3KYKH

Crystal structure of li33 igg1 fab
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
220
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSIYPMFWVRQAPGKGLEWVSWIGPSGGITKYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTATYYCAREGHNDWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy Chain Li33 IgG1
publication title Improving the solubility of anti-LINGO-1 monoclonal antibody Li33 by isotype switching and targeted mutagenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kykH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kykH01
4ISVA 1DQDL 5HHMB 3CGTA 4GUPB 3IETB 5T3ZH 4C54A 1DVFC 2BCKA 1C5DA 4M3KB 3ZE0F 4W4OA 2OS7A 4K8RH 4KRPB 3AM8A 4KHTH 3BVNB 2GITB 5D9SA 4PJ5D 4WWKD 2ED7A 3E8UL 1YJDL 2BNQA 3B6SB 3SDAC 3F62A 2HTLC 3EOAA 3A6OA 5EOCJ 5HPMB 3V2AR 4OLUH 4XGZB 2M8XA 5SX5K 4LFHD 4H20H 3AS3A 3LHPL 1EHLL 2GHWB 5D1ZA 1GAFL 5JORB 4WI3A 4O9HH 1J8HE 1KEGL 3NCMA 5HGBB 4OZIE 2LAGB 1FJ1B 2KZWA 2ARWA 1CT8B 3L3KB 1P4LA 15C8H 4PB0L 3VFTA 1WFTA 5FEBA 3L7EA 1CR9H 2NY7L 3CVIH 4HWBH 1I1FB 2Y23A 1U0QA 4LDLB 2R56H 3HI5H 1DE4A 3LQZA 1XFPA 3PGFL 5ESAB 5ICYA 1WQVT 5B21A 2R0WL 3GSUA 5ICXA 1G6VK 2OLDA 5IF0B 2BSRB 4DTGL 1OGTA 4P46D 5JHDA 1U8IB 3P0GB 3EJYC 4M9OA 3MMEA 3N06B 4HKZB 2AV7B 4ZFZA 3KPLB 2ZSWB 4WV1C 1QYGL 4QRPD 4RAVB 4TVPE 4C57C 3LSOB 2Y06L 4F33A 1MWAB 2FIRT 3BW9A 5IB2A 3J7HA 5AYUL 4WUUA 2IADA 3BJ91 1BF8A 4PRPD 3KPRE 3VFSB 3O3EA 3TZVD 4KDTA 3VFMA 3SQBA 1KEMH 1VFAA 4UBDD 4Z6AT 3X13A 1IEAA 1YNLH 3PIQA 5ACLA 3OZ9L 4KPHL 3FHQA 2QQKL 4U1GC 2OMNA 3WS6C 5DVKA 1IARB 4ZODA 3FJTA 1Y6NR 5DC4B 4I9WD 1S9VB 5E8OB 3ROOB 5ISZB 4HG4K 4M1DL 1QPPA 5HY9A 3SE8H 4NP4H 3QYCA 4OLYH 4CVZB 4Y2DD 4TSCH 1J1OH 1RJCA 4GS7C 4FABL 4XPGL 2BVQB 4HFWB 2WQRA 3RDTD 1U8NA 4U31A 5I19H 3LQZB 1T80A 2F53E 4XPHL 3S37L 4MMXC 1M7DB 2CUHA 5K9OB 5SWZE 3UPRB 3U30C 4HV8B 3GHBL 5GGUB 4JPKH 3ARDB 2DRUA 1JWMB 4GRWH 2BMKB 1A1NB 1RFDL 2BJMH 3G6DH 2GCYB 2Y36H 4JKWA 4G8IA 9CGTA 3NTCL 3C2SA 1IGYB 1UB5B 2ZNWA 3VG9B 4S1QL 2BFVL 2M26A 1I9JH 3HUJE 3BH9B 1E4KA 1K6QH 2H32B 1HI6A 4K94H 2X89A 1YN6B 5DMGD 1U3HA 5E4EC 5I76A 1IKNA 1T7VA 1D5XA 5EUKA 2HKHH 2NXZD 4CU7A 2F8OA 3F8UB 4DUWA 1F8TH 2DM7A 5E08H 4OGXL 15C8L 3P77B 5BOPA 2G75A 2PNDA 2AJVH 3WJLA 4ZFOA 5C0ND 3IDYB 3PL6C 5IESH 4IMKA 1LMKA 5MENA 3HG1E 4I5BA 2EDDA 4F15C 2FRGP 1MFCL 4NQXA 5C0FA 4OT1L 4MJIE 4IOFD 3KPSB 4L4TA 4QTIH 4ZUSA 3HN3A 4C83B 1F02I 3H7LA 3VXPA 3U2SB 1BFVH 3HZVA 2M2DA 4GKNA 2WUBH 1Z9MA 2VDQH 2HVKA 1DBAL 4TVSa 2Z4QB 4GXVH 2OQJA 2VDKL 1U8NB 3EFDL 5CGMA 2E8YA 3BI9X 1DANU 4G7YH 5B38B 1KPUB 3REVA 3W0WA 3S9DB 4UIKH 4MNGE 5IP4A 4LSQL 3RGVD 3T3MF 1T5XA 2MMXA 3BRGC 3UTTD 1L4IA 3C8KB 2BNRB 4NGHH 3OKDB 5DJZA 5EU3A 1RIHH 3LEVL 1U8HB 5SWSB 4O02L 3UZVB 3RAJH 5HHVH 3BMVA 4KC3B 3T04D 3RKDD 4I2XA 4CVXA 3LS4H 4N9GA 1UEYA 3EFFB 3K2UH 1RK0B 3BGMB 4HK0B 1BVLB 4LKXA 1S5IH 1HNFA 2HMIC 4OLYL 5L2JB 5I74B 3CMOH 3H42L 3V4PH 5EU6D 1XF5A 3HC3H 1B0RA 2GSIA 3B5HA 4U4BA 1IE5A 1I1AD 4M1GH 5I19L 5GGTA 1E6JL 4HG4J 3CXDL 5FYLH 4CN4A 5GJTH 3AXLB 3MRJA 4KY1L 4QHNB 3UDWC 2CO6B 2YN5A 4NQXB 5C0FB 4LVHB 4J6RL 1I3UA 2MHAB 1QKZH 5ITFA 1FO0B 3JWNC 3SQOL 1IGIH 4NBZB 4NO2A 3HZVB 4X98B 5DJYA 3L7FB 2UY6A 4GKNB 5I8KH 3U46A 1CFQB 4DKFL 2R4RH 1VACA 4JPIB 3GJEA 2HG5A 1J1XH 2YRPA 2OM5A 2KZ1B 4HUVB 4L8CA 2DM4A 4CU6A 2HRPL 1GZPA 1DTUA 4M6ML 3ZKMD 1QA9A 4L8DA 1MJ8H 4G3YH 3VDAA 1DVFA 1NANH 1G0YR 3RZCD 4RMQA 1M1SA 4ODWB 2CK0L 5EU3B 4JO3H 5IFJA 3ZMRA 3G5ZB 5CEZD 1OQOA 4KTEH 3BYTA 4AEIL 4KROD 4R3SB 1ACZA 1M71B 1PBYA 1UM6H 4KKBD 4ALAH 4CVXB 3QDJA 2MKWA 2N7BA 4OKDA 4IIQA 5EU4A 3T0EC 2A6JA 1F2XK 4POYA 2MSPA 1F11B 1P7KA 4LKXB 1RZGB 2AJYL 3Q5OA 5CP3A 5DO2C 4N8VG 3TT1H 2FL5A 4CVUA 1YMMD 1FZJA 3U4EA 4EI5B 1EDQA 4Y4KD 4Z7VF 1XF5B 3RVVD 1ZGLP 1N26A 3MLRH 1H3WM 3CUPA 4NNXA 5DQ9B 1WEJL 2BDNL 3R1GH 3NA4A 3GSOA 5K93A 5J3HD 2DB8A 3SDXB 3I6GA 2ICEA 2EKSB 1FORL 1Z9LA 5TDOA 3BWUC 4N0CD 3MLXH 4K2UL 3GI9H 5T1MB 5GQBA 3FTGA 3OX8A 4C56D 5I15H 3QDAA 3ARVA 2YD6A 3FQUB 1EA9C 3MRCB 5EWIL 3C60A 3IKCB 3S3PA 3RWCB 2FECL 1FFPB 1TJHH 4KAQL 1B88A 2CIIB 1A5FH 5DUPH 2VLKD 3A0OA 4HQQH 1LO3L 5CGTA 3DVNB 1NMCC 4HUWA 3ZE0E 1FYTB 2G5BA 1U92B 3QULA 5HYFA 1VFOA 1INQA 1H8NA 3ZTNH 2HT4D 3HE6D 1KCRL 1SYSB 2WUCH 4Z7WA 1K85A 4X7EC 4FTVB 2X9WA 5I1IL 4P4KD 5IM7B 4MB4A 5DJXA 2EYRB 5EU4B 4JFHE 1DLHA 3GMQA 3S36L 4NFDA 2IEPA 1C16A 4NN6B 3OAYH 4HK3N 2BX5A 3QUXA 4XMLH 1T0PB 4NNXB 3QRFM 5HYEA 4HJJH 3VI4F 3MJ9H 1N64L 1QBMH 1HWGB 4R0LB 4X6EB 3ZTJH 5C9JB 1X5FA 2ICEB 4LSTH 4PG9A 3X14A 1JHLH 1J0HA 3QB7C 3QH3B 4XAKE 3D3VB 1RJYB 4HWZA 4G9DB 5DHYA 5ADOH 2VR4A 4RFEB 3GUTB 3RNKA 1T21A 2XZCH 4BK4A 5LQBH 3HC0B 4G6ML 3WLWC 1OOAA 1MI5B 5EZJB 2FJGB 2YD5A 5A2LH 5LGJA 3OXRA 4G8GE 1JV5B 3V7AE 1SBSL 3ARTA 4Y4HD 1MAMH 3ARBD 5L8KB 3DRTB 1NCWH 2CRZA 1MFDL 3N1MC 3GIZL 5LXGL 4Z78B 4CMMA 2R2EB 5DJ8A 2AQ1A 4JM2C 4RA0C 4YAQA 5EZLB 3ARGB 1FGVH 4ZOAA 4ZO8A 2XTJB 3RPIA 5EN2B 1TIUA 2XACC 3L3DB 4OB5H 3PL6A 4DN4H 1J86A 3H9SB 2VE6B 4P2RB 1K3ZA 4JFFA 3GMQB 3GKWL 3NH7L 3MRNB 1H8OA 5GIRA 3P73A 5L2KB 3VE0A 4N0UA 2L7JA 3DVGB 5FCUL 4N1CA 5CSBA 1MJUL 5ERWA 3QPXL 1J5OL 