3BE1H 1CFBA 4JPIA 4JLRB 4NQCA 1IJ9A 4JVPA 5KSVA 5CJXA 4OF0A 3QZWG 2XQBL 5FOBB 1KJ2L 3H9YA 3QIUD 3HC0A 2R1WB 3T77B 3S4SG 4WUUB 1HEZA 4Q74A 2V7NB 2YK1L 3SKJH 3ZSTA 3UTZA 1JVKA 4MA8H 1DQJB 1P7QD 4N1CA 3QO1A 1NGYB 4XC3H 3QDGA 2OK0L 4OZGA 1JGLL 3BJLA 1H8OA 1NGQL 3QNZB 4JHAH 1CR9H 4HS6B 2PYED 2RFXA 2I07A 4JG0H 2XY1A 4X6EB 1WAAE 5D7JC 1RK1A 4DAGL 3MV9D 4M3JA 3RUGF 2ED7A 3WIIL 3O3AB 4GG8A 2X4NA 3KLAA 2BVPA 4I18B 3GJEB 4CVZB 1JZ4A 4PJAF 4YXHL 1DUZA 3TV3L 2VDML 5SWZE 4MA7L 4NT6A 2YMXL 4U6HA 3SBWA 3IJHA 3JSSA 2FX8H 5E99L 5J13C 3DI3B 1A1NB 3OF6A 5EIIA 4XMLH 1MRFL 2DQTH 5FF6A 1J0IA 1YNTB 2FBOJ 1JTPA 3LMJH 5D6DC 3QUZC 4XZUB 3LN4B 4K94L 3BP6A 4XP5H 4WV1B 5A2FA 1Z2KA 1LP9E 3GDBA 1TZHA 5IWLC 1KB9K 1OT1A 4FABH 3ZKXB 4ACPA 1PQZB 3DVGB 4JFOB 1CG9B 4PGDB 3C5ZD 3S7GA 5GZNC 4MQXD 5FGCE 5E8EA 2JELH 3MTRA 1YUHB 4M5ZL 4XCFH 4TSAH 1JRHI 2IPTH 4ZS6D 5IBLC 2PO6C 4Z7UA 1LE5A 1U93B 2EYRA 5EUOF 2VLKE 4L9DA 3A6CL 3P77A 3MRNA 4GMSL 1Y18A 1CQKA 5CWSA 2M1KA 4JPVL 5GGUA 1L7IH 3LIZH 1TDQA 4NUGH 4BSWB 1N2RB 3GMOA 1XIWC 1RUPL 4QRTA 1PZUB 4OLYH 4F58L 5IJKA 3LVEA 5ISZD 2AEPH 2B39A 3OR7A 5FM5M 5T1LB 3JV6B 3VFUA 3VFVA 5JW4R 1QLEH 2JB6A 4LCWD 2DKSA 2Z31C 1U8NB 2H2PD 3CZFB 4O58L 3W0WE 4Z76A 1FH5L 4NGHL 1SYSB 1WBYB 3JUYA 4P2YA 3RWHA 4CNIA 3T2OA 4F2MA 1RK0A 1FRGH 4K07A 1K4DA 4XRCB 6FABH 2X70A 2NY1D 3CLEH 3UJTL 4AM0A 3HZKB 3MRQA 1X7QB 4X4XA 3T4YB 5F93C 4LEOB 4D8PB 4HHAA 3ZE0F 1YEFL 3S8WA 2CKBH 4NQCD 3NIDE 3U1SH 1RI8A 4KRPD 4IEFB 3E2HC 5DJXB 4WY7H 4PJDE 2NZ9C 1LEIA 3WFBL 1S7TB 3GMLB 1HDMA 5F72S 2ZWLT 1A1MB 5DR5H 5F7DB 1F6LL 1FVCB 1BLNA 2E27H 2AXJA 5FECB 3BYYA 4ZDHB 3BFOA 5ABDE 3QDGD 2ENSA 2C1OA 4NO3A 5HI3D 2QQLL 4FTVE 1IGCL 3CH1B 3P4MA 4O4YH 5SWQA 1A7PH 1W72L 3EUUA 4K23L 4PJ5A 3VXNA 1GGCH 5IHUL 1VDGA 1LO0H 4N9OB 5C71A 2HKHH 4LSTH 1F3JA 1J12A 2ICWB 3QRFM 1ZWIA 4EDWH 1T7YA 1Z0MA 5EORH 5CGTA 1DE4B 4LOUD 4GRLB 1UJ3C 1BJ1H 4BZ2L 3H0TA 4QOKB 1GGTA 2DJ4A 1WFTA 3OF6D 3C5SA 5KANI 4G6KL 3BGFC 3KPRB 1VHPA 5I1HL 5DGQA 5FO7A 3TO4A 5GZOD 3DUHA 3RU8H 1I7ZB 4U6YA 4J3WA 4PP2A 3VCLB 1DBAL 2N4IA 5I15H 5DWUH 1YEHH 1CZ8H 2YWYA 1GOHA 5BXFA 1AGEB 3PWPA 3ORJA 4Y8AA 4XCEB 1HHIA 1Z3GH 2EKJA 2NY4D 5TQ0L 4H8WC 2HN7A 3L9RB 1YEEL 2DLFL 4JFDA 4NM8H 4CVXA 4X99A 5ADOH 4OIAA 3KWWA 3LB6D 3X12A 5F7NC 2C7UB 3B9EA 4OZHF 4P9HL 3EO9H 4YBHA 5HD8D 1IE5A 4HUKB 4RMUA 5TE7L 15C8L 4LLWB 1UEYA 1NCAL 1DLFH 3R4DA 3WSQH 4XPGH 4JVWA 2A74B 3DSNA 5KJRL 2FJHB 1TVHA 3QG7H 4Q9BA 1NJ9A 4LF3A 1E0OB 1RHFA 1LO5B 2OSLB 3QUXA 4CN1A 5A3ID 4E42A 1A7RL 1FLTX 3B5HA 2WAHA 1W0WB 1CU4H 3HR6A 5LVEA 3MRFB 5DUBB 1XR8A 4LPCA 5C2BH 3KGRA 1SEBB 1UM4L 5DD6A 1EJOH 1CT8A 1D5BB 4ZO8A 4KKAC 4PG9A 5F88B 2ATPB 2XV6B 3PIQB 3OKKA 4UDTA 5IOPA 4JZJA 5EO9A 2YD2A 1I3RA 4OF6A 3D25B 5K59F 1OHQA 1H3PH 1B2WH 4R4BB 1INQB 3VDCA 2VLRE 3IFOB 1ZHNB 1Q0YH 5MERA 4U31A 3TCLA 3NA9H 4ZS6C 3OKLA 5L2JA 4MXQD 1F6AB 5C0FB 4NZRL 2C1PA 3TNNA 4U49A 4RBPK 3UBXG 4AL8L 4S0SD 4HQQH 1EIBA 3GK8L 1ONQA 5E6IA 3PGDA 4PREB 5DMJB 5IMLB 4ZUVA 3KR3H 1KB5A 2NXZB 4PJ5D 4DKEL 4R26L 3TBYB 4RIRA 4QHMA 1K6QH 1FZJB 4P0DA 1S9VB 1JNNH 1ND0A 4NBYB 4AYFA 3U4EB 4KHTL 2H2PC 4Y4FB 4NOBA 5GGVL 4NPYA 5GS3A 1KN2H 2QHLA 1AD9B 3OHXB 3HHRB 4HC1L 3IU3A 3HRPA 3TO4D 3QDME 4JREC 3TFKC 1YN7B 1AO7E 4R97B 3UTPD 4G7VL 1NDGA 3MACH 4X0KA 3MV7B 3D2UB 4NKMB 3STLB 1NDMB 4X6CE 1I9RL 1MIML 4KRPC 3PWPD 5CJXC 4PLKD 5F96H 4N1HB 1LILA 2B4CC 2CLVB 2E9WA 1I8LA 1CGVA 5EO0A 3P30L 3VJ6A 3BW9A 1MJ7L 4JFDD 4JRXE 3TT1H 1LK2A 2H6PA 3CZJA 3NMEA 1EHLL 3MFGB 3QH3B 3BZDA 3QXVA 4QRRE 3X3GL 3MLXH 4EN3A 3H9ZA 2V2TB 2WIIB 5CEZD 2FB4L 1J10A 2LFGA 4KHXH 3MNZA 4PR5B 1QSEA 3Q2CA 4NHUA 3T3PE 1H8NA 3RL2B 2VLLA 3R1GL 5C1MB 5CZVH 4NUJB 4JM4L 4HWEL 3JWOH 3IB4A 3QUXD 3MNWA 4JN1L 4BSVA 2Q3ZA 1T4KB 4H1LB 2R0KH 4NJ9H 3BXNA 3EW3B 3V5DA 2WSKA 4Y5VB 1K5NB 2D7MA 2W0KA 