1O5DT

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
200
structure length
151
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLYYSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 29
structure length 151
sequence length 200
ec nomenclature
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1o5dT00
2I9TB 4DOHB 2OBGA 1IZJA 5FF6A 5SX5H 4PJBA 2WQ8A 3QA3B 3FQUA 2XG4A 4CDHA 2YR3A 4TN9A 5BRZE 4OCWL 1BZQK 3FB8A 2HVKA 1BVZA 1IMHC 2GSIA 3UTTE 1GOHA 3BPLB 1ZA6B 3F5WB 5IMLB 1FGNH 4ODUB 3MLYH 4O51A 3V6OE 2ZUVA 5D1QD 5IFHH 2H8PA 1WZ1L 4CBPA 4MJ5A 3PGDA 1WFOA 4PJHF 5EOQH 3VWKB 4KC3B 3IKKA 1T83C 2G9HA 3GSOB 3KYMB 1PLGL 5GGRB 1KEGL 4BH8B 1EEZB 3ZKNC 4ZYKA 5IVXE 1SEBA 3U0PB 2X05A 1C5CL 3ARRA 4MJ6A 1J18A 5DUPL 5SWSA 3ULVC 2X40A 1X5JA 2FEEI 2JTDA 2VL4A 3QDHA 5IEHA 5D1XD 4MAYC 3LHPH 1RUKH 3T2PA 3R0NA 2KZWA 4Z8FH 5J89A 5CINL 1GGBL 4P2OC 3EOBA 2VDPL 1VADA 2R29H 2XZQL 5KVDL 2ZCKH 5E70A 4KI5D 4FQXC 5ERWB 2HVJA 4P59H 3PL6A 3ULVF 1CFSA 5I18L 4HC1L 3SE4C 2B5IB 1ZE3C 4LHJB 3QUZA 1BQHA 1D5XA 1EV2E 4YXLL 1DP0A 5HHNB 5T3XL 5F6IC 3KAAA 4WHDA 2AXJA 1U36A 2DBJA 4PG9A 4JQIH 4L3CB 4WU5A 2WWKT 4P2QB 3HE6A 2OI9B 3A67H 3SDDD 1ES0B 5BRZD 3QDJD 2FLBT 3CH1B 2KL6A 4R97B 1I1FA 3H9HA 1TXKA 4KJQC 2MCPL 1LEIA 3JTTA 4XBGA 1RURH 4P2RE 3GB7B 1VDGA 4BH7B 1MFNA 5I9QB 2Q8BH 5EUOE 3ARPA 4RFOH 1YN7A 3HC4H 1OTUD 4X7FC 4P3CH 5JQ6L 4KTYA 3FFCB 3FFDA 4JY6A 2X4RA 1BQHG 3LAFA 2Z8VC 5DUMH 5IHZA 2EIZB 4WNQA 2QKIB 1Q9LB 3KS0J 3WSQL 3AY4C 1MCHA 1UZ6E 4Z7WB 5E8EA 1CFQA 2ILLA 3L5WA 5DRZA 3C9NA 1FZJB 4GAGH 1GC1C 1NUFA 4XCNA 1M71A 4RGMC 5L9DL 3VI4F 4M7KL 3KDMA 3U9PL 5GS0H 4U1LB 3ESUF 1X5GA 3ARBB 3MV8A 4XPTH 4Y4KA 2CDEA 4HIEA 1AQDA 2VXVH 1MCWM 1B0GA 4YZFF 3BZEA 1P5UA 2R2EB 4XNMA 3HR6A 1U8HB 1JPST 4FQ2L 4NQVA 4XWOC 2WWMC 5ESAB 4PRPA 2M8XA 4Z78B 3X17A 1RK1B 3IAQA 5L88L 1FJ1A 1QRNE 1I7ZA 1T5WA 4HIJB 4NQUA 4BELD 1CLOL 1DVFA 5C6TL 5GRJL 4I3GA 1JV5B 1RZKL 3MNWA 5FGRA 3BESR 2OTWA 1D5ZA 1JPTH 2NXZB 3GMQA 1MIMH 3U2SA 4PGEA 4P46B 1QEWB 3BSZH 5EPMA 3QDGE 1JHTA 5I73C 4KRPB 4NBZB 5T3ZL 1MEXL 5HY9A 2VXUL 4P2RD 4FFYH 4JJ5A 3BH9B 4PJXB 5IKCB 4ODTH 3H9SA 3OGCA 4KZDH 3MRCA 2MWCA 1JNHA 2X4TB 5EC2A 1T5XA 3SY0B 1F8TH 2HN7A 2B5IC 5GRXG 5GJTL 4HJ0C 5AEAA 4JFYB 1EUTA 5D9SB 4HWBL 4QHMB 2HA1A 5KTEH 5IB2A 5KSUB 1Z9MA 5JW5B 1I7TA 1T04A 1RZ7L 5C0BD 5IG7B 2OI9C 3G5VB 3HZKA 3RWFB 4EBQH 4CVXA 5J56B 5B3NA 2YC1B 1UCTA 3GMRA 4I3SL 4R97C 4E42A 3ALWA 4H26B 2DQUH 3NACL 4CVZB 2E27L 2RFXB 4O00A 3IF1B 35C8H 3TT3L 5K59E 3KPOB 3VFPA 3G6DL 5E8DL 1XH3B 1G0YR 2GFBB 1S7RA 4N0FB 3RGVB 2NY0C 4LIQH 1WBYA 1FFQA 5B38G 3P4MB 1IT9L 1QR1B 1QSFA 1JWSB 5EBGA 4XTRC 3TN0C 1YMMB 1WC7B 3MGAA 2EIDA 2UY6A 4JFEA 3EKCA 5BVPL 4ORGA 1TNNA 4YDKL 3C8KA 3MRNA 4WUUA 3ULSB 2BNRE 2CH8A 1FZOB 1KIPB 4Z7VE 4L8BB 4R2GC 5MP6L 5HHOE 1MRCL 3QDGD 4EDWL 3MJ8A 2PTTB 3WUWA 1FNGB 2EYRB 2QSQA 4Y5XA 2EDBA 3G9AB 4HUWB 4KKCC 5C2BH 4M8QB 1LEGA 1CIDA 1MELA 5FCUH 4XPFH 4K9EH 4O58L 5E6YA 4Q0XL 1BIIB 1CFVL 4RBPK 5CGYD 1HE7A 3OKEB 4JZJA 4FMKA 3L9RB 2XQBH 4Y4FD 4QTHA 5CWSB 4FFVD 3QH3B 4K3HA 3TV3H 3UXFA 5MI0B 1J0JA 3WFHA 1N0LA 3VU2A 1IAIM 1UACL 3JWDL 4K23H 3PE9A 5E4EB 1CTNA 4UOW1 3FOLA 3Q6GH 1I7UB 2DDQH 4NRZB 5D1QC 2FNBA 2W07A 3QCUH 5HDOA 1A6VL 3WUWG 4ZDHA 4H1LB 2HTKD 4KRPC 3PWUB 3OJ2C 5IQ9B 4IIQB 4BUHA 1N59A 4MCYB 1N6QH 1WT5C 2FBJH 3OAYK 2V7NA 1Y18A 1OM3L 2DQEH 5D1XC 5FKPA 1PVHA 1F42A 5JIKA 4N8CH 3CLFL 4H88H 2G5BA 4PJGA 2BNRD 4R8WH 1A6ZA 2CKBL 4OCMC 5JPMB 2RJMA 5HHOD 5E5UB 4HF5H 5E6ZA 5C0AA 4QF1B 3IKCB 3T0WA 2VIRA 3W11D 5GGUA 2BNUB 3SKJL 1QLFB 3KPPB 2V5TA 1BGXL 1DN0B 5C9KA 2VLME 2LAGB 4F9LC 2HAZA 3OG4B 1AFVL 3O4LB 2IC2A 3L3DB 2QADD 3EOYG 4KI5F 3T2NH 4UTBH 1WTGT 2YZ8A 1LE5B 3BO8B 3SDDC 1S7QB 4OM1L 2JJSC 3O3BB 3GMNA 2CXGA 2GUOA 2XWBA 1MHCA 4OF7A 3REVB 4ALAL 1MUJB 4QHNA 3GIVA 1U95B 5TDPB 5D2NE 5I6XB 3M8OH 2X4PB 1WF5A 2APBA 2R15A 2E5EA 3NPSC 1MCPL 5DEFA 1OTUC 2B39A 4JPVH 3NCJH 5J1SC 5I16B 1OTTD 2FJFB 3V4VL 2WIMA 1DLFH 4XB7A 1PZ5B 3FQNB 3OKOA 4NSKB 2FZ3A 1S7VB 1CN4A 2FX8H 5I17B 3O0RH 5DJDB 1TQBC 3F62A 1JF5A 5FEBA 4OIAA 5DVOA 3UTOA 5KS9B 2OLDA 3WFDH 3I9GH 5C09A 1I75A 1UFUA 3CDFA 5FYJE 2GSGA 5B8CA 4LLWA 1I9RH 5F1NA 3DO3A 4JR9H 4HUUA 3X3GL 1I3RB 4Z6AT 2ITDA 4OZIE 2VLMD 4HAGA 3AFLA 4OGXL 3A0OA 5EOTA 3WL9A 4WEUD 1IGIL 4DVBA 4WO4D 1HHHA 5E6IA 3DVGA 3T09A 3MXVH 4MNGA 1OAKL 4WRLA 2AEQL 4O9HH 3GSRB 4OKDA 1M05A 3FQTB 4Q2ZB 4MQTB 4ELKB 1HH6B 4F8QA 4U6VH 3O41B 1OAQL 1DBMH 4NJ9L 5IB1A 5L0QC 1K6QL 5JUEL 3O3DA 4CADB 3VXUE 3TBWA 3KXFA 3BT2H 5F88A 3V4PL 5CGTA 2AKRA 4K3DL 1H15B 4PY8J 1ZHBA 1J1OL 3F7PC 1T7VA 5FB8B 4JHWL 4MJIB 3C5SA 1N0XL 4G8EA 4AM0A 5DD5L 4RMRA 1WSST 4ZPVA 3HE7B 4JPWH 1NDMB 3TNNB 1J87A 1GGCL 1P69B 2FIKB 2CUIA 3FHAA 1IKFL 5IIEB 5F89A 4MLIA 5AUMA 3CFDA 4LVEA 4NQTA 3NZHL 3T8XA 4TPRL 5EUOF 4KKBD 5IBUB 1XZ0B 1NMAL 1F02I 1LVEA 3O6FA 1H3UA 3BJ91 5A16A 1IGYB 1NMCC 3QO1B 4HUNB 5HXMA 1U8QB 4OT1H 4X6BA 1DCLA 4Q6YA 1UCBH 1ZLUK 3H0TA 1F5WA 5EU3A 5DFWH 5D96B 1FDLL 1IGTB 2R23B 1UZ6F 2ZCLL 3DMMD 2YKLH 1RD6A 2V9QA 3D39A 4LRNL 2PXYA 2BSTB 5CSGA 3Q2CA 3EZ8A 3BPNC 4O4YL 