4GBXD

Crystal structure of an immune complex at ph 6.5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
191
structure length
191
Chain Sequence
FVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPSEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTDRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the HLA-DM-HLA-DR1 Complex Defines Mechanisms for Rapid Peptide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DM alpha chain
total genus 29
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gbxD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gbxD01
2ADIB 4X4YB 1PY9A 2P8LA 3H9SE 4QCIB 1II4E 2EDHA 5I1DA 4NFBA 3AMKA 4PJEA 3L3JB 1JGUL 4N8VA 1MFBH 1GGIH 1F3DH 2KZ1B 3ULVE 4FQIL 4OBSA 4NHUA 3RL2A 4LARL 4TNWF 3REWB 4OD1H 5EC2A 3FQWB 1GXEA 1B4JL 2DQJL 2ZPKH 4X6DE 2CGRL 1KB5L 1RJZB 1ADQH 2DIBA 4NC2B 5IJVA 3SDXB 2JJVA 4QYOB 1TNMA 3JTTB 2EH7H 1BWWA 4KZEL 4GAYB 1XFPA 2W0KA 3BKJH 2P4AB 1A4JB 2QSQA 1ZLSH 1GAFL 3C8DA 4M7KL 2YEZA 1CI5A 3TM6A 1AGCA 3DX9A 4ELMA 3I50L 1WQVT 2PCPA 1B88A 1CFTB 2IH3A 4NM8H 4PRHD 4YBLB 5C3LD 5E6YA 1ZGLA 4D9LH 4CGTA 2FHCA 3TH2T 1A3RH 4XP1L 3W5NA 2XXCB 1YPZF 2EH8L 3MRHA 3E6HB 4IDJL 4YFLI 1MRFL 1G7MA 3BP7A 5D7IE 1MHEA 1S7WA 2ZOKB 3AXLB 4QXGL 2OTWA 1OAYH 2ATKA 1YJDC 1CT8A 2WQ8A 2QHLA 1QZ1A 1T7YA 4U6VH 5SX5H 3U30C 5LGJB 4QNPE 1A1MB 3D2UB 2N7BA 2EIEA 5JQHC 3BRGC 4OZIB 4EN3C 1T22A 1RZKC 4J4PC 4B5EA 3BAEL 3IETA 5E8PB 2PTTA 5D2LA 4YPGA 1UJ3B 4ETQA 2MQ0A 1SYSA 1JHKH 4Z5RA 3WS6A 4PJ7B 4J7RA 2BRRL 4HWBH 3CMGA 3O3UN 4WWKB 4HMEA 2R56L 5EIQA 3T04D 3FQTB 4FQ1L 3KPOB 3VH8B 25C8H 3QO1A 4YXKH 1MH5A 3LKSB 2E7LA 4EN3D 1FL6B 2FJFA 5E5UB 5CBEA 4OI8A 3QDGD 2W65A 3QFDB 4JRXD 4P2OC 1IEBB 3ZKND 3MA9L 2IAMC 4QNPF 5DS8B 3U0WH 4LASH 3UTTE 3H9ZA 3L95B 4HK0B 4PRBA 1JZ4A 2DQUL 1EMTH 4F9LC 4JQIH 2YN5A 4XBPB 2NY4C 1KEGH 4X9IA 1J86A 1MHPL 4Z7UB 2WIIB 3VXOB 3OHXA 4A6YH 2DTML 3WO3B 3GRWL 5DK0B 3E6FA 3ARBA 1OP3K 1HE7A 4L8BB 5KSUB 4GH7B 2VLJB 1OAXH 1LP9E 4NCC2 1TETL 2IPTH 3BKYL 4Y2OA 3GSOB 4YHMH 1IM9D 3BEWA 1HDMA 1FNFA 1PW3A 1I8LA 3GMOA 2WUBL 3CDGA 4O4YH 3PV6B 5SWSB 3DSFL 1A7RH 1CT8B 4TRPH 4OI7A 4NO0B 1C1EL 1KB9K 2YOCA 4LPXA 3SPVB 2GJZA 4LF3B 5TE7L 4ZXBB 4K3EL 3RGVA 2GW5A 3IB4A 4ZTOH 2QKIB 3DROB 3MRLB 4ODUA 4XX1G 2F74B 2MTPA 1Z9MA 4EQ3A 2ICEB 3T1FA 1W72H 4OT1L 2QQNL 1BD2E 5TF0A 2EE3A 1I1RA 3LH2H 4WUUD 3VDBA 3F6LA 3AMLA 3F12A 5D6CB 4F2MA 3O4LE 5D71L 2HKFH 4PJGB 1N8ZA 2NY5H 4O2EA 1IAIH 1T0MA 1UM4L 1U8NB 3SKOA 1OF2A 1C5BH 3GO1H 4QXTB 3S88L 1IC5L 1FNLA 1AIFB 4U6TA 1BVZA 1AH1A 3P4NB 1JUFB 5HHOD 2EO1A 3CK0L 5KVMC 3CFKA 1CK0H 4FQCL 4U05A 4YDJB 2DYPB 1KEML 2ESVD 2VXUH 3IFPA 4HK3N 1CDYA 4WY7H 3I50H 4JHAH 3MXVL 4KKAD 4QOKD 1WBXA 4AL8H 5C09A 1JF6A 3B2UD 1ZSDA 3V0WH 3PWUB 1YN7A 3SDCD 2DQIH 2RQ8A 2VTFA 4NJAH 3EOYG 3D3VB 4JDVB 4EI5A 4NO3B 2Y7QA 2GIYA 1BZ9B 4K94H 3RWCB 3SDCA 4XBPA 2BNRD 4PR5B 2BVPA 2FR4B 1LILA 1WEJL 1FZJA 1HHJA 3ZYOA 2NR6C 3GNML 1ZV5A 4IRSC 43C9B 1M6OB 3W81A 1IEBA 4U6VL 1Q72H 3KJ4B 1MLBB 4K7PL 4NO0D 3ULUD 4KQ3L 1FQ9C 4NKDB 1CU4H 3SDAA 4D8PA 2VLRD 5J1AB 4TNVF 1IZKA 4JDVA 3O11A 3JWOH 4KHXH 4V2CB 4U1SB 3VCLA 3D0VA 1F3RB 2EDTA 1DEEB 3VJ6B 3QSKB 4JGJA 5AUMA 1Q1JH 2V9RA 1MELA 4ISVB 4PY7A 3ZTNL 1FFOA 3LN4A 4FXGB 3GKZA 1NH6A 1KIUA 1OCWH 2J8UB 2WBWB 3JWDL 3EZ8A 4NWUH 4EIGB 3ESUF 2X4QA 4PJ9D 5ESAB 2X70B 1QR4A 3DOSA 2EDXA 4WUUE 5DFVC 3EYSH 4RQQB 4OZHB 3MOAH 4UDUA 4PJBB 5MENB 2IMNA 2W60A 1WLHA 2LVEA 2Y06H 2DLFH 3DRQB 1GVIA 2IBZY 2DQIL 5E5MB 1JHTA 2HYMA 4OFPA 1CE6A 3R8QA 35C8L 3KPPB 5EBWB 2DDQL 5LAXB 5FEBA 4GRLC 3G6JB 4N9GA 4DK6A 1EHXA 1AGFA 2HH0H 1N5AA 3DO7A 3GSWA 3V7AE 2PTVA 3QDMD 3N85L 3FT3A 4PUBL 5DD5H 4HKBA 1W2KT 1X5IA 3LAFA 5DC9B 1A4JA 5EO1B 3M1BA 3VD7A 5IJKC 4WEBH 4D3CH 2JCCE 4HT1L 1FL5B 2D0HA 5D7LA 3CVHA 1FYTE 3PDDA 1EFXA 1K5NB 2CDFB 2XG4A 5IEKA 5AG8A 4HKZA 4JPKL 5F7HA 1QO3A 4R4FH 3R1GH 2VR5A 3LKPB 3S4SB 1TVHB 4Q9RL 2Z8SA 1I3UA 3NCYS 3SE4A 5I1KL 1UYWL 1NMBL 4G8EB 3HE7A 2Q6WA 4KV5E 3FB7B 3LRSA 5TE7H 3UC0H 1NGPL 4UU9A 2VABB 3SCMA 3QISA 2XNAB 4TSCL 2CUIA 3OAUH 2BDNH 3S35L 1JMZA 3GMPA 5CILL 1C5DA 4OLEA 4PV9B 4WRLA 3WHE1 2AXFA 3QXDB 4ZFZB 1OD7A 2X5PA 2C1PB 4UT7H 1ERNA 2A73B 4XI5D 2C3VA 4G7VH 3FONB 1NGYB 1JPTL 5JXEC 2FBJH 4U1JA 1ZANH 1QVOB 2FJGA 2XWJA 5GSVA 4K3DL 5EU7E 1G1YA 5EUOF 2QSVA 4KKCC 1FP5A 3DURA 3SGDI 1ETZA 1MH5B 2Q3ZA 1ZGLP 2VNCA 4P48A 3GI8H 3QDMB 4X7EC 2C3WA 2OQJA 4OQTA 5EORL 1TIUA 3VDAA 4ORGA 4AEEA 2NY0C 3QNXB 4J6RL 3VRLE 5J6GB 4CKVX 1UENA 1XH3B 4G6ML 1WWAX 5ICZB 4Z78B 2EDDA 3VGHA 2OL3A 2LAGB 4FNLH 1JFQL 3BH8B 4GW4B 2PR4H 3QG7L 5FDWB 5DUMH 1JI1A 5JHDA 1S78C 3RZCA 3KPSB 4YAQB 1DEEA 3OHXB 1HHGA 1CICC 2DOCA 1R3KA 5HYIA 1AXIB 5T3XH 3EOTH 1NFDA 4DGIH 2JKXA 3EOAB 1MFCH 2O5ZH 3U7YL 1UACH 1UYWH 1YYML 3DGGA 1AE6H 4NZTH 3LB6D 3MCKB 4CN1A 4U1KB 5IMKB 2JIXB 5HD8D 1KCUH 2XKNB 1FO0L 2YHGA 2HTKC 2VLRA 2DKUA 3NGBC 4JPIB 4PTUB 3T65A 4Y5XB 5CWSA 4E41B 5D1XA 5SX5K 1L6ZA 1INQA 4ZAKD 5IKCB 3BP7B 3QDHA 4PJFA 3VWJA 3LH2L 1RZJH 4KXZH 4FQXD 3BJ91 2ZG3A 3I6KA 4UV4L 3BP4A 1NC2A 1MCDA 3MA7B 1BQLL 3BSZL 3MNWB 3W2DL 1D6VL 1XF3B 2R39A 2FHBA 3S98A 4X6DF 1A9BB 