1ZGLB 3BZ4B 1WZLA 3ZKQD 5F8RC 3VH8B 1A8JH 5I1DA 4N90E 4KK5D 5GZOC 4LLUB 2QQKH 1G1YA 1QRNB 4N0CD 3P0GB 3PHSA 5GRUH 1NC4A 4XI5C 4KRLB 4UQ2B 5CS7A 4PJFB 4ZS7H 1MCNA 1B90A 4OD2A 4X4ME 3G9VA 4YO0A 5D8JH 5DQ9A 5EZJB 1GZQB 4R96B 3LB6C 4HLZG 5EG6C 3MGTA 2JCCA 2FCBA 1FGNH 3OJ2C 4P2CG 3H2WA 1S7VB 3MODL 4P4KA 4PJ9B 5MP6H 3L5XL 4PJHE 2PTTB 3U0TA 3V95A 2HJKA 4PRNB 1OM3L 5DO2D 8FABA 1CXEA 3K2UH 5EOTA 1ITCA 5E6ID 4U7SA 3QNYA 4MJIA 1LWRA 1HHKB 4I3SH 5JOEA 1OWWA 5F1IB 1JPTH 5HVWA 1N64H 2NMSA 2UY7A 2CKNA 1CICC 5A3IC 3EJYC 4UZGA 4LBEB 3G6JF 4URTB 5T1KA 4BK5A 3HAEG 1GGUA 3P9WB 1J8HA 1EVTC 4PJ8C 3T0EA 2F8VA 3INUL 4IMKA 5DS8A 1X5LA 3CFKB 3W11D 1EEYB 1KCRL 3REWA 2HRPL 1JWUB 1DQMH 2JB5L 5F9WB 4I1NB 3ZDYE 1J87A 2EZ0D 3PWNA 3F7QA 3KJ4C 3IAPA 4X6BA 4U1SA 4TNVF 3P4NB 2AJ3A 5FFLA 1FYTB 1OF2B 3SDXE 1UWGL 4HUXB 4DK3A 4YXKH 3D1MC 5I66B 1IC5H 1YYMH 2NY5L 3GIVB 4Z7WE 3V6OE 4K8RD 4IDJH 3PGCA 4MXQC 2EECA 1I4FB 1QBMH 1A9EB 4Z8FH 1TTFA 3CVHH 4GW4B 4EDXB 4PJXA 4PJAB 4EN3D 3B83A 4X8JA 1RU9H 2BVYA 2HVJB 5CGYC 3LN5B 3KJ6H 2R4SH 1QSED 1U8JB 3GMRA 5DTFB 3O9WB 5FYLL 1K8DA 3CC5B 2GITA 4FXGA 5AUMB 4HLZH 3IDYC 4XH2A 3Q3GB 3WHXB 2R56L 3FQRB 2EDDA 5FDWA 1ZT4B 5J9PB 3HMXL 3D3VB 4C58B 4L4TA 3V6ZA 1JZ2A 4LLYB 4Y4HB 3NCMA 3TIDA 4DZBA 3L5HA 4F3FA 5HHXH 1ZGLM 5CMAA 1EEUA 1GC1C 2YZ1A 4LVNB 3VXRA 3TN0C 4PRBA 2VZTA 1J1XL 3QXWA 4GAGH 4UV4L 1G7LA 4X7TA 5C6TL 2YUWA 5K93A 4U6TA 2R0LH 3M17B 1JGUH 1BAFL 5EU4A 1NC4D 4OJFL 1N8ZB 3RWCB 4Z77B 3HAEH 5EUOB 1FNFA 1IKFH 1JI2A 3N1GC 4MNGA 3MJ9H 4M7ZC 3G9AB 3S97C 1KCUH 3ARSA 4XHJD 32C2A 1J18A 1QVOA 2YKLL 3NABL 5EULV 3PXHA 4P5KB 3QO0B 3K80A 1G6RL 1YPZA 2ITDB 4P4KD 4S1DD 4IRJB 2BY1A 4KMTH 1YN6B 3T8XB 3QRGH 5DJ0B 4I2XB 4N9GA 1BZ7A 2DYPB 1NC2A 3N9GL 1HHGB 4MJID 1ES0A 3T0WA 4TOYH 4H88L 2EEDA 2GUOB 5ANMA 5ICXA 1SJXA 1X5KA 5GRYA 3CXHJ 3QFJA 5JXAL 1S8DB 3KPOB 1G9EA 3S3JA 4YHKL 2RCSL 3WS3A 3D69A 4ZFGL 3ARGA 3KPLA 5T1KD 2GTZB 3AAZA 4AEHH 5E8NB 4OSUL 1JPSL 2V17H 5A1AA 1J8HD 1MQKH 4S2SB 3IDIA 1XFPA 1MWAB 3T0ED 3GKWL 4MCZA 4FQJL 1RZKH 3PWUB 3RX7A 1DN0B 3B3IB 4H26A 3KPQA 4WW2C 3JV0A 3L3GB 1TCRA 3FB8B 4BH8A 5C0AE 2J8OA 1MHCB 4JAMB 1VGEL 1F90L 4ONOA 4WTXA 4OQTL 1HQ4B 1A7QH 2A77H 3V4PH 2ITCA 1UXSA 4X6DF 5EN2A 5HVHB 2BVUA 4WI7A 4B7IA 1RZJH 4LSPL 4UUJB 1HQRB 4UNTA 1IFHH 5CJOH 4M3KB 4U6VL 2DRUA 3O4OC 5D2LB 4NP4H 5EU7E 3D0LB 2LU3A 2ZCHH 4NZTL 1BPVA 5KTEH 5HDQH 3RZWA 2AI0H 2MCG1 5BS0B 3NIGF 3OZ9H 5D1QC 4OD1H 2HG5B 1K3IA 2V5MA 3IFNL 2VWEC 3T0XA 4NYLA 3RNKA 1IEBA 1Q1JH 3BKYL 3I9GL 4LASL 5JDSA 5CAYB 1KCSH 4JRYE 4JLRA 2P24B 3UTTB 1CD8A 5F1KC 5EZOL 4KXZI 2YPVL 4LSVH 1S5HA 4DGYL 1MAKA 3RWIB 3VW3L 1BGXL 1I9IL 4L4TD 1T0PB 5DVNA 2R1WA 3T77A 1TIUA 4WUUA 1R6VA 3MXWL 4KJPD 2V7NA 4U0QB 2XZCH 3VXRD 2BHYA 5IVOA 2F9BT 1DQJA 4RGMC 1KIRA 3EYVA 5HXMA 1NGYA 1F2QA 2NNAB 3BRGC 3CFDB 4U3XA 3QNZA 3WUWG 4HS6A 1KB9J 4Y5YC 3IFLH 5E2VH 2FGWH 4X6EA 5LWYH 3LCYA 2PW2B 3WNKA 3MZTA 1SY6A 4J6RL 1XGYL 1HXYB 2X10A 3O3AA 4K8RC 5CKGA 5E2UH 4I18A 3CSBA 4G8GB 5ESQA 4CVZA 3CVHB 1N4XH 1MFCH 4PD4K 2J88H 3A67H 2R8SH 4B5EA 5J6HB 1NBVL 1A1NA 2Y36L 3ARXA 7FABH 1PLGH 3PUCA 2XWBB 4WGVB 4MNQE 3HNTL 4NO0A 5BZDB 3HUJE 5I8CB 3BUYA 3O6KL 4Z7VE 2X89A 4XZUA 4ZNCD 1T21A 4P46C 3LN4A 4FOMA 3QFJD 2DM4A 4LSSL 1VADB 5I17B 1JPGB 4NQTA 1RUKH 4L5FH 1PQZA 1P4IH 1CFNB 3DVGA 3ULUL 4JFOA 4M7KL 1CG9A 1MI5B 4PGDA 1FL5B 5MEPB 4KV5E 1ZA6B 4OCWH 3O8XB 1F02I 1YUHA 3IF1B 3K4AA 4NKOB 3CFBB 4JKPL 5I1CL 2XWJA 1U93A 3F62A 2NXYC 5D70L 4WU5B 5DJ8B 4M1CC 1MLCB 4YEFA 5FO8B 2F5AH 1BQLL 2R4RL 1P84J 2LV4A 4NJAH 1A3RL 4XHJC 5FHBL 5KSBF 2O5XL 1OARH 4PS4L 1A0QH 2QADD 4XNXL 1N2RA 4JO2L 5I76B 4ZD3L 4OLZH 1MEXL 3WN5C 4NM4H 2VQTA 2VRAA 4S1DC 4P4KC 1JBJA 1X5GA 3MCLH 4GAFB 1J5OL 1QLRB 3EKCA 4YLQT 4JZNB 3LQAC 3D5OF 1CGSL 1OP9A 4OZIE 2OK0H 3SDXB 3DIFB 1NGQH 3X17A 3CZFA 4ZAKB 