1LE5B

Crystal structure of a nf-kb heterodimer bound to an ifnb-kb
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
313
structure length
313
Chain Sequence
MGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*GP*GP*AP*AP*AP*TP*TP*CP*CP*T)-3'
publication title The X-ray crystal structure of the NF-kB p50/p65 heterodimer bound to the Interferon beta-kB site
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 313
sequence length 313
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1le5B02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1le5B01
2XICA 1YEDA 3TJEH 4S10A 2P1YA 5TQ0H 5FYJE 3NAAH 3KWWB 4Z7WE 5L9DL 2J3SA 5EOTA 3V4VL 2IQAA 4Z0BH 4P5TA 4WW2A 4I0CC 3AVEA 4OLUH 3MXVL 4ODSH 5T1LD 5CJBA 3F7RA 4XP6H 1I1AC 1FVEA 5L0QB 4MA3A 1N59A 4TUKH 3GRWA 4P3CH 4BFBD 1CF8L 1GZPA 1PG7X 1UWGL 4Z78A 2YS4A 1PQZB 3WFEL 4LMQI 3SE3A 2YD6A 2OMNA 3FZUC 3QIUD 3IU3A 1TDQA 2BMKB 4XCEB 3MZGB 2AV7B 4ORGA 2D0HA 3EYVA 1JPTH 1EDQA 4R7DB 4BSVA 1FORL 1G7JB 1XIWC 3HRZB 5FKAB 4OM1L 1BZ9B 4OT1H 1FFPA 5TF1H 3MA7A 3CLFL 3JWNC 5D7IE 4DKAA 5IMLB 3AS3A 1QR4A 3BE1L 4M6MH 5FOJA 5JOFB 4M1GH 2RBLA 3BEVB 1JZ2A 5CBAA 1NCAH 4YGVB 5I19L 2PW2B 1CQYA 3QUKA 5DT1H 1T5WA 3CFDA 4X6CE 3BRFA 1EO7A 3QUMB 2X4UA 5D70H 2F53D 3UZQA 3G6JF 4MNQB 1REIA 4NO0A 2IAMB 4HH9A 1U3ZA 5CZXD 2VDLL 1EBPA 1JPFA 4O2EB 5L0QC 4KQ4L 5JPNB 2NY4D 2LE9A 4IRSD 3D2UD 2WUCH 5H35A 1BWWA 1QRNE 4OAWB 3TFKD 3VXTB 1PLGH 3DUSB 3Q1SL 3BX7C 4K3DL 4OD3L 1G6RA 1OAUL 3QNXB 1WAAF 1HKLL 1LO5B 3VRLE 2N56A 1PJ9A 2AQ3A 2R8SL 3KPNA 4YGAB 4LGSB 3L9RA 1L7IH 1KB5L 1L7TH 3RVVD 5C0CD 5TE4L 5JA9A 5IQ9A 3GMPB 1M4KA 1XGQB 2ZNXA 2Z31A 1TQBB 3D9AL 4RBPK 1FBIH 1KIUA 5IB2A 3BW9B 4X4XB 3DHMA 3LPWA 2PNDA 3K4ZA 2XWJB 3V4PH 3CUPA 3RVWD 1NL0L 2DQTH 4MXQD 5MEND 5JQHC 2BJML 2EKSB 5B4MD 1DBMH 3FO1B 9CGTA 1OF2B 4OCWH 3TO4C 5GS3A 5DMGC 4XB8A 1D5XA 1A7RL 3O9WB 2NY1D 1YMHA 4AQOA 4CVZA 5IB4A 5DZOA 1HOCA 3WLBB 3RVUD 2OK0H 4LASL 5JA8B 2ORBH 2W9DL 3QDGA 2XQBL 2YK1H 4P59L 5DUBB 1P6AB 4G3YH 5GS1A 2PYFB 3K7UA 3VFVA 3NVQA 2L0DA 5ISZE 5KAQG 2BNQE 1N2RB 4KKAC 3BP4A 4OKVB 4XXCC 2J6EL 4K55A 3ARGA 3ALXA 3BGAA 1CG9A 4Y4HB 4KZEH 3LDBB 3P2TA 2FATL 2X4RB 4HK3J 4NRZA 5DK0A 5FOBA 4WEMB 5GGSY 4XNXH 3H0TA 4XCCL 5B8CB 3MLPA 1DP0A 1NC4B 2V2XA 4F37K 2R0WL 1FFNB 4FFWC 4I18A 3MO1B 3MLWL 4TOYH 1MIEH 1AO7E 3O6LH 4X9BA 2HMIC 4H8WH 1TQBC 3TPUA 4MD4B 4OSUH 1AI1L 3HAEA 2Y6SD 1IBGH 2VO5A 5TE6H 3PWPE 4OV5A 1KEML 3SGKC 3SHSA 3HMXL 4IRJC 1A9EB 2AEPH 1GIGH 1E4XL 1Z0NA 4X5XB 2ZCHL 1VENA 3CCHA 3O9WC 3INUL 4YXKH 4AIXA 2VXSL 2AXHA 4YH6A 4F15B 1MJJB 2FYYB 4NNPH 1U8NB 5CILH 4RFEA 2E9JA 4NN5B 1I7RB 2VDNL 1XH3B 4NKMB 4ZPTB 2NR6C 4PJXF 3IJSA 2E6QA 4O2CB 4DZBA 2BP3A 2HT4C 3ZO0A 2APXA 3L5XH 3SE8H 3JV0A 3RWCA 1H15A 1ZA6B 4MQSB 3ULUF 5B8CC 3W0WB 1VA9A 2O93L 2XG4A 3Q48A 5ILTL 2D7TL 1W8NA 4R4NC 3TJHC 3S88H 1OAZL 3HI6H 2IADB 4LRIC 2X4SB 3ECBA 4F80A 2E8ZA 2Z4QA 2ERJB 1NGYB 4NQUA 2DBLL 4BFGA 4UILH 4AH2A 2H9GA 3SOBL 4RISL 3MFGB 3CFEA 3MUGA 4GW1A 3ULVD 3IDMB 5GGVY 3LS5H 3VA2C 2ADGB 1U58A 1V7NH 5I16A 3UO1H 4O51B 4NM8H 5EH1A 4KKCC 3GFUA 5H37H 3OR7B 1KIRA 4CDGC 3P9MB 4QCIA 3P73A 2VYRE 3U4AA 5ID1A 5IB1B 1UG9A 2PTTB 4M43L 4HHAB 4MDJA 3QDHA 3VD5A 1AXSA 4I0PA 4ZTPH 3CSYA 3TH4T 4LDLB 1MCWM 5FF6A 1T2QL 4FHBD 3UCRA 4ZAKA 4HUVA 1FNSH 5E8NB 1TZGH 5D71H 3QEHA 4XNQB 5GS0H 2DQDL 4UUJB 4ODWB 1X3DA 4ONGL 1U8OB 1LDPL 4PLOB 3VXUA 3L3IB 2PTUA 5EU7E 4Z76B 2MQ3A 1S9YA 2IWGA 1SY6A 3I2CH 4YHOL 5MEPA 3L3DA 4P5KB 1SJHA 5DD0H 3P4OA 5IMOB 1UYWH 3D85B 4O9HL 1S5HA 5SWSD 4Z7VA 1KIQA 2R0KH 3AS0A 4WI8A 3GIVA 2B1AH 4RMVA 2NY7H 5HI4C 1VACB 3C08L 1NCBL 3GK8L 5C0AB 1UXWB 2YD4A 3GHBL 4HC1A 4JKKA 4U1IA 5I76B 5HY9B 3ARTA 2Q8BH 2BSRA 3WIFA 4U1SA 1IQDA 3QI9C 1MFBL 4NQEE 1KLGA 2P45B 4Y19D 2CUIA 4Z7UE 3PG2A 1OT1A 3A6OA 1GJIA 1YECL 1JHTB 1P69B 3QCVH 1ZHBB 1AQKH 5JZ7C 3KXFB 4LLAA 1IC4H 3X14A 4C56B 2BVUA 3ZLQC 4IBLT 1ZLVK 3MLSH 2NTFB 3N9GH 2XKSA 2MQCA 3ARFC 4G6MH 3O6FA 5BW7A 3Q3GA 2IPKA 3QXTA 4ODVH 4JPWL 4FQIL 4PJXE 2RCSH 1UACH 3FFCB 2NW3B 3DBXA 5GIRA 4V1DE 2AJVH 2ID5A 3GHEL 1MWAL 1FL5B 4CW1B 4ZUWB 3D0VB 5BRZD 1KCLA 2GITB 3RL2A 1RMFL 4W6WB 3ZKND 4AEHH 1RIVL 3SCMA 1YEJH 3MRGB 1MJUL 2EKJA 1JP5A 3E6FB 1JWUA 1A2YA 3TT1L 3U7AA 1D3CA 4XMKH 1UVQB 1I85C 4DGYL 1BGXL 4PY8I 1MH5B 1IZJA 2VZ3A 1F11A 3MNVA 2JELH 1CL7L 1YZZA 1J87A 2ZKHH 4R0LB 1AC6A 1YYLL 5JOPE 3AREC 3KLAB 2F58L 3PWVA 4U7SA 2AXGA 5DVNA 5FO9A 5IVOA 4UTAH 4HWNA 1OPGL 2DMCA 4OB5L 2IGFL 4HS6B 4YHMH 2XWBB 3IS1X 4FOMA 4WW1A 3VXNB 3UJJL 4L3EA 1MAMH 5IBUG 1WC7B 1NCUA 1F4YL 4EIGB 4JRXA 4GRLB 4KROC 3PV7A 4CL7A 4N0FB 2X89D 2AJXL 2I07A 3IF1B 4PJAB 5K9OA 2PYED 3NCEB 4P2OB 3QO0A 5I74B 1A4KB 4JPIB 4OJFH 1UQSB 4PJHF 1ZHNA 4X8XA 2P5ED 2LFGA 2QADC 1FL3B 5JHDB 5CSGA 5F6HI 4AEIL 4MJ6B 2O5YH 4ZUTA 1UJ3A 4N90E 3AM8A 1RJLB 1SYVB 1XF3A 4ZTOL 2YMXL 5ESQB 4NQCE 1H8NA 4HQQH 3TBYB 5JO5A 5DEFB 1QSEB 2UZIL 2BY3A 4LF3B 3DX9A 4PLKD 5L88L 5T5FL 4LVOC 1PKOA 5GISH 3BPNB 2C1PA 1WEJH 3O4LD 4Y7MA 1H3UA 1UT9A 2AVGA 4JPVL 4OM0L 2R29H 3LQMA 5T3XD 2CMRH 3NABL 4NJAL 3CVHB 1XF2A 3U9UB 3DROA 5DR5L 5C9KA 4K7PL 4MNGB 2OZ4A 1AGEA 