4HG4K

Crystal structure of fab 2g1 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
DIQLTQSPSSLSASVGDRVTITCQASQDIRKYLNWYQQKPGKAPNLLIYDASNVKTGVPSRFRGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPITFGQGTRLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
publication title A recurring motif for antibody recognition of the receptor-binding site of influenza hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 14
structure length 106
sequence length 106
chains with identical sequence M, O, Q, S, U, W, Y, z
ec nomenclature
pdb deposition date 2012-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hg4K00
2RIKA 4HS8L 3QEHB 2R39A 1DBAH 3VFRB 5I6XB 1Z5LB 3S5LG 4FQCH 4L3CA 3ZDYF 2DIJA 3P4LA 1FYTD 3VGAB 4OUUA 5CILH 4EOWH 4U1LB 3OR7B 3E6HB 5C0DB 3BESR 2V5SA 1KC5H 1RUMH 4BUGA 4CN6A 4LRIC 3HG1B 5FGRA 4P3DA 2YSSA 4JN2A 1KEGH 3C08L 3IDIA 1OP5H 2ADGA 3EZJB 3IDYC 3LRHA 3UJJL 3MNWA 1U41A 3L3OB 1Q1JH 4JFZL 5C6TL 1GSMA 3L5XH 4D0DA 3ARDA 3EJJX 1C16A 5CKGA 5HGHA 2XZCL 1KLUB 2PXYB 3BUTA 4C56D 3CMGA 3QDGB 3EFFA 5D8JL 4XCYB 1D7FA 1C1EL 4UQ3A 2H2PD 1RULL 5C07B 3H6JA 3MQIA 3U0TB 3DX8A 3G6JB 3B6SB 5CEYB 3LKSA 4OLEA 2ZG1A 5D72H 5JHLL 4YDVA 5HYSG 1K4DB 3RPKA 4JHZA 4JCMA 5MEPB 1U6AH 3T3MF 1QVOB 4UTBL 2PYEA 3LQAL 5DHYB 1AFVH 3RDTD 4MSWA 5GGRA 5C2BH 5J1TC 4P4KB 5I1IL 5IHBA 4HULB 1MCHA 2VITA 2WWKT 1ADQH 2R1XA 2E9JA 2CDGA 4GKSB 2X4QB 3ESVF 2VXUL 4OV5A 4Y2DD 2BP3A 2QQNH 1RULH 5L2KB 1AJ7H 4LSQL 1H3GA 3UPRA 2R0KL 5JHLH 1G7PA 1IZJA 1NSNH 3ZSSA 2G5RA 2DL2A 2AJSH 1UWXH 3QIBA 4N5ED 4TNWF 4N0CD 5EU5A 1UVQA 2FJFA 4AT6A 5HHVL 4NQDB 5HXMA 4B7LA 3N06B 3PHSA 4KQ3L 3SE8H 1T7YA 4IJ3B 4MJID 4XZUA 3IU3B 3QXWA 5D7KE 1EEZA 1OL0A 2JJTC 1WEJL 4EVNA 1E27B 1Q9LA 2HLAB 3SGDH 3C87A 4P2YA 1CQYA 5JOFA 3ET9F 1UQSB 1IQDB 4X6DA 5DJAB 4QT5A 2AXFB 3BH9A 2R0KH 3D39B 3T0ED 4R7NA 4S1DD 1GH7A 3HAEA 1DVFA 1RHHA 3ARED 4LARL 3V6OA 3FONB 3C6LB 1O7VA 3ARVA 4U31A 3STLB 1N59A 1XGYH 4TNWK 2V7NA 4H0GA 2A73B 3O45A 1TPXC 1DQLH 3T1FA 2XKNA 3SDAD 5ENWB 3BWAB 4PJ9C 1ZLVK 4S1RH 5DRZB 3SOBL 2X9XA 2FIKB 3MRLB 4ZAKC 1GZPB 2O5XL 3QUKA 5F1NB 1HHGA 2Z8VC 2R29H 1JRHL 4ODWA 4ONHA 4LU5L 1CGUA 5BW7C 1OGAA 5IHUH 3WN5B 1MEXL 4YJZL 2DQIH 5BOZG 1Z0NA 3ES6A 4QWWC 1NAMA 2Q86A 3BQUD 4QRRA 2JKXA 4MCYA 4PJBE 3DRQB 4NFBA 3VDCA 3BHBA 3ZKSD 2P24A 2WSKA 2E7BA 3CSPA 5F6HI 3MLVL 5EB9A 4OZFB 1F3DH 1YEGH 2DQGH 2E9BA 2VRAA 3GMRB 1AGFA 5D7JA 3BH8B 1RFDH 3SKJH 1ITCA 1ACYL 5HYJD 5TH2A 1G7JA 1T4KA 3OQ3B 1QFUH 2DWDB 3U7AA 4YQXH 2YWYA 3NFSL 3O3BA 3TT1H 3D0LB 1MCQA 2LU7A 1BVLA 2ITCB 3QUMA 4NC1E 4A6YH 5L2JB 1D9KD 4U49A 2ICWJ 4J23A 4XP4H 1OT1A 3KLAA 1XIWA 3PWLA 4Y4HC 3SE9H 1JWMB 4QXUH 2PO6C 3VXSB 1YY8A 1QBAA 3T77B 2EH8L 1R5VB 4GAFB 1P4BL 3WYRA 3P40A 3CMOH 4PJ5E 1X5HA 4JZNA 4WUKL 5K9KB 2Z92A 4XPHH 1HHKB 2N7BA 4FQQB 4PB9H 5A3ID 1FH5L 5GXBB 1NMBH 3UJTL 2L0DA 4AG4L 4F7EB 3IJSB 5E1AB 3TWCH 3LCYA 4IRJD 1EEUA 4HGWA 3P4OB 4XB8A 5C0BE 4PJDB 2Y07L 4HT1L 3PHQA 2R1WB 1FAIL 1V3LA 1A7NL 5E8PA 1IJ9A 12E8L 2BVOB 4FOMA 5E1HB 1KULA 1CWVA 1RUAL 4HGKC 1NEUA 35C8H 4M7JH 1W72A 1CE1L 4LAQH 5MHSE 2YWZA 5KSVA 4E5XA 1PW3A 5GRVL 4DAGL 4KMTL 1XF5A 4TTGA 1EGJL 1G7IA 5JORA 2MKWA 3RUGE 4YXHL 5I75B 3WL9A 5E95B 1DTUA 1P69B 5KJRH 3IVKB 4FMKA 1YJDH 2GSGA 3VMOA 5FO7B 1QRKA 2R0WH 4HT1H 1U8HA 3M07A 5HHQA 4DGIL 1Q9WA 1NMAL 1U8OA 5ADPH 2X4TB 4F7TA 5AAWA 12E8H 3PP3H 4HIEB 4L4TD 2OJZL 3KJ6H 1QFPA 3MO1A 5I2IA 4IRSB 1GGBL 3CFJA 1GGIH 3B9EA 1MH5A 2AAVA 2ICWA 2X4RB 3BP5A 1KJ2B 4WW2C 3BGFC 4YXLL 5FEBA 4LVHB 1WLHA 3BAEL 4RFEB 1KB5L 4TVPE 4DGIH 5TQ0L 3CX2A 1IGIL 3VG9B 5JXAH 2KZWA 4S2SA 2YR3A 2GT9B 4I4WA 4RDQG 1KXTB 4EIGB 4GRLA 2OJZH 4MX7B 5I17A 1MFEH 4FP8H 3F12B 4LCCA 3EIFA 5CD3B 2F58L 1D6VH 1PKQE 5KBNC 4NQXA 3U46B 1S7SA 4ZXBA 1DJSA 1JV5A 5ELIA 5D9SA 1WCBB 4DN3L 4JLRA 4W6YB 3MBEB 3DURA 3ARQA 1CGXA 2BERA 1EO8L 5I16B 4NN6C 3K8KA 3CDGB 5HGAA 1B0WA 1U8KA 4TTDC 4Z18A 4IMKA 2LAAA 4YHOH 3BEVB 1MCJA 1UH2A 5C0AE 3F6LA 2XN9A 4J4PD 4NWTL 1BIIB 4U1HB 4NJ9L 3L3GA 5CGMA 5FA3A 4LK4A 4ZQKA 5IF0B 3M45A 4H8WC 1MCWM 1FPTH 2NY4C 3HRZA 3RWJA 3S8WA 1BP3B 4HUWA 5HVFB 1YNLH 4WV1C 2V5MA 3KPQB 1AI1H 3BJ91 2VYRE 1OD7A 2VKXA 3CXDL 5KAQG 1KIPA 1RQ5A 1QFWL 1BAFL 5DQDH 5KS9E 1FZJA 2NZIA 1MRCH 2QQKL 3C60C 2GAZA 3IDYB 4MJ5B 3H9SE 4UAOC 1A6VL 2PXYD 3O11B 3QDGD 1Q0XL 3OJ2C 3QUYC 4ODXA 4OF8A 5C07D 5T1DL 2NY7H 3AU1B 4UOW0 5GGSB 4YHLL 2YUXA 2R1YB 2VDML 4PY7B 4NQCB 3K4AA 3QSKB 5DR5H 3ZMRA 4GW4B 2HT4C 2R2EB 1RPQA 2E7CA 3VA6A 3CXDH 1TZGL 3O3AA 1QFWH 2E7LC 4I48A 4NNXA 2IADB 4WIQA 4GXVH 2A77H 3MGAA 3UTTE 1KB9K 2XFXB 3BPLC 4LLWB 4ZMAT 3FTGA 1X9QA 4CW1A 3DI3B 3OXSA 3VD9A 1VA9A 2EEDA 2MJWA 2NY1C 4P2QA 1BGXH 5AZEH 1TZGH 5KOMC 4YGAB 3B3IB 1RIUH 3VFWA 5ERWA 1DN0B 1ONQB 5D71H 1LEIA 4K3JH 5ISZE 4HIJB 4NN5C 4X4XB 4J12A 4PRPA 5DUBA 3PJSB 3ZTNH 4Y16A 5EOQH 5EU7C 5IMKB 4PJBB 3TFKC 5GSRA 2ERJC 3CLFH 8FABB 3D39D 4NNYA 2R0ZL 4K7PH 5C0CE 2VC2L 2VLLB 5CZKA 1NDGB 1MCIA 3MRIA 2HRLA 5GZOD 3B9KA 1MHEB 5JW3H 1U95B 2R2HA 2ICEB 1QBBA 1YYML 3CPLA 4PG9A 5HYQB 1Q9OB 1K5NA 4HX1A 2MQCA 4C59B 4DTGL 2P5EA 3OKMB 5FF6A 4NN7C 4WENB 2HTLC 1ED3A 1W0WB 2CGRH 1FFNB 