5CP7B 1SYSA 3TH2T 4KI5E 1WBYA 2YBRB 3C09B 4F7TA 1RUML 3UDWC 3JXAA 2GSIB 5J57B 1NGWB 3FQXB 2GCYB 3HZKA 5IW3A 1EMTH 5CZXD 2J8UA 1X7QA 5F7MC 2RHEA 3T4YA 3S5LG 4XPTL 4LEOA 4D8PA 1TZGL 2QHRL 4I3RH 2XRAL 2F54E 1DSFL 3ULVD 5JHLH 1CDGA 5DJXA 4JM2B 3NH7H 4IMKC 1S7TA 3GMLA 4WUUD 1A1MA 5TJWK 5F7DA 4F8QA 2EXWC 2EXYC 2VUOA 1EEQA 2IAMC 5DJYB 4BKLB 1YC8A 4YBLB 5FECA 1H3UA 1P4LB 4ZDHA 3SDDC 4YHOL 4PLOB 3CLFL 3S34L 3BEVB 2A6KB 3H42L 4OLXL 4Z95L 3CH1A 5C0RL 1C5BL 4MXVF 4ODSH 1RFDL 2ICEA 1AY1H 3QISA 1Y0LB 4WI8A 4C4KT 2ZUSA 5D71H 4PJCF 4U33A 4UILL 5FB8B 2ICWA 2SEBB 2A1WH 1A7OH 5ALCH 5T3ZD 4FQ2H 3D6GA 1DE4A 4GRLA 1BP3B 1YJDC 4QOKA 1V7MH 4OB5H 1AE6H 1F42A 1M6OB 3WCYA 5ITBH 4PPTA 3KPRA 4HMCA 5I6XB 1VFAA 3H3PH 2EH8L 4NFBA 2HFGH 4NO0D 2ATKA 3ILQC 1I7ZA 1QR1B 4WW1A 1INDL 4YFEA 2X89D 1GSMA 3VCLA 3WKML 2NY7L 3DX8B 3TT3L 1HKLL 4XCEA 5EU7C 3L9RA 1A6UH 3PGFL 2ICWI 4KJPC 2DQHL 1OTSC 5CINL 2C7UA 4PJBF 2IJ0C 1MCCA 3NOIA 2Q6WB 1T22A 4LLWA 3VFPB 2DQUH 3RY5A 4ODXB 1M1SA 4EOWH 3IDXL 12E8H 3KHOA 4AG4L 2A74A 2FJHA 1OB1B 1JNLL 1KNOB 1XCTB 4KTYA 3V5HB 3B8YA 1HINL 4OCNC 1UWEL 1MPAL 3WMSA 1YYLL 3U82B 1LO5A 1RVFL 2OSLA 3AFLA 4NKDB 5EBLA 2BMKB 1B4JL 3IDJA 1TFHA 3QUKB 5DT1L 1EPFA 4Q9RL 3PHOB 3TJHC 4PRHA 1W0WA 4JDVB 3AREC 3MRFA 5DUBA 5DEZA 1SEBA 5IW1A 4WRLA 3VFSB 5FYKH 3HRZB 2IQ9H 3MOAL 3MRGB 1D5BA 2PF6A 2BDNH 3C9NB 1LK3L 4UAOB 5HYJE 2D7OA 3O6MH 5F88A 2ATPA 3PIQA 1NGPL 1VCAA 5T33H 1RIVL 3BWUC 2EDYA 3OB0H 3D25A 3EHBC 1N5YH 2OL3H 4R4BA 2GFBB 1INQA 1MOEA 1NCBL 3IFOA 4MQSB 4Q0XH 3QIBB 5JORB 1ZHNA 3ARFA 2EKSB 3OJMB 2GSGB 3VWJA 1LHZA 4MA3A 4LU5L 3LOWA 4JRYB 3DVFA 4ZTOL 3L6FB 2AV7B 3V6BR 1F6AA 3WNOA 3MA9L 4P2RB 4C55A 1WITA 1PEZA 1YMMB 3MGOB 2AEQL 4PREA 3GBMH 4WTZA 5IMLA 1KJ2B 5FYJE 3VI4E 1UWXH 3TBYA 4LMQI 5BZWB 3SGEH 5MHSD 2FEDD 2EYTB 4JCMA 4ZSOB 1S3KL 1FZJA 2FX9H 1S9VA 4LL9A 4OCXL 3MLUH 4N5EC 4GRLD 3OQ3B 3U4EA 4QOKD 4Y4FA 3V8CA 5TFSL 1Z9MA 4TNVK 3W2DH 1IZKA 1CGXA 3OHXA 1IQDA 3KPRD 4WIQA 1TQCC 2DQFA 3Q5OA 4NC1C 4Y19E 5I71B 3V52L 1YN7A 5DI8B 5CZXC 2GY5A 5AZEH 3VGAC 1QFHA 1A7NH 1GOFA 3B8SA 5KOMC 2A38A 4PG2A 3MV7A 1YA5A 3D2UA 4NKMA 3STLA 1QLFB 1ZTXL 1NDMA 4K9EH 4OCYL 3UJJL 5IFHH 3W5NA 3L3OB 4FQIL 3ZE2E 1FPTL 2CLVA 2FR4A 1CLYH 3EOAA 4PY7A 1UM4H 4S11A 2ADGB 4WHCA 1HSBB 1IARB 2VDKH 4PJGF 3C08H 1U8IB 4OM0L 3EYOB 5IGXL 2V2TA 2WIIA 1NL0L 4PR5A 4J7RA 5EOQL 5GRXG 3VMPA 2ORBL 2X9XA 3RL2A 1OTUC 3DETD 5HJ3B 4YDKH 4LCIH 1P9MC 1C5CL 1CCZA 4G7YH 2VLKA 3ECBB 4TTGA 4H1LA 4ZPVB 4Y5VA 5DHVH 1B6UA 4PRHD 1BJ1J 1ZGLA 3BZ4A 3GSUB 4FQXB 4KUZL 1YZZA 1KTLB 3VH8A 2BSRA 4C83B 1U41A 3FOLB 2VYRE 1KTKE 1MRDL 3HPLB 4M62H 2J5LC 4Z7NE 3DHMA 4WV1C 3JVGA 4OZIB 3EFDL 3QG6A 5KSAB 3W0WA 1NGXB 5F1NB 4UQ2A 3MBXH 3A6OA 3M1BB 3UZQA 2X1XR 3WHE0 4PJFA 3ZKXC 1NCDL 3HI6L 4C59B 1OAUL 2ENYA 1UCBH 4YUEH 4M8VA 3MLPA 5EZJA 1GZQA 3L7FB 2VC2H 4R96A 1FE8L 5KVFL 1QFWH 1R5IB 1CLZL 1S7VA 4HIHB 3OXRB 4Z18A 3UYOD 2AJYL 4PJ9A 4X6DB 5IFAL 4U1MB 1QFPA 4AIZB 2H32B 2X1WL 1IEAB 3O3EB 2P4AB 2PTTA 4IBLT 4RFEB 1J05B 4DUXA 4PRNA 1MREH 3SE3C 1U3HB 1V3KA 3VD4A 5IMOB 2ZUWA 4RWYL 2BVOB 1HHKA 2IANB 4RGNE 3U4BL 3N1PC 2HFEB 2NXZD 5E7BA 4LDOB 1H3VA 4LBEA 2BK8A 4RGOH 3LSOA 4TULH 1BX2B 1NFDF 4C56B 3X3GH 2CH8A 2DKMA 1C5DB 4Y4FD 3I6GB 5L9DH 1P69B 5E08H 3CFKA 1OVZA 1G9MH 5T3XL 1F4WL 2XN9B 3TPUB 4EIGB 2NQCA 3R1GH 3WDJA 3VRJB 1JWUA 2B5IB 4G6JL 3LKPB 3C2AL 1JRHL 4MNHB 1BIIB 2IGFH 2XTJE 1ZHKB 3MV7D 4RISH 3D2UD 2YOCA 1QYGH 2HT4D 3NIFF 5TH2B 3P4NA 5I1IL 3LQMA 4JY4B 1NMCB 1OCWH 1EO8L 5A40E 4L8BB 4OGXL 3BIKA 3EJJX 1YNLL 3I6LE 5M94B 1I4FA 4HWBA 3DGGB 1F4AA 2LTQB 2XOTA 3H9SB 1A9EA 3MUY1 4IRSB 2DDQL 5HHNB 5GGVY 4GW4A 4EDXA 3CSGA 4PJAA 3T0BA 2HVJA 1Q9KB 3LN5A 4FZ8L 3DX6B 1OD9A 2I9LB 3D0VB 1IGJB 1QPXA 5DLMH 4IRZH 3CMOH 4K3EL 5DTFA 3O9WA 2P46B 3CC5A 3HE7B 4G6FB 1LDPL 2NTFB 5AUMA 