1CS6A

N-terminal fragment of axonin-1 from chicken
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
382
structure length
382
Chain Sequence
RSYGPVFEEQPAHTLFPEGSAEEKVTLTCRARANPPATYRWKMNGTELKMGPDSRYRLVAGDLVISNPVKAKDAGSYQCVATNARGTVVSREASLRFGFLQEFSAEERDPVKITEGWGVMFTCSPPPHYPALSYRWLLNEFPNFIPADGRRFVSQTTGNLYIAKTEASDLGNYSCFATSHIDFITKSVFSKFSQLSLAAEDARQYAPSIKAKFPADTYALTGQMVTLECFAFGNPVPQIKWRKLDGSQTSKWLSSEPLLHIQNVDFEDEGTYECEAENIKGRDTYQGRIIIHAQPDWLDVITDTEADIGSDLRWSCVASGKPRPAVRWLRDGQPLASQNRIEVSGGELRFSKLVLEDSGMYQCVAENKHGTVYASAELTVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the ligand binding module of axonin-1/TAG-1 suggests a zipper mechanism for neural cell adhesion.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
molecule keywords AXONIN-1
total genus 80
structure length 382
sequence length 382
ec nomenclature
pdb deposition date 1999-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cs6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cs6A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cs6A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cs6A02
1CDCA 1MCRA 4V1DE 3WNPA 1IC7L 1XGRA 4YX2L 2Z92A 1H0DA 3B4NA 3QIWA 3CFIC 4G6FD 1MQKH 5ISZE 3BPLB 2WK2A 2V2TB 1RULH 3RWHA 1U3HA 5L9DL 1ZGLA 4HIHA 1WEJH 4X6EB 5BO1H 5DMIL 5JDSB 2FIKB 4PIRF 1RZFL 4Z7QE 1JZ8A 2XIDA 5F3HB 3C5ZC 4ISVA 1FZKA 4UNVA 4PJXF 4WV1C 3EYVB 3IU3A 4L8CB 4MCZB 4PJEE 3WIIL 1CTNA 5JOFA 4S1DC 3OXRA 2VQUA 4GRWE 1EO7A 3VFSB 3QNXB 3FB8A 3WDIA 1FNGB 1MWAA 2V7HB 2L7UA 2NZ9C 2WUCL 3LN5B 3BUYA 3QDJB 4P48A 1BZ9A 2FHFA 3LPFA 1VEOA 5ICYA 1OW0A 2KUTA 4XNMA 4LQFH 1J1OL 3PUCA 2A73B 3B5GA 4WNQB 2HFTA 4HCRL 1I3VA 4PY7B 1BX2A 3HC4L 2I5YL 5DVNA 1NUFA 4DEPC 5D7JB 1WBZB 5IJKA 2IH3B 5E2WL 2Q8AL 3FONB 4ZXBA 2HFEA 2VWEC 1FHGA 4ZSOA 1A9BA 2EH8H 3MJ6A 