2B5IC 2BVPA 2QLVB 1PLGL 2A9NH 3DIFB 3C9NA 4P4RB 2KQNA 5T3ZH 2D7PA 2X7LB 3DX7B 3VRLF 3QO0A 3GNMH 1UWGL 4R4BB 1FE8L 5JMOC 3EO0B 3G5VA 3PG2A 1OP5K 2D7MA 4RRPA 4M8VA 5EBLA 1AO7A 4PRNB 3UTQA 2ZUXA 1JCKA 3MLYL 4ZAKB 4FQXA 3IDXL 1QR1A 4PJ5B 3QJHA 4UT7L 1C7SA 3LVEA 4DQOL 1OQXA 4U1NB 1L6XA 4W6WB 3G04A 1BWWA 1O7SA 2Q6WA 4AEFA 5J1AA 3VU2A 4FG6C 1QOKA 5BV7C 2GK0B 3P9MB 5FYJL 5I66B 2OI9C 1KJ2H 4YFLI 3ARFA 5FUCE 3PL6A 3IFLH 3MLRL 5B3NA 3CSGA 5C0BB 4WHDA 1IGJB 5IW1B 1TVDA 5CMAA 3TNMA 3IDXH 5JIPA 1JNLL 1NUFA 2VE6A 3B9AA 2GFBB 4OLXL 1QYGH 3GSOA 3QFJA 5SX4I 3VRIB 2EDRA 3PV7A 4OM1L 2OMBA 5DJCA 1A2YB 2VLJD 2IMMA 1VGEL 4XCCL 3VXSD 4DN4L 4K07A 1NC4B 4DOHE 1UWXK 3RUGB 3G5ZB 5FO8B 4Y4HB 4TULH 2PO6B 4D94A 4MJ2A 4KZDH 3WJJA 4ZFFA 4IS6A 1JF1A 4O2FB 5DVLA 2A6DA 3QA3A 5KVEL 2ZUVA 2QHRL 4LEOB 1FFQA 4DK3A 5CIPB 2EIBA 4XBGA 1CFSB 1AGCA 2CRZA 5TDPB 4OM1H 3RIFF 3SPVA 1KIQA 4NO5B 3X14B 4LSSH 3CSBA 4LCIL 3MRFB 4RWYL 1HZHL 1N5YH 4GMTH 3DARA 1RIHL 3RGHA 2P44B 2Z35B 4R90L 5C0RL 4G80A 2BY2A 5CBEA 5T3ZD 1NCNA 1CVRA 5KVEH 4JO2L 1OLLA 3BN9C 4NQED 3WBDA 4ENED 4OCYL 4HLZH 3HE7C 1B6UA 2XKSA 1LEKB 4P99A 1R0AL 1S7RB 3ARBD 2FB4H 2VUOA 3QJFA 4EXKA 4Q9QH 4UNUA 4XMLH 4PV8A 2ARJA 1PKQB 1S5HB 1WWAX 5DLMH 5T3XE 3R1GL 4PUBL 4F58H 3RIFK 5J3HD 4RWYH 2EO9A 3AY4C 4JY4B 1HI6A 1ZHLB 2HFGH 5C0RH 3CK0L 4TRPH 4KVNL 2NXZC 3S96A 3R0MA 5K9OB 4ZUVA 5JPNB 2VB5A 5C0AB 5TGBB 4JAMB 1CK0L 4Z7NF 3LKNB 3H3PL 3KPPA 2AJXH 3OG4B 2DIBA 1R3JB 3SGKA 5CCKH 3ZZ1A 4EIZC 4M6AA 2ZCHL 4JFFA 4OFPA 4XCFL 3B9VA 3IGAB 1F4YL 1QRNE 3RX8A 1N4XL 1QO3B 4EDWH 2B8OT 3BGFB 1MQKH 3SDYH 5TE6L 1NLBH 3KYOA 4N5UA 3CK0H 3MBXH 3PWUB 3U48A 3CXHK 4M03A 2V5YA 1BFVH 1ETZB 3O41B 1A7QH 3IJHB 5GRYA 5KS9B 3B4NA 3GSXA 1CK0H 3GO1L 1FYTA 2EZ0D 1GC1L 3H9SB 3O8XC 3O6ML 1B4RA 4EI5C 3KS0J 4I3RL 3UC0H 3EO1A 1SEQL 5J4MA 3ZTJG 4K3EH 5GSVA 3DI2B 1F4YH 2R8SL 1YN6A 4AM0B 5B8CA 1R5WB 3AAZA 4ETYA 4ZFOB 2VDRH 2XZAH 4XAKE 3DVNB 5JNYA 1AQDB 1X7QB 3AROA 4RIRB 1X5AA 1YDPA 2DD8H 3BZDA 5CWSA 5BRZE 1FORH 4KJPD 3V0VB 3O6MH 1MHHB 2X44D 1B2WL 4C56A 1A1NA 4HSQA 3LN5A 3UTTB 3I02A 4IHOB 1IC4L 2YKLH 3F58L 2DBJA 2R8SH 1KJMA 2NY4B 1NCWL 3ZE0E 2AV7A 4WV1B 3VXOA 3G6DH 1G9MH 5IBUB 1UADC 1IAOB 1SYVA 5KSAB 3C2SA 5AUMA 1I8LC 2NTSP 3RDTA 1DLHB 3NA9H 2COQA 3O6LL 4MNQE 3ULVE 2BNQE 4TSAH 2GJZB 1I7UB 3BPOC 5D7KD 5ISZB 4IOFD 3C60B 4XPAL 3KWWB 1P6FA 4UAOB 4J1UA 1I4FB 2VZOA 3HC3L 3RGVD 3S34L 3JTSA 1S9VA 1F3RB 4NQTA 3U2SB 3QUYB 4Y2DA 3CFKA 1ZV5A 1U58A 1G7QB 5C0CB 3MJ9A 2OTWA 5I8CB 4OLZL 2A6JB 5I1CH 5C0FA 4PJXE 2BRRL 1WV7T 1T1WA 2CLZA 4NRZA 4XNUL 1ZGLP 3PP3K 2HJLA 3REVB 3MLXH 3VD5A 2NY6C 3Q1SH 5F3BB 4U2ZA 1TNNA 4PV9B 5SWQA 1T2QL 1FZKB 4YHZL 1SYSB 4JFEE 4MJIA 1LE9B 1JZ6A 2JJVA 4JHAL 5GRVK 4HAGA 4R26H 1B88A 4HKZB 2YPKA 3BPLB 5EG6C 2WUBL 4OLZH 1DEEA 1P4LA 3T0EA 4HWNA 3QHFL 1A6WL 3AREA 4WJ5A 4RA0C 2DJUA 4NT6B 1S78D 3NCJL 1T2QH 4XPBH 2CPCA 2YPVL 1GXEA 2Q8AH 4MVBD 5ANME 1KTKE 4ACPA 3EOBB 4JHAH 3VXTB 1I1YA 3VFVB 3U6RA 4LLVA 2IBGA 3KYKH 4NN5B 5CIPH 3S3PA 4YZFE 2QHLA 4AQOA 2V7HB 4RAHA 1K85A 1KJ3L 4TUJA 3OSKA 3CC5B 4ZUWB 3E8UL 3SDAA 1VPOH 5IB1B 3TBWA 1T66C 1IEBB 4KJYA 3U4BL 2BY3A 4EKXA 1IILE 2EKSA 3WUWG 2I9TB 2WIIA 5HY9A 2KDGA 1RHFA 5HJ3B 2Q8BL 1JZ5A 1CDUA 1F4WL 5DK3A 4MD4A 5J56B 1DL7H 3WIHL 4TVPH 1RVFH 1CT8A 4UT9L 4UTAH 2G2RB 3WMSA 1U36A 5MEOA 3BQUA 2JK5B 4EI6B 4ZG1A 4UOW1 2R9HD 3O3DA 4NWUH 4CDGC 4NPYB 1A64A 1WBZA 1X5JA 4ZUTA 2DJ4A 3H7BB 4V1DE 4DZ8B 3DPBA 3HPLA 1FV1B 2IPUG 4JO3H 5DURD 3MRKB 3U4BH 4JQXC 4DOHB 3OZ9H 4R3SB 2XWTA 4XP9H 5F6IB 4F2MB 1N7ML 3FRPA 3OR6B 2RFXA 4PJ5D 4P2RE 1ADQA 3WJLC 5HYJA 2RBLA 5FHAL 5J89A 2V5RA 1MCOH 1TVBA 1C5DB 5JDSA 4UT9H 1OQOA 4RAUA 1T7XA 4N8VB 5INDA 3CFEA 3VWKD 1C5CL 4UU9B 3HB3C 4PJHB 1RUKL 4HZLA 3MXWH 1D9KA 5IBTL 4WHTA 2D4DA 3GM8A 4RBPK 1DUZA 5DEZA 5DDHA 5JW5A 4K9EH 1TJHH 4PGDA 2X1QA 5IMMA 1MIEH 4UV7H 3TYFB 4HHAB 1BQHB 5C0BD 1N7MH 2OI9B 4UMGA 1S7WB 1MFAL 3DVGA 1KN4L 4DGVH 1H3UA 3SY0B 3WFDL 2NMSA 1ZHKB 1LNUA 4U1KA 3BP7A 1RAMA 1UWEL 2NXYC 3BRDA 3MACH 3LIZH 3GMLA 5BZDB 1FGNL 1WIUA 2R69L 4Y5YC 5F9JB 3MRRB 4FTVE 4QHMA 5MHSD 4G8IB 4KK5C 4P5KA 1T20B 4QLRA 4PJAB 2HMIC 5I0ZA 1NC4D 4W81A 4IRJA 4PJDF 1YMMB 1A6PA 4Y4HD 4PB0L 4EN3D 3OKNA 5LGJA 3LKOB 1C12A 1T04A 3MRGA 3AM8A 4HUXB 4ODHH 1RU9L 1HYSC 2ADJA 1CXFA 5GHWL 4LSTH 2BRQA 4NO2A 1UWEH 4WI3A 5EUKB 3L3JA 4HXAH 4RQQA 2KZ1B 4O51A 1NEZA 3S88L 3MLWH 2DLEA 3RI5F 1ZVYA 1EFQA 1ZE3C 2BVYA 3PABB 4GBXB 2VDOL 2B2XL 2BSTB 1CYGA 3JVGC 1X4XA 4IEFB 4R4FL 5I1GL 3EOAA 4LF3A 2E7HA 3OB0H 4H8WH 4ZOBA 4BFEA 1QBMH 1MHPH 1P1ZB 1QRNB 4QHLA 4TVPD 3BZ4A 3GSUA 3M8OL 1RZIB 4WCYL 3OAZH 5EFIB 4MHHI 1IEAA 3I6KA 1MLBA 5IM7A 4M6ML 1OGTB 4L4TA 3T4AB 3DLQR 3TYGL 1EO7A 1JP5A 4XB7A 3HE7B 4KK9D 5DJDB 4GMSH 4UILH 5BQ7A 1FL3B 3RI5K 4PJ7E 5DK2A 4DKFL 3O6KL 5D7LE 3HNTL 2AJVH 2OTUA 4QGYA 4JM2B 3QH3A 4GW5A 4M62H 1T3FB 1BECA 4CJ1A 4MB5A 4L29A 1IQWH 1NKRA 5E2TL 3DYMA 4A6YA 4HIXL 5DMIL 2NXZB 2ZPKH 5BRZB 2D0FA 4NKDB 1IGTA 5F7HA 5ALBL 5DJ6B 2CXKA 4LLQA 1WQVT 3HZKB 4UIMB 1RZJL 1U8QA 1D5ZA 2XT1B 5LAXB 3KPSE 4DKFH 3P9WB 3MFFA 2FJGA 2FYYB 5CSZA 3C5ZD 1AD9A 3PWVB 5JW4N 3QEHA 2OL3B 3X3GH 