3QQ3A 4J3VA 1JZ4A 2R1XA 4RZCB 4DKAA 3Q1SH 1F2XK 1JIBA 5BW7A 3D6GA 1D6EA 1NKOA 4LCWB 5BJTA 1HSAB 3MNZB 5H37G 4Y19E 5F7NC 1ZOXA 4FQJL 3U30C 2LTQB 1XF4B 1A7NL 1F4HA 3PHQB 1MCWW 4OZHA 3G5ZA 5DJZA 3IDMB 3RZCD 4NO2B 3O8XD 1QPPA 5H8DA 2LVCA 3UJJH 2P24A 4OCWH 3REWA 5CGYC 4GAYA 3P40A 3B9KB 4RWHA 3L5IA 1CT8B 5FV2A 1OP5K 3HFML 2EYSB 4J3WA 4Y4FC 1QRKA 4FFVC 4LLQA 1R3KB 3U7YL 1ND0B 3KPMA 5L8LB 4KXZI 1WZ1H 2AGJL 1VA9A 2DJ4A 3L95B 5DUBA 4XCEA 1XFPA 1PLGH 2D31B 5BZWA 1KEGH 4PGCA 1UXSA 4PRHB 5LGJB 2EEAA 1C5CH 2HTKC 4C56B 5DUPH 1AGFA 2YD9A 2UWEF 2NX5A 3KWWA 5JLZA 1KPRA 2DQCL 2CD0A 1ACYL 1EFXB 4TSBL 5CINH 1GGBH 1XF3A 2AXFB 2VDPH 1I9IL 2YK1L 3JVGC 1S7UB 1CI5A 3RBGA 4OZFH 2XZQH 5KVDH 1HNGA 3FQWB 4LHUA 2GYSA 2V5SA 3GIZL 3I6LE 4QOKB 5K59F 2NTSP 1V3JA 4QRRB 1FL3A 2VDKL 3EYFA 1HQ4B 3P9LB 2K7PA 1IBGL 5EN2B 3S37L 1LE9B 1VENA 5I18H 3C60B 1SYVA 4HC1H 4Y19D 3SJVB 5CEXB 4BFGA 2JCCB 4YXLH 1OAXL 3HRZB 5T3XH 3GKWL 3W11C 2F54E 1S9VA 3RNKA 2FYYB 4KHXL 3T04D 4LLDA 1S9WB 3V79C 2CO7B 5HPMA 3CH8A 1RZIA 3BKCL 2OJEA 3RWGB 2QADC 4NYLA 4Z7VF 4UDTA 2H26B 3F8UB 4QYOB 3C5JB 2MCPH 1B90A 4ZG1A 1AR1D 5FK9A 3LEYL 1Z9LA 1IC1A 4MSWB 3N85L 4LHUG 4Y4HD 4JRYB 4ZUWB 2LU7A 5JHDB 4GOSA 3I02B 3VWJA 1KG0A 3MV9E 2X70A 1CGTA 4OF8A 1BJ1J 4X8JA 5JQ6H 4X6CE 2VH5L 5EIIA 2P8MA 1DEEB 1IQDA 4QHUB 1A5FL 1UM6L 3EO0A 1RK0B 2CXKA 4HCRA 3DV6B 1OTTC 8FABA 4X5XA 4WWID 1KJ2L 3EDEA 3WSQH 4WJ5B 5I71B 2E7BA 4N1CA 6FABL 4QGTA 5ESVA 1VB9A 4L8SC 1MF2L 5T5NF 3WLBA 1CZ8H 4H20L 5K9QG 3P77B 2FDBP 2CRYA 5L9DH 1S7SA 4DWHA 3ROOB 4I8DA 1QQDB 4M7KH 3U9PH 4EZMA 3I6LD 3PABB 5J6HA 1B88A 2D7QA 4UTAL 4DEPB 3SDXA 5JOFA 3X13A 4E5XA 3EDJA 1TITA 4FQ2H 5DHVH 5CSZB 3WV0A 5KG9A 3K2MC 2E6QA 2F54D 4LSPL 4WFEE 5L88H 5L6YL 4F7CA 1CLOH 1UZ8A 1NUDA 5C6TH 3NCFB 1K8DB 5GRJH 2AJ3B 3HPJA 3DURB 5DHYB 5BS0A 1RZKH 1FLRL 5TH2A 4WO4C 4IMLA 4HBCL 2F74B 3P2TA 4X6DA 3MA7A 5H2BA 5IWLC 2X4SA 1Q9KA 1FN4A 2NNAA 1P4IL 3HG1B 5T3ZH 5E8OA 1MEXH 1N4XL 1OHQA 1WVZA 2VXUH 5DJ0B 5C0FA 4N68A 4RAVB 1FV1A 2VXTL 5FUZL 2AI0L 3OG6B 3MV9D 3F7VA 3L7FB 5ESQA 2AS5M 5D2NC 4YHLL 2JJWA 2HLAB 5DD6B 1F6AB 3FB7A 4QRUB 4NM4L 3BD5A 3GSQB 3C60C 1CD1A 1NC4B 4NRYB 4WFHE 4Z9KB 1J1PL 5F1KC 4I18A 5D2LB 4QTIL 4JANA 4HWBH 1UQSA 4JY4B 2A9ML 1G7MA 4QRPB 4QCIA 3UO1L 1HXMA 2VDOL 2AJZB 1RZ7H 4PGDA 4PJ5A 4JO1H 1HEZA 3IS0X 5JXED 4KVNL 2CLRA 3MNVB 5C0JB 5FDYA 3LVEA 2LU4A 4HWBA 2WBWB 4I3SH 5C86A 4U1HB 1BECA 3JXAA 4U7SA 3NACH 4MNQB 4BSWB 2E27H 4K55A 4KKBC 4AEHL 2YPLD 3TT3H 3BZFA 2QTEA 5E8DH 3D69A 3VE0B 3MJGX 1G9ML 3BYTA 4J8RB 2OS7A 2ZKHL 4X4YB 4JM4L 4OV5B 1S78D 3S3SA 4AIZA 3IRZA 1GOGA 3ARGB 1IT9H 1FNHA 3IDUA 4JKLA 1SM3L 1IGML 4WFED 2AVGA 3DMMC 3D3VB 2DYPD 5KSAD 1H8OA 1NSNL 4HHAB 2FECL 3PDOB 2H3NA 4PP2A 4MQXD 2ADIB 5BVPH 5CD5D 4YDKH 2EZ0D 1U91B 5EBMA 1NCCL 3PGFL 4NHCL 3RVWD 5D7JA 5MP6H 3V5KB 1MRCH 4AH2A 4EDWH 3G6AB 1F45A 3SO3B 1MCKA 3GSXB 4ZPTB 5F9AC 4OZIF 1U8NB 3HZYA 3OKKB 2IALB 4LSQL 4BK5A 4O58H 4Q0XH 1T89C 5CIPA 1CFVH 5I76A 3LKNB 1EO7A 3Q5YA 4WFHD 3RZCC 3BXNA 3O8XC 3CNKA 4PLOB 1YY9D 5FYLE 1UACH 2N4IA 1YY8A 3U7WL 3F7QA 1HHIA 3JWDH 4G6FD 1KTDB 3G08B 4G9FE 4QXWA 4YE4L 2P7TA 3FT2B 5C7XL 1A6VH 1RJZB 3QNYB 1WFUA 4GKNB 3FO9A 4OF6A 3P4OB 1VHPA 5TE4H 4K8RD 3BGFC 3MUGA 5ID1A 5DTFA 3GMLB 1WITA 2EDQA 2GK0B 5HGBA 1JHLL 1A9EA 5CZKA 1OM3H 1P7KA 2Y6SD 5ISZE 4ONFL 4MA1B 5IT2L 4GH7B 3NABL 2MKWA 3DSFL 2IADA 3CLFH 1BX2B 3BEWB 1FFNA 2LABA 5DRWB 5DVMA 2CKBH 1P53A 3U7AA 1BLNA 1QFWM 1J05B 4NUJA 5HGDA 2ZG2A 3RFZC 1G7QB 1ZGLA 2DTSA 1YA5A 3SKJH 3DYPA 3DLQR 1BGXH 2DAVA 4LVHC 3GI8L 3MRQA 1JZ5A 4BM7A 1Y6NR 5EULV 1AFVH 2DIAA 5KANG 2PUQT 3VXRB 1EHXA 4IDLA 5DMYA 4I5BA 4OM1H 3HPLB 5KW9L 1JPGA 5FYLD 3CSPA 3MRIB 3R4DA 3D18B 2NLJA 3DUUB 4LCCB 4ALAH 4FQCH 1W0WB 3O2VL 2Q87A 1AR1C 1VFBB 4RA3A 4ZSOB 4G9FD 1ZWIA 4M9PA 1MCPH 1KLFA 5DURB 3RY6A 3M1BB 1HN1A 2CSPA 3V4VH 2C26A 4TOYL 3ZKSD 4JFFE 5LKNA 3V95A 5AG8A 1K4DB 5ISZD 3VFRB 4AEIL 1R3JB 3C08L 3NCYP 3CFEB 3CX5J 2Q20A 4P0DA 3X14A 2E8ZA 4AT6A 1U58B 1OGAB 3NA9L 4APQD 3QBTB 3WNPA 2DS4A 3RTQB 3QDME 5CAYB 1IE5A 3WE6A 2AEWA 3QQ9D 5EU7C 1R5VB 1HDMA 4BKLA 2VKXA 4IS6B 4M5ZL 4MX7A 1ONQA 2Q76B 5AAMA 3VCLA 3HMWL 4X98B 1SJEB 3TZVA 3X3GH 5E0QA 3QUXD 3UJIH 2Z31D 4L3EE 1QNZL 4OGXH 4OZGE 1IGIH 2Y5TB 3TO4A 1A1OB 1FNSL 3VD3A 1AD9A 1BVKB 4DW2L 1OW0C 4I48B 3GMOB 2AEQH 3WHXA 4LPYA 4TUOB 5JMOC 3CUPA 1AKJA 3AVEA 1S9XB 2WZPD 1T1WA 4ZAKB 4PJAB 1EEUA 2AXHA 4OAWA 1SYSB 5H94A 4G42A 3T0VA 3QUYB 4GG6E 1OAQH 3SCMD 2BXZA 4NJ9H 2R2HB 1G9EA 5JUEH 1ZLSL 1H3XA 4LPCA 4K3DH 2NW2A 1CLYL 3D0VA 3CPLB 2DLEA 2ZSWA 5SX4I 1J1OH 4YUEL 4JHWH 3L3HA 1N0XH 3QG6A 3GJFK 3BIKA 3GSNB 2JK5B 1AHWB 4JFFD 1FVCA 1GGCH 1IKFH 4MZ2A 2QL1A 2DI9A 3NZHH 4TPRH 5IB5B 3LQAC 1FYTB 2XKNA 1RZJC 3QDMD 1NMAH 2DM2A 3G04B 3CU7A 3Q5OA 4HWNA 1XT5A 4U31A 4X6CF 5JXEC 3D2UD 2APTA 2ARJQ 1CFTB 5I19L 1MLBB 1BF8A 3EUUA 3LRGA 4LCYB 1FDLH 1FZMB 3O9WA 4OF0A 4LGRB 4TRPL 3VXSB 1FL5B 1XR9A 4NDMB 1JGDA 2QLVB 1OLLA 3K74B 1HOCA 4HPOL 4L3ED 3HUJB 4LRNH 1LNUB 3MJ7B 4O4YH 1DANU 5KSAC 2R2BA 3B2UD 1ZV5A 5T1LA 3GSVB 3WIHL 2PCPB 1JYVA 1WBZB 4NM8L 1QYGL 