4GBXD

Crystal structure of an immune complex at ph 6.5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
191
structure length
191
Chain Sequence
FVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPSEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTDRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DM alpha chain
publication title Crystal Structure of the HLA-DM-HLA-DR1 Complex Defines Mechanisms for Rapid Peptide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gbxD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gbxD01
4AT6B 4LSQH 1T5WB 2NY4C 5IB2B 1S9WA 1LE5B 2YS4A 2XQYK 3RBSA 3GBMH 4A2MA 2XKUA 1Z3GH 3QSKB 4U1NA 3SDCD 4MLIA 3X12A 1FFQA 3NABL 4EI6B 2NY7L 2CUHA 1B4RA 3GHBL 4XBEH 1AGFA 1XF3A 3OZ9H 3S5LG 4H5SB 3RJQB 2WW8A 4NC1E 3SDCA 3I6LE 4A6YL 1ITBB 3IJSB 4PJBE 1U93A 3RKPA 1N64H 2BC4B 4H1LB 1RJLB 1WFOA 3QNXA 2GSIB 5CGMA 3U2SA 5F6HJ 3RVUD 1UB5A 3MRFA 2VAAB 4JAMB 5IJVA 4Y5YB 3V4VL 3S8WA 1E0OB 2HJFA 5C09E 4QXGH 4UV7L 3VXPA 4H20H 2Z35B 5EC1B 4EUPB 3OKOB 4ODUA 2WBJB 2AXGB 3O6LH 1N59A 1WTLA 3MXWL 1NL0H 1JHTB 4FFVD 5JXED 5DVNA 4E5XB 4NSKB 4M1CD 4L8SC 4JPKL 1RZIB 3B9DA 2BNQB 4P2OC 5ISZA 2R2BB 3EJJX 1HH9B 5JXEA 2UUDK 3IGAB 4XNMA 2NX5B 3KYNA 5C07B 1A6PA 1OAZL 3WL9B 3GDBA 1MAMH 4F58L 4LSSH 1FGNL 3GIZH 1IMHC 3CPLB 1Q8MA 5DHVB 5D5MF 4L4TB 1KB5B 1RUPL 1U8NB 7CGTA 4UILH 4CRPA 3FZUC 3MREB 2BSSB 3P4NB 3B5GA 4NC1C 5J13C 2K3TA 1JFQL 4KKCC 3VRLF 5LGKA 1OF2A 4HDIB 4RGND 4L9LB 3NABH 5HY9A 5TDOA 2NY7H 4LEXL 3STBA 4NRZA 3G6AB 3GHBH 4DFIA 3MX0A 4OUOA 2OJEA 4OQTL 4QT5B 3H0TA 4GO6B 1MHHB 5E8NA 3FB8B 1QSFE 4A6YH 2FEEI 3VXTA 3PWLB 8FABB 1OVZA 3QO1B 4HWBL 3HNSL 3PHQA 4JKKA 1RJYB 3MOAL 3TEUA 1EXUB 2X9YA 2X4SB 2R1WB 4Z7NF 5EU6E 3V4VH 3D69A 4BFGA 4UV7H 3MXVL 1UJ3A 5D7LD 4LCCB 5D5MA 5I8EA 4FQQB 2KPNA 4R97B 3UYPA 1LGVA 2YA0A 1S7QA 3MXWH 1JPGA 2WNGA 2AJUL 5A40E 4NO0B 4WI5A 5DD0L 4JPKH 5D7LA 2BX5A 3FFCB 4J6RL 5F9JA 3TCLA 5ABDE 2I25N 4N1EA 1R6VA 2XTJE 3V5KB 4FQHB 3NZ8B 2DAVA 1OAZH 4U1IA 1C5DA 3JBG7 2YPVL 1F2XK 2CLZB 4ONHA 5T3XL 4F58H 1FGNH 1JZ6A 3UEZA 3CK0L 4M8VA 1RUPH 3Q5TA 3L5WA 2LAGB 1RZ8A 5FF6A 3A6CL 3VI4F 1QD0A 3TA3D 4UQ2A 5D9SA 3ZYZA 1JFQH 2QQLL 1YEJL 3VH8B 1A1OA 1G7JA 1ZGLA 4ZS6C 2OI9B 2B8OT 4LEXH 3ROOB 2VDNL 3TA3A 1I3RA 4BZ2L 4OQTH 1KPRB 3U30C 1NFIB 4LEOB 1A1MA 1M7DA 4G6AD 1HXYA 3I9GH 4OZFA 5DD3L 5KANI 3SDAC 4WI6A 5CZKA 2R2HB 1DTUA 4HWBH 3HNSH 1P5VA 3MOAH 1UXSA 2W0FB 5HDOA 2R39A 2AQ2A 5H35B 5EO0A 4KK9D 2WANA 4YHLL 4Y4FB 2XTJC 1AY1L 1KIUA 1FIGL 3S36X 2JIXD 4XVTL 3RFZC 3FAWA 5GRUL 1V5JA 3W11C 1DANU 1KLGA 4H8WL 4PGCA 4XTRC 4L29A 3SKNB 1JK8B 5CP7A 5D6CA 2C3XA 5DD0H 5IEHA 4J6RH 1OLZA 5DK0A 2E9WA 2JIXA 2UZXB 2GAZB 3C87A 5F7EL 2MJWA 2R56L 4PLJC 4DTGL 3BRFA 1ORQB 1M05B 1JVKA 2BNQE 1LEGB 4LCWB 4UI2A 2XV6B 3GUTA 2YPVH 3HZMB 5T3XH 1QRND 4AZ8A 3HE7D 1ZLUK 1I9RL 2NX5E 5C07E 3X13B 2F54B 1A7NH 3UX9B 3CK0H 1T66D 1UH4A 2B5IB 2C4FT 1KIRA 2NYYC 3BD3A 4L4TE 4NKMB 3A6CH 3ZE2F 2H6PB 5GGSB 1IEBB 5EN2B 5SX4H 4WI8A 5DZOA 1QRNA 4O02L 3HE7A 3VGGA 3N50A 1YEJH 4G8FB 1LO0L 2X9XA 5FUOL 1WGOA 1N7ML 3BD5A 3BZFB 4DOHE 4GUPB 2AK4B 4OLEA 4MJ4A 1QHOA 4F7EA 2VDNH 3RKDC 4GAJL 4BZ2H 5D2NA 3VMNA 5T3ZL 1WJ3A 1MVUA 3NCEB 4ZUTA 1Y18B 3EDFA 3LAFA 4HUUA 3D25A 4Y5YC 5ADOL 5C0FA 4I2XA 2XPGA 3IDXL 3GM0A 3G04B 3QUMB 5C0BB 4FFWC 4ENEC 2DLFL 4M1GL 2WBJC 5J57B 2H26B 3RL1A 1KJVA 3N1GC 1D5XB 1FSKB 4ZFFA 4Z5RA 4HW6A 4KK5D 4JHZA 4YHLH 3V5HA 1AY1H 1BZ7B 1PYWB 3MRNB 3FAXA 4R4ND 2IAMD 4FG6C 5DO2C 1FIGH 1IAIM 5AD0B 3MO1B 4UNTA 5GRUH 1CQKA 4H8WH 2Y36L 1S3KL 4WI9A 2P5ED 1T4KB 2XZCL 3BGMB 4YBLB 1P9MC 1K4DB 4OD3H 3OGCB 3LCYA 2Y4SA 2EKSA 2IAMA 5IQ9B 3WKML 4BFEA 2V17L 1T1ZA 5F7EH 5IHZB 5SWQB 2K7PA 2R56H 3FFCE 3RVXC 1UEMA 4DTGH 5KW9L 3RIAF 5CEZE 2P5EA 1VADA 3JV5A 5ENWB 1ONQA 3SO3B 1I9RH 2NY6D 4A6YA 4XNUL 4L9LC 5B22A 3LS4L 3VXUD 4Q9BA 5I74B 3MV11 4F15B 1RHFA 1V7ML 1NCAL 2WQRA 3EOYG 3FONA 1AHWA 1JPSL 4PJCA 5E03A 4O02H 3TBWA 3G6DL 2V9RA 5FUOH 3TNNA 5DT1L 3VXUA 2CGRL 1N7MH 3MRIA 5I8OL 4LSRL 3U36B 4D9LL 2YPLD 2DBJA 2BMKB 5SX4I 1P2CA 1IM9D 4X83A 1O0VA 1NAKL 4GAJH 1RZKC 4OLWL 5T3ZH 5F88A 3DJ9A 2R0ZL 2EIZA 3SJVB 3GSUB 5ADOH 4R7NA 1MHCB 2ZOKA 2YPLA 3IDXH 4LCCC 4PJXA 4M1GH 4R97C 1WICA 3DPBA 3CZFB 1IFHL 3UTQA 1FDLH 2Q8AL 1I7UB 2V7NA 2OR7A 3KS0J 4P2QB 3HR6A 3FB5B 4I5BA 4OGAD 3BKCL 5E95B 1G7QB 4U7SA 5KSBF 4JKMA 3IFLL 3FFDA 4KKAD 2HVJA 4NQVA 3IXTB 2Y36H 1S3KH 4C56D 2ZSWA 4CAGA 2XZCH 2BXYA 4YLQT 1BVZA 1UFUA 1MQKH 4EXKA 2DKUA 1ZHBA 2D7MA 3WKMH 2VZOA 2V17H 3NVQA 3NIFE 5KW9H 5L8LB 4X4XB 4C56A 1T1WB 4OQTA 4OUUB 4KJYB 2EDHA 2RHEA 4MQ7B 4LCWE 1H3UA 2MQ3A 3QO0A 1BQHG 1NCCL 3DBXB 4QRRB 1TCRA 2ZUSA 5FYLD 3ZKSD 4NJ9L 1L9MA 4JO3L 4XNUH 4F3FA 2X4UB 3LS4H 2ICWJ 3OJDA 2F54E 2OI9C 4QNPF 2G9HA 1V7MH 4HUKB 1NCAH 1WCQA 1JPSH 4HWBA 1E4XI 4LLDA 3O6ML 2CD0A 2H2SC 4H26B 1VCAA 2FATL 2ARJA 1F90L 3EYOB 2CGRH 4Q74A 5C71A 5I8OH 1KCKA 4LSRH 2L7JA 4PD4J 1A9EB 3LOWA 3CIQA 1NAKH 1UKQA 2AK4E 1OAKL 1QNZL 1CGSL 3HZYA 4OLWH 5IBLD 5KSBA 5JW5A 2R0ZH 5IMLB 1WBYB 4Q6IB 1KPVB 5T3XD 4UIMB 2X7LA 4Y4FC 4LARL 3WV0A 3DXAD 4CGTA 4OF0A 5E7FA 4LF3A 5C0BE 