4GBXD

Crystal structure of an immune complex at ph 6.5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
191
structure length
191
Chain Sequence
FVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPSEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTDRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DM alpha chain
publication title Crystal Structure of the HLA-DM-HLA-DR1 Complex Defines Mechanisms for Rapid Peptide Selection.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gbxD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gbxD01
1JMZA 1IM3A 2I9TB 3LDBC 3GFUA 4OD2B 1U8IB 3WUWA 4J3OC 4CAGA 3V6OC 1LE9B 4K94L 4O4YL 2BNRE 3K8LA 1YNTA 4OCSL 1BBDH 4H5SB 4KKLD 4ZAKD 1U8OB 5INDA 2EIZB 3LPFA 1BX2A 5D1ZD 1T80A 3B83A 1T89A 1WAAF 5ACZA 5FHAH 3NIGF 5TPWH 4YGVA 5I76A 1CE6A 2YK1H 1MJ8L 3LMJH 3IVKA 3H9HB 1W8NA 1PAMA 4IDLA 5HGDB 3LN9A 5KN5B 4NQED 4NNPH 2BNQE 1MUJA 4JPWH 3OXSB 2VE6B 1B0GA 5ID0A 4ZFOB 1C08B 3MFGB 2HJLB 4XVJH 5ERWA 3DVFA 5AG8A 2YUVA 4MAYB 1X5JA 3NH7H 4IEFB 4G9DA 4EQ2A 5DJ8B 1AJ7H 5I30H 4XMKL 1B9ZA 5L2KB 4NQXB 4HG4J 3RU8H 4RISL 1EBAA 1IL1B 1O7VA 2PTUA 3QUMH 1KEMH 4PJGE 4BFBD 3VW3L 1L0YA 5IQ9B 3LS4H 2BNRD 3VWKD 3CVIL 3LRHA 1PEZA 4LRIC 3RKPA 1JPGB 4PGBA 4ORGA 4V1DA 3KPLA 2K7QA 4C4KT 5CJXA 3G9AB 1T83C 3DRTB 1TPXC 5KS9B 2LQRA 1YEGL 3X3GH 1ZA6B 1Q9LB 3G5YA 3RL1B 2V2TB 4PB9L 2V7NA 2BNQD 4JGUA 4Y5XB 1AD0A 2X70B 3HZKA 3P40A 5AYUL 2BSTB 4GW1B 2EXWC 1XCTA 4XCCH 5EU7E 5JW5B 3BJLA 5BCAA 4X7TB 1XIWD 1ZHKA 5KVFL 5H2BA 4PBXA 4NRXB 3LSOB 3C60C 2XXCB 3WCYA 2WWKT 5TF1L 5F3BB 4OD1H 4MCZB 1BZ9B 2R0ZH 1FL3B 1OAKL 2VQUA 3CSGA 3O6FD 3RGVB 4EEEA 4ZFGL 1X5KA 8FABA 3UO1H 3VXSB 3OJDB 4XH2A 4GRMA 2V5SA 3BPNC 4U0RB 1P7QA 1X5XA 3MRGB 3RWCB 2AV7B 3CK0L 4XPGH 1FCGA 4XX1E 3MBXL 1GC1C 4XXDB 4Q9RH 2AK1L 4EI6A 5JTWA 1YEKL 5M95B 1N4XL 3VFSB 3VFVB 5LJYH 3K1KC 1EVTC 2ZG1A 3VXUE 5CBEA 1IM9B 5C0FA 4NN6C 4NQCB 3BT2L 1J0JA 3UTPE 4APQD 1MLCB 5C2UB 3BXNA 1VFUA 5E99L 2VXQL 3LEVL 5IESH 4NKIH 1WT5A 4XZUA 1CGSH 3I02B 4Z78A 2PYFA 3KXFE 1DBAH 1S7XA 4DVBA 5I73B 1WGOA 1SJVA 1GC1H 5K9QI 3WIFA 1T2QL 3P73B 4YNYA 4EBQL 1QSFE 3E8UL 1BLNA 3H6JA 5IVXA 1J1OH 1G0XA 5C8JA 2WW8A 4R6UA 5EZIL 3FO1A 1BD2B 3WJLC 1NANH 1T7WA 2HLAB 2J8UA 1H0DB 1TNNA 5E00B 2LFGA 1AQDA 5DFVD 5FKAB 2LV4A 4K7FA 5DWUH 5F3HA 4EN3A 5CEZH 5I8OH 2D0GA 4F7CA 5I19L 1RZFL 5DJCA 2EDJA 1ZGLM 4IOFD 2EDFA 5T1DH 3VXUD 3G04A 2AJUL 4NP4H 3DX7B 3UTPD 4Y1AA 5IMMB 4NGHH 1N6QH 1PG7H 3PIQB 4N8CH 2FX9H 5GGSB 3VXME 2WIIA 1KTDA 3CX5J 1M05B 3Q3GA 4FN0A 4X4ME 2IBGA 3PGDB 4LFHG 4PJDF 4I1NB 3KXFD 1NDGB 4ENED 5TE4L 5IMKA 2XA8H 1G7HB 4LCCC 5FF6B 3OGCB 1FGNL 4MNGB 3SOBH 1N6VA 3C6LC 4BSJA 3O2DH 1QSFD 4JZOB 3RKDD 5BZDA 2EDLA 2J4WL 3NA9L 4WCYL 4UUJB 1CG9A 3SCMD 1NKOA 3X11B 2XACC 5C0IA 1F90L 5I1LA 1MWAH 3ILPA 4ZSOA 2PF6A 3N1FC 2BDNL 1HIMH 3VRIB 1YJDL 4U1SB 1IQDA 5HJ3B 4O51A 5I15L 1IGCH 1NAMB 4PLJD 5EFIA 1MFAL 5CEYA 2VZ1A 2ZOKA 3MROB 1UWEH 3RWDB 4IOIA 5J56B 4DEPB 2QSCH 3KYAA 5ICZA 4RNRA 1YEFL 1RPQA 1JYXA 5T3XH 2W65A 3VXMD 3OAUH 5JORB 1LO3L 1BOGB 1CICC 1QSZA 5DMGD 3BP5A 1F3DH 2VZVA 1MCKA 2GW5A 4XNZC 4LSUL 4KMQA 4PJXA 4Z0XA 5EO1B 1BFOA 4LSQL 5EBWA 5L0QB 4I77H 3BEVB 4FZEH 5HHOB 1BVKA 2E27L 4KDTA 1HHKB 1FVEB 4ZXBB 3EYOA 4U1JA 5AZ2H 4PRAA 1G6RB 1CDUA 1T6VN 3SDXE 1YYML 3QIBB 3SDCA 4M7LT 1LNUB 5SV4A 1EPFA 4RFNC 3RJDA 4YZFE 4H1LH 5BO1L 1EAJA 1HSBB 1LILA 4Y4FB 1ADQA 1AE6H 4QF1A 1I4FA 4CW1B 2BVPA 5F9DC 1EUTA 3EOTL 2A73A 4IJ3B 4XVTH 1MOEA 1T0NB 3EYVB 4FABH 3HI1A 4I0CC 4P59H 2JB5L 1ZLUK 3ULUC 4GAGH 4WEBL 2FO1A 1K4DB 2IANE 4G9FA 1H8OA 2A6KB 1FH5H 3VCLA 1PEWA 1T1ZA 3OXRB 3SE4A 2X1XR 4OCXL 3WFEL 1ZLWK 3NVQA 3O8XB 4KJPD 3GJFH 5I18L 5TJWK 1IC1A 5D1ZB 4HMDA 1N7ML 4NJ9H 4X6DF 2CKBB 3G6JB 1RVFL 1U95B 4DZ8A 2CO7B 2WBJD 4MWFB 3F12A 2NY1C 2EYSB 3HR5A 1O0VA 2FB4H 4HIIB 1F6FB 4NQEB 2Y6SC 2OXGA 2Z8RA 2YN5A 4KTDL 1TLKA 3OL2A 1AFVL 3BZ4A 3UP1A 1UFUA 3G08A 3EYSH 2BVEA 4X5WB 1T4KA 1OCWH 4FQPA 1AI1L 1BM3L 1FDLH 5GGTA 4UINL 1HZHH 5HGBB 4OUUB 3FZUD 2IAND 4ODXA 5ADOL 5CEXA 4JRYE 2R4SL 4U1LB 4F7PB 5C0AD 4O5LL 4LNRB 3VWKB 1IC5L 1RK0B 5I1AA 5TQ2H 1UJ3A 1PG7X 4S1SH 3V6ZB 2ICEB 4U1MB 4RGMC 4QHMB 3HUJE 3N0PB 4HDIA 2FX7L 1KENL 3GHEL 1X5ZA 5D1XC 1CGXA 3O4OC 5C0BA 4JY4B 1RK1B 4HHAB 5C09B 2BNQB 4OB5H 5ACLA 1L6XA 2R2BB 3H0TB 4GJTB 2WP3T 3SHSA 3QDME 3WBDA 5C9JB 4FG6D 1VPOL 1T5XA 5K33A 3V4UL 2NCMA 1YY8B 1RIHL 4EDWH 3HHRB 4K9EL 4M61B 4WU5B 4NWTL 3PDDA 4D9QE 3EGSB 1IQWH 1F3DJ 4HKZB 3BKML 4R3SB 4EUPA 3CIQA 1FAIL 3FOLB 5DR5L 3W9DA 2X42A 1FPTH 4JRYD 4PJGB 5ITFA 4JFXB 3KDMA 2VN7A 5CP3A 3D0VB 1SYVA 1NUDA 2ORBL 3MNZA 5DSCB 5IOPA 4LLWB 4JDZB 3SE3C 3QFJA 3OPZL 2IPKA 4P9ML 5GS2D 3LVEA 4KHXH 2NY3C 4AEIL 4Y5YC 1YYLH 5E2UL 1KIQA 5EO0A 1JFQL 2FGWH 2ZOLB 1WZMA 3I75A 4L29B 3L5XH 4U33A 4MNQE 3MLZL 6CGTA 1IGYA 1FV1A 1PJ9A 1HOCA 4BQ8A 4M8VA 1H15B 3DGGB 4V2CB 3IDJB 1QVOB 3IFOB 3CXDH 3QDMD 4IIQB 2R0LL 4I2XA 4LLDA 5DUML 3O3DB 1V05A 2QEJA 3HS0B 4D9QD 2PTTB 2IMNA 5B4MD 5CD3A 3AM8A 4HLZG 3RTQA 3U48A 6FABL 4B0MM 5IK3B 5FHBH 1SYSA 4OLXH 4U6TA 1JV5A 1NMBH 2YBRA 4YHYC 2GJZA 4XTRC 3L3OB 1J8HE 3VXOB 