4G6JL 1MFEH 4NRYB 2EIZA 1YEFL 1FPTH 4WTZG 5KJRH 2A9NH 4CU7A 1RZJC 4Q9QH 1JNNL 1OAXH 4XMPL 3SDAD 3T0XA 2E7HA 5ID0A 1NMBH 4Z77A 2X2YA 1IGCH 2YUWA 25C8L 1UXSA 4WI3A 4D0CB 4KUCD 1OB1B 3MNZB 2LU7A 1RK0B 4F7CB 1RJCA 3C60B 3QDGE 4P2OC 3IDUA 3LQAL 4HIEB 1EJOL 4NCDA 2B2XH 1OSPH 3RIAK 2IEPA 2H6PA 1K4DB 1T0MA 15C8L 1QHPA 4QY8A 4X7TA 4L4VB 3MLVH 1AE6H 4LCUB 1UM6H 4H20L 1G7PA 3RIFF 4U6VH 3VI4F 1BFVL 4LOUD 3TA3B 4QOKA 4NC0B 3LRSB 4YLQT 4JFHD 3QULB 2ITCA 3TZVC 2R1XA 1JGDA 1T7XA 3OX8B 4L8SC 1IGYA 3G5XA 2WBWB 4MCZB 1T22A 5BZDA 4JRWA 3RAJH 43CAA 1J18A 5B39A 4DCQA 4ZXBA 1B0WA 4NWUL 4LSSL 1O7VA 2OBGA 2HAZA 3DIFB 5D6CA 5TPWL 4QXUH 2WZPD 2X4QB 1U8JA 2FSEA 3AB0C 5I1DA 1BLNA 1NLBH 1NCCL 4XPHH 1JPSL 5DD5H 3QIBD 1JV5A 4YDIL 1RQ5A 2BVQB 1U3HA 1X5JA 2NZ9C 3SDCB 3LN4B 4OGAC 1NC2A 1CFSB 3X3GL 1I8KA 2VLJD 3S36H 1EFXB 3OZ9H 5JXED 1EGJL 1OTTC 3O0RL 1RY7B 1TPXB 3C60C 2ENSA 3BZEB 5FDWA 1JI2A 3CX2A 5B38G 1VFAA 4PJHE 1IAIH 3QH3B 1AGCB 5EDXA 1KXTB 1RZIB 2CIIA 3BZ4A 5FYJD 5LWYH 2VJXA 4CN1A 5IKCA 3B9VA 3OAUH 4LAQL 1BJ8A 3UTZA 3TA3C 4XVTH 5TE7H 1BM3L 3KNBB 3WXWL 5JNYB 5DDHB 4F58L 4XPTH 1I3UA 3TVMA 4ZUUA 3O6ML 2C9AA 3WKMH 2DIJA 3P3YA 5GXBB 1AR2A 3C8KB 1QQDB 1RUMH 2BFVH 5GGUB 4LHUD 1BVLA 1CT8B 1H3GA 5F96L 1H0DB 4KJQD 1X6LA 2P49B 4PG2C 4PJ5B 3WJJC 5D1QD 1ZEAL 1DBBH 2DL9A 3QQ3A 4MAUH 4KVNL 5E9DA 3SDCC 5HHVL 1KXVC 1WIOA 1Y18B 5IEKB 3MJ7B 2Y4SA 4AT6B 1XR8A 2FIKB 4WO4A 4D3CL 1HQ4B 1FV1B 3DTXA 4UOJA 4RGOH 5DJ2B 3PHOA 1KCSH 4QF1A 4X9IA 4HJGA 1IM9D 4DKFH 3UPRA 3TIDA 5INDB 4I8DA 2IANE 1FLRL 2D31B 5GZND 1F2XK 4LHUG 4P2CG 2CXGA 5K59F 3C5ZC 3VXUE 1WSST 1AHWC 3GSQB 1G9NH 4M4PA 3RUGB 3NTCL 1BBJB 3PGCA 1W0WB 5DJZB 3VFSB 3VGDA 4DFHA 5DTFA 3VU2A 4HV8B 1Y0LB 1EO5A 2H26A 5KSAB 3EYSL 5KN5A 4HK0A 3K2MC 1R3JB 4Z7VE 3WFBL 1QACA 2OL3H 4OLWH 5I1HL 1R5WA 2DQFB 4XPFL 3E3QE 1FG2B 2V17H 1Z3GL 4XCFH 5C0FA 1CICA 5HHQB 1RK1A 5J1SC 3T1FA 4Y2OA 2DLFL 2E7MA 4NO2B 4QRTA 4MA7H 3FMGH 2DWEA 3TLRA 1LQSR 4XNUH 4UIMA 2OR9H 2CO7B 2QL1A 3PP4L 1E4KC 5E2VH 1XGRA 3MBED 4CU8A 2W0LA 4GXUM 4FABH 3BYYA 5IWLC 2VAAB 4PRBA 2QQNH 2ATKB 3NIGE 1SYSB 5B3NA 1XF5B 5GGVH 5JQ6L 3FN3A 1ZLWK 1R5VA 3P77A 4FQLL 3FOLA 5EOQL 1T80A 5C07A 5J7CC 4TPRH 1YNLL 3BOVA 4LLUA 1E6OH 1K4CB 5HYJA 3ARUA 4K3HA 4WY7L 2HTLD 1GOHA 5DJCB 2BNQD 5E7FA 4KTEH 4FQXB 2H32B 1B0GB 4X99B 3O3BA 3GJFH 3DWTA 5L6YL 4M6NL 1H5BB 2EDJA 4LEOB 3DURB 1EVTC 1IC1A 1G0DA 4POZC 3TNMA 4LCCB 2WMPA 1I7ZB 4GG8A 4QYOB 5HGAB 4F2MA 3HUJA 4S1RL 4LP5A 1P84J 2VDQL 2WUBH 4WWKC 3CFIC 2Y36L 3OWEA 3T4YB 2V2TB 1B9ZA 1NGZA 4OTXH 3DRTB 3TBTB 4EN3B 4P23C 2BOCA 3VXQA 3NZ8A 1RZKC 1E4JA 4KVCL 1C5CH 3FQWB 4XHJC 2YC1A 3TYFB 1E4WL 3CK0L 2OCFD 4L3EE 1RV6X 4U0RB 1JN6B 4MS8C 3JTSB 4KQ3L 2R23A 3R06B 3PWPD 4NQDB 3NBNA 1G6RL 1KBGL 3RDTB 3T2NL 1E6JH 4YHKL 1I1AA 3PV6B 3G5ZA 4GAGH 4PRDA 2ICWI 1Q1JL 2XNAA 4KHTH 1NDGA 4Z7QF 5JIKA 1VDGA 3W2DL 2BNRB 4GQ9H 5DXWA 4OCRH 5IQ7H 1DL7H 1DBKH 1A21A 5GRYA 1J05B 5CKGA 3UC0H 4YPGA 32C2A 5E2UH 1Z5LA 3RL1A 3QFJB 4U6TA 2J8UF 5HGBA 4DGIL 4DN3L 3AXLB 1MI5B 2GJ6E 4GKSB 1YEHL 2CKBH 3QEUA 1XIWA 4PBVC 4B41A 1FL6A 4Y2DD 5EZJB 4UZGA 3EJJX 5T1DH 5LGHL 4LCCC 4PB9H 3PJSA 3DV6B 2Z92B 3K80A 1IAMA 3UTTB 5D9SA 3BJ91 5LG1A 4E41A 3CFCL 3SDYH 1HHKB 1MCOL 2VABA 3KWWA 1A22B 2GCYA 4HKBB 1HE7A 4TSAL 3KGRA 3CIQA 3ARBD 3UJTH 1TFHA 3IXTB 1WUNT 4OQTA 4U0RC 3HS0B 1P7QD 3H6JA 4OFVA 5CMAA 5C0BA 3WE6A 5CZVL 5DJXB 2DLTA 3KYAA 4GG6A 3IDGA 4BK4A 1S7RB 3RHWK 1KJVB 1I9JH 5AWNH 2FB4H 2XI9A 3UJIL 1LO3H 2ZNWA 2XACC 5CJ8A 4JO2L 2X4OB 5DRWB 2FZ3B 2GK0A 2MTPA 2I9TB 1DQDL 1BQHG 3ZTJG 3I75B 2DI7A 4ZDHB 4FQPA 1CLOL 4EI5C 3OPZH 5J6HA 4LLVA 3SEPA 5BOPA 3S36X 3WXVL 3WN5C 1RHFA 4ZS7L 5I6XB 3QFDA 1R5IA 4QOKE 2HVJB 4LNVA 1MCPH 4M8QB 2DYPD 1KJMB 1CU4L 1C5DA 1P9MC 1J8HE 4NC1E 1ADQH 1LHZA 3HRZA 5DMYA 1V3MA 2BXYA 4L5FL 4F57H 4EUPH 2J8OA 2AXJA 2V6HA 4Z7OE 1HI6A 5ESAB 3RWDA 3SKMA 5INCA 3TO4A 3CVHL 1WIUA 4UQ2B 4KMQA 4M5YH 5CSZB 2XT1B 4P48A 2DQEL 3GI9L 1P1ZA 2GW5A 3DHJA 3VWJC 4DKEH 1TVHB 4ETQA 1RPQA 5IVZA 3O41A 5F1KC 4ZFZB 3FRPA 3SN6N 2R0ZH 3RWHB 2WBJD 2ZUTA 4JO4H 5GSRA 2X9WA 2VDMH 3SJVA 1A6PA 5CD5C 2HLFD 3H2WA 5CUSL 3BH9A 3FT4B 3HLAA 4MAYD 1IAII 5D93C 1N6QH 4U7KA 4NQXB 1HWHB 4X9GA 1KPVB 4XXCA 2ESVA 5IGXH 2GSGB 1WBYB 2PTVA 4NQED 1PG7L 3DUSA 3MRDB 3EDEA 5DYOB 3NPZB 3T3MF 5F88B 4PJDB 1NAKH 1CD8A 3MROA 4R4FL 4U6YA 2F54A 4KTDH 4PBWD 3WFDH 4N8CH 3ARWA 3QPQD 5I18H 3VH8A 1Q0YH 4OLZH 3PHQB 5EO9A 4HFUL 4P5TD 2AS5M 2P8LB 3F6IA 2UWEA 1I8LC 1JPGA 2ZCKL 3KR3L 3MXWH 1LD9B 4V1DD 5C0RH 3ARDC 3U0PB 3OTTA 4HLZH 5J6GA 1SMOA 1U2CA 2PF6A 2AK4E 3SGKA 2EKSA 3RPIA 1A02N 4C83B 4IRJA 1KG0B 4K94L 4TSBL 4P4KB 5IVXF 2ITDB 2RFXB 1KENL 1KFAH 4Y8DC 3DVFA 2VQ1B 5FYLE 1EX0A 2EC8A 1A7OH 2IH1B 4JQVC 4Y4FB 4HUXA 1QSFA 4G9FB 5I9QB 4WGVB 3QCTL 3A6CL 3CDGA 2CK0H 4FTVD 2PYFA 3TO2A 5D8JL 5ETUB 2P8PA 3T2QA 3ARZA 4AM0B 1IRAY 2OX5A 3P0YL 4TQEL 5I1LA 5JOPD 4Q9RH 2ZG2A 1N2RA 1T3FB 2XFXA 4G8FB 4DTGH 12E8H 3QWRD 5F7NC 4EOWL 3BSZL 3LAFA 1F4XL 4MNHB 2VDPL 1G9MH 1SEBA 4QHMB 1IFHL 4N9GB 1MVUB 2Z9TA 3B3IB 1WCBB 4AIZB 4LRIA 5GRXG 4HC1L 1IGML 3U30B 5J8OA 4LPTA 1KUMA 5E00B 5E5RB 