4GBXD

Crystal structure of an immune complex at ph 6.5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
191
structure length
191
Chain Sequence
FVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPSEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTDRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DM alpha chain
publication title Crystal Structure of the HLA-DM-HLA-DR1 Complex Defines Mechanisms for Rapid Peptide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gbxD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gbxD01
2BNRE 1YEJH 3RPIA 2FEDC 2FX8H 4YHLH 1UH2A 3WJJC 1INQB 4M62L 4TVPH 3Q3GB 4FQ2L 3GSNL 4IRSA 4GMSH 4KY1L 3MROB 2FBJL 3HTLX 4RIRB 4Z5RA 1N64L 2F8VA 3O4LB 2VR4A 3QCTL 2DYPB 3D2UA 1A6ZA 1P5UA 1AQDB 5F9OL 4RBPK 1FO0H 5TF1L 5F71A 3VXRD 3IJHB 4PRAA 4H26A 4X83A 3FB6B 3TZVD 4NNXA 1PZ5A 3VE0B 4LSVL 4LGSB 3VFNA 1J8HE 1I7RB 2X09A 5F7KC 1B90A 3EGSB 4ISVB 5FHAH 2HT2C 2BP3A 2H6PB 4GLRI 5C09A 2GI7A 3LKOB 3HR6A 3MRMA 4PRHA 5M94B 4IOFC 3ARPA 3GB7B 1AC6A 3BYTA 3JV4B 1AGCB 4HIJA 4IRSD 2JJSC 2XWTA 2QR0A 2VDRL 2DQTH 5AG8A 5DRWB 4F80A 4YHMH 5HHQB 3HZKA 1NBZB 2AXJA 2IGFL 1WZKA 2HFEA 4HDIB 2H1PH 3D2UD 5DDHB 2VKXA 5BRZD 3C60B 4OKVB 3ELAT 4L8BA 3F7YA 2VYRE 3EDEA 5GS1B 3MLSL 2IPTH 5BV7L 4JRYA 4GG6B 3MACH 3SKNA 3P77B 5JHDD 4OCWH 3LKPA 4NFBA 2CKBL 2COQA 3WS6C 3RX7A 3ARGD 4TSCL 4JREC 5C09D 3DUSB 1U3YA 1RPQA 1JRHH 2J3SA 4PRHD 5FAAA 4Z7WF 4BQ6A 3E6FA 5T3XH 3QUXB 3V5HB 3VFVB 4XBGB 2ORBH 1LWRA 5HHMB 4YHPB 1YC8A 3QEGL 4OSUH 1LO5A 3WNKA 2IFFL 1WEJL 4TSBH 2BCKB 3EO9L 8FABB 5EO9A 4GO6B 1A6WL 2DI9A 3H7BB 3PWPE 4AEHL 4HUVB 5B3JE 1NCNA 5D1QC 2C4XA 3CDFA 5D7IB 4LLDB 4N8VB 4GBXC 1YEHH 5DRNB 4GMTL 2P5EB 5AUMA 5SV4A 1CS6A 2Z92A 1W72A 5B21A 3REWA 4CN1A 4TVSa 2AJSL 1FORL 3BIKA 2ESVD 3ARRA 4R2GB 3LPFA 3I6GA 4AT6B 3U9PL 3H9SA 4LCUA 4M7ZB 5DJYB 4F58H 4WW2F 1A4KB 1IM9B 4MX7A 1TJHH 1OTTC 4ETQB 3DNKA 1T03L 1Q72L 4Y19E 3STZB 4EQ2A 4OZGA 5F8RC 2W59A 3A6CL 5F7LB 1YYLL 1MJ8L 4BA8A 3QI9D 5DR5L 1R5WB 2NY2C 4UOJA 5HVWA 3GMQB 4X6DB 4QGTA 2XKNA 3IDJA 5D1ZD 4KUZH 4H0IA 2XZAH 1GAFL 2FECL 1WIPA 3GSRA 3U0TB 5L9DH 1BOYA 3WJLA 1MHHA 3P4MB 3U4EB 5BOPA 3KYAA 4Y2OA 4WFFE 3L3JA 1KPUB 1MCOH 1NCWL 3VXPA 4RGNE 5C6PB 2UZIL 3MGTA 4KKAD 3H9SD 5IMOB 4MJIE 1Z0NA 1NEUA 2IADB 4MZ2A 3TCLA 4I0PB 2DQHL 5I1GL 5HHPB 4GKNA 4WWKD 4R4FH 1N2RB 1J1OL 3SGEI 4D3CH 4LLUB 4PY8J 3WD5H 3UTQB 1BD2E 4EVNA 5C0JA 4ZO6A 3WFCL 4LU5H 2A6DA 3CLFH 4D0DA 3ILPA 4PJIE 4HT1L 12E8H 1UH4A 5TGBA 2AGJL 3KPNA 4LGRB 4S11A 1XEDA 5KAQG 1J88A 3QFDB 2F54E 2P5WD 5BMFL 5CEZL 4Z77A 3B9AA 5ANMB 1I7UA 2V2TA 5I2IB 4HG4J 1HI6B 1JGVL 1I9EA 4RZCA 1JUFB 2ZUWA 2LTQC 4JY6A 1GRWA 2APVA 4G7VL 2DDQL 4AEIH 2ICWI 3FJTA 2DQGH 4WO4B 1U8JA 1G7PA 3I9GH 3O45A 3BKCL 1EGJL 2AJXL 4XCYB 4OZHE 2GJ6B 3PWVA 4M61A 1JZ3A 2DJ4A 4Z7UA 2UWEB 1MCJA 5E99L 3V7MA 4U0QB 5ENWB 3MLTA 1SJVA 1DUZA 4CBPA 1MVUA 2H2SD 4NQED 5I30H 3KGRA 2OR7A 5J6GB 1I3GH 1MJ7L 3LN5A 2Y06L 1RIHH 1EPFA 5GHWH 3L3KB 2XNAB 3FN0L 3H9HB 2Q3AA 1ZEAH 5EORL 4L8SC 2Q20A 4MLIA 4AL8L 5HDQH 1VFAA 1R0AH 2HWZH 1R3HA 3GSXA 5IB5A 3MV7B 3W0WD 3GMPA 3UTTB 1TVHA 4RGOH 4G42B 4JG1H 3W81A 3VXRE 2AXGB 5EUOE 1GGCL 2ZOLB 3QIBA 3W11D 4MA7H 5EB9A 5C1MB 3WXVH 3BEWA 1BQHB 5IBLD 3REVB 4XMLL 5CJBA 2V7HB 4GG6F 5EBMB 4XXCA 4F9PC 1U6AL 4GAFB 2RBLA 4U7KA 1OSZA 4MHHI 4P4KB 1YECL 1OSPH 1G9MH 5F93C 4PG9A 1EAPB 3VFWB 2AJUL 5A40E 4X7TA 1X5ZA 4N8VG 2V17L 4OM1H 4LLWB 3JVGC 1IM3B 5ACZA 3LN9A 1F90H 1UJTA 3ZKXB 1QR1B 1DUYA 2W0FA 3G9VA 1FNSH 3ARTA 1CGSH 5FDYA 1BOGB 4MVBD 1JPGA 1EFQA 2XRAL 2FIRT 4PD4J 3SE4C 5ESVA 5LQBL 3L7FB 1RK1B 5ERWB 1CGTA 1K5NA 3MPCA 4P4RB 5BS0B 2WBJB 2BVPA 3TFKD 2E3VA 3WNNA 3S34L 5D7IF 2VZ1A 2NY7L 2BOCB 4FQLL 1QNZH 5HHXH 2AK4A 1ZT4B 2IALB 5FCSH 1XCQA 2WP3O 2VE6A 2IH3B 4CU8A 3EYSL 3CSGA 5D7JC 2LE9A 1RUQH 3DX6B 3E1F1 3T09A 4ZUSB 2OK0H 3WUWA 3B9KB 5GGTH 1HILB 4UQ3A 3UPCA 1PYWB 3G6AA 1FG2A 5D6CB 1HQ4B 3PABB 1RZFH 2L7JA 4O2FA 4D9RE 4OCYL 1AQKH 3MLXL 4Y16A 1EJOH 3BO8B 4JRYE 5I6XB 4J4PD 4U31A 3GBMH 1TQBC 1JTOA 4F7PB 3MOBH 2APFA 1BZ9B 5B38B 1FNGB 1JPTH 5DLMH 5I15L 2W9DL 4X6DF 2QHLA 1I4FB 2GK0B 3F12B 2BHZA 4WW2C 3V52L 4FXGA 3L1OL 2NMSA 4EUPB 1XGUB 2NX5B 4FQJL 4JY4B 3QXAB 3H0TA 1MRDL 2H26B 3BZEA 4YDVB 1YQVL 4OTXH 1H3PH 1Z5LA 3C2AH 1RFDL 2VDPL 1AGFB 4R9HA 3TN0B 2YUVA 5AWNH 4MNGA 1AKJA 4H8WH 4NSKB 3OJDA 1N8ZB 1ZE3C 4QT5B 4JKKA 4PLNC 5GS0C 3CX5K 3A6BL 5B8CA 1R5VA 4XCEB 1E6OH 1NUFA 3IDNA 1P4BH 5KVEH 5DK0B 5E5UB 1ZSDB 1V3KA 1OTSC 3VFGL 2G75A 5JOFB 4P9ML 4HBQA 3OKNA 3QQ3A 5LBSL 3GHEH 1GGIH 1X5FA 5BW7A 4HCRH 4OQTH 1P84K 2OTWB 1E0OB 3T0WA 5I71C 3NBNA 1NCAL 1T1YB 1QYGL 3MJ7A 1YNTB 2H32A 2CIIA 1T21B 5H94B 4MD4B 4LNRB 4QHUB 2X4NB 5B22A 3MLYL 5HGHA 1OHQA 2EXYD 1NGQH 1NUDA 4M6NL 2UWEF 1T83A 4OZGE 1MFBH 3TBTA 1AKJD 1KENL 3QAZB 4ZUVA 2D03L 1RZJH 3ME0A 4N8PA 2ATPA 3OKLA 4MJ6B 2C3VB 2WWMC 5E2WL 4JKMA 2ZCLH 5T5FL 4HX1A 4K3HA 2EO1A 4L3CB 5DUMH 4UT9L 3U82B 3CNKA 1QLRA 2GTWA 3BOVA 4WNQB 1CFNB 1JVKA 4OLWH 4JKWA 3DO7A 2ADIA 1BFOA 1JWSA 3NACH 4Q6IB 1IBGL 5IEKA 1ZTXH 3EJJX 4HQQL 1ZLUK 4U6YB 2F19L 2I9LA 1YN7A 2X4PA 5HD8C 2NQCA 