5HGAA 5LBSH 1NBVL 1YNKL 3FQRB 1KLUA 5DUPL 5C70A 1FL5A 4QXUH 3Q6GL 1HHHB 4QYOA 4Y4FC 1QFWL 2EDQA 2RIKA 1J12A 4LCIH 4QHMA 3TH4T 1XIWB 4HWZB 3C5JB 1MHHA 4OJFL 3OPZH 3GSNB 1T21B 2EDNA 1VKXB 1J8HD 1FNFA 4HS8H 4ODTH 5BV7H 1D5IL 3ZZ1A 5TDPB 4GG6B 5GGRY 1P7QB 1RIUL 1YEEH 4O51A 2NCMA 1KJ2A 3UTSA 2NNAA 4U1SA 1JGUH 4XWOD 4R2GC 4HXBL 2RCSH 8CGTA 2CMRL 1BQLL 4LVNB 2GJZA 3UJJL 1S9WB 5TQ2H 4PJHE 5J1SC 4V2BA 4DFHA 1MIEL 1LP9B 3O3AB 5EC1B 5E8EA 5A2JH 5T1DL 2NTFB 2YPLB 4HS6B 2ZUSA 3QCTL 2B4CC 3KWWB 4EKXA 1ODAA 2A83B 2YSSA 1J0YA 1GC1L 1NGZA 5E0QA 1OSZA 3LKSA 2OJZL 1D9KA 3P30H 4X8JA 3L1OH 3CFEB 5J12C 4PB9L 3SOBL 3VXOB 4YIQB 3OBAA 5C1MB 2HRLA 2NXYD 1T1ZB 3VE0B 4PIRF 4NQVA 3VDCA 4UT7L 3VFPB 4PRAA 4NUJA 1ZMYA 2ARJB 4QHKJ 2DTML 3DV4A 3DXAE 2P7TA 3O2VH 5JO5A 1AGEA 1AHWB 3F58H 3V5DB 2F54D 5EBGA 4FQXB 4LQFL 2ID5A 1HCVA 1NCWL 4NNYB 3MXVH 4P2QA 4H1LH 4WHTA 3I02A 5AZEH 7CGTA 5HHNA 4J3TA 3EDJA 2J5LC 5J6HB 2EE2A 3L3HA 2DD8L 5FDWB 4K9EH 1PX4A 5KSAB 2VABB 1L7TH 3QA3A 2H6PA 5C09B 3KPOA 1VPOL 4EI6A 3MRPA 3IDIA 4BZYA 3RA7H 2ATKB 4IOSD 3STLA 3NN8A 2CDEA 3KYKH 1S7QA 3QO1A 4PLJD 3ABZA 3T0EA 5T5FH 1JGEB 2F53D 2WV3A 3MRMB 1C5BH 2DYPA 5EO9A 1OAQH 4S1DD 4G5ZH 1EFXB 4H26B 3AS1A 5SWZD 3HKFA 1QLEH 3LY6A 4JB9L 3QCVH 4LDEB 1G7MB 1ZXQA 2QSQA 4QXUL 4TNVF 2J3SA 3H2WA 4HKBA 1KGCE 1BEYL 3V0WL 5SWQB 2EZ0C 4UU9B 2Z91A 2FO4B 3E3QE 4S1SH 5FAAA 4OQ1A 3WN5A 5HSFA 4OD3H 2Z31D 1CICA 3KNBA 5BV7L 2EDTA 3E3QC 3OKOA 5KVGH 5MI0B 5FHBL 2WAHA 3PWVA 3PWLB 3LKRB 2WWMC 1EGJL 3DV4B 2APXA 4OAWA 1A7RH 4J4PC 4PJAA 3PHSA 2ARJQ 4F57L 3TBYB 1GOHA 3GBNL 4BM7A 3TV3H 2AABH 2W07A 4Y1AA 3OGCA 4XRCA 2X09A 3HG1D 4PRNB 4ZXBC 4X7FC 4GW1A 3BXNB 3D9AH 5DMIL 5DD3L 4D0CA 4QGTA 4G8FB 2NMSA 3LMJH 1NAMH 4GJTB 5INCA 1F4WH 3GM0A 5FKAB 1LQSR 4LCWA 5D2NA 4MAYD 1RUKH 1BIHA 3QA3B 1A6ZB 2H6PB 4JO2H 4DOHE 2WBKA 4M48L 3MUHL 3W39B 3B2VH 3QG7L 3B4NA 4Y8DC 1D6VL 4HX1B 5KS9B 1QRNB 1MSPA 4J3WA 3LQAH 3R0MA 1JL8A 4LHUD 5CLTA 1ZWIA 5GGSY 2CPCA 1K4DA 5FKPB 2IMMA 2I60H 1PQZA 1DN0B 1DBKH 3DIFA 5C0CB 3HAEA 4RBPH 4NZUH 4Z7VE 2GFBA 3HPJB 3MSPA 4HKBB 1TLKA 1UZ6F 5F7NC 3VFGL 3ZHDA 1H9VA 3LDBC 3TBVA 2D2OA 2DQDH 4JFEB 4N5ED 1LDPL 3WN5B 4XPTH 4QTHA 5AZEL 3PNWB 2PF6A 5GSRA 4MVBD 1J10A 3OKOB 4NZJA 5AEAA 3TYFB 3MACH 3OJMB 4LSPL 1FNEB 4K9EL 4LPUA 5HVFB 3TBTB 1MEXH 1U95A 3BPCA 5FA3A 2A74A 4DUXA 3VXRD 2VLRE 1EJOL 1NC2B 2XKSA 5E9DA 1KIPA 1NFKA 1MFBL 3GFUA 1FNSH 1BWMA 1K8DB 1FSKB 4WUKH 2AKRA 3OGCB 3QIBA 2J8UA 3QFJA 3VWJC 2Z35A 1N3NB 4OCXH 4D0CB 5CJOH 1MREL 1GSMA 3OV6A 1BZ9A 2I26N 4O5LH 4ZAKC 2ZKHL 5F96L 1N7ML 3FQWA 1QFPA 3WXVH 4JM2A 2GK0A 5IB4A 3QEQE 3ZHLA 2KQNA 3PABA 4MQTB 4OLWH 5GJSL 1BOGA 1HXYA 4S1SL 4NQCE 5IMKB 3O4LD 1CU4L 1I7RB 3QXTA 12E8L 2XWJB 2EYSB 1A3RL 1Z5LA 1UGNA 3SO5A 1F3JA 3DIFB 3EO0A 4HUMB 4U1KB 1OT1A 3KYNB 2L7UA 4FQLH 4OM1L 5I1EH 1SEBB 2VDNH 3NPSC 2VKXA 4XPAH 4KXZH 1RJZB 4GO6B 3VI4E 1NFIB 1PZ5A 1QBLL 3K81A 4YBLB 4NWTH 1MCCA 4IMLB 2F8XC 4QTHB 5TH2B 1NPUA 4O2FA 1IM9D 3EDKA 4TSAH 5JA8B 4HH9A 2XZQH 4QT5B 2EXYD 4JN1L 3L6FB 4TUOB 3TJHD 2OMBA 2CRIA 1S7XA 5CBEA 5GGVL 1MCJA 1CD9B 5M7QA 3UTQA 3RL2B 1QFHA 2AKRB 4K7PH 2VQTA 3JUZA 4L3EB 2NY5H 3MO1B 2LV4A 2IAMD 4I0KA 4LCCB 1T3FB 1NAKH 2EDJA 3KPPA 3FQWB 3GRWL 3PWUB 4X5XB 3CVHB 1KNOA 4RFNB 4DGVL 4ONHA 2SEBB 3L5XL 1VERA 4HWBA 2Y1VA 3VXQB 4GMTH 5DVMA 5B39G 1FDLH 4GW4B 1IT9H 4MGXA 4UDUA 5GZND 2D0FA 2AK4B 5J11C 4BQCA 3UC0H 3MA9H 1F6AA 4PP1C 1NGXB 1JI1A 5D6DA 4YDIL 3V95A 3QHZH 1ED3A 4LGSB 2BNQE 4Z7WF 2O61B 4UDTA 2DN7A 5DMKB 3MLYL 4PJ7A 4WW1A 5CJOL 2R0LL 4YX2L 4PYHA 1J1PL 4JFHD 2H8PB 4U1NB 3HR5B 1NCNA 3U6RB 4JVPA 5F88B 4Z8FL 5BW7C 4LSDA 3B9DA 3QQ3B 4U2ZA 5JLZA 3M17A 4TYUA 5ISZE 3WFEH 3KVQA 4N0FB 5IQ9A 1OAZH 3CFDB 3UTQB 2BVUA 4FFWC 3DI3B 2PO6B 3BQUB 4I48B 4DGIL 4LRNL 4G6AC 1TVHA 5J1AA 4XAKD 4LLVA 3B8SA 4XH2A 2HLAA 1WBZA 1OAYH 4XNUH 5F3BB 1AD0B 1ADQL 1YEJH 3N0PB 3WO4B 2X4SA 5DRZA 2NY6C 2DLHA 1ZHLA 5BJTA 2AV1B 1IGCL 4GG6F 3RVUD 4D8PA 5JHDE 4CDHA 1CXLA 4KMTH 1GC1C 2CLZA 1CS6A 4P5MA 5DDHA 4LAQH 1J11A 4N0YL 1B9ZA 4KQ3L 4NM4H 4G8GD 2KH2B 2J2ZA 3IFNH 4TOYL 3ARDC 4WO4C 3U7WL 1J9CT 4OZFA 2H9GB 2KUTA 3FB5A 5CJQH 2VLLB 1I8IA 1X44A 4WUUE 1G6RH 1LP9F 3MLWL 3VG9C 1FL6A 2ADIB 3FO2A 1FIGH 1F13A 5EA0H 1RD6A 3CCHA 2WP3T 2X4OA 3HFMH 1EVUA 3BEWB 4MJ5A 3SKOB 1CVSC 3TO4A 5C7XL 3B3IA 7FABH 1X5KA 4WW1B 1I1RA 1R3KB 1Q94B 2DQGH 4MQXC 4ZXBA 4FQ1H 1YUHA 3RBSA 5E5MB 3SKMA 2YD1A 4I18C 2DWEB 3MLVH 2AJXL 4HLJA 5FO9A 1JPGA 1TVDA 3GHEL 3JXAA 3KPSE 1WBXA 1KPRB 2H2SD 1I9EA 5E7FA 5IQ9B 4IDJH 1BLNB 3RL1A 4UINH 3HLAA 1WCQA 3MRQA 4NN5C 1OTUD 4EBQH 4WWID 4G9FA 5BZDB 5AAWA 5J1AB 5D71H 4OCMC 3G5XA 1WBZB 1EO8H 4LSRH 4EN3C 25C8H 4J3UA 1MHCA 2Y5TB 4ODXA 3IJHB 1IC1A 2VDMH 1OHQA 3GEWB 1FLRL 4HXAH 1HINL 1KIUA 4Z7OF 1SEQH 2D03L 4TPRH 1CGUA 2F5BL 2HJKA 5I1GH 4JN2A 1VESA 2VQ1B 1Q9LA 5SWSE 1U8KA 3TN0D 4X9GA 4I4WB 3X3GL 2RBLA 3QZWB 3PV6B 1JFQL 4NQDD 1KG0B 3FB5B 4F7EB 1UJTA 4JQXC 4GRWB 3MYZA 2ADJB 4X9IA 4JZJC 1RVFH 2VB5A 4CADB 1OAUH 4FZ8L 2P5ED 3AU1B 1JF5A 4ZTPH 1Q1JH 4X4ZA 1AGBA 3O8XC 4FFZL 2PCPA 5I74C 1R3IH 4N9OB 1AQDB 5E5UB 3BP6B 4WIQA 3DSNA 5MENE 3MNVB 3SCMA 3VWJA 