4NQEB 5CD5C 2EZ0C 1GAFL 4HIIB 2XTJB 4R7NB 1ZVSB 1ZA3B 5GPRA 3RVWC 4JDZA 3PV7A 1A7RL 1EZVY 3G6JA 4TUJB 5ALCL 2EDFA 5BQ7A 5K9KA 2C3HA 4FQJH 4UAOB 1YEEL 1A7NH 5DJXB 3FAWA 1I4FA 4G80B 1R3LB 2RIKA 2X4OA 4NP4L 4R0LC 2CUMA 3ARED 3DOSA 2E7MA 5CHNB 4BFIA 3MROB 3V0WL 3EJJX 4WGWB 3N1MC 4H25B 3HFMH 4QEGA 5EU6A 2WQRA 1DQQB 1U3HA 4IRSB 1IL1B 1YY9C 5HDBF 3U7YH 2PW1B 2HFEA 1Z9OA 1RZFL 3PJSB 4ZUSA 3FCTB 4F3FA 5HYIA 1JFQL 5IF0A 1FLTX 1H5BB 2AGJH 4U33A 3QI9D 2ZCHL 5ICZB 4LKXB 5DJ6B 1MAKA 1JWUA 3EHBD 3S96B 3VD5A 1YEGL 1QO3A 1IAKB 1PBYA 2P44B 5C6WH 4LSSL 4CGTA 3TO2A 4D0DA 4NO5B 3BQUA 5CS7A 4G6KH 1WJ3A 1IJ9A 1V3LA 4FG6D 4LFHD 2DQCH 3RDTB 4XRCA 1ACYH 4TSBH 3MLPA 2XWTA 2Y6SC 2YK1H 1I9IH 1KC5L 5GIRA 3GIZH 5IMKB 2KPNA 1J7VR 3DX9A 3KPNB 3PQYB 2VDKH 1DUZB 1IBGH 5CP7A 4GRMB 3S37H 2FEEL 4YPGB 5IEKB 5DQ9A 1G9NL 4J6RL 5C8JA 3IXTB 4ISVA 3OXRA 1EAPA 2VB5A 3WKNA 1OAXH 3GKWH 3UTSB 3UPAA 2DJSA 4RA0C 2X1XR 4JDVB 4KHXH 4X4XB 3MLZL 2C4FU 4UDUB 3VD4A 4OD3L 2IH3B 3MR9A 4BQBA 1BAFL 1P7QA 2MHAA 3BKCH 4P4RB 4KV5E 2ICWJ 2YWYA 5I1DB 1BFTA 3BUYA 4BQ6A 4WV1B 2L4OA 4LPWA 2CIKA 5DD0L 2O5YL 3N85H 2IANB 1FVEB 3NZ8B 3DIFA 1A1NA 3P0GB 4NJAL 4ZUTB 1JJUA 1IGJB 3NAAL 2UYLB 4X0KA 1D5IL 1SJHA 5F9OL 4ZO7A 3PL6D 4YNYB 3WIFA 3W81A 2P5WA 2VH5H 4PRBA 5F96L 2UZXB 1A5FH 4XZUB 1UM6H 2OYPA 3QUZD 3RP1A 4UAOC 4PRPE 3SO5A 4ZOAA 1KJ2H 5MERB 1XIWA 4MA7L 4RGOL 6FABH 1AE6L 1V05A 1MF2H 3HE6D 5HVHC 4H20H 2HT2D 4F80A 4G7YL 2UVEA 3KPRB 1HNFA 1K2DB 2VLKB 3RWHB 4J4PA 4APQC 3MLXL 1S7TA 4UTAH 5JNYB 2LAAA 3E3QE 3QQ9C 1FG2A 5KN5B 4JQVA 5C08E 3C2AL 3LN9A 1RY7B 1H5BC 4LEXL 1NGZA 4LSPH 4BSJA 5C0IA 3O2DA 5GS1C 1LK2A 1I3VA 2YUZA 2Z31C 2IPUK 3QSKB 5JW3L 3KPLB 1FLRH 2ARJA 4HBCH 3MUZ1 3KPSE 5HHME 1R5WB 4IRJA 2IAMA 3RDTC 3BKYL 1P4IH 3B9VA 3J8F7 3L5HA 4ELMA 1N4XH 3DYMA 1VGKB 1ZAGA 4L9LB 4MXWL 3LEXB 4FFWD 4UIKL 5JOEA 2VXTH 5FUZH 4J3TA 2GW5A 2AI0H 3SCMC 4ORZC 4RQQA 1JMXA 3V5DB 4GRLA 5D7LA 4YHLH 1EH9A 4Y4KD 1PQZA 5GGTL 4LVNB 4NM4H 5FF6B 5KS9E 3MRBA 2VLLA 5INCA 4QHLA 2NY3B 1J1PH 4S1DD 3FQUB 4QTIH 5HHXL 5GS0D 2EXWD 4PRPD 2D7PA 2A9MH 4O2EA 2XFXA 1QSFE 2HFFB 2BHZA 2F19L 3UO1H 2AJUL 2GSIB 5L8JB 2YA2A 2VDOH 2DIBA 4KVNH 4HX1B 4O51B 1NJ9B 3UDWA 2G60L 2H8PB 4AEHH 2CKNA 4MJ5B 3PGDB 1EVTC 1IFHL 2G9HB 1P9MA 4LHQB 4D3CH 5E9DE 1G9MH 1NFDE 3NOIA 4JFHE 5C0EB 3DRQA 2ZKHH 3CMGA 5C08D 4JM4H 1SEBB 3MMEA 4U1GB 2N7AA 4KMQA 4G9DA 4EKXA 1SM3H 3UBXA 3H9SD 5SWSB 3GSWA 2W0PA 4P57A 1FYHB 2E9WA 2EIEA 1S9YA 2CDFA 1VFAA 3BP5B 1GHFL 1NCCH 3PGFH 4NHCH 3B2UC 3KPSD 5HHMD 1UVQA 4D2NA 3FO1A 1IM9A 1TPXB 2HVJB 5F97E 2BCKA 3UYPA 1QBAA 4UNVA 1CFSB 4KMLB 4N0UA 1FZKA 4N8VA 4MA8L 1BQHB 1IAII 4LSQH 2AV7A 4OZGF 4K7PL 4B50A 5IR1A 4PG9B 1KEML 2HKHL 5EIQA 4WU5B 1G6RB 1JZ2A 5IFJA 3E6HA 2QR0A 3DGGA 3AREC 4N9OB 3UBXG 2VWEC 5ITBL 4L29A 1QSFD 1T0PB 4RMWA 4GG6F 3H9HB 1I1FB 3OR6B 3DX7A 3HR5A 4U1JA 3U7WH 1LEIB 2X4NA 2V2XA 4R96A 2V5RA 2XWJB 4MS8D 5LAXB 1I8IA 3QB7C 3L5XL 1VCAA 4WUUD 5HBBA 1I8KB 4YE4H 4F2MA 3MFFA 1PKQA 4WTXA 3S97C 5C7XH 5HGAB 3EOTL 1YN7B 3QI9C 1B3JA 1CDBA 5E9DD 5C0AE 4PYGA 5AYUL 2VZTA 3MGOA 2H41A 3FFDB 4JY6B 2X4RB 3SDCB 3UTZA 1NKRA 3LEVL 2WP3O 3OTTA 1JHLH 5IHZB 5DJCB 2VQ1A 2GJ6E 3I2CL 4M61A 4U0RC 4WNQB 4ONFH 5IT2H 3NABH 1T83A 3MPCA 1C12A 1CFQB 3DSFH 3L6FA 2NY3C 4PJ7E 3IYLW 1P6AB 5F7DA 4XCNB 2BMKB 4FABL 5D6CA 1M71B 1JYNA 5SX5K 1LD9B 5MEPA 4HK3N 4NWUL 3MV8B 4RRPA 2NY1D 4HIEB 1OT1A 4D9QE 3WNKA 1B0GB 2FJGA 5F44A 3IDXL 3U6RA 4P2OA 4XNMB 2AK4E 3BRFA 3IDNA 1Q38A 4PJBF 3S5LA 4ZO9A 3GI8H 2FHFA 5FGCE 4FQXA 1CVSC 1FJ1B 1I7ZB 1T5WB 2FB4L 4GLRH 4R4ND 1DVFB 3STZA 1BEYL 1J0HA 4QRQB 4Y1AA 4MHHG 3M17A 1XGPA 4Z77A 5KW9H 1AXTL 3MOAL 2OTWB 1D5ZB 1RPQA 3C6LA 4PGEB 5FYKL 3U2SB 2JB6A 3O2VH 3RHWF 3KJ6L 3O3EB 2YSSB 1JHTB 4J7RA 3VXOA 5DMGD 4F7PA 3ECBB 5HY9B 4TTGA 4JJ5B 2BRQA 4IDJL 1QFHA 4RRPG 5B38B 3MRKA 2ARWA 1TPXC 2P5EA 3MRCB 3CC5A 5C0AD 3PL6C 2EDJA 1JNHB 4KK9C 5C0RL 3S5LG 4RX4A 4YJZL 1WCBA 3QUZC 2VUOA 3FJTA 3QNXA 2GJ6D 5FYKU 2BNQE 4AEIH 4F8TA 3C08H 5HHVL 1W72B 2C1PA 1UJ3A 3RX5A 3VGHA 1PZUB 3NA9H 3BFOA 1T04B 3HE6C 2HG5B 3WMSA 4JHZA 2HT2C 5HYJA 2QSVA 5FDWA 2DQGL 2OL3L 3DRTA 4CVXB 2XY2A 4OBSA 4HSQA 3AY4A 2X4UA 4LKCA 4M5ZH 3VFPB 1ED3B 3DPBA 4D9QD 3HMWH 4PJ9B 4XMKL 1OVZA 2AK4D 1HYSD 3ELAT 1S7RB 1WBYB 1QNZH 2ID5A 3U46B 5JHDE 3DX8B 3BP7A 1FNSH 3FRUB 3WO3B 4DW2H 4CNIA 2YPVL 2R1WA 4JFEB 3QXTA 4XP9L 2EYTA 5E00B 4L1DA 5F8QC 4CL7A 5EZJA 3C8KB 2Q3AA 3QIWA 3D0LA 3FL7A 4KK6C 2VLJE 1DQTA 1JGUL 5E8NA 3MJ8B 4M6OL 1OP3H 4Y5XB 4OBRA 1ZLSH 3MRJA 3V8OA 4FS0A 1Z5LB 2VXSL 4XP5L 1LEGB 1CLYH 2BY0A 5KVEL 1FSKB 4TULL 4L4TE 5I66A 2VR9A 5AWNL 1XGQA 4YUEH 4Y4KC 3ZT5A 4OLVL 1F2QA 4OF3A 2X41A 3WFCL 4S1DC 4QTHB 5GS0C 2EXWC 4HZAA 1N2RB 2BNQD 5ACMA 1HI6B 1QOKA 1ETZB 5EUKA 5IW3A 2UZYB 4HWUA 4WW2A 5F9DC 1IEAA 1MHEA 3EIFA 3MUJA 1RJCA 1OTSD 3QFDA 3L3KA 1WISA 3WNOA 3QIUA 4PS4L 4HKZA 1W0YT 4LAQL 4CMHC 4FTVB 4J23A 5J9PA 4ZDHB 3E3QC 5KSBB 4XNZB 3VXQB 4TRPH 4YXKL 5EU5A 3KXFD 3L1OL 1N59B 1S3KL 5FYJL 3BN3B 4HS8L 3QEQE 3BHBB 3SGDH 2DLIA 5D72L 2E9BA 4YHYC 4Q6IC 3BDYL 4POYA 3WIHH 4NM8H 1QYGH 2G5BB 1YYML 1GAFH 