3FOMB 5EBMA 2D7PA 3ILPA 3UP1A 4ELMF 3BQUB 4P2RD 2HJFB 5DQ9A 1IAKB 3SBWA 5T1MA 3H6JA 1G0YR 1NL0L 4ZYKB 4OQTH 3MRCB 5TPWL 2A2QT 4X6EB 3CVIH 1MAML 3UJJH 1WAAF 5GGRB 3QQ9D 2Y06L 1FZKA 1GHFL 5F1SA 4BH8A 2NLJB 3H9SD 4NM4L 1LE9A 1PX3A 3QEQD 4OLWL 4PJIF 2ICCA 1QFHA 5CILH 3JVGC 4DGIL 2MOVA 3RY6C 4LKCA 3MRBB 2Y72A 1MHEB 4PB0H 4TVPD 2YPKB 5ICXA 3MRJB 3T0EB 3HMWL 2X1WL 3QP3A 1JRHH 3RA7H 3VGEA 4Z7VA 3TO4A 3OKNA 2E7MA 2MJWA 3HS0B 3O8XC 5I18H 2D7QA 2F74A 5JPMA 4NRZB 5IBTL 1BOGB 1PJ9A 2A1WH 4JANA 4JRYE 1FHGA 2RCSL 3LEXB 1M05B 4WUKH 1DQQA 4F8QA 1RK1A 4LVOC 5DJ0B 1SJEA 4FTVD 3E8UH 4JFDA 2BXZA 4XMLL 4X7FC 4ZNCD 1A02N 4FS0A 4N68A 3QUMB 2A6IB 2Z92B 5BVPH 5EO9B 1ZA3A 5J11B 1KIPB 5GJSH 1YMME 4XBEH 3GFUA 1FGNH 2YXFA 5DVLA 1UQSB 1KIQB 4FFVD 3K2UL 2BDNL 3S35H 5HY9B 4XVUC 3IU3B 3TF7C 1PX4A 4XRCB 4YFDB 4EI6B 2ZOLA 3QRFM 3O3DB 1ZT4A 4NZRH 5DI8A 3JV0A 2XV6B 3H0TA 5D1QA 1UCTA 3S34L 3PGFH 4BKLB 3K2UH 1AKJD 4OFDA 3VI3F 4Y4HC 3ZTJG 2C5DC 4Z0BH 1JBJA 2GTWB 3E3QC 2JCCB 3QPQC 3T0EC 4KTDH 4PJ9A 3RFZC 4OZIF 4G7YH 4OFKA 1MREH 4M7JH 3WD5H 1IAOB 4I77L 4WO4C 4OCWL 1ZWIA 5FV2A 4JPVL 3QO1B 3BE1L 2QQQA 4QTHA 4RAVB 4GBXB 1ULVA 4KTDL 2BMKB 5TQ2H 5E8EA 3EFDL 1HILB 1UA6L 3N9GL 5CHNA 5E8PA 1VB9A 5DI8B 1KLGA 5B3JE 4UIMA 5D1ZC 2EO9A 3KPTA 1T3FA 1F4WH 1J0KA 2KQNA 5CEZE 4Z7OF 3VGFA 1CG9A 3QFJB 3WLWC 1CLZL 5LWYH 1KTLB 1CDCA 1UM6H 4IJ3C 4XCFL 4QHMB 2EXYC 3P11H 4H5SA 2R4SH 4PB0L 4RMRA 4UQ2A 2XI9A 5D2NA 5FYJU 3RKDC 4OLVL 2G5BA 4D0CA 1B0WA 1XT5A 1SEBB 3LN5A 1JNHA 2HMID 4PJAB 5FA4B 1JWUA 1M05A 5T1LA 2XN9D 4Z0XB 3EYOA 4HS3A 4O58H 2E7LC 3CPLB 3FB6A 4G6JL 5IGXL 1D9KC 3HE6A 7CGTA 3GZKA 4YR6A 5CEYA 4HKXA 1DQTA 3DUUB 3A67L 5CEZL 1EO5A 4L1DA 1JYWA 5F3BB 4O51A 1ORQB 3HNTH 4XWOD 1RFDL 1UZ6E 1C7SA 4POYA 3CXDH 3NCEB 2OJEB 2XG5A 6CGTA 3ARED 1A0QL 4P99A 3ARUA 5KSBB 1GPOH 1KV3A 1JWUB 1WICA 3AB0C 1HHKB 3QUMH 3QEQA 3KXFA 2LE9A 4U1NB 4D9QE 2OR9L 4NQED 3CCHA 1T5XA 5CP3H 5I1CL 2GFBB 2CSPA 4PRHA 1WZMA 3H9SB 4FG6D 3O8XB 5C0AD 5EIIA 3GMRA 5DVKA 2CJUH 5JHLL 4WNQA 5I71C 4PRDA 3V7MA 4JY4B 4Z7WB 4JKPL 4MJ4A 3FN0L 3HAEB 1VFBB 4PJCA 3L5XL 4PJEB 2WWKO 4K7PY 2N1KA 1AO7B 5DTFB 4EBQL 1YUHA 3EHBD 4X4YA 4ZUUA 5FA3B 4I4WB 3RWIA 2CUMA 2OJZH 4C56B 3JUYA 4ZSOA 3LQAC 3QQ4A 5D1XD 2VDNH 2IEPA 1MI5B 3BIBX 3VFNA 1BPVA 3QUXD 4KK9D 5AYUH 3FT2A 1G7HB 3QI9B 4G8GB 4NBXB 4ODSH 5CP7B 1HNGA 4DAGL 3HPJA 5DZOA 4XP5L 4AH2B 4NT6A 2YUZA 1EEYB 3CUPB 4Y4FA 2Y36H 4QT5B 2JLLA 2FYYB 3MGAA 2UZYB 5HHNB 1D6EA 1ZA6B 2YZ1A 5A40E 4AENB 3T77A 3QUZA 2EDKA 5C0BD 5DFTA 43CAB 1E27B 1CLYL 1EUUA 2AK4B 2NZIA 7FABH 1XF5B 1I1AA 2HLAB 1BQHG 5DMGD 2ZUXA 5I1GL 1G9MC 4FABL 2PN5A 4XCEA 3NZHH 3U0WL 4LNVA 2GY5A 1TJIH 4H20L 3IKCA 2DQTL 4DUWA 1I1AD 1E6OL 4ZFFA 1TZIA 3A67H 2IJ0C 4HUVB 3CC5A 4OLUL 4FZ8L 5DD0H 1FDLL 2NY6C 4R26H 2CQVA 5DD6B 5GGSB 3ULVH 1EVTC 2IALB 1IC4L 2IANE 1U3YA 1FV1A 4O2CA 1PEWA 1E6JH 3FAXA 2VAAA 3PUCA 4GXUM 4Q6IA 4OLUH 5CD5C 3MRIA 2I26N 4XPTH 5JPMB 3CSPA 5TFSH 3GB7B 5BS0E 1CFBA 2CO7B 5DMIL 4K23H 4U7MA 4ZSOB 4JDZA 2UVEA 1N64L 3DV4B 3QRGH 1T7WA 5J6HA 2ESVA 3G6DL 4WIQA 1Q0YL 5EUOA 4YGVA 1S7UB 3OXSA 1HH6A 2OR9H 4G6AC 3W2DH 1IGML 4KRPB 1QFWM 1S5HA 5DD1L 1AD9B 4UTBL 1U2CA 4Y1AB 1TTGA 1JPSH 3HE7D 4JY4A 4Z7WA 5HD8C 1ZE3C 3QCTH 3V6ZB 1CXLA 4X9GA 3HKFA 2UY6A 4L4VE 2NY6B 1LP9F 5EOCL 4FFYH 5GGRA 1MCWM 1X6LA 5A16B 1NMAL 4AEIH 1IARB 3HZMB 3BPLB 1BGXH 4ZNEA 5C0AA 4IS6A 3WBDA 1M7IA 3K4DA 3KXFB 1N4XH 2WZPD 4Q0XH 3U4AA 4LLYB 3NAAH 3L7FA 3QQ3B 2YD5A 5IGXH 2J3SA 1UZ8B 5I8CA 2D31B 1BBDL 1UXSA 5DT1L 1OB1B 4U1IB 1H3VA 4CU7A 4PJEE 5IB3B 3O4LA 2XQYK 4LIQL 3BD4A 1EEUA 1F58H 4OV6F 2BY3A 4XGZB 5JR1L 2EKSB 1U6AH 1YY9C 1BEYL 3REVB 5GZOC 2IGFH 1NBVL 3C5ZA 3W9EA 2CDEA 2I9LB 5E8OA 3FN3A 4P4KC 2B20A 4F7CA 1S9XB 4LGSB 2X05A 3CPLA 2UY7A 4OZHA 3S35X 4JQXA 5HGAA 4PRBB 2FD6H 4PBXA 2BNQE 4NPYB 1AKJB 3HE6C 4ONGH 4WDIA 4NQSB 3FZUD 5B3NA 5KSAA 3NZ8A 2Z31A 1TZIB 1HHGB 4LSQL 1A6UL 1A6WL 1BIIA 3P73A 4EDXA 4DZBA 2ERJC 2FD6L 4BUHA 3K0WA 4G7YL 3OKYA 3PP4H 1CE1H 2EKJA 3PWJA 4XNXH 5MP6H 4AENA 2ADGB 4HPOH 5DDHA 5L8JB 4NM8L 4GBXA 2OQJB 2FEDD 3CVHL 4G80B 1RVFH 5F8QC 5EA0L 1LK2A 2VL4A 3PGFL 3D0LA 3DVGB 1ZWIB 3U30B 4F33B 3U1SH 4KVNH 5FHAL 4MNQA 3IAQA 4X8XA 3MRRB 1AKJA 3D6GA 3FFDB 3KAAA 1PQZA 5SWSE 2X2YA 3B9KD 5DRZA 4YX2H 5LGJA 2YWYA 2CMRH 5CIPA 3UTSD 1K3IA 3ZLQC 4NFCA 5H2BB 1R6VA 1GHFH 4CJ0A 4QRQA 1T04B 3TVMC 1J05A 4J8RB 2P24A 1ZGLM 5EU3B 4HV8A 3C6LB 3TBYA 3CFJA 4W6YB 4QHUA 4ODTH 2W9DH 3FQRA 4ZUVA 3D3VD 1S9YB 4NN7B 3T2OA 1DDHA 3QJHB 1NCBL 3TA3C 3W11C 1MRCH 1XGRA 3T3PF 4N1CA 2P8MA 1DVFC 1L7IL 4HK3J 4K3GA 4PREA 1I7UA 3LEVL 3WS3B 4PYGA 1QHOA 2OM5A 1INEH 2ENSA 2XWBA 3BRFA 2AJVL 2FEEL 1VEOA 3BMVA 5F1IB 3G08A 1J0YA 4P5TC 1XR8A 4WFHE 3PL6D 3WCYA 4JHAL 3MJ8A 1IFHH 3B9EA 5C7XL 3FO1A 3M45A 4NN5B 4X6BB 3SGEI 4MXVF 4YDKH 4IMLA 1D3CA 4JFDD 1CXHA 2F5AH 3DX8A 3VXMB 3C6LC 4H88L 1TNNA 2Y5TB 2ZCKL 4WHYH 3MJ7B 4NM4H 4XHJD 1HYSC 1ZHKA 3LKOB 4GW5B 2FJHA 1URLA 3G9VA 5H35B 3QJFA 1EXUA 4NQCE 3M8OH 4QRSA 3HNVH 5ISZD 5DUBB 3RPKA 4PJCE 5D96B 1ZS8A 1UT9A 5DJDB 3WEXA 2NY0B 5GGTL 4RCAA 5EU5B 4FP8H 5D7JB 2RR3A 1XIWA 4HFUL 4BM7A 3IKKA 