4XX1G 2BNRE 2FEDC 5FAAA 2VN7A 2HWZL 5FCUH 5I2IB 5JIPA 4U6XB 4HBCL 2VLKD 3DOSA 3Q3GA 3WHXA 1MJ8H 5T5FL 3FQRA 2K9UA 4N8CL 3OB0K 1ZT4A 5FUCC 5JTWA 3E3QC 4LLYA 4Y4HA 1O7SA 4HDIB 2KDGA 5DHYA 2NY3B 5I8KL 4OIIL 3W5MA 2DTML 4UTAH 1OP3H 3DUUB 4TPRH 3L1OL 1QRND 3ZT5A 4YHZL 3IKKA 4PP1D 3BIAX 5GS1B 3M17A 5E0QA 3EAKA 4Z77A 4FNLH 3W0WD 2UWEF 1HZHH 2J4WL 2OZ4A 3FFCE 4U1GB 2DQCH 5I9QB 4GJTB 4Z0BL 3OR6B 2QSTA 4G3YH 3L7EB 3MPCA 4Q7DA 1CXKA 4W4OC 1X5IA 5E00B 2QKIA 2FATL 4XNQB 1OP5H 4PJ7F 5L8KB 2DQDL 4P5KA 1EZVX 3MJ8B 3QO0A 1H9VA 2ITDA 2WINB 2WV3A 4PJ9D 1PW3A 4M43L 1ZV5A 4IRJA 1IGIL 3UO1H 4O9HL 3T8XA 1YN6A 4K2UH 5DJ0A 4BQBA 5F71A 4I2XA 4JKMA 2CO6B 1HHGA 4DUVA 3S35X 2GUOA 4JFFB 4YHML 1I8MB 1R3JB 4FQCL 4GQPH 2E6QA 4ZXBC 3VGHA 3QXUA 3TBWB 1S8DA 5DD1H 3KPOA 1T20B 4WEBH 4YZFF 4LHQB 5DHVB 2X4SB 4H0HB 2GTZA 3T08A 3WEXB 5E8NA 3QSKB 5E6YA 1YMHB 2CJUH 3FRPA 5LQBL 2PTUA 1KEMH 1MWAA 2VLJE 3TO2B 3GZKA 5BVJB 3PWUA 5C0IB 2FWOB 3BGAA 3KAAA 1GXEA 3B3IA 1EFQA 2ZUQC 3M8OH 5TDNB 3RUGE 3TJEH 1Q9OA 5FM8A 3C6LB 2GIYA 4OBRA 3FB8A 3I2CH 4XPHL 1MHCA 1ZT1B 5E8PB 4JAMA 2HJFB 1QR4A 5I1GH 1RZFH 2XQYK 3C8DA 3GI8L 4XXCC 1AXIB 3HMXH 3RVUC 1HQ4A 1FYTD 1S7WB 1AO7A 5DD0H 1P1ZB 4OLWH 1M71B 3FB5B 1CFVH 2YC1B 5C7XH 1SVZA 1UEMA 4DVRH 1CD1B 4EBQH 4X6CA 2ZG2A 5GPRA 4KK9D 1HQRA 4RMTA 5CUSH 5D7SH 5D2LA 1QA9B 1FJ1B 2D4DA 1J0KA 4QRPE 4N0FB 2Z9TA 4KWUA 4ZOEA 3REVB 5BS0A 3O9WD 5HHQB 2A0LC 2HG5A 1I8IA 5BVPH 4LLAA 1FVDB 4XCCH 4XP6H 3UTTA 5FUOL 2UUDH 4PD4J 3RWIA 1X4XA 4OQ1A 3QEQE 1CLOH 4Y4HD 4P3WA 3ZO0A 3AY4C 3FONB 4TN9A 4L8SB 3KLDA 4LSQH 1X4ZA 3QEGH 3SE8H 5E1AB 1WZ1L 2ED9A 3GIZL 1HN1A 3L3IB 2R39A 4QWWD 1U8MA 3CFDA 3I02B 4PG2C 4ZFGH 2ICCA 5CGMA 1MRCH 1AP2B 2PW2A 2P5EE 5IM7B 1OAZH 1HXYA 2JJSC 3T2NL 5JA9A 4XAKE 2HFTA 4CRPA 1SBBA 3QXDB 4G8GA 5DDHA 4PLNC 2B8OT 1V3LA 4RNRB 2OP4H 4L3AA 3B2VL 2XTJC 5GGTL 3AUVA 5J6HA 4IRJD 4HK3J 4N0RA 3WDHA 3U7WL 3ZE0E 3K74B 5KOVC 2O5YH 2XWBA 3ZYIA 2FJGB 1VGEH 5BZDA 4WWKC 5DD3L 4WEUD 2WBWB 2CK2A 2ZCKH 7CGTA 4M5YH 1AGCB 4M6ML 1VADA 5I17A 3QIWC 1AKJB 1CYGA 1CFNA 2HMID 1CVRA 1FL5A 4WI4A 5MEPA 4AK1A 3ALWA 5GJTL 2VXQH 3O8XA 3IF1A 3PJSA 4NKOA 1BF2A 1JMXA 3CFBA 4S1QH 1MCIA 2W0LA 4JFZH 3GSNH 1I85C 2X1OA 4WU5A 3MC0A 5HDOA 1T83C 5DJ8A 1MLCA 2ARJQ 5FO8A 2R1XB 1MFBL 4LFHG 2AJSL 2DI9A 3VFNB 1FVEB 3Q6FB 4GG6E 1D7FA 2ZG1A 3BP5A 3OBAA 3B5TA 5D5MB 5D1XC 3SKMB 3UTSE 4GBXB 2VKXA 4PB9H 2XYCA 2YWZA 3HI5L 4UB0L 3QHZH 1RIUL 2UZXB 1ULVA 4QHKI 2HT3D 1QLRA 1PKQB 2JKXA 3VXSB 1SYVB 2XACC 2X4UB 4M1GL 4NNXB 3RIFF 3SDXA 3DIFA 4MAUH 1PSKH 1ZHLB 4ZAKA 5CP7A 3C2SA 1RULH 1EGJL 2YBRA 5I1JH 3OSKA 1J86A 2VTFA 5BS0D 1PG7W 5TE4L 1NGWA 1DZBA 3FQXA 2GCYA 4DOHB 2OR9L 3OKNB 2G60H 4OZHE 2IMNA 1DCLA 4NN7B 2EIDA 3UTTD 5EBGA 1MQ8A 4JO3L 4X9HA 2WWMC 4OLEA 2WBJB 4JM2A 1TZIB 5HGAB 5L2KE 3U83A 4L4VB 1OP5K 2V2WB 2DQJH 5DJYA 4UIMB 1F13A 4PJGB 5CJBA 1P4LA 2C4XA 2MHAB 4K3JH 4H20L 3BEVA 1VSCA 4JHBA 3DXAB 1I1CA 4JQIH 3P0VH 4XWOC 1E4JA 1MLBB 5DJ6B 3NFSL 5EU5B 1Y0LA 1OTTD 1T1WB 5GS2D 4GKZB 4JFEE 4AMKH 5SWSE 5FB8A 4OFIA 1IAIH 1YECH 4G8GD 2SEBA 4KK9C 4K3DH 4AIOA 2P8PA 3MRMB 1MHEB 4ZG1A 5AYUL 2YD9A 3UEZA 5DD5H 3F7YB 1IGFL 1M6OA 3BT2H 3SKOB 5K59E 3S9DB 3SDYL 4OLUH 4QYOB 5EZIL 2FRGP 3ZL4L 1QR1A 1BOGB 1HIML 4YGAB 1NSNL 3TH4T 3UTQB 4OUOA 3DX8A 4FS0A 2BVTA 1IAMA 4JFXB 1ORSB 2HVKB 4YWGH 1TJIL 4HCRA 2VDRL 3SGJC 4PRIB 1DBML 5JO5B 1CK0H 3O8XD 4HK0B 3MREB 1I8KA 3QUMH 2Q6WA 4QGTA 2W0FB 3VFPA 3WXWH 4IOSD 4ODXA 5D7IF 1IT9L 4I48A 2P48B 4JY5H 1GHFL 5BO1H 4D3CH 1OB1A 4YR6B 2RR3A 2D03L 4XNZB 4BYHA 5K9QG 3A6BH 1ADQH 1KNOA 1XCTA 3V5HA 5ADPL 4HX1B 3CIQA 3X3FH 1ZANL 2CR6A 4NKDA 5C0EB 2BMKA 1NMAL 4NWUL 1KN4H 4LDLB 1QD0A 1CL7H 3SDAC 3K46A 2UUDK 4M7LH 4JDVA 2VERN 1WEJH 3BN9D 2CMRL 1MSPA 1P6FA 4EQ3A 5D7LE 2D4FA 3VFSA 4HH8A 4ZAKD 3LKOB 3E1F1 3HRZA 5C0RH 3MRGA 