2W9EL 1IFHH 2Q8AH 4TUJA 5HI4D 4HS3A 3V4PL 5C2UB 1VACA 4G6MH 2XQBL 3DXAA 5J7CC 1XF2A 1CDHA 3IFLH 4HWNA 2P45B 4MSWB 4FQ1L 2HWZL 3M8OL 2D0HA 4CVXA 5H94A 2YUVA 1T21B 2FIKB 4I3SL 5EO9B 1FL3B 4NZJA 3BRGC 2B5IC 4F7TB 1F3JA 4I0PD 4NGHL 4U1HA 1NBZB 1KNOA 5C0EA 4WGVB 4FA8A 1DQLL 1IGML 3ARGB 4PLOB 4ZFZB 4M6ML 2FR4A 4HS6B 4D2NA 4NN6B 1NCCH 3ULSA 3VXSB 3MYJB 4NJ9H 5GPRA 1KEGL 1MY5A 4JO3H 3F5WB 4WTZA 5E8OB 3RWIA 1EEYA 1IARB 4I0PA 1AD0B 1S7WB 2J8UB 5E8PB 4O51B 1JYWA 3ZKMC 3O6MH 3VDAA 2Y6SC 3VD5A 2FATH 4IS6A 4EIZC 3DMMD 4YBQC 1MCFA 1F90H 2DQFB 1EV2E 1KGCD 1LP9B 1XZ0A 4JG0L 3MNWB 3CFJB 3ILPB 4LLAA 3MRLB 4NRYA 1B0RB 3MUGB 1OAKH 1QNZH 1CGSH 1U6AL 2FH8A 1QBBA 1WWBX 2DKMA 4DVBB 1FSKC 2YWZA 1MREL 3BYYA 3DMMA 3W39B 5ID0A 4KGLA 3QR2A 1P1ZB 2HKFL 2AV7B 4LQFL 2ZOLB 3MCKA 4XCNB 4LARH 4LFHD 5F89A 3T0EB 1VKXA 1I9EA 4LBEB 3DURA 5CEXB 2H8PB 3ZSSA 2W9EH 4M3KB 3BSZL 3MJ8A 5BS0D 4LPWA 3D0VA 1G9MH 3MNZA 4NQSB 3V4PH 2XWBA 4YBLC 2FECI 3O3EA 2RGSA 4WHDA 2XQBH 3AGVA 4S2SA 1MFEL 4P2QE 4TTDC 5E5MA 1C12B 3R4DA 4FQ1H 2OMNA 3BT2L 4FOMA 5KOVC 1XR9B 1GVIA 2HWZH 5BS0A 3M8OH 1F4XL 4LRIA 2FLBT 3CH1B 4RSVA 3H9ZA 3SO3C 4GRWH 2HT4D 4I3SH 5DTFA 4HFWB 1RFDL 5I74C 4NGHH 4F15C 4QEGA 1DQLH 1IGMH 3QQ3A 3T0DA 4M6MH 5F1NA 3VFUB 5IOPB 4NO2B 2DIAA 5CSBA 3L5XL 4Y8AA 5E9DD 3N1QC 1W0VB 5CJXC 1KEGH 1IAOA 2YA2A 2LE9A 4QRRE 5J6HA 3TP4A 4LSPL 1G9EA 2EDKA 2VDRL 1H3TA 5HBBA 3WIFA 1GGTA 5E9DA 1HHHA 1O7SA 4JDTL 1DQTA 3RY6A 1BJ8A 4JG0H 4MQXD 1F3DJ 4E42B 2HAZA 1LEKB 4TYUA 3ESUF 3QI9B 3ZDXE 3U4BL 1U6AH 1CE6A 4OAWB 1S5HB 1MREH 4CADB 2CK0L 1TQBB 2O26U 2HKFH 4U31A 2Y06L 4Z6AT 1WBZB 4KHXL 4GW1B 4LQFH 4W6XB 5EZOL 1Q9WB 1BECA 1FG9C 4ZMAT 2BRQA 1ZA3A 1EHLL 4R7DA 2HG5A 5HGBB 3QXAB 1NMBL 1RUKL 5T1MA 1PKQA 5ESVB 4HQQL 5JNYB 5EIIB 2VR5A 5SWSB 3FQWB 2FGWL 3RY4A 5CBAB 1VSCA 1MFEH 2EDRA 3ES6B 2DQDL 4UU9B 3BT2H 2PCPB 3BFOA 1FFNA 3RX5A 1F4XH 4PPTA 2FWOA 3NTCL 4OD2B 5DRXA 5B4MD 1I7ZA 3MROA 1SYVB 4MA7L 5LGJB 5EU5A 1P7QB 1F6FB 1RFDH 4P5MA 4KKNA 2QADB 5DXWA 1A6AA 2F5AL 4F9LC 3VW3L 4N90D 3JTSA 3L5XH 5HVHB 3WLWD 3MRKB 4D0CA 4OBSA 1DQQB 3VA6A 1X5IA 3VXSE 5JHLL 5F9WB 3QG6A 5DQ9A 5C08B 4LSPH 2CKNA 2J8UE 2VDRH 4L3EA 5T1LB 4BH8B 3X17A 5IROA 1YN7A 3NIDE 4JDTH 4Q6IC 3QJHA 6CGTA 4YHOL 4J4PA 1NCDL 1UH3A 2BFVL 3N9GL 1DN0B 1QTYT 1LP9E 2HJLA 4EEEA 3U4BH 5I30H 4JFDD 1ZGLM 3ILQC 3V79C 1AXTL 2CIKA 2CK0H 3PHOB 5J1AB 2Y06H 5EZOH 4KHXH 3IFOB 4DGYL 4YAQA 1M6OA 1A7OL 3KJ4B 1CD8A 1A4KA 4MMZC 3LKOA 1I8IB 1EHLH 3CGTA 4JFDA 4XC1L 3E1F1 5BV7B 4G3YL 1NMBH 5E1AB 3O11B 3VFNA 5C6PB 1RUKH 1JNLL 5C0DB 4HQQH 2B0SL 4EKXA 2CDEA 3E0GA 1BWWA 4HIHA 4D9QE 3FO9B 4UMGA 2FGWH 2Q7YA 3TPUA 4X5XB 1H15B 2Y7QB 1X5XA 2DQDH 2P43B 4RNRA 3G6JF 4U6HB 2IADB 5C3TA 4X6BA 3ARGC 1IC7L 4QHNA 5FYJE 1VFMA 4GRWF 4HMEA 2IALB 3NTCH 4NN6C 1AJ7L 2VQ1A 4GAYB 1T80A 4RIRB 2APTA 3JWDC 2V2TA 3C6SB 2UWEF 4EOWL 2F5AH 5EA0L 5JW4Q 3VW3H 1RK1A 5C0JA 1V8HA 1S7TA 1JBJA 1BD2B 1U8MB 3GSRA 5JHLH 3BN9D 1EO8L 3T0XA 2HLFC 4YHOH 1H3GA 5BW7A 1NCDH 4EDXA 3BUTA 2BFVH 2Y07L 3N9GH 1FNEB 1S78D 3AMKA 3T0EC 4X6EB 5KVDL 1RJZA 1U8IA 2FGZA 2NNAA 5C0IB 4PUBL 1D5MA 5EZLA 3LKPB 5IBTL 4YJZL 4QGYA 1YJDC 5HHQB 4DGYH 1FLRL 1UCBL 1A7OH 2R0LL 3QNYB 2A6KB 4QWWC 43CAB 4JFYB 8CGTA 4XC1H 5KG9A 5DJ8A 4G3YH 3L7FA 2A9NL 4O00A 1JNLH 1NFDF 4XB7A 2DMKA 2DYPD 2B0SH 4L1DA 5K9QG 3VGFA 3BRDA 4B53A 1D5IL 3HE6B 5F93C 5JTWA 1PBYA 4PJFB 3FN0L 1NUDA 3A67L 5SWSE 3TN0D 2VTFA 2YHGA 1VHPA 3IRZA 3O4OB 4YHMH 1IC7H 2IMMA 2DYPA 3LKQB 2DM3A 4WU7A 5EFIB 1ZHLB 3KLAA 1AJ7H 4QHMA 4HX1A 5SV4A 3ARZA 3TN0A 1J87A 5JDSA 5IR1B 1FZJB 4XNZB 4TRPL 4LOUD 3Q3GB 4EOWH 1DEEA 5EA0H 4N5ED 4HJJL 3LKRA 1G7IB 3LDBB 1IT9L 2V2WB 2HP4A 1G9NC 4U1MB 1CFSB 1P4BL 2Q86A 3OKLB 3QI9C 1RZGB 5AUMB 1EO8H 1PZ5A 1E27B 1T0MA 2EC9U 3I6GB 4M7JL 5C08E 3GKZA 2Y5TB 4PJDF 1NFDA 1TQBC 4HH9B 4XRCB 3HAEB 1DLHA 2Y07H 5T1DL 4JFHE 1T5XB 3QWOA 5KVDH 2WIIA 3U46A 3GK8L 1QFUL 4PUBH 1JMXA 1T89C 5DQDL 5IBTH 4RAUA 3TZVB 4HUWA 5GQBA 3D18A 4JY6A 2R0LH 4P5KA 3T0AA 1VDGA 2OK0L 1UB6B 1I3UA 1S7SB 1X5JA 1CGUA 1H0DB 2Q6WA 1LD9B 1FZMB 2A9NH 3P30L 1V3JA 3IDMA 3UTTD 4Z7WA 5TJWK 1D5IH 2APVA 4LCIL 5DEZA 5IK3B 5I8CA 4WEBL 1EPFA 3FN0H 4FABL 3A67H 1CVSC 3DVGB 1BVLA 2UYLA 3UZQA 5T5FL 3EYFB 4RZCB 1XCQB 1RUAL 3QQ9D 3U83A 2QADC 3PNWA 1Q1JL 3S88L 3UTTA 4B7IA 5KVFL 4GG8B 5HVHC 2NY4D 2GHWB 3BQUB 4OF7A 4FXGA 2PO6B 1MCQA 1MWAB 5F9WC 2DRUA 3FT3A 5ICXA 1EH9A 1EBPA 1JF1B 4BH7A 4HJJH 5HYEA 4QYOA 2XOTA 1CT8A 1NCUA 3L3OA 3QZWA 5K9OA 3B9VA 1UCTA 4X4ME 1OGAB 3BZEA 1IT9H 4F33A 1P4BH 1BD2E 5SWZD 5MERA 4HAGA 4M7JH 4M4RA 4P5TD 3X11A 4CBPA 1J1PL 4CUCA 1S9KC 4N1CA 3WNMA 4XPHL 3QFDA 3MRBB 3EDEA 1KB5L 4JY4A 3IJHB 5T1DH 3QIUB 3KJ4C 5D6DC 3OKDA 5SWZA 3GK8H 1X7QA 5BV7C 3R06A 1QFUH 32C2A 4P5TA 3AS2A 3F12B 3LEVL 3NIGE 5DQDH 2JJTC 5EG6C 2XXCB 4ERSL 2ZUUA 1YMMD 4J3UA 4ZUUA 4MQTB 2IG2L 2OK0H 4OI8A 4QHKJ 3TFKC 2R4RL 1JPTL 2OZ4L 1JNHB 3P30H 1X3DA 4UUJB 4PRDA 2YBRA 1L0XA 1YMMA 4LCIH 4BA8A 2P24B 4JFOA 4Y16D 4WEBH 4H1LH 4FABH 2W65B 1IL1A 1DUZA 5T5FH 4PJFE 4X9HA 1RUAH 2XICA 4L8SA 1Q1JH 4LGSB 4WTWA 3S88H 5KVFH 1B0WA 3AAZB 1BF8A 4Y16A 1YEEL 1RMFL 3MACL 3FZUD 