1VESA

Structure of new antigen receptor variable domain from sharks
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLPLGDYNYSLLFRGEKGAGTALTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords New Antigen Receptor variable domain
publication title Structural evidence for evolution of shark Ig new antigen receptor variable domain antibodies from a cell-surface receptor
pubmed doi rcsb
source organism Orectolobus maculatus
molecule tags Immune system
total genus 24
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vesA00
1RZIB 1LE9A 1D6EB 1D5BB 3PQYB 4ISVA 1R5IB 3S35L 3V4UL 3ES6B 1DUZB 4YDKH 5C0EA 4Z7UA 1V8HA 4Q97A 4CADA 1FP5A 1DZBA 2E5EA 1RZKL 2XWTA 4OT1H 1ZHLB 5HYJA 2NY3D 5BV7C 5L2JA 4H26B 3HR5A 1AKJD 3FQWA 2JK5B 4H1LH 5DRZB 5LCVH 3DOSA 4J3SA 4YHZH 4FQCL 3MJ6A 1GPOL 2QQKH 3M8OL 1DSFH 1RUQL 1S7UA 1YY8B 1NDMA 2J5LC 2WANA 3HZYA 3RIAF 3BZ4A 1OLZA 4J3WA 3KPPB 4OUUB 3UTTA 1I7RA 2OJZL 2BVOB 5FUZH 1E4WL 4OGAD 3PWVB 1JWUA 1QSED 3C5JB 2F8OA 5T1KD 3SE8H 4M6NH 4YX2H 3KDMB 3ZKSD 3EYSL 4LGRB 1I9RL 5SV3A 2NY2C 5IBLD 1EIBA 2QADB 3ARGC 25C8L 4DJMA 2FWOB 2FO4A 3E6FA 4MNHB 4YQXH 4R2GD 4ZSOE 4OCSL 2X1OA 1FNEA 1ZT1A 1B4JL 4UDUA 3F65A 2P8PB 1ZS8A 3RPKA 3S5LA 3T1FA 3GSOA 1UM6L 4OI7A 4HUMB 2V5YA 1CQYA 1T5XB 3AB0B 3IDNB 3C08L 5L88H 4JFPB 3P0GB 3OXRB 4KDWA 5FYJU 5C9JA 3O3BB 3MBXH 5CP3H 2V2XB 2X7LA 3QFJD 3VFGL 2V17L 2AK1L 2FZ3A 3GSNH 1MI5E 2X10A 4Z95H 3TBYB 4BJLA 5F1OB 3KPLA 1LO0H 5SX4H 4NRXB 2LQRA 4RFNB 1R5VA 5JPMB 3MROA 4EBQH 4EZMA 4P57B 1X6NA 4LMQE 1KPVB 4G5ZH 3O8XD 2ADIB 2R2EB 2ATPB 2VQTA 1TQBC 4Z7QE 5E2VH 1T2JA 4L3CA 3ULUE 4M7JH 4PJ5E 3IAGC 1K85A 2DLHA 4QOKD 3FO9A 4EOWL 3PF2A 5C0DA 5K9KA 4QTIH 3H9SE 5E00B 3TBTB 1WZ1L 5EU4B 5IJVB 1ND0B 3QXVA 4OF3A 4PBVC 3T0WA 2UVEA 2ICWB 5I1LA 1HH9B 3QPQC 5JUEH 3AU1B 4JHWL 4TNVK 3K1DA 5KSAA 3FFDB 3EYQD 4HJ0D 2NY6B 3STZA 1KIQB 3U4EA 5JXED 1OB1A 1GGBH 3WO4B 5C0BA 1A7BA 1CK0L 3O6KL 4TTGA 3PHOB 4HWEH 5CEXB 1Y0LA 5F1NA 4HLZH 3ULVC 1A14H 4V1DA 4DKDC 3O6LL 4WW2A 4AEHL 4JFFD 4X99B 3U79A 3IDXH 1G1YA 1OPGL 4TTDD 4KK5D 3REVA 3RWFB 4F7PA 2NTFB 4M6OL 3L3JB 3OKYA 3L5XH 2KZWA 4IHOB 4JDVB 3RIFK 3T1WA 3TBWB 4ELMB 4XP5L 3WUWG 1EO8L 2J6EH 2Q87A 4YHLL 1AGEA 2JJWA 3LB6D 4BH7A 5IB5A 2MSPA 1QNZL 4ZPVB 5IQ7H 1RIHH 5I0ZA 3QZWB 5LG1A 3GIVA 4MA8L 5B3JF 5HDQH 1UFUA 3V7MA 4R4FH 2FX8H 4F80A 4CW1A 2NCMA 1VESA 1AP2A 1WBYB 2VZ1A 3BMVA 3T0EB 1VFAA 1NEZA 5D7IE 3HE6D 3MJ8B 2CIIA 2Z35B 5IM7B 2X4SA 1HKFA 3FAWA 1MNUL 5LBSH 2BJML 1F4WH 1SJHB 1JF6A 3IXTA 4Z78A 1ZT4B 5FECA 1KCKA 1JV5A 3LQZA 3RBSA 3AM8A 1BWWA 1U58A 2FLRT 1B2WL 4HIIA 4HMDA 5KSAC 1XF5A 3PP3H 1EEYA 3D2UB 1XH3A 5DJXB 3BKYL 2A9ML 3HG1A 3N85H 4GW1B 5EFIB 4JFYB 1UJ3B 1ZA6A 2CSPA 1LK2B 4I2XE 1PYWA 4PRPE 5I74C 1JZ5A 5D70H 2J8HA 3VXQB 2F54E 4KPHL 5BZDA 5DYOB 4R4BB 5IB3B 5EOCJ 1R24A 5DWUH 4QHKI 4E41D 3RZCA 2Y9RT 4Y2DD 3L6FB 4D9RE 3QUXD 3KPMB 1NBYA 2VISB 2ZPKL 3L7EB 4WW2C 1C08A 3WLWC 1CYGA 4LSVH 4Q9CA 3S36X 2N56A 4XMPL 4K3EL 4MCZB 1UH4A 2B5IC 3T4YB 4CVXB 2APVA 2R0KH 1G7HA 1G6RL 4DK3A 3WKMH 5FAAA 3WN5B 2FYYB 2VLRE 3DBXB 4FFVD 2GIYA 3AAZA 3OAYK 5DDHA 4ONFH 4WU7A 5DD0H 2X9WA 1QYGL 4N0FA 4O58H 3DXAE 3RY6A 1BX2A 3PWPA 3TJHC 3VGDA 5T5NG 4BM7A 5HHOB 4OD1H 3QNXB 5GS0D 1KTDA 2CUIA 3DRTB 1SVCP 1NBVL 2LTQB 4KRPC 3RPIA 1DLFL 4ONOA 4D2NA 1JPFA 3UTPD 5FB8B 1GZPA 3VMPA 4Y19A 3QFDA 4ERSH 4OJFH 1I8IA 4AYFA 4ALAL 4Q2ZA 3S98A 4OBRA 2NY7H 3SHSA 3ULUL 1ZWIB 1N0XH 4QHMA 4XWOC 2FO1A 4O02H 4S0SD 3TIEA 3UPAA 3AM8C 3VW3H 3D87B 1NLDL 1CDCA 1DQDL 1QFPA 3KPSA 1MAMH 2I9LB 2VDRH 1FL6B 1ZXQA 3QUYA 1UZ6F 4GXVH 3U82B 3NGBB 3LKOA 3TM6A 1X4XA 3VGBA 4I48A 1S9WB 1J8KA 4RAHA 1TZGL 4HPYH 3RZCC 1FG2A 4F7CA 4TSCH 3HI1A 4X7SL 3MGOB 3MRJB 5KVFH 3UEZA 5KSBF 3BH9B 3A6BL 2Z31C 3N9GL 5DTFA 1DE4B 3BKCH 1NLBH 1MCSA 1WAAE 2WWKO 3EO1A 3RVTD 4NIKB 3SGDI 4K23H 1R3IH 5HI4C 4M9OA 1CGSH 5HHME 4MDJA 1RQ5A 5DURD 5I1EH 3LZFH 3HNVL 4A6YH 1RZFH 1NDGB 4DN3H 3QDME 1J0KA 3HUJA 3RY6C 1EZVY 2OR9L 3NABL 1QKZH 1DBAL 2C4FT 4HIEB 2YPKA 2FECL 1GRWA 3WNLA 4BFEA 5F89B 3KYAA 1P9MA 2QHRL 4HKXA 5J1AA 4KTDL 3SKMA 3SOBL 3V5DB 5D7JD 2Y06H 4ACPA 4TUJB 4DAGL 1ZHNA 4F37K 3IF1B 3U6RB 1AHWC 5C0AE 4LLMA 1S7XA 4AY0A 4UTAH 1WC7B 5K93A 3TNMB 4N8PA 4NNYA 2IFFH 3U4BL 2EEBA 3P40A 4WGWB 4XPGH 5IMLA 2R4SH 3GBMH 4MAUH 1KACB 3WDJA 4MJ6B 5FO8B 4JKPH 1T20A 3DVGA 1FYTE 4FMFA 4HJGA 1JGLL 4S1DC 4KHXH 5HHVH 3V0VB 5JXAL 4LP5A 1T4KB 4ZO6A 5L2KB 1BD2A 1UWGH 4LRNL 3X3GH 3IJSB 3K46A 1IEAB 4I3RL 5DR5L 1RZJL 4G8GA 4OD2B 3FZUD 5KS9B 1UADC 1BQSA 1N7ML 1SQ2N 3C5ZC 2VE6B 5EOQH 1A1OB 3VXTB 3MOBL 3PV6A 3B83A 3QXAA 3SDYL 3VJ6B 2VIRB 2C3VB 3MUZ1 3F7YA 5HI3C 2W0KA 1QSFD 2NR6C 3BDYH 4BH8B 4QRTA 4YDLC 4IOFC 1LO2L 1JHTA 4TPRH 5F8RC 3V6FB 1CLOL 1IAIM 2H26A 4X7DC 1U92B 5F1IB 3UYPA 3ZE2F 3TGXA 5IOPB 4WEBH 2GFBA 1YECL 3HE7B 4I0CC 1ZE3C 4X0KB 1FLRH 2ATKA 3QWRD 4P5TA 4XC3L 1IT9H 1XR9A 1F3DJ 3RRQA 4IOSD 3FB5A 3T3PE 1KXVC 4RBPK 5E8DH 4KQ3H 1XIWB 4OLUL 3VGGA 5JQ6L 1A7QL 1CFSB 2OZ4H 4M62H 3N1FC 1T7XA 4K3DL 2YD7A 1IZKA 3DVIA 2BNQA 4MSWB 4UT9H 5DK2B 3G6AB 5IBTL 1KLGA 1MSPA 1IGJB 4X6FA 5E03A 3QUZB 2HYMA 4Q9RH 4R4NC 