3D69A

Crystal structure of the fab fragment of an anti-factor ix antibody 10c12
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
211
structure length
211
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGTGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-factor IX antibody, 10C12
publication title Crystal structure of Fab Fragment of an anti-Factor IX antibody 10C12
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 211
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2008-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d69A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d69A01
2VLJA 2ORBL 3BQUD 4QHLA 2XTJD 4NO2B 4WDIB 1I3VA 3GRWH 4JDTH 1K8IA 3GSNH 1W72H 1C5DB 3GM0A 4OLUH 2F15A 5I1GL 2DQEL 4GAJH 3LIZH 4ZFZA 3QIUD 4XVTL 4LVNC 2JELL 1ZGLA 5JW4M 3NFSH 4NFDA 4R8WL 3TJEH 3DYPA 1CQYA 4PRIA 1JCKA 2QTEA 3KYOA 1RHFA 1T7VA 1C5CH 4F15C 1ZEAL 5E03A 3NGBB 4DFHA 1F6AB 2R56L 4RNRA 5DJ8B 3GHBL 4OUOA 4YDVA 1OAXH 5JO5B 1AP2A 2ICWI 2Q76A 5JW5B 3PGFL 5F44A 3SKJL 3NCBB 5KS9A 1QHPA 3B9KC 4MAUL 4HUVB 3K74B 2I07A 1J1PH 4HIIA 4HPOL 5CILL 5KSAD 3ROLA 5JDJA 2QSVA 4I2XA 4XH2B 1NGZA 2AV7B 2C9AA 2NYYD 3OF6D 5ITBL 2WANA 4MJID 3AVEA 5E2TH 1KTLA 4M93B 5L8LB 32C2A 2YN3A 2RHEA 1MJ8H 2J8UE 3OJ2C 1P4LA 4FFWC 2FD6L 3H2WA 4QT5A 2OXGA 5I75C 1GVIA 1JRHI 3E2HB 1T21A 5I17B 2JB5H 1NC2B 5CGTA 2XZQL 4GKNA 4Z7UF 5DRZA 3Q1SH 3QO0B 5IB2B 1MQKH 3U46B 2F54E 5HJ3B 4EDXB 2A6IB 3GKZA 1CLYL 2G9HA 4K71C 1XR9B 4LF3A 4IOIA 4Z76B 4P2RE 4Q9BA 3U0PB 1L7IH 1CLOL 4S1RH 4LP4A 3OBAA 3SQBA 2DTMH 1AE6H 5J56B 4UOW0 4ZO6A 1S7VA 1T4KB 1TPXB 1H15B 1NGXA 4ISVA 2VLKD 2NZ9C 4AIZA 3KR3H 1MFAL 5D7SH 1BPVA 4F3FB 5CZXC 2J8UB 4BK5A 3F12A 1HN1A 3X13A 2Z8WC 1H3UA 2JJSC 5GGRB 4NHUA 5D6DC 4XC1H 1OVZA 3QUXC 3EIFA 2BERA 2F54B 1D3CA 2VDOL 2PXYB 5DA4A 4LQFH 5D1XD 2D0HA 5C1MB 3HAEH 5FF6A 3VXPA 4P2RB 1AO7A 5KJRL 1TQCC 4XCFL 2Y1VA 1II4E 1LE5A 4GBXB 4Y4KB 3MROA 2KBGA 3DUUB 5CINL 3VWJA 4OLEA 1I3UA 2VXQL 1MH5A 4ZQKA 2IFFL 5D72H 2JTDA 3HB3C 1YEIH 4WI4A 3FRUB 3VXSE 4ZPTB 1ND0B 3KYNA 1BJ8A 3ZYOA 5I15H 5EFIA 1HYRC 3SE4A 3H8NA 1AR2A 2BSTA 2X5PA 1D5IH 1A14L 1S7SB 1TCMA 2FX9H 1ZGLM 3QCTL 3CU1A 2FECI 2DM3A 4UAOB 2PTUA 3QPQC 1SY6L 4WW1B 3B9EA 4EBQL 1H9VA 2ENSA 3L3KA 4G8FA 4JN1H 3IETB 2QHRL 3BP5A 3W11C 1WZ1L 1KCKA 4Y4HA 5DZOA 3PF2A 2P8MB 1H0DB 4OZFG 4EUPA 5C6TH 2X70B 2G60H 1LK2B 3PUCA 1RUAL 3CFEB 1VDGA 4PRDA 5HY9A 4PJDF 2QKIA 4GKZA 3BKJH 3F5WA 4L4TA 3GNML 4NZJA 5EU5A 2Y5EA 3VXSB 3QNZB 4HWEH 1VA9A 4NHCL 5IG7B 4FN0A 2J5LB 3IDIB 4JY6A 4ZAKC 2JK5B 3KLAA 5HDBE 1LILA 3GI8L 4AEIH 2X2YA 4HWBL 3MBED 1L4IA 4N0FA 3EDKA 5EUOE 1G0YR 1YYMH 2CKBL 3U82B 5C0CD 1D6VH 4F7PB 1UQSB 3X11A 2WINB 3P30L 4RGND 5F9DC 5I18H 3QPXL 5INCB 3WJJA 1JPSL 3A6OA 1YPZA 3NIFE 4UB0L 4XBPB 3LAFA 3Q48A 2DJ4A 2ZSVB 2BY2A 1KBGL 3UYPA 4BKLB 1XGTA 1S9KC 5JXAL 4MVBC 1IM3A 1Q72H 4JDVB 3E3QE 3O4OB 1AKJD 2H32B 3K2MC 3MLZH 4KHTH 5E9DB 2FJGB 1HKFA 3MXWH 3ZSTA 3GZKA 3PWLB 1E27B 3QH3A 4BFIB 4F7CB 5DMGC 2HVKA 1QLRA 3AS1A 1AD9B 3VG9B 3HRZB 5T5NF 3VFGL 1D6EA 3MRQB 1WUNT 2VR9A 2VXTH 4O2FB 1GJIA 2VXVH 3LKNB 1Y6NR 3HZKA 5MENA 4IRSD 5FCUH 1FQ9C 1KSRA 5IWLC 1JK8B 4NRYA 3I6LE 5CJQL 4IMLA 3UP1A 2IPTH 5C2BL 3IVKB 2FIKA 4LSRH 4RIRA 4OLVH 1CLZH 3D25B 1B88A 3GDBA 4J1UA 2A1WH 3GM8A 2X1PA 4WI9A 3V5HA 5DUPL 4NZDA 5FEBA 4LVEA 2AJVH 2YR3A 3MBXH 4P3DA 3CFIC 5IOPB 1S9YB 4Q2ZB 4UILH 4NSKA 3DO7A 4EI5C 4KDTC 5FGCE 3LHPL 3DX8B 4QWWD 1INDL 4QF1A 3EOTH 3WIFA 1N59B 3RI5K 5HGAA 3ULUD 3RWHA 3C60C 1GRWA 1CT8A 1MUJA 4JHZA 3WMSA 5I6XC 1B4RA 1C1EL 1UWEH 3T3PE 3PHQB 1G0XA 3LH2L 4IBLT 4JFFD 2Y36H 4BZ1H 4YXKH 5IMMA 1DANU 1OAYH 2D9CA 1EEZA 3BN9D 1AD0A 1V8HA 2FGWL 4KK6D 5D93C 3ZT6A 2WBJA 3MR9B 3NOIA 4QHUA 4H25A 4O4YL 1VFBA 4PTUB 3H9SD 3KDMA 2R69L 4X6FB 5FGCB 1T5WB 2AV1B 1DEEB 1A8JH 2AQ1A 1I9IH 2FBOJ 1KTRL 1GXEA 2HTLC 3T0EC 2P5WA 4LPTA 3BPCA 1SJEA 3VJ6A 3LMJH 4MAYD 4QHNA 5J3HC 1HCVA 4LP5A 2X1OA 1FE8H 3GJFA 1FCCA 1JNHB 1NGPL 3JZ7A 3RTQC 4DN4L 4HH9A 5D5MA 4K3EL 3C8DA 4NKIL 4TVPL 3RL2B 4L3CA 1NGQL 5DC0A 2HLAA 1AGDB 3IDYB 3W82A 1IBGL 4LCWA 3S96A 3TYFB 5D7IB 1T7YA 2HTKD 5IUSA 2H2PC 4M6OL 4OCLC 3QDGE 5HHOE 5CIPH 3KAAA 5JPMB 2DQJL 3VGAB 4PJ9D 3EDFA 4G7YH 3RL1A 3HFML 1F11B 3GMRA 2R4SL 1DQMH 4CN6A 2CUMA 4K8RL 1A1MB 1YN7B 4CMMA 3S5LA 5I8KL 5L2KE 2XZZA 1FZMB 4YDIL 1IJ9A 2PYFB 4HUMB 5DQJA 4U1SA 3CPLB 4HJGB 1U6AH 3F62A 1QBMH 1SMAA 2AGJL 2Y07H 2BHZA 3G6JF 3N50A 2IC2A 3WLBB 1RY7B 2FX7H 4ORGA 3DTXA 1OAZL 2WUCL 5MP6L 3TIEB 5HHOB 4HUWB 2P8PA 1BX2A 1UGNA 4OI7A 5JXEA 4PRPD 3K46A 4OD2A 3QEQD 4OM1L 5JOEA 2VLRD 1GC1C 2WLYA 3TO4C 4LEOB 1NLDL 3SJVD 4P2YA 1KACB 2GJ6D 4FP8H 4KMQA 4EXKA 2I5YH 2VE6B 3VCLB 2X6MA 3GJEA 5M7QA 5L2KB 1JF5A 2ZZUT 2NX5D 3F7YB 4YIQA 3SDYH 5CLTA 4X9HA 2BNRE 3S9DB 2F53A 2XTJE 1ZSDA 2GY7B 3AM8C 2CIKB 3UPRB 4H1LB 4Z5RA 2WQ8A 3D2UD 2VDPH 3RU8H 4YXHH 3AXLA 3EYVB 5CEZD 1EAJA 4FZ8L 3QDJB 2RCSH 4L8CB 1YMMD 2X7LB 4XNYL 1U36A 4N8VG 1UG9A 1XCTA 2OR7A 4Z6AT 5EU6A 3WXVL 4OB5L 3T0XA 3KWWA 1F4XH 4BSVA 3FO9A 1FLTX 3Q5TA 3OKLB 5C2UB 5BV7L 5GRJL 1U91B 4O02H 2F19H 3KPMB 2Y06L 1I9RL 3BD4A 3IFPA 3RVXD 3Q6GH 2W9DL 4LDLB 