2NXYB 3EIFA 3KNBB 1FPTL 2ARJB 3MA9H 4F33A 4KJYA 3WFEL 4JFED 3WFHB 2YA1A 1UKTA 5HGBA 2AJYL 4WU7B 4KRNA 1DL7H 4POZD 1MJUL 3AROA 4IOSD 4WVRA 1UM5L 1FAKT 1N2RA 5J7CC 2EYTB 4IEFB 4N5ED 4WW1B 4H0GA 4RA0C 5C0IA 5AD0B 4OZGA 2FO4A 1S3KL 5KW9H 4KPHH 4KRMB 4U1LB 3J7HA 1OTSD 3WN5A 4ZG1A 3SGDH 1QBLH 1X5HA 3IDXL 3L3KB 2VL5A 3C60B 4H1LA 3S37L 3ARGA 4WI4A 2D9CA 3DTXA 4ZUTB 5I1IL 1T1WB 3FT2B 4UZGA 2DLGA 5CSZB 4DW2H 3MRRA 3CSGA 1HIML 4WFFE 4P5TB 1WWWX 5CZVL 4NC1E 3EOBB 2D7NA 5F1OB 3SCMC 1WFUA 2GJ6B 1C08B 5D4QA 3D39A 1GGBH 4ENEC 3NFSL 3AS3A 5EU4B 3P9LB 5C0BB 4M3KB 1KG0B 4KK9C 4TYUA 4XPHH 5M95B 3KPNB 5L8LB 4YXKL 4JG0L 5J89A 2DYPA 4FP8L 2Z9TA 4Z7UF 1DTUA 5J12B 2P42B 2XPGB 4LSPL 2CRMA 1H9VA 1C16A 4EDXB 1NGQH 5CGMA 35C8H 5FGBC 3LDBB 3HRPA 2NY4D 3V5DA 3DARA 4QF1A 3BW9A 4WI3A 4IRZH 2L4OA 4W6XB 1S7TB 2EDWA 4BSJA 4Z7OE 2VWEE 3DRTA 1NPUA 3CSBA 3QDAA 2CIIA 5DJDA 1A6AA 3LV3B 1CYGA 3R06B 4YK4C 1N5YL 1MAJA 5I1JL 2JJTC 1CQYA 3EYVA 1DUYB 4M6ML 5C7XH 2VZVA 1I7TA 4P2QA 3P40A 2DQCH 5B4MD 1J8HD 4TPRL 4XTRC 3MRHB 3MREA 1YN6A 4JFZL 1TJHL 3BIKB 4OD3L 1OB1A 4U1IA 4S1SH 3MUGB 3IJSB 5DQJA 3HE7B 2AAVA 4HH9B 3L6FB 4JO1H 3EO9H 2HVKB 4OJFH 1I4FA 3VFUA 1ED3B 4UNTA 3BZEB 4K3JH 3V7AG 2RFXB 3ULUH 2GAZA 1LEIA 1PZ5B 4MB3A 1J10A 4P46C 3MRPA 4IS6B 3WNNA 2X09A 3PXHA 4XVTH 1IGCL 3JTTA 4YHZH 5GJTH 4JFXA 1GGYA 2X9XA 3LD8C 4WU5A 5JZ7D 2QV2A 2VZUA 3SDYL 3L5WA 4YDKL 4KDTC 1X44A 4OM0H 2R0KL 3D25B 2VH5H 4NQDB 3K1KC 5E8DH 5C0CE 5FAAA 4ZS6C 4QRRA 1XZ0A 3IJYB 1S7XB 5FHBL 1KELH 4LVOB 2NX5A 4UNUA 3ZKMC 2HJLB 5F7KC 4I2XB 1KJMB 4LMQI 3MOAL 4QRQB 4PGBA 3TN0C 1NCDL 1NEZB 3O0RL 4CMMB 3BXNA 2AABH 1YQVL 1CVRA 3D9AH 1QEWA 1RY7B 2A74A 4Y5VA 3V6OE 3D87B 5DHVB 1K85A 3O3EA 1J5OL 3L1OH 4BQ8A 3PHOB 1T4KA 1Z0NA 2FWOA 3VWJD 1HQ4A 4YBQC 5GS0D 5HPMB 5K9KA 5FDWA 1O7SA 1S7RB 4MMZC 2G60H 5A3IC 1I3RA 4XPBH 5T3ZE 3CZFA 3GSUA 1W72B 1KT2B 5GS2H 3UZEA 2DYPD 4ISVA 4MA8H 3HAEA 3EO1A 5ESVA 2HFGL 2UUDH 2C1OA 1NAML 43CAA 3JTSA 1MLCB 2Y25A 3H3BC 4GXVH 1IE5A 3HUJA 4OFIA 4BK4A 2H9GA 2E5EA 2MKLC 2BVTA 3VFRB 4PGJA 2CD0A 3OKLA 4GRWF 4WDIB 5GS0C 3QIWB 1P2CA 1CXIA 4CVZA 5LVEA 2CGRH 4N0RA 5KBNC 1XGTB 4ZFGH 1YMMB 1LQSR 3QG6A 1K8DA 2UUDK 2A6JA 1IGIL 4RMSA 3B9VA 1FZOA 3OX8A 2OXGA 1CZ8H 2AXHA 4J12A 4IRZL 4PJXB 5LWYL 2I9LA 1HHHA 5E8OB 3BH9B 5BO1H 4Z7VB 1TETH 4Y4FC 5ANMB 1XGUA 2WQRA 2YXMA 4XVTL 4YHZL 4LEXH 5D2NE 1U8IB 2PXYC 3DX8B 4F7PA 3GSNA 1QRND 2R29L 5DRNA 5CBAB 1VEMA 5C2UB 4J1UA 5HDBE 3L5WB 4XB8A 3AGVA 4G6FB 4U0RC 1HXYA 5T3ZD 1OSPL 2X4UB 3IAPA 4NQCA 1IKFL 5FYJL 2BP3A 1OGTA 3N06B 2QADD 2X9YA 4PJFE 1GL4B 3RTQB 1VHPA 3V9FA 1Q94B 1E28B 3TBTA 4LLDA 1XCQB 3JWOC 4HKBB 2BNQB 4P2QD 3HA0A 2XZZA 3DXAB 4PTTA 1IL1A 2J7LA 4UBDD 5LGHL 4FQ1H 2I9TB 3AREC 5HGHA 1BZ7A 3RDTB 4Q6IC 3T1FB 1SEQL 4HX1B 4MAYA 3BKML 5D2NC 5DD0L 1KACB 2PR4L 5C8JA 2YBRB 4URTB 3QWRD 4DN3L 1UJ3C 3CLFL 2J1KA 1CXFA 1N59A 5KVFH 2APTA 1QLEL 2MMXA 1I7ZB 3VFVA 1FZOB 3OX8B 3U4BL 5C0CD 3C60D 4MAYD 4YHIA 4M8VA 2AI0L 5CCKH 4NQVB 4XHQA 4FFZL 4FFWD 1JGLL 4GRWB 4Z95H 4LU5L 2BOCA 1IGCH 1F4HA 2X4QB 4V1DE 5C0FB 3L3KA 2AJUH 1U3HD 1FYTB 1SY6A 2OCFD 4XAKE 3F6IA 5IWLC 1X7QB 3U6RB 4ZFFB 1EMTL 1X4ZA 1OAUH 4UV7H 3KYKH 2X1XR 4RFNC 3LB6C 3K74B 2H2SD 1V3LA 4HWEL 3TBVB 3MJ9A 2I27N 1T2XA 3OL2A 1AE6L 1Q9LB 1T0NB 2XQBH 2O5YH 3EO1B 4NZTL 5CS7A 5C2BL 2VKWA 4JLRA 4FQXA 1BQSA 1T2JA 4DZBB 3MBEB 4AQOA 2H6PB 1KTDB 2PYED 1OSZB 4LSUL 1NGPH 2V6HA 2JIXD 4Y1AD 1DQDH 2E8ZA 1Q0XL 4PJHA 2C3HA 3MNVA 5AZEH 1UVQB 5CP7A 2VXTH 1M71A 2DM3A 5MENE 2DBLL 3E3QE 1ZHLA 3DVFA 4XCCL 3O4OC 2W1NA 4LDEB 1J1PL 4KMQA 4QRSB 3HLAA 3HN3A 1MNUH 4P23A 4QRUB 5E99L 1DN0B 1YEKH 3IDYB 3IDNA 3RWEB 2UV3A 5GRWA 3EYUH 2HP4A 3X13B 2DJ4A 3VRJB 1I1YB 1Z9LA 1DJSA 2DWDB 4NFDA 3IFPB 1HZHH 3H7BB 3OKDB 1OPGL 3MBXH 2DQHL 4LLYA 4XC3H 5C6WH 2HT2C 5DO2C 4YHLH 4EI5D 3IXTB 4KQ4H 2Q86B 4JG1L 4HIIB 4J4PA 3O6LH 4PGDB 4OCWH 4NQCB 1D5BA 4RWYH 4PJ5D 1KLUA 4MQXD 3FN0H 5DURB 5E1HB 5GRZA 5I6XC 2C7UA 3EOTL 2EDOA 1CZ8L 4KJWC 3WNMA 5K9JH 5T3XE 1FNSH 4S0SD 4PJGF 3I75A 1MJUH 1DBML 1IC1A 5TDOB 3BT2H 2VZ3A 1L0XA 4HV8B 1G0XA 4HQQL 4K7FA 2VLMD 4OLVH 3VGAB 4Y5XC 3BFOA 3GHBH 1RUKH 3B2VH 3MROA 5ADOL 1OT2A 1QBBA 2EDFA 4JM4H 3BEVB 4OGYL 3QG6B 4ZFOA 4FFVC 3SKNB 3OR6A 2QADB 4ZO8A 2ZUQC 5BZDB 4H1LH 4L3CB 3D5OF 1GC1L 2G5BB 3QYCA 1LK3H 1G1CA 3AU1B 1NLDL 5T1KD 1HCVA 3DLQR 5IBUB 3RWGA 1PKQE 3MV11 1J1XH 2CH8A 1WVZA 3F7PC 1LK2B 3GI9H 3MODL 4JFQA 4P3DA 4PJBE 1N0XH 1RJCA 4XCEB 5DDHB 1HWGB 4IDJH 2R0WL 1R3IH 5T3XD 3VH8G 5JORA 4ZAKA 1IQWL 2IC2A 2D0GA 3O11B 4Z0BL 4OZHE 5C6TH 2W38A 4RGNB 3LZFH 4JM2C 4X8JA 1HSAB 4WU7A 4MA3B 2I07B 1U91B 1DBMH 1G7JA 2P43B 1BHGA 5FM5M 5C08D 3KPLA 3KWWA 3MV8B 1YEDB 4JFDE 3LQAH 3R1GL 4NHCH 5IHZB 5KSVB 4ZODA 5I0DA 2X4SA 4X7TA 4LRNL 4H1LB 5I73C 5BRZB 1S9XA 2ZP0T 2V2TA 1N0XL 1BGXL 4PS4L 1XIWC 2OXHA 1P84J 1C5DB 4WFHD 1ZEAL 3H0TB 5D1QB 4V1DB 4HKJB 5HSFA 2CDGB 3KYOB 4XZUA 5FCUL 4JG1H 5E4IA 1S7XA 5H94B 3VGBA 5C0IB 5AD0A 4NGHH 2J5LB 1M1SA 4H1LG 4ZO6A 3VXPB 1XF4A 2HRLA 2W0LA 5DD1H 1V05A 5EUKB 3D3VE 3FL7A 3UTSA 2A6KB 3CMOL 3LQZA 3D2UA 1NBVH 2WWMD 1RZJL 4WO4D 4ZO9A 2IADA 2Y5EA 5I15H 4RGMC 