3K8MA 1QFWM 4C54A 1VCAA 2GSIB 1BJ1J 4YE4L 2BRQA 2VAAA 1BPVA 1YEEL 3AY4C 3T3MF 5IMLB 5JQHC 4NJAH 4RMTA 1HH6B 4ONGH 5GRUL 1KN2L 1P4LB 1WFUA 5CJOH 1U0QA 4CADA 4FP8L 5DMGD 1JNHA 2NLJA 3VI3E 3V8CA 5E6YA 4AIOA 3MRQB 1MFAH 2VXUH 4OFDA 1MRFL 4JFEA 4XP6H 3MO1B 4XCNB 3I3DA 1BBJA 3C60C 4C83B 2HVKA 1LILA 3INUH 1MQKH 3D39B 3FKUS 4OGYL 4H0HB 5HYJE 1NSNL 1EV2E 3L5WB 4G6MH 4U6TA 3FOMB 2BVOA 4P3DA 4K7PH 4U1GB 2EYSB 2CXKA 1U93A 3PIQA 4Z7UE 4ZDHB 3HHRB 3BWUC 4UT7H 3HC3L 4HUWA 5FYJU 1GIGL 4HFWA 5GQBA 2F58L 5TDNB 1EBAA 2W0LA 2WNGA 1GGBH 5I76A 2A0LC 5AYUH 3JBG7 3QUXC 1UM5H 3WUZA 5GRYA 4FN0A 5CGYC 1I1AB 3RAJH 4MJ5B 2HLFD 3FB5B 2YPVL 4Y4HD 4S10A 2ZUVA 3HZMB 5TJWK 4JFYA 5JA9A 4OB5L 3S37X 3E3QE 3HE7A 4JAMA 4PJFF 5EA0H 1IILE 1NBQA 4PREB 5F9WB 5F9JB 1FLRL 1YEGH 4L4TB 3QJFB 2Z91B 3T77B 4YHKH 3X12B 1XGRA 1U8NA 3BD4A 2UV3A 5HVFB 1CBVL 4M6OL 1P9MC 2CRMA 3FQUB 1JTPA 3WHXB 2UVFA 4RAHA 3HKFA 4R2GC 5DMIH 3QWQB 3O9WB 3ZE0F 3KPMB 2VC2H 3LHPL 1K4CA 1NL0H 4L4VA 4AK1A 3OB0H 4ENED 1OAXH 3AM8C 4M7ZC 1MEXH 5DMKA 1N6QH 4HF5H 4U1JA 5KVGH 4JRXA 2VXTL 3W9DA 1DN0B 1UWXK 3BP5A 4RMUA 1Y18A 2HFFB 3QNZA 1UC6A 3M45A 5D72H 2IJ0C 5FOJA 3P4NB 4X5WB 5GGQL 1FL6A 3DMMD 1QP1A 3QUYA 2VUYA 4GKSA 1T3FB 4YPGB 4XB7A 2VDLL 1QPXA 1URLA 1MNUL 2XKSA 4FFZL 2Q8BL 1HYSC 5ISZB 4LBEA 2AK4E 4I0PC 4I5BA 4Y4KD 4LRIC 2NXYD 5DQ9B 4DN4L 1J18A 5BO1H 5I17B 1YUHA 4XNZB 3QCVL 5T3XE 4Y5YB 2F53D 4IMKC 3HMXL 2W1NA 3CFKB 2R4SH 5JLZA 3LIZL 4GT7A 3SGDH 2MJWA 3KYOA 4JFXA 2AJZB 2GSGA 3CFJB 4AJ0A 3R1GL 4CVUA 1FZOA 4KQ3L 5FGCB 3FRPA 2V6HA 4PRBB 3QPXH 4ODHH 1LGVA 1S7SA 2ADGB 4FQXA 3RQ3A 4LSUH 1I9RH 3PXJA 1S9XB 1NCBH 4NYLA 1HIMH 1S5IL 5DD6B 1T7ZA 4LEOA 2D3VA 1IFHH 4NZDA 2YD3A 3RWHA 4YBLB 4GG8A 2EDOA 5F89B 1YY8B 4NO5B 3D1MC 4MA3B 3RNQB 5IVXB 1YDPA 4BYHA 3C6LC 3V0WH 1HXYB 3QHFH 2R29L 5DUPH 1N59B 1F00I 1OAQH 4U4BA 4ODUA 4MNGE 3QRGL 3ESUF 3NH7H 1IGML 4L29A 5CSZB 5DI8B 1VPOH 5GGRA 2E9WA 4APQA 5EBWA 5JIHA 2QL1A 4O58L 2YPKA 2J4WH 4FQXD 2B5IB 4I4WA 4G9FB 2ZUTA 4JHBA 4MB3A 5DD1L 5IGXH 4MQXD 4IMLA 5K9KB 3QQ4B 4PJEA 5I66A 4GS7B 4X0KB 4WRLA 2I07B 2F5AH 3OXRB 1MI5A 4P46B 1ZHLA 1VERA 2FWOA 1TJGH 2BDNL 4XAWH 5HI4D 5I19L 1IC4H 1YEKL 4MXQC 5GS3A 2EEDA 3CFIC 1FIGH 4G8GA 4KZEH 1ZT1A 1FP5A 4P4KC 3IXTA 2VDKH 1CD1A 2IG2L 1IAIL 1R3LA 1S7UB 1BX2B 3VFMA 2JJTC 1D5XA 1HEZA 1OF2A 5FHBL 1VENA 2ICEB 4NIKB 4D94A 1F58H 1Q9KB 2QSCL 2NPLX 4JGMA 2VL5A 3ZKXC 2P8LB 3IXAB 5BJTA 1OD7A 1G7JB 5E8PB 2HTLC 3LDBB 1FL5A 1WWBX 1IEAB 4XCCH 1UYWL 3M07A 5GISH 1FHGA 4OCRH 3WN5A 4X98A 4PJDA 1GZPA 4PGBA 2HJLB 3BDXA 3PUCA 2OL3A 2VQ1A 3LSOB 2NR6C 5KANG 1NBYB 3AAZA 2VWEC 4L8DB 3SGJC 3G5YA 3HNVL 4PJBA 4G8GD 3S96A 3LS4H 4D0BB 4F7EB 4Z0BH 3CCHB 3SOBH 3NZHL 5E2UL 3CH1B 3CUPB 4S1QH 1QSEA 1RMFL 2ICWB 1UZ8A 3B9KC 1H3WM 4Y89A 5GPRA 1T5XB 1UCBL 4LSTL 1MH5A 4JFEE 3FB7A 1E4XH 3U46A 4Z7OE 3D85B 4NCC2 4TTDC 3PHSA 5I6XC 3BKYH 3FFCA 3G6JA 3VXQA 5D93B 3DUUB 4AH2B 3WL9B 2AP2A 4C58B 3IKKA 4K8RD 1TTFA 5ITFA 1KTDB 5FB8A 1VGKB 2A6IA 3QUMB 1C5CH 1NLBL 2NY5L 1PVHA 5C0BB 2V5MA 3WIIH 4TULH 4Y5XA 5BVPL 5GZNC 5IK3A 3RX5A 4UT6H 2K7PA 5JW3L 3H6JA 3FCTB 4GSDH 4YHNB 1MVFA 4TUOB 1OGAD 2YD2A 1S9VB 2Y9RT 4CKVX 4OI7A 4JJ5B 2HT3D 1JV5A 2AXHA 4UV7H 1DLFL 1FLTX 3F6IA 2RFXA 2XFXA 2D7TH 3TN0C 1QSFB 2O5YH 3CSPA 1MPAL 5IMKB 4HSQA 4E42B 4XNQA 5I8KH 5F96L 1QRKA 2QSQA 5EU5B 1RULH 4WI5A 1A21A 1UM6L 5FA3B 3VXTB 2PO6B 3FFCD 3X14A 1FNFA 4ODTH 4F8QA 1WCBA 4BFGA 1A2YB 3FQNA 2EDEA 4HFUL 4QHMA 4LKCB 2HN7A 2APTA 1XGQA 4Q9QL 1CK0L 2P46B 3BH9B 3LMJH 3FO9B 1TZIA 4HK3N 5CBEA 4GRLD 4P2RD 3TT3H 3GSQA 3ZL4H 3F62A 1W8NA 1FJ1B 1UT9A 1WT5A 1JNLL 2P43B 4ZS6C 4L4VE 2WV3A 4NCC1 4Y5VB 1FC1A 4WENB 1WAAE 3PQYA 5KSAA 1QBMH 4JRXE 3LN4A 4S1DD 1BVLA 1GC1L 3ARFD 1AE6H 5GRXG 3SDXA 4UV4L 5DJ0B 4OCSL 1KYOJ 3QAZC 3T4AB 3OPZL 5IVXF 1O5DT 4G3YH 1A6PA 5HYQA 1JWMA 5EZJA 4JQIL 4QNPE 3VFSA 7FABL 3SE8H 3BPCB 3O3AB 3ARWA 5IB3A 4XP1H 1OPGL 3V6ZA 1EEUA 1EFXA 5I1HH 4KMTH 1EEYA 4M00A 4I3SH 4FQQA 1HH9A 4G8EA 3MYJB 3P3YA 1QQDA 3C2SA 4HG4K 1F8TH 1S7XB 4G5ZL 3UAJC 4Q6IC 1L6ZA 2G9HA 1I7TA 1D3CA 1PSKL 3RL2A 3S36L 1U91B 2YEZA 1T1ZB 1F3DH 3MV11 3QXUA 3LRSB 4G8FA 4XNXL 5JUEH 1VACB 5C2UB 3K4DA 2BXYA 5JW4N 4WEMB 1NDGB 2WIIA 1IL1A 4UUJA 1NCCL 2A74A 3HG1B 4NKDA 4GXVH 5HGAA 3OF6A 1JIBA 1GPOH 3RWJB 2XTJD 1IAKA 2MMXA 4PB0H 3X11B 1M7DB 2DLTA 1KFAL 1XF2A 4P23A 2EDWA 3AC0A 4IS6B 3QEQD 5IBTL 3TNNA 5DQJA 2YXMA 4MNHB 4FABL 5IESL 4ALAH 2A9NL 1EVTC 4J1UB 4GAGH 4PGCA 2AJVH 1HINL 4KRMB 1INDL 4U1GC 4F33A 4QOKB 3DX7A 3GK8L 3CXHJ 4NO3A 4TRPL 2OXHA 4LLYA 2GT9A 4U6VL 4QTIH 4MA8L 2Y4SA 1T66D 3JWOL 5ESAA 1MCRA 3EYVA 1JRHI 1J12A 2DD8H 1LO4L 3O2WH 3DGGB 1I1AC 1VEMA 3BAEH 3EDFA 2DQIH 5EOTB 3UTSB 2R2HA 4ZSOA 3S3SA 4KUCD 3OB8A 3TM6A 1OARH 2R0ZH 3RGVA 4NUGL 2VDML 3AXLB 4NP4H 2E9JA 3X3FH 3DECA 3VGBA 5K59E 2M2DA 3VRJA 1HHKA 3UBXA 4LRNH 5F9WC 2K1MA 2EIDA 1ETZA 5HGBB 4C57C 3IKCA 5SWSA 3ROOB 5IG7A 5DYOB 3MYZA 3TH4T 4PJEE 4WFGD 4XH2B 3VI4E 3C5SA 3RVVD 3U7WL 1MI5E 4MJ4A 4HC1L 1FE8L 4PD4K 2FHCA 3PP3K 2Y07H 3VFTA 5E1AB 3WFZA 5F1NA 3Q5YA 3DURB 3O9WC 4QWWD 3FT2A 1HHJB 3VD9A 3O3DB 1DR9A 4JE4B 1TTUA 1OGTB 4FQCL 