5DHYA 1FNGB 1LO2L 4FS0A 1J8HB 2BNRB 4KUZL 3BQUB 4XWOD 4PG2A 2XTJB 2Q8BL 3QHZH 3U9PL 4GRLA 1F58L 1KB5B 1DTUA 5CKGA 2R8SL 1IGJB 5K93A 2IGFH 3X12A 3QIUB 3IRZA 3BT2H 4UOJA 5E7BA 4NBYB 3QDHA 4P0DA 2DLFH 5ESVA 3JWOL 1ZK9A 3D39D 3T4AB 3TJHD 2GFBA 3ARGC 3M07A 3ZE0E 3D0VB 1AGBB 5DFTA 1CXFA 1FVEA 1W0YT 5DUBA 2CUIA 4WW2F 4IMKC 2PKDA 4QY8B 3JV6A 4XVSL 4D3CH 3W9EB 3KJ4C 4WUUD 2BSRA 1UACH 2VITB 4JFEA 1UA6H 4JRWA 2X4SA 2AJXL 3MCLH 2IADA 3GMMB 5DJ6A 3C6SB 4PJ7E 5HI3C 2W0FB 5EA0H 3UJIL 4MA3B 5KSAB 4JN2A 1L6ZA 4RFEB 2NY3C 1CD0A 5EUKB 4QLRA 4W6YB 3P9LA 1KB9K 1KYOJ 4MJIB 1RFDH 5E2VH 2VLKE 3L1OL 3MLXH 4NQVA 1JZ7A 3P9MB 3DX7A 5ERWA 4RMQA 4G8IB 3QEUB 3RZCD 3HE7C 1C08A 3SGDH 4G9FA 2J12B 5D2LA 5GGRY 3MJ6A 4X99A 5FYKD 1R3HA 1KPRB 4WHTB 4YZFF 1J05A 3AY4A 3V7AG 3L3GB 3HMXH 4OZGE 4XVJH 2A73A 2DQTH 3QZWB 4L4VA 1NBYB 5AZ2H 4P57B 1EGJH 5IROA 2Z8SA 4PD4J 3CFDA 3T77A 3UX9B 4PJ7B 1KG0A 1A6AA 3OKKB 3TBYA 1U8QB 3E6HA 4TOYH 3V0VA 1RV6X 4ZOAA 3B83A 4X9IA 1RUKL 1EZVX 4KZEH 2VLKB 1LDPL 1PW3A 1N5YH 1LHZA 1OF2A 4JFXB 4W6WB 2AEPH 4IDLA 4WY7H 1ADQA 3O6LH 4AENA 2ZUYA 3MV7B 1DL7L 1QRND 1Z5LB 3FQRA 4IHOB 4NCC2 3HZYA 4OZGB 2XZCL 4FQXD 3QO1B 5D1XB 5H35B 2DLTA 3BISA 2D7TL 4JB9H 4KGLA 3QIBA 4PJEE 2PTTA 1U8PB 5DFVD 3NZHL 3ZKMC 3U36B 5KTEL 4N8CL 3PWPA 2BRRH 3W81A 2ZUWA 1QO3A 1R6VA 5I1DB 4JO4H 3RPKA 2VDLH 4JZJA 1AFVH 4NP4H 1B6UA 2FB4H 3P77A 2IG2L 1CXLA 2NY5H 3T3ME 5KVDH 2GI7A 4JFHD 1PX4A 2BJMH 1MFDH 1UEYA 4HF5H 4F80A 1KLFA 3AS0A 5HPMA 3LKQA 3G6AA 1UJ3A 4RGNE 5T1LD 2VIRB 2A6KA 4HMCA 4KQ4L 5D96C 2WK2A 4U1NB 2UWEF 1S9WA 3IU4H 2VABB 2D31A 1RZGB 3MMEA 4EVNA 5CD5D 3MOBH 4KKLC 1O7VA 4PJEB 3CVHH 4X4ME 3P0VH 1UB6A 1U3HD 4EQ2A 1NH6A 1XZ0B 4YC2B 4NO5B 5C8JA 5C0IB 5ENWB 1SMOA 5CSZB 4BH7A 1R3IL 2W65A 1I8IB 3MBEB 1UZ8A 1ACYL 1KT2B 1P4IL 5J06A 3IS1X 4JANA 4ZO7A 5C0CB 2P4AB 4NC2B 2ZSWB 3HUJE 4O00A 3X3FL 5D1ZC 3H3PH 3LKOB 4LMQI 4LSPH 1HWHB 1I1RA 1S5HA 1FNSH 2DBLH 4RGOH 2HKFH 1BVZA 4XRCB 2YPVL 4OCMC 5ISZA 5A2JH 5HVHC 4PLKC 3L5WB 4TUOA 4Y5VC 2NW3B 3BN3B 1R3LB 4KZDH 1G0DA 4JGJA 1YEEH 4JHBA 4R0LB 4RA3A 4OF7A 4ZXBA 2X4RA 4LSTL 2PW1A 5FO9A 2BMKB 3I6GA 1UXSB 2X9XA 2ARJA 4OGYL 5GGVY 4J8RB 4D8PA 3ULUE 1VESA 2QSCH 3HUJB 3HCVA 1P2CB 4FQIL 1A6WL 5DD5L 4IRSB 1BQHA 1N6UA 1TVHB 2FH6A 3BMWA 4MXVE 5FM5M 4GUPA 3UROR 1U8MB 3VXTA 4YPGB 5FUZL 1I8LA 4JFFE 3F7VB 3L5JA 5EO1B 4O58H 5GZOD 4ELKA 1CDYA 3GSUB 1T1XA 5TE4H 5GS0L 4M6AA 3SKNA 3EO9H 2VO5A 3QB7C 3ES6B 2VQ1A 3F65A 3RAJL 1IAKA 5D7LA 2R2BB 3BSZH 3H9SE 2XYCA 4JO1H 4U1IB 1CICC 1U8NB 1YC7A 1W2KT 1GOHA 1IAMA 4LEXL 1L6XA 1ZT1A 4HV8A 4ZOCA 1JN6A 1QSZA 5EWIL 3UTQA 5CAYB 3OR6B 1MVUB 3T1FA 2GJZA 4AG4L 2ICCA 3RUGF 5LCVH 3CLFH 4KJQD 3BI9X 4O9HL 3NIDE 4M8QA 1VHPA 3MLTB 4HIEB 4JFFB 2BY3A 1H5BB 3SO5A 3KNBB 4OLYL 5EB9A 4KHXH 3G5XA 1FPTH 1ZTXH 2Y6SC 3LN4B 2MCG1 1BQLH 4CAGA 1HH6A 1G7HB 4PGZA 3WNNA 2R9HD 4JZNA 1FNLA 1CD1B 5EULV 5D6CB 1X6LA 4UQ3B 3EO0A 1A7OH 2JKXA 3SE9H 5FA3B 4Z8FL 1I1FA 4OLXL 2QQLH 2PF6A 1ONQA 3FQTA 1P84K 5DJ0A 2I60H 1IAIL 3KPNA 3LKRA 1B90A 4YFLI 4MAYB 5FUCC 1N64L 1IGIH 1E4WL 2EDJA 3P9WB 1WWBX 5C7XL 2HMIC 5L9DH 3ULVD 4EOWH 3PHOA 4JPKL 4MD4A 5FHBH 4KUCF 5BO1H 4P23A 1A47A 3O2DL 1U95B 1BFVL 2LVCA 5K9QI 5C0GA 2EDBA 3FKUS 4LSQL 4PJ9B 1N0LA 2MCPH 1Y6MR 3CVIL 1XGQB 3QEQE 5DJAA 4K7PX 3BJ91 1LEIA 3EHBC 2VLRE 4PGJA 3SJVE 1KCSH 4JPIB 2GJ6E 4BQBA 3SDCD 2ZUVA 3NABH 4YHYB 1MREL 2NX5E 2F58L 3HE6A 3MJ7B 3NCCB 3RWJA 4FQJH 4YWGL 4LLMA 2Z8VC 3GMLA 4U6TA 2ICEB 3QULA 3RNKB 2YMXL 5IVZB 4C83A 5F93C 3WNLA 5C70A 1SBBA 2B8OT 4V2BA 3B2VH 3PWVA 2FATH 2IQAA 3MOQA 4I4WB 5CEZE 3BIKA 3C08H 2DM2A 5E5MA 1A1NA 3TBWA 1YMME 1NQBA 4PRPB 4HS6B 1LO5B 3QEQB 2VLRB 4OF3A 4BQ6A 4FFWD 1L0XA 1K6QH 3VDAA 1J87A 1IL1B 5IMOB 4LKCA 5DTFB 2BXZA 5EORL 3RDTC 4YNYA 1U8KA 3PJSB 4NNXB 4KMTL 5TDPA 1UFUA 1A5FL 2E7BA 4GG8A 3OPZH 5J11B 1GGYA 3GGWA 3GBNL 4DQOL 4L1DA 3D2UB 2LVEA 4X6BB 3V6OC 4PV9A 2DQHL 3NFPB 4O2CB 2OCFD 3D48R 1YMMB 1CXEA 4PJCF 2NZ9D 3BKMH 1QA9B 3D39E 3OXRA 3X14B 2L7UA 5CZXD 4P9MH 4KV5F 5I76A 2H26A 5DEGA 3DGGB 1Y18B 4JQXA 3O0RL 3GSOB 4CU7A 5IESL 3ALWA 1S9XA 4AM0B 1RJZB 4WUUE 2SEBA 4ETYA 4OUUB 5E24E 1DUYB 1J0JA 1MAJA 1R3JA 1T2QL 3QUXD 3BXNA 1NCDL 2V2WB 1HSAB 1JMZA 1I1YA 1L9MA 3DMMA 2VISA 3FMGH 4RRPG 4Z7VF 1CZ8L 5E4IA 1VPOH 1IKFL 1WC7B 3BH9B 4M6NH 1G7PA 1WBYB 4H1LG 4MNGE 5ADPL 3HB3D 1WV7T 5F71A 4DK3A 3ZE2E 3D39B 3BO8B 1A7NH 4NQXB 2YUWA 3DBXB 5IB1B 5F3HB 3NPZB 2E7LC 4L3ED 5FYKE 4J3TA 1WZLA 4UU9B 4YBLC 5I1EL 4WFHD 1P1ZB 2DQGL 5E99H 1ZE3C 3EYFB 4WUUB 2B0SL 4GSDH 1T20B 5DFWH 1YEJH 1WISA 2V7NB 3QPQD 4JVUA 4PRID 1KOAA 5HGBA 2A0LD 3BZ4B 5CJOL 4PY8J 4U49A 1ZA3A 2R1YB 5K9KA 5HHQB 4XGZA 4EQ3A 1G9NL 3JUZA 3S88H 1MJUH 5JORA 4NNYB 3GBML 1G1YA 35C8H 3EUUA 4WJ5B 1NMCB 2AJSH 1VADA 2EYTB 3C8KA 1OSZA 3A6BL 4YE4L 5DMIL 1VACA 2GTWB 3H3KA 1U92A 3RZCB 2ZG1A 2A74A 3MACH 4XZUB 1HI6A 3MFFB 4ZAKD 1RIHL 1QRNE 5AG8A 1CYGA 5EU3A 3QEGH 4A6YH 4RX4A 4N9OB 5A40E 3R0MA 2K1MA 4KXZH 4YXLH 4Y16A 1BBDL 3REVA 3UC0L 1QVOB 1N5AB 3BPNC 2NY5C 4KK9D 5EN2A 4L8SB 3QXWA 4NZRL 4ZTOL 4MQ7A 4FFZL 4MWFA 2E7CA 4NN5B 3LY6A 3VFTB 5ID1A 5IFHH 5E1AA 3G04A 1CGTA 4MVBD 4DVBB 1GGCH 