1S9VA 4N0YH 2MKLC 1T21B 5HHXL 4WJ5A 1IZKA 3G5YA 3D6GA 4OI8A 4NO0D 3MJ8B 3QUYD 4QHLA 1WITA 3KLSA 5C09A 2UV3A 5ALBL 2XZCL 4N90D 1UM5H 4P4KC 5DD3H 4NQCD 4I4WB 4X4MA 4BZ2H 4K8RC 4JRYA 4MCYB 3FRUB 4MZ3A 5F3BB 4NZJA 2AK1L 1RZ7L 5I9QC 1I7RA 4NKMA 1HHGA 5IMMB 4PGZA 2Z31D 3QDJB 4D9QE 1I1YA 3WHE1 1NDMB 4APQC 1MRCH 4UBDC 2EH8H 4IS6A 2X1QA 1ZT4B 4WV1C 2FR4B 5IV2B 1V3JA 3GMRB 4CADB 1T7ZA 5IJVB 3QAZC 4YPJA 3T3ME 2R56L 3O6KH 1NCWL 4DN4H 1YEKH 5IMKB 5GRUL 1EHAA 2EICA 3QHFH 1F2QA 2DLHA 5C07E 3U30C 3O2DH 1MNUH 3VFUA 1A7PL 1CK0H 1FZJA 4J23A 1NGYA 2Y1VA 5F7EH 1FE8H 4G6KL 3QDGD 2EDYA 4IOFD 3L1OL 3QUXC 1I1FA 1CVSC 1F8TL 2BCKA 2DKMA 4ODTL 4MQ7B 5FCSH 1GZQB 1P5VA 5C8JA 3DLQR 4XCNB 3QI9A 3KYOA 5GGQL 5IVXE 3RZCD 2VDKH 4J12A 1FQ9C 4QWWD 5LAXA 5HDQL 5IB1A 4J8RB 3HUJE 1LP9A 1QYGL 4J3TA 4PJIF 5E1AB 1OL0A 1KT2B 2AEQL 4PJCB 4D0DB 3WO4B 3ARFA 1MJ7L 1CLZL 1HILA 3EO9L 1UKSA 1GVIA 4ONHA 3IT8D 4HWEL 4ODWA 4PJFA 4RBPH 4G8GA 4GMSL 5BO1L 2Q6WA 1ORSB 3PQYE 4N8PA 2X1OA 2EDBA 5IMOA 1QBML 3MLTB 1D6EA 1IGTB 3VFGH 4MVBD 5CP7A 1I85A 1XGYH 5C0AA 2OXGA 4NHCL 4OZFG 4K9EC 4NUJA 4OZ4B 2VXQH 3AREA 5I76A 1D5IL 1SEQH 4DW2L 4WUUA 2OTUB 3TFKC 1F3DJ 1A64A 3L3HA 1NANH 1JRHL 3SGDH 3B5HA 3VFTB 1EAJA 3NH7H 1EAPA 1OVZA 2YUXA 1K6QL 4LPYA 4PJGA 1OAQH 4O02H 3OGCB 3OF6A 1JHTA 4X8JA 1YY8B 3RVVC 2B4CH 3ULUH 1FYTB 1NBQA 3X17A 2XTJB 2C3XA 4E41E 4GSDH 3P4LA 3RY6C 3G08A 1ZGLM 4M02A 5IK3A 1L6ZA 2DICA 2I9LB 2RR3A 4Q9BA 4CN4A 4HMDA 1TXKA 5IFAH 5BVPL 4U1HA 3RVWC 4X0KB 5B4MC 4JZJB 1AD9A 4HPOL 5CCKH 5C0BE 5FO7A 4HS3B 4CW1A 4OZIB 4ZUWA 4HUMB 3VMPA 1CDHA 5DJ6B 1WWAX 1TJGL 2NY1C 4YHPB 2ED9A 3BAEH 4OUUA 4OCSL 2Z93A 1OGAA 5E5UB 4JREC 2DS4A 3MQIA 2AJ3A 2FJFB 3MRGA 5F9AC 1V8HA 3V5DB 2VN7A 3PABB 4RDQF 4ODUB 3MACH 3FB7A 3LOWA 3VE0B 2ICWB 4NGHL 1U3YA 4BM7A 5EZLA 5J9PA 4P46B 4P4RB 1GXEA 3Q5OA 4LARH 3ZE0F 2IAND 1YPZB 4FQHB 1W72H 3FJTA 5JOEA 3E2HB 4LVNC 1OTUD 4Q58C 3U7WH 1HXYA 3BWAA 5E8DL 4XT1C 3RA7H 2XTJC 1WC7A 4R4BB 1CD0A 3L3JB 4X6DA 5CD3B 2Y6SC 1UZ6F 1HHHB 1A6WL 2DB8A 4RX4D 4NC2B 4P2OA 4OGXL 1G7QB 2QLVB 3MCKA 3V95A 1DQLL 3X12A 2B8OT 3HPLA 3I6KA 4HS8L 1NUGA 1EHXA 4JFFB 4LCWB 2X70A 4LP4A 4JY4B 5HD8D 3LKOB 4NHUA 4UINL 3WV0A 3HMWL 3BKMH 3TBYA 3ZL4H 2Q86A 1MHCA 4NBZB 3TZVA 5HVGB 4FFYL 4X6FA 4UTBH 1HINH 4JG0L 3PWLA 4L8SA 2DM3A 3EDFA 4PB0H 3PGDB 4OFDA 4TTGA 1KIPA 1PLGL 3H3PL 2ZWLT 4P46C 4ERSL 4OCLC 2UWEE 4X98B 1BFOA 5ADOL 3UTSA 2WAHA 3IAPA 1CLYH 2B0SH 1CXLA 3E8UH 1P4IH 1HWGB 1Q38A 2FD6H 2VUYA 4G6FD 4NRYA 2XOTA 4DOHB 2W60B 3PNWB 2ICEA 3GJEB 3TCLB 5A3ID 1FBIL 3ZE1F 4LSTL 2FO4B 5A16A 3FHAA 1S7WA 4HZAA 3ES6A 1TJHL 4PD4J 1JIBA 4PJ9B 4EBQH 5F9WC 5GRVL 2HFEB 1N6UA 3ULVC 4CVXA 4HIEA 1P4BL 4JHBA 4U31A 5CZKA 5F9OL 3GM0A 4OZGA 5DHVB 4AY0A 3C5JA 1DFBH 2JB6B 1RU9L 5H94A 1DBAH 4U1KA 1YDPB 3TBVB 4M61B 4QRUB 3HN3A 3DV4B 3EYFB 3KJ6L 4UT7L 1BIIB 2AJZA 4CJ1A 4YE4L 5FA4B 1KACB 4L3ED 2R4RL 3H9SA 1AY1H 3MCLL 4Y16D 4LHJB 3TESA 4M6OH 3LKNB 2C3HA 3I9GH 4Y1AA 2EIBA 4ZFFB 3KYNA 3KPSB 1Z6JT 4F3FA 3MODH 1ZLVH 1I7UA 2ATPA 3F12A 4PP2B 2MHAB 3QXVA 4K2UL 1WQVT 4G8IB 4PG2A 2F74B 3U46B 3WJJA 2FECL 6FABL 5SWQB 5C0JB 2AXFA 2WWMC 4HPYL 5FKPB 3LIZL 4OSUL 3ZKXB 4WDIB 1JGLH 3M45A 2BVQA 2ICES 5TF0A 5C08A 4HWBL 1GHFL 2GJ6D 4X4ME 3AU1A 3T08A 4JRYE 1A4JA 1ZT7B 4EDXB 2FEEL 1NGWB 2PO6D 1R3KA 2CPCA 1J1PL 4H88L 4DVBB 5ITBH 3HG1A 4L8BA 5GGSB 2PW1A 3BDYL 2B1HL 4YXKL 4KAQH 5IFHH 3S3PA 2DM2A 4P2QB 5E8PA 5TDNB 3F6LA 3I85A 1QR1B 3JZ7A 3K0WA 1H8SA 1H3WM 3CMOH 4M5ZH 3C5ZA 3EJYD 5DURB 1AHWA 4QNPE 3VXRB 3K4DA 4PRIA 3EDKA 4JDTH 3ZTNH 5JUEL 2VB5A 3O3DB 3RGVB 2C7UB 5AZEH 3IGAB 1C1EH 1HZHH 2ZG3A 1JNHB 2HWZL 4QTHB 5B21A 4Z6AT 3BD4A 1JF1A 3DOSA 3B8YA 1ZKAA 5FO8B 3RU8L 1MCHA 3HI6L 3FFDA 4JO1H 5C0IA 3HE7D 3V79C 3BQUA 1LO4H 3ZKNC 1NFDB 2AJUH 3DMMD 4YHIB 2YEZA 4OCYH 4C57C 1MCIA 4QOKD 4XVSL 2BSSA 1MCSA 4M62H 3MJ7A 1E0OB 1J8HD 1E4KA 2AV1B 5E6YA 3STBA 4HF5L 2FIKA 1NGPH 2FIRT 2NX5B 4PRHB 2EO1A 3MRCB 1B6UA 5IWLA 5EFIB 4ALAH 3OGOE 2OR7A 2VZVA 4PJAF 4XNZB 3WUWA 3IFOB 1X5XA 2JCCA 1VFUA 2DJ4A 2NY5H 1DJSA 5J3HC 5INDA 5HHPB 3HNVH 2D31A 5BQ7B 2A6IA 3VG0H 1ZANL 1EBAA 3IFPA 1O0VA 1VESA 4LQFH 4AG4H 3GSQA 2PXYC 1AD0A 5I1GH 1T4KB 1M71A 2EXWD 5IHLB 4H25B 3ZDYE 5I8EA 2YPLA 1JWSA 1IGIH 5EIIB 1XF4B 1U8KB 4N1CA 2DTML 1N7ML 3AS1A 2HYMA 3GMLB 5GS0L 3D69B 5CINH 5C6TH 1NC2D 4L4TB 3LKRB 1S7TA 1R3JA 1NANI 3DRQB 3SGDI 4XBEL 5EO0B 3MJ9A 1I3GL 5C0AE 4NQTA 1UM4H 1OP5K 3LEVL 2OQJA 3L3OB 2EE2A 3QRGH 5DD0L 2ICCA 2ZOLA 2NNAB 3G6DL 5FUZL 4WUUE 2WWKT 1KPRB 1NBYA 5C9JB 5KZCD 43C9B 1HDMB 4WWKA 1K5NB 3WEXA 5B39G 1BHGA 1S7XB 3QO1B 1NCNA 3GJFB 3OBAA 4PJGE 5DVMA 5FYKD 4P23A 4PLKC 3SDXB 3HPJA 3QR2A 1S5IH 4XBGA 4ZSOB 3TVMD 1DUYB 5GRJH 4QXTA 3UBXI 5D2LA 1SVCP 2AK4D 3V0AC 1RVFL 3DXAD 3FT2A 4XNZC 2VL5A 4QTIH 2ZUQB 1MFDL 1MCEA 1JJUA 4QO1A 1AQKL 3FFCE 3ZKMC 5FYLD 2D0GA 1TNNA 5FECB 2VWEC 2HT2D 1TCRB 4J2XA 2BVPB 3MLSL 1AJ7L 1WZ1L 3SDAC 1H3VA 2WIMA 5DEZA 4M48L 4YAQA 1OGAE 1B0RA 5L9DH 4S11A 1JTOA 4IMKC 1I3RA 3QA3A 1EMTL 2XRAL 4UAOC 4WO4D 1ZWIA 3MXVH 4UQ3B 3MR9A 4LCCA 5E1HB 2A9ML 3SKJL 3OHXB 5JDSB 2GFBA 3BVNB 4LOUC 4R9HA 1CF8H 3NN8A 1CGTA 