1PSKH 4WW1A 2VDLL 1Z5LA 2IFFH 4CVZB 1CDJA 1OARL 3EYQD 4J4PA 4U1LA 4MNQB 4OFYD 4MXQD 3E6HA 1VESA 2FX7L 3LB6D 4L9LB 4LL9A 4OCLC 2MQ3A 2E7MA 4KMQA 3UX9B 5IFJB 3C8KB 4FQ1H 3O8XB 1FBIH 3QUZC 4LSDA 1QLFB 5IBLC 2H26B 1P9MA 2RAMA 3LV3A 3L3HA 3G6AB 4WGWB 1M1SA 2EXYC 5ID0B 4V2BA 3FMGL 1VEPA 4PJXB 3D5OF 1QKZL 2DQJL 4X6CE 1OARH 3B2VL 4FQJL 4OGAC 2XZQH 4Y7MA 4UINH 2QSQA 3O2WL 4J3UA 2PXYA 3QDGA 4UT6H 1IGYB 4JFEB 4GAGL 3BMVA 4XCYA 3UTTD 4LGSB 5LQBH 4NZUL 1EJ6A 4NO0B 5C07A 5INCB 4K71B 1F00I 3U0TA 1QBLL 3HZMB 3B6SA 1WC7B 2IH1B 3B9DA 1K4DA 4LOUC 4DGYH 5MEPA 3V6FB 3VXRD 5FUOL 1P7QB 5GRWA 5KSAD 4N1EA 5DHYA 3GBMH 4UDUB 4ZYKB 1QKZH 2FO1A 4KXZH 3MJ6A 3NIFE 3HTLX 3WSQL 7FABL 1JHKH 3WIIH 4F7CB 4KAQL 1MWAB 2PW2B 4LEXL 5ANMB 4GKSA 2X4QA 4WO4C 3FO0L 3U7WL 5DD5H 5IFHL 2UZYB 1MCCA 4M43H 5C0CD 5EBWB 2D2OA 2Y36H 1JPST 4G6ML 2DM3A 3PDOB 3TCXA 2HT4D 3JSSA 4JFDD 4KHTL 2Q3AA 4K7PY 5T3XL 3MA7B 2E6QA 3X12B 1X5LA 2NR6D 1YEKL 3FO2B 3IU3A 7FABH 4YGVA 1E27A 4PJBF 1AIFB 2HLAA 3MNVB 3FO0H 3I50H 1TDQA 3RNKB 1I9JH 4NCC2 4D2NA 2W92A 3UMTA 4MMZC 2IH3B 2AXFA 3D39A 4WWKC 2CMRL 5HHOE 1P84K 3BISA 5KVDL 1CGSH 5JOPE 3BKML 3O81A 1TCRB 2NW2B 3FONA 1T0NB 1C08B 3GMQB 3STLA 1I3UA 2DM2A 2IPKB 2I60L 3MGTB 5IVOA 2A73A 4B41A 4DUXA 4P2RB 2WK2A 4U6VL 3S35H 3VFPB 2BNRE 1FL6B 4FFYH 1YPZE 5F1KC 4XGZA 3BWAA 4HAFA 5JIIA 3T2NL 2CMRH 5DRZA 5E2WL 1GZPA 3UBXB 3I9GH 4XVTH 5F1NA 2DRUA 3IS1X 4KI5E 2N56A 3QFDB 3TPUB 2C1OB 2KUTA 3MNZB 3N9GH 1YEFH 4JPWH 3WFBH 2B1HH 4H88H 5D70H 1JN6B 4YBLC 3B8YA 4MYWB 4UV4H 2H45A 1N6VA 3DRQA 4CKVX 1MLCB 2XQBL 3QIWC 3U4EA 3T2NH 4S1QH 4LRNH 5B38G 3GMRA 4WGVB 4XWOC 4DVRL 1J8HB 1WBXB 4KU1A 1FCCA 1K3ZA 3GK8L 2VZ3A 1QSEE 3BH8A 3MV11 5CZXC 4MHHG 5IR1B 2DWDA 5DD3H 1IE5A 4HBQA 3D0LA 3FKUS 3JXAA 4G8EB 2VDKL 3JV0A 4D8PB 4YX2L 3FOMA 3ULVL 4PP1C 2XQBH 3U7YH 3F7VA 3ILQD 4G3YL 1YZZA 3RUGF 5JTWA 1DBKH 3ME0A 1JWMA 1NGPL 3HMXH 1UZ6E 4MQSB 5IW3A 5T1LB 3VXSA 3O2VH 3T77A 2FO4B 3FO9B 4QCIB 1R5VA 4F9LC 5DEFB 4KKAC 4F3FB 2J7LA 3CX5K 2GCYA 4ZOAA 1UACL 1GRWA 1VKXB 5C08B 3CVIH 1AHWC 2OL3H 3QQ9C 1HHKA 2ED7A 4OZGE 4LPVA 4RFOL 4JDTL 4XPGH 3EJYD 1KUMA 2X70B 4XPTL 3S5LB 2BOCB 5FOJA 3ULVH 1A6ZB 3CLEH 5D1QC 4F7EA 5I1DB 5E1AA 4R2GB 3H8NA 4Y5YB 1A1OA 1DQMH 5F7WC 1FLTX 1LD9B 4MD5B 1G6RB 2GJ6E 2I07B 1QPXA 5T3XD 3BIBX 2W9EL 1XGUB 5EO0B 4PJ7B 3TESA 2DLIA 1XMWA 2H3NB 4PJDA 5D7LB 1U8JB 2R1WA 1MVFA 4XP1H 2ADIB 5I1AB 5GGSY 2AXJA 4LVEA 4POUB 4TOYL 4RFOH 3WS6A 1BWMA 4JDTH 4FZEL 4NQEA 4JHBA 3BKJH 2WANA 1EV2E 5TE7H 3KYMB 2OMNA 4GBXD 1F4AA 4O00A 3T08A 3ESUF 5TE4L 3X3FH 4JJHA 4PS4L 2VLKB 5E99L 1MF2H 1KLGA 1QRND 5FO7A 2HN7B 2DDQL 1TENA 5LGHH 3FQTB 2X4TA 2X4OB 2D7TL 4MAUL 3DUSB 3TZVC 4YNYB 2K7PA 1WUNT 4IRSA 1XF3B 4UB0L 1MWAH 2BCKA 2R4SH 4EBQL 1QA9A 1KJ2A 2JTDA 4H1LG 3S3SA 1LILA 2XA3A 4JM2D 3FFDA 4GAJL 5L6YL 4OUOA 4O2CA 2R0LH 2A0LC 2V2WA 5KS9F 2GT9A 3AGVA 1MHCB 1MRDL 3MLSH 4POZD 2FX8L 4XAKD 3SDXE 4MX7A 1Z2KA 2NXZD 1ZEAL 5FCSH 4GLRH 4X6CB 3F12A 1RZKL 5BRZD 1OWWA 5SV4A 5CD3A 4FFVC 3RVWC 1K8IB 3LPGA 5GRUH 5KW9H 4JG0H 3MV9E 1P84J 1WCBA 3ZL4H 3DECA 5DWUL 1IZKA 4GAJH 3STBA 2BHUA 4LSVL 4GUPB 5I16A 5HHNB 5JUEL 3CDGA 1OY3B 3BO8B 4X6FB 4XP5L 1NC2B 1FZMB 1KYOJ 3BEVA 1WZ1L 2VAJA 4MNQD 3ULVD 2BNQD 1NCCL 1Y6MR 3JUYA 4OJFH 5K33A 5IF0A 3RWFB 1UCBH 4OF3A 3O8XD 4OD2B 2P8PB 3J7HA 3NPZB 5TQ2H 4M7ZC 2FBJH 4WI6A 3ZKMD 3MA9L 1I8MB 1KLFA 3KPQA 2X9WA 3QUZB 4X9FA 4QRSB 4EDXB 4L5FH 2VXQH 2R56H 4BH7B 1HIMH 5D7SL 2EDTA 5IIEB 4X8JB 1EFXB 4MJ5A 2HVKB 2WINB 1NCCH 2APXA 2ZCLH 3O11A 4JFED 3QZWG 1JWSB 2EH7H 2APWA 4NO0D 3RGVA 1OSZA 3AU1A 5GGSA 4IOIB 3G5YB 2R1YA 4PY7A 2NYYD 3MA9H 3IDGA 3MR9A 5AD0B 1Q8MA 4GW4A 3EKCA 2R2EA 1P7QD 3MREA 1XEDA 3WLWC 5HHOB 1TLKA 2JF1A 3OAZK 4DUWA 4JM4L 1AC0A 2QSVA 5IHZB 5J06A 3HC4H 1QQDB 3W2DL 5GPRA 4OZ4A 4KPHH 4OLYL 1A5FL 3G08B 2ZUUA 3V5HB 5GRZA 4LLUB 2XFXA 3U1SL 2VZSA 3T4YB 5IMLA 2O5YL 3V4UL 5J13C 4LLWA 1WCQA 1YPZB 4LLDA 1NAKH 5DC4B 1A9BB 1TQBB 2VWEE 1BIHA 1K9TA 3Q0HA 4CMMA 2A9ML 4JRYB 5JQ6L 4KTEL 4LPCA 3B3IA 2IPTL 1HH9A 1DN0A 1ONQA 5F21B 1BF8A 5EO1B 3QG6A 5EIIB 4JRXE 4JKLA 5D1XB 3K1DA 1XCQA 5E8DH 3ARDC 4RA3A 3T04D 2CDFB 5IMKA 4PJBA 2JJTA 3WNPA 2YK1L 8FABA 4UDTB 4F57H 1Y6NR 2VLLA 2NY0C 4OGYL 3IF1B 4V1DD 5FV1L 1CR9L 1MHEA 3OF6D 1G6RH 1UXSB 3TM6A 5HYQA 1Q9OA 4M93B 5GJTL 2DQTH 3RZWA 3OKMA 4MLIA 3P9LB 4XNXH 3BW9B 1QSEB 4Q0XL 4P2RD 1B90A 5F70A 1FFNA 1VB9A 4P4RA 3DIFA 5L9DL 2QEJA 4DKEH 2X7LA 3DX7A 2ORBL 3SO5A 3VCLB 3A67H 3VFSB 5DYOB 3EO0A 3RA7L 1EH9A 3QQ3B 4YBQD 2VMFA 3C6SB 2LABA 3F6IA 5MENE 1SMOA 4PRNA 4R0LC 4E42A 1AY1L 5HI4D 4JKWA 2G5BB 3QIBC 4Q0XH 3FZUC 4PJ5A 4Q9BA 2WBWB 1EMTL 4KTDL 2ATKB 2EDHA 25C8L 2CLRB 4OZGB 4BFBD 5GQBA 4PLJD 2AI0L 2IQ9H 3U9PH 3UTPE 1S5IH 4FTVD 1Q72H 4HWEH 3OJMB 3VWKA 4DW2H 1I9IL 1AR1C 1XGRB 2GK0A 3P9MA 5EA0L 2H6PB 5I66A 3BP6A 4UZGA 3QIWB 4P9HC 4X7SH 5HGDB 1REIA 3BYYA 4I2XB 5FM5O 3MRBB 1GPOL 4QOKE 4G7VL 5C0BA 1IGJA 4I9WE 4ZS7H 1M05B 3V6OC 3LRSB 1QR4A 5IW1A 4FZ8H 1N8ZA 4FXKB 3FN0L 3WFZA 1CL7H 3MRMB 4HJ0D 1IGCH 3C2AL 4X4MA 1IAIL 4KTDH 3VRIA 2AI0H 3KPNA 3LS4L 1A2YA 4LBEB 1JHLL 2DMKA 3RNQB 1DBBL 3SQOH 5GRJH 2ZSVB 4FQIH 4F7PB 1NC4A 