2PTUA 2JCCB 4XCFL 4KJYB 2DWDA 5L6YH 2QQKL 3RVTC 5IUSA 4LMQE 2CIKA 4ZAKB 4U1SA 4X6BA 1JZ5A 1MAMH 1AY1H 1RJLB 4S0TD 4IBLT 1I1YA 4G6JH 4NQCB 3IJYB 4PJDE 1LP9A 2CDGA 3PWLA 4MCZA 4EI5B 3V7AG 4P2YA 4LVOC 2DQUL 3HS0B 4LCWA 5FUZH 5I1IL 1E6JL 43CAA 4M5ZL 4PJXB 4U7MA 2WWKO 3PG2A 2H2PC 3QFJB 2FH8A 4XVUC 1M05A 1N7ML 3TBWB 1JZ4A 5KSVA 5CEYA 4IDLA 1F2XK 3VXOA 3PNWA 3W2DL 1Z6JT 4GXUN 2NW2A 1ZLSL 5JW4Q 3U6RB 5CHNA 4P2QA 3TO4A 5IW1B 2FLBT 4XNZC 2X9YA 1FFNA 2R0WL 4AQ1B 5HPMB 1FZMA 1QSEE 3G5VA 3U30B 4Y5YC 4EDWL 3U2SA 2QADD 4IIQB 5HHVL 2VDNL 1GHFH 4DJMA 3WDHA 1WIOA 4PB9L 1RIVL 2J8UA 1ORSA 2V9RA 3C5ZD 4JFQA 4PV8B 4Q0XL 5MENB 4WEBL 4DVRH 2PYEB 3CC5B 1MRCH 2XYCA 1OP5K 3B9EA 1IGTA 1ADQL 1RK0B 3P73A 4M1CD 5B3NA 3PL6B 3WJJA 1V3MA 3FOLA 4LCWD 3T1FB 3T0EA 1R3JB 2GCYA 2OLDA 3EFDH 4JFOA 1ZLVK 1MAJA 2WIMA 5IKCB 5HHOA 5MERA 4K23L 4HLZG 4G6AD 5I0DA 5IB1A 1TIUA 1U92B 1VEOA 3EYFB 5C8JB 1RU9L 4P2QD 3BZFA 3MMEB 2B0SH 1QVOA 5FXCH 4F8TA 4P2CG 4Z95H 1LO0H 4EOWH 3ALPA 2PW2A 3C9NA 4YBLC 1ZVSB 4F7TA 2ZKHL 4WCYL 1K8IA 3FQRB 1IGFL 4OGAC 2NY1D 4M7LL 1QO3B 5IEHA 1KBGH 1CFVH 2A6KB 4NQXA 4TNVF 2FZ3B 3HLAB 5IP4A 4NKOA 3T0ED 2WUBL 4Z0XA 2BRRH 1EJ6A 3BUYA 1D9KB 1KB5L 2JJSA 1DVFB 1T7YA 1V7NL 1KCSL 1DQLL 2B5IC 3ROLA 1A6AA 4HS3A 5E56A 5FGBC 5DHXB 1MY7A 3HZVB 1NMBL 3QG6A 1SM3L 5HHNA 4X7SH 1A7OH 3D0LA 4P9HC 4NJ9L 4HW6A 3JWDH 4GS7C 2EC9T 2VZUA 5A2JH 5SWQB 4PGZA 1K8DA 4FMFA 1BLNB 4P46C 3F58H 2CLZA 5I1EH 2FB4L 4HKZA 2R0KL 5AD0B 4Z7QE 3VGAB 1AFVL 3C8KB 1A1MA 3PQYE 4F7MA 1KLUA 3RIFF 1JE6A 4HGMA 3QDGA 2IAMD 3WS6A 3RVUC 3SDXE 1OP3K 4HUXB 1A02N 1WQVT 2AEQL 4GUPA 2Q7NA 1F3JB 4NBXB 4YDKL 3CLEL 4ODVH 2P8PB 2RHEA 2XTJE 3DLQR 3WDIA 1LDPL 4ZNCD 1VFUA 2GKIA 3QIUD 4LHUD 4UBDD 3LDBC 3PGCA 3MGAA 5FGRA 1NFDB 1XF5A 1AD0A 4GKZA 4LVEA 3EHBC 5GRJH 2DTML 3DRTA 1CIDA 4OGXL 4DN3H 3WS3B 2PF6A 2D9CA 1T20B 3EUUA 4X5XB 3D87B 3SDAB 3TEUA 5ILTH 5ADPL 4GW4A 4YBQD 3SY0A 3MCKB 4WTZG 1IARB 3LZFL 3HI6L 2HFTA 2B2XH 5A16A 5KSUB 4N0CD 3EFFA 2EDFA 3LRGA 3M1BA 1L7TH 5HDLA 4GBXA 5JA8B 1I8IB 1R6VA 1SJEB 1MFEH 4YHIB 5C08A 1FAIL 3I85A 2DM3A 4N0YL 3UC0L 3UJJL 1JWUA 1I8LC 2KPNA 3MBXL 1YQ2A 1U58A 2XQBL 2DN7A 3AMLA 5CAYB 2VISB 3LOWA 4KZDH 5TQ0H 4MD5B 5B3JF 2JCCF 5GSRA 3EJYC 4KRPD 3GKWL 4PJ5B 4XXDA 2BFVL 1TJIL 5D93C 5C71A 5GS0H 4K7FB 4L1DA 2R23B 5HTSA 4RFNB 1G7HB 1HDMB 1FCGA 1EBPA 1BZ7B 1UACH 5T33H 5B4MC 1HHIA 3ABZA 4XPBL 4YIQA 5DA0B 4DVBB 1H0DB 4GRMA 3CD4A 5C08D 4PJXF 3STBA 2YSSA 3PWUB 3QDHA 1UEYA 3S37H 4TOYH 4HJJL 4EBQL 1W0YT 1CFTA 4KK6D 1XR8B 3ULVE 4MQ7A 2C1OB 5ACLA 5IHZB 4GQ9L 1A3RL 4AMKH 3B4NA 5FK9A 4QHLA 3VXUB 3VFRA 5DJ8A 3ES6B 1CU4H 2X05A 3BDBA 1G6RB 5IR1B 1DANU 3S88H 3U48A 5IFAH 2G2RA 5E5RB 4EI6B 1ZT7A 2PO6C 5EFIB 4LARH 5SWSE 3F7QA 1NGZB 2NY2D 3VFOA 4Y4FA 4UTAH 5DEGA 1U3JA 3RTQC 3CGTA 4P5KA 1BWWA 5A2KH 1LEIB 1EHLL 5JZ7C 2EH7L 5HPOA 5TE7L 1IAMA 1BF8A 3LKNB 3GMLA 4ODXB 3X13B 4BZ2H 3C09B 5DJDB 3IU3A 4XNUL 1Z0MA 4Y5VC 4NOFA 2GK2A 3LKSA 1DEEA 4AM0B 5C3LD 5JPNA 4PJIF 4DCQA 2FD6H 1XF3A 5D1XB 2CRZA 3DVGA 2FGWL 2YPLA 5D2NB 4QYOB 3VMNA 2C3HA 1Q1JL 3OQ3B 7CGTA 4JM2B 5EWIL 1JK8A 2EH8H 4LF3B 1OTUC 3KYKH 1E4WL 5LXGL 5J1SC 3GRWH 1A7QL 2IQAB 1AO7A 4NQVB 5CZXC 1W0WA 3UYRH 2R8SL 4AY0A 4NQDB 4HJ0D 5GSVB 3QA3A 4Y4FD 1LP9E 1S8DB 1SBSL 1WV7T 5C0AB 3V5DB 1G6VK 1RZKL 4LCWE 3MLUL 5EU3B 3VA6A 4HHAA 1Y6NR 2K3TA 4L8SA 3VRLF 2ZSWB 3WLBB 5AYQA 1UCTA 1J0ZA 5I1JH 5IT2H 3T0XA 5DJ6A 1A5FH 1N0XL 4CNIA 4XHJD 1A47A 1FGVH 3M17A 3BVNB 3IJSB 4NO2B 2YPLD 3ZKND 3AREB 3HC4L 1FV1B 2VZTA 5FYKL 1CICD 4HWEH 4MAYB 5EBLA 1XH3B 3RWFA 3MODH 1EH9A 4R4NC 4F9PA 6FABH 2J8UE 4LMQI 1FYTD 5ETUB 1M71A 3X3GL 2CD0A 1IAIM 1UB5B 4YH6A 3S3JA 3PP4L 5KG9B 3QDJA 3MA7A 4PBVC 5F7MC 5HHOE 3JVGA 2EIZA 4QXWA 3MRCA 1KJ3H 4JANB 3OR7A 5K9OB 2VLJD 3RHWK 1T0NA 4P5TD 4M43L 4UTBH 1AGDB 4LIQH 1NFDF 4H88L 2X89A 3C5JB 4OZ4B 3HFML 5KN5B 1G7QB 4P2OD 5J06A 5EIIA 5EPMA 3SE4A 4JB9H 4KPHL 3T65B 1NUGA 3UO1H 2D9QB 1DLHA 4OIAA 1KCVL 4WU5A 4Z7WA 4HWBH 1YNLH 1PG7H 1HHHB 5HYJB 5FKAA 4PY7A 1BGXH 4XX1E 1PEZA 4DGYH 4OCLC 4F9LC 5D7JA 1EHXA 1ZWIB 4YDJB 3O6ML 1S7WA 1B0RB 2NXZB 3C6SA 4GH7B 3THMH 1HHGA 2EE3A 1JZ6A 1QPPA 5MEQA 2Q8AL 2X89D 4Q7DA 1IT9H 3IDXL 4XPFH 5T1KB 3HR5A 1T04A 4KQ4H 3BISA 4HUUA 3GI9L 1RUAL 2XN9A 2HRPH 1HOCA 3PWNB 1ES0B 1D7FA 3IAGC 1X9QA 3QDGE 3RVXD 4U6HA 1VADA 4DGIL 4PR5A 3LQAL 4WW2A 3PXHA 4XRCA 2P24A 1KEMH 4FS0A 3OAUH 1MJUH 4GW1A 3RL1B 5I1CH 5IFHH 1SYVB 4KDVA 5D7JD 1D5IL 3HI5L 1E28A 4MNQD 4JFPB 2NY0D 4PGDB 3L3OA 4A6YL 4XC1H 5D7LB 5DWUL 1T4KB 4GRWH 2CJUL 1F3DJ 4EI5C 1SY6H 4JQVC 4KKLC 1M6OB 3I02B 3QIWD 2ZUXA 1KUMA 2YZ1A 5GJTH 4S1SH 1W8OA 3MXWL 4CMMB 2QSTA 3GJEA 3VWJD 5B39A 5GGSB 4XVTH 3KR3H 4MSWA 4GFTB 1NAKL 1SEBA 1ZK9A 1PLGH 4DTGH 1NAMA 2DTSA 3CVIL 4R3SB 1G7LB 1IEHA 4AEFA 2PKDA 4HKJB 1PX4A 1WC7B 4DZ8A 4XPAL 4IIQC 4OLZL 5EC2B 5GJSL 1FFPB 4I13B 3NGBC 4X7EC 3PV7A 4MCYB 5ACMA 1WK0A 3DX9B 5KZCD 1R3IL 4G7YL 3SGDI 3MBEB 5FECB 4TUKH 4XMKH 4PJ7B 1INQA 3DO3A 4JM2F 3WO3B 2E7HA 1DQDL 5D71L 4S1RH 3ZTNH 3VXMB 3NVQA 4CW1B 3MROA 4HKBB 1B9ZA 2CMRH 3BMWA 3O4LA 2PTTB 2DYPA 1OTSD 4JG0L 1AQDA 3MRKB 3KNBB 1HCVA 4ZFGL 