1VESA

Structure of new antigen receptor variable domain from sharks
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLPLGDYNYSLLFRGEKGAGTALTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords New Antigen Receptor variable domain
publication title Structural evidence for evolution of shark Ig new antigen receptor variable domain antibodies from a cell-surface receptor
pubmed doi rcsb
source organism Orectolobus maculatus
total genus 24
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vesA00
3TT1H 1MLCA 3JWNC 5D7IA 4UQ3A 1JPSL 1JYNA 5HGGS 3QSKB 5C0JA 4N0YL 3O45B 4YDKL 3BO8A 3SKOB 2DWDB 5A2IH 1QHOA 3JUYA 5F1NB 3BH9B 3AY4C 3GEWB 3B9KA 1G9MH 2EIZA 2PCPB 1BQLH 3QPXH 3BP4A 3IB4A 3VFGL 5HI5C 4KK9C 2C3VB 4KQ3H 2OBGA 2OZ4A 2NY3D 2X70B 5FM5M 5GGTH 1SYSB 4M48H 4G8GB 4LSQL 5I66A 4U1GB 2CDEB 3DURB 3ZDYE 5L7XL 3ZHDA 4JO2H 1P7KB 1QFOA 4UILH 2DIBA 3AM8C 4MZ2A 1NDGB 1KIQB 1TTFA 3QUXC 4JFEB 1ES0A 2VDRH 3QNYA 3KYMB 1T3FB 3BH8A 5C6WH 1B0GA 5D5MB 3O9WD 3CK0L 2DLHA 2VLJD 4PIRF 1NANH 3JWDH 4CADB 2E6QA 4JFXB 3BQUC 4NOBA 5F9JA 4NJ9H 2Q8BH 1QFWI 1YC7A 4L8CA 5DJYA 5DTFB 4NQVB 4NQCA 3U1SL 2CDGA 1HH6B 5CJOL 3D25B 1X7QA 4N0UE 1DDHB 1CF8H 3VFSA 1S7SA 3BWUC 2NY2D 4PFEA 1YY8B 3F6LA 5BRZE 4G5ZH 5DRZB 1VFAB 4OLZH 4GQ9H 3WIFA 4LLQB 4FFYL 1YJDH 4MB4A 5FEBA 4WENB 2FD6H 4TTDD 5T5NF 4CVUA 2JKXA 5DRXB 3VXMD 2R1WB 3S5LB 4GBXA 1MFEL 1CL7H 3EYQD 3ECBB 3B5GA 3PIQB 4MJ6A 3VWKC 3B6SA 3IETA 3MLSL 3PWVA 3VWKB 4FQ1L 4NBYB 2FJHA 1QO3B 5L6YH 2G2RA 1TVBA 3QRGH 4MAYD 3WUZA 2X4UA 3VGHA 4AZ8A 2IF7A 2JJVA 4GSDL 2A6JA 4GW5A 1S9YB 2CIKA 3IJSA 5EULV 3D39B 1LVEA 1EIBA 4X8JA 3RWFB 1NGWA 2Q7NA 1I8KA 1KB5A 2R69L 1NBVL 5ANMB 1M1SA 5DMIL 1II4E 4M6NH 1IKNC 3L3JA 5IEHB 4E41D 4TNVF 5C07B 4F2MA 4NO2B 3QHZL 5GXBB 2XZAH 2A6IA 2GYSA 2Z4QA 3MA7B 3OHXA 4IDJL 3PL6C 5IMLA 4XWOC 4HH8A 2FZ3A 4NFBA 1DUYB 4NO3A 5EBWA 3SDDD 2ICWJ 4YZFE 5EU6B 3EO1B 2IQAA 1L9NA 1MCDA 5GS2D 2OK0H 1FFOB 2V9QA 3I3EA 3BIAX 4TQEH 2ORBH 4QXWA 1BD2D 3MNVA 4RAVA 2A1WL 1FH5L 3T04D 1JGUH 5DJ8B 1VEOA 2QHRL 3OG6B 4Y2DC 5TDOB 1IL1B 2EIEA 1WC7A 2GJJA 4PJAE 1KXQE 3TJHC 4BH7A 5D6CA 4DZ8B 1UCBL 3QUZD 4HS6A 1MIMH 3BKYL 4JM2B 4ZS6D 1HHIA 3GMOA 1OPGL 1WQVT 3NCJH 1X44A 2YXFA 2H2PD 3QA3B 2VZTA 4P2RA 2BSSA 5D8JH 2F54E 4M6ML 1RUAL 3QJHB 1CFBA 5FHBH 3AU1B 2ERJC 4NQDB 5DVNA 3LN9A 5FYKU 1CGSL 1CICD 5F7EL 1O5DT 1MNUL 5SWSB 2G75A 4BQBA 3T0EB 1CGTA 3C5JB 3G5ZB 1NJ9B 3LKNA 3BN9D 4OZGE 1R3HA 2W38A 4Y5VC 4PS4H 3P0YH 4O02H 4Y5VB 4AQOA 4JR9H 2ZCKH 3OAYK 1BIIA 5TE6H 2ADGA 2YD8A 5D7LA 1WBZB 3ZE2F 3QO0A 3PWPB 4KTDH 4OBRA 4X6EB 2EDLA 1H15B 2YD1A 4U6VH 1NCCH 1BFOB 5E2WL 5GJSH 4W6XB 1CLCA 4XP9H 4MNHB 3P73A 1ZHKB 3MV9E 3ULUF 2UY6A 4K94L 2R2HB 4XP4H 4OFIA 2J88L 4R8WH 4PTUA 3VXUA 1ZLSH 5IR1B 1A4KB 4TPRL 4PJCF 1A7QL 2XT1B 5EUKB 5HHVH 4N0FA 4WUUE 4PJ5E 4NWUL 4HCRA 2X4OA 3I84A 2UYLB 3SY0A 4HK0A 2ZUSA 3MMEA 1XZ0B 3B9KD 4KMTH 3B4NA 1BECA 1W72L 3RKPA 3IU4L 1BQSA 4RFEB 1MCLA 5GRUL 3KYOB 2DDQL 3EFFA 3AREA 1KJ2L 4FZEL 3ULVL 3M17A 4RAHA 4B7LA 1IC1A 2J7LA 2VE6B 4PRAB 1DBMH 2EDWA 4LLUB 4LDEB 4MWFA 2X9XA 3HZYA 4DW2L 1RD6A 1KEML 3P0GB 4ENED 1GXEA 4NHUB 5F89B 4YXKH 3QXWA 4GS7C 3U7WH 4O4YL 1NCNA 1KEGH 4F58L 1DE4B 4RGNB 1MRFH 4H25A 3O2DH 4UOW1 5KZCB 4N0RA 3O41A 4KJWC 5HGHA 4NQCD 4WV1C 2Q3ZA 4OLYL 2IH3A 2CRYA 4XI5D 1CFVH 5T1KA 1RY7B 4QRQA 3ZLQC 3NZHL 4M62L 5KANI 1AGDA 4BELD 4U1HA 1KBGH 2XFXB 3KPLB 1T1ZB 3VFVA 4QXUL 1VFBB 2ILLA 1YDPB 2GJZA 1PDKA 1PSKH 1OGTB 3VFOB 3BVNB 3SGKC 1P4LB 4AH2B 4GBXD 5JDSA 1ZVHA 4JVPA 2ZG3A 4LNVA 2PTTA 1KLFA 3KPOA 3R0MA 3HI6H 5BRZA 3UTZB 3GSRA 2VDQH 1Z3GL 4U1MB 3LDBC 4QKXB 2VR9A 3C9NB 2C1PB 3WSQH 2B1HL 5DC0A 4JRYB 5T5FH 1RJLA 1S7VA 2YD3A 4FABL 3RVWD 3IDNA 4KUZL 4QY8B 4FQLL 4K8RC 1A02N 1NAKL 1QBLL 2V7HA 1FL6A 1AHWB 4Y88A 4KY1H 4TN9A 35C8H 4P99A 1IFHH 2YEZA 5GS3A 4LL9A 3RIAK 1PFCA 4LQFH 1E27B 5AZEH 5TH2A 3WO4B 3FONA 1P4BH 2AJSH 4NRYA 2IANB 3RNKA 2DM3A 2E27L 4X6FB 3FN0H 3L5XH 3CC5A 4IJ3C 2DQCH 3MFFA 4IJ3B 3GKZA 1T7VA 1OTUC 5KOMC 3OKLB 3U46B 3QZWB 5C8JB 2DQIH 2C7UB 2PW1A 4NKMA 5GSVA 1CD9B 5GRWA 5DWUH 1HSBB 3HZKA 1PBYA 3FL7A 2DN7A 1QA9A 2LU3A 4HWNA 1ZHLA 1CK0L 2APVA 1MCIA 3FQXA 1SY6A 3V0WH 3R1GL 2QADC 5AEAA 5BQ7B 4HGMA 2DL9A 4WEMB 2QADB 4P2RD 1OAQH 3ZE2E 1MEXL 4PJHB 1K4DB 4LKXA 1MCBA 1UFUA 4KH2A 4JB9L 2FO1A 3RZCC 1IGTB 3BWAA 5CCKH 2Y4SA 4A6YB 3ULUE 5DGQA 1ZTXH 4RFOL 3I6KA 4F7CB 1OP3H 1J1XL 4ZQKA 3JV5A 1B0RB 2WAHA 4PJCE 5D7LD 1OCWH 2F54A 2CK0L 1N59B 4X4ME 3VE0B 1N6QL 1U8OA 1FVEA 5JW3L 4JDZB 1T2JA 4IMLA 3L5WA 3O4OC 1TVDA 4M02A 4BFGA 3I02B 3FB7B 4OZGA 2Y5EA 3V7AG 1WVZA 4LIQE 1LK3L 3ALPA 1U8KA 5F1OB 1OAYL 1F45A 3L9RA 1K2DA 1KJ3H 2ZNWA 5IJKA 5HHNB 2BNQE 5HHOA 3IFLL 2W65B 3RGVA 3UAJD 3VXUD 1I3VA 4E42B 4ELMF 2AK1L 4H20L 2HWZH 4XVJH 2DTML 1MVUB 5CS7A 3OXSB 3VW3L 5FA3A 3TNNA 4CN4A 1EBAA 1EZVX 5CZXC 4MD4A 1CE6A 5B22A 3SDCB 1CXLA 2F53E 4I3SH 3MV9A 4JRXE 3C6LB 5E2TH 4WI3A 1AIFB 4N68A 1P9MC 3CH1A 4P5TB 4KAQL 1FNSL 3J8F7 3P9LA 2GITA 3G6JB 3VXTA 2Q76B 4WUKH 2FSEB 1N26A 3ARED 1SM3H 5D1XC 4EDXA 2H6PA 4FQIH 1X4XA 4L8SB 3BPOC 4AG4H 2AW2A 4WUUA 1QKZH 4PJ5A 4YPJA 