4R7DB 5IHLB 3RUGA 1R3LB 2GUOA 3G5ZA 1MVUA 5FO8A 4Y4HA 1LO2H 4EN3A 4XVUC 3FB7B 2LFGA 4H0HB 2F74A 5IROA 3FN0H 3CFCH 4O2FA 2VLRE 3DSFH 1MCFA 1IAIH 1XFPA 1F6FB 4NSKB 1A6TB 1CFSA 2AK4E 4NUGL 3KPMB 5TDPA 3LS4H 3CVHL 4R2GD 5HVGB 4WRLA 5F97E 3RWEB 3ZHDA 1E6OL 2EYSB 5D1QB 4NO5A 5DJZA 3TT3L 1MJ7L 3L3KB 4KRPC 5D7LD 2ZNWA 3MRFA 2FJHB 2Y6SD 4YDJB 1T89A 5F88A 2Z35A 3NACH 4JHWH 5D7JC 1HYSD 2X05A 1NDMB 3D85B 3T3PE 1I7RB 3SDXB 4NUGH 3W39B 5FFLA 1LEKA 1IC5L 1D5IH 1I3GL 4BH8B 2Z31B 2VSCA 1XGTB 1WWBX 2ED9A 5ESAB 1PKQA 1S5HA 1G9NH 1E6OH 3ILPB 5IQ7H 4JM2F 3KPSD 3MV9B 5J8OA 1XIWC 1ORSB 5E6IB 4AEHL 1H3VA 3A6OA 4KRNA 5GGQH 3P4NA 3TBTB 5K9OA 5JPNA 3WFHB 3MOBL 4MA1C 5IVZB 5TGBA 5CJOH 4GG8B 1I3GH 2CIIB 3LKNA 2C7UB 4RNRB 1BD2E 2PETA 1R3JA 3NMEA 1KFAH 5JIHA 5B39B 3E3QC 4WEBL 2F5BH 2PW1B 1QTYT 4JG1L 3IGAA 2DQDH 1NFKA 4H5SA 1QO3A 2FHBA 3ZE0F 2J4WL 4AEHH 3C5ZA 3QEGH 1FAKT 3BT2L 4OTXL 3WDIA 4ALAH 2WIMA 4WU5B 2QQLL 3FCTB 3ULVF 3MROB 3IJHA 3OWEA 5KS9A 3LMJH 5DUML 2B4CC 4O4YH 4OFYA 1NBZB 5FHBL 4PG2C 2MCPH 4L3EB 4LPUA 1XF1A 3D25B 1GYAA 2YMXL 1EXUB 1U8IB 5D1ZD 2W1NA 1MI5E 1F13A 4F7MB 2NY2C 2HKFL 1U3JA 5F9DC 4Z76B 3QO1A 4AM0A 5A16B 4PJXF 4FXLA 2FECI 4LCWE 5F7DB 1NC2D 4OTXH 5DFVD 5DUPL 1F58H 5AG9A 1B0RB 4K3DH 1X7QA 5E08L 5M7QA 3UTSE 43CAA 5DHVB 5DI8A 3V0VA 1HWGB 1MHHA 4LSRH 3O9WD 1MUJB 4PTTB 5KVFH 1PKOA 4ZO9A 4G9FB 3UTTA 1ACZA 2Q87A 1NGXA 4IHOA 3ZHKA 1CI5A 2D0GA 2VDPH 5IBLD 3IXTB 4NZJA 2Y1VA 1PG7L 1SHMA 1M7IB 4N1HB 2AV1B 3VXRA 1IAOA 4LSUL 2Q1EA 5KSAA 4X5XB 5FYKL 1DLHA 4TSBH 2VQ1A 5EZOH 2YA0A 5IJVB 1I7UA 2MQ0A 4MJ6B 3PGCA 4GRLC 4MA8H 1S7VB 5IQ9B 3KWWA 4JRXB 1INDL 4XI5C 3VH8A 1T03L 4YZFF 4YUEH 1VSCA 3KPRE 3N0PB 3HAEG 4NO3B 3PE9A 1Q94B 1D5XB 5C0CA 5HHOD 4I8DA 1UM4L 5JOPD 5ESQB 4KUZL 1OLZA 4S1SL 4PYHA 2A38A 3PHOB 1RMFL 3REVA 3A6CL 1V5JA 1WICA 3EW3B 1EPFA 3V79C 5F3BA 5T33L 4IMKC 2CIKB 5DGQA 4Y5VB 2APVA 3OTTA 4WY7L 3ZYOA 5EU4A 1SYSA 3OMZA 4PPTA 3GSWB 4JO1L 1LE9A 1FSKC 5DJXB 3BP4B 2BNRD 4GG6E 4HK3J 4HFUL 2DQHH 4EUPG 1FLRL 1OW0A 1NANI 5J13B 3CNKA 4X83A 1UKTA 4N9OB 2W59A 4KI5D 2BX5A 5MENB 1RMFH 2VNCA 1AXTL 3DGGA 4NQSA 3P0VH 1FNAA 1UH3A 2Q76A 3K2UH 3RIAF 5D1XD 2K1MA 3IDIB 3MFGB 4YDIL 1WIPA 3EOBA 3VXTA 3CU1A 3VFVA 3J8F7 5GZNC 3T0XA 2VXTH 3VXMD 5A2FA 3R06A 3ARDB 4CJ0A 1C16B 3CC5A 4ZUWA 4PLKC 5IB1A 5F7LB 1V3MA 3TIDB 1IEBA 1I85C 3RFZC 2J88L 2FEDD 2I9TA 4PGEA 3DX8B 5EZIH 1AXTH 2IQAA 3GMOA 1QSED 2DTSA 4QOKB 3LKSB 4EQ2A 1MFCH 4X4ZA 5C7XH 4YDVB 1JGEB 1MOEA 5HI3C 1QEWB 4C83B 5L8JB 4M4PA 2PYEB 4KQ4H 3RIAK 2IBZY 2G2RA 4POYA 1CTNA 4EI6A 4XPFL 4G8FA 4X7TB 3D1MC 3QWOB 4XBEL 3RL2B 1BM3H 2VITB 5I71C 3H2WA 2R1XB 3QCUH 3H7BA 2X4UB 1FV1A 4OV5B 4KROC 3MRKA 1UYWH 4F2MA 2VH5L 4Z95L 3MV8E 5F96H 3OR6A 1KELL 1RURL 4R0LB 2C3GA 2ED8A 2VLRB 1FL5B 4YXKH 1A7RL 2FJFB 4N8VA 3LZFH 4I3SL 4OD1H 2AK4B 4I5BA 5CJQH 4Y16C 3QIWD 4YWGL 1Q9LB 2GJ6D 3U9UB 4NGHH 2Z91B 3TYFA 4HC1H 1BQHA 4HHAA 5E2UH 5JOFB 3QXUA 2VH5H 4XWOD 3OKDB 3B9KC 1LWRA 3PDGA 1S7WA 4QT5B 4OCRL 4R7NB 1RURH 4LQFL 1EO5A 3OKEB 1A0QL 4GS7B 1RHHB 1A7RH 1LGVA 3GB7B 1ZHBB 5D6CA 4G8IA 1MIML 1MJUL 2DLFL 4PJ8C 4PJ7F 4ONFL 2FH6A 3AXLA 3LY6A 4JR9H 4X80L 3T1FB 4RMSA 1WZLA 2BVQB 3QPXL 2Y7QB 1GGTA 4M8QB 5FGBC 1ZLSL 4K23H 2RQ8A 4JY5H 2EIZB 4OM0H 3D0VB 4FQXC 3O2DL 1H8NA 5EUKA 2YA1A 1HHGB 4HBCH 4ODWB 3EHBD 2CQVA 5EOTB 5DHVH 2EC8A 1YY9D 3PABA 4GBXA 1BD2B 2BSTA 1BZQK 2W60B 4OLUL 5B21A 1UM5H 3ARRA 1F90H 1XF4B 1T7WA 3BHBB 2GITB 4M6OL 3W11C 1P1ZA 1FFOB 1QRNA 2DLTA 3ARFC 4K3HA 3PL6C 4GSDH 1RZIA 5F9WC 3D85D 1T83A 2FGWL 4BQBA 2Z9TA 5D7JB 2Z31D 3T4AA 4FN0A 2VZ1A 1XAUA 3WHXB 1NCDH 4PFEA 3TNNA 4YPGB 5DJDA 4HLJA 3MV9D 1J0HA 1CFNB 3BGAA 1ZLWH 3L9RB 1FL3A 2CK0H 2LTQC 1F4HA 4OZHE 5F9OL 4QF1B 5E6ID 5M94B 3QUMB 4JM2A 2H32A 1TZHB 1GZQB 4L1HA 4MS8C 1CDCA 1T3FA 3QPQC 1XIWB 1GAFL 3DWTA 4XCNB 4M1GL 1BJ1H 4FFZL 4LSPH 4Q9RL 2E27L 4X6CF 3WJJC 5E8NA 5FCUL 1U9KA 1HINH 3LEVL 4NM8H 1PX3A 3FN9A 3IDNB 5BRZA 4OCXH 4JZNB 1UH4A 4NKDA 4MA1B 5DJ6A 2D7OA 3HZKA 3HMXA 2P42B 1BQLH 5LAXA 2EDYA 2DMBA 5F9OH 4NKOB 4PRDB 2FYYA 1EJOL 1FQ9C 3DVIA 5IFAL 4OCWL 2DF3A 1MAML 4O5LH 3PWVA 4MQ7B 3VI4E 2OL3A 4DCQA 1J8KA 4M6NL 4Q9RH 3HA0A 5EUOE 1J5OH 3EFDL 2X1PA 3NIFF 2ADFL 4MNQA 2IGFH 2BNQA 4ODSH 2YPLE 4L9LA 3MCLL 1KCRL 3C8KA 3HNVL 1KN2L 3O8XA 4J3SA 4OFIA 3PQYE 1QLFA 3KPRB 1DN2A 3BXNA 5EIVA 5IFAH 1S9XB 1IT9L 4OCWH 4AEIL 3MCG1 1TQCC 3D18B 4E5XB 5KSVB 2QBWA 2IBBA 5ID0A 1HEZB 2F54E 1H15A 4PJXA 1SY6H 5JORB 3FT3A 1H8SA 2YN3A 5JIKA 2ADFH 3WUWB 5IB2A 3ZDXE 4LHQB 1Q9WB 1IGYA 4JFEA 3VG0H 15C8H 2F8OA 1HE7A 4NO0A 3FB6B 5INCA 4GG6B 3HZMA 5TPWL 1WC7A 3SGKC 2IH1A 2UUDH 2LV4A 2W9DL 5I2IB 2DTML 3V6FA 1P7QA 3NFPB 1L9NA 2ICWB 4UDUA 4XNQA 3BE1H 3GRWH 5C0NC 2C9AA 4ZYKA 1OM3L 1V7NH 4FABH 3TVMB 3K2MC 4JRXD 5GS2H 2PW2A 3CU7A 5ANMA 4HPYL 2NY3C 1F45A 4S2SB 1A6AB 1YPZF 2O93L 3KLDA 3JWOC 1KPUB 5I17B 1PX4A 4BYHA 3GKWL 1FGVL 4QTIL 4YEEA 3C5SB 4XC1L 5T5FL 2NLJA 3T0BA 4KI5F 5B8CC 4TQEH 4ZO6A 1KCUL 3P0YH 1LE5B 4P9HH 1GGCL 1T2JA 2WLYA 2XV6B 2UZIL 4M48H 3HFML 3IU4L 5J57B 1N6QH 1U8KB 1AIFA 1BBDH 4HPYH 3MNVA 2VKWA 3RNKA 4S10A 2J8UE 2P43B 1QLRB 1CS6A 2IH3A 1UEYA 1S7UB 