2BP3A 4M6OH 2VLRE 2GCYB 4PJEF 5D70L 4PRBB 2I27N 1FRGL 3O3AB 1CFQB 4G6FD 2V9QA 3U4EB 3UJJH 3QUYA 4MNQD 5HVHC 1U8HA 2F9BT 3CVHB 3Q2CA 4HWNA 2PO6D 3SKNB 3W2DH 1HYRC 4BH8B 3QI9D 4MNHB 1EFXD 5IWLA 1BQSA 2VABB 3V4VL 3MRFA 5DVMA 4YHML 4LKXB 5KVGH 2BVYA 2Q1EA 4ZAKA 5LGHL 3PABB 5DEGB 3VXUB 5JR1L 3QEHB 2EDEA 1QKZL 1NCAL 3CX5K 1C5BL 1CBVH 1KIUA 3H42L 2MQ0A 3WHXA 4OQ1A 1S7TA 5LGJB 3VD9A 2B1AL 1R5IA 1QYGL 2DJSA 1I8IA 2RIKA 3KXFB 3MNWA 1OGAE 1KJ3L 2GI7A 2VQTA 5J3HD 3QA3A 4P5TA 4S2SA 4NT6B 5FIEA 1J8HD 1IGJA 3VA6A 4UV7H 1OW0C 2Y36H 4NNXB 2VLRD 1MHCB 1QSFB 3GNMH 3VFGL 5JXAH 4ZUWB 2UWEA 3FFCE 4XPBL 3SCMB 3ZKNC 3F58L 3LQAC 3OKMA 2Y06H 1T1XA 2VZSA 1VEMA 1G6VK 2X1WL 1MHPH 3BI9X 3WKML 4ZFOL 2BNRA 2Q20A 3KG5A 3WL9A 3NFSH 4P2OC 1J1PH 3K0WA 4GLRI 2BSRB 1CXFA 1DQJA 5J12B 3H7BA 2O5XH 3VRJB 1EEQA 1EBPA 2Y5TB 3P9MA 3VXMB 1WWWX 3EO1A 1A1MB 2QLVB 3LQAH 3L3IB 1KCRH 2O5ZL 2EECA 2E3VA 5D6DA 4PJ8C 1OGAD 3LPGA 1NC2D 3WO3B 3U6RB 2R0KL 2A1WL 3D69A 4FQXD 3SBWC 4M48H 1OT1A 3FFCD 3ROLA 1XIWA 3IJHB 4JQVA 5T3ZH 3RI5F 2HJFA 2VLJE 1NFDA 3EO9L 3SGJA 2OL3B 3VH8A 3KNBA 4QHUA 2OTUA 3SDAD 5JW4Q 1PD6A 2V9RA 4P4KD 4E5XA 4ZTOL 3O6FA 1J5OL 4KUZL 1S9YA 5INCB 5F96H 3HE7B 3L5WB 3MJ7B 3QDHA 1U58A 4PG2A 4XAWH 2P5EB 1KB9K 4NUJA 1D5XA 1AGEA 3MV11 2X4OA 1MSPA 3DVGB 1AGDB 1IT9L 4NZDA 1NJ9B 5CGYD 3NFPA 2LU3A 1OM3H 4HUKB 4XMLH 4X7SL 1UB5B 4N0UE 1EDQA 2X6MA 2DMKA 1F4XL 3MLSL 4KJYA 4F9LC 1ZWIA 1FIGH 2DWDB 1F2XK 1ADQL 3H3PH 4PTTB 4ZOCA 3W11D 3FQXA 4FXGB 4J3SA 4APQA 1E28B 1OT2A 2OTPA 3PGFL 5C07E 3DX6B 4P2RE 4R7NB 3RDTD 2VLJD 2HRPL 3I50H 4KMTH 2WBJB 3OB0K 2X4UB 4JG1L 1MEXL 4KV5F 1X5IA 4OGYL 3DECA 3GGWB 1LWRA 1U92B 5EIIA 4L9LA 4JY5L 3MZTA 5TGBB 1OWWA 3KPPB 1Q0YH 3VWJD 4WJ5A 1AD9A 1KFAH 2C26A 2FCBA 4GKOA 1E4XH 1JUFA 3UPCA 2Q3ZA 1LGVA 2YPKB 2IANB 4KGLA 5HYQB 3TPUA 1Y0LA 3ARVA 1ODAA 4K7PY 4KY1L 5C0AB 5JHLL 1FZOB 1OVZA 1BZ7B 3SDDA 4JPVL 4HT1H 1KCUL 1KGCE 1JRHL 1OAYL 5C07D 3WNKA 1QBAA 2BRRL 5JA8B 4ZODA 4P2RD 2ZUQC 1XCQA 3MRQB 5HHXL 3TBSA 4U1NA 1KN2H 2XRAL 1S5IH 4HPOH 5D9SB 3F7QA 2XY2A 2UY6A 4O9HH 1IKNC 1VADA 4CVXB 4X4ZA 1CFTB 5CIPH 3RPIA 1KNOA 4G6KL 1X6NA 3EDJA 3JV4B 3CFBB 4D8PB 3AREC 3QO1A 3EHBC 2BMKA 4RQQA 4F58H 2EXYC 2C7UA 1FBIL 4OIIL 1SY6H 2V5RA 3B2VL 1YN6B 4Z7OE 4JRYB 5E5MA 5FUZL 4UT9L 1I7UA 5CUSH 3OR6A 2H2SD 2R2HB 5GGQH 4HC1A 4X80L 1KGCD 2AGJL 2HFGL 1X5LA 3PV6B 3HUJB 1WITA 3MJGX 2OK0L 1Q94B 2DQTL 1NAML 4N8VB 2IH3A 3BMVA 5FO7A 4CU6A 2DQIH 1RUQL 3X14A 1A7OL 2YXFA 1YPZA 3VGAC 5JPMB 4AT6B 4PV8A 4S1QL 5FOBB 4N90E 2DMCA 4PJBA 3QYCA 1E4KA 1KJ2A 4IRSA 4U2ZA 5FK9B 4NZTL 3ZDZF 1G7JA 4L8SC 2YEZB 1CD0A 4GBXA 2R1XA 4MX7A 2ZG2A 3MLTB 1DZBA 3WXVL 4H8WC 4MD0B 2D03H 2DBLH 3B9KD 5IB2A 2L7JA 1E6JL 5KVDH 2DQDL 2BY3A 2W1NA 4Q6IB 2P24A 1CDGA 2R1YB 3N9GL 3K81A 4QGTA 4D0DA 3EZJB 2HT4D 1XR8B 3FO0L 1T2JA 2CLVB 4G6FB 3MRJA 1CWVA 5IB4A 4J3UA 4MNQB 3RAJH 4MJ5A 1G6RL 2PO6B 4DGIL 4DW2H 4M93B 1EFQA 2A6JB 2ED9A 1G7LA 3MRDA 2PYEE 4LLMB 5FA4B 4AG4L 2CRZA 4Q74A 4JPIA 3S9DB 4HFUH 3X13B 3QIWD 2DKSA 2G60H 4ONGL 1YQ2A 3MRNB 3S4SB 4DKDC 1MVUA 4N90D 4PP1C 1HN1A 3MRRA 5GISL 4BSWB 5KSAD 1UCTA 4G42B 1FZJA 2NXZD 5EORH 1IGTA 5IIEB 4MSWB 2FLBT 5F7UA 4C59B 4ODTH 3SDXA 3RZCC 1GAFL 1WEJL 2V5MA 3MX0A 4TUKH 5CHNB 5FV2A 1SBSL 2VR9A 1J8HB 1CFVH 1I85C 3HNTH 5ANMA 2VLRB 2FJHA 4PJHF 4O2CB 2HFEA 2IPUK 1OAQH 4OI8A 4E0RA 1FO0B 3BGAA 4YQXH 3VXTB 3CZFA 3OBAA 1NBZB 4KK6C 1MCWW 2PYED 1UKTA 3BDYL 3CFCH 4P3DB 2XIDA 4Z7UE 3AAZA 2XTJC 4UV4L 1G7QA 4BH7A 1FNEB 3TT1L 3RNQA 4K94C 4OFDA 3ULVE 3OZ9H 1I1AC 4QXTB 1MJ7L 4PUBL 3PL6D 1Y6KR 4FQLH 4LLVB 1NFIB 4P2YA 4XNUL 1FVCA 2CR3A 4I3RH 3ZO0A 1KPVA 1N64L 3MYJA 5HTSA 1MFEL 1T21B 3NCFB 4GS7B 5I2IB 1F4YL 3BWAA 2ITDA 1JGDB 4LSTH 4Q0XH 4XI5C 1NC2B 4Z76B 4NN5C 4PGCA 4PJCE 1IZJA 1UQSA 1SVZA 3SKOB 3F7YA 2CDEA 2VQ1A 2BSED 1INDL 2H8PB 3FFCB 5CZVL 2VUYA 1K5NA 2BNUA 3F62A 4Q97A 5CAYB 4LHUB 4RIRA 4K94H 4O4YH 4KK9D 3NIDE 3HC3L 4OCSH 5HXMA 5ENWA 3SDAB 3OF6D 5A3ID 4P4KB 4HKJA 2NW3A 1Q9KA 5E8NA 1LE5A 4QHNA 4TOYL 2JF1A 3VXPB 3WV0A 5C71A 2KBGA 1MJ8H 3ULVD 4I5BB 2PW1A 4BQ6A 4MXVF 3ZYOA 5FGBC 2B8OT 5HI4D 1DN2A 1HHJB 1BX2B 2QADD 3QJHB 4CN6A 5D71L 3LQZA 1DN0B 1NGWA 3ZHKA 4PJ9D 5I9QB 3VFRA 3T77A 3CCHA 3GIZL 3RVXD 1RJZA 4HUMB 4RISH 3RNKA 5T5NF 3VW3H 2J8UF 4J3TA 1OTTD 3ZDXE 3STLB 2A9NL 3RDTB 3CPLB 2VLJB 4HWZA 4WI2A 4I8DA 2FYYB 4HIHA 3CVIH 4F33A 2V7HA 1INQB 2G5BA 4WI8A 3TN0C 4YDLC 2VRAA 1CDBA 4NQTA 4JZJA 1YEGH 4L4TE 4NC1C 1VKXA 2J1KA 2Q76A 5JOEA 5IW1A 3QUZC 5LBSH 4PB9H 2VNCA 3VWJB 4FFVC 1A6WL 3BWUC 1Z9MA 5GXBB 3KPLB 4U6XB 3QI9A 3V6FA 1EFXA 1DUZB 2BFVL 5AYUH 4Z6AT 1VGEL 1W0VA 4PJFE 3RVUC 1GZPB 3G5YB 4NZJA 4Y4HD 2D7NA 3JWOL 3P77A 3ESUF 4F3FB 2ARJQ 3BX7C 5KVFH 1HINL 1XF2A 3MRIA 1AKJD 4XPAL 4QHLA 3QEQE 3ZE1E 4NQDA 2GAZA 5B8CC 5TF1H 2WK2A 5FDYA 1BFVL 1ZVYA 3CVHL 5C07B 1H3WM 4M3KB 5E8OB 3ARBC 4P2RB 3HZMA 3HLAB 3LKSB 3ZKQD 1RZ7H 4LLYA 3P11L 1OAKH 2H32A 3IRZA 4XGZB 1UA6L 3T0WA 4C56E 5TDOB 5SWZE 4ZFGH 4P48A 4WY7L 2GITA 4L4TD 2Z92B 2X2YA 4Y5VB 5F1IB 2R23A 5KS9F 4RBPH 4NOBA 5EU6E 5D5ME 3CK0H 3O9WC 3RIFF 3MBXH 2AK1H 3DUUB 2VLLA 1YEKH 1N4XH 3NN8B 3FQTB 3CLEL 