4MDIA 4OF5A 3TCLA 2A0LD 4U6TA 1M4KA 4DUXA 4O2FA 3FRPG 4TVPH 3GM0A 4MD0B 4M3KB 4NBZB 1TQCB 1FNGA 2LAGB 4P2CG 2XACC 4JQXA 1HSAB 5DR5L 1BHGA 1RUPL 2ZCHH 2ZOKB 3VFRA 1ORSA 3QQ4A 4NSKA 5IMMA 3L7EA 2NY0C 4F9LA 4LASH 1D5BA 1UVQB 3OGOE 4TOYL 1TCMA 1YNTB 2FGWH 5DK3A 5DVOA 4D9RE 5EU3A 3EYSH 3QFDA 4WGWB 1NBZA 3WHXB 3GB7B 4MS8D 5EU7C 4J8RB 5T1KD 3WEXA 4HIHB 3BZ4B 4DUVA 5BV7C 3P77A 4IOSD 4OT1H 3MOAH 1YN6B 3OB8A 3UPRB 2DLTA 5E6YA 4LVHC 5IM7A 5ACZB 2AEQL 3UTSE 2JF1A 3EOYG 4LVHB 5F88B 3K1DA 3ZYZA 5C0AB 2I5YH 5HHME 4N0CC 5CP3A 5F70A 3RIAF 4UBDC 2AGJL 4JFDE 4YHIA 5D2NE 5JTWA 4GKSB 1X5FA 3LHPH 1H3TA 4EDWH 3U7YH 5BRZD 3GMRB 4WTZG 3SJVE 1HHGA 2VWEE 2ZSVA 3DNKA 1PKOA 3GSOA 3LMJH 3GUTA 1JZ4A 5JORB 3MYJB 5EU7E 2PR4L 5I16A 1U2CA 1YEIH 3FCTA 3HS0B 5IF0B 5IBLD 4HJGA 4U49A 1D6EA 1S78D 2EH7L 4YHZH 4HS3B 4HBQA 2ZOLA 2AEPL 2PNDA 4PJ8C 5A3IC 1CVSC 3RUGF 3VXQA 4PJ8B 3DMMA 2J8OA 2KDGA 5GGTA 2AKRA 1RZKC 1DLHA 1U93A 1URLA 4JDVB 4AK1A 1ZXQA 2WUBL 2PYFB 1QFWM 5E2VH 5JW4N 5D1ZD 5HDOA 4ODBD 5HYSB 1G7JB 2NYYC 5JR1L 3QEQE 1FE8L 1HCVA 4NC2B 3RWGB 5GSRA 3TZVC 3DRQA 4K55A 3V4VH 3NA9L 4PV8A 1H3PH 2PN5A 3TPUB 2A2QT 4K3JL 3M1BB 1ND0A 1WFOA 2AV1B 2YKLL 3HMXH 4OF8A 1Z5LB 1EHAA 4ZSOE 5DJXA 3U36A 3W9EA 4OCSL 3BP7A 3O9WB 4I5BA 5IVXB 2VLJB 3B3IB 4MQTB 4NRXA 1DQLH 4ZO8A 4X7EC 5LAXA 3GIZH 3TYFA 3L5JA 4ODHL 1U8QB 5I18L 4ZUUA 1KLUB 4HGWB 1P6FA 1DLFH 1CG9B 2W59A 1JZ2A 3KJ4B 1QEWA 6FABL 4JZNB 3TO2B 3O3AA 4FQXA 2EYSB 4UDUA 4FQHB 3IFOA 5TDNB 2OCFD 4LHJB 4Z95H 2NY2B 3MLVL 2FDBP 2ZSWA 3PV6B 1S7XB 1T2XA 4PJDF 1CVRA 1UXSA 4ELME 2W0FB 3SGEI 3VXMB 1J5OH 2F54D 4AIOA 3QNXA 1PKQE 4OJFH 2ICWA 5HD8C 4RFNB 3GMQA 1U9KA 1XF5A 3AROA 1BX2B 5MEOB 2IH1A 3MROA 1PQZA 3BKCL 1FP5A 5CJXC 1IEHA 4MAYB 4MCZA 1C8PA 4UV7L 5HHOD 4ODTL 3RGVD 1RFDL 3DV4A 4CKVX 1KFAH 4PJCA 4AEHL 3SGJC 5JNYA 3OWEA 4FQQA 1A2YB 3MLWL 4X4MA 4F7EB 3QI9A 2IBGA 15C8L 2GY7B 3NIDF 1CLOL 5CJOH 1LNUA 5BW7A 1AI1H 3MV9D 1TFHA 3S3SA 1XF3A 5CILL 4QT5A 2ZP0T 2BNQA 4UDTA 1A6TA 5FK9A 4K9EL 2R56L 3ZSSA 5GGSY 3VFPA 3RY6A 4E41B 2B5IC 1IQDA 3VH8B 2B5IB 4D3CL 5JXAL 5CD5D 4R0LC 4ZFOB 4AM0A 2J2ZA 4WUUD 2GSIB 3Q6FA 4PJ5D 1XR8B 1MFEH 1ZSDA 5M7QA 2FECI 5KSVA 4QEGA 4UT9H 4R2GD 1T4KA 3SDDB 3DUSA 3MLSH 2F53A 4DCQB 1BZQK 3KPRE 3MRJB 3SGDI 4JRXA 4M6OL 4FQ1H 4Z7OF 2HLFD 4XGZB 3EJZD 3CFBA 3FFCE 4YHYC 4R7NB 1BD2B 4YHYB 4YWGL 43C9B 1KJVB 3QXAB 3SE8H 3HE6A 2V2TA 1ZT7B 4U7SA 2CR6A 3QO1B 5JW4Q 1FYHB 3EZ8A 2D7PA 2CQVA 5D70L 5MEQA 4XVSL 4BSWA 2AJVL 3QUZB 4XMLL 1UC6A 2H2PC 3MJ9L 1IVLA 2Q6WA 4WTXA 2V5RA 1RZGB 2R69H 1NBVH 3TBSB 3FOMA 1XIWC 2OL3L 5FYKH 3OAUH 5DMIH 4JCMA 1EHLL 1CICB 3LPFA 5F3HA 1MHCB 4Q7DA 4XVTL 3BN9C 3PP3K 1TTGA 5F6HJ 2W60A 2AXGB 1QR4A 4IDJH 2A77L 1ZA6A 5B21A 1G7PA 1AGCA 1LP9B 1MCRA 5GGQH 3KR3L 3ALWA 4OQ1A 1T2QL 3RUGE 1I1YA 1FO0H 3CZFA 5F44A 4XNYL 3UTSA 4QWWD 4D2NA 2Y7QA 1DN0A 5IMOB 1FH5H 1GYAA 2SEBA 1CDHA 2QHRH 4FQPA 1WEJH 4GRWF 1YEFH 2BVPA 3VXSB 3WUWG 1U8LA 4R90L 3G5YB 4JFDA 5I8EB 4NCDA 1BBDL 5D2NA 2HJKB 1NBYB 4ZAKA 2MFNA 4KK5C 2YD9A 3BKYH 5CP7B 1CIDA 3BXNA 1W2KT 3SJVA 3DMMD 1C5DA 3QHFL 1P5UA 4UQ3B 5F21B 1V7NL 4HJ0C 4X6CF 5C0JB 5F7EH 1MNUH 4L29B 3BO8B 1EO8H 3HC3L 3UTPD 3EIFA 5DUBA 3B9KB 1DQJA 1ULVA 1ONQA 2X7LA 2EIZB 3BP4B 3R0NA 4LCYA 1YY9C 2IG2H 1VKXA 3NFNB 1U0QA 3O2DA 3PGFL 5I66B 1QUNA 3G5VA 2X1OA 4R3SA 2IAMC 4G8IB 4Q0XH 5L2JA 3TM6A 4H8WL 2IAMB 5BOPA 5E2WH 3BZFA 4AENA 3UDWC 1ES0B 3KJ6L 4KK8C 5K9KB 3QNYB 3QEQA 1J0HA 4MAUH 3BH8B 1OHQA 1IGFH 2X89A 2AP2A 3OX8A 4PJDE 4LLWA 2J88H 3DXAA 4TPRH 4JPIB 4ZO9A 4L8CB 1A7QH 2EKJA 5DJYB 4ZFGL 1P1ZB 4ZUSA 1RU9L 5C2UB 4NQCB 4UNVA 2Y06L 2CDGB 4FQXD 3N9GL 1X7QB 1MAJA 3VFSB 4JHWL 1FNEA 1S7SB 4ZSOA 3S98A 1Y0LA 3JVGA 1MHHA 5FF6A 4NM8L 5J9PA 2X9YA 4O00A 5T1LA 5JA9A 4EUPA 4RGMB 1JVKA 4RDQG 2NY5H 1Q0XL 2DLIA 4JDTH 5E6IA 1X6LA 1K8IA 2DDQH 3FKUS 4FZEH 1KJ2H 4P4KC 1MRCH 4GBXB 4RMVA 3NIDE 4MJ6B 3B6SB 3PWVB 1UWEL 1FZOA 4WI5A 4FA8A 2FJHB 2H9GA 2G2RB 4DW2H 1KEMH 2DQUL 4LNRB 4HK3J 2X4UB 1PY4A 4O4YH 5J1AA 4F58H 3TN0A 2A6JB 3WIIL 4GW5B 2EC9T 3CXDH 2P45B 2CIKB 3IJSB 1PKQA 4B7IA 4WHTA 3QI9D 4X8JB 3F7RA 4IRSA 5HVFB 4OLYH 3C2AH 1NGWB 2M8XA 4Z7OE 2X1PA 1I8KB 4ZXBA 2Z8VC 4Q6IA 4WY7L 1HDMA 2HG5A 3A0OA 4M62H 5D1QC 1S7QA 5LGJA 2BNQD 4Z0BL 3L3JB 3VFTA 1OSPL 3UTTE 4F2MB 5F72S 2A6IB 2BVUA 2Z4QB 4XP5L 3OHXB 2VN7A 3P30L 5IMLB 2FZ3B 4NO3B 5E08H 1MWAH 1JF6A 5EBWB 4P2OC 2O5XL 4P2OB 4JRXD 4Q2ZB 1E4JA 3LEYL 3QDHA 4IRJA 4KV5F 3MNVB 4P9ML 4RAVB 4I4WA 4NN5C 4LEOA 4OGAC 4NN5B 3HCVB 3HE6D 5JMRA 3U0WL 4HGKC 1S9VA 1WC7B 2VXVL 4HUVB 4JQVA 1IKFH 5E56A 1PLGL 5IMKA 4HIEA 4FABH 4BH7B 4ACPA 1JGDA 1OD7A 3NIFF 1KTLA 5FYLL 3MCKA 4HBCL 4KUZH 3KPRA 4LSRL 4FQLH 4M8VA 1HHIB 3GMOB 5CD3A 1I1FA 1NFIA 3FFCA 4P2RB 2BSSB 3F5WA 4MA8L 1MELA 1EK3A 3HAEH 1JZ8A 4K3DH 4XPBL 4ONFL 4QOKD 1A7PH 4NQXB 2ZCLH 1A7OH 4GRWE 2G75B 3HAEG 1NEZB 3SE4A 5DQ9A 4Y5XC 2ATKA 3VA2C 2Q7YA 3LKNB 4ZTPL 4Y5XB 3VG0L 3IFNL 1H5BC 3CZJA 4PJEF 3UPAA 5IHUL 3JWOL 1NGPL 2DB8A 1V7ML 3LB6D 1BIIB 1GHFL 2ADGB 4KVNL 5D7LB 4PY8I 5T33H 3UTSD 3QO0B 4N90D 4X6CE 3N85L 4OZFB 3W39B 1E4XL 4ODXA 1RV6X 1T66D 1S7RA 2LE9A 2DLFH 5HHMD 3B43A 