3L3GB 5FA3B 1DBJH 1Z3GL 3HI5H 3CH1B 4NKIH 1TCRA 4V1DA 2NW2A 2X5PA 3RWJB 3HRZB 3OF6A 1X5FA 1KCUH 1C08A 3GMQA 1TVHB 1A1MB 3GDBA 4Q2ZA 3MGTA 3ZTJH 4P46B 4NNPH 4P2RA 3JTTB 2FD6L 1UFUA 2AJUH 3VFPA 1FL6A 1FZJB 3UTPD 4QEGA 5GJSH 1A8JH 1UC6A 4GXUM 2VR4A 4FQ2L 4QGTA 5DMGD 4Y2DC 2EE9A 1UZ6F 3Q3GB 4OIBA 5FXCH 5BV7L 2CD0A 5ITBL 4AMKH 1WWWX 5SWZE 4OZIE 4QOKD 1RJYA 5E8EB 4KK8C 3MNZA 4I9WD 1BPVA 3I6GB 4Q6YA 1YECH 4N5EC 4N0CC 1JN6A 1J11A 1A3LH 4I48B 1MLCA 5I74B 1KCSH 2VISB 5E00A 5I1HL 4FTVA 3MRHA 6CGTA 5HVHC 3S3JA 2DBLH 3V52H 5JOEA 3INUH 1VHPA 3QNZB 1PFCA 1WBXA 5LJYH 2JCCE 1QP1A 2AEWA 3QUMH 1HSBA 4KROB 4WI9A 1IGML 4PGJA 5GS2D 3AREC 5IR1A 2VLRD 1IGFH 2F19L 5C3TA 4RDQF 5CUSL 5T1MB 2C5DC 2D9CA 4G8EA 2AK4D 4IRZH 2AXGA 4D8PA 1FVEB 2G75B 4LMQE 1E4KA 4MXWL 3PNWA 3V0WL 1KIRB 4MAYD 2YUVA 4LVNC 4NQVB 4M9PA 1NGWA 4HF5L 1L9MA 2JLLA 3P3YA 4ZTOH 4PRPB 5DUBB 2DI8A 3AB0B 3SDAC 2FO4A 3FO9A 4QCIA 5DEFA 4AK1A 4QYOA 3VW3L 1CIDA 1VKXA 1A6UL 1RZFL 3MRIB 2I9LA 1OAXH 4ZSOE 5FGSA 2OLDA 3UZEA 1GOGA 4QXTA 4BJLA 2KPNA 1FN4B 4M1CD 2X70A 1K5NB 4HDIB 4HUMB 3S5LA 4HQQH 4JGJA 5FF6B 5I1DA 4YDKH 1ED3B 4MDIA 3LS5H 2K9UA 3BQUC 3EYFA 3OXRA 4Y5YA 3M17B 3JUZA 2B4CH 3RY6A 1E4XI 1G6RA 3SGJA 1OAZL 4LVOC 5EO0A 4PJ7A 3ZSTA 4PJ8B 5D7LA 3H42L 1U8JA 4AIZA 3QO0B 3T8XB 4KVCL 5DD1L 2IG2L 5I1AA 2ADIA 2DMCA 3JWDH 3G5VB 3SGDI 5E7FA 3PGDB 4ZO7A 4J3OC 5EBLB 1RZGA 3MRNA 3ARYA 3QEUB 1OHQA 1ZA6B 1TXKA 4FQXB 5CAYB 3KYMA 1XCTB 1BD2D 1ZTXL 2JJWA 2XA8H 3B5HA 1D9KC 1F8TH 3V4VH 3GMMB 4QO1A 1UB5B 2C1PB 3KPSA 3P30L 4OCSL 2ENSA 3JVGA 1L7TL 3UO1L 1SBBA 1UKQA 1JPSL 1FJ1B 1SVCP 2Q20A 1T7VA 4JY6B 4P23D 3DUSA 3PL6B 2OP4L 5FGCB 1ZKAA 5BOPA 1JTTA 2F53E 4YNYA 5EUOB 5F9WB 1KPVA 5CMAB 3TNMB 4YE4L 2YPLB 5A3IC 2VE6B 1NQBA 1CXIA 1MI5D 1FVCA 1F2XK 3PQYB 4ODVH 1T21B 2QSCH 3B5GA 5DJCB 1L7TH 3UJIH 1JZ4A 1TITA 3BPNC 2LTQB 4X99B 1KEMH 3S4SG 4LCWD 2L7JA 3EOTL 3N1QC 3AM8C 3IDMA 2JJUA 2F54B 3U36B 4CRPA 5C0EB 5C92A 1SJXA 1HWHB 3UTSD 4X6CA 4ZDHA 4Y8DC 4IS6B 5ADOL 2QADB 1NL0H 2XTJE 3QA3B 5E94B 4U6XA 4LPYA 5D1ZA 4PREB 3ZDZE 5HHNA 2VN4A 3DROB 4LP5A 4X6FA 1KIQB 1NC2A 1FZMA 4AIXA 4JDVB 1I9RL 4X9HA 1FFPB 4MZ3A 4JN1H 3RWFA 5ADOH 2EYTA 2P8PA 1UENA 1IRAY 3O9WA 3KPRD 2J2ZA 4YBHA 4BSWA 1I8MA 2E6JA 4OT1H 1GIGH 3BX7C 1ZANL 4CGTA 3QJFB 2W9LA 4EDXA 5BMFL 4PV8B 5ID1A 3O0RL 2YZ1A 4KI1A 5JHDE 4BH7A 4ERSL 5IIEA 4AENA 3PGFL 5DXWA 2MPAH 2VXVL 3TO4D 1JWSA 5TF1H 4G5ZL 2AGJH 1I1CA 4HKJB 4IOIA 1EAPB 1KCLA 3STZA 5AD0A 4MLSA 5HHOA 3T0VA 4A2MA 1LK3H 5FDWB 4M7LT 4U7KA 1IFHH 2HJKA 5B38B 3K4ZA 5FUZH 5IHZA 1CXEA 5I6XC 3TVMD 1QQDA 2FHFA 4RMQA 4AQ1B 5IB4B 1FIGH 4JDZB 3MODH 4ZTPL 4NRYB 3PWPE 1FNGB 3ROLB 4J4PC 4LNVA 3V5HA 3KPOB 4ESKA 4LLUA 1ZLWK 3T4YA 2BNRA 1FYTB 5DRWA 1YPZA 2NY3B 4E9LA 2X4PB 4K94L 4PRIE 1A9BA 1GHFH 2HWZH 3ZKXC 1P9MC 5AYUH 5ILTL 1YYLL 5IEHA 4I0CC 2R2CA 5SWZB 5GSVB 3V5DA 1J05B 3I6LE 4F33B 1RZ8B 2C4FU 4JGUA 5D1XA 3RTQD 1O5DT 3ZE2E 3GHEL 5DVOA 5LBSL 2CDFA 5DC0A 3VXMA 4UDTA 4YHPB 3LDBC 1YEHH 5HHXH 1F5WA 3IF1A 3ZKQD 4CU8A 1UKSA 3JBG7 2QJDA 3LN5B 5ILTH 1UXSA 3MV8D 3VD3A 3CFBB 1KJMB 3P9LA 4P46D 1QSEA 3SDCD 2C3XA 1JGVH 2AV7B 3VXOB 4J6RH 1ODAA 3QXDB 1BFSA 4WFHE 1SYVB 2BDNH 3V9FA 2XQYG 5CINH 3EJZD 3VXQB 3VCLA 3VFSA 4LCUB 5DYOA 3GI9H 5KVGH 4KY1L 3C6SA 3S7GA 4HWBL 5JR1L 2WM0A 1KPRA 5CLTA 1CN4A 4JB9H 5DZOA 5KG9B 2EE3A 2G5BA 4ODUB 1DANU 3WIFB 4CBPA 1L6ZA 1MCPL 4IJ3C 4LASL 3L95A 1TIUA 2WMPA 4U1IA 5HDOA 2RCSH 1P7KB 2UUDK 1XGRA 1CD8A 2H6PA 3SDDB 3QIWA 5HGDA 2GJ6A 4OLWH 5HVHB 1EK3A 5JR1H 3MRBA 4KROD 1NH6A 5BVPL 3R0NA 1M05A 2YPKB 3ALXA 3LRSA 3OGOE 3L1OH 3RVUD 4FXKA 2ZOLB 2RR3A 4R8WH 2WUCH 2XPGB 3T3PF 4M7LH 3AREB 2JELH 4TSCH 3OPZL 2FX9L 1P4IH 5EC2A 3VGGA 4HV8A 4LBEA 2A6KA 3EGSB 3EDJA 3RNQA 4EQ3A 2ZSVA 4YIQB 4RZCA 4R7DA 2HT2D 5F6HJ 1B0GA 3GI8H 4TUJB 3KAAA 3TO2B 2OQJA 1U2CA 5K59E 4JKPL 3T1WA 3Q6GH 3CFDB 4KJYB 1AXSA 4BQ6A 2EKSB 4E41E 2FATH 1L0QA 1SBSL 2F53B 3OPZH 3QDAA 3GSNL 5DMKA 1KIUA 1CT8B 1FDLL 2EYSA 5D1QA 1R3HB 4PJ8D 1MSPA 3LH2L 3BQUB 5MEOB 2FJHA 5C1MB 2GYSA 4YDJA 3O3DB 5D93C 4LVOB 4BSVB 4MWFB 3CFIC 3MUJA 1KJVA 3HPLB 3NH7L 3QRGH 2KKQA 1HSAB 3D85A 2XWTB 4HS6B 1JL8A 1T1ZA 3SDXA 1QSFE 1SBSH 1YQVL 4BH8A 2RFXB 2Z31A 4NDMB 4YHKL 1YEIH 4G7YH 1XGTA 5CD5D 5HYJB 5ESAA 5I8KH 4RMUA 3OKKB 1VEMA 3ILPA 1JFQH 3QZWB 3MV9A 3BKCL 4IDJL 4RAUB 3TBVB 1OAUL 5HGGS 1KT2A 4QXGL 4PJGE 3CFEB 5E6IA 4HZLB 2X4SB 5F7UA 2GIYA 1T0MB 5DDHB 1PY4A 2A1WL 3HI6H 2YA2A 5DVMA 4QHKI 5IMMB 3DHMA 1YMHB 1RIVH 4L8BB 4OQTL 4WHYH 3TBTA 1TETH 3WFHA 5IVZA 2DYPB 1FNEA 4O02L 2BFVH 2CIIA 2YPLD 2C7UA 1YQVH 4BZ1H 3DVGB 4LLMA 4Z8FH 5EORH 3BP7B 4I0PB 2FLBT 1CF8L 4FFWC 5F1IA 4GJTB 5L7XH 3PQYD 2PW1A 1H3PL 2X10A 4QHMB 3V7AE 2AJYL 3JWOH 4YFLF 5FECB 5DFTA 3P11H 2F54D 4WU5A 3GM0A 5CEZL 3BPNB 5DVNA 2ZCKL 5JHDB 2YOCA 3MROA 3HPJA 4MA3A 5I18L 4M7KL 1A7OH 3X11B 2ADJB 2QADD 1F2QA 3WXWL 4M4RA 1JZ8A 1FRGL 3D25A 4ENEC 1U8IA 4GO6B 1MFBH 1CD0A 3H0TB 3ARBC 4RQQB 5F7MC 4AYFA 1NEZB 3RY5A 1ZGLB 1X6LA 5L88L 4Z76A 3CJJA 3OAUH 5A16A 2VLJE 4HJJH 4PGCA 4AL8L 5F7DA 4Z78A 4H20H 5J3HC 1V3KA 4ZFZB 1B0RA 2F5AH 3NN8A 2AK1L 1N2RB 4KHXL 5DHVA 4JPVL 4K8RH 1MUJA 4PTTA 5GGUB 