3WHE1 3IJHA 1K4DB 3NAAH 1MHEB 4UIKH 2EDYA 2KQNA 3FB6A 3WIHL 1KJ2B 3NCMA 3WKML 1K3IA 3GSOA 4QXGH 1S9YB 5E8EA 4GKOA 1I7RA 4KAQH 2OSLB 4IHOB 2Z4QB 1G0DA 3EGSA 4ISVA 3VW3L 2H6PA 1S78D 3LKOA 4M7JL 2HH0L 3GB7A 3D3VD 1CXHA 1AGCA 3SKJL 1FNAA 1KYOK 1DVFC 5J1TC 4PLKD 3V6FB 2BZDA 4QRQB 3B5GA 1KELL 5DC9B 3CVHH 2J88H 1J5OL 2Z35B 4HDIA 3ETBF 1ZLWH 5DDHA 4EZMA 1QSVA 4K8RH 3CFCH 3DSFL 3C60A 3MX0A 4OKVA 3T2NH 3G6DL 2LV4A 4HXBH 5GS1A 1S7TB 3TC9A 3QWRD 3VGAC 4GG6A 3P77A 5T3ZE 1MWAB 4XPHH 3IYLW 4I2XE 5FUCC 1DQML 2YPLE 1WSST 1WICA 3MUGB 4ORGB 3DUSA 3WFHA 2HJFB 3B2VL 1HK6A 3VGEA 4BZ1L 5HGDB 5HI3D 5E6ZA 1AO7E 3QUXA 4UB0L 3V5HA 4WY7L 3VFVA 3BPLB 4WV1B 1BVKB 1MCHA 1IQWH 5D4QA 4LVNB 2M26A 4MDJB 1RUKL 5J8OA 4DW2H 2BCKA 8FABA 1OL0A 4JKPH 3QRFM 1FC2D 3H7BA 2HKHL 3SDAC 4HUVA 4OT1H 4HWUA 3V0VA 2XA8L 2V7NB 5T1LD 5D7IA 2B1HH 4LLDA 4N8VA 5L2KB 2DBLL 5DRNA 1GXEA 1C1EL 2X4QB 2P5EA 3BP6B 1P1ZB 3CXHK 4ONHB 3O3BB 3QHTC 4I9WE 1P9MA 2W65B 1B0GB 2VRAA 3IETB 4MLSA 5MHSD 3QUXD 1UH3A 2CK0H 5I16A 4AT6A 5DMJB 1LEKB 4OD3H 3AM8A 5DJYA 2CR6A 5HHMD 1FZJB 1J11A 2ZUQB 4TPRL 3NCJL 1A4KA 2D0GA 1IM9A 3QDJE 4ETQA 5ID0B 2W92A 4X4YB 1ZGLM 1QKZH 2GIYA 3STZA 1CGYA 1DL7L 4KK5D 2AQ1A 5FA4B 1JZ7A 5I8CB 2W38A 1R5WA 3IU4H 3EO1B 3GMQA 1QG3A 3SPVB 4OIBA 4X6DA 4U1NB 4V1DE 1B4JL 4H5SB 2OP4H 2P5ED 4J6RL 4BH8A 4Z7WE 4BM7A 3LEYH 3U7YH 4QHNB 4PS4H 5IMMB 1FN4B 4NWUH 3ARXA 4MMZC 1KPUA 5CZKA 2WMPA 4X9BA 5IMOA 1JZ2A 2IADA 4XTRC 4I0PA 4L5FH 5HHPA 2IMNA 5GS2D 1N2RA 3WXWL 5JORB 3Q5OA 4LLUA 4N1EA 3L7EB 3UTQA 1DBKH 4K07A 4QXUH 1MFNA 3I84A 2AK1H 4HWNA 2FEEL 3RBSA 5J57B 5E8OB 4UIMB 2XKUA 1JJUA 4QCIA 3QFDA 1BM3L 4W6WB 1X4XA 4NQUA 1PQZB 5ANMA 5HI5C 5I2IA 1SY6A 1HI6A 3N85L 2VSDA 4PJ7F 2VB5A 1JUFA 4KROB 1S7QB 4M62H 2XN9E 4FA8A 1PFCA 4CVWA 3C09C 4KY1H 1CDIA 4WO4A 4HIIB 3SDDB 4ONFL 3IDMB 3ZSSA 3N9GL 1IJ9A 1N64H 4FQIL 1D5MB 4XCYA 4NGHL 3QCTH 3GI8L 5L0QB 5D1XC 3RZCA 5D2NC 5F9OH 1WUNT 1ED3B 4F3FB 2UWEA 2LU7A 1M1SA 1N5AB 5ENWA 1IGYB 2YUWA 1UKTA 3JXAA 3ZYZA 1U2CA 3X17A 4IRJD 3FB8B 5J6GA 3MUHL 5E8DL 4ZFOL 3RGHA 3RUGB 5E03A 4KI1A 4KKCC 1DEDA 1CT8B 1FGNL 3S3PA 3EOAB 2XNAA 3H42L 3H9HA 1OY3B 4CVZB 3HAEH 5CLTA 1O7VA 4NO0B 4UDTB 3MV7A 4BSWA 4WO4D 2EE2A 1X5AA 3UTTA 2CUIA 4PJAB 1T6VN 1UJ3B 4G42A 4X9HA 1NQBA 2MKLC 2AXGA 4TQEH 2ZOLA 3TBYB 2OJZH 3RZCD 3AREC 4MDIB 1BQHA 4MAYC 3REVA 3MLSH 5BV7H 2B7DT 2V7HA 4NM4L 1KPRB 5EBMA 1AGBB 4WW1B 1P4IL 4OI9A 5IF0B 3SQOH 2CKBH 1CQKA 3KLDA 4P4KA 5EC1B 1AC0A 4JY5L 1UVQA 4EKXA 2IPUG 3JTTB 5JQ6L 2JJTA 4LLWA 3S97C 5C70A 3MV9D 3IAQA 1BQLL 1IM3A 4M4PA 1QR1A 2XT1B 3DX8A 1BOGA 3O4LE 4KC3B 4W6YB 2IFFH 3Q5TA 1WEJH 3EO9H 1CXIA 3OB0K 3L7FA 5JNYB 1A6WH 3NCYS 3BRGC 5ERWA 4P4RA 5BS0A 2WBJA 5C0CD 1YJDC 4AEHH 4Y7MA 4YEFA 5I9QB 3SGJA 3VH8G 2BOCA 1RIUL 1X5KA 3UPAA 1ZT4A 2IALA 3WKNA 4GMTH 1OWWA 5FV2A 1LE9B 1KEGH 2IH3A 4U1MB 2AJSH 1FORH 3DX6A 2K9UA 3EJZD 2NXZC 4ZUSA 3B9KA 1HILA 3WFBL 1PYWA 5D6CA 1HQ4A 3PABA 2VLLB 3L5JA 3U9PH 5C9JB 2V9QA 3LKRB 2EDDA 4N8CL 1WBXB 1T03H 1Q72H 4CDGC 2EDTA 4HPOL 4F37K 3BO8A 4GXUM 3Q2CA 1PKQA 4OCXH 4GG6E 4F7PA 1YYLH 2E9IA 2WBJD 1BZ9A 3IDUA 1MJ8H 2XG4A 5E1HB 32C2B 1FNGA 5DR5H 3VD3A 5B38A 2E6QA 4LAQL 4F57L 1I4FA 1NJ9B 3MJ6A 2GAZB 2JK5B 1XGPA 4EUPA 5GRWA 1XGUA 2NX5A 4JY4A 3QXAA 4Z7OF 4HK0B 4E9LA 4PG2C 2BMKB 2H26A 1NCWH 4YDVA 2UZIH 4XP9L 3R06B 3U7AA 5I1GH 1GOHA 1AGFA 3HE6B 1KIPB 2MQCA 3TN0A 1J1OH 3KPQB 1GGYA 4UINL 4NSKA 5ITBH 1N8ZA 3ARDB 3WFCH 3WHE0 4NNYA 1CDCA 5HVGB 4WFED 4QT5A 3S36X 4LIQE 4HT1H 5D7IE 4XCEA 2AGJH 1W72L 2AJ3B 5DK0A 4IOSD 1ZSDA 4AZ8A 1H3GA 5BMFH 5CEZH 4YEEA 1YNKL 2EYTB 5JOFA 2VLKD 1JGVH 1OAUL 5FM4A 2J7LA 4W81A 2AEPL 1C5BL 2EXWC 4G7VH 5AZEL 4POUB 2OTWA 2AXFB 4YX2L 2ZCKL 1T1YA 1YNTA 1T21A 3BKCH 3RJQB 1EGJH 4MD4A 2AJXH 4HWZB 1S9WB 4QHUA 2X4NA 3L6FB 3KYMB 3MBEC 3NPSB 1U3HB 5E99H 2X7LB 3I50H 3ZLQC 1WTGT 2B39A 1V05A 3DVNB 2C3VA 4MJ6A 5IB2A 1MJ7H 5DFTA 2Y06H 1UXWB 4L3CA 5TE6L 1T2QL 3QDMB 4Y8DC 4M5YL 4HXAL 3FN0H 4P9HH 5C07D 1WAAF 5EORH 5E8NB 4WNQA 1CFNA 1V5JA 1U41A 2ITDB 4AL8H 1PAMA 4Q6IA 3DHJA 4RAVA 1PJ9A 1X3DA 4N5EC 4ZTPL 4U6YA 3KLHC 1MCKA 4KJWC 4Y2DB 1Z3GL 2QSVA 4QNPF 1QHOA 1GGCH 3KPSB 2E5EA 1H9VA 2X1QA 2GSIA 5FV1L 5KOVC 1C7SA 1ZAGA 3SCMC 5IMLA 1CLYL 1HH6A 4HKXB 4XMLH 2R1YB 4BSVA 4EXPX 1P4LA 1R3KB 1U6AH 3KPOB 4ZO8A 3MRQA 3RNKB 5ANME 1KN4L 5ICZB 2FIKB 4QRRB 1YECH 1ZANL 1YA5A 2O61B 1MCPL 2AKRA 2QEJA 4MB5A 2AJUH 4C83A 1P7HL 2V17H 4KKNA 2XWJB 3D39A 5EIQA 1FNHA 4JGUA 3TGXA 3L5WA 4KTEL 5D70L 2XY1A 3FOMA 1NDMB 2EYSA 2GJ6E 3U4BL 4H25B 4PRPA 1N6UA 2HTKC 4ZDHA 2UWEE 4KI5E 2XRAH 4K94L 2SEBB 5LQBH 1KB5A 3Q1SL 5A3ID 5TDNA 5GGVL 3QBTB 1KCLA 1WFTA 3UMTA 2X4OB 2MNUA 1NFIB 2YMXL 3BPLC 3S34H 4WV1C 5EU4B 2NY7H 4MJ5A 3WLWD 1Q0XL 2VLRB 2ARJB 4FQLH 4LVNC 1G0YR 3FB5A 2Q86B 4J3WA 3HZMA 3EYSH 2Y72A 3MV7E 3B2UD 1Y6MR 5ICXB 3UTTE 4DOHB 4PREA 5F9JA 5SWZD 3MFFB 3P0VH 1FO0L 1QTYT 3MTRA 5IFJB 4L4TA 3QJFA 4PJ8B 3BW9B 2Z91A 5JW4R 3X12A 4PRPD 1HQRB 2NY3B 1YMMD 2R39A 3QNYB 5DF0A 3MLXH 1QRNA 3FQUA 3WHXA 3IFLL 1E4KA 3TBSB 1AHWB 3O9WA 3KPMA 4XVJH 5E94B 4W6XB 2E9BA 4TTGA 2A73B 2CGRH 5I15H 2W9DH 2V2XB 3RWEB 4YC2B 1A6UH 