3EJZD 3C9NA 4N0YL 2BOCA 1OPGL 1V7NH 1F6FB 3G6AB 1FBIH 4JN2B 4XP9H 3TPKA 4KI1A 1D5XB 2NPLX 2HMIC 2DIAA 4FG6D 2GFBA 5E2JA 2VL5B 5GRJH 1E27B 3QIBA 5JORA 4JM2D 3RAJH 4WNQB 2GSGA 3V79C 4JRYA 3L6FA 2AV7A 4OT1H 4ZOAA 4OZGF 2Z0BA 3OTTA 3QR2A 4TQEL 2ID5A 4P2RA 4JGJA 1YMMA 2A6JB 3MRHA 3T2PA 1VGKB 5GGQH 1BWMA 1KJ2A 3ZDZE 5ACZB 4M7JL 5BZWA 5IV2B 2EYTA 4ZSOA 1IAKA 4Z7QE 3EOTL 2ZPKL 3LEYL 4UMGA 4Y1AB 2XA8H 1BVLB 3UYRH 4UT9L 1EAPB 4G5ZL 5HI4C 3BVNB 2AQ3A 1P53A 5GSVB 2H3NB 3VXUE 5IJVB 1DBBL 3O2DL 4F57H 2DQIL 5DI8A 1AJ7H 2P43B 3O0RH 4IDLA 5IB3B 4O02L 1QLFA 4YHNB 3AC0A 3AMKA 4P2OB 5IT2L 3L3OA 3AU1B 1C16B 4U7KA 5DT1H 5F6IB 1CDBA 4MNQA 2X9WA 2VDPH 1OSPH 2YPLE 4Z7VA 2VDLH 3DX7B 4R3SB 3RGHA 2ADGA 4EKXA 1HSBA 3K81A 1EH9A 4Z7UF 5EOCL 1T7WA 1CF8H 1C08B 1U8IA 3CFEB 3G6JE 1LQSR 4GQ9H 4OCRL 3GI9H 4PV8A 3L95B 3OPZH 5E2WH 5AZ2H 3JZ7A 1EO5A 1XF4A 2VMFA 3LH2L 5HJ3A 4ZTPH 5TPWH 1MCOL 4QXGL 4HKBB 3ECBA 4APQB 4P4RA 4ZPVA 4KJQC 2JJTC 2A9ML 2AK4E 3GSUA 4FQXA 1H3TA 3UTSB 5JQHC 4XXDA 3OGCB 1KTLA 2I60L 2JK5B 5DMGC 3KLHD 5FOJA 4C83A 3U2SB 4X4YA 3FOLA 2F53E 2ESVE 2DMCA 5DFVD 3BHBB 4DQOH 5IBTH 3NZ8B 1Z9SA 5MEQB 3UMTA 5LAXB 3U79A 2KUTA 4OZIA 3MNVA 3T1FA 1NGXA 5F1NA 3V4VL 2CRIA 4EEEA 5DJAA 3L5IA 3O2WL 3F58L 1M7DA 3BOVA 2B0SL 3L7FA 3QIBD 3O8XC 4FP8H 1Q9WB 3K8LA 4HPYH 1KACB 5D2NE 1R5IA 4LCUB 3OXRA 4OGAC 3VXME 4JRYD 1BFTA 3H8NA 4AIZA 3NACL 2H32A 3O3EA 1IEAA 4GH7B 5LCVL 4RFEA 3WBDA 4UBDD 1J11A 1J05A 4P2RD 1YMMD 1WBZA 3C87A 4XVJH 2OI9B 5J8OA 5J1AB 2G9HB 3BGMB 5IMOA 5A2JH 3P11H 2BVOA 2IANA 4BZ1L 1YQ2A 1FPTH 3GO1H 3LKSB 2HFEA 4L1DA 3QUYB 1QBBA 3VWKB 1T0MA 3LS4L 1BX2A 4C56A 1XT5A 4E41E 3RX8A 1C5DA 3BN9C 4B41A 3OJDB 2NLJB 3T3MF 3WFDL 1GAFL 3I6GA 1G0DA 1W72A 3U48A 5JNYB 2PKDA 3C09C 1XAUA 2BVEA 3RFZC 2XN9A 3TPUA 1MCHA 1A6VL 3VRJA 3LKPA 1NEZA 2DD8H 4MNHA 2CDEB 1BIIA 1HNFA 1BZQK 1HHHB 4HKJB 1ZHKA 4ZQKB 1NUNB 3HLAA 1UB6B 5TH2A 4MNQD 3QJFB 2YS4A 4JY4A 3O4LB 1RZKC 4K7PX 4HXBL 3D85B 2WP3T 4JKWA 4L8BA 4NFCA 1FZKB 1VKXB 1QSZA 5JDJA 1MF2H 5D1ZC 4RFNC 3DGGA 4R2GB 2EE2A 3H9SA 4IRSA 5HHNA 3FMGH 5FCSH 4YBLC 4ODUB 1LEGB 4GRWF 4L3EB 5ICYB 2HJLB 3DX6A 3AGVA 5FV2A 2I9LA 3D0VA 3Q1SL 1IGJA 4YHLH 2FIRT 4NHCL 1UM5H 2HH0L 3QP3A 3G6DH 5MI0C 4OKVB 4HGWA 3HE7A 1NBZA 2NTFA 5TE6H 4P9ML 4PB0H 1NCTA 5D72H 2VITB 4I8DA 4MMZC 4LIQL 1VESA 4HD9A 4XPBL 5IR1B 3QCUH 1JZ5A 5FGSA 1A6WL 3MO1B 4U1JB 2VZOA 4HDIA 4FQXD 3EDJA 3VXPB 1TQBC 5I6XC 2OS7A 3CXDH 4JO4H 4HJGB 3WFZA 4MCYB 3KPTA 3U4BH 4ODWB 1DVFC 1S9YB 3DUUA 5EFIB 1I75A 3BSZH 3KYKL 1A7BA 2B2XL 3BO8B 5GS1A 5KZCB 3WO4B 4HIEB 2G5RA 3GSVB 3MRCB 3NZHH 2A9NH 4GLRI 4KI5D 1S7RB 3OR6A 2Q8BL 3L7EA 4CN6A 4N0UE 1ACZA 1F3DH 4KY1H 4NN6C 4JCLA 5E00A 5T3XH 1U8HB 2A2QT 4TSBL 3MJ8A 3GHBL 3U46B 2WINA 2ZCLH 4YXLH 2LVCA 4JO1L 1NAKH 5D96B 3ARDC 4HWUA 2Q7NA 3AM8A 2Y72A 5FYKE 1U6AL 3OAUL 1QSFE 5I74B 2IAND 4OAWB 1A22B 5DQDH 5C0NC 4JFFA 1I8MA 1R3JA 4MVBD 4MXWH 3TWCL 1T20A 3CK0L 3S37L 2ZSWB 5T5NF 1KJMB 2X4SA 3WEXA 4C56D 3JWDH 3NAAL 1UYWL 4C54A 1YMHA 4ONHB 4IJ3B 1BQHB 3D9AL 3TO2A 4NRZB 3QFDB 4PRPE 5GHWH 5BVJA 3HZYB 5C0IA 5FIEA 2FWOA 4UAOC 5DFVC 2XN9D 2DL9A 1DLHB 5JOPE 1LDPH 5TDNA 4IOFD 3ZHDA 5ESVB 3C6LA 3HNVH 1I7UB 1HOCB 2HWZH 5HPOA 5ID1B 1ZT1A 5E8PA 3K4ZA 2HJFA 3RIFK 3U36B 3BEWB 5J11B 3TA3C 3CX2A 1AD0B 4ETQB 1RSFA 3VXUB 1JZ3A 3QIBC 1S7WA 2H2SC 4HC1A 2HP4A 3MROB 1P1ZA 2V5YA 2F8XC 3FB5A 2YC1A 1CD1A 4MLIA 3QBTB 3H9SD 4IRSD 1WCQA 4Y2DB 1XZ0B 4Y0GA 2Y07H 4NQDB 1GYAA 1T7ZA 1QA9A 3DARA 1FJ1A 5I1EH 1D5MB 4N0FA 2O26U 3RP1A 5HGDB 3REVA 2X4QB 4PLJD 5D2NC 3CSYB 3HE7D 1VFUA 4G6FD 4XBEL 1XCQB 4WFFD 1Z0NA 3DMMB 1LVEA 1FVDA 4J3SA 3V0WL 3F65A 4F7EB 4YNYA 2VXVH 4PY8J 5IF0A 2APFA 1TVBB 2NY3D 1Q72L 5KSBE 3FONA 4L8SA 2W07A 4Y4KA 4HZLB 2HTKD 3QULB 5E1AA 3X14B 5KBNC 4LVHB 4MD5B 3L3IA 4WHYG 4DN4H 1IGTB 3I02A 5L6YH 2DMKA 2R1YB 