4M6NH 1DDHB 5KVMC 3MUY1 3VXTA 1GZQA 4DN3L 4AT6A 5FO9B 2IANB 4NO0D 3QDHA 5IQ7H 3GNML 4LLUB 4LVHC 4TUJA 2JJVA 2NY0B 1YPZB 5IVZB 2M1KA 4G7VL 1E4WL 4HSQA 5IK3A 4JRXD 3B9KD 2DWDA 4XBPA 4ZSOB 4IHOB 4D9RD 4GQ9L 5GHWH 5IW6B 5HHPA 1BQHA 4PJFB 1DQMH 3VXSD 4L4VD 3AS2A 3FOMB 4JFQB 4HC1H 3NFSH 3D69B 1MRFL 7FABL 2D4FA 5F1OB 1Q9LB 1V3MA 1UZ6E 5I1AB 4QRTB 1CD8A 3HZMB 1UC6A 2I5YH 4YUEL 3HZKA 3CFCL 1ZA3A 3QO0B 4AMKH 4ZYKA 2JJSC 3BKJH 5EORH 2B1AL 4TRPL 1B0WA 1HSAB 1KTDB 3C08L 3VWKB 5CINL 2F19L 2AXGB 4AEHL 2D4DA 2DLEA 4MD4A 2VXTH 1OGAA 5BZWA 3BKCH 3BIAX 4MJ4A 1ETZB 1KGCD 4ZTOH 2IBBA 4JDVA 1NCUA 4EI5C 2DQJL 1X6NA 1RZJH 1EO8L 5D2LA 5CEZH 2YXFA 3SDXE 4NPYA 2YD4A 3W9EB 4R96A 1FBIH 2VDML 2MCPH 2L4OA 3FB7A 2AGJL 2B7DT 4JZOB 4P3WA 4M93C 4UZGA 4F7CB 3G5YB 2BK8A 4FZEL 3QNXA 4K71C 2DMBA 5EU7C 4YO0A 2VLJD 3V52L 4JLRB 3C6LB 1FHGA 1JPTL 1R5WB 4JHAH 3D39D 1JWSA 4Z7UB 2DIAA 1HILA 5D6CB 5TQ0H 5E1AA 1JF1A 1FCGA 3FQXA 1BQHB 1IAIM 1ZHNA 3EYOB 1HNGA 2EIDA 3G04B 3BKMH 1SYVB 5D1XD 4UILL 4BSWB 5FUCE 5DRWB 2R29L 1G7IA 4KUCF 4PJDA 1MH5B 3U0TB 5CD5C 2VDOL 3T0BA 5KG9A 5E8PB 3QDJE 1NBYA 3HNSL 5I30H 4GOSA 4Z95L 4MD0A 5F97E 1W0VA 5DJDB 4XVUD 3O9WC 4UIMA 1N5YH 1P6AB 2HJLB 1UWGL 5D93B 3WEXA 5I73C 1LE9A 3HI1B 5FO7A 4KV5F 3FCTA 2Q87A 1A2YB 1FG2B 2AEQL 5IV2B 4JRYB 4NPYB 3ZDXF 5IOPB 1MCOH 4O2EA 4WI4A 5FYKL 3GMLA 1I9RH 4TTDC 3QIUD 4B7LA 5E6YA 2H3NA 3MJ9A 2P47B 4GAJL 1CDHA 1EFQA 4Z5RB 1CK0L 1SJEB 1NCBL 5KSBB 3FMGL 5DJ6B 4MA3B 2V2TB 1MI5E 5MP6H 3FFCD 2R9HC 3RIAF 2J8UF 4CBPA 4WO4A 5JTWA 3QAZC 1CDIA 1RZ7L 4NM8H 5D1QC 5H35B 5IEKA 1I7TB 3S98A 4DCQA 2XWTA 2VDRL 3O2DL 3QEGH 5HHXL 1JUFB 1V3KA 1LILA 5ACMA 5I71B 1GGCH 1BGXH 5C6PB 4FN0A 5FHAL 5E03A 4U1MA 1DBBL 1CBVH 4Z7WE 1PD6A 4GAYA 5FUOH 4YDJA 4MDJB 3ARGC 1A3QA 3T2NH 4RFOH 2XTJC 5DLML 3H9SE 5D8JL 4P2RE 2MCPL 1QBBA 1V7MH 2YD8A 4I18A 4NQTA 2CK2A 3HPLA 4K07A 1Y18B 1XF1A 4BFBD 3WEXB 2VZTA 2DKSA 1W0YT 3WV0A 1LE9B 1ZS8B 5MEPA 4NO5A 3IDGA 4U6HA 5I1LA 3GMRA 3UP1A 3MR9A 4Q2ZA 2EDBA 5EFIA 1A6AA 5IG7B 1RQ5A 5I8EB 3OAUL 2QQNH 3LKPA 1P4IL 4ZQKB 2J1KA 4JPVL 1DANT 4MXVF 5IT2L 1XIWC 4Y5XA 5HGHA 1E0OB 3GMPA 4XNQB 5K9QI 1KB5B 4GG6E 1OF2B 3W5MA 4LF3B 2DJ4A 3CPLA 4I8DA 3PP3H 3VD5A 5ID1A 4IRSC 5K9JH 2VSCA 1NEZB 5J13B 4JQXA 1UQSA 1EGJA 2UY7A 1LP9E 3BRDA 5HDQH 3O8XA 1FAIH 2E27L 3ECBB 3RWJB 2Q8BL 3OKMB 2X1QA 5FGSA 4WTZA 1CLZH 5KOVC 1UXWB 2GIYA 3S88H 3N1PC 1HYRC 4MA1B 2FIKB 3R0NA 1DQLL 5T3XE 4J7RA 4DK6A 1BP3B 4LARH 4BUGA 4N0UE 4TSBL 3RBGA 1LO5A 1CYGA 2BNQD 4PGCA 3QUMH 4XVJH 4LNRA 5T1KA 5MEOA 4PV9B 5EULV 4NBYB 4Z77B 3VRIB 1Q9WB 4XI5D 5C0RH 1AHWC 4NC2B 2V5RA 5D1ZD 1KLGA 4FQXC 2OR8A 3LZFH 2P8PB 3BT2H 5ISZD 4Z7OE 4E5XB 3UTSE 4Z0BL 1UKSA 3H0TB 1LK3L 4WFFE 5IMOB 2UZYB 3I6KA 3BUYA 4WJ5B 1DL7H 3BX7C 4R7NA 2VXUL 3LN4B 1ZSDA 4OCWH 5KOMC 5KSAC 3QI9A 1JRHL 2X4QB 5CCKH 1Q72H 1GGYA 2MNUA 1NUFA 3IDXH 4RGOL 1HXMB 4XBEH 1I85C 5JHDD 5C07A 2YEZB 4FP8L 3CX2A 3PG2A 3BHBA 4HCRL 5ECJE 2XWBA 1CFSA 4G6KL 3MJ7B 3TIEA 2KKQA 4CW1A 2QR0A 4NO3B 3AMLA 5FYJE 2OTUB 1FZMB 1XEDA 3U82B 4YHIA 4KGJA 4KKLD 4LEXH 2YOCA 2B39A 2OI9B 3QR2A 3T08A 5HD8D 4WUUD 1OD9A 4GRWF 3VCLA 1NDMA 3T65B 3G08A 3MV7A 2K7QA 1WFOA 1EAJA 1NEUA 3O6KL 1QSFA 4PJCB 5MI0C 3OR7A 3FT4B 3GK8L 1PSKL 3D0VB 5FV1L 1F3DH 3MJ6A 5C0GA 3GMMB 3P9MB 1Q0XH 4JY5L 4XP1L 2V7NA 3SPVB 3PHOA 2WM0A 2EE3A 1KN4L 3O6FB 2P48B 1T89A 5ALCL 4PJGA 1A6VL 1HZHL 3RWDA 3EOTH 3KR3L 3KXFA 4H1LB 4XMPH 3C5ZC 2R2HA 3Q0HA 1F45A 1NAMA 2IQ9L 5KS9E 1QRNE 3SDCB 5GGQL 4OF8A 3S3SA 5I0DA 2OXHA 2R23A 2FEEL 1A7OH 3TFKC 3FONA 2C3XA 5C0CE 1T5WB 5F7EH 1QRKA 1UXSB 1CFSB 5EC2B 4APQB 1UYWL 1MHEA 2Y7QB 3WHE1 1PEZA 1IFHL 1EBAA 3CLFL 4P9HL 3NCYS 1WC7A 1TFHA 3HAEG 4EEEA 1N6QL 2VIRA 4JFEE 5L6YH 3TWCL 1NMAH 2X89D 4U6YB 3GRWA 1U3HD 1DSFH 4LSUL 1CLOH 2GUOA 1MNUL 5FOBB 1M4KA 2H45A 4UTBL 3MV7B 1XGQA 2GI7A 3KJ4B 3U4BH 1QSFB 1N0XL 4NKDB 2AXJA 2ZOKA 4ONGH 4FXKA 1OD7A 2BHUA 4F3FA 1D5BA 2VZ1A 4ZO7A 5MEND 4XNXL 2FO1A 5D1QA 3IXTB 2FX8L 1PKQB 5F89A 3OJDB 4L4TD 1U3JA 3QUZA 2R2BB 4GBXC 3KG5A 4LCWE 1RIVH 4J1UA 1Q0YL 1VA9A 3BPLC 4DVBA 5D2NE 2NZ9C 1C08B 4OI7A 5IEHA 2OR9L 3I2CH 4LPYA 5FA4B 5EBMB 1NAMB 2B2XL 5FIEA 4Z7UF 2F58H 1G7LB 1W72H 1K4CB 4OD1L 5HJ3A 3W9DA 4YHPA 4HIEA 5DJ0A 5CD3A 1D7FA 3RX7A 1G0DA 4JY6A 1E4XH 4PJIB 3O6LH 3NFPB 3H9HB 5CJ8A 1RHFA 5BVPL 3VFNB 4QOKB 4AQOA 3VI3E 3AAZA 1H3TA 2XG5A 4KV5E 5B3JE 1BD2A 1UCBH 2Q86A 2QSCL 2XZAL 3VFUB 1JNLL 1YYML 4YBLC 4R90H 1U58B 3GO1H 4P5TC 3PDDA 4Q74A 5T5NF 1GGBL 2C7UA 3WIHL 5C08B 4XCYB 5EBLB 2Q1EA 1WWWX 3CX5K 1H0DA 4ZPTA 3A67L 5E56A 3UX9B 4PGEB 2R1YA 1F42A 1IAII 3AREC 5D2LF 1EEZA 1KACB 2NX5B 2OJEB 1EEYA 4L3EE 4IRSA 5KVDL 2ZUQB 3L3IB 2XT1B 5F89B 3CH1B 4NCC1 4ODUA 3QNZA 2J4WL 1CIDA 3QUZB 4JJ5B 4AZ8A 1AY1L 2JCCA 3SGDH 4TUKL 4LCCC 3DUSB 1T1WA 1HSBB 2ZUVA 2BOCB 2Z8RA 3JTSB 4YHLH 4OLVL 4HIHA 5EO0A 1FV1B 4YNYB 4MDIB 4FA8A 5C9KA 5L9DL 1I9IL 4ZUVB 5J8OA 3S35H 3QP3A 4MA8H 3WNOA 3ET9F 3ZO0A 3M1BA 4M7KL 1PJ9A 4J12A 5DUMH 3ZE1F 2BY1A 3AUVA 4LAJH 4LQ1A 5EUOB 1EAPA 4PJXA 2W9DL 1Q9KA 4Y5VB 4YHPB 4CU8A 3FN3A 1DVFD 3KS0J 1F4YH 3QDMB 1AKJA 3RY6C 2HKFH 3KLSA 4ZFGH 3BDXA 3F5WA 4PJDF 3MYJB 