2HVJA 5L6YL 4QOKA 3E6FB 4CN4A 1A3LL 1CG9A 1EPFA 3WO4C 1TIUA 2OP4H 4WWKC 4QYOA 4O51B 1IAOA 4MJ6B 4NKOA 3OGOE 5DMGD 1Q9LA 5AZEH 2XPGB 3DX6B 3P4MB 3PXHA 4JFHE 3FN0L 1HINH 1H3WM 1P9MA 1JNLL 1QPPA 1QRNB 5GRVK 3RX8A 4CVWA 2ZJSH 1BOGB 3RJQB 4P59L 4KU1A 1WITA 4FQXB 4EKXA 1EMTL 3MLWH 3B43A 4HK3N 3ULSA 3L5HA 4GLRI 3OAUL 3QZWG 1INQB 1QNZL 2JLLA 5EU4B 4WHYH 5IEHA 5HI4C 3BE1L 1QSED 1EO5A 5F97E 2BNQA 3EFDH 3VGGA 5I1HH 4X83A 2FDBP 4HFWA 5KS9F 2R0KH 5L88H 3VXOB 1U8JB 5DI8B 1AO7D 1MCEA 5D70L 1J1OH 2CRIA 4CNIB 3WEXB 2MFNA 1TTUA 3MNWB 4ERSH 3G9AB 4OZFA 2DQDH 1HHHA 5B8CC 5ICXB 3VWJD 5LWYL 4GXVL 4IEFB 5H2BB 1G6RB 1D5ZA 2GTZB 5CEXB 3JTTB 3KPRD 4PB0L 1NFIA 5EBLB 4R9HA 3C60D 2E5EA 1DQQA 4JKPH 1CIDA 3SGJC 1KGCE 4JRYA 3QA3A 2E7MA 1T3FB 3GIZL 4MD5B 4B0MM 1ROWA 2EXWD 1OT1A 1N3NA 2WUBL 2B20A 4ZPVA 4ODTH 3JV4B 3BZFB 3QP3A 4R4NC 3NFNA 3U4AA 3MREB 1K4DA 1U3HB 3TO2A 4WUKH 1MCRA 4R90L 4N8PA 3RHWF 1AXSB 3LEYL 4MB3A 2DLGA 3FB7A 5MEPB 2EH8L 1NSNL 1TQBB 2VDKH 1E28A 4AT6B 4P46C 3PQYA 1QHOA 5SWQA 4NZTH 1Q1JL 4PLJC 3T0ED 1CDGA 4UQ2A 1OARH 1YEDA 5BVPH 3RGVA 5J3HD 1VFAA 4MCYB 2NTFA 4X80H 5DJYA 5KN5B 1ES0B 3RTQD 2EKSA 3CFCL 3LRSB 4LPWA 3OKEB 5GHWL 3CH1A 4YHPB 3BGMB 1MHEB 4RGMC 2GY5A 1LO4H 4XT1C 3QEHB 3PIQA 3GMOA 3O8XA 1BIIB 3SPVA 4PJGA 1LD9B 5IHZB 1UJTA 3R1GH 4KK8C 2Q1EA 3O2VL 4HWZB 1WBXB 2XWJB 3FQNB 4I77L 2HG5A 4JFPB 4B53A 1S78C 1RZ7H 1YEHL 3MRJA 1FL5B 5K9OB 2O5ZH 4P48A 5HGDB 4Z0XB 4OD3L 1RUMH 1RMFL 1OAUL 5I0DA 1LMKA 4U1LB 4PP1D 4ZUUA 2BY0A 4U1GB 4NPYB 3OTTA 3DV4A 4OKVB 3BWAB 2BOCB 3UTTD 7FABL 5IJVA 1DQLH 2EDNA 3AREA 3S34L 2WM0A 5DSCA 4G8GA 4HGWB 2ICES 4YHKH 3BZDA 3THMH 2APVA 3WKMH 1XGUB 3NPSC 1YNLH 5IP4A 1CD8A 4BQ9A 4Y5YA 4FXKB 4HIHB 1N7MH 5DDHB 3D5OF 4FQPA 5IJKC 3TO4D 1MNUL 3EW3B 1X5AA 4OSUH 5DO2C 1W0WA 3TIDB 1X5FA 1FFOA 5LGHH 5F72S 4LNVA 2AXJA 4DUXA 3QQ3A 4WNQB 3KJ6L 1FG2A 2MTPA 3MLRH 3NCMA 3QG6B 3WL9B 4L3AA 4PRNB 1QD0A 4RA0C 1F13A 1FNHA 1A02N 2FJFA 3JVGA 3FAXA 2VL4A 1YPZF 2B1HH 1JV5A 5EIIB 1PAMA 1AC0A 4UIMB 4Y4FA 3O41B 1MFEL 5TF1L 4X7EC 1MCPL 1OP5K 4Q9RH 1YNTB 5IBLC 3OKMA 3G9VA 3HC0A 4HAFA 3ZYJA 4ZFOB 3VFMB 1GHFL 2D3VA 2VQTA 4U0RC 2WBJD 5IQ7L 4NM4H 4TYUA 3QWRA 3VRIB 3UYRH 4PIRF 2NLJB 2OTWB 3QHFH 4DKEL 3MJ9H 2J88L 2OQJA 15C8L 1EAPA 5EZOL 1OQOA 3KVQA 4YAQA 4U1KA 2IPKB 1Q0XL 2XG5A 2EDDA 4OQTL 4HIJA 3RGVC 2AJ3A 2ZPKH 2Z0BA 1TZGH 1BEYL 1X7QB 1KCLA 4LVNB 2CRYA 4LK4A 4Q74A 4DGYH 1CE6A 1KB9J 3ZHLA 1QYGH 3ECBA 5IHUH 3U7YH 3HR6A 3GSWB 3ARGD 5EG6C 2D0GA 4F15B 3SDCB 5DMKA 1CN4A 1QFWI 4HEME 1GIGL 2HN7A 1RJLB 1V7NH 1T1ZB 1MCDA 4NYLA 1JWSA 2VQUA 4R7DB 4ODXB 3T2NL 1R5WA 3B5TA 3BZEB 3DRTB 3BP7A 5CBAB 5HI3D 1A1OA 3B5HA 2ADFH 4EZMA 1MCNA 2GSGB 2ORBH 3MRKA 3QUML 3U9UB 3ZYZA 3U0TB 4YO0A 3FQUB 1FORL 1XGPB 1WT5C 3TBSB 5I1GH 4PV8A 2DQEH 4ZTPH 4S2SB 4BQ8A 5GSVB 1CS6A 2A6JA 4NC1E 5TDOB 1R5VA 1PVHA 4QXTA 5I75B 3HE7D 1I1CA 1KEGL 2YOCA 3QYCA 4GW5B 5IMKB 5KVEL 3FTGB 1HILB 5EPMA 1LEKA 1ZEAH 1LNUA 3MYJB 5I2IA 5JXED 3L7FB 2P24A 5B39B 3GHBH 2AW2A 4K71B 5DYOA 2YBRB 2H3NB 3L3IB 3BP6A 3PGFH 3SKJH 4ZUVB 1ZHKA 5BS0D 3BYYA 3FQXB 3MA7B 4MAUH 4HPOH 5CILH 1S7XA 2Z35B 4JFYA 4HKBA 5DK2A 1G7MB 1NBZB 5J9PA 1WWAX 2F53D 1PKQA 3FQWB 3L95A 5F1IA 1S7WB 5DVKA 2X09A 1R0AL 1A2YA 4P9HH 2FD6H 4WFHE 3KPPA 1HDMA 2Q7NA 4G6FD 4MS8C 2Z92B 4RDQG 2XZQH 3QI9A 3QUXB 1JI1A 4H20L 4JFQB 2DYPB 3MGAA 1GAFL 3MRCB 4PRIE 5EU6D 3SDXA 1IAIM 1UKSA 2F8VA 1CLYH 4K7PL 1TQCB 1YEFL 3VWKA 1KN4L 1CLOH 2ICWJ 2OZ4A 1CVSC 4ODSL 3ZKMD 4WIQA 2JB6A 5GRUL 2P46B 2WSKA 2C3WA 2AXHA 1AGFA 2GAZB 4TNVF 1CGSH 1N26A 1FLRL 1ZS8A 4L3EB 5DZLA 4ZFZB 3EO1B 3EKCA 4R3SA 1P7QD 4WDIA 4GW4B 4B41A 4LHJB 2QADC 1YY9C 1C5DA 1X4XA 4ALAL 4PRIB 5KAQG 3ZL4L 5IGXL 3G5ZA 4OFDA 4W4NA 2VDOH 5LVEA 1CL7I 2DI8A 3ILQD 3WNMA 4XPGL 1B2WL 4RMRA 2NTSP 5KJRH 4XCFH 3Q6FB 4QHKI 4JFED 3IB4A 4F9PA 4MYWB 4ZNEA 1SVCP 1HXMB 1U2HA 1AQDB 5CINH 1T03L 1F6AA 1CF8L 1SBSL 2IANA 1YY8A 2VXQH 5DJCB 5DJ8A 5CLWA 2IFFH 3STZA 3G5VB 3GBLA 1JMXA 4ZAKB 5JW5A 3MGTB 4MQSB 4RZCB 1A14H 1F00I 5D1ZD 3QCTH 4XH2A 2AV7A 3PHSA 2JE8A 3CDCA 3HC4L 4JCLA 1KEML 4GKNB 4EBQH 5F3BB 4TVSa 4XPTL 1FO0B 2NQCA 2QHRH 3MCKB 4K2UL 1QSEE 4PLKD 3BGFC 1WZ1H 1ODAA 4PRAB 4L4VD 3RQ3A 4DEPC 3HNSL 3GO1L 5I17A 1NC2A 1RUAH 3K2UL 4OCYL 2YPLB 1AO7E 4W4OA 4N68A 3GNMH 3QO0A 1C12B 3RWDB 3U46A 5IB2A 5DK3A 1FV1B 5HJ3A 2NY2D 4EDXA 1P6FA 4NHCH 1XR9A 4NGHL 4OT1L 1A6PA 4Z76A 3WJLA 4ISVB 2DWDB 3U0PA 4HCRL 3GI8H 1CTOA 1RIVH 3KPRE 2CQVA 4HWBH 4PJBA 3HG1D 2D7MA 3KPQB 2X41A 2CKBH 4JM2C 4W68A 3X13B 1I7UB 1Y6KR 5EZIL 2EE3A 1T4KA 1H15A 5CJ5A 3QPXH 4HBCL 3MV01 4UB0H 3WO3B 4F3FA 4EEEA 2MQ0A 1QSEB 4Q0XL 3MJ9A 1TENA 3G6DL 2R15A 1CDUA 3TVMC 1KBGH 1KIRB 3U79A 1T6VN 3TPUA 4XNZC 4ZDHB 5GGRA 1HXYB 5JXAH 1JTOA 4EI5B 4G43B 1LE5B 1CICD 2F54A 2BRQA 2PXYA 4LBEB 3VWJB 3MV9B 5E1HB 4L4TE 5I71C 1M6OB 3T0EE 2DAVA 3ZE1F 3KPRB 3VFGH 4GBXA 5A16B 3C60B 3DUUA 4XXDB 1P84J 1H3GA 3UJJL 1VFOA 3AC0A 5FO8B 2MSPA 3FRUA 4KJYB 2C26A 4ZPTA 5CJQH 5D7JC 5K9QG 3H42L 3X3GL 2HLFD 4Z7UB 3MA9L 3NIGE 3Q0HA 5EZJB 4F8TA 3IF1B 3RIFF 1S7SA 3L3KB 4G8FB 2DL9A 5DUPH 3VXRD 3IDNB 4YR6B 4M03A 1WK0A 1KCRL 4M62L 3QAZC 1Z2KA 