2CKBB 1UWGH 3BGMA 4LGPB 3WFEH 2ZKHL 3L6FB 3TBTA 1J5OL 3GSRA 3BHBB 4GOSA 1HH6B 2H45A 4PBXA 2EIDA 3K3QA 3TIEB 3TC9A 2MMXA 4J3SA 1VGKA 4I0KA 1DUZA 3PV6A 4QRRA 2FL5B 1JNLL 4FMKA 5D7LA 1P2CB 4PJAE 3F5WB 2MCG1 1T7YA 4YXHL 1FORH 4XMLL 4OM1H 1O7SA 3DGCR 5DFVC 2OR8A 3CLFH 1CICD 3RKPA 5DI8A 2JK5B 3W39B 3QIBC 5JHDE 2DQUL 3VFPB 4EI5A 1P84K 2IC2A 3BE1H 4UB0L 5DK2B 1NFIB 5CEZL 5IFJB 3WN5A 4PPTA 3B2UD 1MI5A 2HLAB 4WFGE 5JXEC 1HCVA 4D9QD 3FN9A 1GOFA 3U48A 1P9MA 3U36B 5E5MB 1QSEE 2ZG1A 1LNUB 3S4SA 1D9KC 5DEGB 3S34L 1M6OA 1WLHA 4EXKA 2QKIB 1AFVL 4YHYB 5JW5A 3T65A 2VDLH 5DHXB 4M7ZB 5EUOF 4HQQL 3UTTA 1J1XL 3TV3L 5EC1B 3FTGB 4KQ4H 2JJTC 4JFDB 1BJ1H 4LMQE 3UTSE 5I2IB 1WWWX 3VWJA 5C07D 3Q1SH 4I77L 4K3DH 4MNGE 4I48A 2FJGB 4OD3H 1OAUH 4IJ3C 1HKLH 2OS7A 4EUPB 2VITA 3L3KA 4JVPA 2B5IC 1M05A 2R8SH 1FJ1B 3FO9B 3LSOA 1G1YA 5FGRA 1KB5H 4WCYL 3TBWA 4UDTA 2X4PB 3K8LA 5E6ZA 3SO3B 4KRNA 5BXFA 1A0QL 4U1MA 2PCPA 2DOCA 3D9AH 1DZBA 4KJQC 1MEXL 3QXUA 1L6XA 3BPLB 4MA1C 5FB8B 5D1QC 1A9BA 2YSSB 3PDOA 5L7XL 2A83B 3IB4A 2BJMH 1NMBL 3LEXA 4ZDHA 2EYTB 5EPMB 1FZMB 3JWOC 5GHWL 1A7RH 3IVKB 1PKQB 2HVJA 3HCVB 3GMNB 3DX6A 1CBVL 1XGTB 3IDJA 4W6XB 3ZE2F 1CR9L 4YR6A 1OSPL 4D9LL 1I8LA 2XN9D 3QXAA 4JVWA 3RUGF 3MLYL 2X1XR 1LEGA 2VZOA 3W9EB 4LASH 2LTQC 3ARDA 2Z0BA 2W9DH 5AD0A 2XQBH 1AKJA 4P59H 1MHEA 4FQQB 3W5MA 4KY1L 4NFCA 3ARPA 4YHYC 5L2JB 5ESAA 1LEIB 3OKDB 5GZNC 4K71C 3QWQB 3PQYD 3QPXL 3GSNH 2J6EH 1ZT1A 5I17A 2DI8A 3RJQB 2A6KA 3UP1A 4JQVA 4PLJC 1ZLWH 2FATH 3FZUD 5BOZG 2P5WA 3ARSA 4XCCH 5ENWB 5T1KB 1GC1L 2R0WH 4ODHL 2OTWB 5LXGL 3CU1A 1L0YA 4HUWB 3MLWH 4PLNC 3VMNA 2DL2A 4OIAA 2VXUL 1IJ9A 3PDGA 2NY6C 4U2ZA 1ZLSL 3WFHB 1N6VA 5CSBA 4CMMB 1AI1H 1EPFA 1MLCB 5DS8A 4PJDA 2QTEA 2A6DA 1KEMH 4G6AD 4E41D 4RAVB 3HMXH 5EOCJ 1E4XH 1CE6B 3N1QC 2ZCHH 4E5XB 2HTKC 3INUH 3MBEC 4LSQL 2VXSH 4GRWB 4XZUA 4MWFB 2GUOB 5DQJB 4JDVB 4P2RB 1C16A 2DQIL 5HJ3B 4F7MB 1SQ2N 5IM7B 4A6YA 4X6EA 5E8OA 5D1ZB 1Q0XL 5J57B 5J1AB 4F7PA 3BIAX 2VDNH 2D9QB 2NY2B 5IHZA 2R39A 1J11A 5EZOL 2ITDA 2RFXA 4RGNB 3D0LB 4BQ8A 5DGQA 2EE3A 2OI9B 1A3RL 4YIQB 2VISA 4PJ5E 3CGTA 2HTLC 3G6JB 4G9FA 2EYRB 1RUML 5ILTH 2D7TH 2YXFA 5F6IC 3HZVB 1OAZH 1JTPA 3BP7A 5GS2D 4APQA 5C86A 1C5BL 4WV1A 5J89A 2DBLH 4HCRA 4BKLB 2V9TA 1DBBL 3SOBH 2YBRB 4RISH 3NOIA 4NP4L 5J11C 1L4IA 4XTRC 7FABL 3VFRA 3K8KA 1RD6A 2AW2A 4WFEE 2QR0B 3MA9L 4XP4L 5JPMA 5BMFL 2J4WL 2I60H 1FC2D 1DBJL 3ZE2E 4LPVA 5T1LA 4U1NA 4M43H 3RUGE 2YPLE 3QUXA 4YO0A 5D1ZC 2IAMD 4JEGB 4KKAD 3LCYA 1JMZA 4XCYA 1WFTA 2NY2C 3EHBC 1T2QH 3VGFA 3O8XC 4LKXB 2FH8A 4X5LA 2DQDH 4BQCA 1HNFA 1EXUB 1SJEB 1VGEL 1XCQB 1LO0H 4ONGH 1LDPH 1PAMA 3BZDA 1UKTA 4ZFGL 3DPBA 1QLEL 4FFWD 5LVEA 5FUOL 4QHKI 3VXPB 1Y6MR 2VXTL 4YHOH 3Q6FB 1UB5B 4Y2DC 3U2SB 4O9HH 4HG4K 1A3QA 2BDNL 1WWCA 3C08H 5E95B 1NCBH 3GK8H 4XB7A 3RWFA 1LE9A 3FMGL 3GHBH 4P3DB 3U9PL 1CGSL 1TVDA 1F97A 1HXMB 3OKEB 4X6BB 1V5JA 3B9DA 1WIPA 2CR6A 2NY3C 3O9WD 1YC8A 3ARBC 1KN4L 3MRFB 1EERB 1MFBH 3G6AB 4RMTA 1T89C 3UPAA 3VFWB 1BVZA 4JR9H 2F53A 1YECH 2AKRA 4BFIB 1I8IB 4KH2A 1R3LB 3EO1A 4EVNB 3STLB 4NPYA 3WBDA 1F6LL 5BV7L 4KI5F 4FQ2L 5SV3A 3HI5L 2NR6D 2VIRB 3D2UA 4RMQA 4ZQKB 3M1BB 1DLHA 1FNEA 4HDIB 3LKSB 4JPWH 4KDWA 2P42B 4YK4C 4FQIH 3O3AB 3VFNB 1TIUA 4LLQA 3VRIA 1PY9A 5D4QA 3GHEH 4LPXA 1MWAH 4TRPL 1NC4D 5C0CA 4E0RB 3TJHD 3U0TB 3EJZC 3C9NB 5HGHB 5IT2L 3RY6A 2VAJA 3FQTB 1QRKA 3H7BA 5ACMA 5CJ5A 3ZSSA 1LEKB 2DLGA 4UMGA 2C3WA 2DLIA 1RIVH 1MJUH 3KPOA 3TT1H 3QG7L 5MENA 5AZ2H 4DGYH 1KNOA 1BGXH 5GGTA 4NQDE 1CL7H 4PGEB 3V6FA 3G04B 1YYLH 1TZHB 1IM3B 2F58H 5HYQA 1OAKL 1ORSA 4KKCD 1MHPL 2IH3A 5C6WH 4WGWB 2WBJC 3DGGA 4G7VL 1S9XA 4FS0A 1IGTA 4OB5H 2IGFH 1TNMA 3QFJE 1FP5A 2HLFC 3J8F7 3MV8B 2NCMA 5IW1B 2LVEA 3UJJH 4S1DD 1F4YH 4XVJL 1MI5E 4RDQG 1IL1B 2AJXH 1JZ7A 4DUVA 3CH8A 5HGGS 5E99L 5DVLA 3VFTA 3QJHA 4FFZH 2D4FA 3OGCA 4Q6YA 1VADB 3VXSB 3LEYL 4U1GB 3N1MC 1MOEA 4PTTB 3JTTA 3V0VB 3FCTA 4LNRA 3UTTE 1AXTH 4OCMC 4AEIH 4NDMA 3ZT5A 2UY7A 4ZYKB 2IALA 4QT5A 2KBGA 3N0PB 4CAGA 4FQ1L 2YMXH 2HJFA 2XKNB 3HZMB 3RQ3A 1U93B 1KJ2A 4LAJH 5HI4D 2DMKA 4JN2B 2UZIH 5F9DC 5L88H 5T5FH 3BUYA 1G7LB 3QIWB 1MFCL 2FRGP 5CHNB 3ULUC 4UI2A 4X4YA 1MCRA 2WP3T 4JPVH 4OM0H 1KF9B 4YHPA 4X7FC 3LV3B 3QJFB 3NABH 4QRPB 5DLML 1BQSA 1CCZA 2NLJA 4NO3B 5CWSA 4KKNA 3FB5B 5DR5H 2AI0L 3IDNB 4G6JH 1VSCA 1YEFH 4OD2B 1T1YA 4ODUA 1H9VA 1NGXB 4KRMB 3GBML 5GGRB 1MQKH 4OLEA 1FSKC 3KHOA 4XMPH 1DEEA 4UNUA 5KANG 3FAWA 3VI3F 4H1LH 1F3JB 3OR6B 4JKPL 4P46A 3ZZ1A 4HX1A 25C8H 3C5SB 4JFXA 4UT6L 2DWDB 4HGWA 4XGZB 4CRPA 1AGDA 4G5ZL 3WIHL 3LQAH 3UROR 4GKNB 5DJAA 1MCNA 1RULL 1EJOH 2BOBA 5IJKC 5LGKA 4DZ8B 1MCPL 15C8H 2I27N 3BH8A 1ERNA 5HYEA 4R4BA 3UYOD 3EOBB 3PWNB 4H20H 3STZB 1BFVH 5EOCL 3D85D 3VG9B 4F8TA 5BJTB 2RGSA 3LKQB 5H2BA 4G80B 4NN6B 1M7IB 3HC3L 5C0AD 5KSBB 5T1MB 2YRLA 4YDLC 4U3CA 4BSJA 1JMXA 2A74A 3D1MC 3KYKL 4JFFA 3C8HA 4X7SL 1SBBA 4KUZL 1E4XI 3MGOA 4L9LB 4NWUH 1OGTA 3OKNA 3GMOA 1OW0A 2CGRL 4W6YB 2X09A 4PJDE 1HSBA 5TPWH 1PSKL 4TVPE 3KXFD 4BH7A 3V7MA 4C56D 3L3GA 2DJUA 1RJYB 1NCCH 1C08B 1JPSH 5DQ9A 4NFBA 5LQBL 4YDIH 3V9FA 5BS0B 4JDZB 1QKZL 4HW6A 3IETB 