4JDTL 1G6RB 1L7IH 4PGDA 4LBEA 3ZHLA 1CLZL 3L3GA 1EAJA 3I6GB 4XTRD 1PZ5B 2GJ6B 4IJ3C 2YPLE 1BVKA 2MCPL 4TRPH 1C16A 2R4RH 4YAQA 4WW1B 3MUGA 2DBLH 3G08A 4QHLA 1XGTA 3JWDH 2FHCA 4NC1E 4PB0L 4YPJA 4M93C 5GGRA 3QNYA 4NKMA 2L0DA 5FYLH 2G5BA 3CDCA 2XICA 3WUWB 4LDLB 4GRWE 1HXMB 4G6MH 3CDFA 1INQA 1FSKC 3ZKMC 3FOMA 1EX0A 3R06A 5ESVB 4M03A 2P5WB 3X17A 1RJZB 3T77A 3B6SB 5DEGB 5I76B 4X4MA 5KZCB 4FFZL 1SBBA 3K8MA 3D0LB 4TVPD 1U3HD 4JHZA 5IHUH 5K59F 2B7DT 3ZMRA 4BZYA 1HDMB 2FJFB 5DEZA 4GSDH 5JW3H 4U7SA 2BSTB 4PGBB 1N6QH 5A2JH 2XA8L 4MA1B 3QHTC 1TPXC 1L7TH 2CGRL 3OGCA 3PP4H 4BQ9A 2CRZA 2KH2B 3TPUB 3I6LE 3K0WA 2BOBA 3PQYD 4P5TC 1GOFA 1JNNL 4QF1A 3U2SB 1XGPB 1GAFH 2CRYA 4O5LH 3LKQB 1INDL 3IDJA 4RISH 3L3HA 1WF5A 4NRZB 3VDCA 2RFXA 1I9IH 5ENWA 3PGDA 1KTRL 1OSPH 1DDHB 1VENA 3C60A 4KJYB 4HKJA 3QDJD 2DDQH 4XMLL 4MLIA 2X6MA 5ID1A 4QYOA 5F44A 5H2BB 1HSBA 2WIIB 4PJBA 5BW7A 4F7TA 3LEVH 4Q0XH 5AEAA 3O2DA 4WI7A 1SEBB 5FGCB 2XPGB 4ENED 3NBNA 1A7RL 4L4TE 4DKAA 4X83A 2C3WA 3AROA 5D7LA 3MRBA 2WW8A 2CRIA 1CFVH 2HFFA 4PRBB 1KCUL 3BUYB 3QI9A 4H5SB 1VGEL 4LLUB 4XCFH 4LSTL 3GM0A 5GRVL 3FQXB 4PLKC 3BX7C 4WTWA 5IFJA 4X5WB 4M1CC 4JPWL 4GW4A 3GHEL 3Q1SH 3VXOB 3WFBH 4L5FL 4PJDE 2HJFA 2QADD 4MXQD 4KMLB 3VA6A 2JCCA 3CLEL 3MRDA 1I3RA 4M43H 2VXQH 3V95A 1YNTB 3IETA 1X5AA 2AJ3A 1Z2KA 1ETZB 4J3XA 4P49A 1ZSDB 4Y4HD 4Z0BL 3X14B 5C0JB 1I3GH 1GC1H 2JJTC 5FGSA 5HGGS 1NGXB 4YXHH 3W9EA 1BVLA 2XZCH 3CPLA 5F6IB 5T33L 3BO8A 4HS3A 5BO1L 3UPRA 1HHJA 2CQVA 5IP4A 1G84A 2VRAA 4U1GC 1NAML 4I5BA 5H37G 4PJFF 5TE7L 2VZVA 1N6UA 5L7XL 2FL5A 1KFAH 1G9NH 4HAFA 3DHMA 1XGYH 4WNQA 1HYSC 1H3GA 3C60C 2J4WL 3OKMA 4FFWD 1MIEL 1FDLL 4YDJB 3M17A 2ZJSH 4HWBA 4J3OC 5DQDL 3F6LA 4WI6A 2Y6SC 5BW7C 5IV2B 4KK9C 1BBDL 1MHPL 4LEXH 1X7QB 5EU5A 1A7NH 4LCCB 4HS6B 4PJCE 5LQBL 3KVQA 2XQYG 3K1KC 4PP1D 1DLHA 1RD6A 1VKXB 1UM5H 3QI9C 2GITA 2VAJA 2A6DB 4JM2F 4KAQH 4P5KA 3RWDA 5C0FB 2HLAB 3LKNB 5EU3A 2N7BA 4G8EB 4K71B 2VERN 2WV3A 1BBJB 2W60B 3NIDE 5J6HB 5ICXB 5I8CA 1MJ8L 2XKNA 2D4FA 2PTUA 5F96L 1I1RA 4I1NB 2GAZA 5C6TH 4LL9A 3UJIH 5CSGA 3VWKA 1CTNA 3K2UH 3BFOA 4NKIL 1FGNL 4OF8A 3WNMA 4ZOAA 3LAFA 4JLRB 2BP3A 4NUGH 1Q94B 1F2QA 5I8OL 3VFPA 3CDYA 3RWGA 5A16B 4JY6B 4WCYL 3FQTA 4PLJD 4I4WB 4IMLB 1U91A 1BJMA 3BP7B 3RNKB 1NEUA 2PW2B 1X5KA 1JRHL 1AXIB 2IAND 4P9MH 1M71B 2BY2A 1A1NA 3G6JE 3KPNA 3MV01 4FTVA 3GI9L 1CXKA 4XNMA 3MV7E 2AJZB 4K8RC 3EKCA 5ETUB 4FQLH 1KBGH 4GRLA 2F15A 1QEWA 4YFDB 1MHCA 5F7FA 1UA6H 1WGOA 3DI3B 4PJGE 2JKXA 2NW2B 1OTTD 4LOUC 8FABA 3FN0L 5HHPA 5IEHB 4Z9KB 1KB5H 1YEKH 3L3KA 3MLTA 3BVNA 3PDGA 2X4PA 3I3BA 4GAJH 3TO2B 2EDFA 4Y5YA 4LU5L 3FO2B 3CXDL 1OP3K 4KI1A 1IC5H 2AKRA 3BPOB 4ZFGH 4C54A 1HXYA 2CIKB 3GMQB 4JRXE 4DTGL 1OSZB 4NO0B 1MY7A 2VL4A 3ETBF 2CDGB 1CIUA 4N8VA 3WSQL 1AR1C 1JGVH 4C55A 4QLRA 3NFNB 4LLYA 4HIXH 4MJIA 1EEZB 3PWNB 5AWNL 2IG2L 1CT8B 1ZVSA 3ROLB 1FZJB 5ADPL 1DQTA 5E08L 3KXFB 4DQOL 3MOAL 4KQ4H 5KVEH 4PRNA 1J0ZA 3FB8B 1CFNB 1N2RB 3WBDA 4ZO7A 3VWKC 1J7VR 5AZ2H 2ARWA 5FDWA 3MRIA 5A3ID 3EDEA 3V6OA 1U8JB 2HT4C 2XWBB 4UOJA 2OJZH 1DVFA 5BS0E 2W65B 3HRZB 4IRSD 3MXVH 4LLWB 3U1SH 3HRPA 3FT2A 4PGCB 5DD5H 5I1GL 3DX7A 1OAQH 5GGSY 3FN9A 3V7AG 2Y7QA 3MLSL 3BGFC 4O2CA 1JNHB 1MLCA 4OCSH 2IPUK 3TFKC 1OQOA 2YRPA 3GMRB 4WFEE 4GRLC 2C4FU 4JPKL 5HVHB 2ERJC 4GQ9L 2HFGL 4RMSA 5BQ7A 4LQFL 4HKZB 4OCXH 5EIIA 2SEBA 2NZ9D 2XN9B 1T0NA 3TBVA 4S1SL 1ZHKB 4I77L 1MLBA 4PREB 5DGRA 3RWHA 4OZGE 2ZSWB 5FM8A 1S8DB 1NMCC 4ODWA 5HHOD 2VDNL 5B22A 4FXKA 4KI5C 5J6GB 4LMQI 2MWCA 5SWSB 5TDOB 2CDFA 2V17H 4OF0A 4JREB 3C9NA 4PJEB 3IDUA 4ZNCD 4JCMA 1TNMA 1UQSA 3C6SA 3N1GC 1D5XB 4Y5YC 4YXKH 3DVNA 3NPSC 2PW1B 1LEKA 1I1AD 3ZLQC 4IDLA 5ACLA 1YPZA 2PO6C 4WJ5A 5JZ7C 4DW2H 4ZUTB 3PL6A 1S7SA 4GKSB 5D7KE 2AVGA 4NJ9L 1A1MB 4QEGA 3O81A 3WFZA 5CEYB 1CE6A 4M1DL 4TSAL 3UZQA 1CZ8L 2GCYA 2P45B 1PEWA 4PJ7A 1A4JB 1VFMA 4U1IA 2EYSA 3QEUB 3T0EE 4WEMB 5IVXB 4QWWC 4EN3D 3VE0B 4BELD 1A7PL 3BOVA 3VFSA 4OV5A 1P69B 6FABL 5J1TC 1DVFC 5C6WH 3WFDH 2EO9A 3LSOB 3O45A 1DBMH 1IFHL 2XZQH 4P4KA 4M1GL 5HGDA 5DZLA 3FRUA 4K3JL 1CN4A 1T21A 1R5WB 1ITCA 1I9EA 5C0ND 4JHWH 4WHDA 4P2RE 1SY6A 2OL3B 3E6HA 4GG6B 4HUUB 5E99H 4XPAL 1MJ7H 5INDB 1X5YA 1F6AB 1BVZA 5LGJA 2FJGA 4XPHH 2BNUB 4BZ1H 5E5UB 2PUQT 1ZGLA 5FXCH 2FECI 2YN3A 4JGUA 5FKPA 1P1ZA 4X6CB 2EE6A 4G6KL 3MOQA 4PJ8B 3U9PL 1J1OH 3ARFB 5C2BL 4E9LA 4YPGA 5GIRB 4R6UA 4EI6A 3QAZC 3D3VA 3BWUC 2ESVB 1TVHB 3U7WH 4F7MB 5K9JH 4N0UA 5EO0A 2R0LL 5MHSD 5E2JA 2DTMH 4XP5H 3U4AA 1EO8H 1YN7A 3IKCB 4J7RA 5DZOA 3G5XB 4ZYKB 4Y1AB 3KJ4B 1QNZH 1KIRA 3PL6C 4QHNB 1QHOA 1CL7L 2Y36H 2KKQA 3VH8A 2X09A 5I9QC 4WUUE 3NZHL 4JVPA 3EGSB 4G43B 4OV6F 4NBZB 5I1CL 1EFQA 2Z92A 4MMZC 3CVHB 2HMIC 1AGDA 2R56L 3WYRA 1T22B 1G7MA 1S5IH 3OKDA 1CD0A 5M7QA 3U36B 5L2KD 1TDQA 1AO7B 2VDQL 5DJ0A 4KKAC 4P4KC 4NNXB 5D2NE 4NP4L 1A9EA 4HPOL 3TA3A 4DFHA 1OWWA 5J7CC 2A0LD 2X1WL 4S1QL 4UINL 1B2WH 4JG0L 1D9KA 4MQXD 4HDIA 1AGBB 1RJLB 3BXNB 1S5HB 4HT1L 1D6VH 4UB0H 4M61A 1N64L 2CMRH 2YK1L 2Q3ZA 2DLEA 4O2FB 3QG6A 4Z7NF 1SMAA 4G8IB 5C6PB 5F7MC 4Z7UE 1P2CB 2Q86A 1JNLL 4P99A 5HYJE 1FO0L 1EK3A 3RKPA 3KLHD 4Y16C 