2HRPL 5CSBA 4HJ0C 1DUYA 3NN8B 3KLAA 4F9LA 5D1QA 2C3VB 4YHOH 2VOTA 2IQ9H 2GCYA 4P23C 4YDIH 3U36A 4RMVA 4ZAKB 2E7MA 2YPVH 2GUOA 2K7QA 2WWMD 2J6EA 1YMME 1XF4A 2DQTH 4GQPH 1GHFL 1KFAL 1R5VA 5GGTA 3NA9H 2J5LC 4I48B 3PWUA 2N56A 4JFDA 5H2BA 3P11H 1KNOA 3A6BH 4PJ9A 2WM0A 1UCBL 1AC6A 4IMKA 4KKAD 4F9PC 2DYPD 5F97E 4HJGA 1AO7A 2YPLE 4XP6L 3RVTC 1Q72H 3D85A 4PBVC 5D8JH 1MLBB 3AVEA 4RGNC 4EN3D 5L8KB 2OL3L 3IDGB 1CFQA 1OD9A 2Y72A 4FFVC 1IZKA 4OCYL 2DLGA 3IDUA 1MI5A 2DL2A 3NOIA 3MRRA 4YJZL 4EI5B 2D9CA 1UEYA 4CNIA 1RIVL 5LAXA 1N59B 4NZRL 4WTWA 4P2CG 2VXSH 1RZFH 2NY4B 4M00A 2OX5A 1H8SA 3JV5A 3IDJA 1FH5H 3DROB 4RAHA 1A7PH 4JDVA 4PRID 2O5YH 5FM5O 5HPOA 3C09B 1AR2A 5DRXA 3L3JA 1SQ2N 4G6JL 1DBML 4AH2B 2FJGA 5AZEL 2B5IC 1IBGL 1WZ1H 1PD6A 4N1EA 2DM3A 4S1QH 1UQSB 4PJCF 3RVUC 2PYEA 4KUCF 2BNRB 1MJ7H 4X6CE 5IVXB 4PJ9D 5D1XA 2VLLB 2A6DA 3HUJA 4GO6B 4MJ4A 2IC2A 3BZEB 3BVNB 5JHDB 1KJ3L 4JZJB 1MAMH 3RWCA 3VXOB 5IMMB 2VMFA 4BFBD 1HOCB 2EYRA 3ALXA 1A7OH 1P6FA 2J8UE 4OZHE 4YUEH 3C5SA 4EEEA 1NGZB 5I2IB 4RZCB 5IW6B 1BECA 3IJHA 1PX4A 3BKYL 4KAQH 5I8KL 3EJYC 1D9KB 3WCYA 5D1ZA 2OK0H 5GSRB 4NUGH 1FZOB 3P4NA 1MFBH 5DGQA 5T5FH 3B9KA 3B9DA 3THMH 3Q1SH 5DJ0A 3VFTA 3GMNB 5E6IC 4FZ8H 1VEMA 4K3DL 4ZXBC 4QHUA 3WKMH 4X7FC 4W6XB 4HHAA 5H35A 1TQCC 4PB9L 1DVFD 3HLAA 5DUPL 1IKNA 1IC4H 3B8SA 5JHLL 3MXWH 3DURA 3RWEB 4JDZA 4BFIA 3O3EA 2V17L 4ERSL 5D1XC 3SGKC 3RKPA 3KYAA 2I9LA 3MYJB 3OX8B 3QHZL 2VXSL 3WJLA 1G6RH 3PQYD 2ITDB 3M1BB 3BRDA 3WUWG 1T7ZA 2VKXA 5AZ2H 1KCKA 1P4BL 2WWKT 4XHJD 1X5KA 3SO3B 1A4KB 2IBZY 4F7EA 4WFGD 1EJ6A 5IB2A 1UZ6E 4HCRH 1FFRA 1FRGL 2F8OA 3UEZA 5GSVB 4ALAL 3Q6GH 4XP1L 3FO9B 1J1OH 1R3KB 1U2HA 3FO1B 4PRDA 1Z0NA 5JLZA 4CGTA 3MRCB 4XMKH 3V95A 1T1ZB 1NUNB 1XMWA 4FQXC 4DZBA 1MPAH 3QDJE 3BIKB 1D6EA 4M03A 2DIJA 3GSNH 2R1XA 3IFNH 1MCQA 1GPOH 