2O61A 3FQUA 1IAMA 1Q9KA 3CFEB 2HRPL 3I6LD 5DVLA 4OCNC 5DHYA 1R5IB 4KKCD 2D31A 1FV1A 4U1GB 4QRTA 2GJZA 5CEZL 4MWFA 3RVWC 2GTWA 1A6WL 4ZD3L 3Q1SL 4CMMA 1QG3A 5C09D 3E2HB 1J88A 1E28B 1OGTA 1J1PH 4PJBA 4XPHH 5DHVH 1WWWX 1KB5H 2YZ1A 1BGXL 2MQCA 2XKNB 2J8HA 1YQVL 5JA8B 3OB0H 4J3SA 5C09A 3T8XB 2CR3A 1DEDA 3LEVH 5I1JL 1A4JA 4J8RA 3OXRB 3WNKA 1CD9B 3U0TB 1N3NA 4ERSH 1DSFL 2ITDB 3HE6C 1CXKA 2IG2H 5EPMA 4RFOL 2R4RH 1JPTH 2ICWB 5I17A 2OZ4H 3O4OC 4UDTA 1HYRC 2XXMB 4HUXB 4MDJA 4N0UB 4PGBB 5I8KL 4UBDC 3DYMA 5B3JE 1OTTC 1HK6A 4XNZC 5GRWA 2VABA 5IP4A 3C5JA 1DDHA 1MCNA 1Z0MA 4CU6A 1YEEH 3LDBC 5C86A 3CSYB 1NC4B 3DX8A 1RMFH 2IFFH 1T2QL 1FLTX 3MGTA 4NDMB 4FN0A 4WNQA 2HRPH 1QSFD 1NCBL 1JTOA 1G7HB 1U2CA 4R3SA 3HC0B 4JKWA 2CRMA 3ZO0A 4YHPB 4YFLI 1INEL 4ZS6D 5CEZH 1KFAL 4YFDB 3IRPX 3B4NA 2BY0A 1A6WH 4KUZL 4QRPB 3ZL4L 4ZD3H 1PX4A 1Z9SA 1QSFA 3Q1SH 4U6YB 1KG0A 3ROLA 5EU6D 4DKAA 4PGDA 1OGAE 1JUFB 1P4LB 1K8DA 3TZVC 4DCQB 3SDAD 4M93B 2DN7A 4Y8DC 1X9QA 2AJ3B 1BGXH 1HSBA 3RGVB 3ARUA 2X4OB 4CVWA 5C6WH 3CZJA 1YQVH 5EU6A 4ZUWA 2QKIA 3KVQA 4JQIL 5I1JH 2F8OA 3SDAA 1YMHB 5D1QB 2XTJD 1DSFH 3CAFA 1FNSL 3H7BB 1RK0A 4RFOH 3W11D 3WSQH 4YPGB 4N9GB 1N8ZB 4XTRD 2DB8A 5CWSB 5DJZA 2A1WL 5I8KH 1ADQH 1JZ7A 5MENB 3P4OB 2QHLA 5C0GB 2HN7A 3QUML 4YE4L 1XIWB 4PLJD 3BQUC 1QYGL 2PO6C 4KTDL 3U48A 1JRHL 5GRYA 1OLLA 3QH3B 5GZNC 1KJMB 3W9DB 2ZG2A 4AT6A 2XT1B 3GJFB 5FGRA 4GJTB 1T5WA 5I73B 4YFLF 5IB2A 2NYYD 1LE5A 1T2QH 1UZ6E 3F7QA 1KTKE 3JTTB 4Y1AB 3NBNA 5E6ZA 1NCBH 3BDXA 2CXKA 3FQNB 4OZIB 2NLJB 4LMQI 4EI6A 1INEH 5DRNB 1KFAH 2X70B 3T0BA 3QIUC 3ZL4H 4KUZH 3RKDD 2BVTA 1RQ5A 2OSLB 1TMCB 3ZHKA 2YPKB 4JM2B 3IJSA 2RB8A 2BOBB 2XWJB 1ED3B 5IHLB 3UTZA 3UPRB 5JIKA 1WWAX 1RY7B 4ENED 3BP6B 4CMHB 4FFWD 4M8QA 2BC4A 4H1LA 5EZIL 5JOEA 1RJLA 2BOCB 4QOKE 2F19L 2WBJD 4Y88A 6FABL 2VAAA 4MAUL 4JAMA 2VWEC 4Y5YA 3EO1B 4JQIH 3MBEB 2Z35A 5EC1A 2AEWA 4EUPA 4YDJB 5DO2D 2X1PA 4FG6D 3B43A 4NQEB 2BNQD 1FNSH 5BVPL 2WBJA 2AXGA 2BY2A 1YY8B 1JHTA 3UZVB 2NX5D 4H88L 5C07D 4E5XA 4NSKA 1YUHB 2A1WH 1QQDB 2V5SA 2Z8SA 2QBWA 1EJOL 1RZIA 4UB0L 1CS6A 3TO2B 2BNQA 4L4TD 3QUMH 4YE4H 4G80B 2R2BA 1I7RB 5FUCE 3RVXD 1QYGH 3RWDB 5CJ8A 4AG4L 3IGAA 3RNKB 4KTDH 2NX5A 5C07A 2IQAA 1JRHH 3WL9A 1AC0A 5DS8A 1P9MA 2QHRL 3C60B 3MLXL 3CPLA 1PDKA 1Z5LB 5DHVA 1KLFA 1DBAL 4L4TA 4U1GC 1KB5A 1DVFB 4KQ3H 1MCEA 3MFFB 5F7MC 4OCXL 1JN6B 1CGTA 3MREA 2BSSA 2PYFB 1IJ9A 3CFDB 1A21A 4HK3N 3E2HC 3J8F7 4HDIA 4L9LA 2E3VA 4NCC1 4HG4K 1KSRA 1MEXL 4QT5A 1VGKB 1FNFA 4IOIB 3U0PB 1MHHA 1IBGH 3DUUA 4QRPE 2OZ4A 3FB8A 4X9GA 5B8CB 1HNGA 3L3GB 4OZFG 4ALAL 8FABA 3EZ8A 4MA3B 5EZIH 2BHUA 4Q97A 3QO1A 2F19H 4BUGA 1KJ2B 1RJYA 6FABH 1EXUA 2X4SA 4MAUH 2R1WA 4DFHA 2PTVA 4ETYA 4XCEB 4NO0D 2D9CA 4KK6C 5FUCC 2W91A 3FFCD 4LCCA 4NQXB 4DZBB 4B7LA 4FXKB 5BVPH 1QHPA 4FQQA 2QQQA 5CEZD 4YXKL 2ZUQB 4FP8L 4H88H 3TGXA 4NO0A 2X4QB 1I3VA 2R29H 1EJOH 4UB0H 2ZG1A 5MENE 4FQHA 4QHLA 3NZ8A 4AG4H 2EDFA 1WZMA 2CLZA 4WI7A 4PJIB 3MLXH 4K8RC 1GCFA 4N0FB 2D7OA 1DBAH 25C8L 5DC4B 2AEIT 3L9RB 3GMPB 1TPXB 4TUOB 3LQAL 3DI3B 5E94B 4EIGB 4TSAL 5J6GB 3BKJH 4Q7DA 4XP4L 4C58B 1IM3A 4WEUD 4FXLA 3VH8A 1MIML 2H2SD 4I4WB 4Y1AE 4JY5L 2HMIC 5EB9A 2P7TA 5IUSA 4M93C 4FQXB 3QA3B 3ROOA 3WD5L 5J4MA 2LVCA 3RGVC 1MEXH 1KPRA 2A73B 1NFIA 4LEOA 1Q0XL 1UM5L 5DEGB 1UWEL 2ILLA 4I0CC 1HKLL 4WFGE 4ALAH 4Y4FD 5D1QC 4POYA 4I3GA 4N1HB 3S3PA 4BSVB 4DJMA 1U8LB 5D2LB 2W0FA 3MRPB 1OSZB 3OR6A 3ORJA 4XXCC 5EBMA 5H35A 5TFSL 4CN6A 4Y4FA 4ZOCA 4J3WA 4XMKL 5FKPB 4OCRH 3VD3A 1QLRB 4YXKH 3NOIA 3RUGB 1UWXK 1XIWC 4NQEE 2DWDB 1CIUA 4LCWD 4FP8H 1JYNA 3SKNA 1IILE 1DE4B 2EZ0C 2F54D 4DWHA 2FX7L 3VI3F 5I73C 2GAZA 5C0NC 1X4XA 1D6VH 1ORQA 2DMCA 1LEGA 4LCWA 1I75A 3HZMA 1AD9A 1YJDL 2VZVA 1R24B 1YEIL 3X13A 2F54A 3K1DA 4IDJL 1XAUA 4G7YL 2GTZB 3HN3A 1FRGH 1S9YB 4ZO7A 1U36A 2APFA 1UEYA 2AK4D 1SBSL 4XBGB 3LQAH 5FYJL 3ZKMD 4TSAH 2H6PA 4XP4H 1IEBA 4LPTA 2EDYA 5EN2A 2A6JB 2C3GA 4PJEB 5GGSA 3MRHB 3EOBA 2Y6SD 1MIMH 3S36L 2AABL 4O2CB 5IVXB 2E6QA 4JY5H 1ZT7A 4JM2C 4YBQD 4NC0B 3BZFA 4GUPA 2AK4A 4KRMB 3WD5H 3UC0L 1A3LL 4CMHC 1NC2B 5C0BD 4S0TD 4IM8A 1AGEB 1Q0XH 1NAMB 1Y18A 5FYKU 4HK3J 1UWEH 3MBEC 4CVZB 1HKLH 2AJYL 1JHLL 5F1SA 4OCMC 5B39B 4J3TA 3G04A 3QUMA 5C0BA 4M43L 3O6KL 1FNGB 4NZTL 2VXSL 4PP2B 2H26A 4Q2ZB 5F7UA 1FP5A 3VWJB 5ANME 4X9FA 1D5XA 2A6IB 4EZMA 1EFXB 3EW3B 4MD4B 5L88L 5TFSH 1H8NA 1PFCA 4U4BA 3MRNA 3VFGL 1R5VB 1G9NL 4XMKH 5E2WL 4F7MB 5AD0A 1CGWA 3MO1A 4TTDD 3ET9F 3JV4A 5F1IB 1T4KA 4X7TB 3BGMA 3LQZB 2APXA 4Z7VB 1K4DA 4HHAB 3OGCA 3C60C 2IBZY 4ZXBB 5IQ9A 3M45A 3F7YB 4AIXA 1DVFC 1TVBB 5IHZA 4P46B 5SWQA 3D85B 3BEWB 2EYTB 5K9KB 5ENWA 1NQBA 1YJDH 5TDNB 3TBTB 1YEIH 2FZ3B 4IDJH 4G7YH 1I8KB 2DTML 1WC7B 1WWCA 1SBSH 5TQ0L 4OTXL 5FYJH 4LDEB 1EIBA 1QEWA 3WDJA 3VGEA 2ZCHL 3S36H 2AABH 5CJXA 5B8CC 1TETL 2YZ8A 3U9PL 4AQOA 3BUYA 2GK0B 2EIBA 4G42B 3U36A 3EJZC 4YPJA 4MJ6B 2BMKA 1AKJB 2FJGA 1A3LH 2BVOB 5KBNC 4RX4D 2H45A 3EO0B 1H8OA 2B2XL 1IRAY 2HJKB 3GSUA 1AE6L 1MHCA 1U8JB 3L3IA 2F5BL 3V7AE 2AJYH 1JHLH 4HKXB 4P2QD 3KPTA 3BP4B 3Q48A 2R4SL 2H9GB 3O6KH 4M43H 2VXSH 3DV4B 4NZTH 4RX4A 4TNWF 