3QDGA 1ACYH 4ZS7L 5I8CB 5IKCA 5AAMA 5T3ZE 4NN7B 1I3VA 1YNTB 2AVGA 3NCEB 4WI2A 5C0BA 1B4RA 2CR6A 3QDJD 2PYEA 2ICWB 4EQ2A 3FO0L 1JIBA 3B2UD 3QG6A 1JPSH 3V0AC 2GSGB 3KJ6H 2A73B 4LU5H 1GGUA 1NGQL 4MXVE 1U93B 3ZDZF 5KVEL 4M02A 3RUGA 4PY8J 3I2CL 1ZT7B 5C3LD 1OW0C 4JDTL 3HA0A 1EEYB 4YBQD 2WIIB 3DX7B 4QY8B 4A6YH 4S1RL 3ULUL 1RZ8B 2WZPD 4YXHH 1YN7A 4YHYB 1HKLH 1B4JL 2PO6C 1INDH 3EAKA 2D31B 4BA8A 3OKKA 2BSSB 4PJ5B 4WWKB 4OCLC 4Q9CA 4M8QA 2Y9RT 4X80H 4OIBA 4RIRA 3DRQA 4QHLB 4P2OB 3D85A 1AQKL 3C60D 3WO4C 3CZFB 1MI5D 3KDMA 3J8F7 2P8MB 1LK2B 3QT2A 3K46A 4YPGA 4K55A 1KB5L 4G6JL 4WNQB 3PV7A 3SKJH 4JGJA 1NJ9B 3WDJA 4Z0XB 2EIEA 1QSZA 2XG4A 1FQ9C 5DI8A 4FQHA 3ARWA 1FPTH 4Y19A 1YA5A 1DEDA 5E94B 4OZFG 1KJ3H 1R5VA 3IDJB 1FZOB 1QEWA 1UZ8B 4PTTA 5EBWA 1HHGA 2F8VA 2ICES 1I75A 4QF1A 4F58L 3RWIA 1GGTA 2B8OT 1FVDB 2PYEB 1VGEL 3QXWA 4WHCA 3DLQR 3CX5J 3H9SD 5F6HI 2ZOLA 1ZEAH 4MCYB 2FJFA 2YA2A 3EYFA 1YEIL 4MCZA 2X05A 4GLRI 5HYSA 1QVOA 4P46B 1U8MB 3QUXD 4LPVA 2NLJB 2AI0L 3HRZA 1BJ1J 2BY3A 4FXGA 3A6BH 2Q76B 1UWEH 1OWRM 4QRPB 5K9QG 3KPNA 4UV7L 3C5ZA 3NCYP 3WL9B 2HT2D 5J57B 2XNAA 5HDBF 2ADFH 3T1FA 4WEMB 4PRPB 1F4AA 3CJJA 2B5IC 4JCMA 4M8QB 4FQJL 3TZVB 3DRQB 4PJ8B 1P7QD 4RMUA 2MTPA 3FL7A 3KDMB 3VFWA 4FQIH 4YPGB 3DV6A 4Q6IB 4DGYH 3CIQA 4G8EB 4Q58C 1E6OH 3QUKB 3GSXB 3UJTH 3REWA 4AENB 3TC9A 4NRXA 3L95A 3N9GL 4GRWE 4QKXB 1BFOA 3AS0A 4F8TA 4PLKD 1ZANL 4OZ4A 3WNLA 1MFNA 2PYFA 1C1EH 3I9GH 5F1NB 1VENA 3ROLA 3S34L 4Y2DB 5IW3A 1KCSH 3RWIB 5JPNA 2FYYA 3GSVB 3IFLH 4X6BA 1XCTB 4YK4B 3SKNB 4P57B 2G9HA 2VN4A 4A6YL 2FX9H 3RDTB 2DMKA 1G6RB 3BJLA 2PTVA 3WD5L 4JFFD 3N50A 4NJ9H 1INDL 3EYFB 4MCZB 4K94C 2Q7YB 5ACZB 2C3VB 1DUZA 3LVEA 2C26A 5T3XD 3SEPA 1G9EA 4NKMA 1XZ0B 5DK0A 5DYOB 2IANE 3HCVB 1I7ZB 3OG4B 4M7LT 4GBXA 5C0DB 4MHHI 3KLDA 5DEGB 1KIRB 1JN6A 1QLFA 4LPWA 3KPMA 4TQEH 2UWEB 1AO7A 1YPZE 1B2WH 3U79A 4F7TB 2W65A 4YZFF 1U42A 1M7IB 1J0IA 1MIMH 4HJ0C 3T1FB 1BZ7A 2FATH 1YMHB 5JZ7D 4ZSOE 4N68A 4BH8A 3UTSD 1DEEB 4K3JL 1UB6A 1NCTA 4D9LL 4FQCL 4P9HC 4KH2A 4M62L 4OGAD 4XPFL 4E0RB 3OR6A 1BFTA 5DRNA 2VISB 4JZNB 4S11A 2UV3A 1KCUH 5L8JB 4HC1A 4P5TA 3M8OH 1ZHKA 4OGYH 4FQQB 1EFXD 5CZXC 4U1LB 3VWKC 4ZMAT 3V6OA 1TZHA 1RURH 1BWWA 4NCDA 1I3RA 2YA1A 1SY6H 3MRHB 3AREA 4M43L 1T04B 1IGFL 2RGSA 4M7JH 1D9KD 5KZCD 2V5TA 1BJMA 2RFXB 5FYJD 2AQ3A 1XF4B 1XR9B 3O2DA 2MPAL 3RKPA 2AAVA 3MLZL 4PV8A 4OM0L 3UTTB 4MWFB 4UUJB 4Z76A 3IDUA 4KVCH 4KDWA 2DQUL 5EOTB 4OIIH 4U6XA 5FYLE 2CKBL 5DZNA 3NACH 1E6OL 1CDUA 4KKCC 5DK2B 3NIFF 5CBAA 1IVLA 2BY0A 4M6AA 5CUSL 2Z0BA 4QRUB 3V6ZB 1BZ7B 3B9AA 4P23A 4Z7UE 3WFHB 4P2QD 3TO2A 2R1XA 1A7PH 1IAKA 3L3JA 1LO0L 3WNKA 3IGAA 4ZDHA 2ZJSH 3I9GL 1UJ3B 3U9PL 4XX1E 2IF7A 4OI8A 1AI1L 5EU6B 3RY6A 1X5XA 4PJGF 3SE3A 1UM4H 4OI9A 1EEUA 4D0DA 4NJ9L 5TE7L 1FH5L 1UACL 2YD7A 4OFDA 4PJEB 4HHAA 1BF2A 1ZHBA 4HEME 5GRJH 1RULH 2DYPD 4ODHH 5EOQL 1FGNL 3RNQB 5GRXG 3BESR 5KVFH 2ZG3A 5L7XL 4JRWA 3T09A 1QUNA 4TQEL 2I9LA 2D9QB 3CC5A 1OGAE 3MLSH 1GPOH 2R4SL 3WNPA 2BOBB 4RISH 4ZUWB 4KK5C 5HGDB 5D93C 3SY0A 4PR5B 5D2LE 4RDQG 2G2RA 4JRYE 1D6EA 5CHNB 2VDPL 3RVXC 2APFA 1CICD 1HH6A 2AEPL 5BO1H 1A64A 2DF3A 2DQFB 1H8SA 4JHBA 5FO8A 1RV6X 1S7TA 2EDHA 3JWOH 2IQAB 2YPVH 3SDDC 2ZCKH 4XP4L 1NC2D 1RK1A 4PGBA 4YWGH 3O0RL 3LOWA 5JPMB 4PRBB 5I9QB 1S5HB 4DQOL 4W6YB 4Y1AD 4W68A 3ZE1E 4JFPA 5ABDE 1JCKA 5E1HB 1NGPL 2I07A 3GSWB 3DTXA 3QEHB 1C8PA 2R1XB 3LRSB 2X10A 2ZPKL 3L9RA 3IGAB 3U36A 4LIQL 2PETA 1YMMB 4D0BA 1A1MB 4E41A 4YXKH 1R3HA 4Y4KB 1U41A 4DEPC 1A1OA 1CGXA 2P44B 3FQNB 4LCWD 4G80B 5JIPA 3LH2L 4K23L 1WICA 1TZIB 4D0DB 1CE6B 4HKXA 5ESVB 4LLDB 3O41B 4HHAB 1SM3L 3V6BR 3KYAA 1LGVA 3S5LA 3P2TA 3EO1B 3GB7A 2BVOA 1BAFH 4OIIL 4C56B 3INUH 4HZAA 1XGYH 2D7TH 4M6OL 3BO8A 3CFKB 5DD1H 1TZGL 2FD6H 5D7IA 5KSUB 3ULUC 1A7PL 2VLKB 4KTDL 2PW1B 2X70B 3NZHL 5LAXA 2IPKB 3HS0A 3QSKB 3S96B 4L8SA 1MFAH 3DO3A 2C1PA 2HFEB 1P6FA 4OLXH 4YQXH 3HE6B 1R3JB 4HCRA 2ICCA 2HN7A 4RQQA 3P4OB 5FFLA 5J6GA 1OCWH 5IVXA 4P4KB 3A6CL 4XBGA 1RHHB 3WFCL 1T1XB 3QIBD 3HI6L 3QFJD 4L3ED 4V1DB 5B38G 2HFGL 3VGHA 3L9RB 1C5CL 2DQIL 3DX9B 3RTQA 3U83A 3LEYH 3BPNC 2EE9A 2JCCF 4KJWD 3MLSL 5E2TH 5HVHB 1OARH 1HEZA 2G60L 4RISL 5J13C 3L3GA 5C0EB 5ADPH 3EBAA 5EZOH 4KZEH 4K3GA 5H37G 2YBRA 4DZBB 1KOAA 3BN9D 1MUJB 5TF1L 4X5WA 3MCG1 4GT7A 4P0DA 1HYSC 1JZ5A 1P1ZB 1U8LA 3ZLQC 1S3KH 3CFBA 4X6CA 1CDBA 1AP2A 3GB7B 4MXQC 3WIIL 4LCUA 1IMHC 1CGTA 1U3YA 5B8CA 4KJQC 5E6IA 2DKMA 4KK6C 4WTZG 1LNUB 2IH1B 4MA1C 5ID0A 2V9QA 2UYLB 5T3ZD 4MNHA 5D7IB 1MCPL 1CIUA 1DJSA 3EGSA 4MD5A 5TE4L 4L9LB 5IIEA 4WFEE 5GGVY 4Y4HB 3UBXB 2E7HA 4BKLA 3RU8L 1N5AB 5DJAB 4LCYA 4ZFFB 2IH3A 3QUMA 4IRJB 3DMMB 4HWEL 1ZT1B 4DZ8A 2HN7B 3FB8B 4UV4H 4YHMH 3CAFA 5IJVA 3K8LA 2AXFB 4R2GD 1U8QB 2FWOB 4PUBH 3GJFB 1T1YA 1R24B 2GJ6A 2GAZB 1K8IB 3PWNB 3BP4A 4YHKH 4LEOA 1A7QH 1WWAX 3BKYH 4OCYH 4NRYA 3GMNA 2IFFH 4P2YA 2P5WA 1H15A 2NY1D 1T6WA 1FFOB 1S7UA 3TGXA 3P4NA 1FN4B 5DUBA 5DVLA 3WUWB 1T7WA 5BS0A 2LFGA 4JR9L 5I16A 5DVNA 4BZ1H 1RSFA 4R8WL 1MFEL 2YZ8A 5F9OH 5E6IB 4U7SA 4HIIA 3W11D 3UAJC 5DD6A 1S7SA 5JXAL 4XP9L 2VC2H 5E2UL 1OP3K 4FG6C 3VGEA 4QCIA 4HS3A 1KT2A 