4EUPB 2QQKL 4KY1L 4CJ0A 4WW1A 5DC9B 2R2HB 4GAFB 1Q94B 3IETA 5D1QA 3LHPH 5EU5B 4OGAC 5I8EB 2K7PA 4YBQD 4F7EA 1INDH 2IALA 3T0EB 3W2DL 2P8MA 4DCQA 1J86A 1H0DA 3CXDH 4WHCA 3RNQB 2X70A 1LK2A 4UINL 1U3ZA 4JY6B 3CFEA 3KLAB 5HDQH 1G1CA 3C5JB 3VH8B 1N4XL 4HPYL 3UTTE 3RTQB 1C1EH 4CVXA 4N0FB 3VXSA 4XMKH 3QNZA 2HMID 4JE4B 1A7RL 1EVTC 2Q3ZA 2Z31C 3LH2H 4N90D 4PREB 4CADB 2FJHA 3X11B 3ZTJG 2JK5A 4NO3B 4XWGL 1I3RB 1IGYA 1MHPL 3F7PC 5DMYA 2BY1A 1XGTB 4MA8L 1N8ZB 2VDQH 1UQSA 4F7PA 2WINA 2WBKA 3QT2A 4O4YH 3WHE1 4YUEL 4XBPA 5JR1L 1JPFB 4ZXBD 4CU8A 2ZSVA 3VD4A 3QXDB 4BKLA 1FVCB 2F9BT 1DR9A 2OLDA 1C5BL 5HXMA 1CFBA 4JDVA 2OJEB 5E9DA 2CH8A 2FJGA 3WCYA 1D6EB 3MRFB 3UTTB 3PWLA 1E27A 4BFIA 4J3SA 3ARQA 5C6PB 3RBGA 1NGPH 4DN4H 1EX0A 1T5XB 4TVPH 1OW0A 4NKIH 1AD9A 3V4VL 4NRYB 3HRZA 4EDWL 1IBGH 3MRQA 5C0NC 2P42B 1AHWC 4J2XA 3RVTC 3LKNA 3LN5A 4M6OH 2V5RA 4MHHI 4J1UB 1WIOA 1CQKA 2DQJH 1JK8A 2WW8A 3TO4B 3PL6C 1MCJA 1X5HA 4P3DB 5E6IC 5LAXB 4OCNC 1ZA6B 4DKDC 2R4SH 3GSNB 2BCKA 5D7LD 3IVKA 1W72B 1NCCH 4NSKB 3DO7B 1RZKL 1A3RL 2DF3A 2YK1L 3RDTD 4K8RH 3RGHA 1OD9A 1BZ9A 5I8KH 3U83A 4F37F 1NCBH 1S9YA 5IOPA 2H2SC 4YDIH 4Q2ZA 2DM7A 5ECJE 1CFNA 4BZ2L 2IBGA 2DIJA 4ZO8A 2FR4B 4Z78B 5JHDD 1Z9OA 4J3UA 1CT8B 1NLBH 1MUJB 3DX8A 2YD9A 2ICWA 3L3OB 2AGJH 5TE6L 3H3BC 4BFGA 4CU6A 3MRNB 1N59A 1PG7X 4HJ0C 3HMWL 1OAZH 5D5ME 4OIBA 1X5LA 4JPVL 3ULUL 2WUCH 5MP6H 3OXSA 3TPKA 2CMRL 3MLSL 4X6CE 4U05A 3C6LC 3DYMA 4OM1H 5J0BA 2EDRA 4H25B 2IPUK 1NLDH 3DUHA 1PKOA 3SBWA 2DTSA 5DGQA 4GOSA 2D7QA 4G8EA 5DQDL 2L4OA 2XNAB 2DQFB 2BDNL 4PTUA 2WQRA 5FGBA 3FL7A 1SJEB 4WFED 3VJ6B 4HJJL 5ID0A 1WZKA 1IQWL 2AV1A 2FYYA 1DEEA 5FYLE 4GRWH 3MYZA 3LPGA 3VRJB 5L7XL 3MUZ1 1PZUB 4PY7B 5D5MB 4H26B 4L3CB 4U6HB 2ZCHL 5L8KB 3ARGB 4HT1H 5J57B 4JKKA 4XNYH 4X6CB 1JNHA 3STLB 3F6IA 3RL2A 3WXVH 4TSBL 1AGDA 1WVZA 3KJ4B 1MRCL 5D7IA 4I3RH 3GMRB 4M9OA 3WFCL 5BV7H 5GRJH 1JTTA 2W0LA 2Y06H 1CGXA 1FAKT 1MAML 2W9DH 4CMMB 1MIEL 5BS0E 1LO2H 5TQ2L 4KUZH 2FX8L 3U9PH 1F11A 2Q8BH 4YDLC 5B3JE 4NWUL 1F58H 4NN6C 1A9EB 1HK6A 2GIYA 5DQJB 4U1SB 3U30C 3K1KC 2F53E 4GMTL 2MKLC 1A1MA 1YN7A 2CK2A 1UM6L 4JG0L 4Y19B 3ZDZF 2E8YA 4ORGB 1FZMA 1LO3L 4NC0B 2UVEA 3HAEB 3HE7B 1E0OB 1RZIB 3JWOH 4D9LL 3CPLA 4HJGA 4PJAE 2E7HA 2ZKHL 5ETUA 1YN6B 3WLBA 2W38A 1IKNA 1TNMA 3LD8B 4QRRD 1TZIB 4XVSH 5EU6E 1C8PA 4POZC 5GRYA 3BRDA 3WKNA 4HUWA 2KH2B 5C0FB 3GJEB 2AJXH 4L8BB 5BS0B 1EH9A 1UWXK 3ARBA 4Y5XC 3S4SB 5F9AC 5C3TA 2GK0B 3UJIH 4HC1A 3ZTNL 4D9QD 5ELIA 1NCAH 1EUUA 2F53B 3ARFC 2VE6A 2YC1B 3VCLA 3WFDL 3TBVB 1QFHA 4OD1L 4U3XA 4Z5RB 2D7PA 4WWKD 4UTAL 1XR8B 3P0GB 3F7YA 2X1XR 4RRPA 4X4XB 2YN5A 1CXKA 2MHAB 3RVWC 4PJAB 4G6FB 2CIKA 4H1LA 4J4PA 4WTXA 2ZOKB 3IJHB 4GW1B 1XCTB 2CXKA 1R5IB 3EYVA 5A2FA 5CEZL 3QDJA 4OLWL 4L8CA 2CUHA 4M4PA 3TF7C 3IDMB 4FZEL 5B39G 2X7LA 2D0FA 3GMQB 1T1YA 4JFEE 3WSQL 1OD7A 5F7NC 1AC6A 1F2XK 4X7TA 3V2AR 5L8JB 3V4PL 1YQ2A 5I19L 3OKLA 1RUKH 4NFCA 2YWZA 5B22A 2C3GA 3FZUD 1LDPH 3KPMA 4WI8A 1MCWW 3PXJA 1FNGA 2VDRL 3IGAA 3TWCL 1J8HA 1P7QB 2BNRA 3BQUA 1RIUL 1KB5A 1JZ8A 5ESVB 3NMEA 1DL7H 1IGJA 1ZOXA 2ZP0T 4C58B 3I3EA 5JNYA 4QEGA 4YDKL 5M95B 2H1PL 2GYSA 2I9TB 5D96B 1JWUB 5D2LE 3QIUA 5BMFL 3F6LA 1FVEB 5IFAH 1XFPA 3EYQC 1MFNA 1NMBL 3P4OA 2PW2A 3OKYA 1CIUA 3DOSA 2J6EH 5J6HB 2D7TH 4L4VE 5L0QB 4XHJC 3D0VA 4R4ND 3CDGB 1AGBA 1FIGL 3NZHH 4JO3L 3DI2B 4KK5C 4MXQC 4N8CH 4F9LA 5KTEH 1OP9A 4QY8A 5I16A 3HA0A 1TJHL 3P9LB 1ITBB 4QNPE 4JY5L 2OBGA 2IG2H 1OSPL 3C6SA 4PJXE 4P46D 2IFGA 5CUSL 4PLJD 4AQ1B 4MA3A 2RR3A 1GYAA 5D1ZB 1D5BB 4RFEA 3OF6A 5E94A 1ZVSB 2ZCLL 1IT9L 5D2LB 4MJIA 4TSAL 3AU1B 2IQ9L 4RX4D 1ITCA 5HVHB 3P9MA 1J05B 3TC9A 2I9LA 4G8IA 3DJ9A 3QEUA 5A1AA 3DHMA 1Z0MA 2A73B 4L4VB 3S98A 4Y5VB 5ESQB 2Y5TB 5FYKL 3D3VD 4HMEA 4UNUA 2ATPB 4TULL 3NAAL 1KPRA 1JPTL 4WHTA 4KK8D 4M6ML 3WS6A 3L3GA 3E6HB 2NY2B 3V0VB 2IBZX 3QZWA 1NBYA 1F6FB 2HT3D 4P57A 3CSBA 1EUTA 1R3IH 4QOKD 4PJ7A 5CJXC 4PJXB 2NXZC 4HCRA 4LSVL 5JW4R 4RAVA 3HG1B 1JI2A 1U8QA 1OY3B 3RKPA 1UZ6E 4MMZC 3X3FH 5CJ8A 1NAKL 4M02A 4NQDD 3WN5C 1J12A 2YZ8A 2VKWA 2AK4D 2AQ3A 5JOFB 4KTDL 2R1XA 1NC4B 3HZYB 4JFXA 1CK0L 2VAAB 1B0GB 5BRZA 5TF0A 2NXYC 3MV7A 3VXRE 3FT4A 4IHOA 5FB8B 5HYFA 1MCHA 3KLDA 4U33A 2FSEA 1CICB 4OZGA 3TV3L 2W91A 4LLVA 4LSTH 2MQ3A 3QO1A 5D1XA 4FABL 3MCG1 5E5RB 2LABA 5TE7L 1E6JL 5H35A 1FHGA 5GGTA 5DO2D 2J7LA 4PYHA 3VRLE 4JZJB 5BW7A 2E3VA 3C5SB 3GSQA 3P77B 4XPFL 1U8PA 1FN4A 4FQIH 3U36A 2AERT 3QISA 5CIPB 1IQDB 5I1DA 4TSCL 5FUZH 3SCMC 2HAZA 2P5EA 1KFAL 3WIIL 5JW4N 2WP3T 5GS0H 3ARDC 3VXRB 1G6RL 1S9WB 5LG1A 1UM4L 1QPXA 1WGOA 5F7KC 3IDUA 3RAJH 4N0UE 3MRRB 4U1NA 4N0YL 1UB6B 1ULVA 4LEXH 1M7DB 4UI2A 2D7OA 5EBGA 2VABA 3QUYC 4P49A 1RZGA 3O6KL 1CGUA 1HKLL 2AXFB 4UT9L 4PJEA 5EWIH 1E4XI 4AG4H 3PWUB 4DW2L 3AGVA 1UZ8B 5E2WL 1OTUC 4GH7B 4NO5A 3EDEA 3PQYD 4O9HH 1I7TB 2C4FT 2NY1D 4F2MB 5C0IA 2HT4D 1G7LB 3NCYS 5CSZA 1NGYB 3O11B 4QHMB 3RGVD 5EBMB 3MBEA 3ARZA 5C0CA 2ZSWA 2EZ0C 4K8RC 3LKOA 2JCCA 4N0UB 4RSVA 4I18A 4QRTA 1EJOL 2EC9T 3O8XD 4XRCA 4EUPG 4ZG1A 5D7LE 4J6RL 4LSUH 4ZXBB 4Z8FH 4DGIL 1WWWX 4OLXH 3TN0C 5F7EH 3L5WA 3SDAC 1LK3L 2NW3A 5F6HI 3BRFA 1R3LA 4JFZL 