1T66D 2EIZB 5BV7B 4XCCH 2DQCL 5D2LF 2V5YA 4PP1C 2Q86A 2XTLA 2EYRA 5EBLB 1R5VB 5FYLE 1YEGL 2VO5A 2MCPH 3VGDA 4D0DA 5DQJB 5CBAA 4LCCB 5EDXA 3SDAD 3U7YH 4Y1AA 3BEVA 2VZSA 4POUB 4R8WH 1LO4L 3GSWB 2HT4D 4GKOA 4M9OA 3NTCH 4HWZA 1TITA 4X5XB 1NFIB 1XAUA 4TTDC 1F3JA 3WNLA 3LOWA 1OP3H 4I1NB 5FUOH 2AJXL 2QQKL 2XRAL 5HHOB 4MNGA 1EAPA 3DRQA 3ZL4L 4UQ3A 4HS3B 5AZ2H 5DEGA 2AJUL 3G9AB 4RA3A 1R5IB 3N1PC 1A6UH 4LHUG 4D0DB 1YA5A 3QNYB 3S4SA 1G9NC 5DJ2B 1HWHB 3RY4A 2CIKA 4NCC1 3B5HA 3BD5A 5F9WB 3G08B 1U93A 1C1EH 4X0KA 1EPFA 3V5HA 3NA9L 5EOCJ 1ZTXL 3N50A 3BQUA 4IMKC 1RURH 1JPTH 4RNRB 5L0QC 3OZ9L 2BZDA 1KIRA 3ZKNC 1B2WL 5CHNB 3MACL 2XZAL 2P5WB 4LDLB 1IMHC 2OJZL 1NC2D 3FQRB 1FDLH 2AJZA 1OGAB 1MWAL 3BJLA 3BZFB 4IOIA 4LKXA 5MI0C 3W9DB 5JIIA 4LLMB 4PJIA 4MCZA 1T5WB 4C83A 4G42B 4JZJB 1C08A 5D93C 3RNKB 1FNGB 1PG7H 3OMZA 5LGHH 4OGXL 4GMSL 2GTWA 3AS0A 3ZT7A 4MAUH 1J0HA 4YFEA 3IXAA 1NDGA 1QLFA 2F58L 2VKXA 3D48R 5DJ6A 4DOHE 5F72S 4AEIL 3MV8A 1P4BH 4HJ0D 2BSTA 1MVFA 5DYOA 1A6ZA 3MZTA 4I4WA 4F7EA 2AJYH 2W07A 4LBEA 2V5TA 1KCRH 1XGPB 3VG0L 3RIAF 4Z5RB 3QCTL 3VXUD 2XN9B 12E8H 4EI6A 1ZMYA 4CBPA 4CDGC 5E99H 5T1KA 1JGLH 3LEYL 5DHVH 5K59E 3HFML 3C6SA 5I8CB 3TBVA 3PQYA 2RJMA 3UJIH 1RJYB 1DFBH 1ZA3B 2CR6A 3L3HA 1CLCA 4L8SA 3TBTB 1CDGA 4LFHD 3P4OA 5AAMA 5TFSL 2FYYA 1D5XB 5E24E 3MV01 5FYKD 1DQDL 1CF8H 2V9TA 4F37K 1E6JL 1F8TH 3MRMB 1FSKC 2VXVL 3HG1D 3QQNA 4U6XB 1U8QB 1T0MB 1TQBB 5GGRY 1NGYA 1WTLA 4KJQC 1DQQB 4PD4J 4WJ5A 4OZIE 1VESA 4OI9A 5DMKA 5F88B 4CN6A 3IJSA 3HZVA 4NP4H 3RVVD 5IESH 3S4SG 5I1KH 3AS2A 2H26B 3LS4H 5C0JB 2ED8A 1V7MH 5DJXA 2DLEA 1E4WH 4B7IA 4FQJH 1UXWA 3B9KA 4CW1A 4L9DA 4XCYA 3LKQA 4Y19A 2KBGA 4BQ9A 3BYTA 1QYGH 4ZO7A 5FYJH 4CU8A 1EO8H 5D7IB 4UU9B 3UJTH 4NKIL 3HR5A 4IMLB 4BA8A 1A0QH 4PTTB 4H25A 3OB0H 1MCQA 2OP4L 3SDCC 1W0WB 1F4XL 5FCSH 4U6XA 3LKPA 1KTRL 3MLTA 4I0PC 3RHWK 1EFXB 1K5NA 3A0OA 3KYAA 4GRLA 2QQLH 1MHCA 4TUKH 3MRDB 3HI1A 2R56H 4WI9A 2Y6SD 5L2JB 1JGVH 2C1OB 4ERSH 5TH2B 1FG2A 1DLHA 2HLAA 1KJ2L 3VXPA 1EK3A 5KJRH 4Q9QH 3QUZB 4YHKL 4UIKL 4NSKB 3CAFA 2F53B 2DICA 3SDYH 4DQOL 3MRFB 4L4VA 3BN9C 5MEOA 3MXVH 5BQ7A 2X41A 1NCTA 2O5XL 3LV3A 2HVJA 4BJLA 3INUL 3N9GH 5ESAA 3EOAA 5C0AE 4ZFOL 3C8KB 1WZKA 4M6NL 3KWWB 3PP4L 5D8JH 5C9KA 3QEUA 3WKML 5IB2B 3NIFE 4I77H 5KG9A 4KQ3H 5FA3A 2H9GB 1EHNA 2FO4B 3GK8L 4OLXL 5FYJE 1OD9A 4JHBA 4CNIB 5I9QC 5FKPA 4KKLC 3KS0J 4U1SA 3VCLB 3PP3H 4KK8D 1UEYA 1E0OB 4X4ME 3S96A 5E95B 4Z7UA 5CZXD 3VD9A 1EBPA 4ZTPL 5IFAL 1QNZL 1CFVH 4NNYB 2C3XA 2F54D 3MV9D 5BV7C 3MRGB 2IGFL 1QRNB 3WS6C 2CKBH 1QBML 3BGAA 3RVXC 2YD9A 4C56E 4NJAL 5C9JA 3QZWB 1JL8A 3RWGB 3IDMB 4JQVC 2FZ3A 5E2TH 2MHAA 5D5MA 5I1EL 2APFA 4G8GA 2VH5L 4DK3A 3U82B 4HGMA 4G8FA 1PYWB 2E9JA 1PDKA 2JTDA 1T5WA 3RZCD 3L3IB 3CD4A 4DKAA 3MMEB 5FO8B 1NC4B 2R15A 2PF6A 1LO2H 2YBRA 2E3VA 5E4EB 4JPVH 1SYSB 3FB7A 2A0LD 3KPRE 3EYFA 4YHOH 4WFFD 1RIUL 4LCWE 5B3JF 4GW1B 5F1NA 5ISZB 3RI5K 2A1WL 1X4YA 4PJDB 5FFLA 1MEXL 4OIBA 3WD5L 4BH8B 1E28A 3V6BR 2EIZA 3C5JA 5FGSA 1ONQB 3CH1A 2GFBA 4PRHB 5IMLA 2APVA 4WHYG 4YDIH 3VI4F 5I8KL 3MJ9H 4JFDB 2Z4QB 4I3RH 4NZRL 3QNYA 4M62H 5TDPB 4LPCA 5F7EH 5IMMB 1KELL 4PJHF 1F45A 5FECB 1I4FB 3VFUB 3L9RA 1IT9H 3F62A 3P4MA 1G7MB 4Y16C 3ARDC 1ACYL 2E7HA 3VFPB 4UIMB 2IPKA 2Q7YA 5BW7C 4GAFB 3OKNB 1AD9A 2QKIA 3OJ2C 3P30L 4EZMA 1CBVH 1KPRA 1SBSL 4KC3B 3OZ9H 4XPGL 4JFEE 1I1YA 1JYXA 4LCIL 1QFWL 5F7DA 15C8H 2AK4D 2VQ1A 5EBGA 4FQ2L 2G5RA 4EDWH 5IVXE 2IQAA 2X4SB 3PV6A 3QFJE 2KUTA 3ULUL 2FX9H 2OP4H 3EYOB 1IGMH 5DJYA 1TPXC 1EBAA 4EIZC 4A6YL 4UILL 3RVWC 4XHJC 2FLBT 3MR9A 5ADOH 3NFSH 4HUVA 4EDWL 1R3KB 1Q9WA 4QF1B 1EGJH 4O9HL 1U91A 1IM9B 3UBXB 3UMTA 3QA3A 3ZE0E 4GSDL 1S8DB 3UTSB 1GC1C 4PJGE 5HI4D 32C2A 1SBSH 4PYHA 2AERT 4Y5YB 3SKMB 4KTYA 1T1XA 2MNUA 4YHML 4JRYD 4ZUVB 4Z95L 5L6YH 1CLOH 1BAFL 1AGEA 1NC2B 3BPNB 3VFMA 5E8EB 4ZOAA 4CNIA 5I1AA 1FVCB 4YBLC 4V1DA 3B5TA 3QIBC 3C08L 3BPOC 5DLMH 2D03H 3V8CA 2P7TB 4KY1H 5E8NA 4HBCL 1JHKL 4FNLL 2CRYA 5CSZA 2XTJC 4L3CA 5C0GB 2B4CL 4LPYA 3ROLA 3X12A 3LKSA 1T7XA 5H37H 5IFJA 2ZNWA 3IGAA 2WBJD 3QO0A 4IRJA 1CQKA 4U1GB 3RP1A 2J4WL 5IBLD 3EJZC 4KWUA 4EOWL 5IOPB 5ICYB 1D6VH 3MRJA 3O2DH 2JJWA 2EICA 1U8JB 2FX9L 1NCBH 3TJHC 3VG9B 1LO3L 3P30H 3WJJC 4X4XB 5ERWB 4JPWH 5I9QB 5IG7A 3CLFH 4K55A 1W0VA 4MJ6B 1HN1A 1QFUL 1A14H 3LRGA 3HR6A 5EPMB 3PDGA 3PWLB 4D9LL 4JFXB 4ODBD 1HHKA 3TCLA 4ZPVB 4KFZC 2BSSA 4MB4A 5DGRA 2RB8A 3K80A 5DQDH 4X83A 4E5XA 4OKDA 1A1OB 1ZLSL 3OF6D 1FBIH 3U9PL 5HVWA 1G84A 4OZFB 4PV9A 2FATL 5DRNB 3RY5A 4NRXA 3G04B 4XNXL 2XWTA 2R23B 2P44B 4FN0A 3V0VA 2COQA 3OKEA 3RWJA 4XCYB 4Y19B 4P23B 4QRUA 2YUXA 4P49A 4R90H 2BHUA 1KCVH 5E0QA 4X6CA 2W60B 3K8KA 5DD5L 2NQCA 3X3FH 1FV1B 3MTRA 3VXSD 4HZLB 3UPCA 3UROR 1M7IB 2H32B 5SWZD 5K9QI 1T21A 1LWRA 2CDFA 4MJ2A 1MF2H 2F53E 4DN3H 2CKBB 1BP3B 1GAFH 5DVNA 5GRJL 4K8RC 3F7YB 4PREB 4M1DL 5C08B 4I3GA 4QHNA 3G5VA 2ZSVB 1CFVL 3U9UB 4JB9L 5IROA 3VFWA 2APBA 5HYJA 3MPCA 4YBQD 3SDAB 4XMKL 5ACZB 1D9KD 4XH2A 3UCRA 1L6XA 1U8KA 3D9AL 3BO8B 4NKOA 5B38A 5KSBF 3QEUB 5JO5B 2AQ1A 3O41A 5EA0H 3QHTC 4M8QB 2NTSP 3IGAB 2X42A 4NNXB 1MVUB 2EC9U 4L4VD 4WCYL 