2ZUQC 4AJ0A 5FA4B 3CZFA 3IDIB 1A22B 1I7UA 3QDMB 5CGYC 3ZKQD 5CBEB 3UJTL 5L88H 2JK5B 2ICES 4WTXA 1CXFA 5D2LE 3ZDXF 4RISL 4P2QA 4WENB 1JWUB 3VFGH 1OAQL 5CZXC 1G9NH 3P3YA 5E2WH 1G7QA 1YPZB 2P44B 3UJJL 1J5OL 3MRDB 4M48L 5LG1A 3IXTA 1JPST 2NY2B 2CR6A 3T3PE 3RUGE 3RI5F 1T1YB 3QHFH 3VGBA 1MUJB 5CD3B 3B6SA 3NAAL 2AV1B 5KAQF 5HYIA 5I19L 5B38B 4QRRD 1F00I 1QBLL 2NW3B 2W9DL 1EJ6A 4V1DB 2WAHA 4X4XA 1TPXC 2MPAL 1T1WA 3TO4D 4OUUA 4W70A 3T1FB 4KJYA 4D94A 3BISA 2GK2A 3Q2CA 4QRRA 2FO1A 3RWGB 2K1MA 2VXTL 2DTMH 5DRWA 4DW2L 3T65A 1PG7X 4WTZG 4ORGB 3GSWB 5TQ0H 4OTXH 4FQXC 4PR5B 3TO4A 3TT1L 3BPOC 3VFSB 1VFBB 4MJIB 2MCPL 3PWNB 1WFNA 1S7RA 1FGVL 2ZCHH 4H26A 4PJEE 3HMXL 1KN4L 4YDVB 3EYOA 1TETH 1U41A 4PY8I 5IVXE 4QF1B 5ELIA 3CDGA 1A9EA 1BMGA 1A47A 5IMLA 3ILQD 1WBYA 4Q6IA 1KLUB 2B2XH 1KPVA 3LEYL 1WEJL 1AE6H 4UIMA 2F5BH 5JW3L 5CP3H 3EIFA 3CLEL 1YC7A 1N5AB 3NIDF 2R4SH 1WAAF 3ECBB 2V9TA 1QSZA 2GCYB 3GSXB 3G5YB 1LP9F 4XVJL 3UJTH 3ZDYE 3ZDZE 5C2BL 4RISH 1OAQH 3WFBL 4LFHG 5B3NA 3S97C 1VFOA 3KWWB 3UJJH 1J5OH 4HWEL 4MSWA 4RFNB 4M48H 3ARGD 4Q6YA 3O3DB 1EVTC 2GQHA 3NAAH 5I19H 4QY8B 3RA7L 4IRJB 1T21A 2FIKA 1QBLH 3VXSD 5EO9A 1CFQB 4Z7VE 1A0QL 1FL3A 1R3LB 4F7TA 1YNTA 4QXWA 2W9DH 5FFLA 5JOFB 2MPAH 4PV8B 1NBZA 3IDJB 4ZFZA 3ARGA 4HJ0C 4HS6A 1GRWA 4HUVB 4IIQB 5DQJB 2OR8A 2HT3C 3VXSA 3MYJA 3ARBB 2VXTH 4NBZB 3F5WA 5E8OA 4DW2H 1AD0A 1S7WA 2J8UA 2L0DA 5E8PA 1QBAA 4O51A 1G0DA 2YD1A 1MJUL 5HDLA 3TT1H 1GPOL 2MCPH 4Q0XL 2JE8A 1FGVH 3AXLB 3HMXH 1KN4H 2VDKL 2DQFA 2HLFD 1U3YA 1LP9A 5ICZB 3MNWA 3CFJA 3MRLA 5FHAL 5IMKA 3T0ED 3V2AR 3MUGA 1T7ZA 2DL9A 2P42B 4PBVC 1V3LA 3VWJC 4DVBA 1KYOK 5CGTA 1JZ2A 3W39A 2DQJL 3WJJC 3LEYH 2CPCA 1WEJH 3BDYL 1P1ZA 4D9QD 2AV7A 5JW3H 2ZOLA 4XCNA 1JGDB 3CLEH 2BVUA 3LVEA 2EICA 4QWWD 2Y5EA 5CEXA 5INDB 2IPKA 2H8PA 5HHPB 5F6HI 5FYJD 4XVJH 4NQSA 1PX3A 5C2BH 5C6TL 2MKLC 4ZXBC 3QDME 1CF8H 2IANB 3WFBH 4ELKB 4P46C 5ESAB 1C12A 3CVHB 4HWEH 2ERJB 4X5WB 1XR9A 2YA1A 5AG8A 1ETZB 3CH1A 1FC1A 4M02A 2DTSA 1V7NH 5D7JB 3RA7H 4KKLC 5IKCB 5F70A 4P23D 1A0QH 1K4CB 4HFWA 4JLRB 2HVKB 4WCYL 3I02B 4NFBA 4V1DE 4NP4L 3VFUA 5IOPA 2ESVB 5L2KB 4NO2A 4ZPVA 4BM7A 2W60B 5FDYA 1W0VA 4P23A 4U3CA 4X7SL 4JPVL 4CKVX 2MFNA 1AGCB 1MJUH 3E3QE 5IB3B 1IVLA 1GPOH 2CK2A 3LQMA 3QI9D 4Q0XH 3CX2A 3SEPA 5EU4B 3ZSTA 2VDKH 3DX7B 1FZKB 1WIUA 4G5ZL 1VA9A 1QPXA 2V5TA 4GW5B 4E42A 4WFFE 1LEKA 3RRQA 5FHAH 1MWAL 1DBJL 3QI9A 1AXIB 4HGKC 5H37H 3MFGB 4OAWA 3NCJH 1S5HA 2DQJH 3HI1B 1U8QB 3BDYH 4LHUB 1WBZA 4GW1A 3DLQR 1Q9WA 2YD7A 5SWSD 3UTSB 1L4IA 3T4YB 3VA2C 4FFZL 3FN3A 4YBHA 5HGBA 4PTUB 5IGXL 3QXAA 1T89A 2NY2C 4MCYB 5ESVA 5JNYA 5BZWB 1G7MA 3HUJB 5EIIA 5C6TH 3HAEH 3CUPB 1U91B 5CBAA 4YO0B 4L8BB 1P7QD 3ES6A 3K7UA 4UU9A 4A2LA 4HBCL 5F8RC 2PCPA 5EOCJ 1IGJB 3L3DA 4GSDL 3QHZL 4OD2A 1URLA 4RFEB 5INCB 1SYVA 5LGJA 1HHKB 1P7QA 3E3QC 4PJGB 2LV4A 4WCYH 2R69H 1OTSC 5HTSA 5C08D 2VISB 3S96A 2DQGL 4NP4H 2KDGA 5T1LD 4V2BA 3AS0A 3MRKA 1DQQA 4JFHD 4X7SH 2ID5A 4JPVH 5CP3A 3E6HB 1DANT 5K59E 5C08A 4O4YL 4BH8A 5T1LA 3V9FA 3O6FB 3WEXB 4G5ZH 3RJDA 1HSAB 3PHSA 3C08L 3MZGB 3F6IA 3TNMA 2MKWA 1DN0A 1MLBB 1MWAH 1UM4L 1OWRM 1DBJH 2FHBA 2DJUA 3KXFB 2I27N 3PHOA 5J1AA 1ZV5A 3Q5OA 4JKLA 3IFOA 1NH6A 3KJ6L 1DP0A 4NHUA 1LO5A 1I8IA 1C5CL 2ICEB 1IGYB 3TFKD 5IGXH 4WUUB 4RFNC 3O11A 1J8KA 4PGEB 2JJTA 5C0DA 3KLDA 2DS4A 3IAPA 3ZE0F 3FO9A 2AJZB 4IRJC 2WBWB 1U2HA 4X5XA 1H15A 2EDWA 2Y7QA 5HDQL 4XVSL 1D5BB 1XGTB 5HJ3B 4HBCH 1W0WB 5I18L 4HF5L 3MV7B 2IALA 2DWEA 2D7QA 4IIQC 4GSDH 1WV7T 4GAYA 3HMXA 2X4RB 5IVZB 1GHFL 1M7XA 3ARBC 3I3DA 4RIRA 2A0LC 4FQ2L 1XH3B 3CVIL 5F7KC 4HZLB 1BD2D 1IGIL 3GZKA 2DQGH 3C6SA 3OWEA 4TVSa 4JFQB 4X4MA 2ESVE 1PSKL 1BD2A 1U8MA 3N1FC 3RVWD 4YEFA 1S7VA 1FE8L 3ME0A 1LK2B 3R8BB 4K3HA 5MEQB 3BIKB 4AM0A 4KMTL 4XBPB 3C08H 5HPMB 3REVB 1FNEA 2C1PB 3ZLQC 1UM4H 4QXUL 4U0QB 1RU9L 5C0IA 4OIAA 1KTLB 3LKPA 3VXRB 4C59B 4S1QL 3MJ6A 5JPMB 1MCOL 4XPTL 5HHQA 3KJ6H 3P0YL 3QNYA 3KS0H 3HE6D 43CAA 1C5CH 4JFYA 3UTSE 1UWGL 5TF0A 3KPMB 5F7NC 4IOFC 2ERJC 3UTOA 3O41B 2ZJSL 4UBDD 1ZLWH 2LTQB 5D7JC 3HE6A 4I9WE 2YD9A 2VKWA 1OTTD 3HUJE 3NFSL 4PJFA 5FAAA 5HDQH 4XVSH 1ND0B 5I18H 3QT2A 4HF5H 3DHJA 3LKQA 1GOGA 5EFIA 1ZHLA 2D2OA 2I26N 4CL7A 1QUNA 2R2EB 4DVRL 1GHFH 4UOW0 1FNLA 4FQ2H 4Z7UE 3VRJB 3CVIH 5IR1A 5KSUB 4MAYB 1GIGL 4X7DC 1IGIH 4PJGE 5B3JF 3Q3GA 3SKOB 3WKNA 2CLRB 3H3PL 1G7IA 1PSKH 4P2YA 1KCLA 3ZKXB 1V05A 5F9AC 4U1MA 1CFSA 1NGWB 5AUMA 3OKLA 1RZGA 1SY6L 1X5YA 1E27A 3I6GA 7FABL 4XP9L 2Y5TA 3DVNA 3TZVD 4HH9A 1YQ2A 2R0WL 4KMTH 4XRCA 3HAEA 5IFAL 1KXQE 5GGVY 3QDHA 1R3KB 4OLZL 1T5XA 4OCYL 1FO0B 3MV01 3QFJB 3X14B 1RU9H 3NFPB 1CFBA 4OFDA 1B6UA 3OF6A 1A3QA 2PXYD 4XX1G 2FNBA 3TZVA 4S1QH 3A0OA 1MCOH 3L3KB 4XPTH 4GG6B 3P0YH 3KXFE 1OM3L 4JJ5B 2SEBB 5FOBA 2R1YB 2ENYA 2V2XB 1LILA 4OV6F 2AJSL 4MXWL 4JREB 1S7SA 1UWGH 3DTXB 1H0DA 3IF1B 1LD9A 1FZMA 2PXYA 1CXHA 1FAIH 2ZJSH 3GI8H 3IJYB 4PJ7B 5T5NG 4D3CH 1PY9A 5IK3A 3NFSH 3KHOA 1W0YT 2I24N 2EDBA 3BQUD 3DVGA 1F4HA 1SM3L 2PO6D 3EYFA 4IRSB 4RZCA 1GJIA 4DK6A 5GZND 2OXHA 1FFPB 3EDJA 4XPBL 2ENSA 3MV7E 1GC1C 4DVRH 2XWTA 3BQUA 4N8CL 2PO6A 1VGEL 1AP2B 1GIGH 