4P3CL 1QLFB 4LCCB 5CD5D 4PRNA 2D31B 1KLGB 3V52H 3L1OH 1DN0A 1OAZL 5E0QA 2YXFA 2HT4D 2XWBB 3UYOD 4LPWA 4U1IB 4QEGA 1MRDH 1A6TB 2HFFA 3TA3D 4DKFL 4PRID 4PP1C 4MB4A 1YQVH 4L4TD 5EU6A 4G6FD 3P4NA 4X5WA 1RFDH 4JDVB 2IEPA 2VDPH 3PGFH 5DS8B 4RDQF 2Q6WB 3VXSB 1X7QB 2I5YL 5IW6B 3OX8B 3MACL 2BJML 4FTVB 4N1HB 1QRND 1TDQA 4YPGA 5BS0E 2F8OA 4LDLB 2VWEE 3ORJA 3HC0B 4MAUL 3O9WD 3A6BH 3S35L 5ISZA 2P8MB 3Q6FB 3HB3C 4J3OC 5DQ9A 2UVEA 3VFGH 2ZG3A 5T3XL 2VLME 4P9MH 4RSVA 5DZOA 5I17A 2ORBL 5J3HC 5LBSH 1U8QA 4Y5YA 2JB5L 3CFKA 4OSUL 3DBXB 1NCAH 1ZKAA 5GZOC 4FG6C 2GUOB 2XQYG 5EU6D 4XZUB 3MLYH 3N06B 3OWEA 1QEWB 2AJZA 4OLVL 4M6NH 3CFJA 3BWAB 4KROC 3BZDA 3HPLB 2D03H 2PYFB 3ZE0E 3HCVB 3SDDC 2ADGA 1CDYA 4LFHG 5E2WH 3TVMD 1S9XA 4O51B 5ISZD 2FBOJ 2VDQL 4OV5B 5DD6A 5T5FH 2DMKA 4KGLA 2MKWA 4UT9H 5L0QC 3DVFA 2NX5E 2X44D 3UTZB 3C8DA 4NKIH 1IEBB 2DQJL 4HLZH 2AQ3A 1YY8A 5F89A 4NO5A 4DUVA 5C0GB 4MA3A 3RNQA 4DKAA 5IVXA 5JR1L 1IBGH 2HMIC 4HQQH 4L3ED 2F19H 1T22B 1NBVL 2NNAB 3OJVC 1N59A 5F7DB 4MWFB 4YE4H 4U33A 5CSZA 5DI8A 4EN3D 5IQ9B 1VKXB 1XIWA 5GRUH 1AR1C 1KN2H 1JNNL 4BUGA 3BI9X 2C7UB 1UJ3C 4FP8H 5FGBA 4G9FA 4KWUA 2UZYB 2LABA 3W5MA 1MRFH 1IZKA 2VDOL 5K9KA 3QQ4A 5CKAA 4FQPA 4X0KA 5J6HA 2I07A 3GJFH 2I9TB 3OXRA 1S7VB 4OGYH 4P46A 4ZOCA 1NSNH 3I75B 4X4ME 3JSSA 1CFQB 5J12B 5CIPH 5JTWA 3ULSB 2BSRB 5EIVA 1J10A 5DO2D 4B53A 4TNWK 4GAJL 3TZVB 2UUDH 1S7UA 5EOQL 1GIGH 2EZ0C 2F58H 1MREL 2YD9A 2ICEA 3O6FD 1Q9KA 1NEZG 1XIWD 3GMOB 2P8LA 1A7PL 4FZEL 4PV9A 2Z31C 3IXAA 4WU7B 1OAKL 4X6CB 5IIEB 4O00A 1G7JA 1FDLL 5E95B 1IEAA 1A4JB 1TVBB 4Z7QF 2YPVH 4IRSB 3KXFE 2EDBA 2DQCL 5JDJA 4KXZH 1RI8A 2PR4L 2AV1B 4OB5H 2HJLA 2XIDA 3LSOA 1NPUA 3SDXF 4H8WC 2OTUB 3MNZB 3PHQB 3DXAD 5GGSY 4NRXA 5I9QC 4L8DA 4XP4L 4YHOH 1FLRH 4XGZB 3OKKA 5BRZB 4JM4H 3V4UL 3FAWA 2YRPA 2R4RL 4H26B 1QA9A 2MCG1 3O6KL 4D0BA 2I26N 4LPXA 4F7EA 3IT8D 1F97A 3CCHA 5JHDB 5JPMB 2B4CL 1CBVH 4M6OH 3CH1A 3IDGB 3MRJB 3ARGB 2ICWA 1IAOB 4Q97A 1RZIB 3LHPH 1T5XA 3ZT7A 1C08B 5C09B 1XGYH 1HSBB 3U1SL 2HWZL 5FYKD 3O2DA 1IC7L 3D85A 3LV3B 2DIBA 3D39E 2XWTB 3MRBB 1OW0C 4JG1L 1EZVX 1GH7A 3A0OA 2ITCB 5CJXC 35C8L 4MA7L 5C6TH 25C8H 3DUUA 3K8KA 4AH2A 3WL9A 5I1KL 5J13B 3EDJA 3K80A 2JJVA 5GGQH 1KTDA 3F7YB 2NZ9C 1VGKA 3QUMA 3H2WA 5C0BA 1TNMA 1ZXQA 3OR6B 5CJQL 2BY1A 2VDLH 1G9EA 1B3JA 1MNUH 4YHNA 3FCTA 3L3DA 4FFZH 4TUOA 1OSPL 1G9ML 2Q8BH 4XMPL 1S9VA 4XAKE 4E41D 4JJ5A 1WBZB 4RRPA 3UJTL 4ZPTB 1LQSR 1WCQA 2ZUUA 2ESVB 3HE6C 3EYQC 1F90L 1QSFA 5IMKA 4DN4H 4E42A 2DM2A 5FYLE 5EOCH 5EU5A 1FNSL 2XY2A 3QCVH 1CGSL 1R5IA 3ARDC 5FA3A 1CGVA 5HDBF 3U0WL 1CCZA 4NNPH 3HMXH 4KJQC 2PO6A 3VXTA 3C8HA 4L4TE 5GXBB 1PEWA 3HNTH 1A2YA 4O2CB 1BEYL 1L9MA 4WDIB 4LKCA 1O7SA 3JUYA 4X9FA 1HE7A 1KNOA 3BH9A 4HIXL 4N9GB 3FO9A 3QI9B 5D7KD 15C8L 1KB9J 3R1GH 1Q0YL 3QZWB 1FJ1A 1QNZL 5D1ZB 2EE6A 3KPRD 1BQUA 4Y5VA 2LQRA 1XF4B 1S5IH 2VTFA 2C3WA 2YK1H 4X9GA 1CXEA 2H8PB 5D1QB 4FFYL 3ZTJG 2OK0L 5DJ0A 4JFFD 3MC0A 3T4AA 3H9SB 5E2VL 3GSUB 3FQXB 1FNEB 2XTLA 5F7WC 4LCYB 2KUTA 2CK2A 4WWKB 1B2WL 3BPCA 3EOBB 3O3AA 1WWWX 2YKLL 4DUWA 4WHCA 3ZYOA 2R29H 1EJOL 3QRGH 3AS1A 3RVWD 1HSAB 1IGMH 2H9GB 3MYJA 4P57A 5DLML 1HN1A 1S7XA 1F4AA 2AEWA 3I6LE 2P5WB 5ISZE 1HXMB 2O5XL 5CZVL 1T1ZA 3GSRB 3LRSA 3BIBX 4P0DA 4QXTA 1KOAA 4Y2DC 1VACA 5DD1H 5DJ2B 4JJHA 2FLRT 1EUUA 1NDGA 1LP9F 4BUHA 1QFWI 1EMTL 3HG1A 1XAUA 2W9EL 3OTTA 4X4ZA 4YGAB 2BDNH 2EKSB 2ARWA 3X11A 5I19H 1YEKH 4BJLA 1M7DA 3T08A 1IGJB 4HMEA 2YD5A 4IS6A 5DHVA 5T5NG 5CMAB 2IG2H 1IAIH 4P3WA 4NQEB 3T0BA 1D6VH 4XNMB 5FGCE 5FFLA 3CMOH 1G9NL 2BNRD 5FHBH 4MNHA 1J8HA 2QSCH 5KVEL 4LSRL 2RCSH 4J1UA 2A9MH 4X6CF 4Z77B 2V2TB 3HZYB 4R0LC 2LVCA 5CEZE 4JPVL 3O8XA 4QOKA 1FH5L 1UYWH 5JMRA 1HWGB 2UY6A 4NKQB 4HCRL 4KK9D 3FTGB 3O41B 3RKDC 3W0WB 2A77L 5IVXE 5GS2H 4JZOB 3OAZH 5CD3B 2EEBA 3EZJB 3DGGA 1EA9C 3HNVH 5EOTA 3MLTB 4NHCL 1F6FB 3UTSA 5BZDB 5IWLC 3ZE2F 3LB6C 4I2XB 1AGEB 3BXNB 3NZHH 5E2UH 3AXLA 4F9LA 3DPBA 1J8HD 4N90E 1DBBL 1RMFH 5DUML 4G9FE 5HGBA 1UCBH 4LSTH 1AJ7L 3ROOA 4QF1B 5DYOA 3O8XD 4PJ8C 2HP4A 3NACL 4JPIB 2NY3C 4XH2A 1X5JA 3VG0L 5FYJE 3FL7A 5E1AA 1IGIL 1AHWC 3DURA 4YBHA 1LK3L 1RD6A 4YC2C 4HIEB 3MJGX 3MJ8B 2G60L 4LCCC 1NLBH 1JGLL 2NY5H 1ZA3B 2JCCA 1TCMA 4N0FA 4CGTA 4H1LH 5CJOL 4RBPH 1JL8A 5F7UA 5E2TH 4ZAKA 2CRYA 1S5HB 1T1WA 2Q76A 4LL9A 1AR2A 3O2VL 3SKOB 1WZMA 2YWZA 1RJLA 3QZWG 3NPZB 4NQCA 1DLFH 3IJYA 2R2BB 2OL3L 4EI5A 2ZUYA 4JHWL 3MLRL 1MPAH 4JQVA 4NPYB 3HS0A 4G6ML 5E4IA 3OGOE 4PJXA 3ZT5A 3KAAA 1UM6H 3QFJA 3TBWA 3P9LB 1L0QA 1K9TA 3FFDB 4L9LA 5ESVB 3RU8H 5CP3A 3U6RA 4HFUH 1P53A 5AG9A 3PWPD 5IW1A 3BQUD 1CK0H 4Q9QH 3LKQB 5AYUL 1FFQA 2BVEA 1UM5L 1A64A 5HPMA 3IFPB 1I1CA 5FKPB 1K6QL 2MTPA 4ZAKD 1FCCA 2XPGB 2QJDA 3BJ91 1JNLH 4IIQA 4J3TA 2B1AL 4C59B 1OM3L 3GBLA 3KJ6H 5MENA 4PV8A 3RWIB 4OFKA 5FIEA 2PYEA 3CC5A 3BDYL 2YA0A 3H3PL 4EI5D 1GC1H 1RK0A 3PL6A 1C7TA 4UV4H 1R3JA 3FRUB 1A9EB 4OCSH 3OPZH 3TIEB 3K2MC 4M6ML 4NN6B 4ZG1A 3QFJD 5IKCA 5JO5B 4JQIH 2I25N 4KHTL 2HKFL 5FEBA 1UADC 2CUHA 7FABH 4TYUA 5JOPE 2YRLA 2AABL 2MQ0A 4Y19D 5IOPB 4I18B 4UMGA 1I3VA 1MFDL 1OPGH 2ICWJ 5C0BE 1U92A 3EYFA 5C8JA 3MMEA 