5HD8D 3S6CA 2ADFH 4DKAA 3OKDB 2E6JA 2OSLA 4GUPA 4HXBL 3BKYH 5HHOE 1JWUB 3D69A 3KYMB 3IXAB 2DQUL 4P2RA 5JQ6H 3ULUH 3MUJA 4YUEL 3WHE0 1QBLH 4Y1AE 2XY2A 4PGEB 1YEGH 1T2QL 1MAML 3LV3B 3HR5B 5FO9A 3T8XA 5ETUB 3OKKB 4FNLH 4NIKB 4X7SH 2XY1A 2BVEA 4K9EL 4XH2B 4P99A 1BQHG 2XYCA 4DQOH 4LLAA 4LOUD 1CLZH 3CPLB 1IBGH 1WZ1L 4YDJB 2NY2B 3BO8A 12E8H 5BV7L 4WENB 4WEBL 1RURH 2FD6L 4HV8A 3PGDB 2ESVA 1YPZB 4HDIA 2WBJC 5ESVA 4L5FH 1FH5L 3VXSA 1BBJA 1DBBH 4PJFE 1MEXH 1RJYA 4TVPE 1MVUA 2YR3A 4X99B 2HRLA 5KVMC 2FO1A 5D7LB 3P4OA 5IVZA 1YN6A 2GHWB 2LVCA 3RGVB 2HMIC 3PQYE 3PWJB 3DXAA 4CU6A 4EN3C 3DI2B 2QKIB 1WIUA 4KK5C 2NY6B 5C2BL 3DIFB 5GIRA 1MCEA 4HKBB 1NMAH 3VDAA 2IPTL 1ND0B 1AP2B 3WS3A 4BQ9A 4S1SH 4EUPG 2W38A 5CILL 2CDGA 2A0LC 2AJZA 1Q9KB 4Y16C 3OKMA 3L3HA 3NIFF 2PYED 3GSRA 3MOAH 1BQUA 2XA8H 5JHDD 3QFDB 4EBQH 3U7YL 2BVQA 2D7PA 2JIXB 1D5ZA 3WE6A 1CFVH 2W9DL 4BZ1L 5TF1L 2DIAA 2E9IA 5E99L 1OTTD 3G9AB 4JKPH 1UXWB 1FVEB 4L9DA 2GJZB 2CXGA 2ZPKH 4G6MH 4R26H 5I9QB 4DN4H 4S11A 4ZUVA 1S7UA 1NCDL 1IAKB 1JF1B 3FQUA 4GS7C 4OGAD 5KTEH 4G6KH 5JZ7C 3JUYA 2ZOKA 1DBJL 5IOPB 2ZUTA 4WUKH 1OCWH 2XNAB 3QUYC 1R3HA 4ELMF 1ZE3C 1OAKL 4EI5D 3QA3A 1OAXH 1YPZE 1L7IL 2BSTB 3FQXB 2VDNH 4QXTB 3UJIH 1T20B 5J89A 3IFPA 4WU7B 1I1YB 4C56A 2OR9L 1B88A 2E6PA 4Z7VB 2X4TB 5FK9A 5JMRA 4TSBL 5CZXC 5I1LA 4K55A 5MENA 2YC1B 4XP1H 4C83B 3WEXA 5DMYA 3FO2B 5JR1L 4HD9A 3ARQA 3PWPB 2Y1VA 2ZKHH 4OZGA 1AFVL 1W72H 1BEYH 1INQA 4MD5A 4MJID 1X7QA 2VIRB 4M3KB 4HF5H 3ROOA 4QHKJ 4Y5XA 3O9WC 5DMKA 5F8RC 2EKSB 4TTDC 1O7VA 3DTXA 4TYUA 4LPTA 4L8SB 2QTEA 1PSKH 2LU7A 4M1CD 5IB1A 4PJCE 3BZFB 2HN7B 2V9RA 3MFFA 5ERWA 1DTUA 2IADB 2OQJA 1HSAB 3VFNA 4G8FA 1NFDB 3WIFB 5IMKA 3F7VB 2P8MB 4G8IB 1MOEA 1RUPH 2ICWI 2HTLC 4LLWA 5EULV 1C8PA 3NTCH 5C0BA 4YE4H 5I1KH 1P7HL 1QVOA 4LHQB 4YBLB 2NPLX 4NHUA 