3LKOA 2JIXA 2O5XL 1SJHB 4YZFE 1CXEA 3DETD 2WBWB 1FLTX 1T7XA 3VRJB 1YY9D 4ZG1A 1ZOXA 3QUMB 3DARA 3QQ9D 2FGZA 3ZKND 4BZ2H 4U3HA 1URLA 1BOYA 4M7LL 5IJVB 2DM2A 2J6EH 2UWEF 3LRGA 2AJSL 2WSKA 3TEUA 1XH3A 2BSTA 4HF5L 2ESVA 1A4JB 2DDQH 1X4YA 2AK1L 2NXYB 1JZ6A 1DQJA 2NY4C 3MUZ1 3SDCC 2P5WB 2W0FA 5DQDL 2AJ3A 3BZEB 4MQSB 5D7JC 2F54B 5DHXB 2O5YL 3ZYZA 4NUGH 4M61B 3LS5L 2XN9B 2FR4A 4L1HA 1GHFL 4O4YH 1KJMA 4P4RA 2EH8L 4EUPA 1MAJA 1EZVX 5IB3B 3BD3A 3Q1SL 3IVKB 5B4MD 2QQLH 4QRQA 3MOBL 3KPQB 3GI8L 3RI5K 3WLBB 3MV7E 3SDDA 4I3RH 4YEFA 5SV3A 1QSFE 1A9EA 1KT2B 2JIXB 4D3CH 3TO4D 3NIFE 4MHHG 3KJ4C 1NFDB 2CLVA 3EYSL 4LKCA 4PRIA 4ZXBD 5TDNB 2F53B 1A6TA 3VD9A 4HT1L 1A7QL 3BKYL 1PKQE 5SWZB 4M1CD 5C0IA 2B1HH 3DUUA 4OFKA 3PGCB 1JJUA 1Y0LA 5AD0A 4HUNB 1EMTH 5F93C 2E6QA 2EDEA 1DBJL 2NY0D 3ULVL 4S2SB 1I8LA 1TVBB 4G9FD 2EDWA 4XMKH 4KUZL 3DVIA 5IVOA 3MZGB 4X0KB 1J87A 4OFIA 2IPTL 4ELMA 1ULVA 2WLZA 3MBEB 5MERA 3QUYC 5C2BL 1RUPL 4PJIE 1I8KA 5AZ2L 3ZSSA 4MQ7B 1H5BC 2DBLL 4QOKE 2LABA 1IEBA 1U3ZA 1MCRA 2X42A 2PR4H 4WW2C 5F7YC 4RGNB 3LRHA 2FR4B 2XKNA 3Q5TA 1HE7A 4JY4B 4PJEF 4U05A 4JO4H 5CP7B 3TVMA 2NQCA 1HOCB 4QNPF 5HHQB 4QRQB 1YZZA 4NQSA 3WFBL 2CLRA 1IAOB 5C08E 2ENYA 4MJ6B 4MAYB 3SGKC 1H3PH 1X5HA 5F9WB 3BWAA 1F4XL 4GKZA 3WXWH 1PDKA 4AEEA 2QKIB 2AW2A 3GZKA 3SCMD 1UFUA 2UZIH 2NX5E 1A6TB 2ZCHH 1YEGL 4MNGB 4LL9A 5C0IB 3G9AB 2H26B 1LE5A 2ZUQC 5F72S 1R0AH 1LD9B 5GRWA 5D7LA 3CLEL 1VCAA 1A0QL 3V5KB 1MCIA 1HHJA 3QXAA 5IVNA 1IQWH 3S37X 4XPBL 1FVCA 3WFZA 3P9LB 1CD1B 4NJAH 1NSNH 3C2AL 1YYLH 4O2CA 5GGTH 4GMSH 3UMTA 1AFVH 1JHTA 3T8XB 3QDME 1CE1H 3VXRB 1T4KA 3WIFB 1D5ZB 1NCDH 4LLMB 1P4BL 1W72B 1NBZB 5C0AB 5I1JH 1MCBA 3QJFB 4GSDL 3G6JA 5GS3A 4X4YA 4UQ3A 3RVWD 2D7MA 4NN7C 5I1CL 1BBJB 4QGYA 1JWUA 3ALWA 1J7VR 5D96B 5EO1B 1WZ1L 1YECH 5IROA 1OGAD 3FKUS 5KBNC 5ENWA 4YHNB 3BWAB 3DPBA 3UYOD 2P1YA 3OJVC 3QRGL 5I18L 5IB1A 3O4LB 5KN5A 1WBYA 3HC4H 5D70H 2X4NA 4XP6L 1FFNB 3SGJC 4LSSH 4HIXH 1QFUH 5E8DH 3MV9A 3MGTA 4RZCA 4KDVA 2VMFA 3MRKB 4EOWL 2X1WL 1RZKL 4PJ5E 5C8JA 4NKIH 4XAWL 1JYWA 4Q9QL 4YHYC 5F3HA 4JFDA 3UTZA 3WHXB 1P2CA 3OKEA 2ERJB 3BH8B 4A6YA 5T33H 4N8VA 1MHPH 5DD0H 1IC5L 1XF3A 3GIVA 4WENB 1IM9B 4NRZA 3QWQB 4B7IA 4P59L 5EB9A 5CZVL 2NW3A 1YEFH 4LOUD 1BM3H 2YUXA 4OKVA 3VGDA 2IALA 1LEGA 3FN0H 2VL5A 5KSVB 5I1KH 3P0VH 1DQQA 3QISA 1LEKB 5F21B 2X4PA 3FRUA 2OSLA 3G6JB 2VTFA 3IF1B 3EO9H 5FYJU 3MROA 4XXDB 5C0BE 1QR1A 1INEH 1WWBX 2PYEE 2IAMB 4WU5A 3DYPA 3X11B 5ESQA 3F6LA 3B43A 4WTWA 4ODVL 4HPOL 5CIPA 1CGSH 1JWUB 1FZKB 4AIXA 3RWHA 1PAMA 3BZ4B 3RX5A 4Y88A 1XGTB 3FT2B 1UM5L 4P46C 5HYSG 5D7IF 3UYRL 4QRPE 1KULA 2QEJA 3U1SL 4G6AD 3JV4B 4LP5A 4MAUL 2JLLA 3VXMA 4NNPL 4XHJD 3MA7B 1FRGL 2NR6D 4AIOA 4X83A 4AIZA 1NCDL 4PRPE 2FX7H 2NY6D 4ZOCA 4J23A 2QADD 5A40E 3UTZB 3FQTB 3OKEB 1HWHB 4X6DB 1U8PB 1ERNA 5D7JA 5IVXF 1MOEA 3D25A 1AGFA 4YFLF 5DHVB 3PWPA 1IGJA 4GKSA 1G9NL 2FGWL 4UBDC 5F7KC 4D9QE 5KTEL 3LB6D 4YJZL 3QFDB 3I75A 3TCXA 2FCBA 3PHQB 4OZHA 1YECL 4XZUB 1NANI 5DS8B 1LEGB 2ORBH 4I9WE 4WI8A 1JNNH 1IGMH 2CKBA 4P9MH 4KZDH 1JGLL 3GDBA 4PBXA 4MNQB 4ODSL 1MF2L 2PXYA 4FQ2H 1RUML 4WDIB 1CFNA 4K3HA 5ESQB 3QXDB 4Y2DC 2E7LA 2JF1A 3CU1A 4YK4C 1ITBB 5E99H 5E5RB 2LTQC 3C9NA 3RDTC 2VXSH 1OAKL 4I0PA 2DQCL 5CEYA 4CMHC 4XVTH 3EJJX 3MRLA 3OTTA 5ELIA 2UWEE 2XV6B 4G8GB 1EVTC 4WFED 1FL3B 3MCKA 5HI4D 4XNZB 1TQCC 3K4DA 4JANA 3FN0L 3N1QC 3QUYA 4NSKA 3TA3A 4JFYA 4Y16C 1LO2L 5DMGC 5GSVB 2NXZC 5C6TH 3T1WA 2W1NA 2P49B 1AGFB 2ZCLL 3D25B 1CGVA 3L3OA 4WW2A 1A3LH 4KK9D 1VB9A 4WY7H 4XC1L 5KJRL 4WHDA 3V9FA 1REIA 4X4MA 4OZHB 3EOBA 4TVPL 5A16A 4L3CB 1DLFL 3SGKA 3O8XD 4JDZA 1NL0H 4ZUTA 1W8NA 4JE4B 5BXFA 3W81A 1BHGA 3S36X 1F3DJ 1KJ2H 3CSGA 2YC1A 3OKLA 2BC4B 5DT1H 3ULVE 3H3PH 1JBJA 4P5KB 2DQHH 1F58L 1PG7X 4I0PB 4KVNL 1KSRA 3UTTE 5INDA 4DVRL 4ETQB 2OTWB 4NT6B 3RGVC 4J3OC 3GSRB 3BISA 1T22A 5E2VL 2VH5L 3MLUH 5T1KD 3F12A 3TN0B 1E27B 3U9UA 3ARPA 5D7KE 1A7NH 3PQYA 3BZDA 4NQDB 4EDWL 4EXPX 1CF8L 2K1MA 4H88L 5CWSB 1QFOA 3RKDC 1YY8B 2AJZA 3C5SA 3CSYB 4HFUH 1CZ8H 4KQ4H 2P5EB 4H0IA 5CILH 3ARFB 1AD9B 5EU6E 4JREC 4KFZC 3THML 3ARXA 4NQEA 4NYLB 4RMRA 2VL4A 4J8RA 4RCAA 4JO1H 3DO7B 3QEUB 3QI9D 4PJEE 2AJUL 2X40A 4JFZL 1I1AC 1IM3A 3JWDL 1NDGB 5DEFA 4Q9RH 3WFDH 1RMFH 4X9FA 1CWVA 2LAAA 3JV5A 5A16B 3X12B 1SVZA 2DMCA 5C07D 4M5ZL 1IQDB 4RMWA 5H94A 3V6OE 5GS0L 4MA7H 1B0GA 1MCWW 3ZKXB 1IC4H 4JRXB 3VFOA 4PREA 3B9KB 3SGJA 2GK2A 2HWZH 2JB5L 2QL1A 1WZMA 2R0ZH 5JUEL 2JB6B 3O11B 3VG0L 3VXSB 4FNLL 4L4VB 3RJQB 3OHXA 4YR6A 4OGZA 2HJFA 4JFXB 3RZCC 4CDGC 1QQDA 3HE7A 3MV7D 3QHFH 3DURB 5CEZE 3T3PF 1QSFD 3CDFA 1KC5H 2BHZA 2GT9A 1WJ3A 2QHRH 1RZJC 4XCEB 1WT5A 3RP1A 2X4TA 4KROC 1ZGLA 1I4FB 1NH6A 1EERB 5SX4H 4QRSA 5I9QC 3MV8A 3UPAA 1S78D 1TXKA 3CFJA 1EXUA 1YMME 2QV2A 1NL0L 1HHIB 4U1HB 1MY7A 4S0SD 3L5WB 1IGTA 3BP5B 1BIIA 2EH7L 3OKNB 4XNYH 5CD5D 4Y4KC 3MRBB 3RVVC 1BECA 4ZD3L 4ENED 1HHKA 4H5SB 5FGBC 1R5IB 3MCLL 1X5GA 3LPWA 3BP7A 4UT9L 1DQDH 5JQHC 4ELMF 2EIBA 4R4BA 3T2PA 5DC9B 3LQMA 1RUAL 1U6AL 2P43B 3MNZA 4MB5A 4NQUA 3VXNA 1ZLWH 4N0CC 4KHXL 5GZOD 1IZKA 1B0GB 4QOKD 2VLJB 2FSEB 5ANMB 3S5LG 3E8UH 1YJDH 