1WTLA 4JFDD 2GTZA 1DBKL 1VADA 1JNNH 4EVNA 3CGTA 4E0RA 4ZAKD 3WV0A 4PTUB 3NPZB 5D96B 3VXUB 3RUGA 1TZGH 4QHUB 3CDYA 4XC1H 5K9OA 3SJVD 5I1GL 1HWHB 4U1KA 4NQTA 4K23H 4N0FB 5E8NA 3SBWA 3K3QA 3MV7E 3LKOA 4IOFC 2X4OB 3QT2A 2NY4C 5I6XC 25C8H 3SY0B 4G43A 1G7MA 2FB4H 4HK0B 4JB9H 5CINL 4Q9QL 3MMEB 5A2LH 5FECA 1DQML 3X12A 3X17A 4U2YA 2A83A 4XCCL 1Y6NR 3CLFH 5FYKE 4WVRA 2XTJE 3EFFB 2VTFA 3AREB 3TBTA 3HNTL 3M17B 2AJZA 5HI4C 2CK0H 1N6QH 3MA9L 4JQIH 4EI5A 1DQDH 3WFBL 1EHNA 4MWFB 5C71A 5GS0C 5IV2A 3HZYB 3INUL 2HA1A 3QEQD 5DD1H 2AXHA 4F15C 2F8VA 1CTNA 2X89D 1AQKL 4FRWA 4X99A 3VGAC 4GG6F 1RK1A 2K9UA 4U1NB 4H25B 4Z7NF 5E1AA 3DXAD 3O41B 1J18A 1NANI 2MCPL 4Z77B 5HGHB 3V79C 3VW3H 3C60D 4HEME 1MF2L 4PJ9D 1I1CA 4PP2A 2OSLB 5T1KB 5CGYC 2MJWA 4LHQB 4PGDA 4QRQB 2G60L 5E2UL 1AGDB 2JB5L 4HV8A 1D3CA 5T1LD 4PJDA 4G6KH 3VFVB 4XBPA 1FNSH 1NCBH 2GJZB 3V2AR 4WU7A 2J5LC 5E6ID 1T89C 5HI3D 4EZMA 1X5AA 4KQ4H 1HHKA 4JY6A 5C0CB 1R6VA 2WSKA 3MREA 1MFCL 3EOAB 3O3DA 4NNXA 3DO7A 2PTTB 3KPOB 1CL7I 2YUZA 3HPJA 1KIRA 4U0RC 3WNKA 3GSRB 3S37H 5DR5H 1CXIA 5FUZH 1RUPH 2QLVB 3TBWA 1D5MA 1ZT4A 3TN0D 2D0HA 4HUNB 1RJLB 1S7VB 4Z6AT 4IRSD 2FRGP 2DQJL 5IG7A 5L88L 3LQAC 1S78C 3IDNB 3NACL 2ICWI 1J0ZA 4OD1H 4ZXBD 4JPWH 2J8UF 1RIUH 4G7VL 2H2SD 5HGBA 3C08L 2EKSA 2YEZB 2CKBA 2WBKA 5D1ZC 4CN6A 5D93C 5D1ZB 4OM0H 5LGHL 4M8QA 3VG9C 1OT2A 3HMXA 1KXVC 5TH2B 4WFEE 3NIFE 4XXDA 4GUPB 5EOQL 4NRYB 3RNKB 1MCJA 3FT3A 3K74B 4IRJD 2D7TL 1X5LA 2WIIA 4PLNC 3UTTA 5DMGC 3BRGC 4YHMH 1CLZL 3UROR 4NKMB 1IQWL 1M7IA 1QG3A 2PW1B 5GSVB 2PR4H 2XA8H 4PJEE 4RRPA 2P46B 1QA9B 2EDYA 3PF2A 1ZHLB 1HN1A 2EH7H 1ITCA 3ARGC 3FFCD 3N0PB 4G6ML 4YR6A 3V5KB 4LKXB 2QSCL 4RWHA 4A6YL 4LPVA 1GGBL 5M95B 2WUBH 2WQ8A 1QFUL 4Y4KA 5SX4H 3DGCR 4OI7A 5B38G 3AS1A 3MRRB 4ZQKB 1WF5A 1N64L 2HVJA 5D2LE 3QXVA 1OW0C 5BXFA 1FVEB 3L5WB 3U0TA 2EYRA 4ZG1A 4K3JH 1IMHC 4M00A 2R4RL 2JE8A 5KN5A 1VEMA 4OZGB 4XAWL 1U8KB 5JOPE 3UBXG 1K2DB 1UB6A 3V52H 3O8XA 4OCSH 2DLGA 5HHOB 3RGVB 5DZOA 5FA4A 5EIIA 1NGXA 3LN5A 5ALCH 4I9WD 3D9AL 2BSED 5FM4A 4HQQH 4X6CA 5FA3B 4HWBL 3TNNB 3C8HA 1EDQA 3NFSL 3OAZH 4OV6F 6FABH 4KI5F 1RZJH 2PXYA 1CE6B 4MD4B 1E4KC 2P5WE 1OM3L 2E9WA 3MV9B 4TVPD 3QEGH 4LSTL 5JIPA 3VXPA 3CH1B 3C8KA 3P9LB 4GG6E 4K3EH 1XGQA 3VXTB 4Z7NE 3ARBA 4CJ0A 3JV6A 1MVFA 5KSAC 2D4FA 4EDXB 1I7TA 1F3DJ 4UQ2A 5KSAB 4H26B 4XXCC 4WUUB 4PJ5B 3MV7A 4MDIB 4EI5D 1QYGL 1B4JL 3U79A 4R2GB 5T3XL 5ADPL 3BRDA 4O2FB 4HK3N 2FIKA 2V5TA 2UWEF 1C16A 2VAAA 5KTEL 1ZE3C 1FNGB 4B5EA 3VFRB 4U6XA 1ORSB 4NSKB 5IMMB 1SEBA 3MRCA 1BLNA 1EA9C 1L0YA 3L7EB 4WFFE 5I8OH 1D5BB 4FZ8H 1LK2B 4LF3A 1NBZB 1YMHB 1XFPA 1CLOH 1JTTA 2X6MA 2E9JA 1QZ1A 3WEXB 5I1CH 1ZS8A 5DZLA 4TSCL 1I8LC 2DM2A 2Q3AA 1JN6A 2QL1A 2DLEA 5FB8A 5CILH 2BZDA 1FO0A 5IM7B 3BW9A 4K9EH 4M1CC 1OQXA 3MLYL 5I1KH 2IALA 4D3CH 5HPMA 4MJIE 1EV2E 2R9HC 5C1MB 2QKIA 4L8BA 4YHIB 3V0VA 4XP1L 5E03A 3C87A 2P5EE 2J8UE 4M6OH 4OD2A 5D7JA 2ICES 3KNBB 1T04A 1OY3B 1HHGB 2ZSVB 1A3RL 5CBAA 3GSOB 5KVEH 1FC1A 3N50A 5I1IH 3GUTB 2HJLA 3HMWL 1B9ZA 4WI8A 2A9ML 5I16B 1CLYL 3CX5K 1FORL 5D70H 4HJGB 1G9MC 1RQ5A 4KKCD 2AJVH 1XAUA 1A4JA 4W4OC 3DETC 3MJ9H 3VXQB 3KYKH 3EZJB 1UXWA 3DMMB 3L3HA 2QBWA 2AKRB 2OL3H 2EEDA 1DLHB 3GMLA 1U93B 3OKMB 1QACA 3B2VH 4OLUL 2HJFB 4S11A 3L5HA 4XVTH 1V8HA 2BFVL 2A77H 3GSUA 4CGTA 5GSRB 4X6DF 3JWDC 2DTSA 3DRQB 2RBLA 1T2QH 2HKHH 2R0ZL 1FFQA 4PV8B 5F6IC 5EO0B 5C08E 4XNYH 1KN4L 5F6IB 3UTTD 2D7NA 2BVYA 4CVWA 4IBLT 2VUYA 3FJTA 2VDPH 2VLLA 4LRNL 3ETBF 5FHAH 3VGDA 3VMNA 3ZKND 3H2WA 2XRAL 4PJBF 1WIPA 3MBEC 3AC0A 4PLJD 5DJXB 3U36B 3W9EB 2GT9A 5E99H 3TYGL 4MVBC 3BP7B 4NRXB 3VRLF 2Y6SD 5EORL 1YJDC 2W1NA 2XG5A 1IBGL 2EXYD 5LAXB 3IDGB 1OARL 3TYFB 2WUCH 3GBLA 3SDAA 4ZUUB 3KYAA 3F65A 3DJ9A 3GM8A 1HZHH 4PB0H 3QHFH 1QEWB 1V7NH 3O3AB 4FQXB 4UDUB 4YLQT 2I07A 3IFOB 2V5SA 3WS3B 1T5WA 3BT2L 4Y4KD 4PJEA 2ZSWB 1UH4A 2VH5H 3PNWA 4QRRE 4GG8B 1R5VA 4RGOL 4RMRA 2MQCA 4KJPC 2PYEE 2V17H 5C3LD 1WITA 3CD4A 1BBJA 4HH9B 3H3PL 3LH2L 3QNXB 4YK4C 3RL2A 3UC0H 3PGFH 3T1WA 1N5AA 2ICWB 1MPAH 1JF5A 5GGUA 4KI5E 3GMQB 1XF5B 2IH1B 1NSNH 3MROB 2M1KA 1L9MA 1JP5A 5AYUH 4KKBC 4MCZB 1B2WL 3O8XD 1IAMA 4PJCB 3UJTH 1GRWA 3CX5J 1BQUA 2NY1D 3Q1SH 4FQQB 2NZ9D 1H3XA 3UPCA 3GHBL 3QI9B 4ZFGH 1CIUA 1RU9H 4BA8A 2PXYD 4DZBA 1MWAA 2UWEE 1ZANL 5BW7C 1YQVL 1LNUB 2CXKA 2YMXL 4YPGA 2BNQB 2AVGA 4NM8H 1UG9A 4UDTB 1KN2L 5TF1H 3VFPB 2OS7A 3MV8E 4PRPE 4ZFOL 1IQDB 3ARBD 5JIIA 4AEIH 4NN6C 1IAIH 4AM0B 1CZ8H 4NN6B 3S5LG 3Q6FB 1ZSDB 5F3BA 5GS1A 3RTQC 5KSVB 2AJYL 1OTSC 1T4KB 3DUSB 2P5WA 1MY7A 1UWEH 3BGFC 4IMKA 4JRXB 4UUJB 1FZKA 1O0VA 5E0QA 3F6IA 4QXTB 3CFBB 5EZLA 3O2VL 4GG6A 9CGTA 2DQDH 5FUCE 3UZVB 5FYKD 3EHBD 1FVDA 3HAEA 1AO7D 3HE6B 2V2TB 1ZEAL 2X1XR 2P8LA 3RBGA 3DYPA 4UIKL 5AG8A 3S3JA 1UEMA 1T03L 3LQZA 3V9FA 2BSRA 5MEQB 4BSWB 1EFXA 2VERN 2XYCA 2Q6WB 4XMKL 3FOMB 4TSBL 1T20A 1P69B 3OB0K 2VIRA 4QOKB 4HMEA 3ZTNL 1UM4L 3PGDA 1FGNL 2CRZA 3ARDA 5F3HB 5JO5A 4UAOC 1TJHL 3MRIA 1KTKE 2W60B 4DTGL 3E8UL 1GVIA 1ZA6B 5MEPA 1AGCB 3PV7A 5HTSA 1FJ1A 1N5YH 5ENWB 2O5XH 2IADA 5F9AC 5F1SA 1BZ9A 5D7JD 1I1YB 3LEYH 3CZFB 3RL1A 1KSRA 1JHLL 