4OD3L 2R29L 2XWJB 4U1IA 5HDBF 4HKXB 3V6OE 3BN3B 1UC6A 3BT2H 2JK5B 4O00A 4MVBD 5EPMB 4PLKD 1AO7E 4PREB 1JWMB 1WFNA 1EEZB 2DM7A 2GK2A 1NDMA 2P8LA 5E99H 1P53A 3FB5B 4PD4J 2VXQH 3LEVH 3QEQD 1DDHB 2OP4L 3CH1B 2H9GB 4WUUB 4Y2DC 5LAXB 4YR6B 2P47B 2LTQC 1T2QH 1OGAA 4QRUA 1OQXA 2IC2A 4C56D 5CLTA 5D7IE 3E8UH 3PGCB 4L8CA 4NO2B 5SWZD 4TPRH 2FD6L 3EOBB 1AY1L 1WK0A 5C0DB 4FQXA 5EZIH 3ZE0E 3KLDA 5BS0E 4QT5B 1SQ2N 4S1DD 3D2UD 1BMGA 1UWXH 5EU6D 3QNYB 5BZWB 4QWWC 1TITA 2SEBB 5C6TL 5I19H 1RZFH 1SHMA 2FECL 2W0KA 2AJUH 5EUOE 1QEWB 1OTSC 3B9KB 3GIVA 3GMPA 4KWUA 3GK8L 4PRIA 1TFHA 1T22B 1AO7D 1MRCL 3U2SA 5T1MB 4HEPG 1ZT1B 1KJ2L 5DC4B 3WLWC 3T1WA 4C57C 2OL3L 4LASL 5TE4H 4PGDA 3V79C 4UQ2B 1FGNH 1JYNA 5DHYA 4QRRE 3NIFE 4Y16A 4GH7B 5EC1A 2J4WH 5FV1L 3NA9H 4WCYH 1B88A 5F6HJ 4QNPF 1EJ6A 2F5BL 1F90H 4GQPH 4Y88A 5DT1L 5BS0D 3QIWB 4F57L 2BDNH 5IHBA 1YJDH 3TM6A 5F1KC 3TH2T 1P5UA 2Q87A 5F9OL 5I15H 4O2EA 4DK3A 3DBXA 2NXZB 3SGEH 1MFAH 5I17A 4JY6A 1KXVC 5EOQL 2Z31A 1J1XL 3GSQA 1RZGA 2VDML 3OGOE 2M26A 4E41A 1YEFH 1BWMA 5TDNA 5B39B 4L3CA 1FFPA 5JW4R 1LO3H 2D0HA 1A7QL 1DUYB 4FQHB 1LEIB 3FAXA 3QG6B 3QDJA 1U8LA 1CZ8L 2QQKL 4OIAA 5D7JA 4DFHA 4N0UA 5ICZB 4JKLA 3OKOA 4AH2A 2O93L 4LSUH 2FH8A 3RX5A 2PYEB 1AXSB 1DLHA 4OSUL 4WO4D 1U8JA 2FJFA 4LSQH 4OZ4A 4YC2C 4M1CC 4JFEE 5I74B 4QRPE 4Q7DA 2W0LA 2E27H 1T0PB 3NCEB 4LHQB 1B6UA 1MCRA 3PP3K 3MODL 4W6XB 5IFJB 1EZVX 1WV7T 1YYMH 3B9VA 4PYHA 5T1KA 3S7GA 1YZZA 5EZLB 3S96A 5HGAB 5BO1H 5I8CB 3WDHA 1XF4B 4BUHA 3EOTH 1QR1B 4NCC2 1U36A 1YMME 2B0SL 1NBYA 5D1QC 2JB5H 1T0MB 4WEBH 3E3QE 1U6AL 2X4SA 4JANA 1DQDL 2GTWB 5C6WH 1I7TA 1H3XA 1P5VA 4LP4A 4OCXH 3WFEH 4YO0A 5I18H 3MRHA 3LZFL 1N7MH 3C5JB 4UBDC 5CWSB 1B0RB 4G8GA 4JFED 2IALB 3V0VA 4HJGA 4QRPD 1RVFH 4GXVL 1LK2A 4OLZL 3EBAA 4HX1A 4MDJB 4DAGL 3ARUA 2VXSL 4HXBL 1D5ZB 1A1OA 1L7IL 3QRGL 2IG2L 4KTDH 2QADB 2CUHA 4YBHA 3B8SA 1AFVH 3QDGB 4KK8C 3TCXA 1Q9WB 1WVZA 3HCVB 1H8NA 2APXA 1I8LC 1M71B 1AI1H 1BM3H 1T7VA 1YMMD 1KXQE 1U3HB 4UINH 2W0FB 4LPVA 3FMGL 4JO3L 4PRDA 5D2LE 5ADOH 3MRCB 2R4SH 2UZIL 5IGXL 4OZGE 4O5LH 3LKNA 2P8MB 1II4E 4JDVB 1CCZA 4PJ7E 3OKLA 4NRYB 5C0ND 1OF2B 1IC5H 4AEFA 4YFDB 2X7LB 5JXEA 4WHTA 1P7HL 4F80A 4TSAL 3HPJA 4K9EC 1SVCP 3HB3D 1E4JA 1CGTA 5CSGA 1JVKA 5IEHB 1XF3A 3G6DL 3FTGA 4ZUSA 2WWMD 2Z93A 1J86A 2FX7H 4HUVA 1KENH 3GHEH 3G6JF 3IU3B 4UMGA 4C83A 5D72L 3X17A 1NH6A 3FB7A 4LK4A 1R5WB 2BOBA 5I66A 4RAHA 3BH8A 5ESQB 5EC2B 4H1LG 1VPOH 1YN7B 3CFEB 1K8DA 2DM2A 1U8KB 3V4UH 4UB0L 4R4BA 1RIHH 4Y4HB 1S7SB 5J9PA 4K9EH 3WO4C 4NWTH 5F7MC 1AKJB 1ORSB 3BKMH 2UWEF 4F7MA 1FAIH 3HTLX 5DR5H 2W9DL 5E8PA 3FQWA 3VFUB 2ORBH 4ONFL 4P57B 1T7XA 4P2QE 4K7PL 3RRQA 1T3FB 3KPNA 2E6JA 1R3LB 3OPZH 1PKQA 4P9MH 1CYGA 3ZSSA 3TFKC 1U8QA 3SPVA 5E2UH 1D5BA 4JFZL 3TESA 5GGRB 3MLZH 2VL4A 2C3GA 4PRPA 3BKJL 3O81A 3LH2L 1QFWL 3ULUE 1FYHB 3QHFL 5IB3A 3FFDA 4CUCA 5IT2L 2R0LH 5SX5K 5DUMH 43CAA 4PJFB 3RVWD 2KKQA 3DETC 3RL2A 1BQHB 4G80A 4GAFB 4P4RA 4ESKA 6FABH 3QEQB 4TTDC 1FO0L 3LS5L 4OGAC 3PL6A 2WBWB 4DN4L 3O3BB 1CU4L 3K3QA 4PJGF 4KTYA 2NY6B 4P2QD 5CJOL 4H88L 5F97E 4YX2L 4C56B 4GRWH 3OKKB 2ADGB 5D70H 4J8RB 1QBMH 3EDDA 1FRGH 3ECBB 5DK2A 5H37G 3WFBL 5ID1A 1FFQA 2YBRB 1C16A 3D2UB 1NGXB 1A9BB 2ED7A 2YHGA 2EC9T 5D5MB 3TO2B 3CFIC 5DD3L 2DQJH 3V4VH 3GSWA 3S35L 3ULUD 3HG1E 1BEYL 3JWNC 4ELKB 1EGJL 2ED8A 2IPUG 4TTGA 3BZFA 2VITB 5LGHH 3H9SA 2WP3O 2A6IB 4Z7UA 4ETQB 2E9JA 5JR1H 3JV6B 4J4PD 5IKCB 2PW2A 1QKZH 4X83A 2Q86A 1NCAH 1C5BH 5CGTA 3H42H 1AO7B 3PWNA 2H1PL 5K9KB 4PGEB 1W72A 3SKMB 4MCYB 2B1AH 4FXKB 4GAYB 1QYGH 2IAMA 4QXWA 3BEWA 4R0LA 4S11A 5JLZA 2ZSWA 3P0VL 3MMEB 1CDCA 1KJ3H 2F8OA 5H8DA 3QQ4B 5BVJB 5AUMA 4LIQL 1SJHB 4XNQB 4KGJA 1PFCA 4OCWL 4I4WB 5D7IB 3QB7C 3VFGH 3B2UD 4PR5A 3U7WL 1S7TB 4PJ9A 5KSBE 1R5IB 4XPBH 4OGZA 3MGTB 4LL9A 5D6CA 3F58H 3RVTC 2EKSA 5BS0B 4QCIB 3G9VA 3MRKB 5JMOC 3WKMH 1IGIL 1A6ZA 4YHLL 4JO4L 1HHGA 3HG1D 4MD4B 4N5EC 3U4BL 1AR2A 1W0WA 1NANI 2EC8A 1TZGL 5IV2B 5EUOB 3I6LE 1TENA 1QRNA 4OTXL 5DHVB 2QSQA 2NTFB 3T04D 4JFFE 7FABL 2CKNA 2W60A 1A21A 1R3JB 3REWA 3KWWA 5BXFA 3TPKA 4BYHA 3EOAA 1KN4L 1I7RB 4OCMC 2XOTA 3MRPB 3FO9A 2PKDA 1I1FA 5D1XD 1TDQA 2R0KH 3L3KB 5C7XL 3MCKA 3P9MB 5DD1L 4E9LA 3DJ9A 4WO4B 1ZVSA 1JGLL 4DFIA 4FA8A 4WTXA 2R9HC 3BGFB 3EO9H 4HWEH 3FQRB 2ICWA 5FFLA 3RGVC 1NUGA 3QEUA 5BJTA 4L5FL 1KACB 5IHZB 1OHQA 4ZTOH 1V7NL 4U0RC 1A6AA 3ROLB 1J5OH 4W6YB 4KUZH 3IGAA 5GGUA 3MA7B 5EULV 1S7UA 4G8EB 1B90A 3L6FB 4JVUA 3I6LD 4L4TA 4FFYL 3CXHK 4LSVL 3VH8B 1Y6NR 3BPOB 4TSCL 1CF8L 1YC8A 1X5GA 2OTUB 1IT9H 4JFFD 3VFOB 4YK4C 2NY3D 5LWYL 4MHHG 3Q1SL 3WYRA 4KKBD 3W39B 4LCWA 4X7SH 1F4XH 3MLSH 2BCKB 1NGYA 1UWXK 3C87A 3GM8A 1D5XB 2G75A 1ADQH 4L8DA 3DXAE 4TNVF 3DROA 4X6FA 2UZXB 4PYGA 4G8FA 1CTOA 3DV4B 3PGFH 1RAMA 5I73C 3C8KB 4JFEB 4X99B 4QRPB 2HRPH 1F58L 2AV1B 3ALXA 2NXYD 5FUOL 4JM4L 2OJZL 3DMMD 1KPUA 5DHXB 4KJYB 2EDYA 1MEXH 1QFUL 4PRNB 4OGYH 1HI6A 4GQ9L 1D5MA 3LRSB 3ARDD 1TVHB 4AIZB 1DVFD 2A83B 5SWZA 1B2WL 4N1EA 4JY5H 1WCBB 5EWIL 4KRPD 5E9DE 3QH3A 3DARA 3MPCA 4PGZA 3BIKB 3QFDA 1PZUB 3LCYA 5EU6A 4U3HA 3GMLB 2FIKB 4G7YL 1YMMB 4D94A 1ORQB 2FBJL 