3B5HA 1BFVH 3ULUC 3N0PB 5KSBB 1TQCB 4G5ZH 5DC0A 5F7NC 3KVQA 2ARJQ 4JQXC 5CSBA 3S36H 1N6QL 1G1CA 4EJ1C 4TNWF 3RP1A 2C26A 1QO3A 1QSFE 3B3IB 1KXVC 1DE4B 2A6KA 4R96B 4WFFD 2JJUA 2FZ3A 3HLAA 4CAGA 3V5KA 3PL6D 4RGND 4MJID 1NCCH 2R1XB 3LQMA 1Q9OB 1JZ8A 3IB4A 1D9KA 1VFMA 1B88A 5C2BL 1DVFA 4OIIL 1BD2D 1JHLL 1AKJB 1KFAH 3HZVA 1G84A 2NY4D 4UOW0 4LKXB 2MFNA 3IF1B 2X5PA 3ZHKA 4Q9CA 5IBTH 2V2WB 1CZ8L 1EEQA 4OFVA 1CF8L 2Q1EA 5B8CB 5SWQA 1EO5A 3IDNB 4F2MB 4FABH 1BLNA 5IESH 1FQ9C 2A9NH 2F54D 3MRNB 4IRZL 2FDBP 2GQHA 4XC3L 5AD0A 3V7AE 3VWKD 1YJDH 4JO2L 5J12C 1HINH 3C8KA 4F7CB 1INDH 4XBEL 3HI1B 1JBJA 3LPWA 3GK8H 3MRPB 1BJMA 3TZVC 2BK8A 4TRPH 5C0ND 1FZKB 4HUXA 1IE5A 4OFYD 1P7QB 4WI7A 5D7SL 3BSZL 1F3JA 4MA8H 2P8PA 3JWOH 5ICYB 1JHKL 1F4YL 1D9KD 1KV3A 1K2DB 1R24B 2ADFL 1LO4H 1NFDA 5M95B 1Z9SA 1A0QH 4IRSC 3OG4B 1J1PH 2YZ8A 1I9RL 4NUGH 3WS3A 2VDMH 1T20A 1UWGL 3SE9H 4X5XA 1YN6B 1KF9B 3SDAA 1Z9OA 4KGJA 1QACA 1IFHL 3MCKA 1QLRB 2GTWB 5KSUA 5DVKA 5DUBB 2ENSA 1I8IA 3RX8A 1DQQB 2N56A 2ERJB 4YHIA 3L5XL 3QPQD 3U7WH 3HG1E 1JGEB 4HC1H 2HVJB 5KANI 4TUJB 3ARGC 4BFEA 5HJ3B 2GITB 1J0YA 2X4RB 3AFLA 4FQCH 1BFSA 4MD5A 2X40A 4LQFL 2BVYA 4K7PY 2QQKH 4PJ5A 1I1FB 4WIQA 5A1AA 3U79A 1GOGA 4Y4HB 3B6SB 4K7FA 1IMHC 1BBJB 5J13C 4QOKE 2R23A 1G7HA 4TSAL 1BZ7A 1FVDB 3RWCB 4DVBA 1H0DA 1U95B 2BX5A 4URTB 1E6JH 2FECI 1ACYL 4M5ZH 3PWUA 1NC2A 4JCMA 5E2JA 3ULVL 3NA4A 1N7MH 1J0KA 3WUWG 3OKDB 1XR8A 3QQ9D 3W2DH 1I75A 3UTOA 2C1OA 3UTSE 1LO3H 5IHZA 4OF7A 1ZHBB 1ZLSH 3VXUA 1Y6KR 3ES6A 1G6RA 5IR1A 2R0WH 3IDYB 4EDWH 4EI6A 2P47B 2OTPA 5GISL 2R2CA 5EFIA 4WUUE 5HHVH 2DF3A 4LSQH 3D9AL 4PB9H 1RIVH 2J6EA 4PTTB 5MEOB 4X6EB 5I1LB 3UXFA 4WEBH 1LEIA 4RAUB 3BD3A 1ADQH 3QI9C 5CUSL 2IH1B 3MRGB 1MUJB 3LKNA 2PCPB 4ODXA 3MR9B 3X13A 1KJ2H 1NC2D 4OD2B 4D9RD 5D1ZC 5DJDA 4X80L 4K23H 4AM0A 3DMMB 3GHBL 4UQ2B 4HJGB 4JRYD 2JCCE 4U6XB 1RU9H 3O11B 4S1QL 3VXUD 5D1XA 5D2NA 4QYOA 1NGXB 3UROR 2X41A 4YNYA 2LAGB 5KSBF 4KKAC 4JM2A 4KTYA 4FQ1L 2ZKHH 4LF3A 4WCYH 4Y4KB 1E4XL 5DMKB 2NXYB 1IGFH 2IQAA 4WWKC 4JHAL 4M7LH 4NQCE 4OJFL 3RWDA 4GW5B 4NQDA 5GSVA 3TBVB 4LP5A 3BP5B 4R4BB 3MJ9A 1FIEA 1S8DA 2KZ1B 4GQPH 2F53B 5C0AA 3V5DA 4JFHE 5HI5D 5EU3A 4PJXE 2L4OA 5F9AC 5F72S 4G80B 1KC5L 2QLVB 3QFJE 2ZSWA 2WUBH 4LK4A 3NIGF 4K2UL 4W4NA 4OFPA 3WLBA 1JGUL 3H8NA 5DJAB 1MWAH 3LY6A 1V7NH 1KCSH 1DQLH 4TULL 1U8MB 1NMBH 4NBZB 1V3JA 2DQDL 3BVNA 5D1XD 4NJ9H 2D7QA 3EDKA 3IJSA 4KDWA 3NOIA 5CILL 3AREA 1TZHB 4JM2D 4MAYA 3U9UB 1I8KB 2AI0L 5BQ7B 1XH3A 5INDB 2R0KH 3T1WA 2H3NB 1AFVH 5MENE 5ETUA 3DETD 2PYEE 2VERN 1VEPA 5LGKA 2H2SC 1UB5A 1P5VA 2AEQH 5KG9A 4ODTL 4QRUB 1L4IA 1NFKA 4YDKH 4E0RB 1I9IH 3NIFE 1Q9WA 5DVOA 4JANA 3GDBA 1PG7W 4JFXB 2VJXA 1AGDA 3LMJL 1LDPH 1ERNA 4LCIL 2ED7A 1QLEL 3C5JA 1SEQL 3QXDB 4OZ4A 5IHUL 5KN5A 3RDTA 1G7QA 3P11L 4QRPE 2OYPA 1TTGA 4WJ5B 4PRDA 4GRWB 3DRQB 2EDJA 3T65A 1JPFB 4OGXH 4AIXA 3ZE1F 3HNSL 2NTFB 2DLHA 4Z8FL 4GAYB 4R97B 5EOCJ 1II4E 3W11C 5ADPH 3HN3A 3K74B 3GM8A 1AE6L 2W0PA 3HI6H 3LZFH 3U4AA 1A1OA 1HHHA 4GG8B 5IBLC 5HYJA 3CU1A 2IANE 3HRZB 2VXSL 2CR3A 3OXSA 1FAIH 3VRLE 4P99A 2CSPA 4N0YH 3UC0H 4XNYL 3UJJH 5D9SA 3AB0B 1ZWIA 5ALCL 1MIML 1MSPA 4KVCL 1PDKA 1B0RA 3MBXH 5K9JL 2DIJA 2XQBH 3QJHB 2MPAL 4PP2B 1NUNB 5KAQF 4I0KA 5IBUB 4U1KB 2BSTB 3C6LB 3GMMB 2OZ4A 5J1AB 2MQ3A 5GGRB 2CLVB 5TQ2L 4OAWB 3RDTD 4LPVA 5EBWB 5T1KA 4ZXBB 2BFVH 1N3NB 2ZPKH 5EO0B 4MVBC 1ZS8B 3S98A 4CU6A 3F65A 4YAQB 1NMCB 3Q48A 1ES0A 1X5YA 1UZ6E 4NKMB 5FUCE 1UQSB 3EKCA 3DWTA 3G08B 2LU3A 5HYJD 4KRLB 4P59L 1JPSH 1A1NB 4XPBH 1GPOL 3TFKC 4JZNB 4LPYA 1OT2A 4JHZA 4NZTL 5D2LE 4ZTOL 4B7IA 1U8PB 3RL1A 1SYVA 1FO0A 3W39B 1EX0A 4HJJH 2EKJA 4JFPA 4PGDA 4PG2A 1BF2A 3SDYL 2BVQB 3IGAB 1NFDE 5D7LA 4RNRB 3RFZC 1QBAA 1UA6L 1T4KA 1A3RH 2FSEB 5MEPB 2XZZA 5EUKA 5T1KD 1M6OA 3I02A 3ARZA 1F5WA 2P4AB 4CMMA 3M8OL 2BNQE 1LVEA 1DANT 5GRVK 3TJHD 1GZPB 1U9KA 5F3HB 4R3SA 4QLRA 4J4PC 2DQFB 1G7LA 3D69B 3CVHB 2VITA 2J8HA 1X44A 4J3VA 4D9LH 1PZUB 4HKJA 5TE7H 1WC7A 4ODWA 3QIBD 3JWDC 3V6OC 3U0PA 4DGVL 4JVPA 3S96B 2DMCA 4ZOEA 2LFGA 1FFPA 5E9DE 3T4YB 4MCYA 3DX9A 3MBEA 3ZKMD 5BVJB 5FECA 2FGWH 4PJ5E 5E08L 1OGAB 4PJ7A 1VFOA 1Q1JH 5TPWL 1Z9MA 2QHRL 5EWIH 4NN6C 3VXMA 4BKLB 1E4WH 1SYSB 5LXGH 4HKBA 4OZFH 1A7QH 2R8SH 4NRZB 4I18C 4M7KL 5D5MB 1SBSH 5F44A 1MAKA 1RZKH 2PTTA 5DFVD 3MRKA 2ENYA 1MY5A 3FFCB 3KNBA 2V5SA 3G6JB 4RWHA 1MHEA 1TQCC 1G1YA 1KJ2A 1KB9K 1IKNC 4HH8A 5ITFB 3QG7L 4NC1C 3EDDA 4GRLB 4P2RB 2KBGA 3VXUE 1S9YA 4Y5XB 5L6YL 1N0XH 3QULB 2OSLA 1IZJA 4IHOA 2Z4QA 5L8JB 3U36B 2Y6SD 3HC4H 5FYKH 2AK4D 3FRPG 5KS9B 5MP6L 3AUVA 3RJDA 3DSNA 2EXYC 4PPTA 3V6FA 4AG4L 3ARFB 2VN4A 4QRQA 5T3XD 2FL5A 4YFEA 2ATKB 3X3GH 2YHGA 2Z35A 2OBGA 2YD7A 2F15A 3PP4H 5B8CC 4K9EC 3OJ2C 5T3ZL 5C86A 3ECBB 3FQNB 1MELA 2GYSA 4Y16D 2ID5A 4M43H 5HSFA 1QFOA 1U8LB 3ET9F 1B6DA 1EAJA 4H88H 3HFMH 5D2NE 1DFBL 3ZKQD 4GRWF 5IBUG 3IDIA 5DD3H 5EH1A 3P0YL 4KPHH 2HJFA 3KPPB 4IDJL 1KCVH 1AI1L 1T0MB 2DWEB 5KW9L 5HGDA 4JO1L 5E6IA 1ZVHA 4NQDE 5DZNA 5E7BA 5LGJB 3OGCA 4WV1A 5C0AE 3ILQD 4MDJA 3BGMB 3FHAA 4CUCA 4KK8D 5EZJB 3JV6B 4BQ8A 5KJRL 5DMGC 5FDWB 2WLZA 4KI5F 4KXZI 