5CIPH 2UYLB 1YYMH 1QYGL 1NAMA 2LU3A 3QJHB 4OLZL 4X4YB 1AHWC 3I6KA 5ESQB 3H42H 4R96B 3STLB 3QUZA 3LQAL 3SDCC 2IGFL 4CU7A 1RZIB 1AGDB 2NY0C 4PY8J 4G8GB 5D70L 3TT3H 4UQ3A 4PJGE 5HJ3A 3U4AA 4JQIH 3RWJB 4OIIL 1XT5A 1WFUA 4ODTH 4Y16A 3N1GC 5TH2A 3SJVA 5GGTH 2HTKD 3QRGL 4I2XB 2GJ6A 4NJ9H 3BT2L 1ZWIB 3GHEL 5ICZA 2MTPA 3SDAD 3SDDC 4HQQL 4CMMB 2GITA 5IF0A 4LSVL 3VXMD 1MRDL 2WWKO 1GZQA 1RU9H 2AJ3A 3D0LB 4CUCA 1MLCA 2YD9A 5HHVL 1FO0H 5D2NB 3RP1A 2VO5A 4PRAA 2IFFL 3T65A 5LCVH 5F1KC 1NLBL 1AXTL 5IR1A 4JHAL 1U8OB 3RKDD 3IU4L 3ARFD 4KJQC 1M4KA 3QH3B 3EYSH 2X4QB 4JFPA 2ZOLA 3ZL4H 4TUJB 1CL7L 1F58H 5FO7A 5IB3A 5IQ7H 2PETA 3GRWA 3OKOA 1HZHL 1VPOL 1UJ3A 3ELAT 5FYKL 2RFXB 3HRZA 1HNFA 5LQBL 1DQQA 4TVPH 3QPQC 1RZJC 3KXFB 4PJBB 4ZTOL 1RIVH 1AE6H 2DMCA 4WFED 2J6EH 4ZFFA 4Y5YC 3P9MA 4OCYH 4ORGA 3AGVA 2F54A 2VLME 3QT2A 4HIHB 4X6EA 3MRLB 1ETZB 2ZJSL 5JDSA 3VXSD 1BJ1J 1KJ2L 4XGZB 4EIZC 4DVRL 4LVHB 3HN3A 3RY6A 3VD5A 1Q94A 5DD3L 3E2HB 3EBAA 5C0EA 3A6BL 1R5WB 3DUSA 5HPMB 2OS7A 1CT8A 1MRCL 1CG9B 2WBJD 4YHNB 1T5WB 3REWB 3PL6A 5SX5H 5EIIA 5LXGH 4LEOA 1LP9B 1EGJH 3GMLB 2DM7A 3QNXA 4ZO9A 3GO1L 2BRRL 5A43C 1NBZB 3LPGA 2VH5H 2VTFA 4BM7A 5IMOA 2CLZA 2P43B 3CSGA 2Z4QA 2EE2A 1MWAH 1BFOA 4QYOA 1HHKB 2HKHH 1I8IB 4XB7A 5H8DA 4FQQB 5CZKA 5EO0A 4GW1A 3C8KA 3IT8D 4OV5A 1JNLL 3CFDA 2FX7L 4HJJH 4I0PA 2D7NA 4F80A 5FGSA 2Y7QB 3HI1B 1TNMA 4C58B 2YD1A 5E08L 3S35L 1CICB 1BX2B 3ARFA 2J7LA 5TDOA 2JLLA 4XPBH 1E6JL 1WBZA 1YEIH 3JTTA 5DHVB 3OGCA 3W39B 3EYSL 3ZL4L 4PJAE 3MLXL 1UVQB 5DS8B 5TF1H 5DUPH 2CPCA 3GBNL 3MJ8A 5FA4A 3KLAB 5GRXG 3QP3A 1U8HB 1N5YH 3HNVH 4U1SB 2ENSA 3QWOA 3B6SA 2PO6C 4NM4L 5ENWA 3T0BA 4DOHE 3SBWC 4Y16D 4MS8D 3THML 3NPSC 2GUOB 1ZLVH 1I8MA 4DW2L 4CMHC 4MGXA 1U8JA 1GGIL 3RUGA 3QUZD 3PQYA 4WWKC 4LSQH 3JV0A 2UV3A 4JY5H 1YMMB 4C59B 1C5BL 2EDRA 4FQCL 