4IRJD 3FN0L 1ETZB 4P46C 4R97B 3T2OA 1M6OB 3UYPA 4LKCB 3OKEA 5EBLA 3V6OA 1KCKA 5JHLH 4HS3B 5I1KH 1ED3A 1A6VL 5FEBA 4JPVH 3DXAD 2AXGA 1DBBL 1KCUH 1BIHA 4JPKL 1JRHH 1OAYH 3WE6B 2BRRH 3PUCA 5DD0L 1XGYL 3CH8A 5FB8B 4NDMB 2DI8A 1TTGA 5HHXH 3KYMB 2HG5A 3MJ6A 5CD5C 2XRAH 1MFBH 2AJYL 3JVGC 4G8IB 3P9WB 2VKWA 4ZPTA 5EU5A 1V3KA 4L8BB 1CD8A 3DTXB 3SDXF 1PZ5B 3VFWA 5E9DD 5F1NA 4G6KH 2YWYA 5SWSA 1XCQB 4YZFF 3BO8B 5DK0B 2GTZA 3OX8B 4JDTL 4HCRL 2BSSA 1FBIH 1A1NB 4OIIH 5SX4H 4DEPC 5D2LB 3B2VH 1XH3B 3RPIB 4OZGB 5FUZH 3HA0A 3NAAL 4UT9H 3HAEB 1KIRB 5C0CA 3V5HB 3F8UB 3TBTA 5K9JL 1ZS8B 1Z5LA 4LRIA 4XWOC 3LKRA 3O2WL 4M6NL 4X80H 2AGJH 1XF5A 4AL8L 5IMLB 2ATKB 1WBXB 2HFGH 5HYFA 2QKIA 1X3DA 3MOAL 4H25A 2OK0H 1EXUA 5HHNA 3BW9B 4EUPH 5KSVB 2DQTH 1NAMH 3QIUD 2ICCA 5D7LB 2RAMA 1RJYB 4QRRA 4WDIA 1RUQH 2K3TA 3S6CA 4HKBB 4PJ8D 4YDVA 1FNGB 5HHQA 4S1QH 4ZXBC 4DUVA 1NCUA 1W2KT 1MRDL 4NZTH 4S0TD 1QO3B 2JIXD 4XP4L 1PY4A 2FSEA 3C60A 4Y4FC 3VXRA 2P46B 4EVNB 4BJLA 1E6JH 5IFHL 4IJ3C 2DQDH 4RX4D 3N9GH 5JHDB 3UCRA 1JHKL 1YDPA 4RFNB 3BP4B 1G7IB 2E9WA 2OM5A 1EUUA 3FO0H 4Q2ZA 3VD5A 4LDLB 5I6XB 1CFNB 4ZO6A 3E2HC 5GRZA 4HGWA 1G6RH 2J8OA 3HUJF 3O8XC 3FONB 4XNYL 4DGIH 4KKLC 4U05A 2R8SH 3GSRA 5D1ZC 4AG4H 2YZ8A 2R2CA 4JEGB 4N5UA 3EDEA 3TBWB 4YHZL 4ONGH 5DJDB 3DYMA 1EA9C 3JSSA 4HZLB 2VDQL 4KDVA 1QA9A 5GISH 1D6EB 3OG4B 1MF2H 2J6EA 1ES0A 3AS2A 1ZLVK 1JZ5A 1XGRB 3TO4C 1GAFH 3HNSL 1WEJH 2N7AA 3BZEB 5JQHC 1MREL 1I3VA 3MRBA 1SBSH 1IBGL 3MO1B 5DQJA 3SGKC 1OGTA 3B8YA 3FOMA 4ZOBA 5E6IB 1TZHA 2GY5A 4M5ZL 3ULVL 1W72L 5DFWH 5SWQB 5FXCH 2EO1A 4ACPA 2CUMA 5IB1B 4X6EA 3T0BA 3N85L 3WFHA 3JTSA 3BDYH 5J1AB 3PWVA 3FCTB 3O2DA 4OF0A 1IEAA 3L95B 2C4XA 4NCC1 4UV4H 2HT2D 2Z4QB 1SMOA 3MUGB 5J0BA 2XN9B 4CVUA 1MWAA 3TT1H 5JOPE 4NFBA 2QL1A 2C1PA 5E2WL 2B7DT 3D25B 1MJ7H 1JNNH 1F4AA 3I6KB 4PUBH 5CBAA 1VERA 4XNUH 4WI3A 1JPST 3DURB 1N64H 2Y9RT 1MFEH 3LV3A 1QLEL 5DQ9A 3HNVL 1FE8L 2CUIA 1KELL 1OP5K 2JKXA 3ARQA 4X6DE 5GIRA 4LCCA 2IH1A 3DX8B 4K3JL 5JZ7D 2P7TB 3C6LA 1P2CB 4TNWF 4HUNB 1INDH 2YRPA 3L3DB 5CZVH 1MY5A 1JGUL 1CK0L 4BSVA 2J88L 4GKZA 1YC7A 1KLGA 3ZTNL 2ITDB 3ARED 1AGFA 3EHBD 4MA8L 4MD5B 3HC3H 1I1YB 4KDWA 2EXYD 4PJ7A 4MMXC 3IDIB 3HN3A 4HGMA 4NO3B 3OKDB 5C08A 4X9GA 4TOYH 5JDSB 1MCNA 4MA1C 4XCYB 2BNUB 1MH5B 1L4IA 1RJCA 2ITCA 2AJXL 1G9EA 5JOPD 4CADB 3CSYB 2HT3D 4Z9KB 1LP9E 4X6CE 1TNMA 1QUNA 4JFFB 3WS3B 3BHBB 2AI0L 4IIQC 4Y5YB 1JI1A 3OKNB 1LE5B 1FL5B 4QHNB 3DUHA 1CICA 2X09A 1NL0L 4GMSL 5D71H 4H1LA 4K71B 3KPQB 3Q5TA 5GSVB 1S5HB 2WLZA 3GIZH 3R1GL 2H26A 1C12B 5EU3A 4X5XA 2HAZA 4PJIE 5GPRA 1DEDA 4NCDA 5FUCE 4IS6B 4X8JA 2A9NH 3ARPA 1LD9A 4LVNB 4UDTB 2NXYB 2WUBL 1J0IA 3DMMB 1HXMA 4YIQB 3JWOC 4M4RA 2CK0L 5IBUG 5IVZA 4P2QA 3QUKA 1TZIA 3ARDB 1DVFB 2VISA 4K3EL 1BQLL 3GJFA 2Z9TA 5DFVC 4JZNB 1T7YA 2FIRT 4KRPB 2Q6WA 3JWDC 1WBYB 4PV9A 4F7EB 5C9KA 2BFVH 3STZB 1GZQB 1FC2D 4IRJB 1VGEH 4N0FA 5IW1B 3JWOH 4AENA 1RIVL 5LCVL 1HINH 3Q6GL 3C6SB 4XPAH 1OWRM 3DXAB 1A4KB 3TH4T 1J8KA 1BFVH 3CVHH 4ENEC 2WAHA 2EYRA 2VAAA 4PP1D 1CLOL 2ZZUT 1H5BB 5AAWA 5EOCL 5IG7B 3TVMD 5IBLD 1DLFL 2D7QA 3P11H 4ZUTA 4J12A 1KJMA 1UA6H 5DRWB 3SCMC 2PUQT 3IF1A 4QHLB 2IQAB 4WY7H 3V5KA 3T65B 3J7HA 5IMOA 1HNGA 4F9PA 1RJLB 1XGUB 1CDIA 5A16A 3QWRA 4OCNC 5HPMA 1S7RA 5FYJE 3BPCA 4BKLB 4N68A 3HMWL 5IJVB 3BZDA 2EH7L 3CLEH 1EAPA 2N4IA 4OD3H 2R29H 3KYNA 5J12C 4JLRA 4QY8A 2BY1A 1S9WB 3HG1A 1NC4D 4PJEE 5E08L 3K1DA 4F7TA 4KK6D 1GHFL 1S7QA 2XNAB 2ZSVB 2DWEA 1ZGLB 2F54A 4U0QB 5A40E 1YEIL 4ZQKB 4QOKA 1E4XI 2OP4H 3S34L 2Z35B 3VGFA 5FO8A 5TDPA 3TNNB 4CGTA 3IETB 1YUHB 5EOTA 4HS6B 2GSGA 3QIUB 4WNQB 3UTSA 1N3NB 1ZANL 5D1XA 1JF6A 1MVFA 1NQBA 2FD6H 4MQ7A 4KHTL 1QLFA 4DCQB 4MJ4A 4PJ8B 4KKNA 5KSBA 3G5XB 3M17B 3AUVA 2JJTC 3P2TA 4WW2C 5FKPA 5IW6A 1MAML 5FYJD 2FWOB 1LVEA 2UVEA 5C6TH 2PXYD 5DMKA 3HFML 3HE7C 5IQ7L 3NCMA 3GK8H 4JM2D 3IDNB 1X4XA 1X5FA 3GSNB 1NCNA 1I3GL 2DAVA 1F4WL 1MRCH 4TUOA 2RCSL 3NPSC 3PQYA 3NA4A 3VFNB 5JO5A 3SE3A 1HEZA 1KJ2H 4NC1E 1UM4L 2AP2A 2OL3H 3L9RA 4LASH 2P8PB 1MCCA 5F89A 4ZPVB 2X44D 4NN7B 3LKQA 4KJPC 3T0AA 3AXLB 3ROOB 5E8EA 1WAAA 1ZT7B 2F5BH 5DT1H 4K23L 4Z0BL 5HGHA 4L9DA 2WBJC 4J3VA 5DRXB 1ZHBB 4F57H 4GKSB 2H3NB 4XNXL 2VO5A 4X7CC 2EDXA 5F9OH 3RBGA 5CLWA 1ULVA 2VH5L 3QZWB 5D7SL 5EOQH 3BIAX 1FNAA 1J1XH 1S7VB 2AAVA 5CJBA 5FAAA 2VDMH 5DJXB 4Z7OF 1TJIL 2XZAH 5D93B 5IVNA 3FZUC 1DBML 1A7QH 1DE4A 3PWPE 2J6EL 3AY4C 5EUKB 4NC0B 5ABDE 3T4AB 3MV7E 4I0PD 3QUZD 2EE6A 4FQ1L 4XCFL 1CZ8H 2QQKH 4NHUB 4FFVD 5F7DB 2AKRA 3UEZA 4WHYH 4ZMAT 4WFEE 1V3LA 4OSUH 5J6GB 3ZYJA 2ZUYA 3RVUD 2DQCL 4Y8DC 5DLML 1SJEA 3O4LE 3IS1X 4UIKL 3KLSA 5DYOA 5ETUB 1PKOA 3JV0A 3LKPB 3MODH 3GB7A 1ZSDA 1U0QA 3KLAB 4FG6C 4LSPL 3I85A 4ZYKA 1JPFB 2I60L 1HH6B 5E9DA 5CP7B 1CDJA 2ARJA 3INUL 3C8DA 4YHKL 2WV3A 2HJKB 2B0SH 4AIOA 3TF7C 2EYTA 1UZ8A 5IHUL 4J1UA 3DVNB 3PWPD 1GRWA 5E70A 1U6AH 3MV7D 4KFZC 3O9WD 1DQDH 2DYPD 3AREB 1HILA 2MSPA 5FM5M 5HDLA 4TUJB 2BHYA 4R26L 4MB3A 4WFED 2B1HL 1S8DA 1ACYL 1K8IB 1FVDB 3LZFH 4ODBD 1UWGL 4P2OA 3RIAF 3FRPG 4GXVH 4NRZA 2VZ3A 4OLZH 3O4LD 1HWHB 4OF5A 3SKJL 4DAGH 3MYZA 1F11B 2VXSH 2AK4E 4GUPB 