3O6MH 1EHAA 2NY6D 3QEQB 3V95A 3S35X 1LO0L 2V7NA 4CJ1A 4YDIL 3TPKA 2Q8AH 3WFEL 3K7UA 4DAGH 4PGJA 5L2KA 3IDXH 1OCWL 2FYYA 2X4QA 1A7RL 2G9HB 3KLAB 2ERJC 3BP6A 5I74B 5MI0B 1P1ZA 4ONHA 2W65A 3GI9H 1B0GA 4FOMA 3IETA 3GGWA 2XZQH 5E6ID 1RURL 1CFVL 3KXFB 3GSNB 4FQHB 1LEKA 3MRDB 4M3JA 1FZJA 2FX7H 4DGIH 5IJVB 5HGAB 2HAZA 5ID0A 4X4YA 1QBLL 3MRHB 2HLFC 1MHPL 3HI5H 5FA4A 4MS8D 4Y4HC 5DJZA 5I8CA 5GIRA 2VH5L 3TNNB 3EO1A 4A6YH 5DWUH 4ZS7L 3LRHA 1DP0A 1T0PB 2YD4A 3F58L 4H5SA 3NA9L 5HGGS 1KG0B 1JF1B 2L0DA 1WLHA 2J12B 4MMXC 2DI7A 3MXWH 4QHNA 1UFUA 3HAEB 1FN4A 2D7PA 4NC2B 3QCUL 1NAKH 4Z7VB 5F6HI 1A8JH 4WWID 5JORA 3PGDA 3IFOB 4X99B 3L7EA 2QQLL 5I71B 3IDYC 4ENEC 1YPZB 4YJZL 1X5GA 4I48B 4MYWB 4XPAH 5H37G 5I18L 1FFRA 1CL7L 4OLZH 4UIMA 5E8OA 4HIHB 5GJSH 4PJ9B 3WSQL 5BV7B 2I60L 1PQZA 4G7YH 2CKBB 4WUKL 1S7QA 3MFGB 1CTOA 4JFED 1JPST 1DQDH 5D71H 3VDBA 4TVPE 2BERA 3SBWA 4DQOL 1Q8MA 3IDMA 3C5SB 2CO7B 3DMMC 5D5MF 5LKNA 1KIQA 2FO1A 1D5MA 4R8WL 4LLVB 4JG0H 1F4XL 4ZFGH 3OL2A 1N5AA 1IGYA 2VXQH 3WIHH 2RB8A 3WKMH 4Y4KC 5IROC 2NXYC 1CR9L 5D7LE 3FONB 4NFCA 4FZ8H 3BKML 1CT8A 4R90L 1U8HB 3VW3H 2APWA 4CVZA 2QADB 1WAAA 3BN9C 4M7JH 4KRNA 2HH0H 3C5ZB 1KGCE 3MGOA 4ZYKA 4HV8B 5KS9F 4NO0A 3SKJH 4UDTA 1NAML 2X1OA 4PJGB 3Q6GL 4PLJD 4PJAA 1UJ3A 5AZ2L 1S9KC 1KELH 3HE7D 1HNFA 2KKQA 1YEFL 1YEIL 1TCRB 4PYGA 5GGTA 1J5OH 3TBYA 2DQEL 1M05B 2G5BB 3DSFH 3G6DH 4J12A 3CFEA 1WFNA 1YY9D 4LVOB 4NZRL 4OZIB 2ZOKA 4P2QB 1KPRA 1XR9B 1AGBA 4WW1A 3S5LA 5IF0A 5CJ8A 1DQMH 3TPUB 5EC1A 1ZHNB 4PJ7E 2DLGA 3U2SB 3JTTA 4L4VD 2VXVL 2NY1B 3VXME 3B2VH 1F4WL 1IAII 4UTAL 2OMNA 4JRXD 4BZ1H 4M1DL 1F13A 4JFQB 1AR1D 1EDQA 2D4DA 3VJ6B 1H3TA 4HS8H 4AIZA 1IGTB 5DJXB 2GCYB 5I8EA 4CVXB 1S7RA 1X5HA 1RUKH 3QQNA 1IVLA 4FQXC 1G9NC 3TIDA 2DL9A 1DSFL 5JNYA 5TDOB 4R97C 5CKGA 1JHTB 4MQXC 3QUYD 1KJMB 2CDFB 2V5YA 2E7BA 3RI5F 1A3LL 1AXIB 2XA8H 2A1WL 4KKBD 2CRIA 1C1EH 3KYKL 5A43C 1K8IB 1LE9A 5HI4C 4U1MA 1C12B 3UYRL 5CWSB 1Q9LB 3AB0C 1GCFA 1VFBB 2IAMB 4KI5C 4HMDA 3JTSB 4IJ3B 4HCRA 2FJFB 4OQTA 5C9JA 3HAEG 4QRTB 3LKRA 4TPRH 3ARBA 3F7PC 3NCJH 1MCWM 3F7RA 4YHZH 1WBXA 1QBBA 1E27B 4ZXBC 3QNXB 3QIUB 4LHUB 5TH2B 1OW0A 4HS3B 3BT2L 3TYFB 2RGSA 1DL7H 3KPLA 1NMCC 4KUCF 32C2A 2Y7QB 3VRIA 3C08L 1RY7B 4POZD 1NJ9A 1K8DB 4J3SA 2GAZA 1B4JH 5C0DB 2JK5A 1MCFA 3QO0B 4J6RH 6FABL 4HK0A 2BC4B 4NN7B 3UBXG 3CX2A 2BMKA 1S3KL 4FFVD 4Z7VF 3R06A 5BCAA 1A9BB 2P49B 3D6GA 4WTWA 4P49A 4D9QE 3ARBD 2BSSB 3HE6A 4QHKJ 4L8CB 1SQ2N 3K2UL 2D7MA 3KPQA 3L3GB 2E6PA 3WXWH 3TJEH 4LIQL 1YPZF 4O5LL 1BHGA 2YD6A 3ARDA 2QQQA 4CN4A 3BE1L 4GKZB 4TNVK 1I9JL 3LQZB 5J4MA 1JI1A 4APQD 4KRPB 5L2KE 2AJ3A 1BM3H 1GZQB 3L3HB 3FMGL 2HA1A 2NZ9D 2EYTA 3L3IB 4M1GL 3N85H 3S4SB 3ULUH 2GFBB 2VABB 4K8RC 3TYGL 3LVEA 4CJ0A 3UDWC 1UG9A 4ONFH 2AXFA 3VGFA 5EULV 1MI5D 1LEGB 3D48R 3N9GH 3FQWB 4DGYL 4FQIH 2NYYD 4HWZA 1S9WA 5DMYA 1ORQA 1JWUB 4NGHH 3GI8H 3L6FA 3KYMA 3EYQD 2FJHB 3DJ9A 1U3HA 2HT3C 2Z8VC 3RIFK 3CK0H 2X7LA 3ARDD 2EDQA 3OKEA 4G43B 1TZGL 4YZFE 3DVNA 5JMOC 5H2BB 4S0SD 3ZTJH 1UXWA 1FGNH 3K1DA 3QDMA 5KTEL 1KACB 3H42H 2BY2A 3MREB 5E8NA 4PIRF 2ITDA 2ICES 4QRSB 4PJGF 3W9EB 5BXFB 5I0ZA 1WWAX 3EOYG 2KZWA 1OAYL 4YIQB 3MUZ1 3WDJA 4GRLC 3UZEA 4EQ3A 4Y2DA 4X8JB 4Y5XC 1RZ8B 1OP9A 4KJPD 2KQMA 4O4YL 3KPSA 1CYGA 1CFTB 1U3HD 5L2JB 1H15B 5LGHL 4K3JL 4OZIF 4HKXA 2R1YA 3FO1B 3PP3H 5LWYH 3PV6B 1R3KA 4S1DC 1SY6L 1P4IH 3KPOA 2MHAB 3ARFC 5IJKA 3RNKA 1QSED 3DGCR 5ICZA 2FIKA 4QRRA 1QSZA 4JY5H 4FNLH 2O61A 4XI5D 5JQ6H 3K46A 3SE3C 3SGKC 4Y4FB 1BQLH 1PLGL 1YZZA 4G8IB 4DTGL 3K3QA 2F5BL 4S2SA 3LS5L 3P30L 2E7LC 4H25A 3RTQB 2SEBA 3LKSB 4RWYL 4NM8L 3MUY1 5JPNB 3HPJB 3S7GA 1P2CB 3RUGE 2X4OA 4LHUG 1NFIA 3VD7A 2GJZB 4KTDL 5CINL 4RFOL 5EU4A 1CICB 2VLRA 2ARJA 1RIUH 5JIPA 2X70A 4S1RL 4QRRD 2NW3B 5IWLA 2Q86A 3FQTB 4Q6YA 4B41A 4XWOC 3MV8E 4LSDA 4YWGL 1W0WB 1FYTB 4N0UB 5ICXA 4PJAE 3BKJL 4NZUL 5CCKL 3WFBH 3MFFA 4LOUC 3TO2B 5IFJA 3BW9A 3NAAL 4UIKL 4U1LB 4PUBL 1N4XL 2DLFL 3RY4A 2VLJB 3KWWA 5I74C 5MI0C 3QNYA 4P5TB 5FO7A 4HPOH 1GJIA 4RMVA 4QXGL 5F7YC 4KAQL 4WTXA 3TBSA 4CNIB 4P2OB 1AHWA 5E94A 3NIDE 3WIFB 3PDDA 3QUZB 2A73A 5FOBB 2V2XA 3CFDB 3RWEA 1FVEB 4F57H 5E24E 1T66C 4KVNL 3UJIL 1QLFA 4LCCA 5K93A 2D31A 3PQYD 5KSAD 4Z6AT 5ABDE 5DEZA 4Q2ZB 4NQTA 1JF6A 3NFNB 4U1IA 4XPTL 3S4SG 1A6TA 3GIVB 1CVRA 2J88L 1BIIB 2Y5EA 1BIHA 4XP9H 1I8MB 5J7CC 4JDVA 5DS8A 4OLXH 3VXSA 2C4FU 2CH8A 1CLZL 5IW6A 3OR7B 3OX8A 5FO9B 4FTVA 1EFXD 1UENA 5I1AB 4EDXB 2LU4A 3HC0A 1M7IB 5TDPA 3RVVC 1ZGLP 3Q6FA 1W72H 1DLHB 3B43A 1YNKH 3A67L 2VQUA 1B4RA 3L5HA 1LHZA 1NCTA 4QWWC 1OAUH 2AEPH 1C5BH 5AZEH 2YWYA 3GJFB 2YN3A 1KCKA 3DBXA 4YX2H 2ZCKH 5BV7C 3P4LA 2GUOA 4PJ9C 3MLVH 3OF6D 5CIPB 3MLPA 4XZUA 3CDYA 1QEWA 4MNQB 5DSCB 1D6EB 3T0VA 2NY0B 3C6SB 1OP3H 3RY5A 1G7IB 1P7KB 4P23D 3I2CL 4W4OA 5DJCB 3HPLA 2ZSVB 2B1HL 1BJ1H 1LE5B 2PYFA 2OM5A 1JGDB 4C55A 1A6VH 4O51A 5DK2B 1T04B 4OV5A 3QIWB 3QWOA 1DN2A 1VDGA 3MXVL 5TE6H 1T2QH 3VWJB 4M5YH 4HXAH 4WUUB 3UTZA 3I6KB 5ID1B 1AIFB 4NT6B 3T3PE 4R7DB 1IEBA 5C0GA 1HZHH 3MNVB 4U6HB 1JMXA 1KIRB 4A2LA 4MQSB 4HZLB 4PR5B 4ZTPH 2CDEB 1Y0LB 1QKZL 2FRGP 5I1DB 3KPTA 2DKMA 