3T2QA 3PWPB 4GG6F 2MWCA 1IEAB 5L0QC 1H5BC 3RZCB 1E6JH 2J8OA 1TTUA 1VADB 3IXTA 4PRIB 4LVHC 1M7IA 2AV1A 1RJLA 5BQ7B 1DQJB 1CGYA 4P48A 4X5XA 1OAYL 5HTSA 3ZKND 2OTUB 5HDBE 3VG9C 5IJVA 4D9RE 4XWGL 4MJ6A 1YNKH 1NLDL 4L29B 1S7VA 4JRXA 2SEBA 1MCEA 2EZ0C 2EE2A 4LAJH 4K2UL 3BI9X 4NQEE 4NO3A 1PQZB 1Q94A 1D5XA 3MZGB 3RJQB 2B0SL 5K93A 3HR6A 4LQ1A 4NM4H 1TJGH 1QFWM 2K3TA 2E3VA 1U8QB 4G6KL 3PHOA 3MFFB 1NCAH 3KS0H 2IPUK 1G0YR 4MQTB 4RGNC 3UPAA 3RP1A 2CIKA 3U4AA 4XWGH 3BZFB 4Y5VA 1DBML 3GSWA 3TIEB 5DJXA 4OGXL 3BP4A 4WW1B 3SE4A 1GOHA 3RHWF 5F1SA 4K2UH 4KJPC 5BVJB 3V5KA 2NY3D 5FO9A 5LWYL 1NGQH 4XRCA 4D3CL 2VQTA 2B0SH 1I8IA 3OJDB 5I8EA 5IT2L 4XMPH 4U1SB 3IFOA 5FDYA 5SWZD 2G60H 4MA7L 2ZJSL 1R3IH 5MENA 1S9YB 4FQPA 5CJ8A 3ZKXB 3NPSB 2QQQA 3LV3B 3L3HB 3QUXB 2WQRA 4L4VE 5GGVY 1WZMA 4HS8H 3E6FA 4C4KT 1OTTD 5H37H 5AZ2L 4JJ5A 5SWSE 5HDLA 2M2DA 4OSUL 1E4WL 1PZ5A 4OZFG 1JWUB 4IOFC 3RHWK 3RGVC 5GRXG 4YR6B 3MLZL 1I1FB 5FYJE 1CLYL 2UYLB 1NBYA 1GVIA 3TIDA 3T0WA 1SY6A 4HH8A 3LDBB 1BHGA 5TDNB 3UDWA 3T65B 2I27N 5F3HA 4OAWB 2WP3T 4QOKA 5IW6A 4K8RD 1JGEA 3C08H 1QEWA 5EPMA 4RGNE 4C83A 3B2UC 1UZ8B 4HD9A 1V3JA 3UJJH 32C2A 3BFOA 4OIIL 1RSFA 4JFZH 5C6TH 4X7TA 4J2XA 3QWOA 3GHBL 3RL2A 4DZBB 1JHTA 2XZCH 4YK4B 2N4IA 5GS3A 3UROR 2X4UA 1XH3A 5D8JH 1IC7L 3RWCA 1C1EH 4OV6F 2H9GB 3GRWA 4ISVB 1RI8A 4ZNCD 1QZ1A 4GRWE 5CEXA 4KK8D 4R0LA 1NFDE 2VLRA 4UTBH 3LQAH 1S78C 1XR8A 2EE6A 1FL5A 4JZOB 4FQLL 5KSBE 3MLTA 1UA6L 2CO7B 2AABL 2AK4A 4MVBC 2Q7YB 5I1IH 4FHBD 3L7EB 2VN7A 3SDDD 4N68A 3QHZL 4YGVB 4MAYA 4PTUB 5D2LE 2VXUH 3IFPA 3ARGB 4HUUB 3TA3D 3U9UA 1VGKB 2Z91A 3PXHA 4LSQH 3OKDA 1KB5B 3HLAA 5IG7B 3MYJA 2PTUA 3IT8D 3OKEA 1GC1C 1VERA 3RVVD 1PJ9A 3EO9L 3GB7A 3GJEA 5HHVH 1ZHBA 4KQ3H 1KV3A 1QSFB 1OF2B 5DJ8A 3QHZH 1WEJH 4OZHF 4NC1C 1D5MB 3FT4B 2R9HC 2BVQA 3HR5A 2Y7QA 3MRJB 4PJGB 4M8QA 1G9MC 4XGZB 2AEPL 5A43C 4GKNA 2RGSA 3MJ8B 2EIZA 4JFOA 1MRFL 3D0VA 3DX6A 1YEJL 4LARH 4NBYB 1BFTA 1H3TA 2J3SA 2F53D 2OJEB 5D5ME 2VUYA 5DD6B 3HE6D 5EOTA 3ARPA 3AFLA 4ELKB 1BD2A 4OGZA 3VWKC 2W60A 3K81A 4NFDA 1XF4A 3VI4F 2GITA 1HILB 1FFOA 3U4EB 5FB8B 3QG7L 3FQWB 3SOBH 3QCTL 5DRNB 5DQ9B 1MRFH 5TFSL 5EUOF 1YEJH 2O5XH 5D93B 3HHRB 4P23A 4H0IA 4Z7WE 1RUPL 1T7ZA 4NBXB 1G7LB 1JRHH 5JXED 2GY5A 2YD8A 4L8DB 4LU5H 3WEXB 3WHXA 4WI7A 1MELA 1MEXH 4YPGA 2XTJD 5EBMB 1CFNA 5AWNL 4HK0A 3L9RA 4PJCE 1G7HA 3L5IA 1MI5A 4QF1A 5C9JA 3FOMB 1TZHA 1GZQA 3F7VB 1X5YA 3MLVH 2B1AL 3ELAT 2VLJB 4XCNA 3QCTH 3QBTB 4LCWA 4EN3C 5C0IA 2DYPD 5IROC 1EHLL 3RAJL 3RWDA 2C4FT 4P9ML 4FMFA 2GCYB 3ZDXF 3IDNA 3UTSA 4N9GB 2W65B 1ACYH 4I0PD 1JK8A 3NFSH 4GOSA 5KZCB 3CIQA 2LAGB 1LO0L 1CU4L 5IWLA 4NKOA 4PRDA 1J1OL 5E70A 1YC7A 4TN9A 4RFNB 5BCAA 1C8PA 2C26A 4MQ7A 5GS0L 2ZOKA 4HLZG 2YC1A 1A1OB 5DEGB 4HUNB 4RGOL 4IDLA 5JHDD 3F7QA 5B4MD 2XKUA 1T89C 3HCVB 1ND0A 5F44A 2EH8H 1P4BH 1S9WA 4BZ2L 3W0WE 1DFBL 3LPWA 4WUKH 2RJMA 4X4ME 1PEZA 2IJ0C 4YC2B 3TN0B 1FH5H 4PG2A 3KPRA 1AGDB 3UJTH 4NQEB 4AG4H 1S9XA 4KK9C 1A4KB 4Z7OE 3D18A 1G0XA 3ARBB 1F3JB 3IETB 1J0YA 4XNZB 2Z8RA 4DEPB 1HEZA 4ELME 5DSCB 3UAJD 2OK0L 4XXCA 5EC1B 1KLGB 1DANT 3G5XB 3WUWA 4BZ2H 2Y07H 2Z8SA 1VCAA 1DFBH 1HKLL 1FAIH 3PWPD 2Y72A 3BN3B 3TO4A 1LO4L 3KR3L 1A7NH 2D9QB 2ZG2A 2J8UF 3FB6A 5EOCL 4GG6A 3RZCD 1RUAH 2AVGA 4K9EC 1CE1H 4PRID 3QRFM 2EO1A 4W6XB 5L0QB 1H5BB 4DAGH 4KMTH 5LCVL 2BCKB 3NFPA 5FM8A 3PIQA 1MPAL 1QA9B 1EGJH 5DD0L 4YXHH 2WLZA 3C5ZC 3FFDB 4Y19E 4YEFA 3I6LD 2PKDA 1QLEL 2IALB 3TVMA 3BD3A 4O2CB 5J7CC 1NMAH 2Y25A 1LO4H 2V2WB 2EDNA 1A6AA 3LKRB 3EYQC 1WIOA 4MXQC 1KPUA 3LB6C 4LDEB 2DIAA 2GTZB 4UUJB 4CL7A 4J7RA 1GGBH 4LKXB 1X5GA 5LCVH 3VFGL 3L5WA 3C5SA 4OZIF 1AD9B 4YXLH 4BELD 4XHJD 3KNBA 3MXVL 3BAEH 4IIQA 1LE5A 5KTEL 1KB5H 1QLEH 2QL1A 5CKAA 3EDFA 5TQ0H 3VDAA 1IGIH 1Z9OA 3QNXB 4RGNB 4WFHD 3RTQA 1QG3A 5H2BB 4KMLB 2D4FA 2L4OA 2VSDA 5HPOA 2VIRA 3NCFB 1QLRA 4K7PX 1S7UA 2XYCA 2EDDA 3CH1A 2F58H 5DJYB 2JCCF 4WI5A 1JNNL 4DN3H 2EDLA 3QUXD 2ITDA 4QRQB 1EO8H 1TVHA 1A1MA 3MV8A 5KTEH 1A3RL 3BRFA 5KSAC 4P46A 4GRWB 4GH7B 2R15A 4WTXA 3SDCA 3JTTA 3QI9D 5C6PB 1JZ3A 3W9DA 3EYSL 3NABL 2ZUSA 3TJHD 5KSBB 4HCRL 4TNVF 4NWTH 2ZUWA 3N1MC 2HRPL 1X6NA 4NJ9H 3VE0B 1UG9A 3ZLQC 3Q3GA 1LK2A 5I76B 3OBAA 1OSZB 2OZ4L 5D2LB 3RGVB 2FZ3B 1YQ2A 2NPLX 1A3QA 4WFFE 1JGUL 2YN5A 5E8EA 3IDGB 2HH0L 1KCKA 3MR9B 1I85A 3I6GA 3L7FB 3DO3A 4RBPH 4IM8A 1CIUA 1JVKA 3MREB 5J0BA 4LLYB 4M5YL 4H25B 1IAKB 4HWUA 1BAFH 2NR6C 4BUHA 4HCRH 2QQKH 3FFCD 4KRLB 4OFDA 2JB5L 1LO3L 2VISA 3HNSL 1A6VH 1Q0XH 4OZ4B 4TNVK 2HFEB 4LIQL 3QNZA 4KV5E 1TTFA 2IMNA 5T1DH 3HUJE 5IMLB 1OW0C 4YHLH 4JPKL 2VDMH 1FYHB 4LLDB 3MZTA 3VXRE 1KGCE 5HDQL 4CMMB 5T1MA 4E41D 5F7EL 1HH9B 5D5MB 2D03L 3QG6B 1LO3H 1FVEA 2G75A 2WV3A 1KIRA 3ECBB 5GGVL 3DO7B 4NQVA 1XCQB 1NAML 1INEL 3ARGD 2AEQL 5BXFB 4KXZI 1I7ZA 1HXMB 5I15L 1ZK9A 3SE3A 5D2NE 3C8HA 3SGEH 3VWJD 2APBA 5ACZB 1CDBA 5F7NC 5FUCC 4P5MB 1F6AA 4X4YB 4ETQA 3I2CL 3E0GA 5D7IE 4JFDE 1FN4A 4QRUA 3AUVA 3WD5L 4YHYB 1D5BA 1QSFD 1WBYA 4HDIA 4JREB 1WTGT 4JRWA 3VA2C 1NCBL 2VXSL 3M17A 3THML 4PJCB 3S37L 4OZHA 5ESVB 4PJ8A 3EZ8A 1JPFA 2R0ZH 2VC2H 3T8XA 1WFOA 3VGEA 5I1KL 1HN1A 5F6IC 1S8DB 3V7MA 