3HE7D 3QQ3A 4OM1L 4OF7A 4XT1C 3UJTH 3QWQB 1I4FB 5DJDA 4Z7VA 2ZPKH 4JFDA 4RGOL 4WHYG 4YBHA 2M8XA 3PHSA 2NNAB 4Z77B 5E2UL 1HSAB 3TT1H 3MJ9A 1IVLA 1T5WB 5IB2B 5FYKE 32C2A 2FHBA 4KUCF 4NM4L 1NAKH 3H2WA 3UTTE 1A6AB 4QXUH 3PGFH 4G9DB 4KHTH 4EI5B 2AI0L 5CGTA 1QYGH 4ODUB 5ITBH 5I1AB 4G9FB 2OMBA 5DJ6B 4YDVB 4ETQB 2RHEA 3QUZD 3QQ4A 2EH7L 2IQAB 4NFDA 3I2CL 3DX6A 3JWOL 2I07A 4LLDA 2GJ6D 3O6FA 4ZUSB 2VABA 5I8KL 4ALAH 3VFNA 4PB9H 1MI5D 1MCOL 3HTLX 4C4KO 3LOWA 1D5ZB 1KPUB 3PP3K 3TA3C 2AXFA 1F8TL 3VFMB 4PRIB 1EFXA 3PNWB 3NIFE 1P5VA 1D9KC 4JRWA 2VDKL 5AYUH 1HHGB 2P5WD 1EGJL 1NBZB 4NM8L 5F7YC 5HYQB 3AXLB 2AS5M 5KZCD 4I9WD 1PW3A 2J7LA 5D2LE 1S7RA 2NY1C 4Z7WA 5ICYA 1GOGA 1Q1JH 4HXBL 4KK8D 2X1QA 3ULUD 2X89D 3BPNB 2H32A 4TSBL 5CIPH 3ARQA 1NUGA 2V5RA 4PJXB 4Y5VB 4NWTH 2VDOH 3WNKA 1OP9A 3QDGB 5H8DA 1VB9A 3MRHB 4XAWL 3A6BH 4F9PC 4W6WB 3UZEA 5EZLB 3UTSA 3SGEI 5E1AA 1IRAY 3D39E 3DRQA 2VL5A 1AE6H 4NFBA 5BV7L 3HAEG 3OKNA 5J12B 2BSSB 4ELMF 2EXYD 3GMLA 3SCMD 5C7XL 1RIVL 4XP6L 2NY4C 3EUUA 3JWNC 4KJPC 2DLTA 4MQ7B 4H8WH 3DWTA 3HB3D 2EC9T 4M7ZB 4X6BB 3JZ7A 1JI1A 5CBAB 3F8UB 4XBPA 3OR6A 1CICB 5F7EL 2CJUH 2OR9H 4OAWA 1UWEH 1N5YL 1M7DA 1GH7A 2P48B 5E9DA 1YEDA 2QHRH 2M2DA 4DGVL 1AQKL 2ZUYA 4F2MB 4KTDH 2EYTB 3S5LG 5C0BE 4IIQA 3O6FC 1U8PB 4P46A 3JV4B 2X41A 5L0QB 3VGAB 1KJ3H 3RU8L 3RKDD 3V0WH 5F6HI 2A6IB 4LLVB 5DJAA 4OLWH 1KPRA 5EO1B 1FNSH 5E8EA 4V1DE 1YNKL 3VXUA 2DTSA 4FQXA 4R7DB 12E8H 3KGRA 1ZHBA 2HT2C 4JAMB 2NY5H 1HIMH 4U31A 4MZ3A 4X80H 1DEEB 2LVCA 1EUTA 1NCBL 4WI2A 4WENB 3MYZA 4NDMB 5C0CE 5HDOA 1L4IA 3VWJA 4LRNH 3P4MB 2JTDA 3GBLA 3S96B 5J1SC 3T0XA 4KTEH 4KH2A 2IADA 2VUYA 2VLLA 4KUZH 4TNWK 3HLAB 2CK0H 3SGKC 3LS5L 2QSCL 1T1XA 2Y07L 4KJWC 4B0MM 2R23A 5DD6A 1AY1L 4P3CL 3BGMB 3L3OB 3BQUA 4WUKH 3D69B 1CWVA 3A6CH 4IRZL 2EIZB 2I9TA 3EYVB 1RFDL 1CLOH 5HSFA 1M7IA 5SWZA 4XWGH 4POZC 2AK4A 2D7OA 4X9GA 3KYOA 4HFWB 4JR9L 5FUOL 1I1YB 1BLNB 5FYKL 4JPVL 2F54D 2YMXL 3LV3B 4QTHB 1YYML 3BE1H 1V7NL 3KYKL 4WO4A 1I8LC 5F7UA 4EDXB 3HG1E 4KFZC 4ZS6D 4WFFE 1OD9A 1DQLL 1ZLVH 4OI8A 4BSWB 3S36H 3TLRA 4P46C 3QEQB 3TYGL 1GIGL 1A7QH 2R2HA 1N8ZA 2ICEB 3GSRA 2AJSL 3QXDB 1OHQA 5DJ2A 4H88H 2CDEB 3GSUB 1IGCH 4FQXC 5BRZA 2AV7B 3RP1A 3FMGL 3O6ML 2VLRD 3CUPB 4NCC2 2R69H 4TQEH 4ZO8A 5E24E 3GEWB 3O0RH 2DWEB 1AGFB 3BKJH 4HF5H 3EO9L 4O4YL 3RGVD 1CLZH 5TF1H 3T2OA 4ZDHA 2GQHA 3ULVL 4UDTB 1J0IA 2XWJA 4G6AD 5HHNA 1IQWH 1A2YA 1W72B 1YMMB 2I60H 3BW9A 5EORL 3VWJC 1MCCA 5M95B 1GZQA 2VLJB 3ZDYF 1OGTB 2B4CC 3PWPE 3GSXA 3VXMA 4L8SA 1EA9C 2GUOB 3QSKB 2EH8H 3IU3A 4NQDB 4LSUL 4Z76B 3OB0H 4N0CC 4TULL 4LPYA 2PNDA 3BQUC 4Y19E 1WWCA 4HXAL 1S78D 5ID0A 5D9SB 1A5FH 1NCCL 4MB3A 1NGYA 2ED9A 1XF2A 3ILQD 2Z91A 2H8PB 4Z0XB 2EO1A 3H9YA 3HC0B 4QRQB 4P5MA 3W39B 4WO4C 1U3JA 3EOTL 4LVHC 5C9KA 2EDNA 4NO0D 4HUVB 3NZ8B 1NGPL 2YD4A 3QQ9D 4N5EC 2NW3A 1OAXL 5CCKL 1F3RB 3CFCL 3KXFD 5J56B 2MJWA 5DJ8B 4DZ8B 1G7PA 4QHKJ 2PKDA 5BV7B 4O51A 1VDGA 4M8QB 1E6JL 1Z3GL 5CSBA 3NCJL 3LIZL 3QDMD 1UACL 2OQJB 3GGWB 5C0IB 4DKFL 5JHDB 1KCUH 3EO0A 3U7AA 1U2HA 3G5VA 4LSTH 3VXRB 3TV3H 1HQRB 2E7BA 2X42A 4P4RA 1AXSB 3INUL 1BFVL 1T1WB 3HS0B 4WEUD 3GKWL 2J5LB 3ZE0F 5FYKU 1K4DB 2AGJH 3L7FA 1ZANL 4XNYL 4OFYD 5H35B 5BOZG 7FABH 4R3SA 5JO5A 5KS9F 4L8SC 3NTCL 4XXDA 5C0AD 3ESVF 5IIEA 1QRNB 2DWDA 2GTWA 4R8WL 2IH3B 5DHVA 4LVNB 3C6LD 3BPLC 3P0YL 3ARBB 5DJCA 8CGTA 4QXWA 2VLKB 4JPIB 2O26U 3MLXL 4H25B 2CRMA 1MQKH 3SDXE 4RQQA 3RUGE 2XN9D 1U8LA 3RL2A 2C1PB 1JL8A 3OJ2C 1IM9A 3R8BB 1OM3H 5E6IB 2NY2B 5ANMA 3T08A 5FM5O 3H7BA 4XBGA 4D0BA 4X6EA 2AXHA 5SWSD 3MODL 1C5CL 2BVUA 5EOCL 3TIDA 1TETL 5IJKA 1JPTL 1BM3L 3LS4L 2BNRA 2OI9C 4OCRL 5JLZB 3DARA 4KMTH 1TENA 2XA3A 1A47A 4IRJA 4XZUB 2EDRA 2BERA 2DQCL 4DVRL 1ZLUH 5DUPL 5JORB 4URTB 5SX5H 4K3GA 4JE4B 4G8GE 4LSRL 3B9EA 3QUMB 2OL3H 4HUXA 4JN2B 5EU6A 1T2XA 1LP9B 1GGCH 4LAJH 2VKXA 2F53D 2A77H 1CLCA 2UVFA 4DOHE 2F5AL 2MMXA 3P30L 4UUJA 2L4OA 3MLVL 1WSST 4MNGB 3LEXA 1CBVL 1H3XA 3QIWD 5D1ZB 3HAEB 3HZYB 1IGFH 3VXSA 5MENB 4XMKH 1INEH 3VRIA 3H3PH 4KZEH 4JQIH 4Z8FH 4NKDA 4J2XA 1BFSA 4YUEH 1I7RB 4KKNA 3OXSB 3ZTJG 1FFNA 1JWUB 2ILLA 4NKIH 2Z8SA 1IE5A 2D31A 2QHLA 2V5TA 3B9KC 3QIUA 3T04D 5IW3A 4PR5B 2IH1B 5DMGD 1WCQA 4QXTA 5DVNA 3ARFD 5EBMA 4PBXA 2FO4B 4ONGH 2VITA 1JRHH 4R97C 4DKEL 5I1JH 4UDUB 5CEZH 2BNQE 1JPST 3ZE1F 1ZS8B 3S5LB 3DROA 1J05A 5IJKC 4G7YH 3T2NH 1UKSA 3OZ9H 5DJYA 3FB7A 3RVUD 1KTLA 2D4DA 4MCYB 4XI5D 4YBLC 3CVHH 4NO2A 3RVVD 4ZUUB 5LXGL 2DI8A 4IRJC 15C8H 1NMAL 2AQ2A 4OLVL 2DKUA 1TVDA 1KN2L 3WNNA 1FN4B 5CEZD 1FL3B 3RI5F 3KPLB 4N9OB 5H37H 3GRWH 3F58L 1YEHL 1D5MA 1WJ3A 2LU3A 4L3EE 4JRYB 2A38A 2BVQB 1F90L 1U93A 5EUOA 2X05A 4RGNC 4D9LH 1KCSL 3DUSB 1AO7D 1I7TA 4L3CB 4NQSA 3ZKXC 4GKNB 4UBDD 5FDYA 4LLQA 4OKDA 1Q0YH 3RL1B 5I15H 5ADPH 1S7QA 3HI5H 1XGRA 3E3QE 1F3JB 5TDPA 1MFAL 4YNYA 1J86A 5HJ3A 3BZFB 1YYLH 1TQCC 3PGCA 3QIUC 5DD3H 3FCTA 5JW5A 4R0LB 4Q6IB 4IEFB 5KSAB 5SWQB 1NGQL 5HDBF 1UH3A 3E8UL 4BFGA 1B0WA 1U8KB 1NL0L 1A6ZA 4P23B 4PJBE 2EC9U 4JQVA 1FVEB 1PX4A 4QRSB 4M6AA 1NSNH 4R26H 1RULH 5EUKA 4EDWL 3ZT6A 3MV8B 1Y0LB 1FNAA 5FHAH 2NYYD 4GQ9H 4U6YA 5FKAA 1OTSC 