2D7TL 1MFDH 5D7IB 2B1AH 3V9FA 3Q5YA 5HI5D 1FORL 4U1LB 1HNGA 2JCCF 3BDXA 3CU1A 1FZMB 3BD5A 1E6OH 4O51A 5ISZB 3QXDA 2HFFB 4MB4A 3T65B 2ADJB 4RNRA 1JHLH 4H8WL 4LCWB 3VFGH 3SKUD 3MA7B 4L9LC 3PE9A 4KTEL 1NBQA 2FJGA 5KG9B 1H15B 2NY1B 4ZNEE 4EQ2A 4ONGL 4JFFD 5L88H 1AGCA 1SJEB 4JPIB 4NNPH 4RDQF 4BQ8A 2YR3A 3T0AA 3U9PL 3FB7B 1CDYA 3RI5F 4DW2H 4MXVE 1J9CT 3WXVL 3UTZB 3EO1B 1IL1B 4TUKL 3FT4B 4HXAL 3UAJD 3P0YL 4HWNA 5C08E 4PJCE 1AR2A 4E41B 2WQ8A 1FSKB 1E28B 3C6LD 3UCRA 2R1XA 3PWVB 5KSAC 4KVCL 5T5NG 5CEZH 4PGJA 3VFNA 5BV7L 3PABB 1FVEA 4XCYB 1RUQH 3Q6FA 4X5XA 1DUYA 2VJXA 2ARJA 5D5MA 5LBSH 1B3JA 2AJXL 3SY0B 1N26A 1T1ZB 2C3GA 4GBXA 4GG8B 1AC0A 2W38A 2X4NB 4JGMA 1Q8MA 1FCGA 5F3HB 1S9KC 1JFQL 1NUFA 2YUVA 2LQRA 4KQ4L 1PKQA 4TSCH 3GMQB 3VXSA 1SYVA 3GIZH 4WHYH 2X4UA 4I0PC 1PY9A 4NNXA 2V9RA 5CD3B 1ED3B 1BFSA 2QSQA 2OLDA 1U3HC 2OTPA 3PP3H 1SM3H 5F9OL 5C6WH 1ZHLA 1CD9B 1XR9B 4KQ3L 1JZ7A 4CU8A 5GS0L 1HXMB 3QB7C 1RJCA 1NANH 1OW0A 3BP6B 1U9KA 3OKNA 4PJBE 4MD0B 3H3KA 4OGZA 3HB3C 3SOBL 2UZYB 4LRNH 2WBJA 4FMKA 3WNMA 3FRUB 1VEOA 8CGTA 2BNRA 2ZJSH 3BD3A 5HGAA 2VL4A 1G7PA 4R8WH 2HKFH 4L4VA 2V2WA 5JR1H 4UIMA 2B5IC 4Y4KD 2Q76B 3ULSB 1JN6B 2MHAA 3MLVH 1ZLUH 3MBEB 1Y18B 3DXAA 5CWSB 1NLDL 3HMXA 5GGUB 1ZLVH 2D0GA 1CTOA 2OMNA 4XP1H 2DQEL 1NCWL 1MLBA 5DJ6A 5EU5A 2Z8RA 1NMCC 1T1WA 1KB5H 1J8KA 4R4ND 4GKZA 5B38B 1T7XA 1YPZF 4DTGH 2X4RB 3PL6B 3IAQA 5E94A 4JDTL 2B4CL 3MOBH 4M1DH 5I18H 4FZEH 4KPHL 3MRMA 3BPLB 1MHEA 4G42B 3VFUB 4TNWF 5DRNB 4CNIB 4D9RD 1ITBB 1K4DB 4AT6B 4QYOA 3MRPB 1UACH 5KW9H 1BOGA 4AM0B 3AS0A 5IESL 3G5XB 4OCMC 3UTQA 4XVUD 1G6RA 1FG2A 4JFXA 1AKJD 1F4YL 1RZ7H 2IWGA 4LHUB 1YEJL 2HVKA 4Y88A 4RGND 5LXGH 4PRIA 1CBVL 2C5DC 5JO5A 2F19L 1FDLL 2HLFD 2UZIH 4HK0A 4MJ5B 3I3EA 4K8RH 1J0ZA 3MREA 2HTKC 1OAYH 2E7LA 2W0FA 3SE9L 1E4XH 1U95A 2OR9H 5GS1C 4POZD 4F33A 2XTLA 1D5IH 2VLJA 5JPNA 3UC0H 4YR6A 3BDYH 3FKUS 4G80B 4O00A 5HI5C 4PJ5B 4DEPC 5I9QC 4HFWA 1JGVH 4FN0A 1LO2H 4KZEH 2FO1A 4HX1A 4M6AA 1O0VA 1K85A 4GBXD 1A3LL 2W1NA 5C0EA 1DQLH 4GAJH 4LSRL 1WSST 1N6VA 2W9EH 1MIEH 4XNYH 1L7TL 1DN2A 2CRZA 3UJIH 3NGBC 3VXSD 3QQ9D 1ZT7B 1EHXA 4X7FC 1AXSB 3WFCH 1BM3L 3AM8C 2UYLB 3TP4A 3LKOA 4XVTL 4X83A 4OQTA 3WLWC 5EZLB 5TGBB 5DEGA 3RX5A 3NCJH 3I6LD 4G9FE 2CUHA 5FKPB 3G6AA 3PP4H 4JN2A 4XX1E 2Y06H 3K8MA 1W8OA 1KJVB 5C07E 5JHDE 3ULVF 4HK3N 3FB6B 2EDOA 3J8F7 4UV7L 1KEGL 1D5XA 5B8CB 5F7HA 4KTDL 1QFUH 1X5ZA 2VL5A 2WBJD 3AB0C 4LPVA 5E56A 5MENE 1OAXL 1REIA 3KWWB 4WNQA 1TJGH 5HSFA 1FNGB 1WTGT 2BNRD 4RCAA 5FYLD 3MXVL 4L4VD 2IMMA 3FN0L 3OKDA 2FLBT 2GJ6B 5F7YC 5J12C 3C6LC 3LQAH 1LO4L 4K7PL 2A6JA 3X11B 2DIJA 1N6UA 2EDWA 4GRWB 3DXAD 2W9DL 1J1OL 2L7UA 1Q0XH 3TZVC 1NJ9B 4JPWL 2FX7H 4CU7A 5ACZA 3CFCH 3F5WB 3QUXB 2VO5A 5CKAA 5IV2A 5CD5D 3GJFB 4XAWL 3GNML 2YPKA 4M03A 4GSDL 4W81A 1LO3L 4LHJB 4I13B 5JPMB 3BKJH 1S7SB 5CJQL 5FHAL 4J3TA 4Y1AA 1NMBL 5TDOA 1Z9OA 2VDOH 1BVLA 1BZ9B 1EAPA 4EI5C 2R0WL 5DD6B 1FC2D 2CXKA 5C09B 3BVNA 4E0RB 1ZLWH 1GOGA 5JZ7D 1QBLH 4LGSB 4U2ZA 5GSVA 5HHOB 2J6EL 1QSVA 3B9KB 2OXGA 3WKNA 3C8KB 3BAEH 4HFUH 3VD9A 2BX5A 4UDTB 4UNUA 1PX3A 4LLQB 2ERJB 3MMEB 4P2OA 1JTTA 4OD3H 3K1DA 3AU1A 1C16A 3WNLA 4JB9L 2GT9A 1F8TH 2PW1B 3TH3T 1NCCH 2DI7A 5K9JL 1QACA 3DX7A 4R3SA 4PRID 3B9VA 1OGAE 1WUNT 3MRBA 3EGSB 5I1AA 1PG7L 3SGKA 2VOTA 3GJFK 1C08A 3CFEA 4DN3H 2EDNA 3PP3K 1GC1L 4OLVL 1NFDE 1R0AH 3TGXA 4JFPB 2VLJD 3RZCB 4FQLH 2VR4A 4YIQB 4FMFA 3KPSE 2XWTB 1RQ5A 4KRMB 4R4NC 1KIPB 1AQDB 1S5IL 4QHMB 1QHOA 4HKBA 4APQA 3OJVC 3QCTH 3B2UC 1WCBA 4NC0B 5J06A 1UM6H 1FFRA 2VDNH 4MMXC 3M07A 3UTSA 3OGCA 4LARL 2Y6SC 4A6YL 2X5PA 4IS6B 3U2SA 1VEPA 2E6JA 2D9CA 2J8UF 2VXUL 3FCTA 1YDPB 1BFVL 2R29H 3BHBA 5CEXB 5KVEH 4WFGD 3RY6A 2ZUUA 4XVUC 2NR6D 3NZ8A 1FN4B 5MEQA 5LAXA 1ZLUK 4U1IA 5BW7A 1KCVH 4Y89A 3VGFA 1UZ6F 3VGEA 1JF1B 1QNZL 5TQ2L 