3MJ9L 4HXBH 4YGAB 3GJEA 3VGDA 4PJAE 1L7IH 3QRGH 2HVJB 2IG2H 1JK8A 5LVEA 4NIKB 3BUYB 4Y2DD 4WTWA 1V7ML 2C3VA 4XP1L 5GS2H 2EDQA 1OQOA 3S36L 2WLYA 2XZCL 3EJJX 3SBWA 5J6HA 3MUZ1 3FMGH 4JO3H 1HXYA 2QHRH 1J0YA 4KVNL 2JIXA 5C0GB 1X6LA 4RZCB 2UZIH 5IGXH 1TVDA 3K4AA 4A6YB 4KH2A 4JN2A 4Q6IC 4QWWD 3WFDL 4ALAL 2FX8L 4OZIE 4PB0L 5DJ0A 3UJTL 3PHQA 5DMIL 2FEEI 4TSAH 1A0QL 5I8EA 5GS3A 4JFQA 4JFYA 4PRDB 4IMLA 5MEQA 3G6DH 4Y19A 1OTSD 4R96B 2PO6C 2NW2B 3MUHL 4M93C 1BF8A 5D72H 1LP9B 2AK4D 4X6CB 3ULVF 3GSXA 5DJZB 4QRTA 1FZMB 3WLWD 3FT2A 1TCRB 3TIEB 1I7ZB 5DA4A 1BVZA 4CNIB 4D0BA 5DRZA 2MQ3A 1EIBA 4LPUA 1BVLA 4HUVB 3PHOB 4BUGA 3LB6D 4NKMB 2CLZA 4PJDA 4JFPB 1RUPL 4PJCF 5DUBB 3MACL 1I8KB 1MELA 3PWUB 2W9DH 2XT1B 4ONFH 4X6BB 3ULUL 3TVMB 2W07A 3CFKA 1A6UL 4K7PH 3CZJA 3FQUB 3JBG7 4XCNB 2R2EB 3UBXB 5B3NA 1AGCA 1WFTA 4EI5D 1N59A 1KTLA 3U82B 1LEGB 4JFZH 1DBJL 3VG0L 4HH9B 4HH8A 4ZFFB 4PJ5E 3FQWB 1OD9A 3BKJH 2D31A 2N1KA 3LH2H 2JCCB 4P5MA 3U0TA 4C54A 1QFWH 3FT4A 1BBJA 4X9BA 4LF3A 2BVQA 4NM4L 3M45A 3MGOA 4PRHE 4HBCH 3BP7A 3QHFH 1HSAA 5IT2H 4OAWA 1NLDL 1NC4B 1EZVY 5FGSA 5DUPL 1KT2A 2VTFA 5F6HI 5CIPA 2NNAB 1A4JA 5I1JL 3G5VB 3OAZK 4FXLA 2ADJA 4ZNEE 4M1CD 2B20A 4EIZC 4Z7WB 1FO0H 3LS5H 1HQ4B 1WCQA 4LVEA 4XRCB 3D9AL 3BGMA 4DN4H 5AD0B 1SY6A 4FTVE 1TMCB 3BQUC 3ZDXF 2B4CL 5CJOH 4H88H 4YX2H 5JMRA 4ZUUA 2X40A 4FQQA 5JW4N 2ZWLT 4L4VE 3JTTB 3MNVB 4NO5A 4JJ5A 3P4OB 5EA0L 3WFBH 4XBEH 2ATPA 5A2FA 4Q9BA 2E8YA 4PJ5D 3VU2A 1CT8B 1JMXA 2EDRA 1LEKB 3SDAC 5DD3H 4P4KC 5D1QD 3VGGA 3VFMB 3S35H 1BEYH 2PXYB 4PRHD 1QPXA 1EGJH 1V5JA 3KLHC 2PR4L 2KZWA 1C16B 4JM2B 1M7DA 4NUGL 4PJFF 2H1PH 4OLVL 1CD1B 3KPRA 1VDGA 1NCBL 4ODUB 2CLRB 4UBDD 1T89C 3QP3A 4KXZH 4RAUA 5C0EB 3QUXB 3NABH 3NFNB 4YDKL 2XWBA 3RWJA 3ZE1F 3P0VH 4YXHL 4JAMA 4FTVD 4CL7A 4E42A 4MXWL 5I9QC 3GMNA 5EH1A 1KCSL 3W11C 4OCWH 2BVTA 3NZ8B 4LLUA 4QGYA 3IJYB 1MI5E 4X6DA 4L4VD 3U7WH 2IBZX 4YHIA 5FDWA 5I1CL 4ODWB 3RDTC 3RY6C 3BN9D 3QO0B 4KK8D 3QULB 3B3IB 5GS0D 4JHWL 4OQTL 1AP2A 2OR9L 5C3TA 1IGIH 1XGTB 3WXWL 5D5MF 4YHLH 4JO4H 3SJVD 2DM3A 1KJVB 5F9JA 1N8ZB 1JTTA 4L8SA 3U4BH 1Q1JL 7CGTA 1T6WA 1F3JB 3Q6FB 3F7VB 1TZGH 5I1GL 1T1YB 3VWJC 5HYSG 4OTXH 2I9LA 5E56A 5C0JA 4YDLB 7FABH 4NQVA 1RZKL 1ZVHA 2FO4A 4P23D 1KN4H 2GK0A 4ZUVA 1MLBB 1R6VA 1P4LA 2FZ3A 3D85D 1XFPA 2MPAL 4I0PB 3QUZB 5DZLA 4XBPA 2O61B 2OI9B 5C7XH 4XC3L 1MI5D 1GJIA 5DD1H 4DOHE 2IFFL 5D7IF 4LMQI 3EYFA 1JGLH 5JDJA 1AGBB 4PJIA 3JUZA 4DUWA 3ZE0F 3Q0HA 3H7LA 4R2GD 3TBYA 3EOYG 2OTWB 4GO6B 4UAOB 4K7PX 4L5FH 3S3PA 4DGYL 1V7NH 5KOVC 4ZS7H 3DO7B 4DQOL 3FO2A 2VDRL 1TQCB 3MOQA 5E4EB 4PLNC 4JO1L 3RZCA 1F4HA 1U42A 4FFYH 1QBBA 5T5NG 1RY7B 5EUOF 2DN7A 3O41B 4TSCH 4OLYL 1G9MC 2Q7YA 5FO9A 1G9NC 1I85A 1ZK9A 4GRLA 5LWYH 3TFKD 3Q1SH 3OHXB 1T03L 3VXNB 2E6QA 1VFAA 3PWPB 4DK6A 2V2WA 5I1DA 3WIHL 1KLFA 1IAOA 4UU9A 3MV7B 4UZGA 1WC7B 2CIIA 2DYPB 1S7WA 2H2SC 5KSUA 1MCSA 1JNLL 4LLAA 2F53A 3NACL 3NIFF 4YEFA 4FMFA 4HV8B 4HUWA 3U46B 5F8RC 1D5IL 1F58H 5FUOH 1A7BA 4TNVK 3IDMB 1L9NA 4JM4H 2OJZH 1F42A 4GG8A 5J8OA 1QFUH 4R90L 3GI9H 1I8MA 1I1AA 5CGMA 2YPLA 3CC5A 4GQ9H 3QCUL 1MQ8A 4RMUA 4WV1B 4OGAD 1B2WH 5EWIH 4WU7B 2HMIC 1P1ZB 5L2KE 4X4YA 5GS1A 1NBVL 4G7YH 2EDHA 1D5MB 3HRPA 2FBJH 3FN0H 3DHJA 1JNHB 2VOTA 3ZLQC 1CFSB 4YHNA 2FR4B 3V52L 4Z5RB 5F44A 4K2UH 4PJEA 5JPNB 1A6VH 2DLFL 1FLRL 3UTZA 1C1EL 3CSBA 3E6HB 1YEHL 2ZKHH 2HT4C 1DBBH 1CXHA 1G7MB 1VENA 3PJSB 3VJ6B 5DD0H 1XGYH 2X4PA 4Z7VE 5EZJA 4JGJA 2ZCHL 1PLGL 1SJXA 5I71C 1OLLA 5GQBA 3ZKXC 2V6HA 2AK4B 1K4CA 2AJYH 4YE4L 5FGBA 4PJAB 3QIWC 5J06A 1I3RB 2ZPKL 1MCPL 3D39B 4MS8C 3QUMB 1K3ZA 5CSBA 5L2KD 1BJ1H 1TJGL 2C3HA 4JDTH 4HCRH 4NQSA 3GSUB 1N5AB 4D2NA 2FL5A 3RVTD 3T1FA 1TTUA 5ITBL 1WWBX 4GW4B 1DEEB 5DJ2A 4Z77B 1OSZB 5DJ6A 3NAAH 2GFBB 3KYOA 1DANU 1KB5A 3MV9E 5DRNA 4OZIB 3T8XA 5K9JH 5DJYA 1VGKB 3TN0A 4OV5B 3O2WH 4M6NH 4LLQA 4EI5B 3KHOA 3VFPB 1P84K 1FFNB 5HY9A 5E24E 2AVGA 1A9EB 5BVPL 5F7YC 5DS8B 2Y23A 1YEDB 4FRWA 2EDWA 5T5FL 1OP9A 2D7TL 2GJ6A 5I74C 5ICYA 1J05A 3VGEA 4AZ8A 5ISZA 3FJTA 4JFDA 1RHHA 4OZFB 2F8XC 4UQ3B 2FHFA 4FMKA 3PF2A 1R5VB 1NUFA 4NM8L 4XP4H 2MHAB 3UTTB 2FLRT 2BC4A 2ZUTA 5L2JA 2YOCA 3L7FA 5B8CA 5E5UB 5FECA 1HCFX 1KG0B 2XPGA 5D2LF 3ARBA 3LN4B 3N50A 3QNZA 3RGVD 5IFHH 4L1HA 4ODHL 4M62L 3O3EA 1JL8A 2YSSA 4OZHE 4OZGF 4ZS6C 3MV9D 3BH9A 3L7EB 3PWJB 2VKXA 4PJ7F 2K9UA 2L4OA 1F6LL 5DEZA 4O2FA 5IF0A 1JHKH 3P4MB 4TVPE 1NGQL 4KK9C 4EDXA 1FC1A 1HHHA 3IJSA 4ORZC 4NYLB 4PJ5B 4XNYH 4HUUB 3O9WA 5CCKL 4KVCL 5D1QB 3C5SB 4DTGL 2E5EA 1IM9D 5ESAA 4YHZH 5MEPA 1T5WA 3UTQA 1HKFA 3ULVC 1EEYA 2V2XB 4HK0A 2VDQH 3DI3B 4YHOL 1E6OL 2AABL 3O4LA 5HI4C 4POZD 1S9VA 1U8PA 5CFHA 3WNPA 2QADC 1IEBB 5GSRA 1FL6B 3LEXB 2HN7B 4JB9L 1R24A 5DGQA 3FB8A 3HNSH 1SM3L 1UVQA 3HE6B 1LO0L 1MREH 2P5WE 4Y2DA 5CZXD 1ZLUH 1IBGH 2LAGB 4UDUA 1HWGB 1U3HC 2A2QT 2YKLL 2Z0BA 4L4VB 2BOCA 3ISWA 1FG2B 3QNXA 4XCEB 4CBPA 3ULVH 4TVPD 1W72H 2H41A 1ZLWH 1KCLA 3BE1L 2R1WB 1KLUA 4LDOB 3FHAA 4YBLB 2BVOB 3N85H 3HPLA 3SJVB 3CUPA 4P46D 1BJ1J 3RHWK 3ULUF 2I25N 2A6DB 4QYOB 3AU1A 4CJ0A 3FRPA 3IXAB 2H6PA 4OFKA 4QHKJ 2OSLA 5E2WH 2Q8AL 3FT3A 3GMRA 3I3EA 