5E5MA 5DVKA 4LQFH 5D7LE 4LCWA 3REVB 5HGAB 4F7PB 4NQCB 2B1HL 5FM5M 1U8MB 4MS8D 1OW0A 4G9FD 5KJRH 1W0WB 3DV6A 5J57B 4XH2B 1DQMH 5MI0B 4Z6AT 4M7LT 5DRWB 2ESVE 5BZWA 4D9QD 4W70A 5E2WH 1TLKA 5DJZA 1FYHB 1NCDH 43CAB 5EBWA 2E6JA 1JK8A 1YUHA 2I26N 3TZVB 2F58L 2HTKC 1QFUL 2YN5A 2YA2A 3O3EB 4PRID 3RHWF 4NJ9H 1FORL 3WFCL 4JDZA 4KRPB 4WDIA 3WHXA 4H0HB 4JFXB 3NCBB 1U8NA 5CZXC 4F15C 4FQIH 5MEPA 3OL2A 2EKSB 3ZKQD 1A7PH 4Z78B 2DD8H 1QHPA 1G7LB 1KGCD 3NCEB 1HHKA 2ZOKB 4CN1A 3QDGD 1Q72H 2QQNL 4L3AA 3BP4B 3MNVA 5HI5D 2R39A 4YHML 3W11C 1NPUA 2NLJA 1T1ZA 3TVMB 2GSIA 2VH5H 4JQVC 1EXUB 3MXWH 4MNQE 5BZDB 5F88B 2ZCKL 4OBSA 1R3KB 5D7SH 3DX9A 3AS3A 2Z93A 3WIHH 5I19H 5IG7A 5EC1B 3D25A 1ORQB 3EYOB 5CJOH 3TCLA 4NGHL 2Z31B 4UV7H 4OZFB 3FQNB 2O5ZH 1BOYA 4G6KH 4GQPH 3BISA 1ZT7B 1OW0C 3B3IA 1DBJL 3OKEA 1BQHA 2DQGH 2XFXA 1G7HB 1LDPH 1S9VA 3I3DA 3LRSA 3CH1A 3LD8B 3QHFL 3KS0H 4Y4KA 3AAZB 5FEBA 1AD0A 2QQLH 3TP4A 1KYOK 3W9DB 2XI9A 2WBJA 2WUCL 1JHLL 4QRRD 4UT7H 2W9LA 2CLRA 2ZCHH 4NC0B 2IQ9H 2PXYA 3U0WL 2DQIL 2YKLH 4XAKD 5GZNC 1FVCA 1CL7H 4X98B 4G3YL 3I75A 1XT5A 4XHJC 3OKOB 3RPIB 1KLFA 4ODXA 3PJSA 4FTVE 2C1OA 3JV6B 1ACZA 2FX7H 5CMAB 5GSVB 2A1WL 2F8VA 1AHWB 4U1MA 3KNBA 1LO5B 5IW1B 1ED3A 1OAYL 1RHHA 3U0PB 3WL9B 4FMKA 5GISH 3IS0X 3O4LA 4J4PD 4S2SB 5I0DA 1QBML 3GJEA 3GO1H 4LGSB 3QT2A 5BMFL 4Z5RB 2Z4QB 3CZJA 5EN2A 3RTQB 2FB4H 2JELL 1IEBA 3EOYG 1SY6H 5EH1A 4LF3B 2WINA 3MLRH 4HQQH 3ZL4L 4D0DA 3BZEB 3CX5K 3C2AL 3AS1A 4FZ8L 4OZHB 2VDPL 3HPLA 5DMIH 4F7CB 2OX5A 1NCAL 4DCQA 4LHUA 4KVCL 1S7VA 4KVNL 4FQQA 3HHRB 3HNSL 4PJXE 3EIFA 4X5XB 3C5ZB 3CDGA 3DYOA 3P4NB 5C08A 5E8OB 5F70A 4WTZG 5GGUB 5B4MC 4M5ZH 4MJIE 2E8ZA 3O2DL 4M6MH 1NFDA 4XRCB 4P2OB 3H9HB 1WBXB 3RWEA 5FGBA 3B9DA 4PJEF 4AMKL 4IM8A 2RQ8A 1BP3B 1P7QB 3B8YA 1MCQA 1HILA 1F2XK 1JPSL 4Y4KC 4Y7MA 4Q9QL 2WBJC 2HT3C 3H6JA 3QEQD 5DI8A 3V6OE 1ZEAL 1UXWA 3HUJB 3EZJB 5E7FA 3P73B 2PXYC 3FONA 4TUKL 2YRLA 2YPKB 1W72H 5DLML 3UTQB 4MXWH 2FX9L 3QNZA 2Q76B 2M26A 5C07A 1AIFB 3GNML 3KPQA 3CSGA 3WIIH 5DFVC 1AC0A 1HH6B 5CHNA 1T6WA 1NC4A 5HPMB 5IVXF 1I75A 4GLRI 1JYXA 3JUZA 3BP5A 3K81A 1YMMD 4PJ9B 1YDPA 3ARDB 1MCKA 5DVOA 4QRUA 4D3CH 4XNXL 1QOKA 4LFHG 3F12B 2VLJD 3LPWA 4ZD3L 3L95B 4K8RL 5LAXB 3VFUA 2V2TB 2WQRA 3U0TA 3P0VL 5I75C 2X70B 5KVGL 1UWXH 4GG6F 5KW9H 4MHHI 2VR5A 2DQTL 4HIJA 3LKRB 4KK6D 3SKUD 5IGXL 4QCIA 1UB5A 3KJ6L 1VACA 2J88L 1QLEH 5IQ9A 4F58L 5C0RL 1Q9KB 4ZFZA 5TQ2L 4GBXD 3IDIA 4N8VG 4HWBL 3GIZH 4X6CF 1X5HA 4ETYA 4XAWH 4AJ0A 4XC1L 5HD8C 4YHOL 2YBRB 2D03L 3ARWA 5GS1A 3RDTC 1GVIA 5KSBA 3RWJA 1PLGL 3MJ9H 2R1WA 2F9BT 4PJ7E 2BY0A 4NQVA 1PGRB 3FT4A 3VFVA 3S88L 3CCHA 1TTUA 2A9NL 3NCCB 1B88A 2V6HA 3ILPA 4XP6H 4DVBA 1FFRA 4WHYH 4RDQG 4R96B 1HQ4B 3S34H 3S4SG 1I9JL 5IT2H 2OP4L 4AT6A 5F3HB 2R1YA 4QXGH 5T3XL 3VFTA 4JZNB 5F7HA 3SDCA 1XAUA 4M7LL 3VXRD 4PJ5A 1MCPH 2X4TA 3MRNB 1T7VA 2I5YL 2K1MA 4L9DA 1GGTA 3OAUL 1KLGB 3SDDB 3H9SA 2APXA 4HH8A 1X5XA 2AEPL 2OJEA 3CFKA 1XZ0B 1QRND 5HDLA 2FRGP 4GUPB 3D3VE 5CD3A 5T5FL 3GMMB 2WIMA 1NCBH 4MD5B 4N0UE 4JFEB 5ECJE 1U8OB 3QNYB 2NY2D 2QLVB 2HN7A 3ARGD 2CKBB 2HH0H 4L4JA 3RI5K 4H1LA 3HCVA 4JO4H 5DVMA 5LGHL 4MD0A 5GS1C 2AXGA 3QUMH 1BZ7A 4LNRA 1RU9H 1F4YH 4PTTB 1H3TA 4J8RB 1WZMA 1MOEA 5IF0A 3EOAA 4EXPX 4HGWA 5KSUA 3PIQA 3NAAL 1DTUA 3OGCB 5E6YA 1MJJA 4FQHB 4AQ1B 2DYPA 1S7TB 4J6RH 1T7ZA 3LHPL 4KRLB 2JIXB 2OTPA 2O5XL 2FR4A 1CF8H 5BXFA 5HYJD 4CRPA 3NACH 3MFFB 3OV6A 2BHYA 3KYKH 4NJAL 1Q38A 1KLUB 3B43A 3ECBA 5EZIL 4PFEA 3PGDB 4JCLA 1Q9WB 4OTXL 5CBEB 1XCQA 2P8MB 4HKJB 5DC4B 3SDCC 5DHYA 2Y5TA 3V52H 4PRHB 5F7KC 4PJIB 1HSBB 4M7KL 4OLYH 5FYKD 3L3DB 1FFQA 3U46B 5MEND 4UU9A 4UIKH 5HXMA 2OXHA 1IQDA 1J87A 2RCSH 5GGQL 4Z7VE 5K9OB 4JFDE 4K7PX 5CP3A 5ADOL 5BJTA 3DURB 4YHPA 1IAOA 2B2XH 3O8XA 4PV8B 4JO1H 2GY7B 2ZZUT 1U95B 3DSFL 4NO3A 3GSNA 3GSWA 1SM3L 4KC3B 4NZRH 1L0QA 3CIQA 5IB1A 5ESQB 3QPQD 3ZKND 4E0RA 5ITFB 4JFZH 3PWLB 4I2XA 4PRPA 3BD4A 2JCCB 1G7IB 2NXZC 1HKLH 1CXIA 3UYOD 4N90D 3MRGB 4EUPG 3WFHB 5EPMA 4YHYC 1J8HE 2BRRH 3D18A 5I1HH 1OGAB 4OGAC 3VH8G 1TTGA 2MPAH 3VXPA 5KTEL 3OBAA 4UTBL 4KZDH 3ULVD 3T4AB 2D7QA 4UMGA 2MKLC 2DQHH 1BVLB 1JF1B 5L8KB 2O5YH 3O2WH 1QQDA 3V5HA 4AEIL 3BO8B 3V5KA 3KR3H 4KGLA 4DN4H 5CUSL 5JXEA 1A0QL 3BP6B 4RFOH 2E27L 4HZLA 5GHWL 4MWFA 1F4XH 2D7PA 2QSVA 4BQCA 1YEGH 4QT5B 4I5BB 5T1DL 4OGZA 1WBZB 5IKCA 5I8EA 2HVKA 4JRYD 4PJAB 2HVJB 4XCNA 4OIIL 3PHQA 5MERA 3GMOB 1NC2B 5DEFA 3DXAA 2EZ0D 1NGWB 4JFFA 3LN9A 1NGPH 1T04A 5HPOA 4HBCL 3QUKB 1P4BL 4YE4H 4NKOA 2MHAA 2YD8A 2EICA 3EHBC 5D1QB 2X4QB 5CCKH 5EU5B 3EYFB 4I0PA 2PCPB 4P9HC 3VI4F 4B53A 5IMOA 4YZFF 4K2UH 2ZKHH 5B38G 3UTSE 2X4RB 5HY9A 3H3KA 3L1OL 4CNIA 3O8XC 2IF7A 4P5KB 1CFTB 4XNZC 2GT9B 1CFQA 3CGTA 3DV4A 1MRDH 5AG9A 3STLB 3O9WA 2IAMA 3EYUH 3Q6FB 4ORGB 3GMNA 2XY1A 4X6DB 5KSAD 1EAPA 5I8CB 3MRLB 3INUH 1A21A 2J6EA 3Q48A 3JBG7 4OGYL 4RAUA 5GS3A 5AUMB 2X4NA 5C0BD 3VWKB 2XOTA 5AD0B 1HWHB 1Z0NA 4UQ3A 4BSVA 4JZJB 5ISZB 2L7JA 2DOCA 3CC5A 1MCRA 2FIKB 1DBBL 5E9DE 1KNOB 5MP6L 1RUKL 3HZVA 4V1DD 3FQTB 2ZG2A 4X4YB 3MLXH 1S3KL 1U8QA 3SJVB 1AI1L 3DYMA 4BKLB 4G7VL 4O2EB 3I9GH 3NN8A 5HHXH 3D1MC 