4F33B 1T5XA 2ADIA 1NAKL 4OIBA 5K33A 3BIBX 3X3GH 3FFCD 2HVKA 1EGJH 3O0RH 2V5SA 4LLMA 1LK2B 2J12B 3FO2B 4IIQB 3MOAL 4N8VB 4TNWF 2QADD 5EU5B 5FM4A 1GGBL 1U8HA 2Z35B 1CGYA 2HJKA 2X7LA 4AEFA 2P43B 5IIEB 5MHSE 2GT9B 5DJYB 3LKPB 2OTPA 3SKUD 5C0RL 4LAQH 5ICZB 3IAQA 1MCJA 2OP4L 5I1IL 4IOFC 2L7UA 1BM3H 4PJEB 2DDQL 4NJ9L 3WXWH 4F58H 2HFEA 4G9FE 4PJCF 3ZHLA 4N0UB 2ZUVA 3O6MH 5T3ZL 1CLCA 5E2TL 5KVDL 1HEZA 2UUDK 3V7AE 3N50A 4Y19A 3RNQB 2JB6A 3RZCC 1ONQA 3NMEA 1CDJA 4QWWC 4L9LC 3GSXA 3BP5B 4OLYL 3EYFA 2NY4B 4WU5A 4IRSB 5F96H 3S3JA 5DRZB 1BIIA 5I8KL 5ACZB 2EYSB 4GLRH 2QQLL 5E8EB 3I50L 1HYRC 2R2HA 3MJ9L 5L8JB 1ZEAH 4BQBA 4MXVF 4GRLD 5F1NB 3GKWL 4KVNH 3MREB 3MV9B 3MRNA 1A6ZB 5HHVH 3SPVA 4PD4K 1G9ML 4XWGL 3VI3E 1KELL 4P2OD 2FX9L 4PP2A 3WNLA 1PG7W 2C3GA 2MHAA 1VFBA 4D3CH 4U6HB 1RZKL 5JHDD 1T1ZA 1XGPB 5ECJE 2LQRA 3O3EB 3ULSB 1N3NA 3KPRB 2C4FU 4HUUB 1UUSA 2BVTA 1FLRH 3LN5A 3L7EA 5ITFA 4PGDA 4WU7B 4WFGD 1FNLA 3ILPA 4F7EA 3HI1A 3O45B 1ZT7A 4EDXA 5I30L 4IOSD 1QSED 1BVOA 5DSCB 3O11B 1KSRA 4XPBL 3QG6A 3LPFA 1A6TA 4ELMA 4MYWB 3NTCH 1GCFA 5FUCC 4ZMAT 3PL6C 1CYGA 5I71B 3S98A 1BFSA 3QDJE 1S3KL 4P2QA 2G75B 1ZLUH 4NZTL 3EYSH 4L29B 3X13A 3WFBH 1S7QB 1D5MB 1UWEL 4UNTA 4NOBA 5FGCB 1VKXB 4K7FA 5I1HH 4OZIF 3MYZA 3VWKB 4RRPG 4Q97A 4OFKA 1FO0A 4XPFH 1B4JL 2F8VA 5D1XB 2PXYA 3ROLA 3AY4C 2CDEA 2NW2A 1Z3GH 2OJZL 2R1YA 2IMMA 2IBGA 2DLFH 4LGRB 1BX2A 2X89A 1CGWA 4MD0B 2NZ9D 2PYEA 2I25N 4OGAD 3VGAC 2JTDA 5I75B 5MEOB 2F53E 5TQ2L 3U7YL 4WTZA 2C4XA 3KLHD 1K8DB 2WBKA 1OTTD 2P5EA 3C60D 3PP4H 4JZOB 5TDOB 1JWMB 2GSIB 5FO8A 5BVJB 1P7HL 3B83A 2D03L 4FXGA 1ZA3B 3MMEB 4J7RA 4L4VD 3O2DL 1NJ9A 1T1WB 3MUY1 3CH1B 1FIGL 3BZFB 5TDPA 2JJWA 3RKDD 5F7EL 5JQ6H 1U8LB 4OGYL 3TA3D 1NQBA 5EOQH 4LBEA 2OL3A 3CDCA 1MAKA 3PWUA 1YNLH 1DN0A 3MRJA 1F4HA 2UYLA 3VGEA 1UA6L 3PGFL 1RAMA 1CL7I 4LCYB 4Z0XB 4M3KB 4WIQA 4WY7H 3BPOB 3MRBB 3S5LB 4PY7A 5F7MC 4IOIB 1AP2B 4M93B 1KLUB 1OTUC 5L6YH 2ZUYA 1ED3A 4JCMA 4M6NH 5BQ7A 5F7DA 4EXPX 4EJ1C 3T0VA 3FQRA 2HN7A 5D72L 1R3HB 3R1GL 3QDMB 3VXMB 3SDAA 4DFIA 4S1RH 2AJYL 3AGVA 1QA9A 5EIIA 3EOAA 2VDQH 2EXYC 3RVTC 3SDCD 2Y36H 4RGMB 5HVFB 1XMWA 4IMKA 5I75C 4QEGA 4L8DB 4RQQB 4ZFOA 1EFXD 4CNIA 3HNTL 3E3QC 3QHTC 2JE8A 1BZ7B 4KVCH 1E4WH 3CK0H 3ZDZF 3VMOA 3UDWC 4KQ3H 4OF3A 1G6RH 3T2NH 4D8PB 3TN0B 4JFZL 4YHKH 5HD8C 2IBZY 4GW5A 3TH2T 3W2DH 1I9RL 4LSVL 1ETZA 4OFIA 1S7XA 4V2CB 3TBSB 3I3BA 2SEBB 3SDXA 2V7HB 5B38A 2Z8RA 1RSFA 2EC9T 4PR5B 1FYTE 5D5MB 1BF8A 2XTJE 3TP4A 4YUEL 3W9DB 3HR5A 1A14L 1JHLH 1OT2A 4X83A 1W0VA 4DGIH 4DN3H 5HSFA 2UVEA 2APWA 1QEWA 1YEHH 1KV3A 1F4WL 1CXKA 1BBDL 4NQVA 3MRMA 1MFAL 1FDLL 5ERWB 1ES0B 1T2JA 4GAFB 5A3IC 5LGHH 2GY7B 4OZIE 4PJ5D 3QIBA 3SKNB 4XH2A 1HK6A 1PZ5B 2QQKL 3ESUF 3J7HA 3CFCH 1MCOH 3GUTB 2VLJA 1ND0A 5ANMA 3THML 1E28B 4RGMC 5JXEA 4TSAH 1U95B 3P9LA 4KFZC 5I15L 5DJ8A 1D5BB 2EDRA 1D9KA 4WENB 4S2SA 3VRJB 1N0XL 1LP9F 2JJTA 1URLA 1YPZE 3UJIH 2CDGB 4JO2H 4WFED 4EQ3A 4LLWB 1DLFL 5TGBA 1ZV5A 1DQDH 4LIQE 4Y16C 1KPUA 5F44A 4IMLB 3AROA 1JGEB 1CLOH 1T2XA 3ELAT 2KZWA 3HAEH 3MRPA 3BEWB 3WXVH 3IFLL 4ZS7H 5KSAD 3F5WA 3T3PF 1IKNC 3QXDB 4HKZB 1BZQK 3C6SB 3FOMB 4LU5L 3TYGL 1CU4H 3ULVE 3CFBB 1NUNB 3CZFB 3WL9B 5D1QA 4FG6D 4L5FH 3O4OC 1WTGT 5IHUL 4JFFE 4LCWE 1JZ3A 4A6YL 1T04A 3CVHH 1EEYB 1KB5B 1QUNA 3QEQB 3QNYA 4NQSA 4I5BB 4WI4A 3BYTA 2YD7A 4G9DA 2DQEH 3IJHB 3UTOA 1CD1B 2PO6C 4CN6A 3DUHA 5D7IA 4NZUL 2G5BB 2N4IA 1G84A 4YDJA 4K8RL 3JV4A 2A6JA 5EA0L 1BOGB 1U42A 3MFFB 1EK3A 1D5ZA 5CUSH 5ICYA 4UNVA 1KTLB 3P0VL 1DDHA 2FDBP 2WIIA 3EJYC 1LGVA 4UTBL 1ADQA 4BJLA 4ZUSB 2FJGA 1NFDF 1ZGLP 1IE5A 4KDTC 2GTWA 4R4FH 4DOHE 1DE4A 3MYJA 5K9KA 3H9HA 2JJVA 2DBJA 4HCRL 1CIDA 2KH2B 2FGWL 5IB5B 4P2YA 1QFOA 3E0GA 1JZ5A 1NUFA 1OD7A 4JJ5A 3E8UL 3GSNB 3HE6B 3NFNA 4X4ZA 2WWKO 2GJZB 3L5WB 1K2DA 2ZCKH 3KR3H 4UDUA 4PJ7B 3T0EB 3HE7C 5I8CB 4U1JA 3DMMC 5DRXA 3IDXL 4M9OA 3DVNA 4GLRI 4XAKE 2EYTA 4KK6C 1X5IA 4Y5YB 1OP5H 5ABDE 2M26A 3DX8A 4K94H 3IXAA 3EZ8A 4TSBH 1FZMA 5EBMB 4R6UA 3NACL 4HXAL 1JPST 3T2OA 4NC1C 3MBEA 1K8IB 3GMNA 4MQTB 4EN3D 3ARRA 5KS9B 5J12B 1S8DA 3BPCA 3M17B 2EC9U 4KMTL 1W8OA 3PXJA 3B9AA 4HKXB 4NQDD 1Q9KB 1DFBL 4BH8B 1XGUA 1BFTA 1FH5L 3A6CH 4RA3A 3RPKA 5D8JH 2EDNA 1EEUA 4TQEH 3P0YH 2R9HD 3C6LB 4HUNB 4NNYA 4GAYA 3QQNA 1ZK9A 2C1OB 3O4LB 5CBEB 3WHXA 3RWIB 4RIRB 4G8EB 2EXWC 3DVGB 4EOWH 4X80L 3BSZH 3GNML 1F4XH 2VDPH 3QFJD 4WHTA 1UWXH 2BNQA 4JN1L 1IFHH 3BUTA 1P7KB 3N85L 2ADJA 3REVA 4E42B 4HC1H 4H5SB 2DN7A 1MI5D 1XCTA 3SO5A 1P53A 1N5YL 1HNGA 5E94A 3HE6C 5I1KL 1PYWA 1BVKB 5EULV 5HHXH 3EOYG 1J0ZA 3T0EC 2BSTB 3BKJL 1ZGLB 4NIKB 2CLZB 3UTTD 3EO0B 4P2QE 4Y5YC 5CP3H 2H3NB 5ALBH 1AIFA 4RAVA 3KJ4C 5HYSB 2XZCH 5IB3B 3BXNA 4PJBB 3L7FA 4K9EL 3SDDB 3IDIA 3NFSL 1MLBA 1OCWL 2CLVB 5J12C 2D7NA 3PWPA 3VXRE 1HYSD 3TT3L 2AK1H 3U4EB 1RZ7H 4NCC1 1FVCA 2XPGA 4R7NB 4RZCB 3O3UN 3NGBC 1KXQE 2ED8A 5MEQA 4TTDD 3O8XA 2HT2C 3DO7A 3EFDL 4ZOAA 4GRMB 2EE6A 4YIQA 1Q72L 1NFDE 1ZVSB 2YR3A 2R56H 2XWTB 5GGTL 1S7SB 1NCWH 4OF6A 2BY0A 5GRUH 5F72S 4Q2ZB 3KPMB 1J0YA 2WANA 4OZGF 2NQCA 1BQHA 5D2NB 4Y2DA 1TVBB 3IKCB 5EBWA 5DWUL 3MNWB 2NX5E 4PRHE 4G6KH 