3O3UN 4S0SD 4J3WA 4KRNA 3GSOA 5DVKA 2XKNB 4X0KA 2WINB 4P23B 3V7AE 1QLEH 5H94A 3KHQA 3HNVH 1FE8H 4Y4HC 1KELH 2P5WD 4IDJL 5CD5D 4K3JH 1N2RA 4CVZA 4PY7A 4H8WL 1U93A 4N9GA 3WN5A 4KQ4L 5HSFA 1JZ7A 5CMAA 3W9EA 2FJGA 3QCVL 3GZKA 1JGUH 1CK0H 5F93C 2J88H 3S5LB 1LDPL 2G2RB 4R2GB 1GGUA 3ZTNH 1H8SA 4MA8H 4I18B 4IBLT 5GZNC 3KS0J 5DEFB 4M1DL 1JWUA 4OKVA 4YUEL 5F88A 1T1WA 2DQFB 4WWKD 2NZ9C 4U6HB 1RZ8A 1LK3L 2AJXH 1ZHNB 3D3VB 2XY1A 1P7KA 3I3DA 4HK3J 4HSQA 2AI0H 5DJAB 2VIRA 1G1CA 5MENA 4GMSH 1D9KD 1NL0H 4MVBC 5I16A 4PLKC 5DC0A 2AS5M 1JGEA 5F7KC 2HWZL 4FFZL 5DTFB 1CL7L 2X4TB 3R1GH 1R3KA 2Y7QB 5HHPB 4NNYA 1MFCL 2VL5B 3MV8E 1XZ0B 3MQIA 5KSBF 2NY6C 3BKCL 3L1OL 2WUBH 1KIPA 2JJSC 3RQ3A 3RTQC 2CK0H 3DIFA 3TCLB 4X5XB 3U36A 2CDGA 3MFFB 5F21B 4U1KA 3BVNB 4K3EH 1BQLH 1WIPA 1EO5A 1J18A 3K2MC 1FN4B 5KBNC 2X9WA 2ZNXA 1FLTX 4MZ3A 1FYTE 2YD6A 2YC1B 5FM5O 3D5OF 1TETL 1NEZA 2VISB 2EZ0C 5F6IB 2Y1VA 1A7NL 3O8XD 3T0EA 1SMAA 5IWLC 1S9XB 1RIVH 2X4RA 5LCVH 3Q6GH 4MQXC 2HRLA 2NY7L 1IAIL 4OIBA 4ZNEA 4M8QA 3MV8D 3MJ8A 5FYJL 2A74B 3H2WA 1CLOH 4YPGB 5EOCH 5HYJE 1DLFH 4QTHB 5C09E 5A2JH 4FTVA 2VR5A 2APTA 5GRYA 5C6PB 3I3BA 1NGZB 1NSNL 1I9RL 4QRSB 2P43B 4OF8A 1A3QA 4ZFZA 3TO4D 3TJEL 3IDGB 4RFOL 3L3HA 3QPQD 3SY0A 4NPYB 3VFTB 4MB5A 3HMWH 3R8QA 1I8LA 2Z8WC 1FYTD 2EH7H 3R06A 1QPPA 4RAVA 3MRLA 5E08H 3IKCA 4HWBL 5HD8C 4O02L 4UTBL 1OTUC 5CJ8A 2ARWA 5E7BA 1AC6A 1GHFH 1F6AB 2EEBA 5KTEL 4PJHA 2W9EL 1RSFA 5GGSY 5E95B 3S34H 4XBGB 1T20B 4JQXA 1RV6X 3ARGA 5HYJD 3DRQA 4Z7VB 4F7TB 5C09D 1KPRB 1CD9B 3T4YB 5KVMC 1ZANH 2DWEB 4WO4C 2OZ4A 2GT9A 3RWHB 2NLJB 5IROA 4KHTH 1KB5L 1JRHI 1MI5A 3P0GB 4GW5A 3BGFC 5DHVH 1OAZL 1IKFL 2AXFA 2X4NA 1XGPB 2ICWJ 3LQMA 3U9PL 5EOTB 3HMXL 2LVEA 1MAMH 4NZUL 1FSKB 2NTSP 3W82A 3ZDYF 4NZRL 4H26A 3HFMH 4LCYA 1PQZA 3ARXA 3SGJC 5D2NA 2X1QA 5IQ7H 3BPOC 4F2MA 1FJ1A 32C2A 3BP6B 2XQYK 5DD6A 3TNMA 1I3GH 1XGQB 1F4WH 2RCSH 4PTUB 1TVBA 5HYSA 3MV9B 2DLHA 1PYWA 3LOWA 4M7LL 2AEQL 4RMWA 3RWGB 4CDHA 1J7VR 1UM4H 3SQOL 3OR7A 1SEBA 1TIUA 2X89A 1ERNA 2C3XA 4RGOL 2IPTL 3QEGL 2WIMA 4XX1G 5F9WB 4ISVA 4FNLL 1X7QB 1NGPL 1IC4L 2C1OA 1WIUA 4NSKB 4YK4B 3L3GB 5KJRL 1MCOL 1A2YB 1FAKT 4M7KL 1U8NB 5D8JL 4K23H 3WHE1 1MCBA 2CJUL 5I1IL 3MREA 1IAKB 3T3PE 2CIKB 1BGXL 4JKWA 4XNXH 1MHHA 2HVKA 2O26U 3P9LA 1C7SA 1PVHA 3FB6A 4O58L 2NY5L 4PP2B 1JE6A 3GRWL 2VH5H 5CS7A 2VXVL 5D7SH 1AHWB 5E94A 3MR9A 3FHQA 2Z91A 3K46A 3B6SB 2DIJA 5DZNA 4WEUD 4H0GA 5JNYA 2DD8L 5IM7A 4OZHB 4ZDHA 5FA3A 4HZAA 5K59E 2I9TA 5EOCJ 1JWSB 2AERT 4R97C 5KG9B 1DBMH 3E3QC 2JLLA 3RBSA 4OD2A 1U8IA 1LE9A 2J6EH 5L9DL 5C0NC 4XCFH 4FQ1H 4OFIA 5LQBL 1R3IL 4H5SA 3HB3C 1JPTL 1U8OA 1HCVA 2EIZA 4U7SA 1EHXA 1ACZA 3C5ZB 4P46B 2WWMC 4D9RE 5ADPL 3OB0H 2DQCH 5DLMH 1FNLA 3SDYL 1D3CA 3H9HA 2Z8VC 3HZVA 4UIKH 4Z8FL 5HGDA 3IRPX 3TA3D 2OQJA 3OXSA 2VE6A 1Y18B 5E1AB 4ZFOA 1C08A 2HJLA 3T2PA 4MAYA 2IWGA 4LSPH 4OFYD 1HDMB 2I60H 5DJ8A 2P5WB 4OFVA 3INUH 3HC0B 4YHKH 2KL6A 4K07A 2F19L 1ZLSL 3IDUA 3BRGC 4NQXA 2GUOB 5IHUH 5MHSE 1IL1A 2PETA 2DLIA 1J0ZA 1UH2A 3OMZA 4YEEA 3X12B 4J6RL 3IDXH 5IQ9A 4HXAL 3GKWL 2ZUXA 3HZYB 1XAUA 1AJ7L 1JPGA 4R26H 2B1HH 1VACA 2NPLX 3CAFA 1ACYH 3DRTA 5KS9A 4XNMB 4D9RD 4WI5A 1UWGH 3QUML 3V4PL 2P5EE 4WWKB 1ZA6A 1Q9LA 3RL1A 3SKJH 2V2TA 1JZ4A 1IGFL 3G6AB 3CU7A 3GHBL 4DZBB 5D96C 3MJ9H 3RIAK 4PGJA 1F97A 4BA8A 2A38A 4Y5XA 2X70A 3PNWB 3RWFB 5HHVL 2BSTA 4GAJL 3BPLB 4OM1L 4GW1A 3RVWC 3B9DA 1V7MH 1D9KB 4XP1H 1JI2A 2FEDC 5JW5A 3BIBX 4X7TA 1UXWB 3G5ZB 4NRXA 3U0WL 4IOSD 4CMHB 3S36H 2XZCH 1K9TA 3D48R 5MHSD 5F3BA 4KVNH 5E2VL 4MCZA 1CGUA 1BZ9A 4WFGE 3PDOB 43C9B 4WW1B 3WFDH 1FL3A 4ALAH 2FX8H 2HTKC 5FGCB 1HQRB 4PB0H 3UJTH 3RGVA 1A0QH 3KPSB 2CK2A 4WHYG 3HE7D 4NKOB 4QRQB 3VXSA 1KC5L 5I6XC 3OJDA 1HXYB 4FQIL 4L3EE 2P5ED 3MRGA 2DTML 1L0QA 4HIXL 3RWCA 2AV7A 5ESVB 1KB9J 2NX5A 4XXDA 5CSZB 1A3RL 3GMMA 1R3HB 4F15B 3VFSA 3VFVA 3C9NB 5C0AE 4J4PC 1IM9A 3E2HB 4NQCA 3DYOA 1MLCA 1MQKL 3MBED 3O11B 2OXHA 1RUPH 2IMMA 3I02A 3MACH 3FT2B 1V3JA 2QQNL 3M8OL 3MV8B 4WFGD 4D0BB 4KI5E 1PX4A 2WUCL 3ULUH 3P73A 3B2UC 4B7LA 4XHQA 5E6IC 3CDGB 1BD2A 2HLAA 1H0DA 5E00A 3TO4B 4L3ED 1DBAL 1DBJH 2FH6A 2GQHA 3VG0H 3I6GB 3FQNB 1XMWA 1ZHLB 5FKAA 4DUXA 5KW9L 3EO0B 2B4CC 1JN6B 4NM4H 1FYTB 1LP9F 4X6CF 1K3IA 4OLUL 3DX7A 4G3YL 1NLDH 5E5RB 3NBNA 5DUPH 5IMMA 1F2QA 5DI8B 4JKPL 5I1JH 3PIQA 3W0WE 1JF1B 1QFOA 5GGSA 4P0DA 5H37H 2CDFB 1M05A 3FN3A 4I3GA 4GG6B 3D9AH 5GS0L 5T1DL 2D7PA 1NDGA 4PJIF 4N8VG 4KI5D 1G7HA 5FF6A 3OGCA 4MNGA 5HYJB 2B4CH 3LEYH 4JZOA 4UUJA 1H3GA 3X11A 3JVGA 2BVUA 5EA0H 5ECJE 4QXUL 5BRZE 4U1HB 2RJMA 3CFJB 4U1SA 1KXTB 5HJ3A 3MC0A 5DO2C 3GUTB 2D9QB 1NAMA 2NYYC 1MCHA 3E6FB 2I07B 3MROA 4XP9L 1NLBL 2OZ4L 1YNKL 3RWDA 2PR4H 1O5DT 2OJEB 3LHPL 3M07A 3QXDB 4YHPB 1A64A 5T1LD 1H3UA 4OLVH 3W0WD 1NCBH 4KKBC 4JJHA 4R7DB 5JORA 3QXAB 2MWCA 1BOGA 1M7IB 4YDKH 3JV5A 3N1PC 4MA1B 4POUB 5DC9B 4W68A 4K71C 4YXHH 4MJIE 1PY9A 4MXWH 1KCSH 3U83A 3D1MC 4HMEA 4N0RA 5EO1A 3S36X 2P49B 2QSTA 2ZUVA 3BEVA 5I1CH 1RZKC 1VSCA 5HHOA 3S4SG 4B5EA 4LVNC 1LO5B 2NXYC 4PS4L 5BRZD 5EN2B 4MA3B 1HHKA 3DMMC 3U79A 4JHWH 1FVEA 4ZXBA 4JHAL 1FFOB 4OQTH 2OR9H 