1PX3A 5J12C 3UTSB 1SVZA 1LO0L 2ICCA 2Y7QB 4G9FE 4P9MH 1DN0B 2SEBB 1D5IH 1DFBL 4WW2C 4M1GL 4BFIA 1PZUB 2HVKA 3PWJA 3U0WH 4LP4A 2BVPB 1MQ8A 4MJIA 5HHMB 1U8LB 5E5UB 1PLGH 4JFDB 1A6WL 5C0IA 5CAYB 1GH7A 1GCFA 1WBXA 3T4YA 4ZAKB 2P5EA 4ODWA 4HBCH 4X6DE 1KIUA 1I3UA 3BXNB 5TE7H 3SJVB 2ZWLT 1LMKA 5GRVL 3UJIL 3V5HA 1FFRA 3RVUC 2ZJSL 1I7RA 2XPGA 4MA8H 3NAAH 1RZFH 4XPBH 2N56A 1D6VL 2RCSH 3SCMD 1FYTE 4V2BA 4MJ2A 3HFMH 4PJBE 5C9JA 1ZGLA 5DUBB 2NY7H 3VG0H 3IFNH 2OZ4L 1DQJB 2LU4A 1ONQB 1XT5A 2X7LB 2Z8SA 3VRLE 4LCIH 1M05A 1I9EA 1GC1C 4LCYB 1T7XA 4WJ5A 1LDSA 1VKXB 5E4EC 4KVNH 4NNPL 3TLRA 3G5VB 3FZUD 5FM8A 4R3SB 1IGCH 1W0YT 5L2JB 4YGAB 3FQNA 2HFGH 4DGVH 4AENB 4WFED 1IC4L 3QEQB 3K2UL 1LEKA 1DBKH 3OX8B 1X5XA 3OJDA 4LLWB 4WFGE 4YE4L 4J6RH 5C08A 3DXAB 3SDAD 3MJ7B 2XZCH 5J1TC 4P46A 1CFTA 3C60C 2GEEA 4G8EA 4PJ9C 2MKLC 5IEKA 3C60B 2FX8L 2MSPA 4PJ9B 1D9KC 4AT6A 1E4WL 5DQDL 1FNEB 4XCEA 4ZSOB 1Y0LB 2Y07H 1MHHB 4KKLC 1SBSH 4PV9A 3MJ6A 5FF6B 1JI2A 5J9PB 5T1LB 5DLML 1A7NL 2Q8AH 3RU8L 4EUPB 2VZ1A 1V3JA 1HEZA 5GGRA 3ROLA 1WWCA 5E6IB 2AV7A 1L0QA 1K8IB 3HNTH 4LGSB 1FV1B 3S7GA 3JZ7A 3WFBH 1NEUA 3MGOA 5SV3A 4QRRA 5E8DL 4JKMA 3NMEA 5J1AB 1JE6A 4BK5A 5HGDA 2PYEA 3UYOD 3TN0B 1LDPL 3NPSC 1MLBA 1ODAA 1UQSA 3NPSB 1PKQB 4IRSC 5I71B 2W92A 4NOFA 2R0KH 4IRSB 3MRDA 1KB5L 1IC7H 1WAAF 1FFPA 5FGBA 1GZPA 4KRNA 4LCUB 3EDEA 4PBVC 4KHXH 4ZXBB 1MREH 4XB8A 1BQHA 2GK0A 1HDMB 2G60H 2HG5B 4GAJL 3LKQA 4XNUH 1S7QB 5T3ZE 5LGJB 5FOJA 5JW4M 4KJQD 4BM7A 1Z9SA 4ALAL 5F7DA 3IKKA 3VFTB 3Q6GL 1BFTA 1P7HL 3HA0A 3L3DA 3X3GH 1FDLL 3JUZA 3HHRB 2ZZUT 4BQ9A 1MFCH 3WJLC 2UWEA 1G0XA 2P5WD 2V2XA 2GCYA 3LEVL 4IRJB 3ARWA 4YNYA 4OLWL 3MV8A 4HMCA 3LKPA 4KK6C 4PRPA 2VO5A 4I4WB 1R3JA 4LEOB 3PJSA 1UWGH 5HYFA 1OL0A 5F6HI 5B38A 5IMKB 4HIEB 4F9PC 1I4FA 1JIBA 1KTLB 3MCKB 3UYRL 5IKCA 1I1FB 3CFJA 3FFCB 3F5WB 1KGCE 3C08H 3KYNA 2CLZA 2BDNL 3I6GA 3OZ9L 4WFFD 1ZVSA 5IW3A 4XNZC 4PJFF 1DBAH 4O9HL 5DO2C 3ARDD 4XNZB 4OTXL 4P2QE 5DQ9B 3D0VA 1J0KA 2Q7YB 4NFCA 4NUJB 2ZUTA 4GQPH 4UT7H 4YX2L 2VSCA 5DHYB 2J8HA 4M43H 2D7TH 4KDTA 3MFGB 5EUOF 3KPSE 4ODXB 3EDFA 1DBBH 1CLZH 1S7RB 5GRXG 5C0ND 1IQWH 1Y6KR 4MJID 5CEYA 3NBNA 4YO0A 5A2JH 2E6PA 2FO4A 2GTZB 1VADB 4EVNB 3QFJB 4XP6H 4FG6C 3QIUC 4G7YH 5B39G 4UB0H 3RWHA 4E0RB 2FECL 4ONOA 5ESVA 5K9OB 1G0YR 4HPOH 4HCRL 3ZL4H 4MX7A 4U1KB 1NUNB 4Z76B 1QQDA 4G9FA 2QSCH 3LKOB 1U91A 4JKPH 5ILTL 4G43B 1G7MB 2Z91A 5BO1L 4L3EE 5FECB 5DD3H 2IBBA 4MA7H 2OTWB 4U31A 3PHOB 4EI6A 2UV3A 3X12B 2OI9C 2K7QA 3PGCA 4X6DA 5FAAA 4KJYA 4WI2A 3ZE0F 4XPTL 3RPIA 4WDIA 4BQCA 3TBTB 2AJZB 5ELIA 1NCDH 4ZDHA 3TFKD 3NOIA 3UEZA 4EI5B 2J4WL 1FYTA 3WFHA 5IV2B 5H2BA 4PJBA 3WNNA 2H32A 1U42A 4WCYH 4H88L 1XF4B 5JIKA 2APTA 2DI9A 1RJCA 4JM4H 4X99B 4LU5L 1RK1B 4G3YL 4HIXH 1T21A 3DRTA 5E1AB 5C08D 3RNQA 4FNLH 1RULH 1GAFL 4P46D 3T0DA 1KCUH 1BMGA 3R8QA 4HWBH 4PP2B 3ILPA 4U1JB 4C83A 4NIKB 4PGDB 4OM1L 2P43B 3PDDA 3HG1A 3U2SA 1DVFA 4HV8B 3SO5A 4LSTH 5I74C 4PJDB 5EBMA 4XAKE 1FN4B 3VD4A 4B50A 2QEJA 4XBPB 2HMIC 3T3PF 3DVIA 4WU7B 4YXLH 4GFTB 1HHKB 4QGTA 1I8IA 4JY6B 3U83A 4TSAL 3MREB 1WAAE 3PUCA 3O3DB 4NNXB 3DO7B 4YQXH 1B4JH 1EO7A 1TPXC 1R3IL 1TPXB 3U30C 4GKZB 3CDGA 3HPJB 2FEDC 1KIRB 4O5LL 5KTEH 4QRRD 3S34L 1BEYH 3WNMA 1A1NB 3LKRA 3GNML 3ET9F 1KNOA 3TBWB 1D5MB 1ZT4B 2PYED 1N3NA 4LPWA 5IG7B 4KI5D 2V7NA 1IZJA 5F1KC 3TWCL 4TSCH 5SWQA 3E2HC 3HB3D 5HGBB 1TCRA 2EKSB 4FFVC 2R2BA 1VSCA 2XQYK 2CKBB 4CBPA 2DICA 1N0XL 1SJHA 2X1QA 4M8QB 3CVIL 4XXDB 2JJTC 1T7ZA 3WHE0 3QCTL 4U1SB 3EJJX 4J3TA 5FYJE 2BNUA 4UINH 2I26N 1G1CA 1J12A 2WIIB 4X8XA 1NDMA 4WRLA 4YUEL 3RDTA 3MV8D 3UTTB 5HHQB 3VRJA 3ZT6A 5ADOL 3WXWH 4PJFE 1WFUA 5HGAA 4PY7A 2CGRL 2IQ9L 3HMWH 1M7IB 5J57B 2A9MH 2NXYD 4PGCA 3B5HA 4OCXL 1OWRM 3WDIA 3VD3A 1SY6L 1FORH 2BHZA 4CUCA 2X4PB 1MRDH 2Y6SC 1JGLH 3I3BA 4LHUG 2VR4A 3MRNA 5J13C 3BZEA 1DBJH 4Y16C 2BVOB 5ICYA 4DN3H 4Y16B 4YR6B 3WIHH 1J10A 2JIXA 5EUOE 1NMCC 5I2IB 4J4PC 4X7DC 5IB1A 4H0GA 5HYSG 3ESUF 1HILA 2Y25A 2BFVH 2VDOH 5I1JL 1IT9L 4AMKH 4K7FA 3N1QC 1N6VA 4JG0L 4MNQD 2HVJB 1F4YH 4UT6L 5IB5B 1T5XB 2IPKA 5BXFB 4LGPB 3U0TB 2EYRB 3OSKA 1DEEA 2YA1A 4GRWB 4P2QA 3C5ZC 4N8VG 2EDDA 3LOWA 5KN5B 2A38A 5FO9A 2XRAH 4MHHG 1UB6B 2XQYG 4XB7A 1YMME 3VI4F 3O8XB 3TYGH 2CSPA 3AB0B 3ZE0E 5EORH 2NY1B 1NGXB 2OQJA 2WBJA 4F7TA 3LN5B 4NKQB 3F7QA 4HEPG 1JCKA 3C8DA 2NX5E 4X6CB 4G9FD 4OCWH 3KPSA 1U3HC 1HINH 3KPPA 4PG9A 5FOBA 2PXYB 5HJ3A 3RKDD 3OPZL 3P9WB 1CFNA 2YR3A 5BS0E 3K0WA 3BT2H 3VXPB 1F4WH 4OLVH 5LQBL 3C8KB 2JCCF 4RGOH 1XGQB 3SPVA 4ZPTA 3BEWA 3JV6B 4GRLA 1UM5H 4UQ2B 4HAFA 3LH2H 4E9LA 2VKWA 4JGMA 2CRMA 1FFNA 2E7LA 1N8ZA 3LRSB 4ESKA 2FIKB 1FYTD 4LEXH 3WN5C 1MHPH 2FBJL 4L3EA 3QULA 4GMSH 1C16B 2VAAB 1IGIH 1SMAA 1WWWX 2HH0L 3QPQD 1B2WH 1L7IL 4ODSL 1SEBB 3MRCB 1BLNB 3T3PE 2R29L 1AO7B 1BAFH 5JPMA 1A6UL 2HTKC 2APFA 3W0WD 4LSPH 2UY7A 3BDYL 2CDFB 4LF3B 3BP6A 1T0PB 2ZG2A 1ZS8B 1YQVH 5J3HC 4GKNA 4X5XB 3HG1D 1DVFD 1TLKA 2N4IA 5FB8B 1CDJA 1FO0B 3JSSA 2MNUA 3BW9B 3NCCB 4WFGD 3GJFK 1K3IA 2CD0A 5E8EB 1LILA 5IHLB 2IALB 4BSVB 1MSPA 3EGSB 3NFPA 2GJ6E 3NZ8A 3ZYOA 4U3CA 4RQQA 5GS2H 2QKIB 4L8BB 3O6FC 