1TCRB 1A7NL 2DQEL 1Q38A 4TN9A 3D39B 1AGCB 2F5AL 2XFXB 1A22B 1CQKA 2VLKE 5HI3D 1JTTA 1ZT4A 1KFAL 3DSFL 3LHPH 3OHXB 4F7MA 1RZKC 1EHLH 5IMMB 5C08D 1GAFH 1LVEA 2CIKA 3I3DA 1KEGH 4DOHB 2JK5B 2X4UB 4JO1L 3HAEH 3HE6C 2HT4C 2X9XA 2V6HA 3BE1L 4PB0H 3MJ8A 4PJ9A 4IRZL 4KJYB 3K2MC 3TNMA 2NY7H 4V1DE 1U2HA 3MV8B 5D1QD 4P4KC 4HBCL 4YGVB 5CSZA 1OAXL 3PGFH 1BPVA 3QUZD 4YDVB 2R0WH 3O4OB 4KK8D 4KKAD 3SE4A 3TPUB 5DVOA 1FNGB 4DTGH 1ZLVK 5DQJB 5MEQB 3FT3B 1HHKB 1KTLA 3CDGB 3WJJA 5GGRB 2CDFB 2WBJA 2R0ZL 1QYGH 3EHBD 2NY3D 3TBSB 3QIUB 3C6SB 5JXEC 1AGDB 2Y06H 3P0YL 5DTFA 2D7OA 4R97C 1XGUA 3JV6A 5AYUH 5IBUG 4GW5A 3TYGL 2EEDA 3V4UL 2VXVL 2CUMA 3NCJL 1BD2D 2IWGA 3FFCB 3G6JF 1L6XA 5TE6L 5JDSA 1QO3B 5D7IE 3IDNA 3BEVA 4HMDA 4HW6A 4JGUA 4PLOB 3OZ9H 2YXMA 4KPHH 2XIDA 4ZUUB 3P40A 1I3GL 2QQKH 2V2WA 5I6XB 3D2UA 4OV5B 1S9XB 1PVHA 1TQBC 4UAOC 3T2QA 1HH9B 4L8BA 1SHMA 3NZ8A 3OMZA 6FABL 3ARBC 2OL3H 2XQBL 1A8JH 5IHZB 4Y16A 4BFIB 4EDXA 4JPWL 2Z92A 4M1DH 4XNMB 5IW1A 3MODL 5IVXE 3UYPA 4FABH 4XPGH 2R1WA 3FFDA 2A6DB 5J9PB 3TH3T 3R06B 3RGHA 4XPHH 3S37H 1DCLA 2E7CA 4HUUB 1NC4A 5DJCA 4P2OD 4LLWB 1XF2A 4X6DF 3GHBH 3LV3B 4CAGA 4Y8AA 1RFDH 1VSCA 4XCCH 3NTCH 1RZIA 3ZKSD 4S1QH 1A9BA 3QWOB 2BFVH 3EDEA 2PTTA 3WSQL 2WINB 1CTOA 3V0VB 1AKJD 4TTGA 1ORQA 1N2RB 3BZFB 2R2CA 2H1PL 2DBJA 2YK1L 5I17A 3RGVA 3CD4A 3IJSB 1XGRB 4OGXH 5GGSA 1A6PA 1P7HL 5C0BD 2B4CH 2PYED 1MCQA 4XWOC 1MLBB 4ZPVB 3T4YA 5D7SL 1BX2A 4XCNA 1QSEA 2R69L 1MFCH 5LWYL 4OT1H 4BQ8A 5B39A 1FYHB 1R3LA 3V4VL 5JOFA 2BNUA 1AJ7L 3MRRA 2A0LD 5DSCA 3MRDB 3FN9A 4AQ1B 4ISVB 5GRUL 1NUGA 2E9JA 3BAEL 5EOCL 1DBAH 5BMFL 1Z9SA 1NLDL 2R1WB 1FNAA 2BCKB 1C5DB 2VDKH 2W60A 4NC1E 3EFDH 3BD4A 4W4NA 1CXIA 4WU7A 5D9SB 1TETL 2J6EA 1P9MC 4P48A 1NC4B 2BNQB 4LSQH 3PWJA 4PJ8D 1IKFH 2NXYC 3EOAB 2P5WE 3D85D 4F80A 4NZRL 4CN6A 5CZKA 5BRZA 2F54E 3LEVH 1EPFA 2P24A 4LLQA 5GS1A 2FZ3A 4O58L 4O02H 2XN9E 4M7ZC 4Y5YC 5ICZA 3SO3C 1RZIB 5FOJA 5D1ZB 2J8OA 4D9QD 3T0AA 2OL3L 3DUHA 4OZHF 4PG2C 5JW3L 1FVEA 2ICWI 1P4LB 3FB6A 5AUMA 3ULSA 4H0GA 4EUPG 3IRPX 1JF6A 3VFTB 3H42H 3U0WL 5ALBL 3L7EB 4R4ND 4XXCC 4AM0A 4B5EA 1F90L 1D5MA 3PE9A 1OLZA 2VXQL 4WI6A 1ZV5A 1DE4B 1NFDE 1E6JH 5ICYB 3CXDH 3GSUB 5ICXB 4KY1H 4YH6A 4MSWA 1MY5A 4PLJC 1OGTB 4OZFH 5FK9A 4J6RH 5JHDB 4LASL 4ZNEE 3MMEB 2J88L 3ES6A 4ZFZB 4X7TA 1JTPA 3SQOH 3I84A 4S1DC 1S8DA 4NHUA 3I50L 1WSST 3MFFA 3P9WB 3MRGA 5T1LA 1EH9A 4XCCL 4DKFH 4GRLA 3C5ZD 2P45B 3K8MA 5FGBA 1FC1A 3JWDC 4F33B 1CXHA 3BW9B 1UA6L 5IB2B 2ESVE 2HRPH 4WUUB 2IADB 1QPXA 4M6MH 4WU7B 4OTXL 5EU5A 5GS0C 3O3EB 2EDLA 2Z31C 5I8OL 3VFMB 1VFAB 2CK0H 2Z8WC 5BRZB 3X13B 2B4CL 1IEAB 2XPGA 3G5VA 3PGDA 4PRHA 3PIQB 1WUNT 3KLAA 2FZ3B 2E5EA 4AEIH 4WTXA 1T0MA 4RGNE 2CDGA 1MJJA 2V2XA 4WCYL 5HHOA 2PW2A 5DFTA 3OSKA 4YE4L 4X6FA 2F15A 2AJYH 5HY9B 3NFNA 5ETUA 3FB6B 5AUMB 3SDYH 1K2DA 3T3PE 3DGGA 5JW4M 1KPVA 1WEJH 2BDNH 4MAYC 2Q3AA 1KV3A 1OB1A 5F9WC 4QRRA 1FORH 1EHAA 1OQXA 5IWLC 4LK4A 4IJ3B 1IKFL 1QP1A 5JHLL 4K2UH 1JZ2A 3T0VA 4QWWD 2CXGA 4I3SL 1YEDA 4G8IB 1AO7D 1KBGL 4K7FA 4GRLB 4R26L 5EWIH 5D7KD 2CD0A 4HUXA 2Q8AL 4JG1L 1HI6B 4ORGA 2VWEE 4KAQH 5I76B 4I0CC 1U3HB 1A14L 5JXEA 1D5XB 5EUKB 3MBXL 4N5EC 3QIWC 1LO3H 5EPMA 5TFSL 4FQPA 4MVBC 4GG8A 5IBLD 2G75B 3VXRE 4IOIA 4XP5L 4OCNC 3KLAB 1KCRH 4ZFOB 5C0AE 3LKNA 5MENB 4NFBA 3DX6A 2KL6A 1NCCL 5FYKD 1AIFA 4AK1A 3IYLW 3NABL 3AMKA 4I5BB 5I1IH 4ZUSB 4L4TB 4P5TD 4XC3L 3S36H 1PYWA 4X6FB 5ETUB 3VXPB 1K2DB 4ETYA 5I2IA 2NW2A 3FO1A 4HKJA 4WI7A 2HVKB 3LIZL 2OQJB 1GIGL 1U9KA 1I1CA 3O4LE 4WHYG 1ROWA 1N64H 3EDDA 2R39A 3AFLA 3W0WB 3REVB 1T5XB 2RHEA 5DJZB 1KELL 3U7YL 3SDAA 3HHRB 5I75B 4KI1A 3MQIA 4G6MH 3X17A 1S9YA 4I2XB 4HJGA 2NYYD 4N9GB 3V5HA 4P23D 4MS8D 2ERJC 1N8ZA 3VDBA 1SBSH 1W0WA 3AY4C 1T2QL 2I9TA 1W8OA 5D5MA 3SDYL 4MX7A 4TULH 3RPKA 4IDLA 1CQYA 1MFDH 3GIZH 1B0RB 5LXGH 2GSIB 3T77A 2EXYC 4MZ2A 1S7VA 1KXQE 3TBWA 2VUYA 1IBGL 4OZIA 1KIQA 3G6JE 3DX6B 3O3DA 3MRJB 3GMOA 4BFEA 5ITFB 3GKWH 2IAMC 3NH7H 4NO2B 1N59A 5DJYB 2YR3A 1MRDL 4X4XA 3U46B 4URTB 4HKJB 1VACB 3GJEB 1WGOA 5FCUH 2HG5B 3H6JA 1MJUH 2Z93A 3K8KA 4L8CB 3QPXH 1J5OH 4WV1A 1NBVH 3NIDF 3UZQA 1YNKH 1TTUA 1GZPB 3T4AA 3HB3D 1QA9B 4L8DB 1DVFB 3Q3GA 3Q6GH 1QFWH 4RMTA 2HA1A 2KBGA 3H9YA 4OFVA 1X7QA 4G43A 5GZNC 4AEFA 5IFJB 4OJFH 4U6TA 1FG9C 1MQ8A 1D5IH 2ZUYA 1V7NL 3RY5A 1RIUH 3KPRA 3PDOA 3OAZK 4X6DE 3QDJB 3V5HB 1N4XL 4IIQB 4Y5YA 2A6JB 3WS6A 5E7BA 1RJLA 5IB5A 2NTSP 4HXBH 4V1DD 1P7KB 4BQ6A 2CMRH 2OZ4L 1EJ6A 1X6LA 1BQLH 5D5MB 5E00A 2AS5M 2FL5B 4N1EA 1UT9A 4E41D 3KS0H 4X7SL 5C0JA 1FZJB 3UJJH 4FMFA 1MRCL 3U4EB 4H25A 4JKPL 1BVZA 1MIEH 1B6UA 3CUPB 3HZYA 5T1DH 1PG7L 3QCTH 3GSOB 3MC0A 3I6GB 4MNQE 2HH0L 2UZXB 3FOLA 1GC1H 5TDOB 2OJZH 1HQ4A 3O45A 4HBQA 2C9AA 1NGWA 3O2WL 5CEXA 1MCLA 3DHMA 4PB9H 3FTGB 3SOBH 3OX8B 4X4XB 1EHNA 3V8CA 4UT7H 3C60B 5IBTL 2DTMH 3RVUC 4X9BA 3F7YA 2ILLA 4GKOA 4LQFH 3VXME 4HUWB 4TULL 2G5BB 3QULB 1BBDL 4E42A 1INQB 1HK6A 3HUJA 1CFVL 1LO4L 1CDJA 1RZFL 3DMMD 4IRJD 4XNZC 2XYCA 4J2XA 1F6LL 2Z31A 4Z7WB 4UOW1 2DD8H 2X1XR 4CJ0A 2RQ8A 1Z2KA 5DJXB 5DD5L 3MREA 2ZSVA 2UVFA 1RJLB 1VPOH 5IB5B 2A38A 1DLHB 5ILTL 5FECA 2OX5A 3OGOE 