1WISA 3WXWH 4D0CA 1PW3A 1G6RA 2AXHA 1XEDA 3ARDC 1DVFC 3P4NB 3QIBA 1LNUA 1LHZA 4NO0D 1Q1JH 4KRPC 4FZEL 1HSBA 1VFBB 4Y4FA 3MRMA 4YXKL 4G6AD 4CN4A 1BIIB 4CW1A 5LXGL 4JRXE 3O45B 1T0NA 3EYVA 1RURL 4U3CA 3O6LH 4JM2F 1NCWL 3UPRB 4IRJC 1RZKH 3EYUL 2YD5A 4RGNB 2A6KA 2D4FA 3BESR 1NCTA 3U9UB 3STBA 4MJID 3QCTL 1WBZA 3VGHA 2MPAH 2VJXA 5DVOA 3OXRA 1UXSB 2YR3A 3O8XA 2UYLB 3GSVB 4XC3H 2PCPB 2IFFH 4DJMA 5D1ZA 1HYSC 4LEOB 2FO4B 1H5BC 3L5JA 1NUNB 2CKBA 3G6JA 4KAQL 4WHCA 3JXAA 4BFIB 1U95A 2G5RA 4MWFA 4WGVB 4ELME 1UENA 2EYSA 5F7NC 2XWTB 4HIIA 3TA3B 4NQEA 4DGYH 5JIIA 2X4QA 4YDIL 4DQOH 2VDRH 3ULSB 4JO1H 3T09A 3MLYL 25C8L 3DVIA 1UB6B 4X5WA 4JRXD 4OLYH 3REVB 1JHTB 2ZUUA 5HGBA 3SGKA 4OUUA 4LHUG 1ZA3B 1T03H 1WWAX 1RZIB 1ND0B 4U1LA 4F7PA 3WIHH 3QAZB 4JFOB 4LNRA 4LIQE 2CSPA 3VWKA 1RK0A 1JNLH 4G6JL 3V6ZA 1FZKB 1MJJB 2ICEA 3NACH 1S3KL 4U1MA 1U41A 5B38B 4QHMA 3RWIB 1D5IH 3QIUC 4HFWB 1T04B 4JY4A 1MFNA 1A6TB 4R90H 4I0KA 1RK1A 4HHAA 1OY3B 2BNQA 3QCUH 5C09A 1IE5A 3ARFB 2R2BA 2AJ3B 3H0TA 3IXTB 2AJSL 3TZVB 5GJTL 3KAAA 5C9JA 3DUSB 3BQUD 2QHLA 5DURB 1GCFA 4U7MA 2DM4A 1YY8A 2MCPL 5L6YH 4WU5A 4M61A 1F02I 5FCSH 3EGSA 1NBVH 1I8MB 1IAMA 4Y0GA 4OLWL 4HKZA 4R3SA 4UIMB 4Q9QL 4LHUD 1ONQA 3FOLA 4PJGA 4MJ6B 3Q48A 3D0VA 5DQDL 4WW2B 3VE0B 3V52H 2DDQL 5DSCA 1QQDB 4LLWA 4BZ1L 4JDZA 2ZUWA 4K55A 2DLFH 1FLRH 1C1EH 1YEHH 4YBQC 5GS1B 2VMFA 4WWID 3KLHD 3WEXB 2ZOLA 4L29A 4NN7C 4R4NC 2IBZY 3QJFA 2ZCHH 4V1DE 1PLGH 3NPSB 5CJQL 4MDIB 1H15A 3DGGA 5E7FA 3IDJA 1AXTL 4YE4H 4HUXB 1QVOA 3IFOA 2ZPKH 4IIQA 5DMJB 4P9HL 5HI5C 1BPVA 3VMPA 1CIDA 3O3DA 4H0HB 4WFHE 1NCDL 1TJGH 3MBEB 3HS0A 4ZOEA 2PTTA 3TT3L 3QR2A 3MLRL 3RWEB 5IK3A 4CRPA 5ITBH 1QR4A 2PN5A 3L3OA 3DYPA 4PIRF 3MLXL 3WS6C 4HPYL 3VXOA 3K2UL 5D93C 5F7HA 2OLDA 2ERJB 2JB6A 3C08L 2GCYA 1DQLL 4PRBA 4HS8L 3O3AA 1CFQA 5FHBL 4PG9B 5GRUL 4OLXL 3U4EA 4L3EB 2VLKB 3CVHA 4HD9A 3SKNA 2XQYG 2VZOA 4V1DD 5BVPH 4MNHA 2QR0B 5K93A 2VABA 3RP1A 1XF1A 3T8XB 1RD6A 4KI1A 3FRUB 5T5FH 1MNUL 2AQ1A 4IHOB 5I0DA 2HFFB 2D7TH 4LKXA 2HT2C 1EK3A 5EU4B 5H35B 3PABA 5DEGA 2AJZB 1Z9SA 4PJAF 3VXUA 5DFTA 3QEHA 4IMKC 3QQNA 4WFHD 4G7VL 2NY0C 2YD3A 5LGJA 4NM8H 3RX7A 3HKFA 4WUUE 4TVPL 1RI8A 4ONHB 3TC9A 2GJ6B 3KXFA 4NT6A 3D18B 5JZ7C 2F58L 4ODHH 1YMHB 4M62H 4LVOB 4N1HB 4NNXA 1MHCA 1QSFA 1LMKA 4ZUWA 4OZIF 3CMGA 3SCMA 2WSKA 4FHBD 1ZMYA 1NGQH 2VDNL 1RUAL 5FECB 2DLGA 1DQML 3QNZB 5IVXE 4M7JL 3RY4A 5F70A 2YSSB 4YLQT 5CCKH 4KVCH 1A14L 2W9LA 4DTGH 1HHIB 1MCEA 1GGCH 1U8MB 1P7QD 5IR1A 1B0WA 3LAFA 3PP3H 3TIDB 1FP5A 4BK4A 2IBBA 1MCDA 2HT3C 3VRJA 4HIEB 1A6PA 1M1SA 3QQ3B 1E6OH 2ESVB 2Y5TA 3A0OA 2AABH 4XPTL 4YHOH 5T1LB 2COQA 5TH2B 3W0WB 3VXMA 1QFWI 4WUUD 1A1MA 3TBVB 4X4MA 3L3IA 3RUGB 3ES6B 4JB9H 4RA0C 5LKNA 5IEKB 4Y1AE 3LN5B 1SM3H 1T5WB 3H9YA 1LO0H 3U6RA 2YKLH 3CLFL 5KZCD 3AGVA 1S9VB 3ZTJG 3IJHA 3DV6B 3EJZD 5D7KE 2G9HA 1AIFB 4RSVA 2HMID 1I1RA 2E7CA 5AZEL 1HH9B 3BE1H 5BRZB 2OL3A 2JJTA 4J2XA 4LBEB 4M48L 1XR9B 4ZSOE 3ARYA 4NO0B 5INCA 3VD7A 3HE7A 3L5WA 1YA5A 3MJ7A 2VDPL 1WLHA 3L3JB 2P5EA 3QWOB 2Q8AH 5B39G 3DVGA 1AGDA 1OPGL 3F6IA 1NJ9A 5K9OB 3KPMB 2AQ2A 4Y8AA 4PPTA 1UB5A 4Y1AD 5EO9B 3V5DB 4MJIB 4IDJH 3AB0B 2E6PA 2A9ML 2DWDA 4X4XB 4PTTA 3SQBA 1FNFA 2IQ9L 4FXGA 4H8WH 4CU8A 1YNLL 5FUCC 4WUKL 4XB8A 4KQ4H 5D7KD 2RGSA 3QCVH 3DX6A 2EIDA 4R7NA 4MXQD 4MS8D 1YECL 5H94B 1JJUA 5IBLC 3TVMC 1LDPH 3NCCB 2WBJA 2F74B 5GRWA 2X4UA 4JG0L 5C70A 4YDJB 2APWA 4PJXE 1QOKA 4X98B 4FFWD 4W70A 2EEAA 2XFXB 3GGWA 4MJ2A 4M1DH 2Q7NA 1U92A 3WN5B 5A1AA 4YUEH 3P30L 2OMNA 5TGBA 3W5NA 3KPPA 1LK3H 2YXMA 2CKBL 4LSRL 4JRXB 2R4RL 4WEMB 4X7FC 3LKOB 1IRAY 4WVRA 4NKDA 5J1TC 2KZ1B 2YPKA 2IANA 5HYQA 5DA0B 3WLBB 5MEOB 3PWLB 3T2NL 5C0AA 3AY4A 1BZ7A 2HWZH 1Q0YL 5EBMB 4FFZH 1CL7H 4I48B 2ENYA 1UEYA 1P7KB 3OSKA 5JW4M 5IB5B 4BFGA 3DX9B 2VIRB 1K2DB 1MFCH 2GY7B 3TH3T 3BKCH 1N0XL 3Q5YA 3MRQA 3L1OH 1G7PB 4ELMB 3D0LB 3MUY1 4LCUB 1IFHL 4Y4KB 5D9SA 5L88L 5MERB 1OB1B 1QLRB 1QSEB 3QDGE 4CVXA 1CFTA 1HKLL 4NNYB 2NR6D 2L7UA 3BQUB 3VI4E 4ZS6D 3JV4A 5HBBA 3CFBA 4D8PA 4TN9A 4N1CA 5ICXB 5E0QA 5BQ7B 2PXYC 5SX5H 2D9CA 1B6DA 4P5KB 1TETH 1YN6A 4JRYA 3U7AA 4JM2C 4ZOAA 5GRJL 4LQ1A 1A7NH 2BZDA 4FQ2L 1Q72L 2CQVA 3WKNA 1IM3B 2R2HA 3QUXC 3WUWB 4XB7A 2NY7H 3VG9B 1IAIH 3CMOL 3PV6A 3BSZL 1GGYA 3HUJA 4HWUA 5FYJH 5E2TL 1Q94A 1YNTB 4N8VA 1BJ8A 5INDB 3PG2A 4QTIL 1I9RH 3QDGD 5ACZB 4UNTA 5JPMA 1WFOA 4AT6A 4YGVB 3QDMA 1CE6B 3QT2A 5I76B 4XC1L 3TJEH 1U2HA 4OF6A 3GKZA 3IVKB 5FOBA 5HDQL 5C0BE 4LPTA 5AYQA 4RFOH 5FK9A 1U3HD 2OMBA 4XMKH 1MUJB 1B0GB 5ID0B 2YEZA 5ERWB 1F00I 3MLTA 3TJHC 4G9DB 2DOCA 4MD0A 1EO8L 2CD0A 4HWBH 4O02H 4FQJL 4UTBH 3KPOA 5KTEH 2J12B 4Q6IA 1JGVL 2R1YA 1WZ1L 2W9EH 4NWUL 1BAFL 1XR8A 2CLVA 1CVSC 4I0PC 2XI9A 4MNQA 3DNKA 4X7EC 2PO6A 2OI9C 4PGBB 4ORGB 4V1DB 5K9QG 5AAMA 2A6JA 5FA4A 4LLMA 1JZ3A 2DIBA 4GXUM 1WJ3A 1KB5H 3X13A 1OAZH 1IKFH 3MRNA 3OQ3B 1JTOA 3S4SA 2R15A 4QKXB 5C0BD 4UAOC 1BQHG 2V7NB 3U9PH 1S78D 3HMXH 4NZUH 4BSWA 2HTLD 5BOZG 1AD0B 4G42A 3HZKB 4NZRH 5IIEA 4MSWA 4I2XE 1TQCC 5E4EC 3JWDL 3UC0L 1DR9A 2YRLA 1XCTB 4HLJA 2FRGP 2JELL 5CHNA 1DFBL 4WI7A 3CDFA 3I2CL 1ZHKB 1J8HA 2YA1A 5H2BB 