3V0VB 2BY2A 1LO3H 4ZNEE 1QTYT 4GAGH 4RISL 3KLDA 3T65A 5D7JB 4DGIH 4W4NA 3RWCA 3FB5A 1T04B 3NCYS 3U9PH 1I9RH 1GPOH 4S0SD 5T1DL 5CBAB 5CFHA 4PGEA 2HJLB 4LSDA 3DGGA 5HVHC 1H3UA 5D6DA 4BZ1H 5CJQH 1ERNA 3QPXL 1IJ9A 1BQLL 1WAAA 1T03H 4KQ3L 1IGMH 3QQ9D 5KVMC 1AY1L 3B9AA 2MHAA 5GGTL 5KVDL 2AJUH 3QUYA 4M48L 1A4JB 2YBRA 2L7JA 1CCZA 1UXWB 5HY9A 3L3HB 5DK0A 3VWJC 4TSBH 4JO2L 1T83A 4UILL 3S6CA 3GMLB 1GGIH 3SCMC 3SCMB 1UM4H 1FGNH 4CU6A 1U8IB 2NTSP 4ZUVA 4QRPB 4LOUC 4DTGH 3LRHA 3E8UH 4K94C 4ZFFB 2X4QA 3JWDL 5B4MC 3MRLA 5EDXA 4RMSA 2Q8BL 3VGGA 4HKXB 2NZIA 5T3ZD 1FRGL 4EN3A 2EYTA 3HC4H 3KXFB 4OCLC 1JHLH 1OLZA 1P53A 3RDTD 3T09A 1TENA 3OJMB 1CF8L 4OZ4A 1DFBH 3DTXA 1UEYA 2YN5A 3JBG7 4PJIF 3BDBA 4G5ZL 4C4KT 4OFPA 1U3JA 4OLZL 5F96H 2GT9B 3LS5H 4MXVF 1A6WH 4KZEH 3NCEB 2NY5C 3P2TA 4DQOH 1M71A 1UKTA 1W0WA 2X4NB 3F7VA 1CL7L 1HK6A 1SMOA 1F13A 3ULVC 4P23A 2JIXD 4PJFA 4XHJC 4FFWD 4RA0C 1TETH 2I07B 5L6YL 3KLAA 3QRGL 1T5WB 2XOTA 1OAZH 2D7OA 3JTTA 4LSVH 1WK0A 3VI4E 3MRPA 1RVFH 4I8DA 2YSSA 1R5VB 5CWSA 5CEZH 1I1AA 4IHOB 5SX4I 4KKAD 5FO8A 1BBJB 3OTTA 1LHZA 2EDXA 5EUOA 1N5AB 4MA1C 2P7TA 4MA1B 2D4DA 1D7FA 4P2QD 1M6OA 5HBBA 4K71B 4ZOAA 2UZXB 4M6NL 4YAQA 3UBXI 3G6AA 5E9DE 2JCCE 3RQ3A 2XZAL 2WWMD 2WBJD 2R15A 4G80A 2VLRE 4Y89A 2C26A 3KPSD 4JKLA 4LIQL 4YBLB 3MUZ1 4DZBB 1MWAB 1E4WH 5DQDH 4TQEL 2ORBL 2CXGA 3SKJH 3LEXA 4L4VE 4JY4A 4YPGB 1YMMA 4QHLA 4LLYA 1JYVA 3WKML 4WU5A 4J23A 1UWXK 1RHHA 1H3VA 2HTLD 4GRLD 4Z9KB 2NX5A 2EDRA 4JJ5A 2GTWA 4HLJA 2FATH 4L9DA 3D85B 5F3BB 5GS1B 4L9LA 1KCLA 1MIML 4JANA 3NCJL 1M7DA 2P5WB 5IBTL 1L6XA 2P24A 2VDLH 3OL2A 4L3ED 5BS0A 2R2EA 2E3VA 1FZKB 1UJ3C 5D8JL 2CUHA 5FHBL 4JN2A 2F58H 5EZLB 3H7BA 1DSFH 3TCXA 1MCFA 2HKFL 3RA7H 2P48B 3HAEB 2HT4C 2FWOA 1V05A 2ID5A 2P8LB 1LDPH 4X4YA 4PS4L 5D7KE 2WWKT 5F7UA 4C59B 4PRNA 2EEAA 2ZCKL 2BSRB 1KB5H 2A74A 4LCWE 5HVWA 1J88A 5DYOA 3OKOB 2XQBL 1F11A 1MCKA 1T20B 5FGSA 3HE7A 1AR1C 2A9NH 1NCCL 4U6VL 4ALAH 2VIRB 3OXRA 3Q6GH 4LPYA 3M07A 3PGDB 4XP9L 3ARDB 4DKFH 5JO5B 4FXGA 3CCHA 3MRIB 3ULSA 3VFUA 2ZUQC 4ONGH 1KV3A 4XP4L 1SHMA 5GPRA 5B39A 3BD4A 4HXBH 5MEPB 1G7HA 4R8WL 1YEGH 1XF2A 5DFVD 2IADB 2BP3A 1BZ9B 2X40A 5HHVL 3BPNC 2IC2A 3LEVH 3RL1B 4XAKD 4NRZA 2BOCB 4RMWA 2AS5M 5F7FA 4L1HA 1W8OA 4X80H 2YPLE 2JB6A 4JN1H 2HVKB 3PWJB 1KULA 2GJ6A 3Q3GA 4MJIB 4NO0A 3QH3A 5C0IB 1AD9A 1WBXB 2XV6B 3T4YB 4ZNEA 2XNAA 1OTTD 4ODWB 4HPYH 3LS4H 1JPFA 3QUYD 3MV01 4R4BB 3NCBB 3LIZL 1SQ2N 1DBML 1INEH 3V5HB 1LD9A 4Y5YA 5J89A 3ZKMC 1I7RB 2XPGB 4I48A 3H42H 3PDOA 2Z9TA 4O9HH 3CSPA 3V95A 4PJIE 4YXKL 2A6KA 4OTXH 1ORQB 3U7WL 5IFJA 1ZGLB 3GI8L 2C1OA 3X14A 1KEGL 4MXVE 5EC2A 1MRFL 2CO6B 3O2DL 1M05B 1EJ6A 1CT8A 4X6BA 4YX2H 5B8CC 4MXQD 2VYRE 4EN3D 3QDJD 3CNKA 2P49B 1WFTA 4KU1A 5CSZA 4XCFL 4YFDB 4Z7VF 1JV5A 1H3WM 4IRZL 3FQNB 2V2WA 3GI9H 1HXYA 3MXVH 4NWTL 1F02I 4JE4B 3ES6B 1DUZA 1IAKA 1LEKB 4XCYA 4KZDH 1PSKL 3RY5A 5JXEC 4NPYA 4OZIF 4M7JL 3SGDH 5I8KH 4P46B 1CFTB 2Y9RT 3QIWC 4P23D 4PLKD 2HT3C 4P3WA 2DD8L 2C4FT 4MQ7A 4XNXH 4N1HB 1BJ1H 1FNAA 2VDQL 4DGYL 4PV9B 5IIEA 3ZZ1A 5J56B 4OKDA 2YD6A 1UA6L 2W0LA 3WSQL 5HHPB 2BSTA 4U6HA 1HEZB 1WZ1H 5GGRB 5T5FL 1I1AD 3ROLB 4XPTH 5C7XH 4X5LA 1Q0YH 4OGXH 1EEUA 3SKMA 5IVZA 2ARJQ 3H9ZA 2VZSA 4RZCA 3TP4A 4JFPA 3VJ6B 5DVLA 4KY1L 4DAGL 3RWJA 3RJDA 3MGOB 35C8L 3ZDXF 3D69A 1GJIA 3AXLA 1MJJA 1IFHL 4QRRB 2EO1A 1F6AA 1N7ML 4DEPB 1NAMH 1R3LA 4NZUH 1RMFH 4Y1AE 4LVNC 5HGDB 5AZEL 2PYEB 3DSFL 4G3YH 1B90A 2YWYA 1P4BL 1MLBB 3WFCL 1UQSB 1GAFH 2AJSL 1FFPB 2L4OA 5EZOL 5I8CA 2AERT 3L5XL 1BM3H 1GZPB 4RWYH 4GMTH 2DQCL 3HB3C 1BQHB 2GK0B 3WDJA 2YD2A 5E9DA 2FJGB 3BEVA 4L5FL 4X9IA 2JCCA 1FZJA 3VRIA 5F7DB 1F3RB 2DQIL 2FLBT 3L3DB 3Q0HA 4OGYH 5DEFA 5DWUL 1CGYA 2VLRA 3FO1A 4PP1D 1VPOL 2XZQL 2DKMA 2XWBA 4ODUA 4LHUA 4TSAH 1DQTA 3O4LE 3ARPA 1IAII 3V0WL 1S5HA 3HZMA 3HI1A 5H94A 3H3BC 4YBQD 4ZFZB 5BS0D 2V2XB 1R3IH 2GCYB 1OAQL 4L4VA 5CEZE 4Z7UF 5KOVC 2X05A 3S9DB 3MV8B 5C09E 1R3JB 3IDIA 3PJSB 2QSTA 5CCKL 1LO5A 2OXGA 2NXYB 1ZTXL 5B38B 4PR5A 3P11H 5JHDE 1X4ZA 1I4FB 2GAZA 1ITBB 4XT1C 1OCWL 2QQLH 2YZ1A 3CFJB 3TWCH 5F97E 3HE7D 3ZHLA 3KYNB 4I77H 5EZIH 2CLZB 3I6GB 4S1SH 4X9BA 4D9QE 1LO4H 1W0VA 5JUEL 1KJ3L 3B2UC 3D0VB 4LCCC 4MJ5A 3L3IA 5C86A 2VR5A 1FAIH 5C0DA 1KC5H 1CE1H 4LCWA 3GSQB 3QCTH 4MNQB 2VLKB 2HWZL 4U6YA 4XVJL 4XPGL 4AEFA 5GIRB 3F58H 3D0LA 2DI7A 4I3SL 3IFPB 3TVMA 1JMXA 5IWLC 5E2TL 2IQ9H 2GJ6D 3RBSA 4CVZA 5CEYB 5F1IA 4YO0B 4NO0D 2FO4B 5IW6A 1SY6H 2DBJA 3DROA 2EEBA 2VISA 4NHCH 3RHWK 1INQA 4WUKL 3RWHB 2OJEB 4HXAL 1SM3L 3DUHA 2P47B 4FQIL 2PO6A 3EYFA 5ESVB 4JZJC 1QKZL 4MX7B 1JRHH 5IFAH 1QQDB 4G9FB 1PG7X 4Z7VE 3GSVB 5INDA 2YPLA 1U91B 4TVPL 2WP3T 4PGBA 1FGVL 4KDVA 3BPLC 4YDLB 2Z91B 2ZCHL 3T2PA 4EI6B 1HHHA 1CXFA 3GSWA 3ARYA 3PGCB 1N0LA 1G6RH 4LASL 4X6DB 4KJYB 43CAB 4X7TA 1I85A 1MCWM 4LRIA 4WDIB 4OZIE 1HQ4A 2XN9E 5CZVL 1NLDH 4UT6H 3EYSL 4ZDHB 5GGRY 1IEBB 4R4FH 3GDBA 1FVCA 1FYTB 1KYOJ 4PJIA 3WFHB 5H2BB 3MOAL 5KBNC 4PJBB 5FKAA 3MLXH 2H32B 1RAMA 2X4TB 3QPQC 3ILQD 3QXDA 5C0BE 4IIQA 4K9EC 4XVUD 2F19L 5I15H 1T21B 2I5YL 2X10A 3CX2A 3DRTB 1ZLVK 3RNQB 3W0WB 5LWYL 2DQTL 4OQTH 2Z31A 