3BDYL 4F15C 1CGVA 1TNMA 5FGBA 3PGDA 5IOPB 5DURB 4PLOB 2GQHA 4KDTA 1YYMH 3QEUA 4E42B 1ZA6A 4KJWD 4DTGH 1XCTA 4XP6L 1YUHA 5CZVL 3IAPA 1ZVHA 4UBDD 3LD8B 1PLGH 3GMMA 1UB5A 3ZDZF 1HNGA 1FG2A 2C1PA 3K8MA 1P5UA 5L8KB 4APQB 3ILQC 3ARUA 1CCZA 1K8DA 3D9AL 3VWKB 1UWGH 4G8GE 3HZYB 1FE8H 1FJ1A 4ZFGL 2JB6A 3BP6B 4Z7VE 2EDWA 4JY6A 2O61B 5EUOA 3MLYH 2UWEE 4MNGE 2EC9U 1DEDA 2AERT 4YLQT 3W0WB 1N8ZB 1AE6L 2YPLA 5IGXL 5T1KD 4FXGB 4UT7H 3EJYC 1CLOL 1H3XA 3WDJA 1A7PL 5DS8B 4DQOH 1J1PL 3PQYA 3KPNB 1T21A 1J1XL 1WJ3A 1DVFD 1FZOA 4X99A 5HYEA 1OOAA 1JPTL 3FQRB 5FYJH 5ALCL 5E9DE 4JQIL 2F54A 3U36A 4ELMB 1PG7X 4MDJA 2GUOB 3MLUL 5C0EA 1MVUB 1FFRA 3MLRH 4N1CA 4RGMB 2H41A 4EN3B 2OR7A 3KPLB 1RK1B 5EZJB 2BVUA 2LVCA 3DV6B 3MV7E 2F74B 2B39A 1JNLH 2VO5A 1RY7B 3GGWB 5KZCD 3NFNB 5E94A 1CLOH 4WU7B 4XMKL 4OLXH 4DWHA 3MOAL 2P46B 3ISWA 1LHZA 4FFWD 4GBXC 4PREA 4RX4D 5IBUG 1MFDL 4ZOEA 5HD8D 1FIEA 3G9AB 3PWJB 3DROA 2ARWA 2X40A 1VGEH 4XCCH 3OGCB 4WHCA 3CSYB 5DJZB 4DN4H 4JDVA 1NUGA 1QFHA 1FFPA 4Y19B 4D9RD 5HGBB 4QTHA 1O0VA 5F88B 1T83C 1J0JA 2FECL 4GRWH 2Z8WC 3TN0D 3TBYB 4YHNB 4RAVA 2QHRH 5BZWB 3V4PL 1T6VN 1J0ZA 3JV4B 4N8CL 4P3CL 3WDHA 2ZSWB 3RWGB 4JM2C 3WFEL 2H1PL 1U92B 4S0SD 2AJ3B 4LCIH 1CD1B 1HZHH 1RIHH 4NHCL 4MXVE 2EDOA 3MJGX 3ZE2F 2ZUQB 4ZD3L 4R90H 4POZC 1DLFL 3P4NB 4HKJA 4JO2H 1I9EA 4OCYH 4OKVA 3V4PH 1EAPA 3TH3T 2J8UA 1R0AH 4N8CH 5CBAA 4XXDA 4RMVA 5GISL 2O26U 1P5VA 2YUWA 3UYRL 5FDWA 5FA4A 2VDQL 3R1GH 2J12B 3L5HA 5B38A 2P49B 4PUBH 4H5SB 1CQKA 5IB4A 4L4VD 3U0PA 4JDZA 2GKIA 3OKLB 4HIHB 3C5ZB 4NRYA 4O2EB 1FNGA 3ROLA 3KPOA 3ULVC 1DLFH 4JZJA 4KVNH 5SWSD 2NW3A 4L9LC 4NZRL 2F8VA 3OKYA 1U3HB 4D9LL 2X4PA 3H3PH 1S7QB 5SX5H 2CR6A 3BZEA 4HFWB 5FYJD 5GISH 3ZKMC 5JW4Q 4PRBA 4OQTA 2ZCHH 5ICXA 4XCFH 3MSPA 5SWZA 4OZIA 4HGMA 1J05A 5GGTL 1N4XH 3IKKA 3QO1B 4I18B 4NBZB 5TE6H 3LQMA 1RZ8A 4F33A 3S6CA 3RL1B 4RGND 5DTFB 3LN4B 4Q6IB 3NAAL 3RX5A 2V2TB 6FABL 4NZRH 2H2SD 4UIKL 4X6BB 1R3KB 3GO1H 4B50A 1BZ9B 43CAB 1GC1H 1KACB 4YHPA 5DI8B 4K71C 3BPCB 1DCLA 4I3RH 2CRMA 2NYYC 1CLCA 5FKAA 1CFVL 1SEQH 1NGXB 4GLRI 3HUJB 4LHUG 2JCCA 1U93B 3CFBA 4I0KA 3QXAB 1NANH 4KWUA 1B6DA 3KJ4B 3VXRB 3QXDA 1IMHC 5F8RC 2VQ1B 3VXQA 5BO1L 3DBXA 2NX5E 5A1AA 4Y4KB 1Q9KA 4LGRB 3ZHLA 2PNDA 3PGCB 4LCUA 2PTTB 4WVRA 3GSQB 1B2WH 3VH8B 2J1KA 1J9CT 1CICB 1IC4H 3AMLA 3F58H 5KG9A 4ODUA 3MUGB 5K59F 4OB5L 1NCWH 3WIFA 4GAYB 4ZSOA 3P4MA 4Y5XB 5FV2A 4CNIB 3B2UD 5D7IB 1RUQL 4JFDB 5CHNB 4TPRL 1LO5A 3O6LH 2EDJA 2EIDA 1DP0A 1P7KA 4RSVA 5A2KH 1ZSDB 5EU4B 2LQRA 2VLME 4XPAH 3UBXI 3SDDA 3HC3H 4MCZA 2VZTA 3S34H 4WEUD 3WUZA 3IXAA 3WNMA 1OAQL 5MI0C 4U6YB 3BKYL 1OTUD 3TA3A 2CR3A 2BNUA 2DQCL 4I77L 5A2JH 3QIUB 3UTZB 2ZOLA 1Y0LB 2BRRH 2XPGA 2P5WE 3S4SB 1IBGL 2PR4L 4XNUH 3D3VE 3F5WB 3DGGB 4NQSB 4PP2A 2Q76B 4P3WA 3EGSA 5CP3H 4YHZH 5LKNA 3IKCB 4KK6D 1P2CA 2P8MB 4YIQA 5IUSA 4PJGF 1DQQB 3BKYH 2YD3A 4XT1C 1Z0MA 1HCFX 3R06B 4P2CG 5FYLE 2FBOJ 1F4XL 3TO2A 4DVBB 4YBQC 4RISL 2WUBH 3CFDA 1JNHB 3QHFH 5HI4C 1A6WH 4PGEB 1S3KL 1LVEA 3BUYB 3GMOB 2IQAB 2F53A 1PD6A 3IRPX 3NCJH 4B0MM 4GQ9L 4BQ8A 5J6GA 3EYUL 3HE6A 3QWRD 3SKOB 2YPVH 4PLJC 2I24N 3HG1E 1PYWB 3LPFA 5I19L 1R3HA 5DFWH 3GBNL 2WW8A 3REWB 1OSPL 4G8FB 1HH6B 1KJ3H 3E8UH 4BSVA 1MAJA 4MWFA 5FK9B 1WWCA 3SJVE 4AH2B 1B4JL 3IAQA 3K4DA 4RISH 4ZOCA 4NP4L 3OJVC 4YDLC 1HSAA 5E9DB 4J3XA 4HS6A 1OP9A 2DLGA 4F15B 4O58L 2Q8BH 4HJ0C 4NDMA 1F4WH 5JXEA 2MCG1 1BMGA 3WIHH 3RWIB 3B43A 3ZT5A 1JPGA 1E4KC 3BDXA 3G6JE 3OKKA 3QZWA 4Y4FB 3TBVA 4APQD 5A2IH 3RVTD 2ZUYA 1UXWA 3D2UB 2NY5L 4I5BB 2X4SA 4QRPE 1T0MA 1MCKA 3I85A 1U8PB 3EDKA 2CK2A 1YMHA 4L8BA 1N64L 3RRQA 1ZWIB 1MCDA 4KH2A 3NA4A 2DYPA 3W0WD 3ARTA 3DMMD 4GKZB 5FHAH 4I0PA 4X6EA 4XBPB 3F62A 4ZS6D 3SCMC 1G1CA 2KBGA 4R2GC 5D6CB 3NTCL 4KRMB 3P73B 1C5CH 3RY6C 1RUKH 3SGJC 1SM3L 2NY5H 2XNAB 5IBTH 1CDYA 1NMCB 3L3DB 5FECA 3AXLB 3QR2A 1N64H 2HT3D 4NQDE 2XACC 4JCLA 5HDBF 5JHDA 2Y6SC 2JIXD 3UP1A 4Z77B 4JVUA 1MFAH 4X9IA 3X11A 1KN4H 3RQ3A 3WFDH 3KPTA 1QD0A 3WKML 1MNUL 3TJEL 1G84A 3H0TA 4P57B 5CGYD 1JMZA 1FGNH 2P45B 2R69H 1ZGLA 3S36L 1CL7I 2PYFA 3CH8A 4G6AD 3QDHA 3ZYZA 2HAZA 5EO9B 4ZFZA 2OR8A 3KVQA 1WAAE 4PB0H 4Y19D 1N2RA 1W0VB 4X9GA 3WNOA 1RU9H 1L7IL 1SJHB 1JYNA 4BZYA 1FO0L 5GHWH 5GGUA 3PWPA 4NJAL 4M00A 3UZQA 1RZ7L 3WFCL 3TJEH 4ODTL 4OD3L 1MCNA 3ALWA 1A14L 3RZCA 3S88H 2GTWA 1VADA 4KDVA 4PRIA 3TNNB 5BJTA 2VDOH 2ZKHL 2B2XH 1DQJA 1JMXA 2V9RA 4P2OD 5LXGL 4NQUA 4R4FH 5I1GH 2H32B 5FKPB 1UB6A 1L7IH 3M8OH 1FO0H 4WCYH 1I8KA 4NJAH 3K3QA 2W0LA 5E8NB 4M6MH 3BEWB 1PQZA 3DYPA 1X5IA 1NGYA 3TYGH 5I8OL 5EIQA 4G42B 5D1ZC 4Z0XB 5C6WH 1U8LB 2EYRB 3O6KH 3HNTH 5E2VL 3RKPA 3GZKA 5DFVC 5T5NG 3BZFA 5EOCJ 1X44A 4DCQB 1G1YA 1U91A 5IESL 3OV6A 3TIEA 4C58B 4JFQA 5E2TH 4M5ZL 2OXGA 4XVJL 5MP6L 5BVJA 4XHQA 4QHNA 1U3HD 1OPGL 4ZPVA 3LEYL 4HIXH 3MOQA 4H26A 2V17L 2BNQB 3UBXG 5DMIH 3O9WC 1WK0A 5ECJE 3KLHD 1LP9E 2Y06L 1JTOA 1NBVL 5ALBH 4Z0BL 3OJDA 4CMHB 1INQA 4U1SA 1RZJH 3LHPL 3VFTB 3TLRA 3BXNB 4WFFD 1S9YA 1UJTA 1VACB 4GRWF 3MJ9L 3A6BL 4XTRC 3QUXA 1EVTC 2VL5B 5I1JL 1AP2B 1NFDF 4R96A 1OCWL 5KSBF 1H15B 3QI9A 3FT3B 2VDLH 5IKCA 1VFUA 3BMWA 3HS0B 1JWUA 3FRUB 