3W82A 1MFCL 3WN5A 1A6ZB 1PSKL 4AZ8A 1A7RH 3VXPA 5ALCH 2VLJD 1O0VA 5FYJU 5IBLD 2Z0BA 1YEEH 3LS4L 3O6FD 1T1YB 3P3YA 1T0NA 4NP4H 5BV7L 2HJFB 4L4TD 3MRMB 4CJ1A 1VESA 3WNNA 5JOPE 1QR4A 3SGEI 3V0WH 2VJXA 3ARSA 1BD2E 1CL7I 3OMZA 3WXVL 3LN4A 4ZOEA 5D93B 1OL0A 4RIRA 1D5MA 4RBPH 3UTQA 2GT9A 1V7NL 4XI5D 3D39D 2HFGL 1U3JA 5IP4A 2GUOB 2XWBB 4QXTB 1MHCB 1T2QL 4JDTL 1RZFH 2ADGA 1L9MA 4U49A 4KAQL 2ZCHH 3T4YB 3HAEA 1ZHNA 2W1NA 3V0VA 1KXVC 1ZT7B 4NKOA 1B6UA 1YEGH 2VMFA 3EYSL 4LSSH 4M9OA 1NGWA 1F3JA 1XEDA 3DTXA 5I1IL 1UXWB 1U8LA 3DBXA 4BQ8A 4PJCA 1WAAA 3OKDA 1IM3B 3QEQD 2FZ3B 4JKKA 5GSVA 1KC5H 2GITA 2F5AL 2WUBL 5I8KH 4FNLL 1ORSB 4JZJC 5T3XE 3K1KC 4C54A 1NFDF 4K9EC 4PJFA 5C09B 2AERT 5FXCH 3JZ7A 1U0QA 1E6OL 1G9NH 1S5IL 2GSGB 4J6RH 3P4NA 3TJEL 5B8CB 5DMKA 5D1XA 3TVMB 1Q0XL 3HAEG 2NY1C 1R0AL 2VOTA 4HUUB 1U8JA 2DL9A 4O2FA 2IBGA 3TESA 1FPTL 1F11A 3MLZH 4OD3H 3WL9B 4A6YL 4XHJD 4DVBB 5JOPD 1BAFH 1HHHB 5E6IB 4MNGB 4X6FA 1BD2D 1O7VA 4OD1L 1M05B 2BC4A 4FP8L 4POUB 2C3VA 2DWDA 4MCZA 5DD0H 2O5YH 3GHBL 4AENA 2EDRA 1L0YA 4NJAH 4ENED 4LLVA 3VFVB 4LHUD 3FONA 1NBYA 3NAAH 3OSKA 1MI5E 1D5IH 4DN4L 1AP2B 5DMGC 5F9OH 3TBWB 3KXFB 5F88B 3ARYA 2X09A 5F96H 5JTWA 2CQVA 2Q6WA 2ZNXA 3Q3GA 2PYFA 3C5SB 3UTTA 1NGQL 3ZSTA 4MMXC 4F15C 4MA7H 4RGOH 4ZPVB 1AE6H 3FZUD 3RNQA 4L4JA 3V6OA 2D03L 5L2KE 5CBAA 3LN5A 3KLAB 4G7YH 5CD3A 5MENE 1MJJA 5AUMB 4PJGF 3T8XB 3VXMA 5T3XD 3OZ9L 1KCUL 1DUYA 1LO5A 2OJZL 5D93C 3MLXH 1CXIA 5IVXA 3LV3A 3HA0A 4OCSL 2PR4L 2CDGA 1J0KA 5A16B 1X4XA 4X6BB 3C2AH 1MJ7L 1WCQA 3VFOA 3H0TB 1DLHA 5H35A 3VWJD 1OD7A 4LEXH 4NNPL 2DMKA 1BFVL 4N90E 5SWZB 1HYSC 1D6VL 3V7MA 5KOMC 5JO5B 1GGTA 4GAJL 1F4YL 3L3IA 1XF5A 3MACL 3QWQB 2PXYB 2CR6A 4PLKD 3QQ3B 1TENA 2IMMA 2JE8A 2KUTA 1AD0A 1I1YA 3BKYH 3WHE1 2DQIL 1XGRA 1CLZL 1DZBA 5BJTB 3ZE2E 4MXWH 4UIKH 2VZ1A 2IBZY 1MI5D 3NIGE 1G7LA 1T7YA 3T1FA 4DVRL 4ONGL 1OWRM 4V2BA 1N64L 4JM2A 5GGTH 1EHAA 1CG9A 3ES6A 1AGEA 3PXJA 4OZHB 2OXGA 5DJZB 4PGJA 5HHXH 4QT5A 2P24B 3REWB 2YRLA 1GZPA 4X9IA 4P2RA 4ETQA 5GGTA 5D1ZB 2AJUH 4UBDD 1X6LA 4LLQB 5L2KD 1EXUA 5BS0D 3JWOL 5MEND 1KULA 5BVJA 5E6IC 3KPMB 3NIDF 2WK2A 3VRJA 4U1NA 2G60H 2EKJA 1H8NA 4EIGB 1IFHH 2FD6L 4I0CC 5ICXA 5DUBB 3HB3D 1OTSC 5DS8A 2FWOB 1P1ZA 43C9A 4DZ8A 4U1SA 4JFDE 4MVBD 1U8MA 4LVOB 3INUL 4N90D 4WHYH 1YPZB 1AGFB 1GZQB 2NX5B 3KWWB 1KPRB 5HTSA 5GQBA 1GOFA 3JV4B 1JZ6A 2EC9U 1HSBA 3W0WB 3Q48A 1GHFH 4DKEL 2BVPB 4F7TA 2O93L 1L6ZA 3SKOA 1MFEL 4Q9RL 3EYFB 3HTLX 3FN9A 2W60B 3MV7A 3SGJA 4UOJA 5ICYA 2Z93B 1SYVB 4MA8H 1QRNA 5F70A 4K7PH 4NO3A 5IBLC 1KLGA 4Q97A 3O6FC 1BVLB 4OFKA 4D0BA 1YMHA 1KEMH 4HH8A 2HKHH 3P9MA 4XXDA 1PY4A 3QP3A 5I74C 4LLDB 5I30L 4XVJL 2JIXD 1NFIA 3ARTA 5HPMB 5FECA 5ITBH 1RZIB 2OJEB 3LPGA 4NYLB 4WFFE 4EN3B 1LWRA 5JXAL 4UDTB 1EIBA 3SOBL 3QJHA 4TNWK 4YIQB 2F9BT 5FK9B 3LKSA 4XI5C 4NQCB 3HUJE 4Y5VB 3OXSA 5IB3A 2O26U 3L5XH 4XVUD 3LPFA 1OP5H 4WHYG 4GW1B 1KG0B 2X70B 4WI4A 3EOTH 3QIBA 4X8JB 1T80A 4Y4FA 4YGAB 5AYUH 5BW7C 2XTJE 1FNFA 5EIIB 2P8MB 3LEVH 4JFDD 1IQDB 1KLUA 4YR6A 1MJ8L 2KQMA 3EO0B 3I2CH 4QRSB 4TNWF 3VG9C 2ZUSA 1KIQB 5ESVB 3MRRA 3OKNA 4XX1E 2W0FA 32C2A 3C5ZA 3V7AE 3WLBB 3LCYA 4H0IA 3SGKC 1REIA 1Q72L 4LLUA 4NWUH 5J6HB 1IZKA 4S0TD 3S88L 15C8L 3SDXB 1DTUA 3IDXH 2J6EL 4X4ME 3RVUC 5JOFB 4FQPA 3X13B 4E5XB 4GUPA 3JVGA 2D9CA 5INDB 5KG9B 3BP4A 5D70L 4B41A 2VSCA 4K3GA 3MRHA 4O02L 4U3HA 5F7FA 1NGYA 4I13B 1RZGA 2FB4H 3VD7A 4F7CB 1DBAL 1UZ8B 3H7LA 1BEYH 4GW4B 2BNRA 2P4AB 4Z7VA 5HGHB 3UMTA 5HHOA 4XHJC 5TH2B 1AXTH 3MOAH 4IMLB 4W4OA 4WFFD 1EGJL 3MA7B 5H2BB 2X4SB 3LPWA 3UP1A 5FA3B 4OUUA 5FYKH 1FHGA 4QNPE 1QHOA 1FN4B 3L7EB 4JFOA 3KJ6H 3H2WA 4UT6L 5E8OB 2QQLL 2D7NA 2DM7A 1U42A 5C0FB 1FV1B 4W4NA 4OQTA 4IDJH 2BK8A 3F7VB 5ESQB 2NY5L 2MPAL 5I8CA 2EXYD 1C08A 2V2WB 1KUMA 4MMZC 3PQYE 5C0RH 3VW3L 4AQOA 4HQQL 1CD1B 2PYEE 5EOCL 1T21B 4I18B 3MOBL 1FVDA 1C7SA 1UQSB 1A1MA 2Q1EA 2ZUWA 5HHVH 1G7MB 1HHGA 1MHPL 2VRAA 2WM0A 5ANMB 5IFAL 2YPKA 3FZUC 4QCIB 4HS3A 2BY1A 4PGDB 4PJ5B 4CVUA 1YQVL 2NR6D 3EOAA 2CLRB 2DQGH 2OL3H 3B43A 1W0VA 3GJEA 1BFSA 4CUCA 1K8IA 3D69B 1JE6A 1G84A 4XMKH 2Z4QA 3U4EB 4XBPA 3B5GA 2OL3A 3GMMA 1GGIL 2J3SA 4MWFA 3VWJC 1A6UH 2FATL 5IBTL 1IC4L 1JPSL 4YDLB 2YPVH 5JDJA 5FOJA 3SKMA 4XP9H 1YJDL 3S8WA 4S1SL 4P2YA 2H3NB 4PP2B 1UEMA 4YHKL 5E2UL 5CJQL 1KPUB 2F8OA 2FJHA 2J8OA 5EBMB 3EYOB 3QO0B 3ILQD 1A7BA 4PLKC 3LKRA 2APXA 4WTZA 5D7JB 3QNZA 2EDWA 3AGVA 4AH2B 1JGUH 5JA8B 4M6OH 2RCSL 2R56L 5DC0A 2VXSH 4XP5H 4WO4A 2DKUA 3HZYB 4CW1A 5KVEH 1K5NA 2PO6A 4TULH 1T66D 3ARZA 3VFWA 5AWNH 1CICA 2VLKE 5CIPB 4EIZC 4OLVH 2YZ1A 2WINA 3TZVD 3OR7A 3TYGL 2PYED 1CIUA 1M7XA 3QPXL 3WFCH 4ZNEE 4RNRA 2Q86A 1A3QA 3VGAB 3TO4D 5D2NA 4Z7NE 5K9OB 2VE6A 4UBDC 1YY8B 4NZTL 2HJKA 4IOIA 1JTPA 4LDEB 4WTZG 2JJTA 4PS4H 3BZ4B 2ZZUT 4ZO6A 1U8OB 4LAQH 1C7TA 1U6AL 1FFRA 3G6JE 3IJYA 4Z7UE 4ZUUB 4X6EA 3FO9B 3HB3C 4YXKH 3L1OH 3HN3A 1RZKC 1S3KH 2VABA 1WWAX 5FYJH 5ID1B 4Z5RA 3PWNB 4HS8H 1UG9A 5HGBB 3QEUA 1P7KB 1INQA 4YHPB 1EBAA 5D72H 3KJ4B 2ICWB 4X6DF 1L6XA 3BE1L 3BDYH 1J11A 3S98A 4JO2L 1FFNB 4LQ1A 1KNOA 4I18C 1YYMH 5C07B 1MIEL 