4NQCD 5JXEC 3TWCH 5D5MB 2UWEB 3UJJL 4OZIB 5T3ZH 1GSMA 4NN6B 4JO3H 3VXUE 3F7VA 2FJHB 3F5WA 3KYMA 4OCLC 5FHBH 2ERJB 4MD4B 3IVKA 5IHZA 3HZKA 1NMBL 3TBSA 4ZAKB 1WFOA 2N1KA 3MLUH 1KCVL 1GHFL 4ZUWB 1PKQB 3MLTB 3QCUL 4FOMA 3HZMA 4PJFA 1IAIH 2WUBL 1WWWX 3GI8H 1F6LL 5EBGA 4WI3A 3LN4B 4KRPD 3S3PA 3O41A 3DMMB 5EWIL 4XCYA 1JZ4A 4I0PC 1OARL 4Q6YA 5E6ZA 4FZEH 1KJMB 3LH2H 1P7KB 4N8VB 1UM4H 2PO6B 1JPGA 5GRVK 3NH7H 1HWGB 3WS3B 3ELAT 4KXZH 4XWOD 3MREA 4EVNB 3O9WC 4RFEB 2IAMC 2GYSA 1J0JA 1ZVSB 3P30H 3CMOH 3VFRB 1NCTA 3IB4A 5SWZE 4OZFH 1FYTA 1CBVH 3HG1D 4JFOA 2AK4E 1JGUH 2YPVL 3WJLA 3MACL 4HAGA 4JM2A 3MRKB 3TVMD 3ZYJA 2QQQA 1HINH 1EJOL 3FHAA 4NPYB 4U49A 3RWIA 3TF7C 3NIGE 2V9RA 4HBQA 3S4SB 4N0RA 3JXAA 3OAYH 3FB6A 1AGCB 2Z31D 5TH2A 1OLLA 1QFWL 4GFTB 4UNVA 4K7FB 4LARL 1NFIB 2X9YA 4ODVL 5F3BB 5ILTH 5I6XB 3D9AH 1MLCB 1RSFA 4WI8A 4I3SL 5FCUL 1EJ6A 5HI4D 4MJ5B 5BRZE 5HHQB 3ZYIA 3THMH 5F6HJ 3MJ7A 3MYJA 4XP1H 4PP2B 3CFJB 1EHLL 3OAZH 4NRYA 1ULVA 2FEEI 3PWPD 3BHBA 4DZBB 3DJ9A 4RWYL 5SX5K 5TE4H 1QPPA 2KBGA 1PEZA 3C6SB 3CSYA 3PDOA 2H1PL 3FRPG 4Y19D 2YUXA 3EDKA 4MA7H 1NUDA 4LSSL 3F58H 5CP7A 2X40A 1CDYA 1YEIL 3MNZA 3BDXA 3VXME 2C4XA 4GAYB 1LO4L 3ALPA 3MLWL 4XVUC 1T66D 5EZJA 5DRNA 5T1KB 2A73A 4FS0A 5IVNA 2X4UA 3QO1A 5CINH 3PL6B 3SY0B 4DGYH 3D85B 2UUDK 1XF4A 3MRRB 3KPSD 1XEDA 3GHBL 4ZXBA 5GGSA 4R2GB 5I9QB 1MREH 2YPLA 3WJLC 4JM2C 2VTFA 4PS4H 4A6YA 1MCFA 4NSKA 1I7ZA 1BOGB 2AJYL 1KUMA 3MGAA 4M9PA 4MXVE 4S1RH 4S1DD 4X9FA 5AG8A 4J3UA 2RGSA 5C09A 4L8CA 2F74B 3GSVA 2A2QT 4NZUL 4OM0H 3QFJB 5IVZA 1CG9A 2H9GB 4PUBH 4RCAA 1RZGA 3QCVH 4PY7B 3C5ZD 1MHEB 2D7TL 2WQ8A 1UB6B 4ESKA 3EFFA 3E8UH 5DK0A 2WZPD 2VZ3A 4AH2B 3RWCB 3DUHA 2Q6WA 2NR6D 1JIBA 3ZTJH 3NPZB 1P7QD 2HFEB 5LGJB 1VPOH 4RIRA 1CS6A 3MCLH 4IOIB 5DUML 4Y16B 2YWYA 2JB5H 3PABA 3ZTNL 3KWWA 3MGTB 4PG9B 4YPGB 4NQEA 3UBXA 4OKVB 1OCWL 4Y88A 4QOKB 3O3DA 4JEGB 5HYSG 3OJDA 1D3CA 1RUAH 1CU4H 5A2FA 2V5MA 5AZEL 4GAFB 4NN5B 2ITDA 4U1KB 1YN7B 3CFBB 5FA3B 4Z7OF 5KBNC 1ITBB 2I25N 5I73C 2VDMH 1LP9F 1T0MA 3MRMB 1IKFH 4WFHE 3W2DH 1XR8B 4QHUB 5B39B 1F3DH 1MWAB 3P9LA 2HWZH 3OR7A 4FNLH 3UZVB 4BYHA 4EUPB 2F58H 1AQDA 2BDNL 4ZXBC 2B4CL 3CXHJ 4L4TA 5EBLA 4XPBH 2XQYK 4R4ND 3QR2A 3UAJD 1I7UA 1KEML 3KLAB 3WNPA 4ELKA 2F5BH 1E28B 1Z9OA 3CZFA 4NC1C 2NMSA 4XGZB 4PY8I 2DLGA 3BD3A 2YUZA 1YEJH 3JTSA 4RMRA 2BNRE 1BD2D 2RJMA 1FNFA 4U1NA 4YC2B 1ADQH 1A9EB 4FA8A 1F58L 1XGQB 3ZKMD 5TFSL 3MV9B 1BIIA 3U9UB 2BXYA 4A2LA 1TJHH 1H3PH 4RBPH 4Y5XA 4RZCA 2OZ4A 4PYHA 2R29H 3B2VH 5IMMA 3DGGB 2RR3A 2EDOA 2W9DL 1MVUB 5D4QA 5MEOA 3BPCA 3ULVF 3TJEH 3FZUC 1UVQA 4RGNE 5DJDB 3NCYP 4M48H 2V2WA 2GJZA 5JDSA 1P5UA 4P5TD 5B38B 5F7NC 5EA0L 4A2MA 3LPFA 1J12A 4JY4B 5KN5B 5D72H 1WEJL 1MCDA 2HLFC 3RNQA 3HE6B 3VXSE 4NOBA 3BSZH 1U3HA 2WAHA 4L1HA 1WCBB 1VFUA 3QXWA 5GRUH 2NY4B 1F6FB 5EOTA 2DQJH 1C5DA 3MRQB 4XP4L 3HI6H 1RZIA 2BNQD 3NFSH 1MCHA 1N5AA 1UEMA 1D5BA 1D6EA 5FFLA 3PQYA 4OLXL 1R5IA 4XBEH 2FATH 4CDHA 1QR1B 3I6KB 3ES6A 1DUZA 3NA9L 2W59A 1ZA3B 1PQZB 2CKBH 3SDDD 2ARJB 1CI5A 4G3YH 5D93B 1QBLL 2F19L 4EJ1C 4H26A 2JK5A 5DRZA 3E0GA 2VABB 2A1WH 4H0IA 4E41B 3TPKA 3DETC 2E7CA 4NQXB 4Y2DB 4M1CD 4JFED 3QUXB 3LKPB 3C5SB 4W4OA 1J1XL 1YY8A 3GJFB 4UQ2B 3V8OA 3KPPA 1KEGH 4OUUA 1JYVA 5JPNB 1RZ7H 3ORJA 3RZWA 1RVFL 2BVOA 4NHUB 3PWVA 5I2IB 3C5JA 1OF2B 1S7RB 3ARRA 3HNTL 1FQ9C 4GMTL 2H32B 4P2CG 3ZL4H 4ZTPL 1IC7H 2VDPH 5EUOE 3MV7A 4MNHA 3TYFA 3K80A 4XPFL 6CGTA 3MLZL 3U7YH 1JF5A 2E6QA 2W9EL 2XZAH 2P8PA 2VL5B 2JIXD 4PJHB 2OYPA 1T5XA 4JFPA 3JWDC 5C0GB 3OXRA 3RIFF 2AXJA 3O3BA 1TCRA 4AMKH 5IB4B 2V2XA 4JZOB 5GJTH 2AJVH 1HYSD 2EC8A 1M05B 3C60D 2RIKA 3CK0L 4N9GB 3SDAC 1J5OH 2GW5A 2Y6SD 5L8LB 4KK9D 3WEXB 5IEKB 1EPFA 5J9PB 3WHE0 1ACYH 2CR6A 1T2QL 4P57A 4ZODA 4P59H 2FSEB 1WLHA 5D7LD 1KPVA 1O5DT 3BGAA 2CLVB 3QI9D 2R2EA 5BVPL 3VXNB 1YQVH 5CZVL 4HG4K 4QY8B 4OD3H 1TTFA 5E7BA 2BFVH 3EOBB 3S35X 1KPRB 3EDDA 2XIDA 5E8EB 3NOIA 3CVIL 3R1GL 1OOAA 4J1UA 4M00A 1BEYL 1N4XL 4ZUVB 3VI3F 1LO3L 5E00A 4X7TB 3TBTA 2Q8BL 2IMNA 5EU4A 5IJVA 1ND0A 5DURB 1URLA 1JCKA 2J12B 1H0DA 2YD1A 4U0RB 1XMWA 1MFCH 2ICWA 4WTXA 1HH9A 2VQUA 4LPUA 2D2OA 3AU1A 3PWJB 1G9MC 3VWJB 3FFDA 3QG7H 4M5YH 2APFA 2BSRA 1KIQA 4HG4J 4K8RD 1BZQK 3GZKA 1YJDH 4BQ6A 1A6VL 4OI9A 3WKNA 5T1LB 3AB0C 3OMZA 3PHOA 5CILH 1CDHA 5D7JB 5CEXA 5CD5C 2YD2A 1H8OA 4JGJA 3V4VL 1FPTH 4LOUD 4X99A 4YFLI 3RWFA 4XVJL 1BJ1J 2NTFA 2VDLL 4NZDA 5E4EB 4F7EB 5JOEA 3SKOA 4IHOA 3VG0H 4JDVA 4YWGL 4BK5A 4NCC1 4GH7B 2P5EB 1FHGA 3TBWA 4ELMA 1GC1C 1XF3B 3GM8A 5DUBA 3QHZL 1UEYA 5T3XH 2AEIT 4ZPVA 1AR1D 3MJGX 3WDHA 3QZWA 1FRGL 2OTUB 2C7UB 1LNUB 3CLFL 4OQTH 2DKSA 5AAMA 4JVWA 4PRHE 3SKJH 2MQ3A 1WBYA 2G60L 1P4LA 1WQVT 4AIOA 2ICES 3T0EA 1C1EL 1A3RL 1G9NC 3MJ8A 2Z35A 3VWKD 5INCB 5IM7A 4YHKL 5T3XD 4G8FB 1QSFB 2AEPH 4UV4L 2HT4D 1RIUL 4F33B 2YZ1A 1SJHA 1KB5A 5F9OL 4ZDHB 4ODSL 1ZT4A 5D6CA 2XTJB 1U6AH 1HZHL 2K7QA 3QXTA 4JFHE 2WP3T 3ESUF 1JHKH 1A2YB 4X7FC 5DGQA 5HYSB 4OZHF 3D2UA 2BC4B 4PRAB 4FTVD 2NY6C 5DJXA 1JNJA 5HTSA 1T03H 1K8DB 4GW1A 4N1HB 5EFIA 4X4ZA 4JFYA 1UJ3A 5D96B 1E4XH 1LK2A 3DGCR 3WO4C 1MF2H 2CXGA 1BAFL 1F45A 3VXQA 