1T1WA 3QIBC 3LHPL 4EDWL 3U7YL 3BIKB 1GGCL 4C83B 2LABA 1AGFA 4MSWA 3ZDXE 2G9HA 3HG1B 2BJMH 3U2SB 1DVFB 4GH7B 4MYWB 5HYJA 5EBMB 5I17A 3MLTA 2VXTL 4MMZC 2VKXA 3R8BB 3HNVH 2DJ4A 1MJ8H 4WW1A 4OF3A 2VQTA 1RZ7L 2BRRH 4HF5H 4XTRC 4CVXA 3LD8C 2FBJH 3CDGB 4NKOA 8CGTA 3LD8B 2FL5A 2EC9U 5IB2A 4Z5RA 2P8PA 3LKRB 1L7IH 5T1MB 3QXTA 2NY6C 4V1DE 3HUJF 2NY6B 1A6UH 4Y4FA 3FQRA 3QUKA 5H8DA 4HIJA 2KZWA 2V7NB 5J0BA 3E1F1 4OV5A 3U6RA 4P57A 3V4VL 5HDLA 5SWQB 4Z7UE 4EIZC 1C7SA 5E9DD 3P4NA 5HVGB 2CKBL 2EDTA 1CTOA 1TCRB 4KGLA 3RVVC 2R2BB 3ARVA 4Y1AA 3HMXL 3MRFB 5I75B 4MQXC 4HUMB 5T5NG 2VLRD 1CWVA 3GJFA 2BMKA 4YHOH 3EDJA 1SJEA 4LHUD 5IFHH 3PWUA 2GUOA 1HYSD 4L4VD 5GRZA 1DLFL 1RK0B 3MNWA 2X5PA 1AXSB 1NDMB 3RDTB 4YXHL 3MRKA 3VRJB 5T1DH 3CH8A 4Z95L 2MQ0A 4PY7B 4JGUA 4PGCB 5DQJB 4DOHE 1JWMA 2NLJA 3V6FA 3E3QE 1QLRA 3O4LA 3IF1B 5JZ7D 4FXKA 4H1LA 1AY1H 3K81A 4HW6A 5KVDH 1J5OL 3MRNB 3QBTB 3GKWL 3BZEB 4U1GC 2V5YA 4OJFL 3WHE1 5ICYB 1ZOXA 2M26A 5C09A 5ACLA 1RZ8A 2YD4A 2GW5A 4H8WC 3OR6A 5D7KD 5JHDA 3RI5F 3WD5H 5IB1B 4QGYA 2LVEA 1HILB 2Z92A 1U2HA 1KFAL 4LCWD 1VGKA 5CMAA 3WLWD 4K7FB 1WIUA 3VFWA 2O26U 4RAUA 1FRGH 2IPKB 1DEEB 1BZ7A 2BY0A 4OD3H 4DWHA 2O5YH 1AI1L 2ED8A 4P2QB 3NGBB 4Y4HA 1KELH 4JFOA 4I0PA 4Q9RL 1EXUA 4DK3A 2C5DC 4BZYA 4UMGA 4JFEE 3TO4A 2PO6D 2EDEA 2OQJB 2WBJB 3WNPA 4F7TB 1PD6A 4G6FD 2M2DA 2H45A 5HYEA 3GMNB 4K8RH 4UT9L 3OR7A 4NT6A 3KPSB 3KPPB 2YPLD 5FOBB 1AH1A 4PRHB 5HJ3B 4PUBH 2WK2A 1FL3A 4G9DA 3SE8L 1F4AA 4GRLC 5DJ0A 3SPVB 4ZPTB 3BEWB 4GRLB 4KROD 2EDBA 2IPTH 4R97C 4Z7VA 1Z0NA 4R97B 1FFNB 1N8ZB 3ALXA 3ULUH 5I9QB 2EICA 3L7FA 2CUIA 4L3EB 4QTHB 3K8MA 3QULB 5FYKL 4S1DD 5IGXH 3OAUL 4GO6B 4OLXH 3D3VE 5F7YC 5GGVY 4Y19E 1JL8A 1DJSA 4OZIA 4IS6A 4DFIA 5JPMB 2XN9A 1HXMA 4LVOB 2EE9A 1CD0A 4YHLL 1QLFA 5L9DL 1MFDH 2F5AH 1NGQH 3HR5A 2EDHA 1V3MA 1G9NL 5GGQL 4CDGC 1NUGA 3BP6B 4LIQH 3T2OA 3GHEH 1FO0L 1J0IA 4GKNB 3D39E 1F8TH 4PRDA 2KUTA 3WJJC 5C0BA 5HYJD 1PYWA 3WKMH 5KS9F 1WEJL 4NYLA 1YEFL 1MJUH 3WMSA 3D2UA 3HUJE 2DQEL 5ANME 5LBSL 3NFPB 3NVQA 4ZS7H 3NZ8B 4HX1A 3GRWH 4RQQB 5ACMA 4JM2C 4XX1E 5C07E 4Q74A 4N5ED 5IBTH 4DJMA 3NABL 4G6AC 3TC9A 3RWCB 3FB5B 1K6QH 5DJCA 3HRPA 4PGEB 3T0EC 2HKFH 4NNYB 5C0EA 3DGGB 1EO8L 4Y4FD 1KTDA 4HHAA 3BGMA 2VDML 2ADIA 2JJSC 2OLDA 3SKNA 4BQ6A 2MHAB 4P2YA 2IG2L 3DYOA 3JWOC 3MJ8A 4G42A 4Q6YA 2YBRB 1ZVYA 5HY9B 4U3HA 2XQBH 1WT5A 4APQA 1JZ3A 4Q0XL 1U6AL 5H37H 4Y1AD 4XBGA 1FAKT 4P0DA 4WWKA 5H37G 5DA4A 1S9XB 3GJEA 4MAUL 4HSQA 3D1MC 4ZUVB 1IGFL 1X9QA 5GZND 4KRPD 4NQDE 3U4BL 2OTPA 2E5EA 2DMCA 1VACA 2X4QB 3NCMA 1ZLUK 3T0EE 1WCBA 4MXQC 1ACZA 4Z7UA 1G0DA 4EN3B 3QDJB 1T0NA 2EYTB 1HHJA 1NMAL 4X83A 2DQFA 4XZUA 5E5MA 2VRAA 3DTXB 5DUML 2J6EA 1MCPH 3PWPE 3O4LD 2NY5L 4M93B 2NXZD 4JDTL 1HYRC 1GZQA 2ITDA 1M71B 5CEZD 1KIPA 1A5FH 1MRCL 1A3LL 1W0WB 3F7VB 1R0AH 3LIZH 2RAMA 1MAMH 5C09D 4I3RH 5LJYH 4PJFB 2LTQB 3BE1H 5AG9A 3KLAB 4LKCA 3BESR 1ZGLP 1HOCA 5E6ZA 5JHDD 4LBEB 2C3XA 3G04B 4IDLA 4FMKA 1X5GA 3JTTB 3GI8H 3N1PC 3MRPB 3UO1L 1PEZA 4MCYB 4RGNC 5CWSB 1NAMA 1I1AB 3OAYH 2B2XH 2YUXA 3CXDL 2PF6A 5FO8B 5EUOB 2Y72A 3C2AL 1QSFE 3CFEA 4D9QD 4XCFH 4BJLA 4IRZH 3IDJA 4QHMA 3IXTA 4Y4HD 1M6OB 3BP5A 4NWTH 4I0PD 4YAQB 4MHHI 1U95A 1E6JH 2FNBA 3S35L 2L0DA 2AEWA 4LARH 3O45A 3GIVA 4I18C 2DWDA 3TO4D 1OVZA 1ZLUH 3UJJH 5F1NA 4I18B 3DVGA 4G80B 4M7JH 5JDJA 3OF6A 3AY4A 5E08L 1MWAL 4N0UA 1LE9B 5J11B 4GT7A 2NR6D 1K85A 2DD8H 4DGYH 3LEXB 4EUPH 4JY4B 2RR3A 4QHLB 3KHOA 1FSKB 3HPLB 1UA6H 1NL0H 4WU5B 3AM8A 5TDPB 4NKDA 4JFEA 4DKAA 4EUPG 1RHHB 3QUXA 1IKFL 3DX7A 4JJ5B 3EAKA 1EO5A 3SE3C 4L9LB 4NGHL 4JANB 1Y18A 1S7UA 1AHWC 2P24B 2VC2H 3BQUA 2R2EB 4DAGH 5FKPA 2YN3A 4JN2B 5DRNA 4K3DL 1A7PL 3H7BB 1N7MH 2RHEA 4CMHB 2ZCLL 1UCTA 1A7OL 5KS9E 2PTUA 4OZHF 1F90H 2FWOB 2XN9D 3DSFH 3WO4C 2IPUK 4X4YB 1VFAA 4LLDA 3WFCH 2OR8A 2A74B 4POUB 3SQBA 5EZOH 5DFWH 5DYOB 5T33L 1BWWA 1R24A 1I75A 1UZ8A 3D3VA 1ROWA 1F11B 5C0BD 4L5FH 3HE7B 1CGWA 1HH9B 3VWKA 1JWSB 4Y19A 3OXRB 5F9WB 2ZKHL 3D2UD 5DA0B 5DGRA 5KSBF 2DLFL 1MCCA 4FXGB 3W11D 3CCHB 3S35X 2Y36L 3ULSB 3VFUB 1JNNL 1VPOH 4JFZH 4HG4K 5B39B 4Q58C 1OAUH 2XZQH 6CGTA 2HRLA 4LLMA 2AABH 1DP0A 1NGYA 3WXVL 1PG7H 1TZGL 2BXZA 2EZ0D 5D9SA 4CU7A 1XF2B 2EDNA 4XC1L 3D39A 2DJSA 4K23L 4JZOB 5IROC 1VFOA 1UGNA 3RWFA 3MR9A 3P9MA 2IANE 1CI5A 25C8L 3HUJA 4PJAA 4X7SL 2FB4L 5ANMA 2JB6B 3MC0A 2GJ6B 3PXHA 3HZVB 3NH7L 4NO5A 3VDAA 4NO0B 3QH3B 1IKNA 2I9LA 4ZTOH 5C07A 4NQEE 1AD9B 3BKML 3CLFL 5ETUA 3U4AA 2XNAB 1JPFB 3X13A 1G6RA 5I30H 3PL6A 5B3NA 5DURD 3BKJL 4N1EA 4JQIL 1LD9B 2MPAL 4Y5YB 1DQDL 4APQD 4M6AA 1E6OH 4I48B 4JPKL 3S3PA 3IT8D 3PDOB 4WWKD 1LGVA 5DD1L 1Q9WA 2A6KB 1RZIA 5JUEH 5IFJB 2C1OB 4ELKA 3X14B 4R4NC 5EC2B 4Y2DA 1YEDA 4KC3B 1CT8B 4X6BB 4NQSA 5CSZB 1WZMA 4XPGH 1NC4A 4OQTA 1JV5B 32C2A 3SDCC 1YYLH 3QA3A 3C6LC 3S88H 3RWEA 2V2WB 5GRVK 4AEEA 3QJHA 4P5TC 3AU1A 1DUZB 4NQDA 4G6KL 1NCBL 4XCYB 4HXAH 4L8SC 4KQ4L 1F42A 3EFDL 5F8RC 3KLHC 4OIBA 4Y5VA 3GBMH 4YHNB 5CZKA 3GO1L 4HWUA 2R0WH 1TQCC 2GIYA 4UIMA 1FGVH 3M45A 4MQ7B 3S37L 3VFNA 3PWPA 5I1EL 5FUZL 1ED3A 5IIEB 5GZOD 1RIVL 4PG2C 2BSTB 4XPAL 4U6HB 4JFYA 4MNHA 4NZRH 