5CIPB 4Z7UE 3HAEG 8FABA 1QBAA 5IB1B 4EUPG 4PG2C 1BQHB 1KN4H 1PQZB 3KJ6L 5EOTA 5J0BA 1KJVB 3TZVA 1A7QL 1QEWB 1B0GA 1IRAY 2IWGA 2HH0L 3JWDC 4PJDE 3MGOB 5DRWA 2FECL 3HI6L 3ZSSA 3SDDC 2P47B 3FB8B 1ORSB 2YPLA 1Q72L 2XNAA 3PWUA 5M94B 4G8GE 3VFWB 1PKQB 4CVXA 2Z0BA 1MI5E 2J6EL 2OL3B 1D5IL 2O93L 4ZAKB 1IL1B 3C5ZD 4M6OL 3DETC 3Q6FB 2IAND 2EDJA 1J1PH 1WAAE 4NZUH 3UZVB 3C9NA 1PBYA 1U3JA 2YRZA 3RWHB 3QH3B 3QZWG 1MFEH 1CGVA 4TUKL 2HN7B 2Z93B 4LIQH 5ID1B 3F7RA 4KKLD 1CFSB 4X98A 3EYQD 5MP6L 4XNYL 2UWEE 3NAAL 3C5ZC 3W39B 5FO7A 3QI9C 3L5JA 5C0BE 4EI5B 1BOGA 2YUVA 4GG6B 3G04A 1KB5A 3SHSA 4GQPH 3RX7A 1J0JA 1YN6B 4XMLH 2B8OT 4TN9A 4QRPB 4RWHA 5IVNA 4OLZH 3SPVA 3LKOA 5I8OH 5KTEH 2YPKA 5ICXB 4JO2H 2VMFA 2CLVB 3VXSA 4PP1D 1A2YB 4FQJL 4JPWL 3P4MB 4ODVL 3S3SA 5DJ8B 5ID0B 1I75A 3DRTB 3WV0A 4X7SL 5D1QD 2VLRE 2BVOA 2DI9A 2ADJA 4ONOA 5C6PB 1E4KA 4Y5VC 3F5WA 1NQBA 4Y7MA 3REWA 4QRPD 3SY0B 1KJ3H 1MCIA 4L4TB 5SX4I 1ONQA 4ZDHB 5ILTH 1RUKL 3B2VL 3O9WC 4U1MB 1HXYB 1IEHA 4XP5H 4TTDD 3QCUH 4HS6A 2OS7A 4FXGA 3TJEH 4MVBC 1CICA 1CWVA 1ND0B 4HF5L 2BNRE 3L5XH 5GZNC 2DWEA 2GJ6D 2WIIA 1ORQA 3N1FC 4NQTA 2X4TB 4N9GB 3RWEA 5GS0L 3WIIH 1B4RA 3NA9H 4NQEE 3WYRA 2M1KA 3FQNB 1C5BL 3GO1L 5D1XC 1EHLL 2C4XA 3NZHL 5E00A 4PRPA 4YHNA 4WV1B 4MD4B 4WGWB 5D9SA 3ARDD 1CXKA 3PL6A 4P2RB 3IDJA 3U4EA 2VC2H 2BFVL 5HHOE 3ARGB 3C9NB 5DHYA 2E27L 4LLUB 2YKLL 2UYLB 3BZDA 4H5SB 4UQ2B 5JHDB 3TO2A 4GSDH 1RZGB 3NABL 4QHKI 1DVFA 1FO0B 1YUHB 4OGZA 5H8DA 5MHSD 4HWNA 2F58H 2AVGA 1EFXD 3SBWC 4JLRB 4D94A 5GS0H 3LKRA 5JW5A 1YEHL 2VSCA 1JTPA 3WHXA 1T1XB 4GG8A 3CX2A 4G7VL 1QBLL 3I6GB 4XNYH 4M4PA 3IU4L 1X5GA 4NKDA 3WSQL 4R7NA 1YEGH 1J0ZA 15C8L 4FZ8H 3I02A 4QT5A 3VE0A 2XWJB 4PP2B 3ESVF 1T20A 2FH6A 4GRWH 4ONHA 3G5YA 5HGGS 1G9NL 1U8NA 1AJ7L 1A3QA 5CEZD 1M4KA 4WTXA 3NFPB 4G9FB 3UC0L 1NDMB 5DJCA 1G7IA 2XFXB 4GUPA 5IROC 7FABL 1EFQA 2X4RA 3W9EB 4KI1A 3U9UA 4BZYA 3HC0B 3HPLA 4UV7L 1AP2A 2ZG1A 1I3GH 4JKKA 5LCVH 3OJVC 5IB3A 1ZHKB 4GW5A 4E9LA 3RDTA 4M93B 2KPNA 2PW1B 5L9DH 3I2CH 5IB4B 4S2SA 2D31A 5E4EC 1J88A 1NLBH 3ZL4H 2JE8A 1K8IB 4Y8AA 4OF7A 1HH9A 1LO4H 2EEDA 3VWKB 4MJ5B 3LPGA 4FMFA 3WNPA 1OW0A 1JUFA 1RIUH 3KLHC 1IGFL 1PLGL 2LTQC 4PJHE 3TT1H 4LLQB 1FAIH 4HC1L 1J18A 4LSTH 3OKMB 3T1WA 3UTTD 3EO0A 4R3SB 3KVQA 4M7KH 2R2CA 3BP5B 3EJJX 2KKQA 5SWQA 5E2VL 1CD8A 4XMKH 3U36A 3CFEA 4L3EB 2OBGA 4R4FL 3GSNB 4WEUD 5F7NC 5CINH 2OL3L 1FFPB 2D4DA 4UNVA 4O51B 5EBWA 4NRXB 3FKUS 2PW2B 4HIJB 4RIRA 4U31A 5I15L 1TPXB 3T0EA 1MIEL 3QQ9C 1XGUB 1YPZA 3EOBA 1CLZH 4L9LA 1JJUA 4JPIA 4PTUA 1RUPL 4Z7QF 3SE9L 3IDMA 3T65B 3N85H 2DLTA 3KS0H 5CMAA 2E6QA 5GJTL 2NZ9D 5DMKB 3QAZC 3BDXA 2XZCH 1MEXH 5SV3A 1G0DA 4MA8L 4CDHA 3O45B 2VL5B 3LIZL 3EKCA 4FZEH 3ULSA 3WXVH 1AQDA 2VUYA 3GKWL 4NHUB 4XXCC 3KPMB 1HCFX 3WIHA 1ZEAH 2WBJB 2X4PA 2DD8H 3PHQB 3RX5A 4IHOA 1NCCL 1L0QA 1FFOB 3ARBB 3LN4B 3JZ7A 1UWEH 5JA8B 5E2WL 3LKRB 3ARDA 5K9OA 4K71C 3RU8L 5EU4A 2LVCA 3QEQE 1MCLA 3WHE0 3KXFE 2JJUA 4N8CH 3MRNA 1UG9A 3SQBA 4XPFH 1WWBX 4PRHE 2ICWI 2ITCB 2ZZUT 1RUMH 3PHOA 1YY8A 4PJFF 3JV6A 5FYKH 4B41A 1QNZH 3C2SA 4P9ML 3KG5A 1A6PA 3PV7A 5CJBA 4AIXA 4DVRL 1MRCL 3BPCA 2EE6A 4WHDA 1ZT1A 1BZ9A 5GIRA 5DUBA 3TPUB 4LOUD 4FQIH 4X6CF 3O6MH 1JNLH 3FQTA 2XZCL 3TVMD 1Y0LB 4OTXL 4UT9L 3QJFB 4G6FD 2KDGA 4X4MA 1I1FA 2VITA 3FO2B 4OD2A 4ZSOE 2X4TA 3T08A 5IVZA 2P5EB 5DR5H 2ZOLB 1X5AA 4Y5YA 3TFKC 3MBEC 3M17A 3OKOA 1UM4H 5D7KE 3SKJL 5IHLB 3KXFD 3KR3H 1A21A 3EO0B 4BSVA 1J5OH 2NY2D 3ARBD 5T1LD 5IJVB 3L7EA 5SX4H 4F8TA 1KLUB 3QXAA 3P4NA 3DUSA 4P57B 1JZ3A 3JV5A 1NCWH 1QYGL 1T83A 1K6QL 4QXTA 5F7MC 2CUHA 4MDIB 2VRAA 3EJYD 3X11B 3ARYA 4K23L 5EBMB 4R0LC 5D7IA 4JB9H 3OPZL 1F11A 1IGFH 5IESL 3QNZA 3RRQA 3ZSTA 1IBGL 1WFTA 5HHQB 4FQPA 4KQ4L 1QLRA 2FX7H 2DWDA 3E6HA 2O5YL 4NO5B 1JGVL 4ERSL 3D85D 3CFJB 3OXSB 4XBEL 1MFAH 4QY8A 2O26U 3U36B 1KPUA 1U36A 1DANT 4J3XA 4RZCB 4N90E 1MCJA 1DSFL 3DYOA 2V2WA 3TN0B 1W0YT 1JPSL 3E8UL 2ZSWA 4Y4KB 2JIXA 2QSCL 3QUZC 1RZIB 1BQLH 4PJAA 3BSZH 5FA4A 3UYOD 1J1OH 3LSOB 1YEJH 5JIPA 4YDVA 1F42A 4KKCD 2DM2A 3AAZB 4HS8H 5TDNB 1YMHA 3BYYA 4S1DD 4Y2DD 3M1BB 1EO8L 3RZCB 5KVFL 2FBJL 3GSRA 5FUOL 2NMSA 1CG9B 1HIMH 5EU7C 1J8KA 4Z7WE 1NGWB 3PIQA 5DEFB 5DJZA 1IAIM 2W92A 3D0VB 5FUCE 5I1IH 5EC1A 3C6SB 1RZGA 5CJQH 3TT3H 5A2JH 4FTVB 3TA3B 1ITBB 5E9DB 1BFSA 4KH2A 2V2XA 3SCMD 5J9PA 4KK5C 4UUJB 5GHWH 2VZ1A 4UAOC 4MNGE 1EERB 1U0QA 3CFDA 4DJMA 4ENED 1J05B 2Y9RT 2I25N 4OM1L 3ALWA 4EKXA 3UYPA 1OQXA 2Q8AL 4M8QA 1QLFB 4JFFA 5KSBE 5I1LA 4HS8L 4Y16A 3DTXB 1VERA 3GBML 3BAEH 4R6UA 5M7QA 3QDME 4HG4J 2AJZB 4LU5H 1OAUL 3V95A 1G6RH 4JY5H 1CGSH 1FORL 1O5DT 1R24A 4ALAL 4G42A 2HRPL 1RUQH 2NW2B 4LSDA 3GBMH 2K7QA 1FNEA 5DTFA 1FVDB 3ZYJA 4WFGD 4QLRA 5CFHA 2ORBL 4PJCB 2DRUA 3FRUB 2JCCF 3B4NA 2R2HA 4ZDHA 2BNQA 3STZB 4GLRH 5INCA 2GT9B 1Y18A 3Q2CA 4R4BA 4NQEB 4NQDA 3ULSB 3DWTA 3F5WB 5D70H 1B0RB 2EDRA 4HPYL 4C55A 4P9MH 4KY1L 3B8YA 2ERJB 5LG1A 5MHSE 3CNKA 5GSRB 3QXWA 4Z6AT 1VFAB 5CUSH 4H20H 3QIUB 2H8PA 4P5MB 5DJ2A 5IBLC 3EJZD 2WSKA 3G5ZB 2OTWB 4UOW0 2BVPB 3BZEA 4NJ9L 1VKXB 2Y1VA 4X6CB 1BFTA 4HEME 4WI2A 1BZQK 2ICEA 1JK8B 1YC8A 3NN8A 3HS0A 