1N64H 4R0LA 2N7BA 4GXUN 4D8PB 3KLHC 5JHDE 1F4YL 2BMKA 5C7XH 2PTVA 5IHLB 3VH8G 5GGQL 3V6OE 1UXSA 1BQHB 2K3TA 3BESR 4JPKH 1FFQA 4WEMB 5GSRB 4GUPB 5DJXB 3QFJA 5ADOL 3O2DH 3GUTA 1BFVH 1P2CA 3ARED 1BF2A 1T1XB 4IRSA 5GS3A 2ID5A 1TVHA 1RHHB 2ZUXA 3LDBC 4LSQH 3CC5B 4PGDB 4URTB 4DGVL 3CVIH 1BZQK 2VQ1B 4G8GD 5EO1A 3F7VA 3FOMB 1E4XL 3RDTB 2UYLB 3SDDC 1MREH 5HHPB 3ES6A 3RZWA 2F58H 1IGTA 1CE1L 2DRUA 4KRPD 2R2BA 5DHXB 4YWGH 3ZLQC 2GJZB 4LQ1A 4WFEE 1QZ1A 3MSPA 5JHDB 1U8NA 1SM3H 2YMXH 1BGXL 4PFEA 1A7PL 3OR6A 3ARXA 1RJYA 3QXAA 5BV7C 5TPWL 3STBA 5C0EB 2WIMA 4JZNB 4HIEA 4Y4FD 4JFFA 1HQRB 4UTBH 1H5BA 3KNBA 4NRZB 2JJVA 5GXBB 1UB5A 4E0RB 5T3ZH 3LN4A 4G7VL 5D8JL 1FL6A 2OL3L 5EORH 4LLUA 2AEIT 1CD1A 5D6CA 3D18B 4FQCL 3LKRB 4NCC1 1S5IL 3QWRD 5HDLA 1A5FH 1F4AA 3ARRA 3JWOC 2JJTA 2EE9A 5FA3A 4ZFOL 1I8KB 3LEXB 2HA1A 3GBNH 4DQOH 4L9LA 2DQHH 3EFFB 4LVHC 4MAYA 3GK8L 5JHLL 5D4QA 5CKAA 5ALBL 3KYKL 5F1NB 2EICA 4HHAB 4E5XB 3O0RH 5ALCL 1YY9D 5IESH 1P6AB 1LEIB 1U95A 4HZAA 3UEZA 1T2QH 2UZXB 2YWYA 1P7HL 3LB6C 1NCDH 4P2CG 1K85A 5HHVL 1I75A 1XGQA 4PLOB 3RWJB 4D9QE 3S35X 2AJYL 1CZ8H 1KLGB 4JPIA 4LLMB 1U8LB 3RUGB 3QULB 1IKFH 3L6FB 4FRWA 4IDJL 3LV3B 2EDFA 1ZV5A 3MJ7A 3FN9A 4EI6B 1IMHC 4DFIA 4BZYA 1QSVA 3MX0A 3P11L 2Q6WB 2ICEA 3RNKA 5IVZA 3BPOC 2DB8A 5E5MB 3GFUA 3UCRA 5DR5L 3UJTH 5I1EH 4QRRB 2DQGH 3CSGA 1PG7L 1EEQA 1K4CB 2ESVA 3BDYL 2GEEA 4I4WA 4WCYL 4N0RA 1KC5L 1V5JA 5MEOA 3BPNB 5CJOH 4CJ1A 4PRPA 4HS6A 1LO5A 2VLRA 4JKWA 4ONGL 3SO3C 1DLFL 3JTSB 3V52L 1IL1A 5IM7B 4Z7QF 5IMOA 1G9NH 1TFHA 3WO4B 3GGWB 3OJMB 4WWKB 2V7HB 2GT9B 3VI4F 3A6BH 3PV6B 3PJSA 4YE4H 5DMIH 2R4RL 5ITFA 1U8IB 3H0TB 2X4TB 5H94A 4K23H 4HXBL 4IOFD 3CVHB 3HAEG 3LKPB 4X6BA 3ARYA 4RWHA 3NFPA 4O2CA 4JM2D 2WWKO 3BUYB 1L7TL 1BD2B 2DN7A 3T08A 3B4NA 3C9NB 3PG2A 1YMMA 2O93L 1JFQL 1S9XB 1QA9A 3X14A 3UC0H 2SEBB 3O9WC 4S0TD 3RX5A 3VG0L 2XKSA 5I8OL 5GS2H 2AEWA 2IF7A 3BXNB 4NZRH 2AXGB 4FFZH 2K9UA 3DGGA 3TFKC 3GSOA 5A3IC 3S4SG 4ESKA 1FAIL 1RJZA 5L6YH 2CRMA 3FB8B 4Z95L 4OUUA 1A3LH 1PG7W 2VXUL 5B8CB 3U0WH 1HSAA 1CU4L 3FN0H 3CDFA 1JNLH 4YHNA 1OM3L 5DJZB 5CGMA 5JDSB 3MQIA 1WC7A 4O5LL 2XRAL 1WBYA 4P2QA 5JMRA 4IS6A 5F7DA 1DP0A 3OAZH 5ACMA 3D39A 3BO8A 5D7JD 1CGVA 4NQXA 3HI1B 3OAUH 3VFRB 1QNZH 2NZIA 5IQ9B 1NUGA 3DBXA 5IB1A 3QCUL 2OTPA 1YUHB 1X5GA 5F3HA 3D3VE 5KSUB 3VFSB 2NW2B 4UU9A 1P1ZA 3EYFA 1RUQL 4ZS6C 5T1KB 3I85A 1T20A 5K9KB 1U8HA 2KQMA 1J88A 4Z7OF 5D70H 2V7NA 3BZ4A 4QOKE 4P46B 4ZS7H 2H6PB 3C8KB 1VADB 1OPGL 2R1YA 5LWYH 4GXVH 2IAND 1OSZB 4KVCH 1A21A 5HHQA 2D4FA 3IFNL 3BVNA 4NQDE 4PB0H 4NNYA 4FFYL 3OB0H 4ODWB 4ZSOB 4WJ5A 4XP1L 2AK4E 3IDJA 3GIZH 3VFPB 4PRHD 3NVQA 2GTWA 4ZUSA 2Z31D 1MCBA 4YHZL 3RZCA 4PTTB 3MFFA 3D3VB 2WUBH 3REVB 4MHHG 4G6AC 1J7VR 2DI9A 5DWUL 1BP3B 3GMNB 5JOPD 1EBAA 1S7RB 4HQQL 4R90H 5EOQL 2BNQE 4Z7VB 1WCBA 3LEYH 5CMAB 5KZCD 4ELMF 1NC2D 2M26A 1QVOA 2EH8H 1N5AA 1NSNH 4L8SA 2CDGB 1Q1JH 3ET9F 4KXZI 3VFTA 1FH5L 3HZVB 5GS0C 5EO9B 4DVBA 4X7SL 4NQDB 3UZVB 4LLYB 3E6FA 1D5XB 3UBXB 4ZOBA 2AK4B 3K8MA 5FA4B 3HI6L 3LQMA 4GLRH 3RIAK 3FB5B 3CFCH 2W9LA 2XPGA 2HJLA 3P4MA 5GHWH 1DBBL 1WFOA 2DLHA 1AQKL 1FDLL 3KS0J 1QRNA 1GGTA 3VGDA 1MVFA 1BOGA 5E00A 3NPSB 3RVTD 1QFPA 5IEHB 4FQXA 3RY6C 3O2VH 4I77H 1YEHH 1YNKL 3PL6D 2CLRB 4S1QL 4XAWL 3MO1A 1VEMA 4KJPD 3UPCA 5EU4A 4XCEB 1D7FA 4OD3H 1A6UL 1RMFH 1OAUH 2F74B 1HHHB 3VXOA 4MZ2A 1X5IA 1U8JA 3PQYE 5J1AB 3NN8B 5DI8A 3KS0H 3S3JA 1N6QL 1BREA 4CNIA 1KJVB 3WEXA 7FABH 4U7KA 5LJYH 3MNWA 3S34H 5ICXA 2A6DB 4BJLA 2GTZA 5CEXA 1AIFB 3WIHA 4HJ0D 5FO7A 4WVRA 3BW9A 3JTTA 5EBLA 4MXWL 5GISH 2NNAB 4MD5A 5I66A 3RVVD 4M61B 1M4KA 4LHQB 4PJGE 2XKUA 4XNXL 3DETC 3C6LD 4ORZC 4LAQL 4AEFA 1UH3A 1MNUH 1RQ5A 4WEBL 1LE9A 3JV4A 2HWZL 4YHML 3BZFA 3MREA 1U3HA 1A4KA 2R2CA 3VXQB 4YBHA 3I50H 4CDGC 1X4ZA 5D1QD 4CBPA 2NY1B 3ZKXB 1AXSA 4J3VA 5F21B 1MLCB 4K7FB 3UTOA 4ZUWB 3RGVB 4D0BB 5MEPA 2Q86A 4OZHA 5DJYB 4AT6A 5I9QC 4Q6IC 2J8UF 5C9JB 3CH1B 5TF1H 1MFEH 3BAEL 3QRGL 1RK1A 4MCYA 5FOBA 5LQBH 3GMOB 1XEDA 4G8GE 4X98B 5KN5A 4LDOB 5DRNB 1ES0A 1GHFH 3OKEA 4L5FL 1E4KC 2HG5B 3BGMA 3O3AA 3LQAL 3TESA 3QEHA 4Q9CA 5BQ7B 5IQ7H 4LRIA 5BCAA 1BIIA 4AK1A 2BOBB 1D9KC 2XQBH 1LD9A 5IHZA 4HWZA 5E2UL 2YXFA 1WBXA 2XWJA 3FQNA 2J88H 4DKEH 4DAGL 15C8H 2HP4A 1IC4L 1FL5A 2YD8A 1I85C 5HGDA 4Z0XA 1Q0XH 2E9BA 3DV4B 4OQTH 5EZLA 3GHEL 2RFXB 1BEYH 3AREB 4U1LA 2C4FU 3GMPB 1CVRA 4NPYA 5JTWA 5DSCB 4G8GB 4OKVA 3BWAA 3LN9A 2BOCA 4LPVA 1HHKA 3BP4B 1Q9OA 4M7LL 3T0WA 2IAMC 3MLVL 3UDWA 4Q58C 4HGWA 1GIGH 4UT6L 1RUPL 4EN3C 3I02A 5JLZB 2EC9U 3VD9A 2CR6A 1UWXH 2HRLA 3T2NH 2GUOA 4FXKA 5DDHA 1FG2B 1FFNB 3CMOH 3QUMH 1G7QB 3TIDA 3MRHB 4AYFA 3ARFD 1BQHG 4QTHB 1FORH 2FJFB 4BH8A 3ZZ1A 1HNGA 4X7CC 2D2OA 1KCVL 4WNQA 3R4DA 1V3MA 2V9QA 1U58B 3QG6A 3CAFA 4Y4FB 4PRNA 2NY6D 4J23A 3RVWD 5T1DL 2DM4A 5C07A 4LL9A 1KEGH 4HH8A 2XKNB 3B5GA 2E27L 4Q9QL 2P48B 4OZ4B 5KVEH 4I13B 5EIIA 2WNGA 3A67L 4UIMA 3QXVA 1YJDL 1WZMA 1I7ZB 4TNWF 1A6VL 1MQ8A 2V6HA 4Z9KB 1YNTA 4P2OC 1RI8A 5FFLA 4OFVA 4KKBC 4RQQB 1A7QH 3SE3C 1DBAH 3VFMA 3SKUD 4A6YB 2OQJB 3QIWA 1TMCB 3O4LA 4FHBD 4U1KB 4AL8L 1KJ3L 2Q8AL 3VRIA 4MD0B 3V4UH 5HD8C 3DYOA 