1ZHKA 4HG4J 1BIHA 4RCAA 3T1FA 5CZVH 2AJXH 2J3SA 2VAJA 1LEGA 2EXWD 3SKMB 5IVZB 3L3OA 4GKOA 3WE6A 1KPUA 4OD1L 4PRIB 5IR1A 4RZCB 4JFPB 4JPWL 1RIUL 5GGSB 3RWJB 2IGFL 2W07A 3QRFM 3D69B 3WFDH 2Y23A 3AXLB 1MJJB 2O93L 5J6HA 1F6AB 3CAFA 1R3LB 5EO1B 2D03L 2F19H 4OM0L 4TULH 3S4SA 3LY6A 1GOHA 4POYA 5DXWA 5T3XE 3QDME 4CW1A 3OF6D 5LWYH 2DQTH 1QSFA 2DM7A 5HI5D 4KK9D 2VZ3A 2ED7A 5I8CB 1H8OA 1KACB 1GGCH 1RPQA 4M03A 3BEVB 5E9DB 5C6TH 2JCCB 1FZJB 3IJYA 4LLUA 4JLRA 3VRIB 4YHML 4JFFE 2JELH 4MD5A 4JFED 3MLZL 4OZHE 1A21A 2VXTH 3QUXD 5I76A 4NHUA 5DEFB 1VA9A 3TEUA 2VLRB 2XA8L 3FO1B 1XCTA 2XWBB 4ODUB 5CGTA 1RZ7H 1KLGA 4LHUB 4JEGB 4LQ1A 1S5HB 3HI1B 1T0MA 3BQUD 4L4VB 4POZC 3P3YA 4WV1A 1OB1A 3CPLB 5TF0A 5J1SC 3IDIB 5KSBE 3S37X 1AC0A 4ZOEA 4OUOA 2MMXA 3K4AA 1TDQA 1LO5B 4LP5A 4PR5B 2MTPA 1T1ZA 2KQMA 5LXGH 1YDPA 2X4SA 2GAZB 2NY3C 2NY3B 3SGKA 4K3HA 5JW5A 3MTRA 3DVNA 3D3VD 3PQYE 2DBLL 3F7PC 2CKBH 5IJVA 5KS9A 3VWKD 3CVHH 4Y19D 5BVPL 4CJ1A 1XH3A 1T22A 1LP9F 4LAQL 4RBPK 4N8VB 4UTAH 3UTZA 5GJTL 4K7PX 1CGUA 1W0VB 1NCWH 4U1MA 4M3JA 3V52L 3O9WC 4MJ5B 4YC2B 2YA2A 5C0DB 3IXAA 3LAFA 4LCWB 5ALCL 3LN4A 2C3WA 3D39D 4U6YB 4HQQL 3QP3A 1HIMH 3KJ4C 4MQSB 1J86A 2ZUUA 1J1PH 1NMBH 2F8XC 1RZJL 4YXHH 4EQ3A 1S8DA 5DJDA 3D0LB 2NY2C 3LQMA 2RQ8A 5GRYA 3QEGL 5EC1A 1OAKL 3T0VA 5BZDA 3B8SA 5LG1A 5IW6B 5C07D 3DROB 4K3EL 2VISB 4RRPG 4TTDC 1INQB 2KZ1B 3E6FA 3UZQA 2DI8A 3EYFB 4RSVA 3BPCA 3EYQC 3GKWH 3PL6D 4G6FB 4QO1A 4RFNC 1JHKH 4MA3A 5EBLA 1MCSA 2IANA 3BOVA 3SN6N 3DPBA 5DJ2A 1XGPA 3QQNA 3T2NL 4MAYC 1G7QA 1HHHB 4NQEA 3GSWB 3OKLA 3QZWA 5IVNA 3HRZA 4P5MA 2VB5A 4Y2DD 5I8OL 3O6LH 5DD6A 3MSPA 4FZ8L 4KROC 1HQ4B 1CDBA 3TJHD 4BZ2H 4KROB 4GRWH 5SX5K 5K59F 1NC4D 1U8PA 5I1CL 1FVCB 3KPQA 4WI4A 1I3GL 3H3KA 5FKAB 5KVGL 2KBGA 2IFFL 2JJWA 4Q9RH 3QXDB 4OSUH 5I1KL 4IIQB 3VFMA 3RZCA 3V4UH 2WLYA 4DKEH 5EFIB 5IW1A 1MJ7H 3T8XA 3SDDC 1T1WB 5DMYA 1B0RA 3GRWA 4OF7A 3ZSTA 1AGFB 4MSWB 2G9HB 3PWPD 4OI9A 1FPTL 1ZMYA 3O0RH 1D5ZB 2AXJA 3CFCH 4HUWA 5HYJB 5KVEL 5CUSL 5I1IL 2HN7B 3FQUA 3CLEH 3MLTB 3MQIA 3FB7A 3EBAA 3KGRA 4YDIH 1L0XA 2KQNA 4NC1C 1KPVA 4HZLA 4UOJA 3ZKXB 1YZZA 1JYWA 3OV6A 3QUZC 5GGVL 4CVXB 1WICA 4ZS6C 4OF0A 4TRPH 3KYKL 1A6AB 2WMPA 4NKOB 1PG7W 2FL5B 3AAZA 1A9EA 1AFVH 1JGVH 1J0YA 1MCEA 3TH3T 1TVHA 3B2VL 1EEZA 1CICC 2P8PB 4Z5RB 5L8JB 7FABH 3FB6A 4LSUH 1OOAA 2UUDK 4NCC1 2DQGH 4Y4FB 3FQRB 3TBVA 4YHLH 3QUKB 5TFSH 4HIJB 3DARA 1QSFD 5L9DH 4KGJA 4X9HA 1G9NH 5AD0A 4LLAA 4IM8A 4OV5B 1GIGH 3U6RB 3O6KH 4U1IB 4OCRH 2HKHL 5D1XA 3V6OC 4XRCA 4RMQA 3P4NB 4UTBL 4KMLB 3MOQA 3H9HA 2ARJA 4Y1AB 4D0DA 2VDPL 5FHAL 1S7WA 1EEYA 3QDMA 1LEIA 4N9GA 2DQEH 3GJFB 2BMKB 5LBSH 5E99L 1SJEB 3CJJA 4KRPB 4FTVE 4MNGE 3UCRA 5T3ZL 5KZCD 3RGHA 1UVQA 2VOTA 2WUCL 2GUOB 4A2MA 3MYZA 1CR9H 1WBYA 3NABH 1HZHL 2AJ3A 2ZUXA 4PB0L 4PD4K 1MLCB 5D7IB 1CGXA 4JFFA 2WNGA 3OQ3B 2PUQT 3MRKB 3BZ4A 1LP9E 4OZHA 5DI8A 1YN6A 2VH5L 3B9KC 1OP5K 3V6FB 1QLRB 1ZK9A 3O4LB 1I9IH 2YHGA 2VDMH 2NXZB 4FXKB 4H1LB 2V17L 5DSCA 2XICA 3VXSE 1RUML 1F00I 3UC0L 2CLRA 1MPAL 5C09B 1RZ8B 5B3JF 1U6AH 5KSBA 2FYYA 1NSNL 4HT1H 4ENEC 3CDFA 3Q5OA 4WTWA 3OR6B 5JHDB 5AYUL 3PP3H 4N8PA 4M4RA 3SOBH 1B0GB 2Z92B 3U4BH 3MYJA 1VGKB 5CMAB 3UJTL 3Q1SL 3VFWB 3SO3B 5I19L 4MZ3A 5F9JB 3ABZA 3MGTA 3PQYA 2BOBA 4V2CB 2Y1VA 4N9OB 1NMAH 4XI5C 4ZO6A 4K8RD 1BZ7B 2P4AB 4JHZA 5C70A 4M7KL 4PJ8A 5FFLA 3RWIA 4Y4HB 3OKDA 5DUMH 5TF1L 3ZTJH 4JFOB 4M7LH 4RGMC 1EXUB 3WIFB 2XKNA 3I50H 3TESA 4JDVA 1CQYA 1KUMA 1KG0A 3ZTJG 2DL2A 3KPNA 3TO4B 4AEIL 1IAIL 1TNNA 2DJUA 1FG9C 1DTUA 1A3LH 1CZ8L 4GBXC 4P3CH 5AUMA 1QRKA 1NKRA 2FH6A 5K59E 3BYYA 3RWGA 2IAND 3LV3A 3IETB 4F33A 3TZVA 1JRHI 3ULUD 3TIDA 1FG2A 1TVBB 4P3DA 4X98A 3P0VH 1JUFA 1FL3B 2DQDL 4NQED 5DZNA 3IDYB 2QHLA 1LO2H 3C09B 3DYMA 4G9DB 1YEHH 3UO1H 2AV1A 1N4XH 4L3AA 4ELMA 5DJ0B 2NW3A 5HDQH 1U8MA 3RVWC 3I3DA 4Z7VB 1AD0A 3QEUA 3G6DL 1UYWL 3L7FB 5HYQA 1KB5B 1P7QA 2LAAA 4PD4J 3QJFA 4HGWA 1P4IH 1CDUA 3OBAA 3TO2A 1NCUA 3IAGC 2EYSA 3S35H 4ETYA 2B0SL 2I9TA 1IARB 5TDNA 1INDH 3KS0J 4OZIB 4IS6B 3RZCD 1XGUA 3MRMA 2XN9B 1HXMB 1S7XA 1QLFB 3T2QA 2XG4A 1ADQA 3HR5B 4YDJA 2BK8A 1N5YL 4FQ2L 2IQAB 2F53D 2C3HA 5IT2H 4PRDB 3VD5A 2YS4A 5C0BB 2JLLA 3DI3B 1PYWB 2IMMA 3MBXL 1D5IL 3THMH 1BX2A 4GRMA 3D2UB 1UJTA 1I9JL 5CJXA 2J12B 4JO4L 3EYOA 5D6CB 2XA3A 2FH8A 4HS6B 3DLQR 4NGHH 1KCRH 3DHMA 3H9YA 3SGJA 4GAFB 5KAQF 5TE7L 1ZV5A 3TIEA 4G6JH 1QR1A 3NAAL 5DJCB 2FX9H 1RZFL 3P4MA 2RCSL 5CZXD 2FX7H 5C0EB 4D9RD 3HFML 1KTDB 4HHAB 1YEJL 1TZIA 1EH9A 2NY7L 1R3HB 1A7BA 4P59H 3BGMB 3CDCA 5JLZA 5KVFL 1MCHA 4LCIL 2ADIB 3TV3L 4HC1A 4J3UA 3SKNB 3VH8A 5L2KE 5D1XD 3MJ8B 4G42B 2ARWA 2GSIA 2Z35A 4R0LA 4YBHA 1IGCL 2QSVA 1S3KH 5I1HL 4APQB 1RUKL 2QR0A 2CK2A 2HFGL 5L0QB 4DGVL 5ITBH 2ZKHH 4WWKB 3QDMD 3ARRA 3P73B 1TJGL 1MUJA 2VXUL 2Y36H 3BI9X 4J7RA 1P6AB 1TXKA 3UAJC 5D96C 3Q48A 2NY0D 3WXVH 4J6RL 4Q9BA 1UKQA 4HUXA 5MI0B 4Z7UB 5D2LF 1A7RH 2WM0A 2XZCL 1T0NB 2DAVA 5I1LA 3DX8A 2VABA 1G1YA 1HHJB 4JFFD 4EOWH 5B3JE 1U8HA 2DQFB 4XZUB 2Y07L 5E5MB 4X7SH 1SBSL 1H8SA 1XIWA 1SJVA 2Q8AL 3NH7H 1GOFA 4FTVA 4MNGA 3WDHA 2CMRL 3LPGA 1KENL 3BKMH 3AREC 5EH1A 2ITDB 