3TFKD 4BQ8A 1C12A 4B7LA 4GRLD 5DYOA 4R4BA 5C8JA 5IB3A 3F7PC 1OP3H 2PYEB 1TZIB 3HC4H 3L6FA 5FYJL 1MIML 3KPMA 35C8H 3WIFB 3LVEA 2VISA 3L7EA 4ZAKD 1UYWL 4MJ2A 4WY7L 5B3JE 4KI5D 2Z91B 2QBWA 1BF2A 2DQEL 4MCZA 3X12B 3T4YA 3HUJF 4P5MB 4RX4D 4YR6B 1DQJA 1J0YA 2AJUH 3C87A 3VG9B 3BDBA 5F1KC 3AMLA 3O4LE 2OI9B 5JR1L 3UTZB 2P49B 2FD6H 1A02N 3WN5A 1B9ZA 3DBXA 3ARTA 2PO6D 2MQCA 5JZ7D 1HEZA 2JLLA 1R3JB 5HHOA 4MJID 4FABL 5C71A 3QNXA 1JN6B 4YO0B 3B4NA 3CFDA 3T0EC 5DD1H 5FB8A 5FOJA 2VXVH 3UC0L 4W6XB 1YA5A 3BEVA 5C08E 4QWWD 3FOLB 1YEFL 4S11A 1Z6JT 4FP8L 1NANI 1QFWI 3ZDXF 1ZWIA 4PV9B 4AQOA 4FQJL 3DUUB 1IMHC 3I84A 4ZMAT 2I9LA 1RZ8B 1FL6A 4U6XB 4GW5A 1CE1L 5GS2D 3BJ91 2YS4A 4MDIA 5I30H 4QGTA 4UIMB 1ERNA 4XXDB 2DWDB 1S9WA 3L5IA 2IGFL 1NJ9B 3G9AB 3T0VA 3B9KB 4LSQH 5C07E 5DXWA 5TJWK 3WXWH 5L9DL 4C56B 5KTEH 3MGOA 2VZUA 3MRJA 2NX5B 3BH9A 4ZTOL 3QDJB 3RA7H 5K9QI 3H7BB 1DE4A 4EIZC 5DA0B 4D0BB 4N5UA 4MAYC 4M3JA 1T6VN 3QCTL 3VDAA 2E27H 3TN0B 4AL8L 2HRPH 4XNQB 5CFHA 1W8OA 3MRPB 1LK3H 3WN5C 5E70A 2ORBH 4HFUL 4P2QB 1NDGA 3R0MA 3SO5A 1LEIB 3PL6D 5DQ9B 1UCTA 4N8CH 4L4VB 3MA9L 3IFNL 3D85D 2G2RB 5IHBA 3G6DL 5JQHC 5F1SA 4QRPB 4LHUG 4FFYH 5F89A 1AD9B 1H3VA 1UZ6E 1JGEB 1IM3B 3QJFB 1HK6A 4WI4A 3V5DA 2FGWL 1OAKH 3CSPA 4JN1H 3SKNA 4TUJA 2W0LA 1II4E 3IF1A 4U6VH 5EU6B 4XCCL 3U6RA 3KPRB 4C57C 1IILE 2W1NA 2UY6A 4Y4HB 1WC7A 5D2NC 3TNMA 4NYLB 1FFPB 2FBJL 4F57H 3RAJL 4P4KD 5KSBE 3Q6GL 4P3DB 4CJ0A 3GBNL 3TNNB 4MJ6A 5E94B 5FO8A 1C5BL 1LEGB 1KJ2H 3VRIB 3NGBC 4NKDB 3ZHKA 5D2LA 3QPXH 1IGMH 2Q8AL 2ZCLH 4OSUL 2WBKA 5GJSL 3FTGB 3V0VA 2ED7A 1T4KA 5L2KA 4PRDB 3QIUB 3FFCE 3ARZA 2C9AA 3X11B 2FCBA 1ONQB 4Y16D 4JY5H 2NZIA 1EMTL 3IJSA 1IEAA 5IW6B 1DFBH 4OD2A 5KS9A 4YDIL 4MVBC 1S3KH 3D39A 5C0NC 1QSVA 2VE6A 5MEQB 4G80A 1K2DB 3VXTA 1VEMA 2J8UB 1MWAH 4OB5H 3VJ6A 2VIRA 3D3VD 4EUPH 2C3VA 2MFNA 4TOYH 4X7EC 1J05B 1T1YB 4BH8A 1JP5A 3WE6B 2VXTH 3HMXH 3V6FA 1K3ZA 1IBGL 5F93C 2IFGA 1FIGL 1KTLB 5JDJA 1U92A 4ODBD 5F1IA 3WMSA 3HE7A 5KANI 4X0KA 1NCUA 1E4JA 1GHFH 5JHLH 4PJIF 2BCKA 1RUML 2DLFL 1Z5LB 4YXLH 2P4AB 2HKFL 4R7NB 1XIWA 3X13B 3KPTA 4R90L 1AH1A 1OARH 4LAQL 1CFSA 2DQFB 5IESH 1EUUA 4XPTL 1QSEE 4MSWA 1I7TB 3I02B 3K74B 4UNUA 5DK2A 5DF0A 3G6AA 3KPOB 2IANB 3TA3D 1GGUA 1IGJA 2EYRB 4ZOEA 4LLQB 3QUZA 1D9KD 4K94H 3MV9D 4OCNC 3I6GA 1XGRB 2JCCF 1PZ5A 4PTUB 4OLZL 2R0ZH 4LASH 5IFHL 5C0CA 4WW1A 2UZIL 3SGJA 4J12A 4AG4L 3HN3A 3PGCB 2XQBL 4JHAH 2QSQA 3ZE2E 2H2SC 4K7PH 3D6GA 4NO5B 3HFML 3WUWA 2A0LC 2H41A 1HXMA 2W0FA 3PDDA 3UO1H 1TVBB 2DB8A 1TJIH 1MHHB 1FV1A 2P5WA 1A6ZB 4K9EH 1TZHB 1RJZA 1QLRB 5EU7C 1QBBA 1OAZH 3W0WB 1CGVA 3W5MA 2K9UA 3B6SA 4ODHL 2X4OB 5DEGA 5I76A 5FCUH 3D0LA 4Q9BA 4XVSL 5EUKB 5L6YH 1WTLA 1MJUH 1FGVL 5F7LB 1HDMA 2FJFA 4APQA 2NY4D 3Q5YA 4PJAF 3OKLB 1K9TA 2BSTA 4KJPD 4PGBA 3ME0A 1V7ML 4LCWB 3HE7C 43C9B 3MA7A 2DJUA 4HUKB 4RRPA 3PG2A 3OKKB 3IU4L 3TPUA 2PF6A 3U2SA 1H3WM 1ZKAA 1XGPA 2PETA 3T3MF 3AY4A 3REWB 1L6ZA 3GJFH 3LKQA 4CUCA 1XIWC 3HR6A 1IC1A 4NRZA 2YEZB 5GGTH 5CIPA 1FZKA 5A2KH 4LSSH 3O6FD 3ZDZF 4KJYA 1LO4H 4IRSB 1NCWH 2N4IA 4X8JB 2WIIA 3S37L 3R4DA 1LWRA 3MPCA 4LSPL 2AEQL 1JWSB 1EFXD 4OCYL 4OCWL 4X6DF 1SEBA 2XPGA 3R8QA 2HT2D 3WHXB 5GS0H 1AXTH 2VXSL 1Y18A 4GAGH 5LWYL 3ULSB 5DQJB 1MEXL 2ZUUA 3BUYA 2QJDA 1CLYL 1K6QL 2DLIA 4LLUA 1JGDB 3EJZC 5K59E 1Q0XH 3SGJC 4X5WA 2CO7B 3HA0A 5ICZB 3VXOA 1MFDL 4ZPTB 4WFGD 4PD4K 4U1LA 1KCRL 4NZUH 1CXLA 4FQPA 1MUJB 1Q8MA 4JFFE 4GMSL 2OTWB 3G5YA 1RUPH 1YNTA 2VC2L 2XNAB 1FIEA 2ZOLB 2ZUSA 1ETZA 1ZSDA 5D5MF 2GTZB 3HPJB 2Y23A 2UWEF 5TGBB 4KJWD 4OZIF 1KOAA 4AIZB 5C0JA 4C83B 3DX9B 1I1AB 5GRYA 1NGXA 4TYUA 4APQC 4YGVB 2KQNA 3OAZK 5F9DC 3BIKB 1MCJA 3G04B 2P24B 4POZD 4NNPL 3Q2CA 4NN7B 1YY9C 2JJVA 5ALCH 5FK9B 5CJ5A 1CFBA 2XRAH 3AY4C 4KI5F 4PD4J 1VEOA 4JM4L 3OKEB 4HLJA 1NGZB 1FG9C 2VMFA 5E9DD 4HCRH 3H0TB 1QA9B 1JMZA 4U05A 2B0SL 1BFOB 1AJ7H 4RGMB 4EN3B 4YBQC 1G7JA 5GGVY 1P4IL 1UXSB 4P46D 2WBJB 4YDJA 5F9JB 4HS8H 5GRJH 4GS7B 1LE5A 1Q9LB 1MFBH 4ZFOA 3EAKA 5IV2A 4YDKL 4JJ5B 4HIHB 5ACMA 4ZQKB 4OT1L 3EFDH 2FEDD 3QP3A 1DJSA 1WITA 4FQXD 1RV6X 1XFPA 5TPWH 1X7QA 4HHAB 1DL7H 4ODXB 4WWKA 1UT9A 2GSGB 3PJSB 5T1MB 5LCVL 4HS6A 3UTOA 4YHZL 4O9HH 3LQAH 1BIHA 1VKXA 2A6DA 4U1MB 4H8WC 4FQ2H 4RNRB 5C0FA 2QQKL 4G8EA 1BBJA 2W60A 3VWJD 5J6HA 3ZT5A 3O4OB 4GRMB 4HC1H 5ICXA 4W4NA 1GCFA 3E1F1 4NZTH 2IPKB 3AMKA 3BAEH 4H20H 4U1SB 3VU2A 5EN2B 5FUZL 2HKHH 2OCFD 3G5ZA 3P4OB 4JLRA 4PJFE 1I8KB 2ZSVB 5T1LD 4HULB 5I75B 1Q94A 3SDXA 1JUFB 5E2TH 3RUGA 4N0CD 5TE6H 3NFPB 4M6NL 4YX2L 1A9BB 5A16A 3BQUD 3WCYA 4I4WA 4IMLA 2JJUA 4UOW1 3BP7A 5F6IC 3RNKA 2PW2A 5SWZD 1K8IB 4YQXL 1M71A 1S7VB 3H9ZA 1KN4H 1LD9A 2DJSA 2NY5C 2AJZA 5D71H 2BVPB 1DQQB 1K4CB 2P5ED 1NFDB 1CDUA 4F8QA 5L88L 5EA0H 4WO4D 1H15A 3QUYC 3TT3H 4P9HL 3RDTB 3QA3B 3V6ZA 3UYRL 4Y8AA 3GB7A 3UTPE 4Z18A 4XVTH 2D3VA 2NW2A 4WU5B 1YC7A 2QKIB 4GKZB 3GSNL 5FF6B 1F11B 3MRCB 4N5ED 4Z95L 3T0BA 3WUZA 4XB8A 4OFPA 1LO0L 3BZDA 4MZ2A 3TO2A 5JW4M 1QO3B 1YMHA 3FO2A 4EBQL 4WWKC 3NA9H 3QH3B 4G5ZL 1J1PH 2CIKA 3GMQA 1OSZA 1QBLH 4NO0A 2CDGA 1JYNA 5CHNB 1FAIL 2IALB 5E2VL 3Q0HA 2XTJD 3LDBB 4K71C 1FH5H 