2NMSA 4XCFH 3GZKA 1RUQL 5GZOD 3PWJB 1MFCH 1PSKH 1T3FA 4AIXA 3HMXL 3DMMA 4NUJB 1KN2L 4MD4A 2ENYA 1L9NA 5DZOA 2VNCA 3LS4H 1JNJA 3QQ4B 5BV7H 3S7GA 1RIHL 4PRIE 4RMQA 3ARQA 2BOCB 4ZQKB 5EU4A 1MLCA 1YEKL 3UYOD 1AH1A 4KK5D 4JVPA 4P5KB 4OQ1A 3WXVH 1FNAA 1NC2D 4I5BB 4UU9A 1QBML 1BZ9A 2O5ZL 3W9EB 1V7NH 3LKPA 3ZE2F 1FNEA 2HFGH 2L0DA 3VXUA 1UJTA 1T2QH 3QXDA 4JDTH 2FEDD 5EB9A 2NW3A 3NIGF 4KAQH 1XGUA 4XVUC 3O8XA 3WDJA 1ZWIB 3T3PF 1HK6A 4DFIA 3EYSH 3PWVA 5D7JC 1R3HA 1A2YB 3VH8B 1ZT1A 3AAZA 5I1IH 4KY1L 4XMLL 1H3WM 3CJJA 2GTWA 1QA9A 4NKDA 2H1PL 1C5DB 4U1IA 3C2SA 2DL2A 4KXZH 3QZWA 1KN4L 2A83B 1YUHA 4GG8A 5CFHA 2VL5A 2WUBH 4FNLH 3TA3A 3JV6B 3U0WL 3QISA 1U3HD 3WE6B 1UWXH 2DQHH 3GUTB 3VGAC 1PAMA 1HDMB 1E6OH 1S5IH 4LCUA 2MNUA 3TJEH 4BKLB 4XB8A 1Q0XH 1MCLA 1R0AH 4I0PB 1FPTH 5IHBA 4ZXBD 5EBWA 5FO8A 1HINL 4ZFFA 2P5WE 3IDJB 4X7TA 4PRID 1QTYT 4A6YH 5KOVC 3PWLA 3TO4B 4HIHA 4F57L 5IVZA 1AD9B 4NO0D 4UQ2B 3TIDA 3QHFL 5C92A 1CS6A 3JWDC 4QY8A 3WHXB 3MBED 4OD1H 4LDOB 1H3GA 1AKJB 3QZWG 4Y19A 4U6HA 4FP8H 3H6JA 5KVFL 4A6YA 3GHBH 4NKMA 4DKFL 3ZDXE 1OF2A 3OF6A 5IV2A 4KMTL 4DN4H 4PRNA 4FZ8L 3MTRA 2ZSVB 4X99A 1H0DB 1EDQA 1T20B 2NW2B 3AS2A 1R24B 1OWWA 4MD0A 2ZSWB 3PV6B 4LSUL 3F7YA 2EXYC 3H9YA 3L3HB 3PG2A 4U6YA 1NGQH 3BIKB 4PBVC 3UJTL 3VGFA 1J1XL 1JBJA 1RHHB 2V9RA 5FA4B 4Y4HA 3U4AA 4U05A 2D03H 1FVCB 1T6VN 2HRPL 2VAAB 2YD3A 2Y07L 1P7QD 1LHZA 4E41E 3OZ9H 1KCUH 1VEPA 4NQXA 2OJZH 3I75A 2LU3A 2XKNB 1JZ8A 4TVPL 1RIVL 2BOBB 2IPKA 2NR6C 2P45B 3FTGB 4OCSH 3D85B 1AIFB 2PR4H 4LNVA 4J2XA 4ELME 4W6WB 1MJ7H 4JFXB 3RUGB 3W39A 4FQ1L 4NNPH 3I84A 1BFVH 3O9WB 1OARL 2I07A 2OM5A 2ED7A 1D6VH 1T22A 1XR9B 3GNML 3MV11 2P5WD 1HOCB 4GAJH 8CGTA 1A9BA 1F4YH 3MACH 4GO6B 5J13B 2ITCA 5F8RC 3X11B 4S1RL 3IFNL 4P5TB 2Y1VA 4RFNB 2R2BB 3U82B 1MCFA 5T1LB 2DQIH 4Y8DC 3K2UL 3D5OF 1IAOA 1WBXA 2OR7A 4M7LL 2F54A 4JDZB 2FR4A 5BQ7B 3CU1A 1OW0A 2I9LB 3HCVA 1WZKA 3SHSA 3MRGA 2OSLA 5K9KB 4J4PD 5IW1A 5IMOA 4LSRL 5JQHC 4BSVB 4DVRH 4ONGH 3OPZL 4KK8D 4N5UA 1T1XB 1I4FB 1N64H 2VC2L 2X6MA 5HI4D 4DCQB 4DGVL 4KUCD 2X1QA 1T66C 1QFUL 4YHNA 4PY8I 1MCNA 2YD6A 4E9LA 1TVBB 4M4PA 3TZVC 3AUVA 4QNPF 3O11A 5FGBC 4EI5A 1JWMA 3MV01 5DHXB 5EU6B 3VFNB 2ZOKB 3DV4B 1FFOA 3E6FA 1RUAL 3MV9A 3JWOH 3TO4C 3QFJA 4P4KA 2HFEB 3DX6A 4Z0BL 4E41D 4X6CA 2NTFA 4F3FB 4IJ3B 5IF0B 2FO4A 2FD6H 3HI1A 4O2CA 3CFBA 1JWUB 5DRNA 3T3MF 3UPRA 3GJFA 3WYRA 3RVTD 3K8KA 2YEZA 4NBYB 5D7IE 2VITB 4D0DB 1HHKB 4BK4A 2X44D 3K80A 1FO0B 3INUH 1LEKA 3MRPA 3BQUB 4NN7C 3ARFA 4GRLD 3BDBA 1YNKL 3U9UA 3NN8A 4MJ2A 3T2OA 5JXEA 1ZLWH 4GBXA 5TDOB 3LMJL 3EDDA 2FH8A 2XWTB 4HWZB 4WI8A 1MREL 5GIRB 3CMOL 3WS6C 1J0YA 1K4CA 3ZO0A 1RHFA 4DKEH 1JGLH 5DGQA 1MFEH 3VMPA 3DX9B 4Q9RH 4GRWH 5CP7B 1VACA 5DQ9B 3ZKMC 5C8JB 2DWEA 1PKQE 4ISVB 3OXRB 4M5YL 1EAPB 4MB3A 1F3DH 1LP9A 2JJUA 3O3AB 3S36X 2W59A 3WBDA 1QPXA 1OSZB 2CK0L 5I30H 2ADJB 4XVJH 4Y2DB 2DQJL 5C0DB 1ZHLB 1M1SA 2MHAB 4IOFD 3O9WC 5KSBE 4QWWD 1DQJA 4KK5C 4P48A 3SOBH 3S36H 3H3BC 4PJDE 5IOPA 1IAIL 4GKSA 4WHTA 3PNWA 5J13C 4YGVA 2E6PA 2WNGA 5A2IH 3DIFB 1A1NB 1A6TA 5IHLB 1F00I 3EJZC 5L2JA 5T1MB 4GXVL 2B0SL 4X0KB 3QT2A 2YXMA 2YD7A 1JYXA 1SJHB 1IM9D 3QJFB 3WIFB 5HPOA 1A47A 3ARDD 1JF1A 2CRMA 1MJ8H 1TZIA 4U3CA 1C16A 1NGXA 3UROR 1XIWB 4FHBD 2YMXL 3CAFA 1DN2A 2ZUXA 3QXVA 3NIFE 4CN4A 2D0GA 1TETL 2I24N 7CGTA 4CVWA 4U1KA 1ADQL 1BOYA 1UB5A 2X42A 1BF2A 4MD5A 3PWPE 1Q72H 3G6JF 1CTOA 1GJIA 1U3HC 1T6WA 3S88H 15C8H 5DI8A 4UUJB 1FG2B 3T65A 2J6EH 4AY0A 1OY3B 2A0LC 4WUKH 2EKSB 4JZOB 5C71A 1OP9A 1TNMA 3OBAA 2VZ3A 5D70H 1NGZB 3QWOA 2EDOA 4O02H 3HZMA 2P5EE 5F6HJ 4OUOA 1DBAH 4B5EA 4FA8A 1E27A 3IS1X 4WVRA 2XPGA 2EO9A 4JKWA 2ARJB 3S35L 1A21A 1EGJH 4GXUM 4XP6L 4UINL 4HJJL 2PTUA 4IRJB 1IKNA 2IAMB 3K81A 5A43C 1AI1L 4UT6H 4OLZL 1MHHA 2QQLH 3GDBA 3TCXA 3ZTJH 3ALXA 4KRNA 3AB0B 1QZ1A 1EGJA 3T0EB 2NY5H 2MPAH 1YEFL 4X5WA 5D7LB 3NH7L 1CXLA 1U8PA 2BVQA 3VW3H 4HQQH 5EOCH 5INCB 1ZK9A 3MOBH 3Q6FA 3BZDA 4DQOL 5GGVL 4O2EB 1MHPH 5IFAH 3BDXA 5J4MA 3QHTC 5I8EA 4G9FA 1YQVH 2ESVB 1HQRA 4JFPB 4GFTB 4YHIA 4M4RA 3WIIL 5J6GB 3PWPD 3FAXA 4NNYB 3C6LD 1SMOA 2UZIL 1SBBA 2C9AA 3OKLA 3MRLA 3UPCA 3DRQB 4YC2C 2H6PB 2VLRE 4V1DE 2I9TA 1GGIH 4G9DB 2FATH 4X9BA 3MGTA 5IBTH 3UBXB 1IC4H 2P5ED 3GSWB 3QA3A 3PHSA 1CCZA 3ZTJG 2CDFB 1B2WL 1YJDH 1VFAB 4S1SH 3KR3L 1I9EA 3QCVL 4YHKH 5E2UH 5CJQH 4OFPA 4C83A 3CXDL 5DQDL 1ZA6A 4ODHL 3DECA 4R7DB 1Z2KA 3I6KB 3WS3A 3QUXA 2Z31A 3GM8A 2RCSH 2R56H 4UZGA 3W5MA 5HYJD 4N0UB 1NDGA 3VWKA 1CXHA 1P7HL 3TH3T 4J4PC 4Y16B 5GGRA 4BH8A 1EEZA 2PF6A 5IR1B 5HI4C 5DRXB 5EA0L 3MLTA 3TYGH 5IFJB 4LMQE 3E6HB 2OMNA 3IFPA 1DR9A 3QPXH 2ICEA 4K71B 3DGGB 3RWIA 4LLMA 2COQA 4HWEL 3SCMA 4PY7A 4L29B 2QEJA 5DZLA 3G9VA 4MA3B 5EORL 4BZYA 5SWZE 2C1OB 3DX7B 3NGBC 4U1JB 1DL7L 1QLEL 2AV1B 4NZTH 4GKOA 5SX4H 1I1AD 2X4NB 2V2XB 4R96B 1N6UA 1I8IB 3DROA 5BOPA 4PJHB 5ERWA 4KUCF 4Y89A 3VA2C 3MFFB 1D7FA 3QIWD 3RPKA 3STLA 2P42B 2VR5A 2EDTA 1U6AH 2IAMC 3RX7A 4JFFA 5GISL 1N5YL 1K85A 1OQOA 4OB5L 3RVTC 2VLRD 3EYVA 2IPUG 4V1DD 1JRHI 3MX0A 3TP4A 4B7IA 4M61B 4WI7A 4GRLC 2YD1A 4P2QA 3QDMA 4WI5A 3BE1H 4JFZL 