1G9NC 3PP4L 5IB2B 2FX7H 4YR6A 3S97C 1I1FA 5D2LF 2UYLA 3LHPH 1HHJB 3VFOB 5TDNA 3T65A 4OAWA 1JI2A 3VD4A 3O3UN 1PGRB 1DBAL 3I3BA 1KGCD 4JQVA 4HKBB 2P8LA 2CKBL 4FQCL 1UZ8A 3FMGH 4RMWA 5CILL 2P5WB 4XNQB 1IKNA 4EOWL 4NYLB 4IMLB 2DQJH 5HI5D 3B2VH 4OFVA 4FQJH 3FFCA 1EEYB 3PP4H 4V2CB 4Y4KD 1V7ML 4D0CA 4ZUSA 1KC5L 1RUML 4DZBA 2XY2A 4PD4J 4Y1AE 3O2WH 4GAGH 1EGJA 1SEBB 1CICD 1OTSD 4NZUH 1PAMA 4DKDC 1V8HA 2H9GA 1TQBC 1KEGL 2YD1A 1QBLH 4ISVA 5FYKU 2IBZX 2YXFA 2HTKD 4JFHE 5FUOH 4KI5C 2BSRB 2CKBH 2NLJB 5D5MF 4JZOA 1Q1JL 4QRTB 3L5XL 5D1XC 4JANA 1HYRC 4E41A 4J3TA 3ULUE 2Q7YA 1V7MH 2FIRT 3WSQH 3L7EA 3FHQA 4KAQH 2AKRA 2A74B 3N50A 4LEXH 4PTUA 3IYLW 3U7WH 3ARGA 4HUUA 5IFHH 1U3YA 1VGKA 4EZMA 5D72L 5J1SC 1PZUB 4WTZG 3BDBA 1KB5A 5MI0B 5IG7A 1U6AL 3QIUD 3VWJA 3FJTA 2BY1A 1AFVL 2FEDC 4G6MH 4M93C 3SJVB 1KF9B 4V1DB 1JYWA 5D6DA 5C2BL 4Z7WF 4KHTH 4HMEA 5T3XH 3ZO0A 1ZVSB 1ADQL 1QSFA 4Q2ZB 1YEKH 1KYOK 1OF2A 5SX5K 4PJCF 3NCCB 2QQNL 2A83B 1AJ7L 4U05A 1D5MA 3IJYB 3FT4A 4BFGA 3MRJA 4PJGA 3DRTB 4GRMB 4QRPB 4G8GD 2XWJB 1NSNL 3MJ8A 3MRDB 1WISA 2AJSL 1WT5A 3P77B 5KVDH 3ORJA 1IAIM 3BKMH 1E4XL 1R24B 1MQ8A 4QY8A 2OJEA 3SE8L 3IDUA 1RJYB 2J6EL 5DD6A 5K9JL 1HHIB 2OYPA 4R4ND 2I60H 5TJWK 2YRZA 4LP4A 4U6VH 4ELKA 3JZ7A 3LOWA 3VXME 5E00B 1HILA 1F02I 2HFTA 3MRHB 4FTVB 1XF2B 5FB8A 3FQWA 5L8LB 5DRNA 5E2WH 5DQ9A 4GW1B 1E4XH 5E9DD 3SBWA 1AQKL 2E6PA 4ZUUB 4HCRA 1XGYL 3VXPA 1G7LA 2J6EH 4PYGA 1HSBB 5D4QA 5K9JH 2H32H 4YDLB 2D31B 3MV7D 3DVFA 1B3JA 4L8DA 3MUY1 3WEXA 1DQLL 4ONOA 4URTB 5FM4A 5T1KA 5EBMA 4Y4FD 4RCAA 2OZ4A 4NQCE 3NOIA 3EDDA 3KYNB 3D2UD 2AXGB 3ULSA 3A0OA 4Z7OF 3CDYA 4S1RL 3PNWB 1DE4A 2MHAB 4ELMF 2PN5A 2VLJA 3O6FB 3L3IB 1NGWB 1WFUA 3RX7A 4P5TD 2R29L 1TZIA 4DVRH 3H9YA 1AQKH 1AGBB 3GK8H 4QYOB 4PBVC 1C5BL 2W0KA 5IHUL 3WV0A 1ZA3B 4N9GA 2W65A 2DQIL 2ESVE 5E5MA 2I9LB 5DT1L 4NCDA 1JUFB 4QXTB 3EHBC 1UJ3A 2BVEA 3C5JB 2VDKH 4YX2H 1YY9C 1AKJD 4RX4A 4KC3B 4MDIB 3SCMB 4M1DL 1YEGL 2DQGL 4G3YH 4GFTB 3EYFB 3OXRB 3Q48A 4EUPA 2CDEB 5DEGA 1NGPH 5ITFA 5FYKE 1J7VR 4F8QA 3HCVA 1RFDL 3SKJL 4L8SB 4AIZB 1J88A 5E8OA 1QFUL 1C5BH 1UACH 4YQXL 3KDMB 2YD6A 3TT1L 4HKXB 5DT1H 3TN0A 2Z31C 1RZGB 3MRNB 4A6YL 1AGDA 3PV6A 4XP4L 4XPTH 3OG6B 4DFIA 1A4KA 2UVEA 3MGOB 3QDJE 3ARBA 4HK3N 4M1DH 1F3JA 3SE9L 4QXUL 3IETA 5E6IC 5DSCA 2V6HA 2W9EH 4D0BB 3KPSB 1MREL 1EVUA 1DZBA 5EC1A 3CMOL 3G5XA 2EXWD 4XPHL 5FYLL 3MV01 1JF6A 4PB9L 1NMBL 5HYSB 4TOYH 1N3NB 4XH2B 4FZEH 2FSEB 2RB8A 1KPVB 3TWCL 3QDMD 4KKLC 2F9BT 1KCVL 1LP9B 2X4NB 1H5BA 4QXWA 5TE4H 1BVZA 3N1FC 5HBBA 3MC0A 4PS4H 1FVCB 5F72S 1MREH 2JJSA 5E99H 3AVEA 3VFMB 2DDQH 5FYLH 2IALA 4L4VA 1KTLB 2BOBA 4YHIA 1GCFA 3IDMB 3LKRA 2D7TH 4MAUH 2DKSA 35C8L 4M7JL 4U3CA 5SWSA 3VDBA 4LAQL 3GMNB 3U82B 1F6LL 4U2YA 2GTZA 4ZDHB 1LMKA 4UUJA 5JZ7D 1KCVH 4LKXA 3DYOA 4UB0H 1ORQB 4U6XB 4HEPG 4EBQH 5KJRL 1YJDL 2B7DT 4J8RB 5D1ZB 2R0WL 2BMKA 1EERB 3VXNB 4PRAA 5L6YH 1EUTA 5ADPL 4KJQD 1N5AB 2A6IA 3QNXA 3ARSA 3KJ6L 5H2BA 1MRDH 1FNFA 2FX8H 2YXMA 1ZEAH 1RZKH 2NX5D 1GGIL 4Y1AB 2EYTB 4KV5F 2ICCA 3HUJF 3SO3B 5DJYA 1BLNB 3O9WB 4WI2A 2AS5M 3OB8A 1SJVA 4BSWB 4B7IA 5DWUH 4QRQA 2VWEC 2EECA 3OX8B 4LSVH 3TP4A 4LPTA 5JUEH 5JXAL 5ID1B 2Q3ZA 4XP5H 1NFDA 3S9DB 1WZ1H 1MFEL 3K8LA 4FP8L 3GMPB 5KSBA 5JO5A 3TV3L 2LU3A 4KKCD 4NRXB 4AENB 4Z6AT 1TMCB 3CVHB 1D6VL 3O4LD 1W2KT 3X13B 5JLZA 2DI7A 4TUKL 2VLMD 3VE0A 1RK0B 3GSVB 5I76A 1S9KC 5D2LA 2FZ3A 2HLFC 3RVXC 1R5IB 3STZB 5E5UB 3L7FA 2YUZA 3IAGC 4LLYA 4YHOL 4KGLA 2C3WA 5D7IF 4H25A 2P5WD 1NJ9B 1IAKA 2QKIB 2HJKB 3D3VD 4Y5VC 5D7SH 2GEEA 3TV3H 2W0PA 3SE4C 2WBJD 5CLWA 1KXVC 1X3DA 3EYVB 2HFEA 4TUKH 1FPTL 4CAGA 1N6UA 1YNLL 2BNRB 1AI1L 3BD5A 1NGZB 5DRWB 5FYLD 3QNYA 1A21A 2P7TB 3TF7C 5DQDL 3NBNA 4W4OA 1MRCL 5IEHB 4JM4H 5D5MA 4MB4A 3V5DB 1T22A 3H9ZA 2IFGA 3W2DH 3WHE0 2AJZB 3ECBA 3DO7A 4HW6A 4N0UE 4OLYH 2NY7L 1A5FH 3HG1D 4HIIB 2JE8A 3U1SH 2EDEA 5BXFA 2O5YH 1HXMA 1VEOA 5DR5L 3V4UH 1X4ZA 2ENYA 4FQHB 5I0DA 2DQFB 2OSLB 5DMGC 3VXMB 1KXQE 5ACZA 9CGTA 3SJVD 4P5MA 4Z7VF 4Z9KB 3UDWC 4OKDA 4X4YA 3KXFE 3D87B 2XXMB 5JQHC 3O3EB 3LKQA 2A9MH 5JQ6H 4KTEH 2UWEF 3GUTB 2E8YA 2IPTH 4Z7WA 3L6FB 3I3EA 4GXVL 2CUIA 2D7NA 2A77L 2HFFB 5BS0E 2HJFA 3QWRA 4WWID 1RD6A 4PJCA 1M71B 5ESVA 2YK1H 4QRPD 5GGTA 1BGXL 5AZEL 2N7AA 4OGYH 4OZFH 1S8DA 3FB8B 1CR9H 5AAMA 5IOPA 1RIUL 1JZ7A 3P0GB 4LNRA 4P4KD 1GL4B 5D71L 4K3JL 1KPRB 1T1YB 5GJTH 1Y18B 5CP7B 5B39G 4D9QE 2ESVB 1XT5A 3RBGA 5L2KD 3ZTNL 5EOQL 1VFAA 3L95B 1EX0A 2GI7A 2FRGP 3CLFL 5L9DH 2PF6A 1K2DA 4K7PL 5HYIA 4APQA 4U1IB 2ORBH 4LPXA 4MAYC 2FEEI 3HZYA 5JW3L 3DX9B 3RA7H 1AH1A 4NQDD 2W0FB 1I75A 2GJ6B 2O61A 5E6YA 5C0JB 4GS7C 1AY1H 2CGRL 3RKDD 3W0WA 3DMMA 4FXGA 4M1CC 2A9NL 5T3ZL 1EMTH 5EBGA 5DS8A 25C8H 5I1EL 3F7RA 3GNML 5EC2B 4HV8B 1I9IH 2A6KB 3O6FD 2CSPA 1YN7A 1AGEB 3QDJB 1EZVY 3C6LD 5EA0H 3FQRA 1OP3H 1BBJB 4HUVB 4RZCB 2X9YA 4X5WB 4ELMA 1B0GB 1GPOH 4MXVF 3I75A 4G7VH 3KPLA 1RK1A 5EZJA 2JIXA 3MRCB 1P7HL 3DV6A 2OQJB 4P49A 2DJSA 5CP3A 2KL6A 2E9WA 5H94B 3GGWA 2HVJA 2D3VA 3NFNA 4WU7A 1AXSB 3C2AH 1TPXB 1KNOB 1NPUA 1H9VA 1S7TA 5I1EH 1XGQA 4NKMB 1ZLUH 2ZNXA 3SCMD 4PJFE 3ULUL 1BZ7B 3PWJA 1JHLH 5DMKB 1DBBH 3OGCA