4HIJB 5F9WC 2OTWA 4FNLL 1SYSB 2BVPB 4YLQT 1UXWB 1KELL 5T3XE 4P5KB 1MJ8L 1NAMH 3ZO0A 1R0AH 2IPKA 4RFOL 1MRFH 4FOMA 2QADB 1UEMA 5CHNB 1E4JA 4ODHL 3BHBB 2JB5L 1RSFA 3ECBB 3NIFF 1GGBL 4TUJB 5BOPA 1G9NC 5DRWB 1ZGLP 2XTLA 1XH3B 5H37H 1GAFH 3HR5A 3EYQD 1RU9L 4QKXB 2HN7B 3DRQB 4WENB 1QLEL 1YEFH 3GSWA 4XHJD 1KN4H 1PYWB 1VGKB 2XY2A 9CGTA 4S1RL 1R5WB 4XP5L 4ODSH 5DJDB 4Z0BL 5I1AA 4MXQD 4KK5D 1XCQB 5FDYA 5GRUH 1T1ZA 2DQCL 4YO0B 1U3JA 1FNFA 1FNEB 3N1QC 4R7DA 1FLRH 2FEDC 3B9KA 4EIZC 3QQ9D 3BZEA 3DRTA 1P69B 5CBAA 2B7DT 4M93C 1PKQE 3U9UA 2A6JB 5FYLL 3U0TA 2HKHH 4PBXA 1LO0L 4QXTB 1M7IB 4M1CC 2I24N 3TBSA 4ALAH 4S2SA 5IGXH 5GSVA 4XBGB 4HIXL 5J1SC 3BGFB 5TDOA 1NKRA 1YQVH 3RBSA 3V6ZB 5IR1A 1SEQL 1BJ1J 2PR4L 4DEPB 1B2WH 2NY0C 3SDXE 3FN3A 4GW5A 1ZXQA 5IMKA 1BVLB 5CWSB 2KDGA 1HZHL 3FTGA 1BOYA 1HILA 3MYJA 1BF8A 3ILPB 1T03H 2CJUL 3ARBD 3L7FA 1SBSH 5B39A 2I27N 4MCZB 1AGEB 1KN2H 2YBRA 2H3NA 4GG6E 3L3IA 2X4QB 3DO3A 2NXZD 3BH8B 1PKQB 3MA7A 1D5IL 1GCFA 3L95B 2VZTA 2FX9L 4JM2B 2Z35A 4H5SB 3DARA 2PUQT 5INDB 1G7MA 5FV1L 1NBZA 3MRGB 4RAHA 5D7KE 4WO4C 4ETQB 1NFKA 3WHXB 3HLAB 1F42A 1KEMH 2OJZL 3EDJA 5K9JL 2BVOB 1S7WA 1MFBH 4XPTH 1XMWA 4YPJA 3TVMB 2JJSA 4XNZB 3SDXB 2UUDK 3R0NA 3HNSH 2YUZA 3GO1H 5D6DA 2Z92A 2W0PA 2DKUA 3K2UH 3QUXA 4OCYH 1QFUL 2APTA 1OHQA 4JFQA 4QHKJ 3BKJL 4Y4KC 3S8WA 5CGYD 2DYPA 3MRCA 3V7AE 2BVTA 4ZNEE 2LU4A 3V5KB 3V0WL 5I71B 4IIQC 4GG6B 1MY5A 4KH2A 5HTSA 4NGHH 4X6DA 2IANE 3S35L 4DKAA 1PGRB 4XTRD 4LIQE 1YA5A 4ONHB 5IEKA 1TLKA 2FO4A 4S1DD 1J8HD 2ED8A 2XZAL 5SX5H 3IJYA 3MPCA 1CL7H 4JR9H 5EZIH 2ZUUA 4P5TC 5D7JB 2GAZA 5MERB 4HBCH 3SCMD 4WTWA 3TA3C 4TPRH 3KPOA 4L3EA 3G5ZB 4KKCC 4Q0XH 4D0DB 3EO1A 3G6DH 3ARDD 1BM3L 4GW4A 5JOPE 4F57L 1V05A 4X5WB 3QAZB 1OP3K 1FIEA 1F97A 3MLZL 4KHTL 3MXWL 2QV2A 3FO1A 2D9QB 3WFEL 3Q5OA 3QUYD 2IANB 1YY8B 2VSDA 4TVPD 3STZB 4NUJA 1CGWA 1K2DA 1SHMA 3IJSB 3Q6FA 4GJTB 4NT6A 1QOKA 4C4KO 1DZBA 1HXMA 1WCQA 4F7TA 1AQDA 4OCRL 4FQ2H 5JIPA 4PRHB 5DJCA 3NCJH 4PJBE 3UJJH 2Z31B 2XQYG 3G5VA 3OG4B 2AK1L 4ZAKA 3MGTA 3H42H 3X3GH 4LOUC 4TTDC 1KJ2A 4I8DA 3MA9H 2FHFA 4WHDA 1PEZA 4RZCA 1NGWB 2EZ0D 1H3TA 3T0DA 5GIRA 5FYKU 4K8RD 1HQ4B 2VDML 3MBXL 4U6VL 3UTPD 2Q7YB 1KCRH 2E8ZA 2XOTA 2QQKH 5KZCB 4KY1H 3O3UN 5F3BA 3OKOB 1FO0A 3P0YL 3MCKA 1LVEA 5KOVC 1YYLL 1MCSA 1MCOL 1I7RA 2ITCB 3W2DH 3C09C 4PRAA 4QGYA 3V8CA 3SOBL 3LEVL 4UINH 2UV3A 5KVGL 2YPLA 1K9TA 1N4XH 1C12A 4PJBB 3RWDA 3KLHD 5CP3A 1FV1A 4XPBH 1A7RH 2VZ3A 4M8VA 2DJUA 4WU5B 3VFOA 2DWDA 1AHWB 4XWGH 3CK0H 4YHIA 2WWMC 1MHPH 3KPQA 4UNTA 4Y1AB 3BGAA 1I7UA 4MA8H 3TPUB 5IWLA 3F7QA 3PL6B 1ADQL 5E6IB 3E3QC 4M43L 5FDWB 5BRZD 5GJSL 4N1HB 3MV7D 4XHQA 4YUEH 3WD5L 4AY0A 3MV8A 1QSEA 5JR1H 5HPOA 2YHGA 4LCIH 1KIRA 3S36X 3IU3B 4ZDHA 4YHLL 1HXYA 1NAMA 1C5BH 4O2EB 4QRSB 2HH0L 3LMJL 3DURB 1FZJB 4XP9L 2C7UB 4EI5A 4G43A 4KDTA 1FE8L 3C5ZC 3FOLB 4LNRB 4LBEA 3UBXG 3RHWK 3MV9A 4N0CC 1JGUL 2X4OA 1M6OA 3V4VH 3DROA 4EDWH 3KPRA 5A16A 1X5YA 3C60A 4PBWD 3ZE0F 3CXHK 5F7FA 2P5ED 4XXDA 4LFHD 4HX1A 3C6LB 5FO8A 4KJYA 4G7YL 1V3LA 3EYSL 4LCYB 4Z7UA 5DA0B 1FBIL 5EZJA 3IF1A 4PJFE 4U1JB 4N5UA 1RZKH 4PJ7F 2YK1H 5D1QB 4G3YL 3EGSB 3IDNA 4YR6A 4F7EB 2IALB 4DCQB 2ADIB 4BZ2H 2R2HA 1IGML 5E9DE 2VLLB 1Q94A 2C3VB 1QBML 2VWEC 5I8EA 4YK4C 1IEHA 3DGCR 4CVXB 3T0EA 5TE6H 4M7LT 3B6SA 3RNQA 4D2NA 2FJHB 3HMWH 3W0WB 4JPVH 3ULUH 3AROA 1EBPA 3C5JA 2HFTA 3VH8A 2ERJC 4PPTA 1WICA 3PGDB 5E95B 3RTQA 1EIBA 1IGYB 2W60A 2CMRH 3EJYC 3MLSH 4OZGF 4PREA 4JHAH 5JIKA 3VGAC 4CADA 3SQOL 1CXHA 3WS3B 4U0QB 1A0QL 2X9WA 4PJFB 4NO3A 2Z93B 1I3RA 5C09D 1YECL 1ZT4B 5E8EB 1J11A 2Y9RT 4ENEC 1NANH 5DQDH 1N8ZA 1BFOB 2NR6C 3BX7C 1S8DB 4YDLB 2BDNH 4NN6B 1B6DA 4HJJH 1TVBB 3U30B 1JPFA 4LLQB 3QXDA 1FVCA 3RU8L 1RZ8B 2XI9A 3KPTA 5L7XH 4YXHL 4LAJH 3SGKC 2OJEA 3KYMA 1JZ6A 3VMOA 3LZFL 1ZHBB 3MRFA 3QFJD 3UTTA 2YPKB 4ZFGL 3LN5B 5EIVA 4NKMA 1T5XA 4XXCC 4JQVA 43C9B 4M1DL 4TSBH 1OCWL 3WFCH 2BCKB 3GEWB 4PJEF 5I1JL 1JNJA 4Y5XB 1G7IA 3AFLA 3B2UC 3O81A 1MAMH 2DWEB 3LSOA 1MIEH 1BZ9B 1PBYA 3TO4A 5TQ2H 4K3JL 3FCTB 3QHZL 3C2SA 4MMXC 5LAXA 1ZA6A 3NA4A 2ZG3A 3GRWA 1CFNB 1QFWM 3GSNA 3MOAL 3ARFB 4NWUH 1W72A 2DMBA 3T3MF 4GMTH 5DVMA 2ICWB 1UM6H 4NRXB 2NY6B 3MRPB 5E6ZA 1VKXB 3AM8A 4D9LH 4OIIH 2FR4A 4Z78A 3TZVC 5DD1L 1T7WA 4ZODA 5FGSA 4JLRB 1BIHA 1MRDL 3L3OA 3O3DB 3OXSB 4MSWB 3MZGB 3IKKA 3MRNA 3L9RA 5FV2A 3RWIB 1F90H 3VW3L 1WIUA 5IFJB 2HJFB 5D7IE 1H3PL 4G8EB 2EE2A 3TFKD 5JQ6L 2XTJC 1JF1A 1N6VA 4RWYL 4I0PC 5DMJB 5HI5C 3H9HB 1JZ5A 5ID0B 1CFQB 4PP2A 4GAGL 2FYYB 3WFDH 1RFDL 4OD1H 5EDXA 3N85L 4UTAH 5DGRA 4PGCB 3IFLL 3HUJF 2XNAA 3PDOB 2DQFA 5MEQB 1QKZL 4OQ1A 2W9EH 4QXGH 2N7AA 4FG6D 3FFDB 1Z0NA 3P4NB 4L4JA 1IEAB 1MFCL 3VRJA 4QCIB 4PY7A 4H26A 1TDQA 3K1DA 1RULL 4U6HA 3NACL 4OLWH 2H8PB 4JREB 1OTSC 3ARGA 3CX2A 4X6CA 5AD0B 3STLA 3WSQH 4IMKA 2CKBB 4ZS6D 5KSAC 3A6CL 3UXFA 5I19H 4KZEL 2NYYC 1DLHA 4ZD3L 3UPAA 4E9LA 3O3EB 1N5YL 3ULUF 1NL0L 1IGFH 2VYRE 3TWCH 2VDRH 2CKNA 4MXVF 3VFNA 1RIUH 1A9EA 5IB5B 2Q87A 2XA3A 3B8YA 2G2RB 2N1KA 4YDKH 1BLNB 1CCZA 2H1PH 3FRPG 5ETUB 3TCLB 4Y19A 5BMFH 1UWGL 3HPLB 2DI7A 3HAEA 4JQVC 2X9YA 3HE7A 5GRWA 1NMBH 4FTVA 