4NC2B 4JRXE 3CH1A 4XP1L 4JO2H 4O5LL 3L6FB 1FG9C 5FV1L 5KJRL 1AGCA 5F7DB 1MIEH 4ELMF 1RUQH 4YHML 1KYOK 4I3RL 3RAJL 3HMXH 3HRPA 3LRSA 5DFVD 3ETBF 1KN2H 1A22B 3T77B 2FJGB 2VO5A 4ZOCA 3AROA 1I8LC 4OZGA 4P2OB 1CGVA 4NNXA 5EBLA 1HXYA 3UDWC 1RIHH 1SJXA 1X5FA 3QIUD 4NQSB 3S5LB 4PR5A 2A6JB 1YEKH 4PJ8D 3HMXA 4FQXB 1P9MC 2W92A 4BUGA 3HNSL 2DQFA 4DTGL 3SDAD 3STZB 4Y1AB 2EIZA 3M17B 1XGPB 1KXQE 4GG6A 1QBMH 1CK0L 4KJWC 2O5ZH 4IOFC 1I3UA 3P11L 4QWWC 4OF5A 3L3JA 4XCCL 1FZJA 2XN9B 2JB6B 1G9MC 3CLEL 2P43B 1DE4A 1PG7X 3DUHA 4JJHA 2CJUL 4U1LA 4XT1C 3AREA 3ARBA 4B7LA 4TYUA 3W0WE 4PJFE 1CL7L 1PX4A 3RU8L 4KRLB 4HK3J 3CC5B 4KY1H 4XMLH 5ESAA 3ARDC 1BMGA 2H1PH 4Z78A 3QUKA 5IJKC 1KN4H 4HIJA 5CBEA 4EDXB 4OZ4B 4LLAA 1FFPB 4XPGL 3PF2A 1S7WB 4JRXD 5LVEA 2YUXA 4X7SL 3V52L 3U0WH 1PDKA 4P5MB 3AS0A 3DRTB 1QEWA 5D7IF 3C6SA 4BQCA 2QSTA 3LSOA 5MHSE 4LKCB 3Q0HA 2KBGA 2Y23A 4NCC2 4XGZA 3BH9A 5JR1L 1SVCP 4OLXL 1IRAY 3RBSA 4BFEA 5IKCA 1HINH 3TIEB 4RGMB 2NXYD 2MQCA 4LOUD 3BP7B 4F57H 3CVIL 4ONOA 2WIIB 3QHFH 4CNIB 3LQZB 3LKOA 3KHQA 4JFYA 2R1WB 4NC0B 4FRWA 5D9SA 4C59B 2FCBA 3B9DA 3JSSA 5KVFH 3ARVA 3O81A 1JTTA 5JW5A 4DKFH 4JN2A 3VXME 1FBIL 4RAUA 1IC5L 3D0LB 3F6LA 3RWFA 5E8NB 4KMTH 4GS7C 2RB8A 4P2CG 5GRVK 2YC1A 1TLKA 1FC2D 4FZ8H 4KPHL 5BZDA 2R1YA 2X1OA 4LFHG 4LSUH 4XNUL 5I66B 1XGQB 2GFBA 1CR9L 4N5ED 3RGVA 5I73B 3RJQB 3UJTH 4OI8A 1J1XH 4PJDF 5F7UA 4KGJA 1QR1A 5C6PB 1JWSA 1KENL 4X9HA 2HRPH 2I27N 1YN6A 4WU7A 2Y07H 3LRHA 5DA0B 1X6NA 4MNHA 4TVPH 3ULSA 1IEAB 1RIVH 1KIPA 3QFDB 3OV6A 4JQXA 2PTTA 4D9RE 1FNGA 4HKZB 3C6LC 5MHSD 2MCG1 2BSSA 2K9UA 4FQ1H 1SHMA 4X7EC 1OARH 3NCYS 5EU5B 2JKXA 3O6ML 3GBLA 3GNMH 5DXWA 1F6LL 3Q5TA 2PETA 3OKEA 3UTTD 4S1RH 3IFNH 5J12C 3UTPE 1KBGL 3KNBA 1KPVB 3K2UH 2NY0B 1Z0MA 1SVZA 4ODBD 4H1LH 3QULA 2GAZA 4M7LH 1UJ3C 3FHQA 5J1TC 3VXMD 4FXKB 3TN0B 5ANME 1L0XA 4M8VA 4LSRH 5FUCE 3OPZH 2VC2H 3VXTA 3FB6A 4DGVH 2OP4L 3IVKB 1QFUH 1P84K 5GSRA 3MLSL 4R2GB 4YK4B 1S8DA 3M07A 5C3TA 1SY6L 3LN4B 3GGWB 4RIRB 1A3RL 1RUAH 2GT9B 2XI9A 4G8GB 4P9ML 4Z0BH 1XGYL 2ADGB 4N1HB 2F8VA 1EK3A 3CSGA 1I1AC 5EC1B 3IJHA 3HAEB 5MEOB 4G5ZL 3V0VB 3RI5K 3MV7E 2Z35B 1EUUA 7FABL 4D9RD 1ULVA 4QF1A 3QIWC 3IKCA 1NGWB 1RU9L 3T0BA 2SEBA 5B39B 1X9QA 3DTXB 1U8LB 1MH5B 3KPPA 3DBXB 5JMRA 4NT6A 4JM2D 5DEZA 3OKDB 1OP3K 5E24E 1Z6JT 3LMJH 3L3DA 4LASL 5D1QB 2LE9A 1MREH 3I6GB 2GITB 4YDIL 3CMOH 5F9WC 3UTPD 2KZ1B 5HD8D 1LE5A 1KCSL 3V6FB 4ESKA 2VDQL 2C3WA 4YDVB 5C08A 3RI5F 3REVA 1KCVL 4NQDE 3GBNH 3FOMB 1NUGA 3AS1A 2YD5A 1U95A 5D1XB 5TDPA 5DMKB 2D4DA 3NCCB 5DFVC 4JGUA 4M5YH 4Q6IA 5HYQA 4WW2C 3QAZC 3ZLQC 2EE9A 4PJIE 4WGVB 1SQ2N 3QIUC 3F65A 5E56A 5I16A 3KPSA 4PJ8C 2DQJH 5M95B 4DGYL 1X4ZA 1PZ5A 2C7UB 4UIMB 4X6FB 3HLAB 1S7VA 2BC4B 1IAIH 4WW2F 2C3VB 3OWEA 4MCZB 5DJDA 1HIML 3VGEA 2W91A 2YWZA 3RPIA 4OFDA 4QRTB 4LLVB 4XVTL 4MZ3A 3FONB 4GXVH 1NBYB 4AMKL 5KS9A 2B0SH 2R9HD 3IAGC 4PB0L 5JHLH 1TCMA 4UQ3A 3SDDB 5BRZB 2XACC 3MV7D 3QDJB 5C07E 3WN5C 1QRND 5J11C 2FRGP 3Q3GB 2PYFB 2FO1A 1I3RA 1FC1A 2YMXH 1A7OH 3QUMB 4P9HL 4WWKD 3RNQB 1TETH 2A6DB 3K7UA 5JW4N 1L7IL 5CBAB 3NPSB 3GSRA 5B3JE 1ADQH 1SBSL 4YK4C 5CD3B 1MJJB 2H32H 3T08A 3FQTA 5E9DA 4PRAB 4XHQA 1NFDA 4NRXA 1DUYB 3MREB 1LO5B 4PB9L 5C1MB 1HH6A 4NQDD 2Y7QB 1ZEAL 1ADQA 3GSNL 4S10A 2H32A 1Y6KR 4CADA 3S35X 5H35B 3ZHDA 1OPGL 1TQBB 3QIBD 5FYKE 1HH9B 1TQCB 1KCRL 2FH6A 2YOCA 5FB8A 4WTWA 2A77L 1FQ9C 3HI5L 1ZS8A 1WFNA 3S35H 1XF5B 4J3UA 2X9YA 5DJAB 3ZMRA 4G8FA 2ICWI 4XP6H 2FIKA 4UINH 4HJJH 5IIEA 3K1DA 4D9LL 2IBZX 4OIIL 3S4SA 1AI1H 3DHJA 4OLZH 4F33B 4J3XA 3C5ZD 2W65A 1QHPA 2J8UE 2WUCL 1XZ0A 1T0MB 2I60L 5TJWK 1G7LB 3T1FB 1IGYA 1YEFH 3QO1A 3NH7H 1U8QA 3MLVL 4JM2B 2XOTA 4JGJA 4OD2B 4PJCF 3ES6B 1AGEB 1WAAF 1IGTA 1M6OB 3PP3H 3OKMB 5DVLA 4DQOH 2VR4A 5GGVH 4QT5B 5E2VL 1NLDL 5L0QB 2VZVA 3LIZL 1GZPB 2NY4D 4P2RB 4ETQB 5TDNB 3QEGL 1G1CA 2B4CL 2BSTA 4QO1A 3TH2T 3QHZL 1G9NC 4KI5C 3K3QA 3FO2A 5EUOB 5FAAA 3WIIH 1ORQA 4PJFF 2M1KA 3S4SG 2UZIH 1I1RA 4LGSB 1Y0LB 5FOBA 4HGWB 5DS8B 4OFYA 2GJ6A 1YDPA 4HAFA 1P1ZB 43C9B 4TNVK 4DZ8B 1U8MB 5DGRA 1DBBL 5FYKD 4PJ7A 5C0BB 4Y8AA 5J57B 4Q9CA 3ROLB 4NO2A 2APFA 5LJYH 3CFCL 4K7FA 1B2WH 5DQJB 1NMCB 1ZANL 3KR3H 3QCVH 3PUCA 1HSBB 1CT8A 4JGMA 4PTTA 3CXDH 5DQDH 3ZKXB 2F15A 1BJMA 4ODHH 4F7TB 4U0QB 2AK4A 3SKOB 2D2OA 1T2XA 3V6OC 4XPHL 4TNVF 1HHJB 5FHAL 2XXCB 4KVCL 1QKZH 4OM0L 2O61B 3BPNB 2V7HA 1X44A 5CP3H 4PRHA 3CSBA 3W9DB 1ZHKB 4D0BB 5EA0H 3P9MB 4XXDB 3W2DL 5DK0A 4ODVH 3H7BA 4HWEH 3QDGB 3U30B 1TQCC 5EORH 1M7IA 5FKAB 3QJHB 5DYOB 2VSDA 1DL7H 2YN5A 1QLEH 4YO0B 2W9EL 5IVXF 3LKSB 5IB3B 2J1KA 1A3LL 4XNQB 1W2KT 4QRRA 1P5VA 1DBJL 2H9GA 4U6XA 1HQ4A 2BXYA 3U0TB 1LE9A 1QD0A 2P8PB 4Y4FB 5GISH 4U7MA 1N5YH 3AS3A 5CEXA 3MCG1 2BNQA 4OB5H 1L7TL 3RL2A 4IM8A 3HNVL 2NYYD 4YR6B 1KLUB 2PO6D 4WEMB 3SKNB 2UWEB 2FYYA 1CICD 2VISB 4H8WL 4HKJA 4JM2C 3IETA 4JFZH 4XP1H 4O5LH 5DK3A 5KJRH 3C5ZB 2HWZL 2VZSA 2H26A 1QSEE 4YHMH 5HD8C 4I3RH 3RAJH 1RJLB 3BKJL 4ZUWA 5CLTA 5JHDA 2H45A 3I02A 2HLFD 5D5ME 4JM2F 3ME0A 1TZHA 3GO1L 4GUPB 5FUOL 3BP4B 4P23D 3MBXL 4G8IA 4CMMA 1EA9C 4R4FL 5FUCC 1BREA 3MRHB 