1EEZA 3PWNA 3DI2B 4M7JL 4AENB 1CT8A 3OPZL 3ROLA 3AS0A 1FZJA 4WGVB 3KXFA 2P43B 4QTIL 5HVWA 1CFNA 1WWBX 3LEYH 3RX8A 1P9MC 1U8JA 2XWBA 1A6UL 2O93L 2CXKA 2PYED 2E9IA 2W65A 3HRZA 5JUEL 4HH9B 4LLWA 4QCIB 4ZSOB 4PGCA 4XX1E 2R0WH 4ZO9A 1GGBL 2COQA 4OFYA 4AK1A 1JNHA 1RURH 4OGXH 3AFLA 3GMRA 4LGPB 4HWEL 2PR4H 2X9XA 5GS1B 1A14L 5EZOL 4HKZA 4HJJH 2H45A 4J23A 3IDXL 1KENH 1ZHKA 3FT4B 4PREA 2ZSWA 1MI5B 4NHCH 1S8DA 3L5XL 1CQKA 4TVPH 4M4RA 4DVBB 5J6GA 5SWSA 5TDOA 5C09E 3J7HA 4PJEA 1M6OB 1U9KA 2A6JB 4AT6B 2J6EL 4CU8A 4LCIL 1D5XA 1X5LA 4L3EA 3EDFA 1I1FB 1V5JA 5DVLA 3BPOC 4L8DB 3BKMH 4RWHA 1OAUH 5IQ7L 1RIHL 4IS6B 3LN5A 3ROOB 1FE8H 2G75B 3QQ9C 4ZUTA 2EDHA 1SJXA 4GKSA 4R4FL 2FX8L 3M45A 4JB9H 3BIAX 4F9LA 4FQ1H 5C92A 1A1MA 1FBIH 5CEYA 1HHHB 3QEUA 4NQEE 5LBSL 1E6OH 3M1BB 1KTKE 3N1QC 5IVXA 5IFAH 1F4WL 5DT1H 3VE0A 4ZNEA 4WFHD 2GK0B 2ADGB 3LSOA 3B9KD 1ZTXL 1PSKH 3SQBA 4C56D 3SCMB 5I1KH 1KC5H 4LIQH 1RJYB 2NX5D 1B0RB 4DEPB 3SGDH 1IM9D 4U0QB 2Z8WC 3WD5H 3NMEA 1CXFA 1R5WA 3N85L 2HN7B 4XX1G 2VKWA 5JW4N 3QEGL 3T65B 1X5ZA 2OL3A 5D70L 3QO0B 3OF6D 4GG6A 4HUUA 3MLPA 1MPAH 3TN0D 5DWUL 1R3LB 5INDA 4CMHC 2BNRD 4FXGA 5HVHC 2R8SH 2BNUA 5DMKA 5I17A 3BH8B 1ZLSH 4P2QD 4X6CA 4LSVL 4PJ8A 3P77A 3ARFA 4IRJD 1YN6B 4G6JH 4N0YH 2A6KB 4HGWB 1F5WA 4L4VD 1PY9A 5GIRA 3IRZA 4JREC 1GL4B 2R0KL 3F7QA 4QRPD 2DYPB 3PWUB 1VFOA 2ESVA 3IJHB 4F7MA 3CAFA 4ONFL 3IKCA 5DD0L 5EU6D 3KPRD 3G5XA 4ZYKA 4O58L 2DQUH 5EO9B 2O61B 3W5NA 4RGND 3S9DB 5FO7A 4Y1AA 4OD1L 4QHNA 2Y5TB 3MNWB 4GG8B 2V7HB 3OGOE 1DBKH 4F9LC 3IDGB 5D7IB 4ERSL 3E3QC 4OJFL 4HKBB 4LPTA 1GGIH 2G60H 3BEWB 2EE9A 3WFEL 4DGIH 1MRFL 2NY7L 2ADJB 3MLYH 3CVHA 1FZMB 4RA0C 4K7PY 1T22A 1N0XL 1CVRA 4O02L 3U36A 3C8KA 4CVZB 3QIUD 4NO3B 3L5JA 3VW3L 3GSWB 5A40E 5I1IH 4NNXA 1MAML 2VDRL 1HZHH 5FYLE 2HTLC 4GXVL 1UCBH 3FQRB 3GRWA 4OZ4B 4I2XB 1QZ1A 1MH5B 3P11H 2B39A 1AGBA 1N3NB 5I18L 2F54B 4MNQA 1S5HA 5BVJB 5FV1L 1U8IA 4HPYL 3PQYE 4JFQB 4ZS7H 4O2FA 4KROC 3O3UN 4PJHF 1HOCB 4TSCL 3QRGH 5KVFL 5H94B 1OTSD 3JTTB 1MIMH 3BKCL 2CUMA 1E27B 4PJ8C 1NLBL 3X3FH 1QQDB 1I4FA 2FH6A 3QXUA 3O3AA 2NNAA 2NPLX 1HSAA 4K23L 4HZLB 3HKFA 1R3IL 1T5WA 2CPCA 1CGSL 5IB2A 3BI9X 5I1EL 3H42H 3LZFL 2VLRB 4PY8J 5IROA 1FZOB 3F7RA 5KVDH 4A6YL 2N7AA 2HVKB 1A6PA 1RZFL 5MERB 4FRWA 5FYJD 3RGVB 3DXAB 1AFVH 4XI5C 1A6AA 4G9DA 3KJ4C 1QKZL 4EI5A 3FO0H 1T04B 4J3TA 3LKSB 5I1AA 1A4KB 1BQLH 4G9FA 5DJ6A 3UCRA 1R0AH 4YDVA 2Y06L 3OJMB 1U8HB 3QEHB 2VXUH 2B1AH 2IQAA 1B0GB 4I0PB 1EH9A 4POUB 4ZG1A 3CJJA 5CZXD 1VFBB 2Z0BA 4Z7NE 4ZUSA 5HY9B 5J3HD 3SE4A 2IFFL 4XPGL 2R4SL 3GBML 4MAUL 4FP8H 1A6TA 3O9WB 1D5ZA 1KPUA 4JKPL 3VFMA 4PRIA 3T09A 3PNWA 5KSVA 3W11D 2VQ1A 3HMWH 4Y0GA 1HHGA 2X4NB 3W0WD 1CE1H 4TNWF 4KHXL 3MC0A 1NBZA 5HHVL 5HYQA 3AXLA 3S35H 3V4UH 1QBAA 2H3NB 1UWGL 3CC5B 4HMEA 3X3GL 1RZKH 3IFOB 2EECA 2JJSA 5A1AA 4PJXA 4Y5VA 3CNKA 1D5IL 1U8QB 1X5IA 3QDGA 4LCWD 1DN0B 1KT2B 5EOQL 4FQCH 3MRHA 1GPOH 1W8NA 5EZLA 3M8OH 3QJHB 5FOBB 2NXYC 3BDYL 1RUQH 4TPRL 2WK2A 3KYMB 5IROC 5IK3B 2BSSA 5KOMC 2ITCB 3C09B 3IVKB 5IHZB 4WEBL 2KUTA 3QDMB 4MQ7A 2LABA 1E4WH 1FLRL 4HFUH 4EI5C 3KYNB 5CBAA 1IT9L 1CICA 3MBEA 4MS8C 5GZND 3HZMB 3EYSH 3N0PB 5E8DL 3IDMB 3MA9H 3IFNH 1EEUA 1I9RH 4KQ3L 1HCVA 2J3SA 4XHJD 25C8H 3WIHA 1M1SA 5C0AB 5JIKA 1PJ9A 1B4JH 1JJUA 4F2MA 1ES0A 2EYTA 2OZ4L 1FCCA 3C6LB 3SE4C 1UM6H 3JV4A 4UT9L 3C08H 1KB9K 3MREB 2VN4A 4LLVA 2BOCB 2FBJH 3RAJH 3IXAB 4Q9RL 1L7IL 2CUHA 4R7DA 3VFGH 2AK1H 1C5BH 2P46B 4TRPL 4CMMB 2R4RL 2DBLL 3RWIB 3JWDL 3UMTA 4E42B 1YNLL 3QRFM 4ELME 1BMGA 1T83A 3ZT7A 4NDMA 2JJSC 5FYLL 5ESAB 3AGVA 3BPNC 5E4IA 1JZ8A 1V3LA 4LVOB 4Y5VC 5E1HB 3P4MA 2XYCA 4G6ML 3S96A 1IC4L 1EMTH 1CR9L 2HG5B 2L7UA 4YHNB 5B4MD 1KB9J 5CSZB 4S10A 2VO5A 1EV2E 1KG0B 1Z0MA 5E8PA 4PG2A 5CWSB 1NAMB 5IHUL 4EOWH 4LRIA 2YD3A 5J12C 2ZNXA 5JOFB 1Y6KR 3L3OA 4GSDL 4RAVB 5JW3L 1N6QL 3D69A 3V6OC 5IWLA 4Y4KD 2EIZA 2F53B 4BUHA 3KS0J 3MJ7B 3O11B 2WBJD 1WZ1H 3PP4L 4M7ZC 2P8LB 3H8NA 5FCSH 5FV2A 1G9EA 1CICC 2PXYD 1I1YA 3PXJA 1GAFL 3MBEC 1BLNA 2B20A 3D5OF 1W0VA 4LPXA 3LV3A 4O5LL 4C59B 5IMKB 3QIWB 4QTHA 4RISL 3PDOB 1I9IL 4Y4FA 4EDXA 2DLFH 1ZK9A 2Y1VA 1OSPL 5DFVD 1IAMA 2DDQL 2YUWA 4BSWA 1EHXA 1F42A 1I1CA 1G0DA 5I73B 1CK0H 1VCAA 3O6KH 5L0QC 4LAQH 1VADB 3VGAC 2ICEA 3LEVL 3MMEA 1G9ML 4Q0XL 3C8HA 2X5PA 4L29B 3VMNA 1XF4B 4RMUA 2AV1A 3O6LH 4AEHH 1KSRA 1OQXA 3GSUA 1QACA 3OX8B 2AV7A 1OPGH 4ZXBB 3CUPA 4M6OH 3MCKA 2VSDA 3UROR 1CFVL 4XCFL 2NQCA 3N50A 1Y6MR 4UDTA 3Q1SL 4YHLH 3WFBL 1RMFL 4ZFFB 5FA4B 3OSKA 1F13A 1W72A 5FO9B 4LHUD 2YC1B 4GRWB 4M43L 3QZWG 2VXQL 2VLJA 4MA8H 1OGTA 3IFLL 5I71B 3HFMH 5HHOE 2ZP0T 2GUOA 5HD8D 4LHQB 2YRZA 1WZKA 1I3GL 4NQDA 1GC1L 1BECA 3B8SA 4Z76A 3MUJA 3RDTD 2EIEA 4YXHL 4LRIC 2XZCL 4DFIA 3DSNA 4HUNB 1GYAA 5IWLC 4RIRB 5D9SA 5SX4I 1RK1B 1KF9B 1MNUH 2BJMH 4Z0XA 2H8PA 3QIBB 3S3SA 4I13B 2EXWD 3HC0A 4QRQA 4UAOB 1RJCA 3W39A 3IU4H 4HX1B 1IL1B 1KFAL 4D0CB 4Y4FC 1G9NL 3BKYH 2A9MH 2IEPA 1CXHA 2DRUA 3DX8B 5E8NB 2ITDB 4HUVA 3NZ8A 4KPHH 3IDYB 2ZJSL 3NCYS 3VRJB 1T0MB 3QDHA 5ERWB 1U3YA 2WSKA 1N59B 3OR7B 2H6PB 1SJEB 4LEXL 3ZDYE 3VRLF 1A7NL 5DJ8A 4L4TB 4DZ8A 1SYSB 5DMYA 