1RJCA 1RZIA 1OLLA 2ESVD 2WBWB 4QGTA 3QDJE 4G6AD 5HHXL 1YN6A 1FIGH 3ARBB 1T7XA 4JO3H 1H3XA 2ZWLT 1TZIA 4DOHB 2VDLL 5FUOL 1TJHH 2NXZB 5C0FA 1B4JL 4L8BA 5BS0A 4JY5H 5ANME 3BIBX 1YC8A 3S4SA 5JW3L 3NIDF 2G5RA 2HFGL 5CUSH 2GK0A 1WF5A 5LXGH 1J8HE 2YD2A 2ZCLH 2YC1A 5F7UA 3TBVA 4WI7A 1XR8A 4TSAH 2NY4C 2IQ9H 4NUGL 4X4XA 1RVFL 2MWCA 2UY7A 2MHAA 3OJDB 4PJAA 4TNVK 4N9GA 5JZ7C 3T2OA 2ZOKA 1UH4A 3IJHA 4TULH 3NAAH 2ZG2A 1JPTH 1T1YB 1S9VB 4GW1A 4M6MH 4NKQB 1P7KB 1R5IA 1MELA 2F8OA 1MCKA 4HKXA 5C0JB 4X7TB 5EO0B 3IDMA 5GS1C 4TVPE 5ANMB 4M3KB 5KANG 3GMQA 4LSVH 3LS5L 3IGAB 4PJIE 4KI5D 3H3PL 2BSSA 4OAWA 3SCMB 1ZT7A 1NMAL 2O26U 5IT2H 4IOSD 2X1WL 5F70A 3MUHL 2Z9TA 5JNYB 1FP5A 4HXAH 1P7QA 3NH7L 4MJIE 4QRPB 1CK0H 4P2QD 2B1AL 3ARDB 1S7TB 2GJJA 1SYVB 1F5WA 3P4OB 2PW2B 4RDQF 3UTPE 5BJTB 1B0RA 2I9TA 1JWUA 4OF5A 2DMKA 3TV3H 3I84A 2HT2C 1LEGA 1JIBA 3QUYB 5TE7H 2BC4B 4MB5A 1QUNA 25C8H 5HYIA 1E6JH 2RQ8A 1JGEA 5I16B 5J6HA 4JAMB 1HYSD 2KZWA 1CFSB 3CDGA 4XPFH 4PJHE 4PJIB 1KTDB 1M05B 1AGCA 2GKIA 3VDBA 4JEGB 4U3CA 3CFJB 4RGNC 12E8L 4LGPB 4TSCH 5E94B 1JGLL 4HUXB 1KFAH 3WIIH 1CDJA 2ADJA 2FL5B 5D1ZA 1WEJH 1D5BA 2I9LB 1G6RH 5C9KA 1UM4H 4NJ9H 1QBLL 1ZVSA 3K80A 5F7LB 2LE9A 3ABZA 4NM8L 1MIMH 5BRZE 1DFBL 4JO1L 5KAQF 3MV7E 2X4NB 3AU1A 4HUUB 4FQLH 4N0YH 5DK0B 1JUFB 1OGAD 2X1QA 3ZTJH 4E41D 4GRWE 3MRDA 3VXMD 5B38B 3DSNA 3O6KH 1HKLH 1HE7A 1JWMA 4Y5VA 5GZND 5ESQA 2Y5TA 4PJHB 1D9KD 2ATPA 1H8SA 2WAHA 5DQ9B 1UCTA 1OAQH 4RAVB 5E2WH 3RWEB 3O6FC 3F7RA 3QJHA 3TYGL 1XIWC 2A9ML 4HD9A 5HVWA 3QQNA 4PJXA 2G75B 5TQ0H 4ODVL 1S7UB 5FYJD 3WXWH 1DQJB 3HG1A 1Z9MA 2R1XB 5T3ZD 5KG9B 2P5EE 3UYOD 1RZKC 2V5SA 5BRZB 4JKLA 3FT4B 1A7OL 2DD8L 3DSFH 4I3SH 2DQIL 3H7BB 5JOFA 1EJOH 1RPQA 1NC4A 2FSEB 4GRWB 4J6RH 4LLVB 1JHLL 4DGIH 2VAAA 4QWWC 2APFA 3SDDB 1B0GA 2IAMD 4RCAA 2I60L 5FB8A 1LK3H 4JFZH 4EN3D 3ULUC 1TVDA 1CICA 3RIFK 3GSQB 1J0KA 1FN4B 1F4YH 5GGQH 2XIDA 2JJUA 5FK9B 3MRBA 3IDXL 5FHBL 3ZE2F 4R6UA 5BZDA 3C5SA 5T1MB 3JUYA 3LS4H 4XVUC 2P5EB 3EZJB 1G9EA 1IC1A 2B2XL 5F1OB 1JPST 5CIPA 1IQDA 3TT1L 4AEHL 3MUY1 2G5BB 5C0CE 1KCUL 4DGVH 4YX2L 2JCCE 3L3HA 1DVFC 1E4XH 1T0NB 3OMZA 5C09E 1KXTB 4ODUB 3NABL 3VXRA 1DBML 3PNWB 4KTYA 3UTSD 1T83C 3DX9A 4P2OD 2AEQL 5DEFB 3QNXB 1CE1H 4KKBD 3MRRA 5F6HJ 1RZFL 5F6IC 4OF6A 1M7DA 5E5UB 1CDHA 1UT9A 4LVHB 1A7PH 2AXFA 3UAJD 3B2VL 2VUOA 1KPUB 2HTKC 3PWUA 4XB7A 3QFJE 3W5NA 5TPWH 1WAAE 3V6FA 5IVXE 4LRNL 1I7TA 3AMLA 4HS3B 1BQSA 4F2MA 2PYEA 4PJ9C 2EIEA 5CCKL 1G7LA 1EO7A 1K6QL 2JCCB 1NGYA 5I1IL 3O11A 4QHMA 3VFWB 4I18B 4HGMA 5EBMA 4AMKL 4QRTB 1UM5L 5C09B 2DICA 1HHIA 4G7VH 2OL3H 3NTCL 3DVFA 4FQCH 4N0UA 1KXQE 1K3IA 2VXSL 1I1AC 1S5IH 3RX7A 3S37H 3QBTB 1JP5A 2NMSA 3NCFB 4W70A 4Y0GA 1C16B 1WSST 3S36L 5C86A 5T5FL 3TNMB 1JHKH 1BVKA 4G80A 3QFJB 5BXFA 3GK8H 5A43C 4LGSB 5JHLH 3GUTB 3BPOB 5IVXB 5ALBH 3KYKH 2BXYA 3P73A 1ZLSL 1IAII 3WFHB 5HGHB 4X8JB 4F37K 5GS2D 5GSRA 1DBKL 2XT1B 4UV4L 2E9JA 1NEZB 4MLSA 5DJXA 4AIOA 1J1XL 2QR0B 1C7SA 4UZGA 5ALCH 1X5JA 4K3DH 4MGXA 3KXFB 2UWEA 2CR3A 1X5ZA 3BDXA 4NBXB 3BOVA 4WW2C 4PGDA 1RHHA 3CC5A 1LDSA 4OV5B 3SO3B 5HHVH 5FKAB 5DHVH 1IGTB 3MLPA 2NY0D 1FYHB 3FOMA 4X0KA 2AJYH 4XMPL 1IILE 5J11C 3RDTA 4IDJH 2UYLA 4LASL 4HAGA 1V3JA 5HHPA 1NBVL 4HDIB 5BVJB 3WNPA 1DUZA 4HS8H 2DQUL 1A7NL 1RJYB 5JHDA 3P11H 3QXAB 5CZVL 3V6OA 3IS0X 4PGBB 4PG9B 1L0YA 5CD3B 3JWDL 1T89C 5HVGB 4U2YA 1PG7H 4KTEL 3BDYH 4WCYH 5C07D 4OIAA 1KC5H 1UB5B 3CH8A 4HKZB 5C0EA 1FL6B 3HRPA 4MA7H 4LLUB 3CX5K 2AP2A 2UUDH 4JQIH 1JYVA 4ONGH 1HQRA 5FIEA 1DLFH 3V52H 2BNUA 4JG1L 4NRZA 3QUZC 4E0RA 1OAKL 1FYTA 1AY1L 1U9KA 4L9LB 4ODBD 3FONA 3K7UA 3QDMD 3D18A 2YRZA 3QIWD 2R4RH 3O4LD 2CXGA 4HXBH 1EO8L 1I8KA 3LEXA 3VGFA 3T1WA 3VFUB 5KVFL 3EFFA 3ARPA 3HMXA 1QQDB 4R97B 1L7TH 4P5TD 4KPHL 4LVOB 1EGJA 1JFQH 3C2AL 3TA3D 2ESVE 5F1NA 2E7LA 2YD1A 4NDMA 3HI5L 3VG0H 1G84A 5I8OH 4Z7WE 5MHSD 1NUDA 4V1DB 1U0QA 4HHAA 4E5XA 2HYMA 2IH3B 1OP3H 4PRPE 1K8DA 4DKFH 1MF2L 4WGWB 2XACC 4N1CA 1EFXD 2O5YL 1FAIH 4Z95H 2OP4L 2WV3A 3VGBA 2VXUH 3MJ8B 2HJKB 4LKXB 1CU4H 5E0QA 2WMPA 5GGUA 1SJXA 3LVEA 1I8MB 2DLIA 4UDUB 5DC4B 1NEUA 3M17B 1KLGA 1IC7L 1OM3H 1U8LA 3EJZC 1Z6JT 4IRZL 3RUGA 2ZUQC 3L6FA 4MJ2A 4O5LH 2XRAH 2EECA 3B9KD 3LV3A 3MLWL 1EFQA 4PRBB 1NPUA 4EI6A 5HYSB 4H88L 4KQ3L 2ESVB 4DTGL 2Q6WA 1JVKA 4E42B 4LOUD 3E8UL 5T3XL 3OAYK 2Y25A 4R2GC 4Z7WB 3QCUH 5MEOB 1CBVL 3PP3H 4LMQE 3ZYIA 2WP3O 4OBSA 4ONFL 2R0KL 4QRRA 4MA1C 4UV7L 1RUQH 3OL2A 2LU7A 1FC1A 4JM4L 1K4CA 4KMLB 5IB3A 4TN9A 5EU7C 3KHQA 4RBPK 1QEWB 1OPGH 1UVQB 1TZHB 3JTSA 5E8NA 3TNNA 3ULVF 5ITFB 5IM7A 5IK3B 4KI5E 3IFNH 1YEKH 4WV1C 5H94B 3I6KB 3OKNB 4WWKA 2O5XL 4FFYH 4HWNA 4XP1H 1R3KA 5TFSL 2V7HA 2GT9A 3Q2CA 3PV6A 1J9CT 4P2QE 1KPVB 1U8IA 1AI1L 3H0TA 4YHZH 2X4TA 2R29H 4KKAC 1XF5B 3CVHA 1ORSA 3LKPA 1Q9KB 4EXPX 1VERA 2VZVA 5DWUH 2WWMD 5DFVC 2R2EB 5EOQH 4HQQH 3BUYA 1BD2A 3T65A 4S0SD 3C9NA 4BFEA 3ALXA 3SN6N 1UKTA 3CXHJ 2X42A 1NDMA 2VDKL 4OFKA 3O3BB 2DYPD 4Y8DC 4NZTL 2AXGA 1FH5H 1OARL 5DD3H 4X7SH 1IEBA 4XNQB 4YHNB 3TT3L 3FB8A 3HS0A 4L8DB 2OZ4L 3HI6H 4LCCC 3BDBA 5B8CA 4P2QB 5BZWB 4ZUTB 3RWCB 4IS6B 4P4KC 5F7DB 4FFVC 4AJ0A 1DBBH 1DSFL 