2VAAA 3RTQD 1C16B 1JGDA 2CGRL 4K7PY 4OZHE 1ZLSL 4H25B 5F7FA 5CFHA 3QUXB 3SN6N 1VEPA 3F7VA 4MJIA 1MWAL 4JB9H 1CDGA 3ARYA 3LEXA 2A77L 4PG9B 3X14B 1QG3A 3V0WH 1BEYH 4CJ1A 3KAAA 4O00A 1OTUC 5DHYB 3O81A 5EIIA 3RNKB 1JZ4A 3ALPA 4M8VA 5IWLA 4LHUA 1S7RA 5CJ5A 2C3WA 1PY4A 2K7PA 3UTPE 5E6ID 43CAA 5FHBH 4OFPA 5LCVL 2JJUA 4KI5F 3ULVF 1LEIA 1DBML 1EGJH 1BJ1H 5TJWK 3S4SA 2YUZA 2GKIA 5LGJB 2APVA 4OCRL 3OXRB 5H8DA 4XWGH 3VJ6A 4F57H 3GBNH 1G7JA 1UVQA 2MQCA 4NQDE 2C1OA 3TN0C 3O6ML 3TIDA 4ELKA 4OUOA 3WE6A 4CMMB 5DJ8B 3STZA 2AXHA 5DMIH 4XTRD 3QIWA 4YAQB 5DD3H 1ORSA 4EZMA 3ESUF 2P8LA 4UT6L 5LVEA 3RPIB 1HIML 2LVCA 2P5EE 4LPXA 5FF6A 5TGBA 2E9IA 1XGPA 3PL6B 3T0WA 4JFFB 5HVGB 4M48H 1VFMA 3JTTA 2OP4H 4F15B 3QG7H 2A6KA 1D6VH 2X2YA 3UDWA 5GIRB 2YMXL 3P73B 4IS6A 1JPFA 4N0UB 2KQMA 2JJTC 5ERWB 5HGAB 2P5WD 2IPUK 1CFTA 3SJVA 1BREA 1KLUB 3VXUA 1EO5A 1IL1A 1FL5B 4QYOB 3P4MA 2EKJA 2XN9D 4QHMB 2VITA 4JRXE 5BS0D 3VFGH 1O7SA 1DUYA 3VD4A 1X9QA 1MHHB 4DKAA 1LDPH 4D9RE 1CVRA 3D1MC 1J18A 3B9KC 3T3ME 4HGWA 4L4VE 3VXSE 4O51B 2X1OA 4LSPH 2V17L 1KJ2B 3UTSB 3GGWA 3GBLA 5DA0B 2NNAB 2DICA 5HI5D 3UBXI 3TESA 3LN5A 4RGMB 4U1SB 3TCLA 1IAIL 3KYOA 1NBQA 4HGKC 1EUTA 1EJOH 1JK8A 1WCBA 2JIXD 1UH4A 5ITBH 1MFBH 3OJ2C 3RWFA 4I1NB 4LPTA 1UVQB 1FFRA 2GJZB 1AXTL 2RR3A 3WE6B 5E2WL 1X4XA 3STZB 5E8EB 2GTZA 4JFOA 4CN1A 1MREH 5GRVK 2EXWD 2ZKHH 4B50A 5FGCB 2A6IA 5F96H 1N7MH 5FF6B 2EICA 5GS2H 2EIZA 2I25N 2YSSB 1NGZB 1OSZB 3LKSB 1GYAA 3KPTA 3MUGA 1JZ3A 1D9KB 5KZCB 4LFHG 1M05A 4X8JB 5GJSH 3GSQA 2EC9U 2A6KB 5A3ID 1U8OA 1CU4H 2ESVD 4PS4H 1KCVL 2DJUA 12E8H 4NQVB 3MBED 4PRAB 4NUJB 1A3RH 1U2CA 1WZKA 3FHAA 2FHCA 4F9PC 2N1KA 2P7TB 2DLTA 5JO5B 4OM1H 3VXUB 1AGEB 4XWGL 2EYTA 2VLJE 5AWNL 3EYVA 5ANME 3P4MB 2OXGA 4YHOL 4HIJA 4RGND 1T66D 2VITB 5JIHA 3D39E 5JR1L 1QBLH 4HZLA 1A21A 4P2QB 4WHTB 3I02B 4YGAB 4ZFOL 5HHNB 5F6IC 3L3HB 1MVUA 1NCAL 5IJKC 4JN1H 2ATPA 1OTSD 3KPOB 4EI6B 3MRPB 3IDIB 5D1XC 2FH8A 5E4IA 3RWFB 5F9JA 5IHUH 3STLB 4UMGA 2OP4L 3NN8B 1FO0L 2CDEB 4RNRA 3ZE2F 5GGVH 5JNYA 1S7QB 3QO1B 2DAVA 4PRID 3TF7C 2EDFA 3T0EB 2V9RA 1OPGL 1UH2A 1KUMA 5CGYC 5EO9B 2DYPB 3MV8E 2PKDA 2ITDA 4KU1A 1DFBL 3NVQA 4KKNA 3WUZA 3MXWL 4AY0A 3GRWH 4XVUC 5I66A 4G6FB 2W9EL 4NWUL 4EVNA 1UG9A 4DGVH 4U6VL 2Z91B 2WWKO 3L5XH 4W6WB 1ONQA 2IFGA 3GSQB 3VH8A 4QO1A 2QSVA 1CICB 3KNBB 3NGBC 5JW5A 3PWVB 2MWCA 2ZZUT 1C7TA 5M94B 3OB8A 2LU7A 4OAWB 4LPCA 3QIUC 4PJAB 4YDIH 3WS3A 4DFIA 1LWRA 5ITBL 1PKOA 5C0AD 3VU2A 3C09B 3FFCE 4Y1AB 1YQVL 2HFTA 4XRCB 4GW1B 3MLYH 1NMCB 3TVMD 2R0LH 4V2CB 3FZUD 1AXSA 4YX2H 1J1PH 5INCB 5EIVA 5F1KC 3RWEA 1KXVC 4DWHA 4LCWB 32C2A 1ZVYA 1T83C 5D2NB 3LKQA 3DHJA 4Z8FH 3G6AA 2CJUL 1BZQK 4QXTA 4RNRB 3RFZC 1E28A 4PS4L 1ZWIB 2OL3A 1K4DB 4DGIH 4LRNH 4DUVA 2VDLL 1PQZB 4UB0L 3ORJA 3HAEB 3QHTC 4K3EL 5HYQA 2F74A 1QLRA 3EJZC 1ADQH 1C12A 2GFBB 1KENL 5D7LD 1G9ML 4KRPC 1IGCH 2C4FU 1Y6KR 3TBVB 4NHCL 4Y4FA 1A02N 4N0YH 5GSRB 4KQ3H 5H2BA 1YC8A 2NY2D 4HAFA 4TOYH 3I3BA 2BRRL 5J4MA 5D5MF 3U7WH 1SMAA 1U95B 3BPCB 3EDFA 5FA3B 2A74B 4BFGA 2J12B 1OT2A 3MLWH 5E9DB 4JQIL 1KIPB 5IHUL 1XCQA 4PPTA 3QNYA 1MLCA 3LPFA 4OZIF 1VFBA 2A9ML 3VFRA 2YPKA 1YEKL 3QIBB 2J8UB 3QFJB 1J88A 2Z35B 1XR8A 5C7XH 2E7BA 3SE9L 2X4RA 5K59F 1BZ9B 5GISL 4NKOA 1QNZL 4L29A 3BGAA 2LU3A 4JM2B 1X5IA 2GK0B 3V6FA 2V5YA 1PLGL 5IB4B 2BP3A 1MQKL 1TJIL 3PABB 4PJHA 3UO1L 3LKQB 2AJXH 4JG0L 3GHEH 1BOGB 1HXYB 4RRPG 1NLBH 4I3GA 4RWYL 2A9NL 2NPLX 1YEHL 3MRFA 2XXCB 3EYQD 1VADA 1Z5LB 4IM8A 3CK0L 4OFYA 1F3JB 3EO0B 1CDYA 4YDKL 1ZAGA 2F74B 1QLRB 2JJTA 3QJHA 4W4OC 4JFDD 1O5DT 1FLRH 3BSZL 3AM8C 4OQTH 1HINH 1PZ5B 2FLRT 4NO0A 2D03H 2F5BH 5FUZL 4Y4FB 3DXAA 2IBZY 4A2LA 4O2FB 1HQRA 5DRXA 3BOVA 2HTKD 4HH9B 1AR1D 3EYUL 3X3GH 1T20A 4BH7A 4FFYL 3P11L 1JFQH 4XI5C 4HLZG 1E4XI 2HLFD 5D1ZC 1S7XB 4L5FL 5CBEB 5J7CC 2GYSA 4RAUA 3VFRB 4FZ8H 3OG6B 4MNQD 4R2GB 3ARUA 2BRQA 1XR8B 4JHWL 4FFZH 5GRZA 3KPPB 3DROA 3UXFA 4L29B 2FB4L 1KNOB 5JQ6L 3BDYL 4DN3H 1NKOA 4ONHB 4OZGA 4GAGL 1VHPA 4D94A 2EDOA 3MRIA 2NY1B 3GNMH 2A1WL 3ARZA 4PRDA 4RX4A 3GSNL 2YRZA 3WKML 2WMPA 5J12B 4UDUB 1Q9OA 1ES0A 1GOFA 4G7VH 1E4WH 3VXMD 1DN2A 1WLHA 4K3DL 1F6AB 5DEZA 3HUJF 3N1FC 4Q9BA 1MJ7H 1Z3GL 4KKLC 2AQ2A 1ED3B 4GQ9H 1OSPL 1OTTD 4U0RB 3SGDI 5HD8C 5CLWA 4UDTB 4J4PA 3PP4H 5D7JD 5BRZE 2H2PD 1MRFH 4PJ7B 2X7LA 3PWPD 4KDTC 1ZLWK 4KGLA 1ZVSA 4BH7B 4OD2A 4YUEH 3CFCH 3IDYC 3VFVA 2ITCA 2B1AH 4TRPH 3C08H 2J5LB 2IG2L 2VZUA 3K80A 5JLZB 5CINH 3M17B 2F19H 4AEHH 2PN5A 1NLBL 5DFVD 2PXYD 5T3XL 3IU4L 3EW3B 2MJWA 5D1XA 1JGVL 5IFHL 3X3FL 1TVHB 3D18A 4LLVB 1JMXA 3D48R 2DQJH 4XH2B 2HLAB 3ZT5A 3IU3A 1JHKL 2FH6A 2V7HA 2X4SB 1G7QA 5DRZB 4QXGL 1ZHLB 4I0PD 4Z18A 5BJTB 4OQTL 4WEBL 4D8PB 3UTPD 4OSUL 2AGJH 3HNTL 2CLZB 2Y4SA 4P5MB 5AG9A 5DDHB 3ILQC 4IJ3C 4M4PA 1QACA 3O3BA 5DF0A 3S6CA 4FZEH 3KYMA 5GPRA 4PLNC 3V52H 1Q9OB 4OZFB 1YDPA 1J05A 1JPTH 3VW3L 4PJBA 2BVYA 3BGFB 1I8IB 1FL6B 3TA3D 1G7HA 3FO2B 1E4KC 3CCHB 2Q6WA 5KAQG 1U3HC 2X4OB 5DR5L 1V3JA 3ARFD 4EQ3A 4MJ5B 2MQ3A 4UILH 3TO4B 3B3IB 1F5WA 2R29H 2VLRA 2YD9A 3ILPA 4ZXBB 1YUHB 2VDOH 5HVWA 6CGTA 3SKMB 3WJLC 3K3QA 2ITCB 3HNSH 4IMKC 1Z9OA 4ZAKA 1GGIL 