3VI3E 3DO3A 5B3JE 5C2BL 5GZND 4MA7L 2VLRA 4M7LH 2AEQH 2NY5C 3D6GA 4O2CA 3MA9L 3SQOH 2ZCLL 3OB8A 4QHKI 2NZ9D 4RGOH 2IPTH 1FO0A 3QEGH 3VXTA 1NBZA 1UT9A 4FNLH 1NGPH 4Z7VF 1IC4H 8FABB 4P3DA 2CRYA 1ITBB 4XH2B 5GHWL 4GRMB 5KJRH 1MCOH 4M7KH 1P7QB 5D8JH 2CJUH 4X9FA 1KYOK 1DSFL 1BGXH 1FNEA 4N0CD 5HI3C 4EI6B 4QXTA 3FN9A 4WV1C 4O58H 2NY5H 5E1HB 4Z7NE 4LLVA 1NFIA 3GRWH 4QO1A 5F7WC 2VXVH 5CBEB 4OBRA 5C0FB 3K8KA 4GRWB 3U1SL 2NY6D 1T21A 5I2IA 3ZSTA 1JGDA 1EGJA 4EBQH 1NC2A 2DD8H 3BXNB 4Z76A 2DI7A 3RTQD 3SKOA 4XZUB 3FB6B 4Z78B 2PYFB 2YMXL 2H8PA 5KZCB 3FFCA 3MXWL 4HJ0D 4WRLA 1S7XB 4UILL 1BECA 4DVBB 3MTRA 5L9DH 3WIFB 4Q0XL 4YNYB 2JJUA 1RU9L 3QXTA 4HULB 5LQBH 1BLNB 5IVXB 5JNYB 1R3IH 1FCCA 1JPTH 5JIKA 5C8JB 3FO1B 3HR6A 3SDAA 4P4KA 1CDYA 2J8UB 2NY4D 3QUYD 2EZ0D 1AQDB 2DQGL 5ADPH 3BKYL 3VXPA 3SDYH 4K7FB 1OD7A 5F3HB 4I5BA 4EN3B 5JA9A 4Z8FH 3UAJC 4MQXD 4F7CB 4N8PA 4ZO9A 5DJCB 3WD5L 1HHJA 2FGZA 3G04B 1SEQL 2BRQA 1ZOXA 3QJHA 1I9IL 4Y1AB 1DN0A 3LB6C 3HZVB 5I71B 2DMBA 2WIIB 1KTDB 3ZKXB 3Q3GB 1E0OB 5FCUL 2F19H 1ZLSH 2OQJB 4OZHF 2IFGA 4DKEL 5IMKB 4P5TD 3STLA 1A3LL 4J6RH 3RDTA 3CPLA 2VLJA 3RY6A 3GMQA 2FYYA 4HXAH 3GKWH 5BZDB 4LARL 4U1GB 1TXKA 1INQA 1CG9B 4MQSB 1JYWA 4OF3A 4EI5C 5C0IB 5I1LB 1DQTA 3ILPB 4ZSOB 4F8TA 1GPOL 1NFDE 3V4PH 5HD8D 1IQDB 1OTUD 3VH8G 3VD4A 1GSMA 4O51B 1IGFH 3VWJA 3GHBH 5EFIB 4KJWD 2ZJSL 5CEYB 5CILL 1BFTA 1VACB 2ZOKB 2OR7A 4U6XA 1OOAA 1DUZA 1CXLA 5HHVH 4IOIB 2WNGA 4GAJH 4KKCD 4OM1H 1QHPA 4LSDA 2VZTA 4RNRB 1GZPA 4KUCD 1D6VL 1DTUA 5LBSL 2W65B 2XA3A 1F3RB 5JUEL 4F3FA 3U0WH 1Y6MR 5F7LB 2I24N 3OJVC 4W4OA 1AR1D 2VWEE 5C07A 3BP5B 4L4JA 2JJVA 5E2VH 5E8OA 4P2RA 5JIPA 2EH8L 3NCBB 3HLAA 3LKSA 1WIOA 4HQQL 4XGZA 4PJXB 4Z0XB 5TDOA 1BFOB 5EBWB 1KEGL 3WFCL 1BVKB 1KC5H 2Z92A 3ARWA 4FQIH 4OZFH 4Y5VA 4CVWA 5F1IA 2C4FT 2DTMH 3EYOB 4EJ1C 4HIXH 2MTPA 5GGRY 4LAJH 4U1JB 4PRAB 1RZ7L 2ENSA 3CXHJ 1A3RH 3DUUA 3SDCB 3NN8A 3FQTA 5JW3L 1GYAA 2XWJA 1KV3A 4HKXA 4LGRB 4B50A 3ARZA 4QF1B 1I4FB 5TE6L 2BVPB 4RDQF 4KC3B 2J8HA 2A73B 2JK5A 3OJMB 5EPMA 1MQKH 1HE7A 3HI1B 4PREA 4HBQA 1U2CA 1JWMA 2NX5B 1EEZA 3FB5A 3GMMB 5E6ZA 2DIAA 1DDHA 1G0DA 4G9FB 3CH1A 2ICWI 1VHPA 3VCLB 2H9GA 3HE6C 4WUUA 2QQNH 3M8OH 1T1ZB 5LAXA 4YR6A 4JREB 2OR8A 4P49A 2WUCH 4M7ZB 3PGCA 2VDOL 4NO2A 3EOBA 5C0DA 3BN9C 1BFSA 3WSQL 4QT5A 1BOYA 4DZ8B 5GS0C 3F12B 3HR5B 4YBLC 3QNYA 5KW9H 4KQ3L 5BZWA 2SEBA 4TPRL 1Z0NA 5TFSL 3BZ4B 4OLUH 3G08B 4G3YH 1QEWA 4MZ2A 3B9KA 3HAEG 1T4KB 1T22A 1Z2KA 4JKPH 1T66D 1ZLVH 5T1MA 2YD7A 5F7EL 1ZT1A 4ODXB 4P23C 5CEXB 1J11A 4HCRA 5GS0H 2V5TA 5D7LE 3SDDD 4UQ2A 4UOJA 5I1AB 1UJ3B 3C09B 2X1OA 4TYUA 3BDBA 2AEPL 4FZ8L 4HDIB 3QIWA 4M9OA 4R2GC 4QXUH 4KJQD 4I18C 5C0BB 3KYKL 4F37K 2Y5EA 4X8XA 1E27A 2H2PD 3PE9A 1YPZE 5KSAA 4OCLC 1G1YA 2HKHL 4XP9H 1NLBH 1T5XB 2OZ4H 1YNKH 3MXVL 4PJBE 4AIXA 3LHPH 4DN3L 3NTCL 5JHDE 4EUPB 4AEIH 5B39A 4RMQA 3W9DB 1JFQH 2XYCA 5ITFB 1DUYA 3KDMB 1OP5H 4FQHA 1SYVB 1LEIA 3QG6A 5D7LD 3MNZB 5IOPB 4GG6F 5ALBL 3QFJB 4XP5L 4UTAL 4D3CL 2IPKB 4P3WA 2MOVA 2PYEA 1AXSA 2VLME 4HJJL 5B21A 1F13A 4LFHD 1KIQB 5EO0B 3IU4L 3I75B 1MFDL 1W0YT 1GIGL 4PS4H 1P9MC 5I75B 1IGYB 1FV1B 2FEDD 3NCJL 4HF5L 1HOCB 4JHAH 2X10A 1MCIA 3X3FL 4JCLA 1FNSL 5IFJA 4NOFA 4I2XB 4LLDB 5EZLA 5HGAA 5I8CA 4IRSD 4YXKH 1XF4A 2HTKD 5LXGH 1VEPA 1QR1A 1AQKL 4GBXD 5JHDD 5CD3B 3RTQB 1RURH 1NCWH 1A47A 4D0CB 1SYSB 1T0MA 3EYUH 1JV5B 4EOWL 5F6IC 2PTVA 3F7RA 3IFNL 2GJZB 1FGVL 3MRMB 3QCTH 2W92A 5ILTL 5ANME 2GTWA 2CH8A 3UTOA 1X9QA 2HKFL 4YHMH 2VLMD 4XXCC 3OF6A 1NAKL 3C5JA 2XN9E 2NY4B 5CWSA 4RMSA 1B0RA 3QUYB 2IALA 3KPTA 1U8HB 4KAQH 4JO2L 1UG9A 1QSVA 1WBZB 4MDJA 5IFAL 2BHUA 3K4DA 3MRFB 4OBSA 1D5ZA 4ZAKB 4YDIH 1MAKA 3BD5A 3O0RL 3QDGA 1Q9WA 3MLYH 4JE4B 25C8H 3QWQB 3HCVA 3WHXB 2NMSA 5J7CC 2BY2A 2GSIA 4PJCA 1M71A 2APBA 5E6ID 4NJAL 1RZJL 1I8IB 1U3HA 2P44B 2W0FA 2VB5A 1BHGA 3MNWB 2X4QB 4F9PC 3MRCA 3QA3B 4P5TB 4S2SB 3ZHLA 1KULA 2YPVL 1IGJB 2P8MA 4JDVA 4NRYA 1OF2A 1MPAL 2X7LA 3DSNA 4KROD 15C8L 4G6JH 4HG4K 5MI0B 2UWEB 1BF2A 4K3DL 3WNLA 3OKMB 3WNNA 1S3KH 2XN9D 5IEHA 1ZAGA 1T1XB 3IU3A 2BNRB 3T3PF 3WL9B 1R5WA 2QSVA 2O5ZH 4MB4A 1SBBA 5ESQA 5GZOC 5EC2A 1DQJB 2AJSH 2HFTA 5GJTH 3S97C 4HMCA 1A7PL 3CJJA 3H7BB 1YN7A 1NMAL 3CFEA 2A1WH 1U8KA 1FSKC 3VD3A 2MCPH 1UKQA 4S1RL 4Y4HA 1S7SA 3S8WA 4HGKC 4A2LA 3EO1B 1LDSA 1AKJA 4OLWH 1ORSA 4Q9QH 5K59F 5KAQF 5DQDH 3VFUA 4P57A 4P9HC 2DDQH 3D69B 4BZ1H 5DO2D 3MLWL 2NYYD 1T3FA 5I1EL 5L7XL 1R3LA 1XIWB 3QISA 1ONQB 2MQCA 2HJFB 1NFDB 5GGRA 4KZDL 5F9WC 2RFXA 3KNBB 3WUZA 1MHEA 4QHUB 4XPFL 5CJQH 4UOW1 1RUML 4RMRA 4E5XB 3O6FB 1AXTH 1QP1A 1S9YB 4OT1L 3F7PC 4RCAA 5IVOA 1U58B 2IJ0C 4P9HH 4PJFA 4NUJB 3NGBB 3SO3B 1AGEB 4GKNA 3UX9B 2X4OB 1L7TL 3QJFB 2BJML 1NCDH 1BQHA 4POZC 3TT3H 2VR4A 2X9XA 3MLRH 3NFPB 1AHWC 3QEQA 3OAYK 4M43L 3O3BA 2BXZA 5CZXC 5TQ0L 1G9ML 4JG1H 4XAKE 1G9NL 1ZWIB 3MLXH 4HPYH 3K2UH 3FQXB 4APQB 3DPBA 4WW2F 4C56A 5GRVK 3C08H 3OKKA 4NQDE 1DQLH 2JJSA 3UDWA 2ADGA 1ITCA 1OLZA 4J8RA 2QQLL 4HS8H 4UI2A 3ECBA 5GRUH 5EG6C 3SN6N 3ZDYE 2DJ4A 2J2ZA 3D2UA 1NGXA 2C4FU 1A9BA 4N0YL 2E7LA 1CE1L 1GL4B 5D5MA 1I75A 3TO2A 3IAPA 1DQQA 5EIVA 4DWHA