1MWAA 1OGAD 2IBGA 4OLVL 2EYRB 5ICYB 5HVWA 4RA3A 1HDMB 3O6FC 4PJ9B 4MB3A 2LAAA 3EGSB 4UQ3B 1OGAA 3QIUD 1DQML 3EYUL 1SY6H 3FOMB 1J18A 4X80L 7FABH 1UZ6F 4XP9H 4XNXL 3VG9B 3MRBA 4KV5E 2R0WH 5IFAH 2FDBP 4QO1A 3QIUA 4EI5B 3JVGC 2Z8WC 4OLZH 4OCYH 3HR5B 1HIML 4OF3A 3F12A 3PIQB 1UXWB 2YKLL 4YR6B 1CQYA 5I15L 4QHUB 4IDLA 4WW2B 1OM3H 4RMRA 3WS3A 3VXRE 4KI5E 1IKFL 2AJSH 4MXWH 3MGOB 4FRWA 4UUJA 1TFHA 1E4KC 4S1SL 4XGZB 2P24A 1TTGA 1OP5H 3QDAA 4X6DB 1CE1L 4O9HL 2W65A 4J1UB 5FCSH 4HKBB 1KJ2L 1SM3H 3FT2B 3C8KB 4FQCL 3H7LA 3INUL 1BBJB 3E6FB 5CAYB 2OM5A 1OARL 3AAZA 3VFRA 2JJSC 4BZYA 4Z7OF 5KSVB 4N8CH 1HEZA 1VGEH 1F4WL 2ADIB 3WIHL 3S9DB 4LLVB 4R6UA 4Z0BL 2E8ZA 4OLVH 3CFEA 1JGVL 1IAIL 3IKKA 4LVHB 3STLB 1R5IA 1JMZA 1WT5C 5I1LB 5D1ZB 4QOKD 1Q94B 1EHAA 4DEPB 1DQMH 1F3DH 4O2FB 4YGVB 3EYUH 4WU5B 3PV7A 4X80H 4XNXH 3ZT6A 1F5WA 4KI5C 4QOKA 4NT6B 4JZJB 5I1CL 1HIMH 4WHCA 3BPCB 1A9BB 4KVNL 1S9XA 3QUZB 2HTLC 3MJGX 4ELMB 4Z78B 3P11L 2YKLH 5ILTL 5JHDE 1F02I 3BN3B 5I15H 3OXRA 4KK6D 4QRQB 2ITDA 2LTQC 1H3WM 3L3JB 5HXMA 4XVUC 3ZHLA 2YUXA 2YMXL 2VE6B 4DN4L 4N0YL 3BGAA 2VAJA 4OI7A 1OB1B 3GIVB 4CU7A 4ORZC 4C83A 1HE7A 3VFPB 3KPLB 4HUXA 4DZ8B 4HMCA 4PGBA 4S1SH 2N1KA 2X44D 1AGBB 1UQSB 5ACZB 2CDGA 3LIZL 1OY3B 4PJ7E 1CE1H 4O9HH 1NC4D 5CILL 1KJ2H 2HTKC 3EO9L 3VE0B 4MAYC 4XPAL 4FQCH 3INUH 4K8RD 3PF2A 1OARH 5TE7L 1U3JA 2YN3A 3CSYA 1NC4A 1E4WL 4GRMB 4TVPE 1F4WH 3WIHH 4NDMA 1S8DB 1F97A 3ZKXC 2AGJL 4QRPD 4Z0BH 1JGVH 1IAIH 1G7HA 4OIIL 3HC0A 1RVFL 4RAHA 4HWUA 2HMID 4YHPA 2VH5L 2WV3A 4NCDA 4NNPL 3RGVD 4QRPA 1F45A 4K9EL 4U6YA 3ULVE 3LRGA 3HB3C 5BOPA 2NPLX 1JUFA 3SDXF 2I9TB 1P4LA 5HHVL 4DCQA 5MHSE 3VD4A 2Z8RA 4LDOB 2Z31B 2AJ3A 5D1QD 3HNVH 3RGVA 2G75B 4ESKA 5CUSL 2X4OA 3NA9L 4K23L 4MXVF 4H1LG 5I1CH 4ZQKB 2A38A 5K9QI 4JREC 4KVNH 4GW4B 5SX5H 5ILTH 1A1NB 1BM3L 5DK2A 5ITFB 1YMHA 5D1QA 3UPAA 5MEND 1I9JL 4EUPG 1KCUL 4J3VA 5JMOC 3H7BA 4LKXB 2DQCL 2VXUL 2YMXH 1XIWD 5FM4A 3DRTB 4OZHF 4DN4H 4N0YH 4YPGA 1NAML 4JM2F 4XXCA 3B9EA 4IRSC 4N9GA 1N8ZA 4JRYB 5CWSA 4ZFGL 1JTPA 2EZ0D 3MODL 1WVZA 5IVOA 5MENA 1EUUA 1H9VA 3P4OA 3DX9B 4MX7A 1CI5A 5HGDB 5C0GA 3LIZH 1SQ2N 1BIIA 4Z77B 2P1YA 1XIWA 5C9JB 5CILH 3EO9H 1CD0A 5F3HA 2IWGA 4KJQC 4XPAH 4X6DE 4Y1AD 1SY6A 5F21B 4X99B 1KJMA 3W9DA 2C4XA 3GJFA 2IPUG 5TE7H 3CCHA 4PJ9C 4R90L 1E4WH 1UKTA 2IEPA 3BH9B 2AGJH 2ZSVA 4Y1AA 5FB8B 3U9UB 4GLRH 4R4FL 3FQNA 3WXWL 4OIIH 2NLJA 2XACC 1RVFH 2AI0L 4JM2D 4WFGD 4M61B 5F71A 1HCFX 3VG9C 2VH5H 5DRNA 1NBYB 3KR3L 5IEKB 5I2IB 2N56A 2X70A 3MRJB 1J0HA 4EI5C 1FIEA 1IAII 1NGYB 4K9EH 1N6QL 4IMLA 2LQRA 1P84K 3FO2B 5E5UB 4FQLL 1ZLSL 2OSLA 2YPKA 4JM2A 1RZJL 5HHVH 3MBED 3DIFB 4AK1A 1ED3A 2OS7A 4WW2C 3UPRA 3BZ4B 1X44A 5GGRY 5IM7A 4NQED 2BOCA 4K23H 3ARWA 5IESL 1PKOA 5HI3C 1MCKA 5GS2H 1ZHNB 5I16A 5DSCA 3P77B 1WF5A 3EO1A 3MUY1 5KN5B 5D70L 1UVQB 4N0RA 3BEVB 3MBEA 2O93L 4JN2B 4W68A 4ELME 4NJAL 3BDBA 4I77L 4KK8C 4G6KL 4YDJA 5DEFB 1I9JH 1KCUH 4NQEA 3QIWA 4P59L 2DQCH 2P8LB 2VXUH 1P53A 1YY8A 4NO3B 4ZFGH 1YUHA 2FHCA 1QQDA 2F8VA 3C60D 3MODH 5GGSY 1MQ8A 3TO2A 1ULVA 4G80A 1KPUB 1DVFD 1I7RA 4D9RE 2GYSA 3N1MC 3HZVB 1F2QA 3RWDA 3RNKA 1OHQA 3C60A 4LVHC 1Z5LA 4ZUVB 1DVFA 3B5TA 4R90H 1CXEA 1NGPL 3MFFA 5D1ZC 4U1LA 2YSSB 4P3DB 1JN6A 4NKIL 3B2VL 3H9HA 4U1SB 4DEPC 2PYFA 4M6NL 3CFDA 4MB4A 2AXFB 4R4FH 3C5ZB 1CICB 3WXWH 3VH8G 2AI0H 3QISA 4G43B 3GEWB 3KR3H 3EJZD 4JZJC 4WWKB 4EVNB 2NW2B 4GLRI 4RBPH 3FQRB 1VGKA 1N6QH 4XT1C 3U0PA 1MCPL 3THML 1ZLSH 3REWB 4FQLH 4EN3B 3QUZC 3O45B 5B8CA 1RZJH 1FL6A 1EGJL 3S35X 2BHZA 4LPUA 3QWRD 5ALBL 5IMOA 4MA3A 4ZAKB 5ANMA 1Q9OB 1X5AA 5L2JB 5IESH 1MCLA 1SJVA 1KJ2A 4YHIB 3IXAB 5EUOB 1PD6A 4JFPB 5CGYD 5D70H 4XCEA 3QWRA 4GBXB 1DFBL 4NJAH 1RV6X 4I77H 4DZBA 5CZXD 5DR5L 2EDXA 4FXKA 1XEDA 4PTTB 4P59H 5GGUB 2EC9T 3WIHA 2FO4B 3MV9A 4HEME 2CUMA 2FRGP 5F7FA 3MZTA 3UBXB 3OTTA 1CK0L 4JRYE 5FDWB 3MLZL 1KCRL 1OTUC 3RQ3A 4LDLB 1R5WB 4APQD 1GGIL 5FHBL 4BSWB 3SQOL 43C9B 3D9AL 5D2LF 1NEZB 3MLRL 1I4FA 3GB7B 3FJTA 2ADGB 5D7KE 5F1OB 3BE1L 1QSEB 3LRSB 3HA0A 5CS7A 4APQA 4KPHL 1NGPH 4X4YB 3W82A 3T3PF 2ZNXA 3RUGF 3GMPA 4WEMB 4P9MH 2H2PC 4JANB 4TUOA 5HGHB 4NKIH 4P57B 5ID1B 4FQXD 3B2VH 5E94A 1INQB 5JO5B 4I4WA 2A6DB 1WITA 3ETBF 3PDDA 5IHBA 4DKDC 2Z31C 4FQXA 2D3VA 3QA3A 4AEEA 4RWHA 1FORL 4MJ5A 1V3MA 1J0ZA 1CFVL 2A73A 2EE6A 4GKZB 3V6FB 3THMH 5DEGA 4U6XB 1EGJH 3DECA 1F42A 4LIQE 5ALBH 1N6VA 3PV6B 3T2OA 4AIOA 4UTBL 4DQOL 1J1OL 4Z18A 4MNHB 4PJEF 4BSVA 3QXDB 1MCIA 3QDGB 1KC5L 1U8LA 5D2LA 1R0AL 3MRPA 3WUWB 2R1XB 3ZE1F 2AXJA 1DFBH 1EO7A 4JZNB 4IHOB 4AENB 1RD6A 5DR5H 3BXNB 1QLRA 3RUGA 2B7DT 2EYSB 3L5JA 2DWDA 3QHTC 3TH2T 3CLFL 2BERA 1DE4A 1NKRA 2W9LA 2WLZA 1CK0H 1REIA 3MLZH 1KCRH 1KOAA 1NGXB 1GGIH 5FHBH 3SQOH 3D9AH 5TF1L 3ZDZF 2J1KA 5CFHA 3MLRH 4HJ0D 1R24A 2HT3D 3BE1H 1CLOL 4LKCB 2GTZA 2WQ8A 4KPHH 4D8PB 1GGCH 3CSGA 3MNVB 1Z9OA 1JP5A 3CVHL 5BRZB 9CGTA 4XNQB 1NC2D 2A6JA 4PJEA 1JNNL 1A3RL 3MRHA 4F7PB 1ZAGA 1HXMB 2P5WB 1KV3A 2HKHL 4O2CA 5IVXA 4OKDA 1XF3B 4NCC2 4WGWB 3TF7C 1N2RB 5I1KL 1U8PB 1KEML 2Q3ZA 2BZDA 3LRHA 1NC2A 1FORH 1MCHA 5TE4L 1CFVH 1AGEA 2QSCL 4KRLB 1NAMA 3VWJD 2NZ9C 1CDGA 