3ZYZA 3VJ6B 4BQ9A 1MVUB 4KJWD 2B1HL 4G5ZH 1LK2B 4YBQC 1Q9WA 5HHVL 4LCUA 2FL5B 4L3CB 3RGVB 1SEQL 3MX0A 4G6AC 4O02H 1QSEB 2G9HA 5J1AA 3BGMA 4MA1B 3GSXB 1FLRL 4DKAA 2ZKHL 3LKSA 2V7HB 1HYSD 1H5BA 3I84A 3QUYA 3BKMH 3VWKA 1OOAA 4XP4H 4ONFH 4LRIA 3HN3A 3THMH 1BJMA 4XMKH 4WHDA 1OGTB 5I30H 5DJDA 2O5ZH 1IC4H 2NTSP 3NTCL 5JA8B 3MLYL 3CSPA 1U8QB 2WUBH 2NLJA 4Y1AD 2UWEE 1MJUL 5I1DB 5JNYA 4JFHE 1MNUL 5SWSA 1TETH 5IROA 1JI1A 1DFBL 3LHPL 2DI8A 3TVMC 3WNNA 5HYSB 4XC1L 4A2LA 4KK8C 3RA7L 2CDEA 2I5YH 4PJ7E 5B21A 4PJEE 1HHHA 1TNNA 4NN7C 4P2OD 4ZQKA 1UB6A 3S35H 4F9LA 3O4LA 4QXUH 4LDEB 4QXTB 3D85A 4KXZH 2APWA 5DUML 2JCCB 4J4PC 5JW5A 2QQNL 1NKOA 2CDGB 4YFDB 1VKXA 1QKZL 3H6JA 3FHQA 5IG7B 4RAUB 4ODUA 1LEGA 2QSCH 5A43C 4L3EA 4MX7B 5ICYA 2HJLA 3ULUD 2H8PB 1GIGL 2DQGL 5DA4A 1ZLSL 1YEIH 4OKVA 5T1DL 3EO0A 3FO2B 5FA4B 3HI1B 5IQ7L 3QDJE 4LVOB 2VITA 4Q6IB 1FFQA 3RVXD 4APQD 4L8CB 5IR1A 1TXKA 1KJ3H 3D39B 3ULVH 4YDLB 3K3QA 3MO1A 4U1JA 4LIQE 4EXPX 3UTSD 1WK0A 4UT7H 2K1MA 3VXPA 4HJGA 4MCYA 3REWB 4ODWA 1QZ1A 1S9YA 2BHZA 4YFLF 5EFIA 4YDIL 5FA3B 4G8EB 3QCVH 3BO8A 1WWWX 1EZVY 4TRPL 3MRCA 3GSVA 3LKRB 2BRRL 1I9JL 1N6QH 3RTQC 4LQFH 1S7RA 1F00I 4JPKL 4P3CL 4YQXH 5I75B 1SY6H 1U8HA 4P99A 4GW5B 3U46A 3BRFA 2DKUA 4JJ5B 3KG5A 4R90L 5T3ZH 5GRVL 3SPVB 5JW3H 3QI9C 5AYQA 1TJHH 1MY7A 1F4HA 5LGHH 3Q6GH 1EVUA 4S1SL 4XNZC 3GMRB 4WGWB 2D31B 3RI5K 3MLZH 4OAWA 4FXGB 4XWGH 5E70A 1N59B 3EYSL 4Z78B 4I4WB 1GGIL 1JHKL 1IGML 3QUYD 5FKAB 5DSCB 3F12B 4WWID 3VWKD 1XGPB 4KKNA 2ZSWA 4P57B 2XG5A 1SBSL 1KJMA 1S9WB 5EUKB 4S1RL 1WJ3A 4F3FB 2H26B 1BQHA 4MJ2A 1KTDA 4UIKL 4NRZA 5CIPA 1MHPH 3QFDA 2FBJL 1FNSL 3HZYA 4NHCH 5JXEC 4ZUUA 5SWSD 3GMMB 1UA6H 3V6FB 1DLHA 4UTBL 3VE0B 5ACLA 5ESVA 3DVNB 4PUBH 3WS6C 1I7UA 1BVZA 1EXUB 2BCKB 5EU4B 1JUFB 1RURL 5HHMB 1KBGL 3HE6B 1JYNA 2XZAH 1R3LB 1DP0A 5F1OB 2AEIT 1AD0A 3LDBB 4ETQA 2X42A 4LPWA 3VXUA 4KJWC 1YEKH 3O4LD 1VFOA 3D85D 3MROA 1C1EL 2BSED 1YPZB 3EYUL 4X98B 5I73B 1INEL 4R2GD 3DLQR 5KVGL 4Y2DA 5HPMB 1XZ0A 2IH3B 3O6LL 4OGYL 4L3ED 4NQDA 4PJIB 3MV8E 1L4IA 1NC2B 1D5MA 5L7XL 1F58L 3IS1X 5HGDA 5ICXB 3ARBC 2X4QA 3CSYA 1XCQA 4KK6C 2AXGB 3BUTA 3DMMA 4WO4B 4U0RC 5B39A 3D69B 4K71B 3ARGB 1DBKH 3KS0H 1K3ZA 4RQQB 4A2MA 4F7EA 3EYFB 4R4FL 3MLRL 2VXSH 3C60C 3FN3A 2IPUG 1MFEL 4EZMA 1TVBA 1KGCD 1FAIH 4LAJH 3ARYA 2WP3O 3HMWL 1GPOL 4DKFL 4HZLA 3K7UA 3QULA 3X14A 4MD5A 4HS8H 4LSUH 4RMVA 1IGTA 4HIXH 4J3VA 4LNVA 2YN5A 3DUSB 4M6NH 2ZUTA 4KH2A 2R0ZH 1FG9C 3Q5TA 4ALAH 5F6IC 3TLRA 4TNWK 5I19L 1BD2B 3VG9B 4TUOB 3SDCB 4DGVL 1ORQB 3AS3A 4GXUN 1FZMA 2XG4A 4OM1H 4ODHH 4X7DC 4CU6A 1IBGL 5EWIL 4S10A 2HFFA 3WYRA 4EUPB 3T65A 2Z35B 4HUVB 3U0WL 3IAGC 4LGPB 2DN7A 5E9DE 4WEMB 2E7HA 1XGRB 2HRLA 1CDJA 4XVSH 5B22A 5KG9A 1H15A 3VXMA 5C8JB 2DMBA 3O3BB 4KKCD 3GBNH 1MFAH 1IEBB 1J0HA 1P7KA 1SJEA 4OZ4B 1I1YA 3RVXC 5AWNL 1T03H 3A0OA 1HH6B 2PYEE 1S5HB 2DIBA 3MLWL 2KBGA 3FOMB 2R69L 4GXVH 3FB7A 5KSUA 4WTZG 5CBAB 1I3GL 2XKNA 3UZEA 1YQVH 2DLTA 2AK1H 3OB8A 3MV9E 2VQUA 3IDUA 2NY0C 3EO1A 1IL1A 1CXLA 3FT4A 2VB5A 1KIRB 3EYVB 5I8OL 4HSQA 4DCQB 3RY6C 4E41A 1E28A 4Q9QL 4P5TB 1KENL 3PWVA 4V1DE 4XMPL 2MCPL 3PABA 4YK4C 4XCYA 2RBLA 2UVFA 2AGJH 3TBSB 5DJCB 4PV9B 2V2XA 1L0XA 3VXUD 3S36L 3SY0A 1AGFB 1T1ZA 4UOJA 5JLZB 4ETYA 4PJEB 1F3DJ 5F3HA 5ESQB 1J88A 4HKXA 2ADFL 3JBG7 4P49A 4RBPH 1AQKH 1GGBL 3GMQA 1DTUA 3IU4H 1TNMA 2BJML 5L0QB 1NAML 3OAZH 35C8H 5CD3A 4RRPA 4X9GA 1ED3A 4Y2DD 4LCCC 4WUKL 3V0VB 2GY7B 1UFUA 4NQDD 1D6VH 2KKQA 4P2QB 4NO0B 5INDA 5A2KH 1XR9A 3BUYB 3L3JB 4HT1L 1HXMA 4PRDA 1T21B 4HJJH 3U30C 2E9BA 3VWKC 4MD0A 3DMMD 2C9AA 3RY4A 4LAQL 1XF5B 1FGVL 1FO0L 3FRUA 2ARWA 2GQHA 2IF7A 4DGIL 4JR9L 3M45A 3STZB 1KIQB 2Q8AL 2XWJB 4NRXB 5EBMB 2Q76A 3ULSA 1JN6A 4H1LG 4MAYC 3MBEA 4CBPA 2YXFA 1CXHA 3VH8G 5F6HI 4NWTH 3WIHL 4I0KA 1RZ8B 1V8HA 3MRJB 3TEUA 