1LO4L 1AQKH 1FDLH 5CD5C 4JFDD 5DJZA 4JHWL 5JDSA 3SGJA 5L2JB 3U7WL 2EIZB 1OB1A 5IV2B 4GS7C 1OGAE 5C0DB 4E41E 3EOAB 4S1QH 5F88A 3HI1A 1U8HB 3VFRA 2R0LL 5IQ9A 1CDIA 1YUHA 5KSUA 3VFSA 1A6UH 2NW2A 3FHAA 5AWNH 4OJFL 3FO2B 3W11D 4HK0B 3BKYL 4XNUL 5T1KA 1AR1C 1IARB 3D6GA 5SX4H 2VR4A 2EE6A 4YHOH 3NBNA 2EEAA 2YRPA 3BVNB 1N6QH 5LBSH 1NCTA 3OR7B 1DQLL 1GGIL 5I9QB 4CUCA 1QR1B 4Q6IB 4P46A 1G9ML 5FYJE 2H6PA 3F8UB 1KLUB 1RURL 4C54A 3IDJB 3CFBA 1X5XA 4M48H 43CAA 5T3ZE 4M1GL 4XMLL 2MMXA 4ZUSB 4M9PA 4LIQL 4YHKL 4MXWH 5SWSD 4AH2A 2VZ1A 3WKML 4ODWA 4ZSOA 1J0HA 1NFDE 3TBTB 2P43B 4R4BB 1OGAB 3VFPA 4E41B 3EJYD 5HHNB 4XNXH 3VXMB 3S7GA 1U8OB 4LAQH 4IRJC 4PTTA 5IMLB 4KDVA 4XPAL 3TP4A 3D3VA 1WCBB 4WEBH 1FGVH 4DWHA 3PV7A 1D9KB 3ZKSD 2HWZH 4YHMH 3GMNA 4ENED 2E9IA 1S7RA 4P3CL 3FFCD 3WHE0 2C1OB 1DCLA 4Z7VA 4U1GC 5I0ZA 3KHOA 5CMAA 2YPLD 2ADGB 2CDGA 3HPJB 2HJLB 4DN3L 1PZ5A 3HZVA 4LLDB 4Q9RL 5EO9A 4FQHB 4NQDA 3BAEH 4LLYA 4MQXC 3QRGH 5DURB 1D5XA 3R06B 3UBXA 1NFDB 2AK4A 5E00B 5FA4A 1Z9SA 3FB5A 1BWMA 3Q5YA 4DUWA 4L5FH 2IAMB 1IFHL 3UTSE 3TCXA 3MO1B 5B38G 4EN3B 5F9OL 4CMHC 3OQ3B 1WBZB 3MV8D 1PY4A 4LPCA 3MJ9L 4DAGH 3G5YB 2QQQA 4LARH 5C71A 5IJKA 1GL4B 2CLRA 3V79C 1PQZB 3SKMB 4XCEA 4EI5D 4GT7A 3U2SA 2F74A 4Q6YA 3GHEH 1ZMYA 4OZHE 4UMGA 2LQRA 3MV9D 5B3NA 5D2NC 2P44B 3DXAA 5J1AA 1DN2A 3NN8A 1Z3GH 4Y88A 5FO7B 4K94H 3BW9B 3LRGA 1KIPB 3U7YL 1KJVA 2XWBB 3TZVD 4I5BA 4M7LH 3WE6A 3EOYG 5I66B 1MI5D 2A6DA 1EERB 1ZAGA 3UTSB 3MLVH 1AIFA 4MLIA 4P2OB 1UYWL 4UT6H 4W6XB 1RUPH 3QXUA 4OBRA 1LE9B 2NNAA 1A4KB 4M61A 1CDBA 2VC2L 4S1SL 3QWOA 1MWAH 2BVUA 4I0PD 1HEZB 5HI5D 5EC2B 2HFFB 5F9WB 1GZQB 2Q86B 4OZHB 3VXQA 4PJ8C 4ZTPL 2P8LB 1KCVH 2HTLD 3L7EB 2PO6C 4LFHG 1XF1A 1MLCA 4K7FA 5T1DH 2YD7A 5HDOA 4ZUWA 1CD9B 1RK1B 4D0BA 1FC2D 5FOBB 2E27H 4Q9QH 1EEYB 3SDCC 3A67H 5C9JA 3O3AB 1YJDH 1A6VH 5DVOA 5KW9L 1OTSD 3V95A 3DVNA 4X98A 5DRNA 2H2PD 5IB4A 2YS4A 1DQTA 4JVWA 1D5MB 5C6WH 5BQ7A 4AL8H 1KJ3H 2Q8AH 1M1SA 1JHTB 2BOBA 5EZLB 4XPHL 5HYQB 4FNLH 1XF2B 5I1LA 4NJAL 4FMFA 1KELH 3QNYB 4KWUA 4P9HL 4RFOH 4ODHH 1HHKB 1WT5A 1GGBH 1Q9OB 4LHUD 2RFXA 4OLZL 3GJFH 4R3SB 5C07E 3P4LA 3GMPA 1T04B 2X4UB 4X6EB 4GAYB 1RU9H 5DS8B 2NY0B 1JGDB 2EDHA 1ZLUK 1QLEH 2VL5B 3BP4A 2L7JA 3I02B 5KOMC 4XP5H 2WZPD 4Z0BH 2GUOB 3CCHB 4GXUM 1PSKH 3QDME 2W0KA 2DQCH 3O4LE 5JLZA 4JFOB 1CGSL 4BH8B 5DVNA 4TQEL 4NC1C 1FFNA 1G7QA 3V0AC 5FYLH 3ULVE 3MRHA 1LO0H 4QTHA 2CLVB 4WO4B 4X4YB 4QTIL 1NEZG 5C07B 4G5ZH 3NIGF 4U6XB 2NY4D 4Y2DC 1YEGL 4HIXH 1U58A 5GGVL 2APWA 4EIGB 2OK0L 5IBTL 5MHSE 1SEQH 4APQC 2PR4H 5T33L 3FT3B 5JZ7D 5GPRA 3F58L 3ZDXE 2XKNA 4L9DA 4ZNCD 4OZ4A 1HZHH 1T1WB 3ROOB 2CJUH 3QDMB 1I7ZA 1XGYL 4IIQB 2KQNA 3QIWB 3DPBA 3O4LB 2A38A 4RQQA 4MX7B 2V17L 1JRHL 4A6YA 2UZIL 5J4MA 3V8OA 3GB7B 3INUL 4MD0A 4P5TB 4OZIE 3AAZB 2YD4A 3TA3B 5K9JH 4B7IA 2OJZH 1SYSA 2BVPA 2A0LC 3ARVA 1X4YA 1UXWA 2ZUSA 4P5KA 2XWTA 3HR5B 2OR9L 3W39A 5CHNA 3FRPA 2H41A 1EFXB 3BHBA 2BP3A 4TUJA 5DRWA 4B7LA 1XH3A 1QFUH 1EHLH 3QUKB 5JA8B 2HT2D 1A6ZB 4YFEA 5I1AB 3HNVL 3V0WH 1TJGL 3DRQA 2YA0A 2DIBA 3S35H 1PYWA 1VGKA 1RIVL 3LQZB 3B9KB 5DJDA 3FT2A 2EKJA 2YSSB 5AYUL 3K81A 4OZIB 1XCQA 2XZAH 2NY3D 1FNEA 5HHMD 4HKJB 4JCMA 4KK9C 3GSRB 4Y19D 4GQPH 4XVTH 2JELH 4G42B 4P5MB 1BM3H 2EYRB 5DT1L 5IR1B 4F57H 1FGNL 3U4BL 4JRXD 4R8WH 1M7IA 5C08D 4FTVD 3MODL 3B9AA 2DDQL 2CGRL 1A6TB 1FSKC 3LOWA 1KIUA 2YD3A 4XBGA 3L5XL 3WFEH 3K0WA 3V6ZA 1J10A 3C09B 2R56H 2CO7B 4OGZA 4XCNB 5DJ2B 2OTUB 1IGCL 1BVLA 2FECL 5CWSA 4X6DE 2AI0L 5EUOB 3ILPA 4K9EL 3O6FD 1SJVA 4AIXA 4OCRH 4HC1L 4MCZA 1AGEA 2FWOB 5D5MF 1TJIL 1XIWD 2AK1H 5HYSG 2X4QA 5ITBH 3BH8A 4JFDE 4FXGA 2RIKA 3J8F7 2VAJA 4GQ9L 4X5XB 4X6CF 3U7AA 4JM2A 4H5SA 5CP7A 5INDA 4L3EE 1X44A 3EYUL 2VDMH 4U6VH 1MWAA 3MRGA 3GIVB 4ETQA 4F7MB 2EXYC 4Z7NF 4RAUA 3WHXA 3HLAA 2BVOA 2AJZB 2J1KA 5KSBE 3TVMA 1O5DT 3P0YH 1BECA 3QFDB 1YYLH 4MDJB 3VWJC 1MCOH 1LP9E 1ZLWK 1JYNA 3CXDL 3SE8L 5C3LD 2VDNL 1RK0B 4X6DB 3SOBH 2I25N 4HLZG 2YEZB 3LEVH 5C92A 5KVGH 5HDQL 3C5ZB 2J2ZA 3SE4C 1Q0YL 3VFVB 5IEKB 1A22B 2FO4B 3MNZB 4XMKL 3V5KA 2VWEE 4GG6A 3MRLB 4YQXL 3FHQA 3D69B 4OFYD 6CGTA 2XA8L 2EXWC 2Z8RA 3IJYB 4JFDB 4L29B 3O6ML 1U41A 4LDEB 1RAMA 3W9DB 4XVUD 1MFAH 1MLBB 1S3KL 4ONHA 5SWSE 1TTGA 2A2QT 5SV4A 3KPOB 2VDQL 2GW5A 2FO1A 2O61B 1KB5L 4Y4HC 1ADQH 4M43H 5CZKA 5D7JA 5SWZD 5MERA 3ARSA 5GJSH 2JIXA 1QLFB 2OS7A 3WD5H 5KSBB 1DVFD 2AJUL 4D0DA 3FO1B 1LP9B 3W5MA 1N0XL 4AZ8A 4MNQD 2FLBT 4YHLH 4KGJA 4X5WA 2YA2A 2YZ1A 5CSBA 5B3JF 3FFCE 4KKLD 2HH0H 4NUJB 1K2DB 4XP9H 4NT6B 2D03L 2Y4SA 3CZFB 4J12A 4F7TB 4YK4B 4KDWA 4M4RA 2YPLE 1F45A 1AXTL 1JGUH 4YGAB 2NY7L 3SGEH 3LQAC 3IJSA 5SWSB 4PJAF 3WJJC 2ERJB 1KJ2B 4H0GA 4XP6L 4RMTA 1EXUA 4XCCL 4PRHA 4LSSL 2Z31A 5GIRB 1CXIA 2GK2A 3QUMB 3EYSH 4XCYB 3IKCB 1NCCL 1SY6H 1FBIH 1P5UA 1NGWA 4J3WA 3MV8E 4G3YH 1EJ6A 4PP1C 1HQ4A 3FFCB 1I7RB 2Q7YA 1NCBL 5DVLA 5MI0C 1I1AD 3UTZB 4K94C 3ESVF 5GQBA 3V9FA 3OKOA 5DUML 1IGMH 4WI3A 1NLBL 1F4WL 3RY4A 3KGRA 2ITCA 5E4EC 1T0MB 1CFTB 1FFPB 3MV9E 5HGGS 3PWJB 3VFOB 2Z4QB 3QDGB 3P3YA 1T22B 3BWUC 3C87A 4YHIB 4R26L 1FG9C 4WTZG 1FL3B 3FAWA 1MI5E 1IM9A 3P30H 4MDIB 4WU5A 3SQOH