3JV0A 1EFXD 1CTNA 3L5HA 3WO3B 4CVZA 5B39A 3R0NA 4UTBH 5GRZA 2PUQT 4DQOH 1J1OH 4C57C 1VEMA 2DLEA 1FNGA 4PP2A 4R26L 3VWJA 1KC5H 1YYLL 2A6IA 3WJJA 1R0AH 4JGUA 3F8UB 1EFXA 4MD4A 3RU8L 4RMQA 5EUOE 4Y2DB 1JGEA 4ZXBD 1R5VA 4F7MA 1BAFL 1HHIA 4P46D 1HQRA 3D85D 4QHKI 5HDBF 5HGGS 3LQZA 3CLFH 4Z7VA 3Q5YA 5ISZB 4HHAA 4HZAA 3BAEL 3JUYA 4FZ8L 4FFYL 3VXOB 3F7YA 3RBGA 1TVBA 4P46A 3D85A 3BEWA 5TF1H 5MP6L 2JJUA 5D7IB 5K9KA 1FQ9C 1NKOA 2XKSA 3QNZB 1UJTA 5H2BB 4NYLB 3OB8A 5F96L 3C5ZC 1CICC 3TBTA 4PJAB 1CLOH 2YXFA 4IEFB 1BFSA 2FLRT 1I8KA 3P9MB 1WC7A 1QSEE 2WP3T 3CVHH 1AKJD 4WHYG 4WWKC 5HYJE 1JNNH 5TDOB 1OAYL 5HY9B 1JZ5A 3B2UC 4EN3C 2HKHH 4NRZB 3JV6A 2OJEB 4M9OA 2GK0A 5I1KH 4G42A 3K4AA 4LLMB 1KEMH 4MJ6A 2OCFD 1AKJA 4ZAKC 1WLHA 4XHQA 2N7BA 2BVOA 2W0PA 5TE4H 1ZHKB 2P46B 2VDOL 3EO0A 3VFVB 2VDMH 4YDIH 1GC1L 2HJKA 4DGVL 3QDMD 4NZUL 1U8JA 3BWUC 4HKXA 4GBXC 3UXFA 1L9NA 4N0CC 4XHJC 1A64A 3TIEB 5KAQG 3BP4A 3NCFB 2H9GA 3DV4A 3L3HB 4R26H 1KB9K 1NGZA 1J11A 4UT9L 5FA4A 1YYLH 2NY2D 3QXUA 3QDMA 1QFOA 5CBEA 3RU8H 2JK5A 3QDGE 1IC4L 1JWUA 1SEQH 1BAFH 4K3EL 4V1DD 2NY5C 3MRDA 1A6VL 1GXEA 3BWAB 1A6UL 1QO3A 3DROB 1T1YA 5CD3A 1MUJA 2AV1A 3BAEH 3F62A 1RSFA 4FZ8H 5B38A 4F8QA 4PB0L 4FFYH 2NW3A 2BNRE 4V1DA 1CXIA 1OTSD 4QCIB 5MP6H 1Y6KR 4X9IA 4PLNC 2HT2C 2ATPB 4W6WB 5F96H 4ZG1A 3RWGA 2D7PA 1L7TL 1EGJA 2VN7A 1GGBH 4WFFD 2BVQA 1U95B 5LCVL 5D9SB 4ORGA 3GSWA 3P9WB 4PR5A 2I9LB 3V6OE 3VFSA 1VFBA 1NSNL 5DJ2B 1OAYH 3PWNA 5CD5C 5BRZE 3MLYL 3OAUL 4P2RB 3G5ZA 4M3JA 4AH2B 3O3AB 2P5WE 4I18B 3R0MA 4L3AA 3DETC 4QF1A 2V9QA 1SEBB 1A1MB 3ESVF 2Z9TA 3NCBB 2VDOH 3RWEB 1PGRB 2IC2A 2CQVA 1GC1H 1KLUA 4DGVH 4XWOC 5K59F 4NZUH 2LABA 3JZ7A 1PAMA 2K7QA 4JFXB 1BPVA 1D9KB 1N5AA 4ODVL 3ECBA 5JR1L 2GCYA 1L6ZA 2NTFB 3V95A 1TQCB 5IT2L 1IC4H 3CD4A 4IRJD 1FVEB 2F74B 3MQIA 1X4YA 3KWWA 4K3EH 2CUIA 3PXJA 2VYRE 1A6VH 3LPWA 5IEHB 1A6UH 5FYLL 3O3DA 4M6OL 4H0GA 4QY8A 4IRJA 3P9LB 4PB0H 3ARBD 3VRIB 5ISZE 2A0LD 5DUML 3SO5A 1GGYA 1R3LA 3V6OC 5JOFA 1LO3L 4PV8A 3IDJA 1G84A 5E2TL 5DK3A 4DKEL 4HUVA 1MLCB 4IIQA 1NUNB 5DQJA 4MS8D 5D7IE 1W8NA 3NPZB 3ARBA 1L7TH 1MFBL 2E6PA 3CX5K 4ISVB 5LCVH 2X5PA 4PJAE 3QXWA 3AS1A 4U49A 5E70A 3NPSB 1NSNH 4EQ3A 3OAUH 5GZOD 3AXLA 4F7EB 3IAQA 4Y7MA 5ICZA 2VZTA 4S0SD 5C0CB 2KBGA 3QEUB 4ZUTB 2UVEA 1YEGL 3RX7A 5DJ6B 5C0FB 1QACA 3U1SL 3U7YL 5FEBA 3Q6GL 2XPGB 3KYOB 4E41B 3WHXB 3CNKA 4Y2DC 4OLUL 1JGDA 5HHNA 1BFVL 2FEDC 4NNXB 1NUFA 5INDA 5JR1H 4IOFD 2QQKL 4PB9L 5F7HA 4LLYB 2VUYA 5GS1B 5IT2H 5D7JD 2OLDA 4ELKA 3CVHA 1MH5B 5GS0C 2DLIA 4X5WA 2EKSB 5FYLH 1ETZA 3UDWC 3EOAB 1T1ZB 5FV2A 2ESVD 2VQUA 4M6OH 4ZYKB 5L2KD 1QKZL 5EBGA 3MXVH 1WFTA 5D7JA 1LEIB 5IKCA 3VGHA 5DUMH 1K4CA 4JLRA 2HVKA 4X8JA 1LO3H 3I02A 5D7SL 5E2TH 3DV6A 4PJ5B 2GIYA 4DKEH 2AJUH 3TBYB 2ESVA 5GGRB 1AGDA 1WCBB 2W60A 1MFBH 1NCTA 5J89A 1AGCA 1HQ4B 5IB3A 5IG7B 2ZZUT 4YC2B 3VXUB 4Z7UF 3P40A 5KTEL 5EU4A 4TVPL 4ETQB 3DX7A 1DR9A 4LHUD 1FZKA 3IAGC 2KZ1B 2HFGL 4PJGF 4P2RE 4MHHG 4GW5A 4K55A 4G8IA 3UTSD 1YEGH 4IJ3B 5GRVL 5JPNA 2ZOKB 3I2CL 3U1SH 3U7YH 5CIPB 2QQLH 3WE6B 3HI1A 1Z0NA 3IU3A 4LHUA 4X9BA 4I9WD 4OLUH 3ULVL 3UTSA 3FKUS 2EIDA 4HG4J 3T4YA 4HIJB 1BFVH 4JCMA 3JWOC 1ES0B 4PTUA 2OQJB 2QQKH 3KPQB 4MCYA 4PB9H 5BZWA 1F6AB 3HUJA 5HGAB 4TPRL 1U9KA 5DD3H 4ZOBA 3CUPA 3WJLC 5F7DB 2HVJB 4YO0A 1CLYL 4KY1L 1Q72L 2X6MA 3BESR 4L8BA 4PJCF 4UZGA 3C09C 4Y4HB 1G6VK 1IGJA 3RWCB 5DVKA 4Z7UA 1QKZH 4RFEA 5INCA 5J12B 1OW0A 4HC1A 4HIEB 4L9DA 4PJGA 4XVTH 3B9KB 3QO0B 5CLWA 5D7SH 1BBDL 2VISA 1MCJA 5FO9B 3OJDB 4NUGL 2VR9A 3O6FD 1LVEA 4PJXF 4I18C 1TTFA 5I1HL 4XI5C 3OQ3B 3BO8B 3E6HA 5JZ7C 5DFWH 1AC6A 1XGYL 3O9WB 1U58B 1YEFL 3ZYJA 3DUSB 5KTEH 4TVPH 3KXFD 3O6FA 3WEXA 1J05B 2HFGH 2FH6A 2HFEB 4WHTA 1I8LC 1HSAA 3X3GL 4UIKL 5KSBB 4ZPTB 3WO4B 1GZPB 1NDGA 1MLBA 1D9KC 4OGZA 1D3CA 5C0CE 5DA0B 1OOAA 3JXAA 2J6EL 3I2CH 2WM0A 5DGRA 3KXFA 1LO0H 4MD5B 1U8HB 1HCVA 1ZTXL 4M1DL 3VFOB 5DFTA 4J2XA 1TQCC 3VFMB 4WJ5B 3ULVH 4E41E 3JVGA 3SBWC 4PREB 1IEHA 4JGMA 3PDOB 2ICEA 1IGYA 4HS3B 4KV5F 5C0AB 3MV7D 3TBVB 1X5LA 5BOZG 4TPRH 2FL5B 3WNNA 2AJZA 2H32H 5CJBA 2L4OA 3GI9L 1IM9A 5LVEA 1CLYH 5D8JL 4KY1H 1Q72H 2DLFH 1OT2A 5GRXG 1XGTA 4Y5XB 1W0WA 3MV7A 3MC0A 3K1KC 1J12A 4LNVA 1E4KA 3FB6B 2IFGA 2VDPL 3D5OF 2X4RA 5IVZA 1KNOB 1RHHB 3T3MF 1XH3A 2VO5A 1H5BB 4HZLA 1CR9L 3C9NB 1SVZA 2ARWA 2HFTA 1K9TA 3NPSC 5DHXB 5DC0A 3SKUD 1EDQA 2FX9L 5H37G 4NUGH 4PJ5E 5IW3A 3DOSA 2JJSA 4JFQA 3OKMB 5EULV 1BVKB 5I1HH 5DMYA 2CJUL 2G2RB 1B3JA 1LK2A 2QSTA 1XGYH 3AM8C 5MEQA 1YEFH 1WT5A 2LFGA 1GL4B 3BIKA 3OXSB 3VXRD 4KI5D 3X3GH 4XBPA 4UIKH 5HPMA 4O58L 1T04B 3REVA 4JPIA 3HAEG 2C1PA 1OP3H 1MHPL 2HRLA 1OAXL 2J6EH 3Q0HA 2HTLD 3MCKB 1KTLA 3G6DH 4ODBD 2DKSA 3QWQB 3VXRA 1ZTXH 1VKXB 5DT1H 5JPMA 4M1DH 3DURB 5GS1C 4XH2B 4YHZL 1FL5B 4OBRA 4D9LH 4YNYB 3VDCA 3TYFB 4XVUD 2M8XA 3D0VB 3KPMA 3CMGA 4BYHA 1ACZA 3O3EB 5BMFL 3O41A 2ED7A 1NJ9B 2VZ3A 4OM0L 2CRZA 4RGOL 4Y5VB 5IW1B 3GI9H 3PUCA 5D8JH 1J10A 2HTKD 1ND0A 4MAYD 2DMBA 1ZLVH 4E9LA 4JDZB 2NMSA 3HG1B 3PGFL 5EZJB 5E08L 2VDPH 2R2EA 3KPSB 3ALWA 3BKCH 3K46A 3VRJA 1PG7W 5KSUA 4FS0A 3STZB 4MAYA 1CR9H 5GRJL 4L8CB 