2KQMA 1WAAA 3RVXD 3L1OH 3KVQA 3OKKA 2GTZB 4D0BB 2W0KA 3P30H 2BVOB 1IT9H 2VUOA 4ODTH 1F8TH 2Q76A 3RWJB 5DK3A 1N5AB 4EKXA 2DQGL 3T0WA 3CX5K 1IGFL 5C7XL 1U91B 3ARBA 1T89A 4JKMA 5J13B 1KGCE 2QJDA 2VWEE 5GGQH 1AGBB 4ALAL 2GQHA 35C8L 3WSQL 1GOGA 4KJYB 1IEAA 4PGCA 5HDQH 4Z7WB 4NWTL 4R97B 4OF5A 1QYGH 3LQZB 3GDBA 5F8QC 2AEQH 3C2AL 3GMMA 3TNNA 5E08L 4MHHI 4YZFF 4L4TE 3P4MA 3QCUL 1MJ7H 1CLZH 4MJ2A 4WRLA 1RUPL 3EO9H 4U49A 4AG4L 2PR4L 3I02A 2ZSWB 1Q9OB 4N5EC 4TUOB 2CQVA 1EXUA 1IGIL 4ZUVA 5F89B 4HWEH 3OQ3B 4LHUB 1KJ2L 4HEME 4FFVD 5FK9A 1B2WL 4HGKC 3B2UC 4GMSH 5BO1H 1QD0A 3QQ9D 1FNGA 2DYPA 4GBXB 3SQBA 1X5KA 3Q6FA 4JLRA 4R2GB 1QBMH 3SDXE 1J1OL 3L5IA 2CRZA 2VSCA 3GSWB 4ZSOE 1INEL 3B9KB 4GW4A 5ICXB 4LLDB 2EH7L 5SX5K 1MWAB 3C09C 4NHCH 2ZSVB 4PJ8B 1T0NB 3D18B 1G0XA 1AGFB 1D5IH 3GB7A 4DW2H 4P4KD 1YEGH 5B3JF 5MHSD 1ZHLB 1JRHH 2VE6A 1E27B 2WBJA 4R90L 3VFWA 3PP3H 5HXMA 3NZHL 1IM9B 1CGVA 1K6QH 2AQ2A 1SHMA 3SGJC 1QFUL 4G9FD 4EVNA 3K8MA 2G9HB 2OJEB 4X6CB 4R96A 2VLJE 4ZQKA 1MREL 4NQEA 2F19H 4HDIA 5BVPH 3K1DA 4KV5E 2XZZA 1YMMA 1RFDL 3JV5A 1Z9SA 4HPOH 2R1WA 4RMRA 1ODAA 2F15A 2K9UA 5D7KE 1QRNB 4Y8AA 4DVRL 2XY1A 5C0EB 3Q5YA 3ULVL 3GO1L 2GJJA 1TJGH 3C9NA 2VMFA 3EYQD 4FP8L 4J1UA 3SY0A 4OCSH 4PJXA 2DRUA 2H2PD 4V1DA 1WF5A 4H0GA 1QLFB 1TZIB 2A1WL 2JCCF 4H26B 3T4AB 2HG5A 3QUXD 5K9JL 1A7NL 4Y5VC 3G04A 3KYMB 4FXKA 4NGHH 5HDLA 4P57A 3WS3A 1X44A 1A3LL 4JY6B 3OSKA 3NIFE 1FYHB 3V7AG 2Z91B 4NKDA 3H9YA 4ODXB 5EO1B 2VZ1A 4FTVA 5E8DH 5J06A 4AZ8A 1X5AA 3UBXA 5HHME 2C3VA 3I6GB 3EFFA 3V5HB 1T83A 4GRWF 2R2EB 1M7DB 3D25A 1QFPA 3QDJD 3HZKA 1IL1A 5F7FA 3QWRA 4YHNB 4PRPB 2HA1A 4WI7A 1WCQA 3QNZB 5ISZB 2FGZA 5JORB 1A6WH 4XBPB 2W92A 3DETD 4OGXH 4G6AC 3H3BC 5I66A 1U8MB 1DQLH 5E6IB 2HH0L 4PTTA 1VEOA 2CLRA 4PJIB 4X5WA 4HS8H 1RHHB 3V5KA 4JFDE 5D2LF 4H1LB 1DQQB 2HKHL 3X3FL 3BT2L 1NBVL 1GSMA 4UINH 5GSVA 5GS0D 1Q9LB 1U93A 1W72A 1AH1A 3HMWH 4JQXC 1U92A 3QUYA 4FFYH 4F7TB 1AO7B 4JG0H 3F7VB 5CHNA 3MLUL 3L95A 3KPLA 4RWHA 3H3PH 4NQCA 5F8RC 4J3WA 4ERSH 3T8XA 5KSUB 3AMKA 5ADOH 5B3JE 4U6XB 5H37G 4U7MA 3BP6A 3MC0A 3FQXB 4OD1L 4HWZB 4Z8FL 4X7EC 2L7JA 1A1NA 3MGTB 1XFPA 5GGRA 1RJZB 1FFOA 1F6AB 4LSTH 1QTYT 1INQB 5CEYB 2DD8L 3MRHA 2LU3A 1TJHH 3MUZ1 1PVHA 2RQ8A 2MNUA 3UPCA 2IFGA 1P4BH 1U36A 5F9OH 6CGTA 3IJYA 4HBQA 2D2OA 3NCYS 5D7JB 1NAML 5FAAA 2VLKB 5F7HA 3S96A 2YZ8A 1RU9H 2GAZB 3EYOB 2CDFB 3K4AA 3IRPX 5EUKA 5F9JB 3KJ6H 4S0SD 1K3ZA 4UT7H 2IAMC 2FWOA 2VL4A 1X5HA 3OV6A 2GEEA 3PF2A 4YE4H 2R4RH 4MDIA 3FONB 4W81A 2V5TA 2I26N 3MCLH 4KC3B 1FO0L 3GSNL 5AUMB 1IC5L 1DQJA 1R0AL 4JFQA 1P7QB 2P8MA 3DUUB 3RZCA 3LRGA 3KLDA 4P3WA 4OZFA 5E56A 2XA8L 4R3SB 3E6HA 3PIQB 4K2UH 5LGJA 4L8CA 1FYTD 3ZHDA 3HC0B 2XTJD 6FABH 3BMWA 3D39B 4HPYH 3LIZH 4HIIB 3WNOA 4XNMB 3GI8L 4HWBH 1GHFH 4LKCB 5D7SL 2JIXB 3REWB 5EBLB 4F33A 4P2RE 5AAWA 2E7CA 2YN3A 2AQ1A 4JPKL 3AFLA 3FQUB 4QHNB 4HIJB 4H88H 1J1PH 4KHXL 4MJ5B 2Y7QA 4HFWB 3FB8B 1LK2A 3WDIA 4B0MM 3B6SA 1H3XA 4N8VA 1IVLA 5DHYA 3BDYH 2R2BB 2B1HH 2Y5EA 3KHQA 4BFEA 5JLZA 2QSQA 3OKMA 4QRQB 3EKCA 2KKQA 1CFTB 5J0BA 5T3XL 2GT9A 5HGDA 4JM2B 4QHUA 5ICZA 3JV6A 5ALCH 5JHLL 1EEZA 2VLLB 5IOPA 4R8WL 3S6CA 3G6JE 5DJDA 1GGIL 4PJHA 3H9ZA 3RTQB 4P0DA 1ZXQA 3PL6A 3QZWB 4IRZL 3V6BR 5JUEH 3FQNA 1WV7T 5JDJA 4P46D 3SGEH 1DVFB 4Y4HC 3LDBC 5ACLA 4NKOA 3VFMA 5L2KB 4FZ8L 4MAYB 1S7VB 1WAAE 2HWZH 4ELKA 3BP5A 5SWZA 1ZMYA 3AY4A 2P24A 3RU8H 1S7UA 3EAKA 1G1CA 4F37F 4HIXL 4MD5A 2FNBA 3X11A 3OKOA 3RWEB 1XZ0B 1QBBA 1LMKA 1YUHB 5EU4A 1RZFH 1YEDB 1BD2B 4XVSH 3MV9A 5ESVA 3EGSA 2WP3O 4L1DA 1QVOA 3NCMA 4O2FA 2IF7A 4GXVL 4HGMA 4HF5H 4GMTL 2OSLB 5A43C 5EOTB 1MUJA 5FA3B 4YNYA 2IQAB 4P5TB 1NEZB 4U6HA 1OM3L 4HD9A 2N7BA 4YX2L 4JFFD 1G7IB 4LCWD 2BY1A 3OKLA 4F15C 1C8PA 1CGXA 4LQ1A 4ZOCA 4YXLL 2I60L 2BC4A 1FVEB 1F3DH 4MA3B 1IAOA 1N59B 1WFNA 4JANB 4NKIL 1ZANH 4NO5A 4NN5C 1GAFL 4M7JL 3ZKQD 4KWUA 1GZPB 5DSCA 4Z78B 3O11A 4S1DC 4OF8A 3HFML 1MY7A 3RTQC 2E9IA 1I4FA 1DSFL 5MERA 3VJ6B 2DTMH 1N7MH 2IANA 2NZIA 4AL8L 2ARJA 4JFYB 1JF6A 3IU3B 5BCAA 1OHQA 1DVFC 4KK8C 1LO0L 1IEBA 5ADPL 1JRHI 4ORGB 4XBEH 1S7QA 5C3LD 1I3GH 2AEWA 3LEVH 3OXSA 4BSVB 1B4RA 2WWMD 3G6DH 5FUZH 3MA7B 1T0PB 1HHJA 4OQTH 2ERJC 3V6OC 3KDMA 5KVEL 4RX4A 5FYJL 3F7YB 3QBTB 1U8IA 3T09A 3EDJA 5CBAB 2VN4A 4HIHB 3QUKB 2XY2A 2GSIA 1T5WB 2IBZX 3CFDB 1JZ4A 4KI1A 5FGBC 1FVDA 1RVFH 4XAKD 2X4UB 1ZA3A 1CVRA 1WBZA 2V9RA 4JR9L 1MFDH 4NO0B 4HH9B 2H8PA 3OJDA 1JPFB 4BA8A 1YMME 4PIRF 4TUJA 2YD1A 3BO8A 4J6RL 4EI6A 1AJ7H 4YJZL 1WZ1H 3JUYA 1G6RB 4NZRL 4UV7H 4Z0XA 2CRIA 4I3SL 4M48H 4NKQB 5F1IA 3KPNB 3S5LA 3L9RB 4ODBD 4OBRA 4YEFA 4IOIA 1EMTH 2MQ0A 4XXDA 5KSBF 5IQ9B 2XRAH 3JWOL 4G43A 5JW4N 5DVOA 2F9BT 3ULUE 2APFA 3VXMA 3QDMA 2A9MH 2Q7YA 4JAMA 4XNYL 1P4LA 3SKJH 5IB2B 4LSRL 4NNXA 3CUPB 4NN7B 2J5LB 5TH2A 4W4OA 5AZ2L 3RWGA 4TSCL 3PUCA 1J5OH 1D5XB 8CGTA 4FTVE 1INDL 3QWOA 4WUKL 4CVZB 5TJWK 5IB4B 3ET9F 4ZG1A 3QDGB 3VXOA 4P2QD 5J3HD 1JNLH 5GS1B 4XVUC 5GPRA 3C87A 4BQ9A 1UB6A 3NCFB 2UUDH 3QRFM 3TBSA 4YXHH 4XMLH 5DURD 2PXYD 5K9QI 3VXRD 5C0GA 3ARGB 4Y16A 4OI7A 3VFOA 3ALWA 1CG9B 5BZWA 1YJDC 2DQUH 3P4NA 4NRZB 3FT3A 5DK0B 5FOBB 