2F5BH 1KIPB 4JKKA 4NN7C 1H0DA 4NN7B 4N0CD 4ZD3H 4UBDD 3MJGX 2A0LC 4URTB 3BKJH 1JTOA 2DMBA 2MPAH 5L8LB 1IAOA 4O58L 4NZTH 4JPKH 2V9RA 3EYUL 1S5IL 4LKCB 1HOCB 3TA3A 1C5CL 1F2QA 3EDDA 1A47A 5CLWA 3PWNA 1UM6L 3KHQA 5FGCE 1NAMB 5J7CC 4ZOBA 3VXSA 5CSGA 1C5BL 3PQYD 2XY1A 2R0KL 1IC7L 3PXJA 5ESQA 2IH3B 5C0RH 4MS8C 3AFLA 4KHXL 1MREL 1XEDA 4PJ8D 5A3ID 4DVRH 4XNUL 3PHSA 2GQHA 3BP5B 2YOCA 4U1HB 3RIFK 1U95B 3AS3A 3GSNH 5FYJU 3X3GL 3CIQA 4MMXC 4L29A 3GIVB 5ERWA 3DVGB 1PW3A 2NYYD 3EFDH 2B4CL 5JDSB 4R7DA 4N0UB 4FMFA 3GO1H 3RVTD 3L3KA 3KDMA 3TZVD 1A1OA 3GFUA 3NFNA 5BRZB 2NTFA 1SEQH 4AL8H 5I1EH 4YFLF 4G8IA 1IM9A 2IAMA 1RIVH 1UWGL 4PREA 2YPVH 4XPAH 4NKDB 4F57H 5C2BL 3QUXB 4HKZA 5K9KA 3NA4A 3UDWA 4CL7A 1PGRB 3DX7B 3IRPX 5IBLC 4LFHD 3Q5TA 4KUCF 1Y18B 1S7UB 4HWEH 2V7HB 1FL6B 1P7QD 4WHCA 3BQUB 4JPIA 5D7SL 1P1ZA 5FKPB 2IGFH 5C0CE 5DRNB 1KCSH 4K7PH 2YRLA 3ARTA 3F7YA 1DBAL 4OGZA 3VA6A 3BYTA 5CSBA 3HTLX 1YN7A 3CVHA 3V6ZA 5IHBA 2D03H 1CBVH 5HXMA 3FONB 4LLDB 1BJMA 1WWBX 3TGXA 1L7TL 4UT7L 1T1YA 2PTVA 2BVEA 4PBXA 5DF0A 3H8NA 5TE4H 3REVA 4M43L 3CC5B 4FN0A 4P4KA 2QQNH 1R24B 3MFFB 4KRMB 1BQHG 1UZ8B 3D3VB 5HD8D 2OYPA 4HAGA 1AXTH 5D72L 4Y19B 1DBBL 4X0KA 4HZAA 3N1FC 3QCVH 4JVWA 3MLZH 2HAZA 1FIEA 4LNRA 2QV2A 3HZKB 5JOEA 2L7UA 4XP6L 4G7YL 4LLMB 4UB0L 1GL4B 1NGYB 4EIGB 4TUKH 3KPRD 3FQXB 4C4KO 5D9SB 3S97C 4HPOL 3ZL4L 2Z93A 1I1RA 4F7PA 5KJRL 2OM5A 3BSZH 1SBBA 2I27N 4OCYH 3MR9B 2MKWA 3P9MB 4JKPL 1VGEH 3HUJB 4PJAB 2DYPA 5DD3L 3BWAB 4MA7L 1C1EH 5D1QA 4NO5B 3I6KB 2I9LB 2XKSA 4YEFA 4YHKL 3FO0L 3GBNL 5ETUB 2YC1A 3ARUA 3X13B 1G6RB 1NCDL 4WO4A 4J3SA 2F54B 2RJMA 3PL6B 1U8OB 4Y8DC 1JI1A 4WNQA 2GI7A 5EWIH 4IMLB 2DBLH 4F7MA 5K33A 3VXRE 4P2OA 5J06A 5BVPH 4Q2ZA 4LAQH 4R6UA 1S7TA 1K5NA 3V8OA 1Q9WB 4WCYL 5GJTH 1RZIB 3L9RB 5IJKC 4S1QL 4FXLA 4JM4L 4ELKB 3RGVC 3OGCA 1F3DH 2AQ2A 3HCVA 4GW1A 4HIXL 4Y2DB 1YEDB 5L2KA 4L3CA 3BHBA 4HUVA 2OX5A 4FNLL 4Y2OA 1A64A 4NQSB 1RULL 3ZO0A 1OF2A 1KCUL 3QUMH 1PEWA 1NC4B 5AZ2H 32C2B 5D71L 3RWEB 1XIWD 1OAKH 4FTVD 2ERJB 4NQXA 4L8DA 2GITB 1J8HE 4KXZH 1NEZA 3DI2B 1HKLL 3TBYA 3A67H 3RIFF 4YXLL 5CD5C 2H6PB 5DDHA 4Y5XA 4AJ0A 2ENYA 1H5BA 2OXHA 4R2GC 1Z9OA 3SDXF 3TCLB 4YQXL 1MCOH 5HHOE 2AI0H 3MPCA 4W6WB 2V9TA 4UIMB 2HLFC 4JQXC 3T2NH 3EJZC 3VFNB 5BCAA 5I1DA 1BEYL 3V0AC 3BUTA 1ED3B 3QAZC 3TA3D 4JY5L 3QQ4B 4OZFA 3W39A 3QAZB 2DMKA 2H1PH 4F9LC 1NH6A 4JFYB 1J05A 3VXSD 1FHGA 2IBZY 2ZG1A 3MUGA 5EU3B 4BFBD 3T1FB 1UB5A 5K9QG 1LEGB 1R5WA 3L3OB 3QFDB 3WE6B 3QWQB 2DS4A 4WI9A 4KK5D 1KPUB 4WGVB 4QHUA 4DFHA 2H32H 2WWKO 4JO3H 3P77B 1I3GH 5KVGH 4U2ZA 4KKNA 3PP4H 2IFFH 5J6HB 4HJ0D 4LDLB 1KCVH 2JK5A 3S4SB 1HI6A 1GSMA 5FCUH 4CW1B 1QSFB 5DVKA 4P9HH 4RIRA 3MRHA 3QWOA 2E7BA 3VCLA 3O3BA 3F12A 1ZHBA 3UYPA 5IQ7H 1YY9D 1CGVA 2UZIL 4UINL 4FQJH 2CIIA 1MY5A 4QWWC 1FPTH 1VHPA 4U0QB 3ARFA 3IJYB 1IM9D 1MCQA 2OJZH 4JLRB 3WXWL 4CNIA 2IAMD 4ZPVA 5CUSH 1WISA 4MD5B 4HJJH 5I76B 4KK8D 1XCTB 3FCTB 4GS7B 3AS2A 5DHVH 3VD7A 4BKLA 1GC1H 1MRDL 1JGLL 1D6EB 4PYGA 4U7MA 1KLGB 4U1NA 5GGVH 2ZOLB 2XI9A 1T0MB 1DBJL 3DMMC 4DN3L 1HKFA 4Z77A 3WIHL 4WV1B 1OB1B 2OSLA 5I73C 3FHQA 1IC5H 5I73B 3W82A 1EJOL 5SWZE 2QQKH 4OUUA 5EIQA 2VDOL 4HFUL 4JHAH 4AMKL 2X4SB 2ITCA 1E28A 1F3JA 1T89A 1F4YL 4JAMA 4P4KD 5JW5B 5C0CA 3DVNB 3ZT5A 2G5RA 4DN4H 3EOAA 1WZKA 4P5KA 3W5NA 4UTBH 4EXPX 5IJVB 1ND0B 4GJTB 5KS9B 4KRLB 2GY5A 1XH3B 1T22B 4LSSH 3U9UA 4EBQH 1CS6A 5IESL 3R4DA 5F7KC 3LDBB 2VDKH 2ICEA 4PJXF 4I5BB 5DJZA 5DS8A 3IXAB 2DF3A 5T3ZH 5E4IA 1YC8A 5JHLH 3LN4B 3FQWA 4WW2F 2VQ1A 3A6OA 1EX0A 3UTPE 1OP3K 3BX7C 1OLLA 4OCWL 1HINL 4FQXC 4LMQE 2H41A 2I25N 1S8DB 5DJDB 4XC3L 2DYPD 1FIGH 5D1QD 5EC1B 3H9SE 1F4WL 4OLVL 5TJWK 5BZDB 1Q9KA 2AQ1A 3DWTA 1ETZA 4Z78A 4OFVA 1UXSB 5D1ZA 1P2CA 3E6FB 2D9CA 1UM5L 4WO4D 3FAXA 5DMKA 3BPCB 1RUMH 4MA3B 4GUPA 5EBLB 3NTCH 3I75A 4LEXL 4P2OD 3V7MA 1MHPL 5DJ2B 1XGPB 4GMSL 3ULUC 1IGIL 1PQZB 1G7QB 4JG1H 2BVQA 5AWNH 1XGYH 4NQEB 3HRZB 1PZ5A 4P5MB 2H26A 3DV4B 5BZWA 1BAFL 4KHTH 4OGAD 5L2KD 5DD6B 5D2LA 1FLRH 4LSPL 5JNYB 5I19H 4RMTA 3IJHA 3QI9C 2ZUYA 4HD9A 3SDXE 3RWDA 3VXRA 4MXWL 3RP1A 1U8PB 3QXUA 3AMLA 3ARGA 4M7KH 3KPQB 5CJ8A 3FMGH 4M1DL 1XF3B 3V5KA 4CMMA 1YEKH 4QT5B 1X3DA 1I3RA 1K4CA 1A6TB 5FK9B 4FQCH 3MLPA 3RY6C 4BK4A 3VFMB 2LU7A 3RZCB 2LV4A 5GISL 3BD5A 2C4FU 3IKCA 5IOPA 1MFAL 3CU1A 5IW1B 3MRRA 4XPHH 1F97A 2EH8L 3T8XB 1KTRL 3MV7D 3KPMA 1N2RA 1LO3L 4NKIH 4GAGL 1KCKA 2F53B 4DGIL 4HS8L 3ZYIA 1OW0A 3U9PL 1I9RL 2D9QB 1GPOL 3BD3A 4HUWB 3O4OB 1J8HA 3FQUB 3HE6C 2XTJD 5GRJL 4WI7A 4BZ1L 5CJQL 1KPVB 1YNLL 2NNAA 4HZLB 4NP4H 1FLTX 1IGML 1EGJA 3H7LA 3WS6A 2AJUL 3G6DH 5E7FA 1UYWH 3L1OH 2FEEL 3AAZB 1A9EB 1NFDF 1TVHB 1GGIL 2FIRT 1BVLA 1EEZB 1G7IA 2F15A 4IOFD 2B0SH 2NY4D 2HRPH 1E4KA 3U0PA 3FB6B 5E94A 5ITFA 4D0BA 3TBVB 3SE9L 4JO1L 3BAEH 3WNLA 4QXGL 5MHSE 2LFGA 1G7PB 3LB6C 5AD0B 4FQ2H 5HDBF 1AP2A 2V6HA 1O7SA 5D1XB 5KSAA 4H26A 5HYIA 2ZUWA 5HI4D 1OSZA 3BPOB 3HC4L 4XXCA 3EW3B 5CIPH 3IGAA 4XRCB 3ARFD 4LPCA 3H9HB 2ARJB 3MBXH 1T66C 4D0DB 5GS0D 1S7WB 2PW2A 1EEYB 2D7QA 3QDMB 1LEIB 4N9GB 3CXHK 5F96L 2FLRT 1I9JH 5D2NC 1DR9A 3LS5L 2QSQA 4JO4H 5D2NB 4X7CC 4ZAKC