1Q0YL 1U3JA 1S7QB 2EZ0D 1FFPB 3ABZA 1HCVA 2BHUA 1ZEAH 5D6DA 1F3RB 5DEGA 1ZHBB 3WYRA 1A7BA 1AD9A 1KTKE 3DMMC 4BQ8A 3IS1X 2F5BH 3QG7H 1RUPL 3MRRB 1XIWA 4W4OA 4HPOH 5HHXH 4L3CA 5CJBA 3K74B 4B50A 2R1WA 5H37H 4AENB 5SWQA 5HGHA 2FJHA 2ICWB 3QDAA 5BZWB 2GY5A 4OGYL 4KVNL 1QFWL 1U58A 3NIGF 1RUML 2NTFB 4N0UB 4U1MB 3BQUD 4J4PC 2CO6B 1GAFH 2CKBH 2R2BA 4H25B 4DVBA 1CLOL 4H0GA 5EFIA 4Z8FL 2G5RA 3LIZH 3WFHA 3OZ9H 3HE6C 4EUPA 1WJ3A 3RZCB 2J4WL 1Y6KR 1Z5LB 2ICES 1N7ML 3RVVD 3TT1H 1FIGH 1JZ5A 5DD5L 1RUQL 3L3IA 3JVGC 1UKTA 4DOHB 4ZUSA 5DFWH 1KELL 4H1LG 1H3PL 3UTOA 4P46B 2B8OT 3QQ4B 5EU3A 1BWMA 1JHTA 4BSWB 3QUML 2DLTA 2CSPA 4RDQG 5D6CB 1KIQB 1OGAA 2CXKA 3DI3B 4PV9A 2ARJA 4N1HB 1P53A 2CR6A 1NCAL 1WWBX 3BGAA 3UTQB 3UDWC 1IC5L 1CGSH 3FFCB 4XNXL 4KROC 5DVMA 1I8LC 3OB0K 5KS9E 4HULB 4W6WB 2YD8A 5IBUB 3N9GL 3IAGC 1HDMB 3ZO0A 4FQ1L 4QHUB 2NY7L 4NSKB 2NY3D 4M3JA 1OGTA 3QNZB 1IGMH 4H88L 3V0VA 4EN3A 4X5WA 3ZZ1A 4HWEH 4ODWB 2VAAA 4KTDL 4LCWB 4JO2H 3WS6C 1DFBL 1P4LA 3CH1B 4GAJH 3WXWH 4P9HL 4XTRD 4CL7A 4MAYC 1G7PB 3NABL 2X4SA 3KXFE 2ITDA 3TZVB 3UTZB 3HMWL 4D0CA 1DUZB 3WXVL 3TVMD 4Y4HD 5JNYB 4PJ5A 3HPJB 3E8UL 4J6RL 2VLKA 4G6FB 3RY4A 5IB2B 1NMAL 2EXYD 5B39G 5EB9A 1QEWA 3A67L 4BELD 1LO3L 3MOBH 3MLSH 2VERN 1R3KA 5GJTL 3WFBL 2VLRA 1QNZL 3Q3GA 2CH8A 2MQ0A 2VN4A 2Q8BH 3S34L 5F9AC 2AGJH 1WVZA 4R6UA 2DQDL 1G9NC 4MA1C 2VLJD 4FQCH 2B0SL 1DBBL 5BS0D 1C5DB 5B8CB 4Q58C 3DETC 3LQAC 5CJQL 5EZIL 3P30L 3P2TA 1M7IB 2HWZL 4HBCL 3VI4F 1IEAB 1PW3A 3L3KA 1T89A 3TPUA 3IRPX 2YRPA 4PLJD 3CDFA 2EDBA 3T3ME 1G7QA 3MUZ1 1G7MB 1KLGB 4NM4H 3GJFH 5F7EL 2YN5A 4WO4D 2H8PA 2K9UA 4RIRA 3RWDA 4KMTH 5EN2A 2H32B 5IBUG 4XXDA 1FPTL 5I66A 2DI7A 4QRRA 4MQ7A 3LRHA 3T0WA 3ESUF 1ZA6B 3OKKA 3W11C 4ONOA 4U6YB 3EDEA 3H9SE 3TPKA 1XCQA 3IKCB 1MY7A 1Z9OA 3VGAC 1FYTA 5JUEH 1RIUH 1EAPB 