2RQ8A 4MWFA 5IW3A 1CE6B 3ULVD 3HUJE 2QADC 1CD9B 3BUTA 1CLOL 1CLYH 3QEHB 4LSSH 4JFZL 5IQ9A 1VKXA 1JN6B 3C5ZC 3RGVD 1INEL 5KZCB 3EO0B 2X6MA 1MIEL 2C7UA 3D0VB 4JFDB 4M1CC 2JIXB 5IVNA 5J56B 4M8QB 1KN4H 5SX5K 2VZOA 3OAZK 1ZANH 4PS4L 1IKFH 4QHKI 5GGRY 5B39B 5SWSD 1MCPH 4G6AC 4XBPB 3MZTA 5F1IB 5KVFL 1A7NL 2CLRA 1BMGA 1S7VA 2CPCA 1NGYB 2I9TA 1CN4A 4WI4A 3N1FC 4C56B 1WJ3A 3I75A 1CFQA 4KTEH 5D70H 3ULSA 2BSRA 3U4BH 5EZIL 4JPKL 3TZVA 1SJXA 4W68A 2AK1L 2NY1C 3NFSL 4NHUB 3Q1SH 1JYWA 5GGVH 3UTPD 3GMOA 2ZJSL 4WU7A 5IIEA 4X6CA 2YMXH 1KTRL 2ZCHL 1UM4L 3T0EC 2P7TB 1Q0XH 3QDME 4H20L 3RY6C 3EBAA 1A4JA 2NZIA 1TVBA 4TN9A 3D3VB 5H35B 3NGBB 2FJGB 5ESQB 2AV1A 1FAKT 5KVDL 4DEPB 3FZUD 4BSJA 4FXKB 2OTUA 3MNZA 3PHQA 4FFWD 5ALBL 3HA0A 4XGZA 5BRZA 5GRVL 3NFPB 4ZFFB 3KPSE 3MNWA 1U2HA 4P48A 1PGRB 5J0BA 5JPMA 3GSOB 5JHDA 3BP4B 3IDGA 2VZVA 3TO4D 4HLJA 2ADJB 3IFLH 2IAMC 5E8EB 1DQTA 4QRPB 2EIBA 3MRJA 3ARGA 5T1DL 4BELD 1IAOA 1RZIA 1H3UA 1T2XA 4IJ3C 3OJMB 1C08A 3MLZL 4QRRE 1HSBA 1RZGB 4P3CH 3LV3A 4AEEA 1OAZH 2FEDD 3MRBA 3QIUC 4UBDC 4LSPL 5JDSB 5LCVL 3P4OB 5BZWB 2IANB 3BH8B 4TQEL 2ITCA 4DKFH 1MOEA 2Y23A 2OJZL 5JHLL 5HHOD 2GY5A 2C1PB 2I5YH 1U8OB 2WW8A 1OQXA 1LMKA 4YBQC 3S8WA 2BJMH 3OR6A 4DFHA 5DQDL 3OZ9L 5T1LB 3DYPA 4NN7C 4N0CC 4QTHB 3SQOL 2W07A 4ZPVA 5C0FB 3QHZL 4MAUH 1BQSA 2VLRE 3S35H 4NC0B 1WBZA 4B50A 4ZPTA 4BK4A 3WFHB 5FYLL 2ESVA 5KBNC 4ZD3H 2XACC 3BPNC 4DOHE 2E27L 4ZOAA 1H5BB 2JB5H 2HT2D 4YXLL 1MFCL 2EDXA 1RAMA 5D2LB 4IOFD 4KRPC 2FATL 4O2CA 4WDIA 4ZUTB 3FT3B 5DA4A 1X4ZA 4OLVH 4N9GA 5DURD 3QI9A 3ARSA 3V0VB 5DZLA 3QZWA 5IVZB 2OI9B 5DRZB 5D1ZA 2Y36L 3S9DB 4DUXA 3QH3B 1KEGL 2XA3A 2LVEA 2VDQH 1XF4A 4UNUA 4KDTC 3OMZA 5T1MB 2BNQB 2H8PA 5D1QA 1JP5A 4HUKB 4KK6C 4GJTB 3QDGD 3SJVE 5I16B 1HKLL 2DQJH 1XZ0B 3AS2A 3GSUA 3FQXA 5B39G 4BQ9A 1FNEA 2A6JB 5JR1H 2IBGA 4LCYA 1ACZA 5FCUH 2G5RA 1ZA6B 4WWKA 3EOBA 1NBVH 4ZO9A 3VXSE 1IQDB 5E00B 4OCXL 3PWJB 4FTVE 5ECJE 1C16A 2FHFA 9CGTA 3MRLB 1HSAA 2H9GA 3MOQA 5E9DB 5LJYH 4HS6A 4K9EH 4U2YA 2P5WA 3RKPA 5C0EB 1JNNH 1W0VB 4Z7NF 1HXMA 1IC5H 3TT1L 2VKWA 3CXDH 3CPLB 1SHMA 1ND0B 4BH8B 2VDOH 5DJ2A 1UGNA 5D1QD 1SVZA 4RGMB 3O6LL 5ADOL 2QQNL 4WFHE 5HDBE 3TWCL 4GBXD 3EYUL 2IF7A 5I8OL 2H32H 3E8UL 4LHJB 3QUKA 4C4KT 2EKSA 2RIKA 1AXSB 1KCUL 1CFSB 2A83B 2DJUA 1IGJA 2QTEA 5DD5L 5ITBL 3DOSA 5CMAA 4GAJH 4NQEA 4XP5L 4IRJB 5EOQH 4XNMA 2VO5A 3ZHLA 1MREH 4HJ0C 4Y4FC 1A14L 4QCIB 1OTTD 4H1LB 1A7PH 4FZEH 1OAKH 1YEDB 3HZYA 1U8IA 2R1WA 1T7XA 5CFHA 1H8OA 3RWGB 1FDLH 1J8KA 5EN2B 4LVHB 3VDCA 5DVLA 1RJYA 4CMHB 3ULUE 3FTGA 5JXAL 3O41A 1AP2A 3W0WA 4NUJA 1FSKB 2DQCH 1NMAL 2PR4H 5DRXA 4JZOA 3CAFA 5DHYA 5CD3A 4XHJC 1WZLA 4HH9B 3RZCB 3QYCA 4JLRB 4XP4H 3ZKNC 3V4UH 3NIFF 1CICC 2R4RH 3K1KC 2AV7B 1UWEL 5BZDA 3I50L 3O6KH 4NDMB 2YS4A 1OQOA 4R7NB 4NWTH 2XICA 5GGUB 1BAFL 2CXGA 4I2XA 3UTPE 2B4CH 1AGEA 3BXNA 3NABL 4O9HH 3VFUB 5D8JL 4NRYB 3MSPA 3OKOB 4WVRA 4P9HL 4QF1A 3H3BC 3BPOB 3U1SH 3MV9B 1L0XA 5FYJL 5DGRA 1JYVA 1IC7H 4JPIA 4BSWB 2AW2A 4P5TC 5DTFB 2LAAA 2YR3A 3V6BR 5DT1L 1LO2L 3VXNB 1DDHB 3VCLB 3ZSTA 3GIZL 4P2OC 1QD0A 4M9PA 35C8H 3QUZC 5I1KH 4M48L 3BMVA 1CE1L 4HIEA 3MJ8A 5A2FA 1NCDL 1ZA3A 5T3ZD 5C0CB 2R2EB 3BZ4B 3MOAL 3QEUB 5CJQH 4Q9BA 4HPYH 2OS7A 4U2ZA 4X6CE 1S5HA 1RUPL 2YA2A 4WEUD 3SKOA 4XMPH 1UVQB 3DARA 1DBAL 3UJTH 4DKEL 1CTNA 2PNDA 1XGTA 2R2BA 1AO7D 2JJWA 1UZ6F 5HY9B 3ZDZE 4NPYA 3IFNL 1U8KA 2IBZY 4HBCL 3DX8B 2Z8WC 3U0WH 2UYLA 3BFOA 2MCPH 2VQTA 3P9LA 4EXKA 5BRZE 5D2LF 3FFDA 3QISA 1CD0A 4NN5B 3F7VB 1BEYH 4J4PA 3ZE2E 3KYNB 5JHDE 3LKQA 5C3TA 4HIXH 5F97E 1MCNA 15C8H 3GMRA 3RVXC 2WINB 3ZMRA 3IFPA 4DK6A 1Q0YH 5FKPA 3V6OA 4V1DA 2XPGA 1KJVB 3O2DL 5C09E 4PRHE 4I9WD 4Z78B 2FX9L 3RWIA 3ALXA 3BHBB 4Y1AB 4YO0B 5EU7C 2I24N 2XXCB 4FFYH 1RVFH 3OHXB 2NY0C 3GEWB 3SDCB 4ZUWB 4PJFB 3WFDH 3VFPA 3NTCH 3FRUA 1A9EA 3P0VL 1T89C 3TIEA 5E2VH 3VGDA 2AS5M 5JO5A 4JEGB 3QDJD 3QUML 1B2WH 4YXKL 4KU1A 1VGEL 5IOPA 3WCYA 4I18A 1P6FA 2YKLH 3QIWC 1PKQB 3VWJC 3PJSB 5HYEA 1PW3A 3SKMB 4XVJL 2W60B 2CGRL 5KSBA 1KULA 1LNUA 4G9DB 3OAYH 5F6IB 1A6UL 4LLMB 1IKNA 4XWGL 2CQVA 4V1DD 4PJCB 4D0CB 5CZVH 2O5XH 3MLWL 4YDLB 2VLKB 1M4KA 1XGPB 2D0HA 4H1LG 5DFWH 4X6FB 2ESVE 5IM7B 3B3IA 1LK2B 2MOVA 1DE4A 2N4IA 4R96A 1PKOA 3MCLL 4O2EB 2HJKB 1UB6A 3STLB 2IPUK 1EMTH 2VZSA 2R1XA 4CN6A 1Q9OA 2W9EH 5KVMC 3PGFL 1MCQA 2BOBB 4P5MB 4BH7B 5K9QI 4LKXA 3IF1A 4NNYB 2GY7B 2V2WA 1MQ8A 1G9NH 4KHXL 4F2MA 3MRNA 4LSRH 3QSKB 3GUTB 1ZGLB 2WQRA 3L9RB 3CZFA 4F7CA 5C07B 1ITCA 4JPVH 1IGCL 3HI1A 3GO1L 1QUNA 5CGMA 1MLCB 2XN9D 1RHHB 1FH5H 3MRPA 2FCBA 1T5WA 4K55A 1FZKA 2ZG1A 1P7QA 2DI8A 3H9SE 3TNMB 2A77H 2O26U 2VN7A 5ICYA 3QR2A 1PY4A 5C7XL 1K2DA 4OI8A 1R24A 3SKUD 1S78C 3GBNH 4OM0L 4NOBA 2IC2A 4NHCH 2EDRA 2JTDA 1CDBA 4V2CB 1BQHG 4ODSL 4PLKC 5IB2B 1TETL 1YMHB 2P5WE 1FBIH 4DEPC 3RA7H 3C87A 5IHLB 1YN6A 1DBBH 2Y5TB 4NBYB 3OKMB 1RJZB 5J9PB 3FO0L 3Q3GA 4CRPA 1J86A 1G0XA 1AJ7H 4NKIL 3VG9B 2YD8A 5GS0D 5EDXA 5DUBA 5HYSB 1DQQA 2EDKA 4RIRA 4UDUB 4RAVB 3VG0H 1P7QD 1JGEA 2HVJA 1JYNA 4TUJA 1IGIH 1NGWB 5HJ3A 4ELMB 1F6AB 1GVIA 1LK3H 2GITA 2R69H 2XG5A 4MXWL 4F15B 3QB7C 2X4RA 4G6KH 4NQEE