2E7MA 2A74B 1KIPB 4M8QA 1UM5L 3P4LA 4K3EH 4MMXC 4XMPH 4MB4A 2UV3A 2V7NB 2YOCA 4ELKB 2OQJA 3CZFB 5C0IA 1G6RH 1MEXH 5JHDA 1CLYH 5F8QC 1HQRA 4PJDB 1AXSA 3MZGB 3V2AR 1T1WA 3HS0A 3VFOA 5C6TL 4L9LB 3Q3GB 1K4DA 2VAAB 4M8VA 5H35A 3K2UL 1J8HA 4YEEA 4NUGL 1QRNA 4GOSA 2J8UF 2IH3A 5F9WB 1NBVH 4ODTL 3ARBA 4RMWA 1DLFH 3VGHA 2VLKA 5DRXB 4JPIA 3DTXB 4H25A 1K3IA 2D0HA 5MHSE 4P9ML 3MR9B 2C1PA 3TESA 5E6IA 2AERT 1HHIB 1WVZA 3SO3C 5L8JB 1S7WB 1JMXA 3ULUH 3JV0A 3N1PC 4FQLL 1KBGL 3GJFK 3WLBB 5J11B 1NLDH 1DQDH 1EERB 5C86A 1LHZA 3I85A 4CN4A 4YLQT 5JLZA 5DZNA 1KB5L 5ACZB 1UG9A 3IGAB 3SDAB 1TZGH 4PJ5D 1PG7W 4GAJL 5L2KE 4KV5F 3IFPA 1N5AB 5JORA 4UI2A 4X7SH 3U30B 3ZE0E 4BK4A 3IKKA 1IC5L 3N9GH 4PJCB 4ZFGL 3EJYC 3UXFA 5KS9E 3FQUB 3H9SD 3QUMA 1BWMA 2YSSB 3OG4B 4JN2A 1LP9A 2OSLB 1JGVL 3ZZ1A 5KVMC 5A2LH 4HWNA 4HIXL 5EU7E 2Q7YB 1FFOA 2C26A 4DUVA 4Q74A 4D8PA 4MNGA 3HNVH 4KQ4L 5KVEL 5D1ZA 3HAEA 3GMPB 5MENA 2NXZD 5AZ2L 1XCTB 3NABH 1DBAH 1TNNA 2BHZA 4R9HA 3OXSA 4HK0B 3MUY1 2R1XB 4LVNC 3ARBC 3MXVL 1ZGLM 3U1SL 4U6HB 3SOBH 4PR5A 2IH1A 1T80A 4DAGH 3G6JB 1BZ9B 4X9HA 5DD5L 5E6IC 4QRRB 1OAQL 3SPVB 3MV7B 1VGKB 3TYFB 2HP4A 2VWEC 4AM0B 4XHQA 3U4BH 2DYPD 4CKVX 1F02I 4LK4A 1L0YA 4U1JB 2Z8RA 4PJGB 4OCXL 5JIIA 1T3FA 2ZUXA 1KCLA 1Z9LA 4P9HH 1TCRB 4MCYA 1Q9OB 2PYFB 3UYRH 1ORSB 3QWOB 3AC0A 2C3HA 2GJ6E 1JGLH 4ZUUA 4FG6C 3JV5A 3DO7B 5JXAH 4DUXA 1FN4A 4U2YA 3ET9F 4MYWB 4YXKL 1VHPA 1U2CA 4KKLC 1FL3A 4YHIB 4I3RH 4LKCB 5DR5H 1RZJH 3EHBD 4MHHG 2QR0B 1N7MH 4JRXB 1MAKA 4JRYA 3CFEB 3MOBH 4OIBA 2BVQA 2UYLB 2P5WE 3SDYH 4DW2L 4PGEA 1N26A 3DUSA 4I9WE 2R2BB 2DL2A 1FAIH 1LO2H 2A83A 5JOPE 4GKNA 3SEPA 5DSCA 4PRPD 5D1ZC 1YECH 2HJLB 3OPZH 1X44A 2VLME 4J1UB 3RL1A 1MCIA 3ZE1E 5HGHB 2D0GA 1R3HA 1F3JA 4XC3H 5BS0B 3WFDL 1DBML 3BWAB 4IDJL 4MA3B 3BZFA 2XZQL 4D9RD 4G6FB 3QULB 2DQDL 1A6UH 1H0DB 3IJYA 4OLUH 1FO0B 1I8MB 2JB6B 3P3YA 4IIQC 5JQ6H 3FJTA 4R0LA 3ZKNC 4Q6IA 5SWQA 3RGHA 4JJHA 3GUTB 2BSRB 4CJ1A 4K3DH 1QLFB 5E99L 1U8KA 1MJ7L 1F4HA 3STBA 4P23A 5DO2C 3MO1B 3TO4A 5IBTH 1FVEA 4QRSA 3ARUA 4XPHL 4BZ1L 3MZTA 1LGVA 5B8CA 3MV8A 4E5XB 4JDTH 5FGCE 4OZGB 3DXAD 5EZOH 1J1OL 1FL5B 3GSQB 4NUJB 1IAKB 1D7FA 2PTTB 1QFWM 2MCPH 4LCUB 5HGAA 3VCLB 1MVFA 4NQCA 2DM7A 4PB0H 1U8MA 4X4XA 3SKOB 4UILL 1W0WA 4OFKA 3LY6A 5TDNA 3U7WL 5K9JL 4XH2A 1JTTA 2DTML 5DRWA 4I0PD 4LCIH 4NQTA 2P47B 4LCYB 5DUBB 2EZ0C 43CAA 3PUCA 3CD4A 5IHLB 2Y36L 1NEZG 1WIPA 4FFZH 3UBXI 2APTA 3TZVA 3O9WD 2IAMD 2DIAA 5HDBE 3O3EA 4GBXB 3WNOA 4U1HA 4I18B 4LKXA 1P4LB 2XA8H 4F3FB 2CGRH 5DA4A 4JFXA 4RRPG 3MUHL 1OTUC 1JNNH 1H5BB 1S5IL 4WIQA 4HWZB 1F97A 1RPQA 2EKSA 3A6OA 1KB5B 1INDH 5GSRB 2J2ZA 5D6CB 1G7LA 3SGEH 1NFKA 5DS8B 2ZOKA 1ZTXH 4P2RB 4R0LC 4Q6IC 3BP4A 5J4MA 3J8F7 3CFIC 4XMLH 1FNGB 3WDIA 1D6VL 4UB0L 4BA8A 2CMRL 3QEGH 1MFEL 2IBZX 3L9RB 4ONHB 4P23C 3TVMA 3IRPX 1E0OB 2ZWLT 5HHMD 1EXUA 4XCEB 3TO4C 1C12B 2DAVA 4Y8DC 5F88A 5C8JB 3VMOA 1R3KA 1J11A 5B8CC 1NFDF 2FH8A 4BFBD 4L8BB 5EC1A 1A7RH 1ORQA 3EYOA 3UJTL 4QNPF 2Z31A 1VGEH 4OZFA 5D8JL 3FQNA 1IGTB 3TT1L 5CJBA 1ZT7A 1UH2A 4MAYB 2P7TB 3OWEA 4JPWH 3GHEH 5F7DB 4L5FH 1DQJB 1NAKL 4OFDA 5MI0C 3CLEH 3ARPA 1S9XB 3T2PA 4BFIB 4WRLA 5JNYB 4QXUL 3PGFL 2NY0C 4V2CB 2EDWA 4KHTL 5I66A 3W9DA 4XVUD 1HEZB 1RY7B 4Z0BH 5ITBL 3W82A 3TZVC 4MGXA 1PD6A 1HI6B 4WUUB 2DMKA 3ARGB 5CGYD 4X98A 5T33H 4MX7B 2GK2A 5SV4A 1FYTD 3CFDB 3OKOA 3BN9C 5BO1H 5EDXA 3JV6A 4JM2D 3BEVB 5CMAA 5GSVA 1AHWA 1EO7A 4PB9L 3WFEH 1MRFH 1NAMH 1LO5A 4HGKC 5IW1A 5D2NB 2JE8A 5TE7H 2BK8A 4WVRA 2CLZB 2R9HC 3OHXB 5L7XH 3U0PA 4WHTA 3WL9A 1T7YA 1YEEL 1WICA 2J4WH 5AYUL 1MIEH 1FDLH 4S2SA 4GW5B 5DQDH 1LE9B 1HN1A 4Z5RA 2Z4QA 4MDIB 3RX7A 3FHQA 4ISVB 3TVMC 1B6DA 3RTQA 5I18H 5C0EB 4Z7UB 1WUNT 4CADB 2XWTB 1ZV5A 4KKCC 1Q1JL 5HYJB 1A3LL 1BBDH 3SN6N 1MHPH 4LF3A 1DR9A 1SEQL 5L2JB 3HR5B 3BZEA 3FQWB 4OZHA 2DJ4A 4NWTL 2VDOL 2WWMC 2ENYA 3VFWA 1TQBB 4X5XA 3C5ZA 3BYTA 3P4NA 4U7MA 5E8OA 5GGUA 1S7UB 4LHJB 1U3ZA 2UUDH 1AE6L 1NDMB 1SYVA 4XRCA 4P2OA 3H9HA 1WBXA 3BZ4B 1MJ8H 5F96H 3KXFE 1P7QA 3UTTB 1NUNB 3LD8C 3VGEA 4H8WL 1JZ3A 4HK3J 1FGNH 2OLDA 1HNGA 2CJUL 3HC3L 5I8OH 3P73A 4Z7QF 1JYWA 1UWEL 2BVTA 4P48A 4WCYH 3UTQA 3ULUF 4GRWH 5A43C 3E6FB 4U3CA 4ZXBD 2Q76A 2YXFA 1FNEB 1ZT1B 1AIFA 2YPLD 3GI9H 3SKNB 5TQ0L 5I1DA 3T1FB 3GSOB 1HH6A 1KJ3L 1T66C 2MKWA 5HPMA 5C9JB 3V0WL 5C09D 4OLWL 1FNSL 1TJGL 2X7LB 4PJ9A 1B6UA 2EEDA 4JKKA 3ARDA 2XN9E 12E8L 3FN0H 5DHXB 2FZ3B 3F12A 2NY5L 1HIML 3L95A 5ABDE 1UKQA 5LAXA 1IARB 2V2TA 5SWSE 3AVEA 4X80L 5J13C 5D2LB 3RTQC 2X70A 4PJEE 2DBJA 1R5VB 4LU5H 3CXDH 1C7TA 3MROB 3LKRA 1MCNA 1CGYA 3DO3A 3DVFA 1CXEA 4DTGH 4KTEL 1Q9KA 3WSQH 3I6LD 4KUZL 3QIBD 3D39B 1D5IH 2CK0L 4ZFOL 4NQED 4G80B 5AWNH 2IG2H 4KJQC 3FO9B 4P2OC 2BHUA 2YBRA 1MELA 5DMJB 5C0DB 5K9KB 5E08H 2HLFD 4DQOH 1GJIA 4WUKL 3MOAH 3A6CL 3S8WA 4BZ2L 2ICWI 4HEPG 1ZLWK 3MFGB 4XWGL 1ADQA 5IVXE 1ZMYA 5HGBA 4ZNEE 2F53E 4JKLA 4R96A 1HQ4A 5I1LB 5T5NF 5F71A 5TF0A 2Y72A 3RIAK 4LLAA 3BE1L 5EULV 3STZB 5F3HA 3U4EB 2BCKB 1OB1B 4L4TD 4U2ZA 5I1GH 5I74B 2FBOJ 5D7IF 5C0BB 3MLSH 3S36L 4GG6E 4JZNA 5F1NB 2X2YA 3DETD 4JPKH 2DN7A 5FUCC 4HV8A 1TCMA 2HFGH 4V1DB 3Q5TA <