5JW4M 1BX2B 2NY1B 1WTGT 3PP3H 4HH8A 1MJJB 2FX9H 4YC2C 1MY7A 4YUEL 3SKOA 2CSPA 3VMPA 4PV9B 1JPFB 1HOCB 2CJUH 2Y1VA 2CRIA 3LY6A 2VLKB 1AFVL 5JA9A 4IJ3C 1ZA6B 4FMFA 3HB3D 2DM7A 5JHDD 4UT6L 3GBNL 2GFBA 2ZUTA 4JQVC 5F7WC 2XY1A 4OLXL 4O58H 1CE6B 3BMVA 5DVOA 4ODSL 1R3KA 3L6FB 4ZTOL 1FO0A 4D0BA 1MHPH 3NFPA 4OF5A 5JHDA 4HK0A 3RTQB 2VMFA 5IBUB 3L3KA 3ULVF 1ZA3B 2CO7B 4U2YA 4YHZH 3SDDB 4JJ5A 1B2WL 2SEBA 3IB4A 2R1YA 4JO2L 3FCTA 2V2XA 3QEQB 4O2EB 1IEAA 3DTXA 3DNKA 3IF1A 4IRSD 4Y4HC 5BMFH 2NXZB 5GJTL 3UYRL 3GRWL 3IJYA 4PJ7A 5E0QA 3SJVE 5C0AE 4OM0H 4TVPD 4RGOH 3VFTB 1FCGA 4WW1B 5J12C 2BY3A 3QULB 3ZYIA 2FWOB 2VERN 4KJQD 1MCWW 3B9KC 1I7ZB 5E6IB 1IGTB 2RFXB 1CL7L 2AS5M 4WW2F 3PGFH 4S1DC 5E08H 3AC0A 2KZWA 4P5MB 4NWUL 1RZ7L 3F6LA 5IB1B 4PJ9D 1LMKA 4CDGC 3ULVD 5GRJH 1AP2A 2GY5A 3JTSB 2MWCA 3OAZH 4D0CB 5ICYA 3CMOL 3O9WC 1KUMA 1PY4A 5MHSD 4PJ9A 4X6DF 2PTUA 4KMLB 1CTOA 3BHBB 4L3EB 3EGSA 3KPPB 3HMWL 3WO4C 4EI5D 1AFVH 1JWSB 2YRPA 3FOMA 4BQBA 4UT6H 1HHJA 3GBNH 3GMMA 2J7LA 1MF2L 1EEZB 4OLXH 5IBLC 1FCCA 2H32A 1MIEL 1BJ1J 3D87B 4EI5A 4ODSH 1YZZA 3ZT5A 4JVUA 3HR5A 4JKPL 4ZTOH 5HI3D 3EDKA 2DQTL 3U0WL 1BZ9A 4YAQB 3PIQA 1UXWA 4P0DA 4YR6A 3T4AB 1H8SA 4M5ZL 1YC8A 4QHUA 4WW2A 3O3UN 4KK8D 3PWJB 1B2WH 4JO2H 1LO2L 3EHBC 5HI4C 3AFLA 1GYAA 2VL4A 4Y5XC 3ABZA 4HIHB 3MGOA 5DWUL 5GJTH 1CD1B 4NUJB 5ACMA 3TVMD 4MYWB 4XGZA 5I1DA 1SHMA 3BVNA 4X6DA 4J1UA 1H5BC 4HKBA 3QRGL 4ELMF 4K94C 3FT2A 3C8KA 2VQ1B 3V6ZB 4RWYL 3AS3A 3BSZH 1CL7H 1BBJA 1WZKA 3E6FA 4F7CB 3GBLA 3SQBA 3RIAK 3TVMA 2WWKT 1EAJA 4NWUH 1RZ7H 3GSVB 3H8NA 2ZCLL 3HG1E 5KSVA 3D1MC 5D1ZD 3TBSB 3KPSE 5J9PB 5FV1L 4OQ1A 1RK1B 5AWNL 5T3ZE 3SGKC 2J6EA 5CJOL 2UUDH 2DL2A 3STLA 4K71B 5I1LA 2CMRL 1OT1A 5D1ZA 1T2JA 1XR8A 5FECB 1J86A 2NY5L 1J7VR 3HMWH 3IDNB 2YRLA 4H8WC 4JRWA 1JZ4A 3OJMB 2OX5A 4O2FA 1S7UB 1M7IB 1QPPA 4YGVA 4WU5A 3RVTC 4PRPB 1IAKB 4D0DB 5JW4N 2VLKE 1I9IL 4EDXB 3QUZD 1FN4B 3KHQA 1MF2H 2NY3B 5LBSL 4NT6A 4JZJA 3KPRB 4L3CB 3G6JB 4JKPH 3B3IB 2DJSA 2LU4A 3BPCA 1A9BA 2DQTH 4ELMA 3QUZA 3U0WH 4Z78A 1G1CA 4M5ZH 4L8DB 4LGRB 4QRQA 4HLZG 3H3BC 3V0AC 4C55A 4D9RD 4Y5VC 1LO2H 3L3JA 3L7FB 2VE6A 4LRIC 2UWEB 2AEPL 2IBBA 3GIVA 3QEQE 3B5HA 1KYOJ 1P7KB 2X4NB 5DWUH 2M26A 3KPLA 3VFPA 4ZUSA 4DZ8A 3F7PC 2COQA 5JQHC 1AGBA 1OTUD 1UQSA 5DMGC 5ACZA 2WINB 2A74B 4XCFL 2EE2A 1RAMA 5D96B 3QRGH 3EZJB 1DL7L 5AZ2L 4XXDB 3T0EE 2FJFA 1Y6NR 4RWYH 2NY1C 1BFOB 4QHMB 4ACPA 4ZO6A 4OKVB 2P49B 1MJ8L 2X4PB 3T2NL 1TLKA 5HYSA 2ZCLH 3VCLB 4GRMA 2H2PD 4R8WL 4ZOAA 3KDMB 5AWNH 1CL7I 5GGTL 2H1PL 2QLVB 5F7YC 5CJOH 2QR0B 4KMQA 2CMRH 3SCMD 1K6QL 4MA7H 2B4CC 4NN5B 2Z31D 1I1FA 2NY5H 1PW3A 3I3EA 5GGVL 1I9IH 3BH8B 2I9TA 1K3IA 1MELA 1ZGLP 5GXBB 3SCMA 4I3RL 3RTQC 5I1AB 5LBSH 2PW2B 3SDDC 2NY0B 3MCLL 2G75A 3M07A 5DGQA 4RAUB 4ZQKA 5B21A 5BQ7B 4JRYD 1G6RB 2NXZC 1ODAA 1X4ZA 3DO7A 1ZEAL 4LKXA 3DRTA 2AEPH 5D7KD 1YEKL 4JRYA 4NO5B 1WBXB 5E6IC 1AXTH 3NCYS 5IJKA 1FG2B 5E8EB 5EU3B 3BP7B 4HGMA 3DX9A 5HGDA 1EUTA 4XCFH 4Z77A 4NNYB 5EO1B 3N85L 5C9JA 5FM5M 1RULL 1DL7H 5AZ2H 2BNUB 2YD6A 2Z4QA 4PJDB 4X99A 2FD6L 2OL3L 4GMSL 1A2YA 2XA8L 1MJ8H 4XAWL 3T2NH 4L1HA 3H42L 4PS4L 5ECJE 3BH9A 1YDPB 4R8WH 5IROC 3HZKB 4X6CB 5GGTH 4BH7B 2H1PH 2ZP0T 3S4SB 1A7PL 3QQ4B 4J4PC 3QZWB 3MCG1 4JO4L 4M61A 4NOBA 1K6QH 1T7XA 1GOFA 1NBYA 2DQUL 4F33B 5IEKA 3ZKNC 5GSRB 5I2IA 3MRJA 2XNAB 5GS0L 4Y19B 3X11B 1NGYA 5I1EL 3T0WA 2GSGA 1A14L 1QOKA 4G9FB 3FO2A 1D6EA 2F8XC 5GGVH 1DLFL 1I85A 4Z7WF 2NZ9D 4EQ2A 2QQNL 3V8CA 4I3RH 3GRWA 4PRPE 3OKDB 4J23A 5A16B 3SGDH 4JM4L 4ONFL 3BZ4A 4P5TB 3MCLH 4RMVA 4NQCB 1ZHNA 4ZDHB 3KPRE 2GUOB 3G6JE 3HI6L 4S10A 3P77A 4ZS7L 5KN5A 1P6FA 1UVQA 2OXGA 3BEVA 4M62L 5C92A 4JN2A 3G5XA 4HEPG 5DYOB 4M7LT 1RURL 5DEFA 1NGQL 1ZEAH 1SJHB 3C5SA 3G9VA 4JJHA 3DO3A 1CYGA 5HHMB 2GJ6B 3ZTJH 1JE6A 3K2MC 1CXLA 1YEKH 4NO3A 3QPQC 2Z92B 5IFHL 1NBVL 2UWEE 4WV1B 2YUZA 3TWCL 4YZFE 1FLRH 1UCBH 4H25B 2X41A 5ALCL 2W59A 3N85H 3DX6B 2NR6C 2CXGA 1RULH 4OCSL 4Y16B 5K9JL 5I0DA 1ZWIB 2FD6H 2OL3H 1CICD 3C5ZD 4GMSH 5SV3A 3P4MB 4K71C 2XA8H 4ZUVA 4XAWH 4ZNEE 2QJDA 2AAVA 3H42H 3B8SA 3JWOL 4PS4H 4LHJB 2YSSA 4P3DA 1QVOB 4QTHB 1XGQB 3KPNB 4U1SA 2D31B 1PQZB 4WWKD 1A7BA 1ROWA 2AXFA 1G9MC 2Z93B 3C5ZA 1CICA 3LKNB 4EN3D 1OP3K 1A7PH 4URTB 4MWFB 4G6JL 4JO4H 1C7SA 2GTWB 1HHGA 2DQUH 2NY3C 1BLNB 1Z2KA 4HPYL 1FYTB 4K2UL 1C08B 5DJDB 1RIUL 3B9AA 2W1NA 3CDFA 2Q7NA 4ZAKD 5GS0H 5IIEB 1OGTB 4WWKA 1QLFB 4EVNA 2NW2A 5I1EH 3FQRA 4TRPH 1A14H 4WDIB 1H3XA 3N06B 5T5NF 4EN3A 3REWA 1WIOA 1DLFH 2D0FA 3JWNC 3O45A 3V7AG 2QQNH 4KROB 1C8PA 4GBXD 5DRZB 4N0CD 4XHJD 4JM4H 4ZAKA 4ONFH 5C09B 4U1JB 1Q9OA 1UH2A 3OBAA 5L2JA 3H6JA 5EBLB 4YHIA 5EUOA 3HI6H 3NH7L 4ZS7H 1UG9A 1JNJA 4JFPA 2ZCKL 4M62H 5CMAB 2EDJA 4GBXA 2HLAA 3EOTL 1RURH 5F3BA 4PTTA 1IKNC 1NGQH 5M94B 5D96C 2E7MA 4ZODA 2FO4A 3I84A 4NZDA 3D6GA 5IFHH 2YEZA 1JV5B 3MV8B 3RPIB 2D0GA 2A77L 3TWCH 5FDWA 1OD9A 1QSED 1ZSDB 1R5WA 4BSWA 5ALCH 5DLML 3FOLB 1J8HB 43C9A 5HYJD 2PN5A 3S35L 2JB6B 1NEZA 4BSJA 3GB7A 4PJBF 2HT2D 2ADGA 4OCSH 5K9JH 1QSEA 4PJDE 1HWHB 5DMKB 4UTAL 1KBGL 2VQTA 2OTWA 4P2OD 3JWOH 5HYJA 5IW6B 5HGHA 4NN5C 4JANA 1RZKL 5ID1A 