1CK0L 1XGPA 3MV7E 4NO5B 2AW2A 1YY9C 3E0GA 4Y2DC 3O6LH 4LPXA 3H0TA 1NBQA 4MAYA 1IGML 4H88H 4G8GE 4GXUM 2Z91A 5DJ2B 1AFVH 1W72L 2PO6A 5B21A 4D9LL 5FHBH 1BQHA 3MZGB 1VENA 4QXUL 5CP7A 1T66C 1QZ1A 3IDMA 2Z31C 1OARL 2XACC 1B4RA 1T0PB 4P2OC 3O3DA 5HHMD 2XOTA 4JFDE 4QWWD 5EZOL 1MVUB 2FYYB 1CI5A 2CIKB 4K71C 4LP4A 3K80A 3KPOA 3MLTA 1KJVA 4LIQH 5ANME 1HHJA 3P9LB 3DXAB 4P2QB 3RTQA 4K8RH 3TV3L 4ZOBA 2I60H 5BVPL 4HKZA 2QQLL 3KYKH 4NKDB 2H26A 1Q1JL 2EYSA 5KSAD 1CQKA 2X4RB 5C0IB 3GBML 4XZUB 4OCXH 3L3HB 4Y5YB 1WZMA 3RVWD 4OLUH 2AK4A 3TT1L 1RPQA 3O0RL 2Q87A 4J4PD 4C4KO 4PRPE 2VZUA 1LK2A 4ZMAT 4PJXE 1UA6H 3AREA 3QEQE 4PD4K 4WWKD 4M5YH 1OP5H 3UX9B 1ZTXH 4YK4C 3HZVA 3DX6B 3BEVA 3DSFH 3TO4C 4NO0D 2CKBB 4MHHG 5CZXD 4X6CA 5E2TH 5LGJB 5I15L 1YNTB 4AT6A 2JK5A 4G7VL 4JPWL 5CFHA 4Y4FA 5J6HB 5HVFB 1G6VK 4Q9QL 1DQTA 2DLEA 1J88A 3P73B 1Z0MA 5FO8A 2ZNXA 4ONFH 2E5EA 3MLVH 4GRWF 2F53A 4R7NB 5J13C 3ZKMD 3DJ9A 1RU9L 2B4CH 4G8EA 4UOJA 4Z7UA 1DN0A 4PJBF 5D1XD 4CVZA 2P44B 1CD8A 4JKKA 3F62A 2ZSWB 3VRIA 3WFBH 3VXQA 2VR4A 1ZLWH 5B3JE 5EUKB 1J12A 4JQIL 4F7TA 1AR1D 4YGVA 1J0HA 1TCRA 5HHOB 4LSSL 1EEYA 5CEZE 2W0FB 1G7JB 1XGYH 3AUVA 3FB5B 2P24A 3LQAH 3U4EB 5JW3L 4JQVA 4JPIA 2FB4H 3MUHL 3ZTNL 4PV8B 3HTLX 2VZ1A 1JGDA 3B2VL 4F57L 1FZJA 2Z31A 3EGSA 3BIAX 2X9YA 4JQXC 4K9EH 5EO1A 2YEZB 4I3SL 4Y2DA 3HS0B 4KWUA 1DQLH 2RCSL 3V7AE 3I02A 4FMKA 4ELKB 3GB7A 3QDGA 1OAUL 1N2RB 4YHPA 1ZLUH 3QIBB 1HQ4B 4GXUN 3BSZH 5D7LD 3EO1B 4P2OA 4L9LB 4E42A 2ZNWA 4XP4L 3VXNA 1GC1L 3VH8A 3S35H 1I1CA 4JY5L 1D5MB 1QFWI 4MCYA 1A1OA 4Z76A 4F37F 5E9DD 5DTFA 4BKLB 4X80L 1JNLH 1NAMB 5H94A 4YO0A 2H32H 4JRXA 2DRUA 1QFPA 1Q1JH 4Y2OA 2GY7B 4M8QB 4JZOA 5TPWH 1MNUH 1NANI 3D3VB 3T08A 2VITA 5I0ZA 5EA0L 5A2JH 5DFVC 3WLWC 3ZDYF 1RJLA 3PGFH 2GJ6B 4FZEH 5DQJB 2F58L 3EKCA 2GITB 4CDGC 4JFYA 3D0LA 