4UB0H 5IESL 4LVHB 4R26L 3LZFL 4KPHL 5CEZH 4OZHF 3R8BB 2V2XB 3RGVD 4HEPG 3VCLA 4NBYB 1CFQA 4FFZL 4PJEF 4XP9L 1AXTL 3S34H 3TPUB 1ES0A 4KKLD 1CFVL 4MX7B 4BK5A 1AFVH 4J3XA 4CVUA 3CPLA 3HAEB 2GJ6A 1PZ5A 5EN2B 1J1XH 3MRKA 3TV3H 4NSKA 4OV5B 2J5LC 2X6MA 4QRPE 1RZ8A 4NT6A 1JGVH 2PO6A 4I77H 1U95A 1YNTB 2G60L 4R0LC 1U8PA 3CCHB 2NX5D 4PRHD 4RFOL 1EA9C 1MRDL 3BKCL 4RFEB 3CFJA 2DM7A 4WCYH 2W9LA 4KMLB 1N8ZA 4YDKL 5T5NG 1RUQL 1A0QH 3TWCL 3CC5A 3ZKMD 1BAFL 1NFKA 1KGCD 1R3IL 1MEXH 3IJSB 5KVFL 3AUVA 5DMIH 2WINA 1MQKL 2FX8L 4KDTA 5L7XH 1Q94B 4GRLC 4JCLA 1JGEA 5HTSA 2RB8A 4MSWA 1Z2KA 1JFQL 2X1WL 4L4TD 5GHWH 1M7XA 5I74C 1CBVH 1CXHA 1X6NA 3QXDA 4RAUA 1CR9H 2D7QA 4D9LH 1SJXA 3ECBB 3MLYH 2ZOKB 5IBTL 3RBSA 4K3EL 2W9EL 3DX7A 2CO6B 3HE7A 3CZFA 5KSBE 2RIKA 3DMMA 2MCPL 5T33L 1VHPA 4KY1H 8FABA 4JFOA 4LLYA 4AH2B 2FECI 3JWDC 4U05A 1GH7A 2H9GB 4UOW0 2PUQT 2K7QA 3NFPA 3CFEB 3MUGB 4GW1B 4KRPB 3ORJA 1QPXA 3M8OL 4JGJA 1J8HA 3QPXH 4UOW1 4DEPB 1JK8A 1U58B 1ZOXA 1KJ3L 3GIZL 4QRSA 1XR9B 5I16B 3BPNC 2FEEI 2AP2A 1LO2L 1KIRB 3G5VA 4QCIB 1GC1H 3RX8A 5ID1B 1KTRL 4ODHH 2KDGA 5LXGH 4MDJB 2XYCA 5BS0E 1KTLA 2LU4A 4I0PB 3OMZA 2YPKA 3CSYB 4PG9A 2VXUH 3ROOA 1ZLSH 4IDJL 5FF6B 5DFVD 1JUFA 4ZAKB 4HUVB 4RMSA 4ZUSA 5DHVH 3QEHB 1KLFA 5JMRA 1CZ8L 5MP6L 3VXUB 1FHGA 1Q9WA 4ZD3L 3MV11 1R24A 3KLHC 4JHZA 3SGEI 1S9YB 3UMTA 1N64L 1OLZA 4LSQH 4Y5XB 1SJHB 4PJEE 5HBBA 3P4OB 1D9KD 2DQIH 4YDVA 1ZS8B 2YA2A 3T0EA 4N0UE 1S5HB 3RIAF 4Z7VB 1KIQB 5FUCE 3GIVB 1Q0XH 4GKZA 5D7KD 1RZGA 4WHYH 3RKDC 2J8UA 3BD3A 5DRNA 4UU9A 4U1IB 1JHKL 5EZOH 1A1MA 1HQRB 3CFKA 4XPAL 4DEPC 5SWZE 2BSRB 3UTQA 3F7PC 4U1SB 3WIFB 3D3VA 1IQDB 2FO1A 1A3RH 2AK4A 4A2LA 1KLGB 3DXAA 4Q7DA 1UZ8A 3NA4A 5EUOB 1OP3H 3X14B 2Q1EA 3MV9E 4K94C 2YA1A 5JXAL 4I0PC 3GSOA 1KTDA 1C5BH 5CBEA 2FHFA 3O6FB 3RWIA 3Q3GB 2IPKB 1QLRB 4ZAKC 1MCWW 2KL6A 4GKOA 5HPMA 3HRPA 1G7MA 3DBXB 3LY6A 4OQ1A 5GIRB 5HHMD 4KKBC 4NP4H 3ZDXF 2DF3A 3KPRE 4G6FB 7FABH 2BNUA 4B53A 3RL2B 1TPXC 1NPUA 2W65A 2JB5L 3MA9H 4M1DL 4TN9A 5D5MF 4XP4H 4Y5XC 5BMFH 3U0WL 2J4WH 3DNKA 1QSVA 1BVKA 1DBJH 2FEDD 3SCMB 1LE5A 1A2YB 4NUGL 3MOBL 1IMHC 1F11B 2CLZA 5E2JA 1K9TA 1U3JA 4JFDD 5HYSA 4DQOL 4LL9A 3VI4E 1KCRH 2EDXA 2NXZB 4U3HA 1FNAA 5SV4A 4XRCA 3TCXA 3VDBA 3PWVB 4MQXD 5C3TA 4PLJD 5FO9B 1IAKA 1HH9A 1VGEH 2V2WA 1FN4A 4ZFGH 1UGNA 1QLEH 2Y25A 3W81A 3WD5L 5FUOH 2VXTH 4WW1B 5CIPA 5A2IH 4MJ4A 2IPUG 4P9HL 3WFCL 1QNZL 2X42A 2NY6D 2J88L 4XWOD 5C0DA 2YKLH 1A1OA 1J0JA 4JRXB 1DTUA 2I07B 2BDNH 5K9OB 4GRMA 1U0QA 2MKWA 1HKFA 5E4EB 1BOYA 3U9PH 1CGSH 1ZHNB 1FNFA 2XKUA 2G2RA 3GRWL 4Q2ZA 3OXRA 4CVWA 2HTKD 3HZYA 1KN4H 3HC4L 2XG5A 4ZUTB 4I2XB 2W1NA 1XF3B 3BIKA 5KVMC 4EUPG 5BV7H 2WM0A 3CSPA 2ZUXA 4D0BA 4WTWA 4FQ2H 3HI5H 1ZSDA 2ADFL 3DX9B 1XF1A 1CFNB 1N5AA 4BSWA 2C1PB 3PHSA 1MFNA 1MHHA 5HI3C 4ZPVB 5EU3A 2IQ9L 3VXME 1V7ML 3QDME 1I9EA 3SGJA 1DR9A 2VNCA 4TRPH 3DROB 5T1KD 3V6ZA 1AGEB 5KSAC 1EO8L 2EIZB 3RFZC 5IT2H 1H8OA 4ZS6D 4XPGL 5IVXA 4FQCL 3LB6D 2J1KA 4FG6C 3CAFA 3QG7H 3FL7A 4Z77B 1MAJA 2AABL 1UXSB 5F89A 2FBJL 5E4EC 4KK5D 1YNKL 4XTRD 4O5LL 1TTGA 4MMXC 3MLZL 4AMKL 1SBSL 1RI8A 5KSVA 2XN9A 1OAKH 1MHPH 5CLTA 4QY8B 4OI9A 4X7TB 3V8OA 2IFFL 4G7VH 4WFFD 4P2RD 3AM8C 4AIOA 1G7PB 2FX7L 5ICXA 1MVFA 3MZTA 1J0HA 5D1ZD 1JZ6A 1FZOA 4HLZG 4E9LA 4Y5VA 3T77A 3H7LA 4PV8A 3UZVB 2ITCB 3Q2CA 1JVKA 2ZSVA 5DMKB 3SKOA 3PQYA 4LPWA 4XVJH 2NY2D 3EHBD 1IGYB 3G5XB 4PJ7F 3O8XD 1CDYA 5BZDB 5E99H 43CAB 5EG6C 5K59E 1PX3A 2APTA 1JHLL 4ZXBB 4DCQB 5JW3L 4U1LA 4K07A 4ZOBA 3LEYH 4WEUD 4WNQA 3MRLB 2DQCL 1GPOL 5D6CB 4OKDA 4GO6B 4FQXC 4RAHA 4RNRA 3P0GB 2FSEB 5KS9F 4QLRA 5HVHB 2VLME 1PW3A 5HHOA 1NBZB 1BLNB 1I7TA 1H5BC 1MCKA 4FQ1H 1T66C 1JV5B 1UADC 1U3HB 1NC2B 1I8KB 1KB9K 3MRRB 4Z18A 1MFCH 2YUZA 3NCJL 2QSTA 2NY3D 4EN3C 1VFAB 5DLMH 1RUKL 4KJWD 5SX4H 2CIIB 3BZ4B 4NBXB 2AI0H 4JQXA 5IKCB 3RDTC 3JXAA 4JVUA 2R4SL 2R9HC 3IDYB 3GBMH 2R0LL 2FJHB 1VB9A 3TVMB 4ORZC 4ZUUB 5M7QA 4JY6A 1PQZA 2D9CA 3O2VL 4JKPH 3LHPL 4PRAB 5F7LB 4UT6H 4G5ZH 4ODXA 3WIHH 4ZXBC 2BMKA 2LAAA 1BVLB 1RULH 3P40A 4XCEA 2AV7A 3EJZD 4PJBF 1X4ZA 3QEQE 4JFEB 4R7DA 5JIPA 1G7JA 1MCFA 5FKAA 1Z9MA 1BZ9A 5EOCH 3QEGL 3QQ3B 4PRPA 5E9DB 5IMLA 1IILE 3HC3H 5C0NC 4ONFL 1Y6NR 1JGUL 3FN0L 5JOFA 1JCKA 3F58L 1I3VA 1AXIB 1XR8B 3BEVA 4WO4B 4YGVA 4YHLL 3DTXB 2PW2A 3KYKH 1PFCA 3PHOB 4H1LA 4X7SH 5E03A 4KUZH 4LFHD 4QF1B 4HJGB 5I1AB 3QUMA 3H3KA 1HYSC 1A6AB 3UPRB 2CGRH 4MNQA 3TIDB 2IAMA 1A7QL 4OLXL 1PSKH 1IQWL 4O2EA 2FHCA 4CDHA 1NEUA 5JPNA 3FB6B 3OAZK 3RHWF 4Z7QE 5F1SA 5LQBH 2K1MA 1CDCA 4OAWA 4TTDC 2IPUK 3VXTA 1QKZH 3PGCB 3QNXA 5KSUA 1LO5A 1Y6KR 2V7NB 4DGVL 4PJ7E 3T0EE 1YMMD 5KN5B 4HK0B 3QB7C 3FQXA 3MOAH 2J8UE 1GGBH 3GMPA 1TQCB 4X9HA 5I6XC 3ZT7A 4KI5C 1XGQA 5FYKE 1RJZA 4M9PA 1RK1B 4I1NB 4QRTB 3BW9A 4X4XA 4Z7WF 4Y89A 3D3VE 1INQA 2OP4H 5I1IH 2XWJA 4LFHG 3RVXC 3QUZB 2VSDA 3DXAE 5CJOL 2DDQH 3FO1A 4NJ9H 1OF2A 4UIMB 3ULUD 5D6DC 1XGRB 5T3ZH 5E2TH 3O9WA 5I1JH 5I1EL 1RIHL 5SX5H 5KVDH 3P9WB 4FRWA 2CRMA 1BQUA 4PRBB 3RI5K 2GAZA 3WLBA 5IR1B 1ZTXL 2CDFA 2GIYA 4S1SL 4M7LH 5DUBA 4OLYH 1A5FL 5DC9B 1R5VB 3P77B 3FOLB 5I8KH 1S9WB 3MV8D 2QQLH 3I50H 5C07B 