1JPGB 4Z95H 4L4TE 1WBXB 2CSPA 5FYJL 5LGHL 1T83A 3QQ4A 3RL1B 1BQUA 4UQ2A 1Z0MA 1UWGH 3HLAB 2O5ZL 2HVJA 3QEQA 3MRQB 3QCUL 4QLRA 5B22A 1A4KA 4G9FB 4GXUM 3UBXG 4LMQE 1QBAA 3ZE2E 3G5XB 3DNKA 4NQCA 5DJ2A 2AEQH 4YXLL 1MJ7L 1MHCB 4ODXB 3W0WE 3ZL4H 4ESKA 5FYKH 3TLRA 2IPUG 4GUPA 3IETA 4OF5A 2B0SL 1RUQL 3PP4L 2YKLL 2HJKB 4KJPD 3MOAL 1KN2L 1A6UL 4JN2B 5FDYA 1T03L 4GAJH 4LRIC 1CK0H 3BVNA 2GITA 1U8KB 1NCBH 4YHZL 3FMGH 3LDBB 3RQ3A 5GRYA 2FBJL 1YDPB 3B6SA 4I2XE 3PQYD 4ZOBA 5I75C 1L7IL 5HPMA 5E70A 2HT3D 3DGCR 5IGXL 2W91A 4XGZA 1RZ7H 4MYWB 1CL7L 2VDRH 2QBWA 4H8WL 3O2DH 5HHXH 1AGBB 5JORA 2YS4A 2PCPB 2G5RA 4NQED 5FHAH 5HGBA 5DWUL 3WUWG 1DBBH 3SCMB 1ITCA 1FJ1A 3L3KA 3VWJB 1CT8A 4ZNCD 3VXTB 4LGRB 1GZQB 1W2KT 4AT6B 2XA8L 5DLMH 5D8JH 1OP3H 5A1AA 4QXWA 1I1FA 4P3CL 1MCHA 5EH1A 4Q0XL 3HMWL 3DYOA 4DKEL 5ESAA 1GL4B 4TUJB 4PJAF 4ZS6C 2VLME 2FEDD 5IF0A 2BSRA 2W0LA 4A2MA 5IK3B 2Y07L 1U8IA 4HKZA 2DWDB 2AV7A 3KPLA 4XBPB 3U4AA 2GTWA 2ZSWA 3B5TA 4HPYL 4L1DA 4DAGL 1X5JA 4I77L 5HHPB 4RAVA 3LSOA 3NPSB 5LGKA 1MWAA 1FE8L 1G9MC 3OAUH 2L0DA 1P4IH 4JPVH 3HE7D 5IT2H 3RVTD 5JOPE 3N85L 3VFSA 5FUCC 3HZKB 1ZA3B 4ZYKB 1CLYL 2YRLA 1L6ZA 5C3TA 1NMBL 5L0QB 3MV8D 4OCSL 4Q7DA 2X5PA 4MXWL 1BJ8A 5D5ME 4IIQC 4MD4B 5BW7A 3B2UC 3HMXL 1OGAB 5BZWB 2YD2A 4J3XA 4M00A 1AE6L 4NN6C 1BQSA 4LHQB 1S9VA 4JDVB 2OK0L 5E8OA 3ROOA 5ISZA 5D2LB 3TJEL 1JYXA 2E27H 1TENA 2GQHA 4R96B 3LN9A 3ZL4L 4CVZA 5HBBA 2Q8BH 1TNNA 4R0LC 5K59E 4YBQC 4JAMA 2BVQA 4HFWA 3FB7B 5TPWL 1I1YA 3MGOA 4NZTL 4PGDA 2YZ1A 5IFAL 4L9DA 1DQLH 3ZKQD 3QNXB 4R4FH 2XY1A 4HWUA 4YO0B 1M7DA 1PEWA 4TSBH 5K9OA 3UPRA 3UJIL 1TJGL 1JWSB 4HV8A 4OLZL 5GGUA 1HILB 4HMCA 3ARDA 3C60C 1JWMA 5E1AB 2GTWB 5J11B 2BMKA 1A1NA 1JF1B 3FQXB 3NA9L 2GCYA 1ZHNB 3DX8A 1IGYA 1UB5A 4UNTA 4JM2F 2XRAL 4OF6A 3BH9A 4BELD 2H32A 5A2KH 1G7IB 1YN6A 4JVWA 4PJDB 1JTOA 4NBXB 4ERSH 1KCKA 5KG9B 4Z0BH 3ZT7A 1LK3H 3Q6FA 1NBYB 3P77A 3CVHL 2DJSA 4PJ9D 4MD0B 2VXUH 1W0VB 4UIMB 1JRHH 4S0TD 3DYMA 5FO7B 4RGOH 3KPSA 3FCTB 3TT3L 4C83A 4FP8H 3QUXC 4HCRH 4N90E 3U2SA 3I85A 4X9HA 4U1IA 4G6KH 3ISWA 4O2EB 2WBJD 2YN3A 3GMLB 4EN3A 4JAMB 5T3ZL 1AR2A 2Z4QA 1I1YB 3MGOB 4C58B 2H3NB 2HT2C 2NY6B 4PGDB 4K8RL 2QADB 4KHTL 5B38A 1V5JA 1KPUA 3VGBA 3C8KA 1IC7H 2BNRA 3O6KH 3OKDA 4LHUG 3CNKA 3GK8H 4WO4B 4OLUL 2C3HA 1PSKH 1U8HA 5IEKB 5KW9H 5SWSA 3K7UA 1H3XA 4H20L 4DCQB 3ARRA 2XWTB 3DX8B 4RAHA 4ZO9A 3D2UD 3D0LA 3S4SG 4JY5H 4XP1H 2VRAA 4JZJA 4O9HL 4PJHF 1F97A 4LVNC 4HMEA 4Y16D 3EFFA 4U1MB 1RK0A 3BGMA 4HK0A 1BVLA 4GAYB 4YDJB 1EO7A 4PLKC 4B53A 1KN4H 5L2JA 5ALCH 3Q6FB 2DOCA 3RJDA 1A6VH 1HZHH 3KR3H 1CR9L 3CVIL 2GEEA 2MCG1 2RJMA 4HWBL 4JFFE 4I18B 4KRMB 2R56L 5GXBB 3CFIC 3HI5L 2IQ9H 3HPLB 4R4FL 5GGQH 4N1HB 3AXLA 3FO9A 4QHNA 3CDCA 1NC4D 3AC0A 5MEPB 4NO5B 2MHAA 3IDGB 4NN5B 1FO0A 4FS0A 4X98A 4U1IB 4U6HB 4PJ7F 3L7FA 5I1LB 1UYWH 5BQ7A 3GMRB 3MR9B 1CFQA 4Q2ZB 4WGWB 5EFIB 1A6AB 4JPIA 1IFHH 4EN3B 3M45A 3CLFH 2BVEA 4P9HH 1N6QH 4HUVA 3LKPB 4Y5XB 5HGHB 3QPQD 3TWCH 3GMPB 4ERSL 3VGFA 5JZ7C 4LSUH 1MNUH 4KI5D 3ULVD 4ODWA 4UTBH 4LRIA 1CTNA 1KEML 4KRNA 3CPLB 1N0XH 5ID1B 5L8LB 1YNLL 3G5ZA 5BV7B 4RGMC 3PJSA 2JJSA 4OGAC 4R3SA 2Y6SD 1M71A 1IEHA 3D0LB 4XNXH 2FHFA 1UQSB 1Z6JT 4JZJB 1QSED 2FX8H 5DK3A 4OZGF 3SGEH 2JE8A 1F11A 1RZGA 3O8XB 5FGCE 3SE8L 4NP4L 1Q0YH 4TSCL 4EI5A 1J1OL 4MMZC 3T0DA 3AB0B 4YDLB 5DQ9A 2OR9H 5JA9A 2B2XH 1D9KC 1YQ2A 3SDXA 4OD1H 2EKSA 3FO9B 4G42A 1LO5B 2WANA 4U7KA 1T7ZA 4PGCB 4GFTB 1IC7L 4K7PX 4Y0GA 3KLHD 1CFBA 5T1MA 3SJVE 4JPKL 4LNRB 5T1KB 3VXUE 5BRZD 5BVPH 5MEOB 5KW9L 5BQ7B 2BJML 3G6DL 2Y36L 3FQUA 2QSCH 2XZAH 3MRCA 1JNLH 3IKCA 1WIPA 1I9JL 1KLGB 4P2QE 3RWCA 5CSGA 1K6QL 1U91A 1FFPA 1YYMH 4K94L 2CIIA 1X5LA 2HKHL 2W38A 1DQTA 1GGBH 3WIHH 3DVNA 1F8TL 1FYTA 5E08L 1U92A 3I6KB 3BUYB 4M03A 4R7NB 4GAFB 3NIGF 3A67H 2AJVL 1ZSDB 2DI7A 1SYSA 2W59A 3QI9B 3PJSB 5IESL 1IZJA 4FTVA 4QHUA 3T0EE 5IM7A 5KVDH 2EYRA 3O9WA 4H8WC 4QTIL 2OTPA 4EUPH 5C07B 5DZLA 2J8HA 2J4WH 3IT8D 3BHBB 1AY1H 1BFVL 4TUKH 2XWBB 3TIEB 2CRMA 4OLVH 4CW1B 2WUBL 2QR0B 2VDQL 4ACPA 5T1LD 4F7PA 3B9VA 4GRLD 5L9DH 1I9IH 4GXVL 4YHIB 2LE9A 4M7KH 2OR7A 4G7YL 4R0LA 2VUOA 4X6EA 4PJBF 5C9JA 2W9DH 3VCLB 1PX3A 4G42B 1NDMB 4UIKL 3OXSA 3WN5C 3VH8G 4M93B 3G08B 1TDQA 1CICC 3QH3A 4LBEA 3D3VA 1RJYA 4K71B 4JKLA 4G9DA 4NGHL 3OR7B 4RFEA 3GUTA 4PJAE 1RIHL 4PRHD 4KRLB 4ZS7H 3RAJL 3HC0A 5HHVL 4FFVD 4Y1AE 4P99A 2C3GA 5C0GB 2BHYA 1MI5A 3LS4L 5EZJA 2V7NB 3C09C 4NKQB 1U91B 2FJGA 5HHOD 3FO0H 3PHOB 1FSKC 5EDXA 1JV5A 3K2UL 1S5IL 5HDOA 4PJGB 2K3TA 1NGQH 3CMOL 3V4PL 1CGWA 3DRTA 3RWDB 3HC3L 3KXFB 1YJDC 5KVEH 4Z78A 2R2EA 3V7AG 5EZLA 5FB8A 2R2HB 3ARGA 4M1GL 5D2NC 1R6VA 2IC2A 5F70A 4QHUB 5EN2A 5FYLL 5GJTL 4JDTH 4QRRD 3L3DA 3W0WD 2E9BA 3O9WB 2R23B 1QSVA 1O7VA 4S1RH 3H9SA 3ULUH 2VE6A 4P2RA 3FONB 1QKZL 4UI2A 1B4JH 5I73B 1IGIL 2D0GA 1KTKE 3MRNA 3WDHA 1MHEB 5I8KL 5L2KA 1CCZA 1QOKA 2R4RL 1OM3H 4F7PB 3DVGA 1J1XL 1AQKH 1BVKA 1WC7B 2VIRB 3ZDXE 5J89A 4E9LA 3FQRA 1ADQA 2WLYA 1MJ8L 4G3YL 4U49A 2GUOB 1KB5H 1XMWA 4G6JH 5JXED 1HHHA 3OXSB 1J0JA 1F2QA 4LBEB 1XIWA 1XGQB 3C5JA 1ZLUH 4JO3L 1V05A 5E9DE 3GSNA 2ZOKB 1VKXA 1MCDA 4FXKB 2DM3A