4DUWA 1EVUA 3H9YA 4ODWB 5DA4A 5JO5A 5TH2A 4JE4B 5KOMC 1WFUA 3GSNB 4PY8J 5CD5D 4MD0A 3CFKB 4X6CE 3I75B 3OHXB 2KKQA 15C8L 4G6JH 2A6DA 4EUPH 4P2OA 4HPYH 3DETD 4K2UH 1EAPA 4M5YL 1RIUH 1ZXQA 4PGDB 5DC9B 2NY0C 2ED9A 5C8JB 1DQJB 2VLLB 1MCWM 1HZHL 2E7LC 2BSTB 2XYCA 3MA9L 4Y19E 3QDGD 3RDTB 1BQSA 4U6XA 4EXPX 5BVJB 3WYRA 4AYFA 4XWOD 5DUPL 4G9FE 4OCLC 3PV6A 5B39G 2Q3AA 3OAYH 4MNHA 3MPCA 3LV3B 2JTDA 3QDGA 3NH7H 4NOFA 4NQCE 3FO0L 2R1XA 5IV2B 3ARFB 3EOTH 4IHOA 4PG9B 1F3RB 2BNRD 5E2UL 4AENA 1MRDL 5C1MB 3MOBL 4N5UA 3BXNA 5FIEA 2GITB 3K74B 4AMKL 3MMEB 5LAXB 5GGTA 2BVPA 5HHME 2GJ6E 1MRFL 2A77H 1NMAL 2BNRA 1NGXA 1KXTB 4NM4L 5KVGL 1BQLL 5DLMH 2KUTA 3WNPA 2L7UA 5FKAB 3X3FL 1CDIA 2UY7A 3P2TA 1CGXA 3S35H 1EERB 5BRZD 1SJXA 3TV3L 1TJGL 1U3ZA 4UILL 2P5WD 4LKCA 5I66B 4D8PA 4UTAH 4N8VB 1KBGH 3V6OA 2PNDA 1QFWM 3F7VB 1RZKH 4RQQB 3MNVA 3P73B 5BRZA 4XNQA 2FBJL 1IGCL 5E24E 3MJ7B 4F7PA 1HXMA 2P5WA 2UY6A 3RPKA 15C8H 2F58L 1C5BL 1OCWL 1N2RA 1IQWL 1FPTL 4M5YH 1U8PA 1ZS8A 1X5GA 3MACH 4EDWL 2D7NA 4P5TC 5D7IF 2Q20A 1FYTE 4JFFB 4Y2OA 2Q76B 1HZHH 3BP5B 3MA9H 3CC5B 4PJAF 3UTZB 1MAJA 4M8QB 5DUPH 1TZGL 3EYVB 4Y2DD 2IJ0C 2C1OB 1SJEB 2AQ1A 2VL5B 2FEDD 3LB6C 3NGBB 2JCCB 4RMSA 1IZJA 5AAMA 2AERT 4B41A 3FO0H 4E0RB 2OL3A 4G7VL 5ISZD 2E9BA 4WV1C 4Y2DA 3W9EB 2EDEA 5E2UH 1MRDH 3MOBH 3WS6C 5C9KA 3IT8D 2C7UB 4AMKH 5GS0D 3IFNL 5MEOA 3GSQB 3DARA 2DF3A 1F58L 4YHYB 4OFPA 4QXTB 3TIDB 4Y16C 1MRFH 3O2WL 1NMAH 2B20A 3DYPA 3MLTB 5B38G 3MV8E 1EEQA 4NM4H 3VXOA 2IQAB 1VPOL 5KVGH 1BQLH 2FYYA 5DS8B 3X3FH 5GIRB 4LQ1A 5D7IA 1J8HE 3PWPB 2IH1B 3QNZA 3CFBB 3TV3H 3UDWA 1TJGH 5H2BA 4NYLA 4R96B 3DGCR 4PJAA 2VWEE 2XY2A 1ZT1A 3P9MA 4JR9L 4Q9QL 1AO7B 3MLVL 3MRQB 3ELAT 4DOHB 3K4DA 2FBJH 1IGCH 2FHFA 1T0NB 1M71B 4HFUL 4XCYB 5FYKE 2FSEB 4JPWL 5I1IL 2F58H 1C5BH 1U3HB 2EXYC 1OCWH 1U42A 5DURB 5EORL 1IQWH 4KROC 4NIKB 1FPTH 4U05A 4YEEA 4U33A 3A6BL 4LLMA 3DUUB 4EDWH 5L8JB 5TE6L 1ZHKA 2BVEA 1VESA 3I9GL 3VFVA 4NRXB 5DJYB 3KPOB 3OX8B 1LNUB 2IQ9L 1TZGH 4L4VB 2IH3B 3RZWA 4LPYA 3ZTNL 1TZHB 3TIEA 3EJYC 3HC3L 4RMWA 2V5YA 3T77B 1QBML 3QCVL 2VXVL 3L3HA 5E4EB 5TGBB 2ATKB 2DOCA 4H5SA 3TH4T 1G1YA 5CJQL 5C7XL 4G7VH 5KVEL 3NFNB 5IF0B 4HULB 3MRCB 3EFFB 1A7QL 2GSIA 1HI6B 1NLBL 3IFNH 4OZGB 5CIPH 3BWAA 1F58H 2O5ZL 3DROA 3O2WH 3ARXA 4QHLB 3WJLA 2XG4A 3FQXB 3OKOA 1VPOH 4NQTA 1MFDL 4QCIA 5GS3A 3HHRB 1A7NL 4K3JL 2ATPA 3GSOB 4P2RD 4JR9H 1IM3B 1U95A 4N0UE 4XI5D 4Q9QH 3WDHA 3MLVH 1HH9A 5JZ7D 2VLME 2I9LA 4POUB 1CLZL 5DJ2A 1Z6JT 2J3SA 2P7TB 4HFUH 4P2RA 4JPWH 3RDTC 4AH2A 1AQKL 5I1IH 1MI5B 2Q1EA 3O3AA 1NUGA 1PEZA 4I18A 5EORH 3WXVL 5I0ZA 1U8NA 3A6BH 3TYGL 4QKXB 1J0IA 1SEBA 3QB7C 4K94L 2CLVB 1D9KD 5TE6H 2AKRB 4JQXC 4LLWB 5LJYH 3P4NA 3RWEA 2A2QT 3LS5L 3ARDB 4I8DA 1KACB 4GQPH 4JFFE 2IQ9H 3PABB 1I8LA 2ZWLT 1E6OL 3ARFC 4R2GB 2QEJA 1T0PB 4JFXA 3ZTNH 3G6AA 4KKBC 3HC3H 2ZUXA 4JHAL 1D9KA 4GXVL 3OR6B 4QRSB 5EBMB 5JW4R 1QBMH 4C4KT 3QCVH 2VXVH 5JIIA 1BOGB 1IE5A 2A83B 4W6YB 2NTFA 5CJQH 1MCSA 5C7XH 5JOPE 3C2AL 4YWGL 2CO6B 4K07A 4CU8A 5KVEH 1RI8A 2JCCE 2PW1B 1CWVA 3OKEB 3SBWA 5EIVA 5IB4B 2ADJB 3PWLA 1FVEA 4CVUA 2F74A 3H9SB 1A7QH 2E9IA 4OD3L 1NLBH 5BCAA 1EX0A 3BIAX 2O5ZH 4HBQA 1JGUL 4G9DB 4K3GA 5KS9B 3P9LA 4I0KA 1R3HB 3GMNB 3VRIA 4HWZB 5L0QB 4CN1A 1MFDH 3K8KA 3IFPB 1AD9B 1E4XL 4PRHB 4OF8A 4K3JH 3RWJB 1XCTB 4Z7QE 1MLCA 2EXWC 2YR3A 1YYML 3SKMB 5F9DC 3PWPE 2AW2A 4RCAA 3FFCA 4ISVA 1O7VA 1ZMYA 3EOBB 3V5KA 3OV6A 5C0CD 2BP3A 4X6FB 2EO1A 1ZT7B 4KDWA 4PRBB 1AO7E 1CLZH 3T2QA 2QHRH 1TTUA 1AQKH 2AEQL 4E41D 2WSKA 4XP1L 3WXVH 3WMSA 5J56B 1CIDA 1QP1A 3TYGH 5C0CA 3HRPA 3PGDB 3QEUA 4K94H 4OCXH 4NN7B 3O2DL 1JRHI 4X7EC 5DJ6A 3AM8A 3LS5H 3NGBC 3NIFF 5C70A 1QFPA 3KYOA 4E41A 3WHXA 1MPAL 4LHUG 1E6OH 1BHGA 3MLPA 4OZIE 5E4IA 5DMIL 3LEXB 4Z8FL 4JHAH 4L4VE 4GXVH 1FDLL 5J3HC 3BPOB 5CEYB 4NNXA 2M1KA 4LCUB 1P84J 2X1WL 4YHYC 3C2AH 4LLYA 4YWGH 2B4CL 1K2DB 3ISWA 5GS1A 3QRFM 2CDFB 2R2HA 3JV4B 3V6BR 4LMQE 3JWDL 4WHYH 4LLUB 1NDMB 1MH5A 5DZNA 5FOJA 5LXGL 3M17B 3VD7A 1MQKL 4PJ5D 3GHEL 5E1HB 1JGUH 3EOAA 4OZGE 4ZYKA 1IQDB 3OSKA 1LEIA 1JWMB 2Y72A 3RAJL 3VXMB 1ZVSB 4B50A 1E4XH 4PJ5A 3TBYA 5E6YA 5GGRA 1T6VN 1JK8A 1YYMH 1WCBA 2XI9A 4PYHA 5T1KB 1NANH 3FTGB 1U3HC 1KIQB 3MR9B 1I1YB 1QEWB 2PTTB 2W07A 3DVIA 1HQ4A 1M05A 5IG7A 3BUYB 2XRAL 2AEQH 2FJGB 4ETQA 5D72L 4XP1H 25C8H 5CHNB 1MI5E 3O2DH 4NKMA 4ONGL 5E56A 2RJMA 1PLGL 3L3IB 5E4EC 5CIPA 3WE6A 4G8FA 3AUVA 4JQVA 5IFJB 2FECL 3KGRA 3GMRB 1ZOXA 1MPAH 4QLRA 5DMIH 4LNRB 1P4IL 4Z8FH 4HIJA 1ES0A 4AEIL 2OQJA 1UM5H 3KPQA 4Y4HD 35C8L 4G6ML 1F6AA 5HGAA 2B4CH 3RL2B 5TQ2L 4GKNB 5DJXB 5F7DA 1F4YL 3FO1B 2D4DA 3JWDH 3T2PA 5LXGH 3B6SB 4Y4HA 5F97E 3B9KD 3T08A 3H9SE 3GHEH 2APBA 3RWCA 4S1DD 1T1XB 1IZKA 4GKSB 4Z76B 3PQYB 4JRXB 1BZ7A 1PYWA 3QPXL 3SPVB 3O2VL 4HIEA 4GAGL 3RAJH 1XFPA 5KS9E 1TNMA 3HCVB 3B9KA 2JB5L 1XF1A 1MOEA 1T83C 5FO9A 3L5IA 5DRWB 4PRHE 3O9WD 3T65B 4MA8L 1DUYB 4WRLA 5GSVB 3TO4B 5DDHB 2FX7H 3IDGB 3BO8A 1S7RB 4TSCL 1WZ1L 4BUHA 4KVCL 4MNGB 3OAYK 1NANI 3O9WA 1U58A 3ARDC 3BKML 2XRAH 4JDVB 3DUSA 3CDGB 5D72H 1EFQA 1Q0YL 1IC1A 5HYFA 1J05A 4PJIE 2HFEA 4FQIL 2IPUK 5DJ0B 4ZPTA