3MJ9H 3W11D 4LLUB 4OKVA 1SY6L 2M8XA 5HYJB 5AYUL 1MJ8L 4GRWH 5F7KC 3KS0J 3GKWH 4Y4HA 4LEXL 3DUUA 1GGTA 2X4RA 2XIDA 4XWGH 1KELH 1TJIH 5B8CA 4P49A 2FX9H 1ROWA 1NC4A 3O3BB 3DECA 3PE9A 1FFNA 3PIQA 4FFVC 4R3SA 3VXSD 5FHBL 3MO1A 3QQ9C 1QZ1A 1RZKH 5GJTH 2ZP0T 2LAGB 3B5GA 4M8VA 4GG8B 4PREB 4MD4A 4F2MB 3HUJB 3T1WA 5F7WC 4HG4J 3DI3B 3OAYK 4RCAA 2M1KA 5IF0B 5I30H 1KOAA 3QUZC 2YWYA 1NGZB 4X6CF 3HHRB 4MJ5A 2BOCB 4HFWA 3FB8A 3QIWD 4XPBH 3VXQB 3UBXG 4HWUA 1A9EA 4X5XA 2YC1B 4H8WC 1J0IA 2R23B 3WYRA 3ISWA 4QRQA 1S3KH 1MJJA 2FYYA 1DN2A 4NZTH 4QRPD 1CFTA 1I1AB 1U8NA 3G5ZB 1KYOK 4PRDB 4Y4FC 2XNAB 2Y9RT 3OKYA 2Y07L 1NDGB 4ZO8A 1UWEH 4AJ0A 3FO0L 1B4JH 1XH3A 4ZPTA 2OJZH 3WHE0 4F8QA 3UXFA 4POUB 1UURA 3RTQA 4O2CA 4YPGB 1VEPA 2R2CA 1IGJB 2Y5TB 1Z5LB 3RL1B 1YYML 5D2NE 5F7UA 5HGBB 5H8DA 4UT9L 1ZA6A 5TQ2H 3U7YH 4TVSa 3S37L 3W0WA 3QEUB 1XIWB 2IADA 2KPNA 3EYQC 1FL6B 1KC5L 2D03H 2Q20A 3ZT6A 1FAIH 2X4SA 1OD9A 3MTRA 2H2PC 2VDRL 3PJSB 1FIGH 4N0RA 3F62A 4OGYH 1BD2A 4Q74A 5D9SB 4N1HB 5DFWH 4E41B 1YA5A 3B4NA 1KCKA 1A6UL 2VABB 3P30L 5M94B 2VR9A 2GCYB 1IT9L 3IDMA 1BQLL 2ADGA 2G5RA 3P11L 2OSLA 5FA3A 1UA6H 3PGFH 1NEZA 1MRFL 5FGBA 2DQHH 4O51A 1G7IA 3OR7A 5CMAB 3WE6B 3P9MA 4JE4B 5C0BB 4GG6B 5F1OB 3IDGB 2PTTA 4HHAA 4JANA 3JBG7 3CXDL 3VDAA 1Z9LA 2ZUWA 5D72H 3R1GH 2GK0B 1CDUA 2AJYH 1FC1A 1J8KA 2XN9E 4EZMA 5E8NA 4QGTA 3TGXA 2BRRL 3VJ6A 5BS0D 1KCUL 4XNQA 5J6HB 3K74B 4LLVB 4JFYA 4ZODA 4UUJA 3GSUB 3DETC 1TCMA 1U8OA 3WIIL 4UV4L 3L3IA 3HNTH 1QG3A 1R5IB 3QFDB 5EWIL 4LRNL 4Z76A 1QBLL 2EIEA 5DD6B 4X9FA 1C5DB 2VZUA 4PTUB 4P5KA 2CJUL 4JFZH 1OARL 3NCBB 2YOCA 1F4AA 3D85A 3SQOL 1HSAB 1HI6B 3N1GC 5GS0C 4OFYA 3RWDB 3SKMB 5INCB 3TO4B 1I9RH 3DARA 4LSVH 1JYXA 3F7YA 1VACA 3U6RB 4FZEL 1UXWA 2OZ4L 5KOVC 1P1ZB 1FFQA 4ETQB 1MELA 5CGYC 3GBNL 4HIHA 5IVZB 3O41B 4OV6F 5HY9A 3PL6D 1YEGL 4YUEH 1A14H 2ZCLH 1UJTA 5HHOE 3LVEA 5KBNC 5GSRB 3MLRL 1X4YA 2V5MA 3SJVB 2NY0B 1OTSC 3BH9B 1ZHBA 3HLAB 1F4WH 1BBDH 5SX4I 3KXFA 1MFAH 5SWZD 2OLDA 4C56A 1QO3B 2ESVB 1FDLH 4LSDA 2CSPA 2NTFA 2BERA 3WO4C 2NYYD 2A2QT 2F19L 3CLEL 4N8VG 1X7QB 1PEZA 4L3CB 2QQKH 3MROB 1WFUA 4U6YB 5DO2D 2F54B 2E9BA 3FFCA 2NW3A 3THMH 3MV9D 5EU6B 4NRXB 3UYRL 3VH8B 3A0OA 1FCCA 4O00A 1FL5A 4FA8A 5I15H 1UCBL 3D0VA 5EO9B 2GITA 1X9QA 2UWEB 1JPGB 2VQUA 1N0XH 1HIML 2HKFH 5J6GB 3E6FA 3KPRD 5DQDL 2JJUA 3RPIB 1NMCB 4NM4L 1UVQA 1CXIA 1MY5A 3K46A 5I1CL 4M7KL 4HK3N 1MH5A 4IRJB 1KTKE 4R0LA 5DGRA 1DLFH 4JGUA 3KLAA 2X9YA 4HUXB 1KEGL 3T2PA 1QSFB 3R8QA 4TVPH 3IFLH 3CDGB 4KU1A 3TO2B 4HS6A 3WNKA 2XWBA 4PRPE 2P8PB 4CJ0A 2NY0C 4LU5H 5I1LB 5IG7B 3TYGH 1TMCB 1VFOA 3VXNA 5KG9B 5IUSA 3VWKD 2XFXB 5D1XD 4XHQA 4PJIE 4GRLA 5IHUH 4O58L 4IEFB 4N0FA 1EFQA 3ARXA 2UVFA 4A6YH 4FNLL 3IF1A 4HJJL 4JM2F 4PJAA 5FHAL 2EXYD 1SEBB 3RVTD 3RX7A 5IVNA 2X9XA 2WQRA 3I3DA 4RRPA 5I0ZA 2QHRL 3D87B 1A4KA 1MQ8A 4MNQE 1UC6A 4JPIA 4JZJC 1UQSA 5FYKL 4NZUH 1FL3A 5JHDA 4OIIL 4MJ6A 4K8RH 1S9VB 1ZHKB 3EOTL 4MX7A 5EA0H 1RJLA 1SYVA 2ZUUA 4WJ5B 4JG1L 3G5YB 5ESQA 4Q0XL 5EN2A 4QHLB 3P0VH 5EIQA 5DEFA 1NMCC 5C09B 1QSEA 3PWJB 4Y4KB 1F58L 4LF3A 5FYLL 4Z7UF 1YNTA 4CUCA 2HRLA 5DD1L 4JRYB 3MV7B 4JB9L 4HCRH 1XT5A 4IM8A 3CVHA 2FGWH 3R0NA 4KK9D 3CJJA 3U9UA 1R6VA 3BJLA 5B22A 3E2HC 4MNGA 5CLWA 4MJIB 1HHGB 4WW2F 4HSQA 2P47B 1I1YB 4JJHA 4M1CD 1V05A 2Q7NA 3VXMD 3QDMD 1NUDA 4IS6B 3IDXH 4WHDA 5C92A 1Q94A 2VLKE 1IARB 1U6AL 4D0CA 1OB1A 3MNZA 2AGJL 1RK0A 3NACH 4RMWA 4F7CA 4HXAH 3C60A 5FV1L 4LPUA 2ZOKA 4KMTH 1K4DA 7CGTA 3VFUB 2O5ZL 1FZJB 4L4VA 3TN0D 1FH5H 4LCUA 3UAJD 5F7YC 3U83A 1CXFA 4XAWL 1I8MB 2DJSA 3TA3A 1QPPA 2BHUA 3LRSA 3S5LG 1I1FB 2BCKB 2QV2A 3B5TA 4Z95L 1CDGA 3QULA 4Y4KC 5C8JB 3OX8A 1PDKA 3QI9B 1XR9A 5CGMA 4X80H 4MCZA 3GNMH 3KYOB 2F5AL 4S1QL 3D39E 4JN1H 5LAXB 4CGTA 1LP9B 3N85H 4WI6A 1JYNA 3ZE0E 4KXZH 5ELIA 3DIFA 1N5YH 3ARFB 2X4QA 5HHNB 5I1KH 1MSPA 4JY5L 1HILB 4DJMA 1HHIB 3F8UB 2EDHA 3UZEA 4M7LT 3RJDA 3BKJH 4PV9B 3I84A 1KN2L 4ONHB 3U4BL 2BRQA 1GC1C 1UH4A 3CSGA 3SDCA 4PJFB 3U82B 3LN4A 1CFSA 3WCYA 5A1AA 1EFXA 2VLMD 4G8GB 4K9EH 4PJ9C 1UZ6E 3NFSH 2LABA 2Q6WB 5IHBA 1OCWH 3BZEA 4Y5XA 5HYFA 2FH6A 1MF2L 3WDJA 3GEWB 4YWGL 1ZS8A 1D6EB 3TT3H 5CP7B 3QH3A 1AGCA 2VH5L 3LRHA 5I8OL 1RZIA 1OWRM 5ALCL 2HT3C 1S78D 3H8NA 1YC7A 1EUUA 1XEDA 4L1HA 4NUJB 4PUBL 2D3VA 3KNBA 5L2KE 3AREB 5DDHA 3SE4C 1HQRA 5JNYA 2H1PL 4WUUB 3W0WE 5AG8A 3EFDH 5C2UB 3L3HB 1Q72H 4W70A 1EAPB 4PJGB 3C8KA 1QQDA 5GGTH 3V6OE 4X8JB 3OJMB 5GGUA 2VERN 5CP3A 1QP1A 5EUOA 1CT8A 1BD2E 2EDDA 1NKOA 1H0DA 3G08B 4GAJH 4KROB 3EW3B 5DWUH 1JZ8A 5IK3B 1YEEL 4PJ5A 2L4OA 2WK2A 1QLRA 4U1HB 3N1PC 3ZKXC 1RZFL 1V3KA 4KK6D 1AD9B 3QEQD 5FO7B 3ZE1E 4IDLA 2DQGH 1Y18A 5IEKA 1IGFH 2QADB 5C7XH 5FM5O 1NCDL 4AT6A 5KVGL 4P99A 1HQ4A 1FV1A 4JZNB 4OUUB 2YD5A 2Z93B 1OGAB 35C8H 5DJ2A 3WSQH 2LV4A 3BISA 4NWTH 2AJ3B 3C8DA 3C2AH 2MPAL 5E08H 4LVOB 3FB7B 3WFZA 3QCUH 4N5UA 1ZAGA 1RUPH 2PR4H 3QDAA 5EZLB 1J7VR 5J9PB 1HN1A 2A77L 3RUGA 3B2VL 1BBJA 5DJ0B 5TFSL 1W0WA 5DJZA 3VFSA 1KJ2H 5BV7B 4ONOA 2VC2L 4HV8A 1Y0LA 3RGVC 1B2WH 4XC1L 2NXYB 1UH2A 5KSAA 1HXYB 3BWAB 3IFNL 3V52L 3A6BH 4JQIL 2DQJL 1EVUA 3HE6D 3WLWD 2DQFA 1G9NC 1J1OH