4HUVA 2N7BA 3HNSH 1DEEA 1ZVHA 1RZGB 4QHUA 5TPWL 4DTGH 1RK0A 5CLWA 2BNRB 4Z7VB 3GSUB 5HHOB 1P6FA 1CK0H 2VLJA 2Y36L 4RFEB 1MFAL 2XKUA 3P11H 5CJXA 4OLYL 1G7PB 4XCCH 2YBRB 3CLEH 4JFOB 3RWCA 3P77A 4M03A 1JNNL 4L4TA 3ROOA 5FYJD 3BWAA 2CJUH 5EFIA 5C0CE 1F97A 3SGEH 2EECA 5FCSH 1CL7H 1MRDL 1XGTB 3ZKXC 2QADB 2R9HC 3RU8H 3MRDB 5E8PA 1C08B 3F12B 4LCIL 4ZFZB 2DMCA 3SGJC 4HULB 1T7XA 5CZVL 2HT4D 1PX3A 2C3GA 2JF1A 5F1SA 1RI8A 1FVDB 2HFTA 1A1MB 3N50A 5D7SL 4DGIL 1K8DA 3DURA 2YPKB 5BO1L 5DHYA 4XPGH 5F93C 4X7SH 4HS3B 3BRGC 2WBKA 3V52H 4NGHL 3ABZA 4NUGL 1IC7L 1QSED 3EOAB 4OLEA 1MAML 2IFGA 4YBQD 5IJVA 3VXUD 1XCTA 5DJ0A 2Z9TA 5TGBB 1K8IB 2DRUA 4L8SB 4LP5A 4EQ2A 1H3VA 3QEQA 5JR1H 4OLXH 3L7FA 4XBPB 2VZOA 1LQSR 5T33L 2YUWA 4NC1E 4MWFB 3B9AA 4LPTA 2HLAA 5C0GA 3SGKA 3G5XA 3QIBC 4QRUA 3CVIH 1NC4A 3I50L 4PUBL 5D2LA 3SKMB 4DJMA 4JY4A 1NCUA 1YQ2A 4G7VL 3HZVA 3BOVA 3MRFB 4YFDB 1RVFL 2FJHB 4F9PA 3TPUB 1H8SA 3KHOA 4DK3A 3LKRB 5CJOL 2DN7A 4Y0GA 1FBIH 3RZWA 3TA3D 2K1MA 4WI3A 3TBVA 5A40E 3MNVA 1AGDB 3C5ZC 5C0CD 4PJIF 2NY6D 4KPHH 4L4VE 5KSVB 2PNDA 4MNQA 4HD9A 1HILA 2VUYA 4WO4B 4JG0L 1K5NB 1KCLA 2ATPB 5CEYA 3VFWB 1BD2A 4KJPD 4XNUH 4J8RA 4R9HA 1CR9H 4A2MA 2Y06L 4X4YA 2XV6B 4OV5A 2CR3A 2V2TA 3FT3A 3OR7B 4M7JL 4MDJA 1EX0A 1KENH 3D25B 5T1KD 4RNRB 2Q86B 3JV0A 3GM0A 4NN5C 4HHAA 3BKML 2NQCA 3PDOA 5D2NB 3AXLB 3IFOA 5LXGL 2ADIA 2VE6B 2A38A 1BQSA 1WEJL 2F53E 3LS5L 4RGNE 4NZDA 4OZFA 4W4OC 2GJZA 4OFIA 2VDML 4JREC 4OTXL 1KJVA 5IM7B 1GXEA 2Z8WC 4KDTC 3OF6D 1CE6B 1G6RL 4PJEE 1X5LA 3IJYB 2ERJC 1KIRB 3T0XA 3OKKA 1LO2L 4HC1A 3O6MH 1WIOA 4WHCA 1YNTA 2VABB 3WCYA 2AJYL 1YZZA 1KJMB 3BPOC 3QEUB 4HK0B 5B3JF 1INQB 4NN6C 1KTLA 4KWUA 1DSFL 1KBGH 1KNOB 5AZ2L 5ADOL 1INEL 4M1CD 5E1AB 1NCNA 1Q0YL 1J8HE 1XCQA 1T3FB 3QFJE 4EXKA 3DMMB 5KVMC 1V7ML 4OZIB 3G08A 3VI3E 4OZFG 4L4VD 2J5LC 2PW2B 4PTUB 4XCYA 1MCSA 2ESVE 1RJZA 4YFLI 4ERSL 4LEOA 2OP4H 3DUSA 4GKNA 2MQ0A 1MLCB 5D7KE 3MLSH 5FO9A 1KXTB 3DETD 1KSRA 1NCTA 3GMLA 2DLFL 1SY6H 5DR5L 4I2XE 4RMTA 1A3RH 3VJ6B 4UV7L 1BZ9B 2J8UF 1T2JA 1MI5A 3HNTL 3RKDD 1BX2A 5DRWA 2Z91B 3QXDB 4P9MH 1DQLL 1XGYH 2F53D 3JUZA 2R4RL 4RGND 4F7EB 3X12B 4R3SA 1SY6A 4CDGC 3S6CA 2WBJD 4G43B 3RZCB 3AM8C 3O8XB 4G5ZH 1UB6A 7FABH 2D7MA 1G7QA 3K4AA 4B53A 1RU9H 3FT4A 4KROD 5L2KA 5E2TL 2GTWB 1QA9B 1LP9E 4NKDB 5DHVA 4X7DC 2YD4A 4GRWE 5MENA 2NYYC 4U1IB 2PO6C 3QZWB 4LASH 4LPXA 4Y2OA 4EVNA 1CICC 1YUHB 2DI7A 2EH8L 4YDIH 2VL5B 1N8ZA 2EC8A 1KCSH 3TA3B 1G7HA 5ABDE 3HC0A 2VDQH 3OJDA 1NAML 1UWGL 4EI5D 3BGFB 3DVIA 4LCCA 5DVKA 1J8HD 3LKQA 3QFJD 1VFBA 4P4KD 4LCUB 4RCAA 4ETYA 1OAUL 1GPOL 1WFTA 1UGNA 3IDYC 4ZSOA 3UAJD 5GJTH 2HLFC 2BSRA 5DO2D 5EBWB 5FO8B 1B6DA 1JN6A 1W72L 4X7TB 2JJTC 4P23C 4PJHE 3I3EA 4P3DA 5D7KD 3PWLB 2YUVA 4DGYH 3MXWL 3UBXI 3ARFD 4QY8B 5M94B 3EFFA 4X8XA 1MNUL 2ENSA 2R0LL 4Y19B 4GBXD 4U6HB 4BFBD 4PYHA 4LVHB 1HIMH 2X10A 1U58A 4Q9QL 1OGAA 2BERA 4DAGL 5I0ZA 1OF2B 3G6DH 4XVTH 3RTQA 4AMKH 1BM3L 5IV2B 4PB0H 1NBZA 4H5SB 1R5VA 3DXAE 2JIXA 3I3BA 2A6KB 4NZUL 4IS6A 1AO7E 5F7YC 2Q76A 4MD0B 3BEVA 3F7YB 1TJHL 4U6YB 4N0RA 4R4BA 3BMWA 2XA3A 4P9HH 1JI1A 1CU4L 4Y4HB 1A1OA 3S3PA 1BVKA 1U8IA 3RA7L 1L7IH 1KB9K 1IEHA 1SBSH 4FOMA 1FL6A 3C87A 3M45A 5FM8A 1S9XA 5KZCD 1D3CA 4AJ0A 2X9XA 4ZAKA 2DJUA 3I75B 1EHNA 4JFDA 4D0CB 5BV7C 4Z76B 4J3SA 3PGCB 1ZEAH 4XWGL 3GSNH 1B0WA 1D5BA 1OPGH 1RAMA 5DSCA 3CPLA 1KCRH 1T22B 2A77H 3HI5H 4HKXB 1A9BB 1IEBA 2JK5A 5I1HL 4HXBL 2XQBL 1E4JA 4FXGB 4D9LH 4MDIA 4OIIH 4NFCA 2NPLX 4PRDA 3RGHA 5D5MF 1WBXB 1EEQA 5IB5A 1LO3L 1U8KA 3QXAA 4HUKB 4NPYB 2F54B 2WUCH 2CIIA 1X5ZA 1WK0A 2I60H 3TA3C 2FR4B 4PFEA 3MRGB 2OSLB 2UUDH 5IW1B 3DXAD 2DDQL 2NY6C 1MLBA 5I1AB 5I1LA 1AO7D 4LCYA 1MOEA 1E0OB 2IMNA 4KJPC 5GRVL 3VXSA 1UWXK 4DOHE 5E2VH 1NLDH 3DVFA 4MAYD 4NDMA 4XH2B 5DC4B 3HUJA 3LIZH 3VRIA 5HHQA 1JWMB 3LDBC 1T4KB 1UA6L 3QEGH 2B4CH 1LNUA 1FFOB 3E6FB 3QHZH 4JY5L 4AEEA 3MV9B 1CWVA 5DJYA 3MZGB 3DX6B 4R90L 1B4JL 4X6CB 1XR8A 4OKVA 2NTFB 5J1AA 4DFHA 4R7NA 4UILL 1ZA3A 3BYYA 4O2CB 5IVNA 1N3NB 3KYOA 3CFBB 5DRNB 2OTUA 2CKBA 3GJFB 2EE3A 4K3EL 4UNUA 2B1AL 2YEZB 1EMTL 1EPFA 1LILA 2R0ZL 1CFBA 2E7HA 2G75A 1R3LA 1LEKB 4FQLL 3MRPB 1DBBH 3U9UB 3NN8B 2E9JA 3CFCH 2X7LA 4NC1C 4JEGB 5CHNA 1ZANH 3MROA 3EFDL 2YPLB 4H25A 2IH1A 2IQ9L 3LD8C 4H0GA 1K4CB 1MAJA 1PYWA 4X4MA 3B6SA 3T0AA 2PW1A 4Y4HC 1KIUA 1Z3GL 5AD0A 4M1CC 4XPHH 2BVTA 3PJSA 4KQ3L 1VACB 5FHAH 3SPVB 4KVCH 3TBYB 5MEQB 5ICZA 4OM0H 4LKXA 5DJ6A 1CE1L 3ARWA 2DYPB 2DWEB 3V5HB 5KSAB 4KFZC 4YAQA 2AQ2A 1IAKA 3NA4A 5I0DA 3WUZA 3W2DH 1NEZB 3ISWA 4XX1G 1E4KC 2VXQL 3DETC 2A2QT 3V7AG 1TJGL 1ZVYA 3X3FL 4P2QE 5IOPB 2W9EH 2A73A 2V17L 4GKSB 1NBQA 3O0RL 2IGFL 4WHTB 4R0LB 3RL1A 1MCDA 4QHKJ 5IMKA 3RKDC 1A6TB 1DBJH 3KPNA 3PQYA 1DUZA 4RGNC 4GRMA 2PYEA 5FGBA 4YPGA 5IESL 4ZFGL 3TBSA 2EDXA 3DI2B 3HNVH 1FORL 1U2CA 3VWKD 4HUXB 4KROC 2X4QA 1ZT4A 4KRMB 1OAKH 2AK1L 4X4XA 1C16B 1NGXB 1N6VA 3FFCE 5C2UB 4WY7L 4H8WH 2J7LA 4GMTL 4JVWA 4G6FB 4QGYA 5I1DA 2HWZH 1KJ3L 3TYFA 1UB5B 4LNRA 1K6QH 4Z7WE 4WV1A 4MD5B 3BKJH 3F7RA 4PJEF 3WEXA 4EI5C 1JRHL 3V4PH 3NZ8A 1FCGA 5DI8B 1FP5A 3T65B 