4HIIB 1DL7L 5B38A 4PIRF 1G7IB 4QRSB 2X4RA 4ISVB 3PL6A 4ELME 4R2GC 4CVWA 4NQCE 4NZUL 3CDYA 4G42A 1UT9A 1QHPA 4U4BA 3TBVB 1A14H 5DRNA 2GEEA 3ROOB 4F7TB 3LZFH 4AT6A 1R5VB 3MRPA 2QV2A 5F3BB 3S96B 2IG2L 3VXMD 2Z8SA 2AJXH 3G5XA 4LEXL 1HE7A 5DURD 2J8UB 4IHOB 1ZEAH 3O2VL 1QBAA 1AHWA 4OZGE 5TF1L 1VB9A 4MYWB 4LHUA 3GRWL 2PR4H 3NPSC 4QRUB 2EE3A 1OAKL 4NC2B 2BNQE 2PO6B 3FTGB 3SQBA 2RGSA 4MJ5A 1HH9A 3OAYH 5EA0L 1BQUA 1F5WA 1DBJH 1JF6A 5FUZL 4E41D 1L9NA 3ZKMD 1KELH 3FQUB 1PFCA 3WO4C 5IB1B 5DK0A 1U58B 2MOVA 3RWDB 4G80A 2ICEB 3DSFH 4PRPA 3BKCH 4KROB 5JW4Q 1K8IB 4XNUL 1RAMA 2R23B 5E8DL 4LNRB 4JVUA 4X6CF 3F7VB 5T3XD 3N85L 1ACYH 4NKIL 4UT6L 2OJZL 1BHGA 1D9KC 4QHUA 5CCKL 1T3FB 4H1LH 5D2LF 1ZT7A 4M93B 5D96C 1HSAB 1AXSA 5C0CE 2UYLA 1VFAB 2RAMA 5EZLA 5TGBA 2ATKB 5E5UB 4KKCC 4WW1B 5DK3A 5FKPA 4P23B 1IAIM 5KVDL 1JP5A 1OAQL 4Z7UE 4M6OH 4BK4A 1KJVA 1ZVSB 3FT3B 4D9QD 3FB6A 5B8CA 4JDTH 4JDZB 1AIFB 3BZFB 3QIUC 4HH9B 25C8L 5IBUG 5LGJB 3UPRB 5IB4B 1FNGA 2GAZB 5IHLB 1DQDH 2VH5L 1T22B 4MS8D 3ZKND 4Q97A 2GJ6A 1UCTA 1KPVB 5E8OB 1P4BH 3X11A 3MBED 4X80H 2P5WB 5BRZE 4QTIH 4U1KB 1BBJB 1MCPH 4HF5H 5J11C 4RA0C 2PYFB 3VXQB 3P3YA 1HK6A 4N68A 3ELAT 3F5WA 5EBLB 4NQEB 3IDJB 3GJFA 1UJ3B 4UOW1 5JUEL 2WLZA 3DJ9A 3PL6D 1T0NB 5JPMA 2I9TB 3MLSH 1S7SA 4PRHB 3BGFB 3MOQA 1T80A 43CAB 1KC5H 5IW1B 4GW1B 1BZ9A 3N1FC 1QO3B 5C09A 4Y5XB 4E0RA 3FO0H 4ODVL 4PJHF 5HHOA 3I6KB 2AABL 4ZO9A 3B9KA 4EJ1C 3C8KA 1MCSA 4OTXL 2EDFA 3WFEH 5E2TL 4N5UA 3W82A 4G43A 1XGQB 3OXSB 5E9DB 2D7PA 1Y6KR 4LLQA 3MMEA 5GGTA 4RFOH 3WD5L 3SQOH 3VGBA 3C5ZC 2PW1A 4LHUD 1H3XA 4MQXC 5DJ2B 4I77L 4Z7OE 3ARFB 2IPUK 5KS9B 3CVIL 5ALBH 3VWJB 2NW3B 4MA3B 1MCDA 1R3IH 3WIFB 3EGSA 1D3CA 4HWBH 3OAZK 3U9UA 2R15A 3NCEB 1SMAA 1S9XB 4HPOL 2MPAH 2X4TA 2APVA 1E4WL 3HCVB 3FRPG 4JFPA 4TVPL 5FYJL 1HI6B 4YE4H 3RZCA 3NFPB 4YIQA 3BE1L 2OMBA 2F5BH 2ZUVA 2XWTA 4PFEA 5C08A 1KIPA 1AQDA 1OAXH 1AI1H 4M48H 1MCFA 3BQUA 1FNHA 3SDXF 2PXYA 2PUQT 5JW4M 1XEDA 2VKWA 3PWPE 3SKJL 1LO4H 5BV7B 4Z7WF 4HGKC 1RIHH 4IIQA 3VD7A 3VXTB 1IQDB 3FZUD 4IS6A 4JFDE 3V4UH 2AJUH 4N8VB 3W39B 2NY1C 2DQFB 2ZNXA 4Z0XA 3U7YH 1L0YA 1YDPA 4JHAL 5SWZB 1CR9L 5CEXA 2EICA 5FV1L 3LS5H 1MAJA 3WJJC 1FN4A 4LKCB 5CEZE 3TYGH 1JF1A 1Z6JT 3BP7B 4JM2F 1HCVA 4BQ6A 4ZODA 3OMZA 2FR4B 2OZ4H 4WI6A 3EOAB 4PY7B 1YY8B 1MVUA 5IKCB 1EGJA 4KMLB 2DLIA 1LP9B 4UINH 5AG9A 2NCMA 3QDHA 2FL5A 4L3CA 4XMLL 2DQTL 1OQOA 4QF1A 3RGVA 3UP1A 1VPOH 2IFGA 3VG0H 1FSKC 3ZKMC 1KCLA 2GJ6D 5HI3C 3B43A 2GJJA 3LMJL 5FGCB 4QNPE 2BOBB 5BMFH 4FQ1H 3GSXA 3K0WA 4G8FA 4XP5L 3FQNB 4KAQL 5MEOB 2V7HA 3IGAB 4FABL 1IGYB 2VLKB 4G9DB 1VACB 5J7CC 3ILPA 4LOUC 3MRIB 1OGTA 3SBWC 2JELL 4HAGA 4K3HA 4XCFL 4TSAL 3RVTD 1U8QA 2YSSB 2IPTL 2OR7A 5TF0A 3BZEB 2VDQH 2BSRB 4P59H 2EH7H 1MWAH 5C09D 5IHBA 5JQ6H 2FEEI 2P8LB 3QHFH 3OAYK 5HHOD 3B9KD 4K7PY 5HYSA 2QLVB 1L7IL 3QG6B 1J1PH 4MWFB 3W0WB 3LIZL 1BEYH 2CK0H 4NUGL 3JWDC 3HZMB 3TBTB 2NY4C 2FGZA 4OLYL 3U4AA 5K33A 2AEPL 4QXTA 2V9TA 4PTTA 5D7KD 1IQWH 5ITFB 2VWEE 2CDGA 5HD8C 4MS8C 1EEZB 2E5EA 1QLEL 1CD0A 3P73B 4JG1H 2XXMB 5IG7A 5IUSA 4RAUA 3CFJB 4MX7A 1CFTB 1FRGL 3S88H 4PJDB 2Z8WC 6FABL 2LVEA 3CLEL 2C3HA 4PTUA 3LRGA 5TQ2H 3RVVD 3RZCD 2H8PA 4F9PA 3DYMA 4AEIH 1MCKA 3IVKB 2CDFB 3FO2A 2CKBL 5IEHB 5FA4A 5LGKA 3U1SL 5IJKC 2VXTH 3HI1A 2K7PA 3NFNB 4FTVB 3LSOB 4HIJA 4Q6IA 4W4NA 4XCNB 4WY7L 2XIDA 2W0PA 3BQUD 2J8HA 4L8CA 3D39A 5DR5L 5AAMA 4AY0A 3EOYG 2E27L 3ROLB 3SCMB 2HYMA 2ZKHH 3SEPA 2WZPD 2Y5TB 2GJZB 4FFYH 4J3UA 1J0JA 3KXFE 1H8SA 5FA3A 4G8EA 4O4YL 2E8YA 1A7PL 1VFBB 1UH3A 3FHAA 5ELIA 3GHEH 1GGCL 1LO0L 5ESAB 3LKRA 4RAHA 2HKHL 5HGGS 4LSTL 3AROA 1I3VA 4EDWL 5IVXE 5EORL 3BIKB 5GS2H 1CE6B 1K2DB 2BC4B 4GW5A 4RMWA 2IFFH 3CX5K 1WIPA 1DFBH 3HC3H 3NCYS 4JJ5A 3CMGA 3VRLF 3RGVD 4D9LH 3SPVA 2FO4B 3O45B 1WIUA 3RU8L 1MCLA 1JGEB 3DO7B 5MENA 1LE9