3GMMA 2CLZB 2EEBA 4YHPB 4JO2L 3ULUE 1R3IL 3AM8A 3ES6A 5HYQA 4X80L 4X98B 5TDOA 3VWJC 3IFLH 3V5KA 3W82A 2EYSB 2X89D 3U46A 2FIKA 2IQ9L 2R4SL 2Y5TA 2VDPH 5SWQB 3PHSA 1FH5L 4PRNA 5I75C 3GI9L 4F80A 5ITFB 4UT6H 4YR6B 5A43C 3QQ3A 3O3AA 4UAOB 1WZ1H 1JZ6A 1RZJC 3S97C 3IJHA 1R5VA 1QTYT 4EVNA 1AIFA 2AV1B 4ZXBD 4X4XA 1UWGH 4H25B 4OGAD 2IADB 5BO1L 1I8IA 1RHHB 5J1TC 4R90L 5EO1A 2F8OA 1HKLL 4PS4H 3FRPG 5FM5O 3A6BH 4GBXD 2P8MB 2ESVE 2BMKA 1W72A 4HZAA 4JM2B 4OD1L 3VMPA 5I76A 1A7OL 3B9DA 3ARFD 2NR6D 5C0CB 2EDBA 4Y4KC 1XGYL 3BPCB 4OM0L 1FZMB 3BDBA 1V5JA 5C0GA 3G5ZA 3W0WE 3ULVF 4D2NA 4LLVA 5HDQL 2WV3A 1EZVX 2VDOL 1PKOA 1Z3GL 1CK0L 3AVEA 4YWGL 5T5NG 5E7BA 1ZHNA 5DHVA 1PFCA 5DWUL 2K1MA 5EIVA 2NY5L 4PJHB 1F4AA 3H2WA 1B0RA 4FZEL 4OUOA 4WWID 1CD0A 1CU4L 3BRDA 1H8SA 1FSKB 3STZA 2RIKA 5JTWA 4LCCC 2P8PA 3D0LB 4JFEA 4UTBH 5GS2D 1FVCA 4C4KT 3E0GA 4LCWB 4KAQL 4LDOB 3WJLC 4NUGH 1JVKA 4QRRB 1KB9J 5IR1B 3WNOA 1N64H 3QRGL 3C2AL 3GSNH 3Q5OA 4YDJA 2AEQH 4PRID 5I1EH 4PGEA 2R1YB 1KYOK 5KJRL 1R3JA 1MI5D 2RCSH 2Z91B 1D6EB 4H0IA 1RIHH 3LQAL 3PGDA 4QOKA 5E56A 2R9HC 2GUOA 3NZ8B 3KYNA 5I6XB 3DIFB 1TVBA 3SO5A 1OCWL 3ZDZE 3FQXB 1WITA 4PJGA 3RNKA 1FE8L 3HPJB 3BGFC 4JCLA 5KOMC 1I8MA 4LLMA 1I9IH 3BHBA 1DFBL 4PJIB 5FOJA 3SQOL 2YSSB 3ZE0F 2F5BH 4MQTB 1KSRA 1WZ1L 1N59B 1KNOA 5D7LE 3ABZA 1P7QA 4JREB 3UPRA 4MMXC 5T5NF 4TUJA 4QEGA 4M1GH 5I1HL 3ULUC 3UJJL 4FXLA 1GGBL 4ELMB 3T8XB 5MEQB 4HGKC 5F6IC 4HX1A 5T33L 1AR2A 1BVLB 4YEEA 4DKEL 3QDJA 5F70A 3QPXH 2HKFL 1R5WB 2JJSA 4NBZB 5CEXB 3FB6B 4JRXE 1EJ6A 3BUTA 3LIZH 2HKHH 3CU1A 3X17A 1TMCB 1JNJA 5DF0A 3L7FB 4L4TA 2R2EA 2ZKHH 4U3CA 3DUSB 4P57A 4MNQE 2UWEA 4G5ZL 5DZLA 4EVNB 2ID5A 5CSBA 2OL3H 3VGGA 25C8L 4JFYB 3O3AB 2J8HA 1LNUB 5KZCB 2FSEA 4HFWB 4P2OA 5FGBA 3NACL 1OM3H 1HYRC 1X3DA 2F53D 3V4UL 1AJ7H 4PJ9C 2HJFA 5IQ7H 5AWNH 3ARFA 5A2LH 4BQ6A 1RSFA 1N6VA 4O02H 4GMTH 3E2HB 3VXSE 4TUJB 2Q76B 1KB5B 2FX8L 2VUOA 5E2VH 1CR9L 3QAZB 1S7UA 3TBYB 5FO7B 2BNRB 1MFNA 2CJUL 5GRYA 4GQ9L 4E0RA 3L3DA 3FQXA 1DUZA 4N0YL 4ZUWA 4HXBL 3VXQA 4KK6C 3L5IA 5HI4C 2DQTH 1XF1A 5KN5B 5E5MA 4GKZB 3MLUL 1MWAB 2DF3A 2HG5A 4PB9H 4C58B 1FORH 2ZUQB 1SY6L 3VGAC 5AEAA 4O2CB 3EO9L 4JDTL 4OJFL 2XQBL 4XPHL 3TIDB 2CLRA 5C2BH 3CFDB 1ZHBB 2AEWA 1KTDA 4XC3L 4OFVA 5J9PB 1KC5L 5DMYA 2X70A 3KLSA 2YD3A 3BX7C 3VFRA 1AGEB 4KROB 2V5SA 3PJSB 1SY6H 3MFFA 4ZPTB 3RGHA 3RL1A 4LCYA 3V52L 3AFLA 3C09C 4Z77B 3MYJB 4GO6B 2X4NA 2CK2A 1T3FB 2XZQH 1MNUL 1GH7A 2NY7H 5C0RH 1FLRH 3RVUD 1GZQB 3IFOA 4HUWB 3VA6A 5TGBA 1XGQA 4OCNC 5T3XL 3U4BH 1J9CT 1EA9C 4OLYL 3SQOH 1Z5LA 3MOBH 5CJXA 1ETZB 1KJVA 5KG9B 1A64A 4J3WA 3HHRB 1ADQL 2VR9A 3VXRB 4ESKA 1IM3B 1FLRL 1NKOA 3BKMH 3ULVD 5F96L 4TSCH 3O9WB 3MRFA 3SKUD 4LHJB 5GISL 5EU5A 1ROWA 2YPVH 2BSED 2ZCHH 3V52H 4UILH 2GSIA 5JXED 4IOFC 1N26A 3TEUA 1K4DB 1NCNA 4QY8B 2Y7QB 3F7QA 4UV4H 2AXFB 3RWCA 4BH7A 2VISB 3GMLB 2WANA 4N1HB 1FN4A 4ODVH 4PJ7A 4N0UA 1CGUA 4XGZA 3UXFA 3DXAD 5JXEA 5E2UL 4YNYA 2R1WA 1BBJB 4LLDB 4FMKA 2BCKB 3QHZL 4OLZL 1WIUA 3BP5A 4N1EA 2DMKA 4QXUH 2PTUA 4GAYA 3RTQA 4M03A 4OUUB 5DD3L 1T22B 3CH1B 4JKLA 1KYOJ 5I66A 2ZUVA 4ODSL 4PJ8B 1U2HA 4M43H 3VXTA 1DEDA 3ZKQD 5CLTA 4RAUB 3CCHB 2X9WA 3MLTB 3OG6B 3WFCL 2NXZC 3QCVL 4PRNB 1A7BA 2EEAA 5SWZB 3L3DB 2DKMA 5IQ9B 4HH9A 3ALXA 1ZT7A 3GMMB 1T80A 3IDIB 3QFJD 3FCTB 4P4KB 4YHPA 5JOPD 1U92B 4WI8A 3I75B 3GMQB 4J8RA 1QLRB 4XT1C 1G7IB 2R0WH 4ZAKC 1H15B 3GMNB 4YGVB 3WFEH 5IKCA 1F11B 2VLKA 5FF6A 4I5BA 1JGDB 2DQEH 2NXYC 1P7KB 3G5YB 2A9NH 1XR9B 3QIWA 4A2LA 4XP6H 3MX0A 2FBOJ 3SDXA 1D5BB 1AGBA 5GRUL 4KDVA 3P4OB 4ODTL 1HOCA 4EQ2A 4LSSH 5J13B 2JJTA 5TQ2L 1KN4L 3AREB 3KJ6H 4HUWA 4E41E 1F6AA 1OL0A 2W0FA 2UWEF 1D5XA 1R0AL 2P48B 1UADC 3KHOA 4NKIH 3K2MC 1A5FL 3ILPB 5HYSA 2ADGA 5J3HD 1JYVA 5DFWH 2X4NB 3SO3B 4KZDH 2FB4L 4Q9BA 3KLAB 3MFFB 4ZPTA 4HLZH 2FECI 3ZMRA 1MFEL 1IGTB 3L3IA 4JY6A 1WIOA 4CVWA 3CXHK 4Y4HD 3B3IA 1MCRA 1T2QL 4EUPH 1GOGA 1U9KA 4JPKH 4JKWA 4P46A 5IB1A 1I8MB 1ZA6A 4XPAH 3NFPA 2YC1A 4G9FA 5JMRA 1MUJA 3A6BL 5F7WC 2Q8BH 1KFAH 4MXQC 1KENH 3CMOH 3BXNB 4APQC 3B9KC 3U0PA 1ACZA 1SJHA 1I9RL 1K3ZA 3H3KA 2AJ3A 4F7CB 2K3TA 5DRXB 1I8KB 2ENYA 4Y4KD 3MLSH 3NPSB 1EH9A 4DGYH 2WWKT 1U42A 2OI9B 1TFHA 4XNUH 4LMQE 5I75B 2F54E 3MGTB 3MV9E 4XAWH 3WXWL 1BWMA 3BMWA 4QHLA 5JIHA 1WEJH 4X0KB 3IDGA 1Y6KR 4X99A 4AG4L 3VFTB 2CO6B 4WFED 1A4KB 1XGYH 2BJMH 2ADJB 2EDYA 4LOUC 3V5HB 1ZHBA 4QWWD 2APWA 2VXTL 3ZHKA 3QT2A 4PV8A 1E4XI 1NFKA 2CIKB 4PJ7F 3QWOA 3OJDB 4RZCA 4NWTH 3RZWA 1WV7T 5BXFB 1R3HA 5JXAL 1Q1JL 5C0ND 1FZMA 2VLKB 1FVEA 1REIA 5TE4H 3OAZK 2LU7A 4PRPD 4UDTB 4KI5C 5DA0B 4G6KL 2BNUB 3DNKA 2DWEB 5DJAA 4OCXL 2EXYD 2R0KH 4JRXB 3VG9C 5TH2A 3MBXL 1HKFA 2AK1L 3Q48A 4E42B 3ARFB 1H3PL 3R06A 1LDPL 2IFFH 3KJ4C 1U3HB 1NGQL 2AV7B 1WZLA 1UGNA 4LPTA 1UFUA 4ACPA 4M1CC 4XNQA 3EDKA 3OJDA 5IWLA 2GUOB 4OT1H 5FYLL 4O5LL 2EE9A 1LE9B 4Q74A 4Y4FD 1PAMA 5KS9E 1CGTA 1CD1B 3HB3C 1E4JA 5IT2H 1KCKA 5L8KB 1AGDA 4Y8DC 3MQIA 5JR1H 5ITFA 4L8BA 4XWOC 1DQJA 1H8OA 3Q0HA 1MCNA 4NN6B 3UYRH 3VFOB 4A6YB 5IUSA 4S1RL 5T5FH 2VDLH 4LRIA 3P9LA 5C0BA 3OF6A 4OZFG 1G9ML 1OP5K 1X5LA 4QCIA 3R0MA 2VXSH 5BVJB 4KJQD 