4P4KC 2UYLA 3GO1H 5FUOH 3WS6A 3MBXH 1G0DA 4R4FH 1CDYA 2A9NL 2B7DT 5DD5H 3UAJC 3OL2A 3QWOB 3R06A 3HZMB 5DO2C 4I4WA 3JWOC 2LQRA 1VPOL 1BZ7A 3BX7C 3WNLA 2Y36H 1MFAH 4I9WE 3ARFC 4OLYH 4P2QD 3RX8A 3DSNA 4KTDL 1S5HA 4GBXC 1JNNH 2G2RA 3D87B 1MHHB 1K2DA 2VLKA 3RWHA 1X7QA 1JPFA 4OV6F 4L8CA 1ZLWK 4FZEL 4GKZA 1MRDH 1A6PA 3QWRA 4K3JL 2ZCLH 4HS6B 4OGYL 1KT2A 1NC2A 1S78C 3VDAA 4ZFOB 3ZYJA 4LCIH 4ZNEA 3BP6B 1U8PB 5IW6A 1AXSA 2BVQB 5JW4Q 5CZVH 1CQKA 4PJXE 2YS4A 3LQMA 3FFCD 4DGIH 5D7SH 4MQXC 3QXWA 2Y25A 5BO1H 4JO4L 1KCKA 3CVHB 3KPLA 4G9FB 5I8EB 4PG2A 4ODSL 1MWAB 2QQKL 4NGHH 1TDQA 4NUGH 1IC7H 1HQRB 4YHIB 1MAMH 4Z7UA 4C57C 1TJIL 1DDHA 5K9JL 2EDHA 2YD8A 3BN9D 2BVOB 1N7ML 4K94L 5T5FL 3LEXA 4RAHA 1LP9F 5HVHB 5ISZB 4GRWF 3ARBD 3RVVD 3BVNA 5T33H 3WFBL 1EEYA 1UC6A 3MGTB 4APQB 1INDL 5GXBB 3I50H 4PUBH 2DQTL 2P8LA 4LP4A 3QDJE 5JPNB 3FQRB 3UJJL 4G7VH 4OLWL 1EO5A 3LOWA 2HFFA 1RVFH 4I9WD 1YMME 4JAMB 4C83B 1QUNA 5CJOH 5I2IA 4N0YL 4FQQA 3WS3B 4ZXBA 3QUXB 5DD1L 1LO4L 5GS1B 2Z31B 4HX1A 5FHBL 3KYNA 4PRIA 1JVKA 1NJ9A 3L3OB 2ZOLB 4AQ1B 4KKLD 2NXZD 2J4WL 1O5DT 1NDGB 4P46D 4NO0A 2H2SD 4JG0H 2BDNL 4KRPD 4W6XB 4ZD3L 3MBEA 1BWMA 4K8RC 3ESVF 5C0EA 4HG4J 2Y06H 2MMXA 3MLTB 4M7JH 4TVPE 3MCLL 3S37X 5ID0A 3IFPB 2ICEB 3RWIB 4LLMB 3SCMB 2FSEA 4PY7B 5DC9B 1CDGA 1OD9A 3BP5A 3IXAB 3BKMH 3A6OA 4S11A 5LXGH 5DEGB 3DHMA 1WEJH 2AXGB 3LS5H 1WIUA 5IVOA 3DROB 4NWTL 3B8YA 2VDMH 4OTXH 3STLB 4PD4K 1G6RH 1IKNC 4JFFB 3K4DA 5GS3A 4Z95L 2KKQA 1LO2H 5I8OL 2OQJA 4N1EA 3EYVB 1MCJA 2D7OA 5JIHA 5HHPA 2AJYH 2GY5A 1G6RA 1VKXA 3QDMB 4XAKE 1AGBA 3RGVD 3LEYH 1DSFH 2GK2A 4OCRL 3D2UB 4LRIC 1AGCB 5AZ2H 5ADOH 1INEH 4J12A 1AQKL 1YMMD 3OR6A 4LAJH 1V8HA 2NY5C 1Q0YH 4XNXL 5D4QA 1V7MH 3LRSB 2XWJA 5LAXA 2GQHA 4L3EB 5F7MC 1I8KA 4OZGB 4HCRL 5HGAA 4NNXB 3CDCA 5EBLB 1HXYB 1G1YA 4ERSH 4PR5B 3SDCA 4ZOBA 3A6BL 4HBQA 2A6IA 4TSAL 2DQFB 5GRUL 1DEDA 2DLFH 4TVPD 5DR5H 5DJCA 4GG6B 4UV7H 5I15L 1KJ2A 3O4LE 3B3IA 4ODXA 3HNTH 1KF9B 1N5AB 1IGCL 5FIEA 3L3JB 2DLGA 5C0BE 1DQLH 4HXAL 1CZ8L 1S7XA 2BMKA 4FFZL 5SV4A 1P4LA 3QDAA 1ZLVK 1JUFA 2R4RH 5HYSA 1CDUA 1LD9A 1DE4B 2F58L 2DQDL 3AREB 3KVQA 3C8HA 5FFLA 4HKBB 1ACZA 1EHLL 1GSMA 4LF3B 4EUPH 5HJ3B 3BPLC 4PV9A 5L6YH 3QUXC 4OCXL 3SE9L 4OCLC 4RDQF 1YJDC 4OI7A 2RAMA 5E2WL 5E2TH 4FMFA 1JK8B 3TGXA 3VWKC 3QUKB 4NKIL 3IFLL 3LB6D 4JPKL 4E41A 4EUPA 3B83A 5CBEB 2EH8H 2FX9L 1CVRA 3QI9B 5E7FA 4QRQA 4XAKD 1I85C 5TE7L 3GRWL 3CCHB 2XXMB 1NAMH 1UWGH 4YHZL 4JE4B 3VFUA 2DKSA 3ZE0E 4M43L 1R5IB 3QG7L 3B5TA 5JORB 3O3EA 2YSSA 4IHOA 4MB4A 4U0RB 3C6SB 3LSOB 1OAUH 3ECBA 3CDGA 5HYSG 1GPOH 3TBTA 4W81A 4XGZB 4PJBB 1NAMA 1E6JL 1X5YA 2D0HA 5B38A 1W72H 5CCKL 4J3OC 1Q9OA 3NFNA 1JZ7A 3FB8B 2C4XA 2HVKB 3MXWH 1OSPL 3LKOB 1MNUH 2R0LH 1I8LA 1W72A 4EUPG 3EBAA 3O4LD 1NCAL 2UWEE 4Q9QH 1ITCA 4DAGH 2ZNWA 2HG5A 4JN2B 4RAUB 4JO1L 5GGSA 1BM3H 3ZHKA 2NY7L 2YHGA 4MQ7A 4ZYKB 1E4XI 4NZUH 1G0XA 5BZDB 3PXHA 5I1JL 4MJ6B 4BZ1L 1IGMH 1ED3A 2R1YB 5IEHB 4PJ9A 2NZ9D 4Z0XA 1TJHH 1NSNH 3JTSA 3VFSA 5I9QC 3U46A 4P49A 3EOBB 1CU4H 3DX8A 1VADB 3I3DA 3FRUA 5GGRY 4MJIE 1A7PL 3OJMB 3RA7H 1YN6B 4G6JL 2OK0L 4WU7B 5E03A 5E00A 3PL6B 2PTVA 3SN6N 3ARDA 4MNHB 4CU6A 3DVNA 5D7IA 3SQOL 1U92A 3QUZB 4WDIA 5IJKA 1I3GL 1D5XB 3O6LL 4XWGH 3BN9C 5DK2A 1VEMA 2BSSB 1Z5LA 3HE6B 1VSCA 3ARBC 3RVVC 3IU4L 1AC6A 5F1IA 3U36A 3BAEL 4WIQA 3VDCA 5I1HH 4HXBH 1FGVL 4Z7WF 4HLZH 3JTTB 4XBGB 5CMAA 1KELL 1N2RA 3KNBB 3STBA 1HI6A 2O5XL 1ETZA 3RQ3A 5ITFA 2NZIA 4JO3L 5IMMA 1LO3H 3QULB 2GAZB 2GTZA 4F37K 1U41A 5EH1A 3BUTA 3EHBC 4JFHD 5D6DC 4N8VG 2ED8A 4PLNC 4Z7OE 4KKLC 1MCRA 4LCWE 2NXZC 3EYQD 5JW4R 1MVUA 3VXTB 4P46C 4FTVA 4LBEA 2H2SC 3FB6B 4DN3L 1VERA 5KSBA 3VXQA 4E0RA 5GSRB 5TE4L 4PJDA 3TEUA 4FG6C 1S8DB 5DRZB 5E8EB 3L5WB 3C9NB 3VFTA 3ULUL 3BHBA 1GGYA 5DDHA 3OHXA 1UA6H 4MJID 3KDMB 4JY5H 4PGZA 4F37F 1BJ1H 3WNMA 4R90H 2XQYK 1B4JH 3HE7D 4Y4KB 2CDEB 1AQDB 3OAZK 4Z18A 3BZEB 4UILH 1NANI 3IJHB 4NQVB 3WJLC 2VDNL 4K3EH 4PRPB 2B1AH 4PJXF 4IOSD 4HLZG 1EMTH 2R0ZH 3QQNA 2SEBB 1C8PA 1T1YA 4FQLH 2HJFA 1A0QL 5A3ID 5ILTL 4KUZL 3MRMA 4NT6B 4PRHE 3MNWB 2ZUUA 4HJGA 2QV2A 3PWPA 1I9JL 2NY2D 4C56E 4NZRL 3GMQB 5F21B 4CMHB 3EFDH 5EPMB 1MY5A 3RGVC 2IQ9H 3TNMA 4KH2A 3OGOE 4GXUN 5C08B 2R0WL 1Z3GH 5HDQL 4QXTA 5ADPL 4FQCL 4KQ3H 3H9SB 3OGCB 4QOKE 3T4YA 1RZ8A 1CE1H 4QRRE 5EC2B 3SQBA 4YHYB 1T5XB 4Q6IB 5HYQB 2HN7B 1ZT7A 3EYUL 4LCWD 4TOYH 4XC1L 3FMGL 3D1MC 4OFYD 3SJVE 3ILPA 4JQXC 2JCCE 3MJ6A 4C4KO 3SE3A 1UXWA 3KPSB 5HHMB 3OQ3B 5EWIL 3BIAX 2VXQH 5IB2B 5ACLA 2ADFL 3NFPA 1I7TB 1TJGH 4QKXB 3X3FH 1IM3A 4WEBL 3HZKB 3P0VL 2Z92A 1B0RA 2IG2L 2V17H 1KACB 3GMRB 4TQEL 4E42B 2IGFH 1ORSA 3B9KD 2OMBA 4UT9L 3RPIB 1BOGA 4M6AA 2YN3A 5MI0C 4JCMA 5IESH 4ZFGH 4UQ3B 3R8QA 4JRYE 2ZG1A 3GBML 3TVMA 1QSFB 1FORH 3CFJA 5E4EC 2VDLL 4LDLB 5L7XL 1CFNA 3V6ZA 4G3YL 2AK1H 3UJIL 1YEHL 1R3IL 2CMRL 4WY7H 1I1AA 4GMTH 4PRHD 2LV4A 4ORGB 3MRNB 3LB6C 4LPUA 1PG7W 4WUUB 4C56D 2VQTA 1QSVA 4IIQC 1KJ3H 3VMNA 1H9VA 4M7LT 5E9DB 3WUWB 1NFDB 4RWYL 4NRXB 1EFXD 2E6JA 2VLRA 1JRHH 4FFWC 4V1DA 5FGSA 1PKOA 3VFVA 3NTCL 5CEZL 4QOKD 1QG3A 1AP2A 3RWDA 2H32B 4KV5F