4YQXH 1NC4B 2AV1B 2NY5L 4E0RA 3TCXA 3ARGA 1ORSA 3PWNB 5DEFA 1T4KA 5HYQB 4XNYH 5CCKH 4OFPA 3HE6B 4LSRL 3D2UD 1IM9B 1T89C 3O6LL 2EXYC 2NXYC 4O5LH 5HHPA 5F1IB 5EO9B 5GGQL 1MF2H 4B7LA 4TRPH 2ZP0T 4JCLA 4OD2A 3MPCA 3CUPB 4XNZB 3DX8A 4G43B 1RAMA 4PJBA 4HLZH 4ZDHB 1QSFE 2HMID 5CGYD 1FBIL 2QQKH 1NSNL 1YC7A 1QUNA 3NVQA 1OT2A 3O6FB 4WW1A 4IRJA 5TFSL 3MACL 2Z35A 3EHBC 3W0WB 1N5AA 3W9EB 2CKNA 3TV3H 3R0NA 4P23D 4V1DD 5DJAA 2BNQB 3HA0A 4JO1H 5GISH 3BFOA 3L9RA 1I3GH 3VDBA 3FFDA 1P2CB 3AM8A 1AD0B 3UO1H 1D5XA 4FHBD 4WHYH 4XRCB 3QHFH 1BZQK 1R5WA 1N8ZA 3F7YB 5D2LB 5EZOH 1MH5B 4LNRA 2VDRL 3W9DA 1PZUB 3TLRA 1X4ZA 3KGRA 4P2QE 1WLHA 5EZLB 5FDWB 5ALCL 4F2MB 5DO2D 4Z77B 1MFNA 4H20H 3QXAB 1U8KA 1AQKH 5IP4A 4LPUA 3HUJF 1NL0L 1S9XB 2OTWA 3AXLB 1NBZA 5F9OL 4HG4K 1F00I 3D18B 2ORBH 2PYFB 2HYMA 1IM3A 1YNLH 3MBEC 3VGFA 1IGYA 5B38B 4NQDD 4MXWH 5T1LA 1L4IA 8FABA 1ACYL 5HGDA 3VFOA 1E28B 4X9FA 1FG9C 5A2IH 2E27L 3IF1A 3B3IB 4CU8A 3CIQA 3EYOB 2VZVA 2H45A 2K1MA 1PG7X 4LARH 1XGQB 1LWRA 1Q9LA 1QA9A 3FO0L 5DZOA 5HI4D 1RK0A 1OM3L 3QEQB 1TVHA 5TQ0H 1KLUB 5F3HA 5L2JA 4F9PA 3SHSA 3F5WB 1E4WH 4HW6A 1KB5A 5DJDB 2P5ED 3H9HA 2EIDA 4PG2C 2XG4A 3FRUA 4U1LA 4G6AD 3WNNA 5LVEA 2XWJB 3O9WD 3BP4A 4PJGB 2GK0A 5HYIA 3UP1A 2P45B 3CXDH 3FMGH 1T04B 3FT4A 4HS8H 4OLWH 5CSZA 2HKFL 3S7GA 1RHHB 5I1IH 1KPUA 1U8PA 4L4TB 2D0HA 2Y25A 4D0DA 2YS4A 4KZDL 3OKYA 5B8CC 5IHLB 3AMKA 3MACH 4ZQKB 3EJYD 5EPMB 1J8HA 1A7NL 4LEXL 5TE7H 5EU5A 1EEUA 4DUWA 2DJ4A 1WTGT 1AJ7H 5FUZH 4GW5B 2GTWA 3E3QE 3KS0H 2VLJE 5D7IF 1XIWB 1CE6A 3FRPG 4WW2A 4Y89A 3CSBA 2C26A 3H8NA 3QXVA 5GGUB 4Z8FH 4GKZB 4U6HA 2UVFA 1W0VB 2D03H 4OZIE 4U1JB 1MFCL 4JQXA 1DP0A 4OD1H 4PJHF 3PWLA 3HZKA 4U1MA 1I3UA 4NWTL 3VGAB 1F2XK 1MCJA 1RI8A 5I9QC 1JYWA 1N64H 5IFJB 1U2CA 1QSEE 2P5WD 3MRHB 4M4PA 2ZUQB 4JHAH 3RZCA 1GRWA 4UV4H 5HD8C 