2X4OB 4FQCH 1RJLA 1IZJA 3MMEA 5J1AA 3BPNC 1FNHA 3OXRA 4PBVC 3IDXH 2QADC 1IQDA 2OZ4H 3R8BB 4NOBA 2GYSA 1K8DB 2AGJH 5GRUH 3CUPA 4Y4FB 1DBJH 4XP6L 5EFIB 1I9JH 1T20B 2HN7A 4PJ5A 1QQDA 5KN5A 3FOLB 1HXMA 4UBDC 4EOWH 3MUZ1 5DRZB 2DQGH 3HUJF 1U8MA 2BVYA 3HI5L 5IMOB 1R3JB 2GT9A 3HG1B 1WT5C 5C07D 2DQUH 4KI5F 3KR3L 1D5ZB 1T89A 3LS5L 4WTZG 2RHEA 3MLUH 1KIRB 5FYKE 2R2BA 4FQ2H 4NGHL 5ALCH 5FKPB 4N0YH 3UTOA 3QUXC 1ZVSB 4ETQB 5CZVH 5D1ZB 1ZLUK 4PLKD 8CGTA 3HMXH 4HAGA 4MXWL 4DUXA 2FCBA 3GJFB 4B0MM 3C08H 3G6AB 3D18B 3TZVB 4QRRD 4HCRL 1U8MB 3QDMA 1AGBB 1NDGB 3M8OL 1FIEA 4RFOH 4Y4KA 2IPTL 1BECA 3DURB 4YLQT 3FFCB 4W4OC 1FJ1B 5EU6D 5IQ7L 4HHAA 2UVFA 1RIVH 5DJ8A 2A74B 2Y23A 4NN5C 3TC9A 5HHOA 5KVEH 2APXA 1A3LL 1LP9A 2YRPA 5I8KH 3QDJB 3C09B 3DVNA 1JFQH 1YYLL 1CLOL 5I1GH 5EULV 2C1PA 4X9HA 1JZ7A 4I9WE 1CN4A 2GK0B 1X6NA 2HFGH 2BNUA 3ORJA 3T3PE 3VFPA 5CIPH 5DEFA 5DJZB 1DL7L 5C70A 4LCCA 1FNAA 1ND0A 2G60L 5IHUH 4PB9L 3SKJH 5C07B 3NIGF 3GK8H 3F7VA 4MD0A 1CFSA 1MJ8L 3BIAX 4MDIA 4G8EA 4Z0XA 1N0LA 5FO9B 3MC0A 1T21B 4LLQA 3PGDB 4MXVE 1BD2A 2X1PA 2RAMA 2DB8A 2VLKE 5C0AB 1IGIH 1EEQA 1NEZG 1F6LL 1Y18B 1MCPH 2H2PD 5D7LB 1R5IA 4FQLH 3ZKXC 5HHME 1IKNA 1U3ZA 2AS5M 3G6JE 3MUGA 4DQOH 1N8ZB 2B1HL 4S2SB 3OPZH 3VMOA 5C07A 4RMTA 1SEQH 5GZOD 3W5MA 1HK6A 4W68A 4JGUA 2R1WB 4AY0A 4XPFL 3Q5YA 4HWZB 5E1AA 3N1QC 3U0TB 2N7AA 1NMBH 4OF0A 5CD5D 4XWGL 2ILLA 3EYVB 4PLJD 4LNRB 1YZZA 4QHUB 3U2SB 3X13A 3RU8H 1ES0A 1U8PA 1MQ8A 2AJ3B 4KXZI 4WGVB 3ZKMD 4MQXC 2GSIB 2H2PC 4WI5A 5EBLA 5DS8A 5F7FA 3BN9D 1F4WL 5FCUH 5IBUG 3PNWB 4ONHB 4WHCA 5C09D 3VFGL 1SBBA 1P4IH 4YK4B 1T1YA 5EZOH 1FFRA 3S7GA 3QH3A 5EG6C 4U1HB 4XNUL 3ZDXF 3ZHLA 5TGBB 2R29H 3B3IB 1OW0C 4BSWB 4I3SL 3F58L 3S8WA 1JPFA 3QR2A 3ARDB 3NMEA 5K9OB 1RZ8A 1JNLL 4PLNC 4NYLB 5DSCB 2B1AH 4OCSH 4M7LH 1AI1L 1CIUA 1KLFA 1RUPH 5IVZB 2B2XL 4RISL 3RL1B 4R2GC 5JOFB 5TE6H 2VN7A 4I18B 3OGCA 3OG4B 5E2JA 3O2WL 5E70A 4K2UH 1XGPA 3PDOA 3T0EE 4YEFA 1DLFL 4OZHF 5DMIH 1P7HL 2CKBA 1CFNB 4YZFF 2P46B 1LO5A 2AV1A 1JWSA 3FO0L 1BEYH 1GOFA 3JV6B 4MHHG 4ONFH 1EEYA 3OR6B 3O81A 5JA9A 4R26L 3MRKA 3NFNA 3RTQD 2W65B 1YDPB 2WW8A 4P2CG 4CN4A 3KPQA 5BV7L 1FFQA 1ES0B 1U8PB 3C60C 4GS7B 1UA6H 2Q76A 3EDFA 3MV8D 3QQ4B 5C0EA 1Z2KA 2FH8A 4PJDF 2DQDH 2X40A 4JM2A 2Q3AA 3EZJB 3LEYH 2BERA 1RQ5A 3I3DA 4JFFD 4JCMA 4PJIE 1NGWA 1F5WA 3PIQB 1EAJA 4M93C 1MY5A 5BV7H 1QSEE 4L3ED 5CAYB 3O2DA 1H3TA 5BXFA 3T0DA 3ARXA 4LQFH 3QA3B 3P77A 1LE5A 9CGTA 3QIUA 2F19H 5FIEA 4JZNB 4LASL 5CSGA 3PWLA 3IDYC 1FO0H 1OTTC 1EO7A 4L9LC 5I1JH 1FZKB 4EN3B 1RZIA 3ZE1F 1BD2B 3O4OB 4MAUL 3RWFB 5MERA 2AABL 4I0KA 4NDMB 4HZLA 4F9PC 5AYUL 3V4PL 5F6HI 4MQ7A 5KVEL 1UB5A 4N0FB 3IVKA 3WLBA 1BQUA 3GJEA 3BZ4A 1JMXA 3U46B 3VXNA 4NUGL 5EUOB 1L7TH 3QDJE 4PGCB 4I8DA 2UZIL 4JRXA 3FT3B 3SOBH 1TENA 3BDYH 2C9AA 1HHHB 4X6FA 1U8LA 3TT1L 1P7QB 4IRSB 2XFXA 1QKZL 4ODUB 1F2QA 5B39B 3QNZB 1N6QH 2V5RA 3CFBA 4ZXBA 2Z35A 1IC5H 1OY3B 4I48B 1VCAA 5ID1A 3KYNB 2HJKB 4N0CD 3HE6B 5B8CA 1YEKL 4F57L 3MV7E 4YPJA 1S7SB 1U8HA 5LCVL 5AYQA 4XNZB 3TNNB 3VFSA 4PJ8A 1RJZA 2P5WD 1TZHB 4KK5D 4BELD 4EEEA 1MQKL 1KJ2A 2DBLH 1I7UB 3EAKA 1YECL 5ERWA 3EDJA 4Y19E 2AQ3A 3TA3A 1JRHL 4Y19D 4PJ5E 3WDHA 2HA1A 3N0PB 3TYFB 1OTSC 3CZFB 3LD8B 1FNEB 1NAKH 1J8HA 2W59A 1DVFB 1FO0A 2VXSL 4GLRI 1YJDH 5DK0A 4DZ8A 3UTPD 5CEZH 2X4RB 1CF8L 1F6AB 1N6UA 2OR7A 2VDMH 1E27A 1FIGH 2BSRA 1NJ9B 4XXDB 3HG1A 1NBZA 1P1ZA 4O58L 1B2WH 3IU4H 3PL6B 3PWNB 5DJYB 3SE8H 1HXMB 3RUGB 4K9EH 3CLEH 1B4JH 3VFVB 1MVUA 5JHDE 5DGQA 5BJTB 1EGJL 4L9LB 3T4YB 1QA9B 3BQUC 4N8PA 5D6DC 5ELIA 4ZUWB 3QDJD 3QWRA 3VXQB 5I74C 1KJMA 3ARRA 2GI7A 2NY1B 1UM6L 2R1XB 5B39A 1QFOA 5E03A 2VLLB 1JZ2A 3N1MC 4R7DA 3RQ3A 4TSAL 4HJJL 1F4YL 5FUZH 4OCRL 1H0DA 1WCBA 2LABA 1ZT4B 4LL9A 4AT6A 3Q5TA 1UEMA 2J88L 5E6IB 1TZGL 3V0AC 2GTZA 3EDEA 3S36L 1Z9OA 3FFCE 2UYLA 3KPMA 3MLVH 4S10A 5JXAH 3FMGH 4RAUA 3ELAT 2LAAA 2X44D 1UACL 1YYMH 3RPIB 1NCUA 1S7VB 4L3EE 1QSED 5IM7B 3CFCL 3LHPL 5HYFA 4G9DA 2VDNL 4JQXC 2WLYA 4JFFE 5KSBA 2VLJE 1RULH 1K4CA 1XEDA 1VA9A 1CIDA 4PRIA 1G7QB 1IFHL 4U1NA 3MV8E 3HMXL 4MXWH 3BVNB 4M3JA 3OKOB 1JGDA 4V1DD 4O2EB 3ES6B 2NY4B 3QCUL 4ZOBA 2EYSA 1AP2B 4HMCA 2P5EA 4JQVA 4NN6C 1ZAGA 4MAYB 4WW2A 1Z9SA 4HEPG 3G6JA 2BK8A 3MREB 1UXSB 1G6RL 1K4DA 1KF9B 3HC4H 4JY5L 2ZCLH 1J0IA 3P9MB 1FVEB 2PCPB 4PJAF 4FQXC 1NEUA 5JOEA 2C26A 2FZ3B 1PD6A 2IMMA 1S7VA 4WWKC 2DJSA 1G7QA 4Z76B 5IV2A 4MJ6A 4PV8B 1IILE 4KJPD 5T1LB 3MLSL 1AY1H 1S5IH 5IVXB 1GPOL 5DEZA 1MFAL 1JF1B 2BY1A 4TSBH 2Z91A 3DETD 4HIIA 5F93C 5LBSH 5E9DE 2DDQH 3QXVA 3KYMB 3MOQA 3FQWA 1CDBA 4XVUD 5CLWA 4Z7WF 5HI5C 3DX7B 3AY4C 1TQCB 2VDKH 4UINL 3OAZH 1KTLA 2R4RH 3KPRA 3V6OA 4JFZH 4LCWA 4OFYD 5GPRA 1G7LB 3VJ6A 3GJFK 3P0YL 1NGXA 3UYRL 4WY7L 3OKKB 4ONFL 5IIEB 4HPOL 5KS9B 4P59H 4A2MA 1QRNE 2R4RL 4NWUL 3AB0B 5CKGA 2HTLD 3X12B 1E4KC 1FGVH 1HHIA 5D96C 4PJFB 2GKIA 5IHZA 5JW4N 4Y5XA 4E41A 4XVJH 2BRQA 1RI8A 4RWYL 1CGXA 5E94B 4FQHB 1DQLH 2L0DA 4L4VB 4LSQH 3ET9F 2JELL 5A3ID 1NCAH 3CC5B 4Z7NF 3O6KL 4KHXL 4JHWH 4X8JB 3OB8A 4PLJC 5I76B 4ONGL 4UUJA 2G2RA 5HHMD 2PETA 1TJGH 5E1AB 3U0TA 1MCBA 5BVPL 1CDHA 1DLHB 5JW5B 3X3GH 1BX2A 2VQTA 4JHWL 4OCLC 5DVOA 5EZLB 5JZ7C 5IW6A 3H42L 4KGLA 5JIKA 5CP3A 1V7NL 2ED7A 3EYQC 2ZUYA 3ISWA 5FKAB 3MR9B 4GKNB 3SY0A 5L88H 1S7SA 3W0WA 4W6WB 4ORZC 5IBTH 1KPVA 3NIDE 4B53A 1HSBB 4NT6B 2Y4SA 3IJHB 1T7VA 1T1YB 1N7ML 1WFOA 1VACB 3H9HB 3QXTA 3GIVB 5ID0A 3JWDH 4RMVA 5C86A 2YK1L 3L6FA 1IC7H 2WLZA 5KZCD 3QIBA 2CLVA 3VXSB 3RIAK 1A5FH 3RWJB 2EECA 5LQBL 5MEQA 2Z35B 1HINH 1XCTA 2VE6B 4X5XA 4PFEA 4YXLL 2J8UE 2DL9A 5I17A 3GMNA 4PJCF 5L7XL 4F58L 5HHQA 3TNMA 4J3OC 1ITCA 1OWRM 4FXKA 3WUWB 5K59F 4LAQL 4QWWC 1MOEA 2HFFB 3UTTB 3HZYB 3EDDA 4P5MA 1KCLA 1UKSA 6FABL 4XXCA 5GQBA 5F1IA 4AJ0A 1VENA 5IHUL 4Y2DA 2V7HB 3WJJA 3SJVB 2NX5D 1JIBA 5EUKA 5CZKA 1FRGL 1LO0L 5D5ME 2YWZA 1LD9B 4JFOB 3QJHA 4MNGB 2VXVH 1P5VA 5TE6L 3RA7L 3HNVL 3BIKA 1Z0MA 3BT2L 4O4YL 1CDJA 3MLWH 1ZLUH 1K2DA 3RBSA 3I9GH 3G5XA 1PYWA 2P8PB 1N5AB 1MCFA 2JB5L 5DJXB 3U7WH 3VW3L 2HT3D 2DMCA 3KLDA 1Q38A 4BH7B 3GRWH 5H2BA 5LAXA 4U6HB 1UZ6F 1BQHA 3I6LE 1J8HE 2WK2A 3VFGH 1MCKA 2ADFH 2B7DT 1G7PA 4QXUL 3VRIB 3ZYZA 2OTUA 3QXUA 4PRPB 4YHNB 3QBTB 5IJKA 4UDUB 4P0DA 3CJJA 5ETUB 3I02B 4ZUSB 3H3PH 3QUML 3RDTD 2YRLA 4DW2L 3DMMB 1HSAA 3GHEH 4DUVA 4R7NB 1GZPB 1W8OA 3ZYIA 1AXTH 5DMGC 1WBZA 1PG7W 4FQQA 4MJID 4K3EH 3U7WL 5A2IH 2WP3T 1QLEH 1G9NH 4FA8A 1NBYB 1U41A 1RZKL 1CGYA 2WUBH 4L4JA 1V8HA 3QEGL 2ARJA 5IFJB 5IVXA 4PRAA 5GHWL 2HFTA 3T0BA 4Y16B 4KTEH 2VXQH 4YDLC 2DLHA 2PKDA 3S3JA 5T1DH 3AY4A 3LDBC 1OAXL 1YJDL 5EFIA 4Q2ZB 1P7KA 3TGXA 2ZOKA 1NANH 3REVA 1FZJB 4LLWA 4JZJA 3P9MA 4MAYC 1UC6A 4I2XA 4U1LA 3NIFF 4TUOA 1CLYH 1XF2B 2CLZA 1YECH 4PG2A 4LNRA 3FCTA 4P4KA 4GOSA 4XX1E 3K7UA 2VC2L 5L2JA 1LD9A 4JFOA 4LIQE 1CFTA 2IH3B 1YYLH 32C2B 2IBGA 3QEHA 5BS0A 5I8OL 5T33H 5C09B 4DFHA 4ODWB 5JW3H 4LPUA 2OSLB 2XTJD 5F9JA 3WKMH 4GRLB 4K7PH 2NYYD 1DSFH 4U1MA 3DHMA 3MLWL 3MUJA 4PJXF 5A1AA 3VWKA 5I30L 2QL1A 5IG7B 4PJDA 5B39G 1G6VK 3V6ZA 2NXYD 2BCKA 1CXEA 2F54A 3MV9A 3P0GB 3S34H 3OSKA 4XVSL 2CKBL 1OAKL 2EZ0C 3IAGC 3MJ9L 4LVHC 3HPLB 3OBAA 1IAMA 3QO0B 3RI5F 4F15C 1PEZA 5CD3B 2AQ2A 1KBGH 5ISZE 5EH1A 1RMFH 4MDJB 4NQCD 4G8IB 5GIRB 1YMMA 4J3SA 4BFGA 3S37X 3BHBB 3CFIC 4TVSa 3RBGA 3FB5B 2H8PB 1MFDH 4OCYH 4NO2B 1H5BC 2QR0A 2X7LB 1QRNA 4KI5E 5F6IB 1FJ1A 1H5BB 3BP6B 2DBJA 3HUJB 2Q20A 1GYAA 1IAKA 2AXJA 4QOKB 3I6GA 3WIIL 4C57C 3DO3A 3LQZB 3JTSB 3IFNH 3K81A 5B22A 3WLWD 3T2NL 3WIFA 1RFDH 2E9WA 5MEPA 1IGTA 1QFPA 4P9HH 4OD3H 4ZS7L 1KT2A 1YQ2A 2EDEA 4IIQA 4U2YA 1KBGL 1UH2A 5IR1A 1DCLA 4LVHB 1WBZB 3E6FB 2HMIC 3CSYB 3BKJL 3O6FD 1Q0YH 2NW2A 3TO2B 5HJ3B 4M6MH 1BIIB 1DN0A 4K9EC 3ULUF 3IDUA 3OV6A 1Y0LA 3FOLA 2DL2A 4GAGH 5C0FA 4K07A 2A9MH 5HI5D 43C9A 5IMOA 4NPYA 2FEEI 2ATPA 4AMKH 3LPFA 4X7SH 5GGVL 4LARH 5ESQB 4L29B 4MNQB 3VI4E 3KDMB 5E00B 2F53A 4I0PA 3D3VA 3Q6GL 4LAJH 2BNRA 4E0RB 2VJXA 3UTSE 4ZS7H 3I85A 1LK3L 4LAQH 4WENB 5HJ3A 4HXAH 2P49B 3SDCB 4YC2B 5SWSD 5AAWA 3FZUC 4LGRB 2NTFA 1OP9A 2NPLX 1KCVL 1UCBL 5FYKU 4YXLH 3ARGD 5IQ9A 1DBBL 3TIEB 4DKFH 3G5VB 4XP4H 5F9OL 4JN2B 3EGSA 3NCMA 1KCRL 3IVKB 2PO6A 1KEGL 2BSSB 5JLZA 3OKMA 4ZQKB 2VDQH 5IFHH 5GGSY 1OF2B 3PGCA 2AP2A 3KNBA 4UIKH 1OAKH 2X4UA 4XCNA 3K1DA 4OV5A 3SDAC 3DXAE 2VDKL 1IEAB 1AXSA 4J3UA 3SDDD 1NAMB 4XMPH 3KPSE 3HR5B 4RDQF 4TNWK 2RBLA 4Z8FH 3L3OB 4M5YL 4WO4B 2GCYA 5TPWH 2EKSA 1QFUH 2B2XH 1I7TB 2BNQD 4P2QB 4NZJA 2YPLE 1CS6A 1XCTB 3DYPA 1ZXQA 3DV4A 3UTZA 4LSTL 4LSPH 4IRJB 1OTTD 2CXGA 5J12C 1XIWD 5ALBH 2XOTA 5FK9B 4S1DC 1F13A 3ARVA 4UDTA 3ILQC 1IEAA 1YNLH 3U79A 2JELH 3DJ9A 4JHZA 3ZE2F 3DIFA 3PWVB 4QGYA 2YMXL 1RD6A 1EUTA 4G3YH 1K4CB 1U58A 5HDQH 2D9QB 2Z93A 4D0BA 4B50A 1TCRB 4I18C 1W0VB 3L3HB 1VFMA 1CVSC 3QUYA 1MLCA 4MB5A 3M07A 4OUUA 5EZLA 4YQXL 4ODHL 4JQIL 4QRTB 4TULL 2YD4A 3MSPA 4HLJA 3MGTA 3QIUC 2NW3B 1PSKL 4HUXA 4TRPL 1TJIL 3KPPA 2HLFD 2ZCKH 1BMGA 5E08L 5D7JD 5T1DL 5C0JA 1T6WA 4TULH 1Q9WB 5DVMA 4PJ9B 4U1HA 2HT4C 5D2LE 1ZT1B 3QFDA 3MOBL 4GRMB 3PWPD 2ATPB 2XYCA 5IK3A 3ROLB 4RQQA 3O9WA 2B39A 2IALA 4JG0H 4ELKA 3QZWA 3WE6B 5HGDB 5BS0D 3VXRA 5KS9A 3PQYE 4O5LH 1BM3H 1WISA 1AFVH 2YD8A 5KOVC 5KANG 5EN2A 4XH2B 3CZJA 1NGZB 2PW2A 4HIJA 4RIRB 5D7JC 1G6RA 1S9VA 1QSEB 4F37F 1TLKA 3JV4A 1QKZH 1Q9LA 1T0NA 1YPZE 2BFVH 1X5YA 2NY1C 3MLYH 4ZXBC 1FCCA 4BFBD 1J12A 5I8EA 3PWJB 1MHHB 3GSUB 3GEWB 5EZJB 2UZIH 3RKPA 2ZSVA 4AM0B 4I2XE 4MNQD 1ZKAA 2HFEB 5F44A 1H5BA 1MSPA 1A3LH 1S8DA 2B5IC 3C87A 2JB6B 1U93B 2NY3C 1CBVL 4Z8FL 1YEIH 2QR0B 5JNYB 4HC1A 4JN1L 5TF1H 1RIVL 4U33A 1YNKH 2H32A 4KPHL 5JDJA 4OF5A 3VI3E 2VXQL 1KCSH 3RJQB 4M7LT 4I5BB 5F71A 1A3RL 4XP1H 1FFNA 2R2EB 3TNNA 1S9WB 3VFSB 5GGQL 4DGVH 4WV1A 5D7LD 1MWAA 3VFNB 3I9GL 4KVNL 2D2OA 5MEOB 1OQOA 1OP5H 3MROB 2FJHB 3HC3H 5CGTA 4MSWA 4YUEL 3NGBB 4XP4L 4OCRH 2E6PA 3GMQA 1UM5H 5D5MF 1L7IH 3RHWF 4HJ0C 1UCBH 1ZK9A 5KVGL 3LPWA 1T89C 3ZE1E 1AD0A 4E5XB 2WINB 4RMUA 3BZ4B 1S9WA 4MLSA 1C7TA 1Z6JT 5FECA 1MRDH 2W9DL 3SGEH 1P53A 1QR1A 1UB5B 4PRIE 4CVZB 2Z4QA 5D6DA 1BREA 4P4RA 4YHYC 1TVDA 1T5XB 4Z18A 1OGTB 3RVVC 4KUZH 4TOYL 4YO0A 2ADFL 1GC1H 2UWEB 2GTZB 2P5EE 2GAZB 1KFAL 2YD1A 1BBJA 3L7EB 4XMPL 4HAFA 4PGEB 5JPNB 5EZJA 3TIEA 4AM0A 5HDBF 1IC7L 4LSRL 4GKSB 4HIHA 5L6YL 2F8XC 3T3ME 2DMBA 3KPNA