2DTSA 3IFLL 1UWEL 4Q6IA 1W2KT 1RJCA 2XRAL 3MLRL 4NWUH 3O4LD 1OAKH 3QIUC 4NQXB 3X3FL 3AS0A 5IWLC 1QO3B 3WLWD 1A2YB 2J2ZA 1MY5A 3MJ9A 3UXFA 2DQJL 4HUUA 1OY3B 5CD5D 3SOBH 1H5BB 3ARYA 3BKML 4KKNA 3MBEA 3NCCB 4G3YL 4P2QD 2EC8A 1NCCL 4XNUH 4HLZG 3SE3C 4POZC 4ODBD 3EFDH 5FA3B 4LBEB 3U2SB 2FSEB 5F7DB 5F71A 5FKPA 5SV4A 4NQDE 5CUSL 4F58H 1GGCL 3T0ED 1LEGA 5F1SA 1CFTA 4CNIB 1ZGLB 5LAXB 4IMKC 4UUJB 4YHLL 3V7AG 3ZE1F 1GXEA 4M4RA 3OHXB 1KJ3H 5K9OB 4GG6A 3IDJB 3MRIA 5JORA 3UTPD 4ZOCA 2YK1L 3LHPL 4L5FL 1K8DB 1NGWA 5FYKH 2W0LA 3GIZH 2A6IB 2VL5A 1CDUA 1R24A 3B9VA 1V3MA 3O2VH 4PFEA 4CAGA 6CGTA 4LCUB 4YDLC 3PABA 1RVFL 5GS2D 3CFCH 4BSVA 1OP3K 4X7SL 2D9QB 1OD7A 4LDLB 3UAJD 1BD2B 3UYOD 4J8RB 1JV5A 2BK8A 1W8OA 3W82A 4OTXH 4WY7H 1CD9B 2P1YA 3MV8A 4X4ME 5L6YL 4L29A 4R4ND 5DHYA 1PQZA 2HKHL 1F3DH 1AXSB 1TTFA 3DMMA 3WIHH 1KIPB 1I1FB 5GGTL 4WVRA 4LCYB 1C1EH 3L5XL 3PV7A 4OAWB 3VJ6A 1FG2B 1HEZA 1MIMH 1OB1A 2N7AA 5D1ZB 3FONA 4LLDB 4Q9QH 3ULVL 1Q9WB 1NEZG 2KDGA 4LCCA 1KV3A 1A9BB 4E5XB 4FQHB 4YBHA 3ZYZA 3OJDA 1VESA 4PRHA 1U3HB 4MLIA 3LKQA 3HLAB 4JFQA 2A0LD 4YX2H 3L3KB 4Z0XB 4BZ2H 3KLSA 4EQ3A 2QV2A 3IETB 1JYNA 4QRSB 1FNAA 3RNQA 4U1GC 1G7MA 3B9EA 3M17A 1XF4B 2XTJE 4JM2D 1OSZA 1QG3A 2P5WA 3BXNB 3TZVD 5DZLA 3K8KA 3O6ML 4I48A 3OX8A 4RGOL 4Z18A 1Z9MA 2CGRH 4NHCL 1TETH 3LD8B 3VFSA 2R56H 2N1KA 3VI3E 1S7VB 4MQ7B 2X4OB 4K94H 1WWWX 4BZ1H 2DBLL 3KPMA 5IW1B 1GPOL 5EBLA 1NLDL 2R2EA 1UWGH 4GBXB 5E9DE 5T1MA 4PTUA 1I3RA 1MWAL 3K81A 2EDJA 4UDTB 1MLBA 3ZKQD 5HYSB 5EBGA 3RL1B 5DVKA 4LVEA 4UB0H 4Y5VB 1P9MC 3H9SB 2JCCA 3WV0A 4I0PC 4OFYD 4HH8A 4MAYB 3ES6B 4Y19E 1EXUA 3BPLC 4LSSH 4ALAH 5C92A 1SY6H 4PY7A 3QXDA 4XBGB 3X3GL 4M6AA 3VG9B 1ROWA 1X5ZA 2QQQA 3VRJA 5I8OH 5TGBB 2IH3A 4FQIL 1C12B 3WO4C 1G9NL 2X44D 1V05A 5IROC 4JANB 3IFOB 5DRXB 3WL9B 4HS8L 2OTUB 3R0MA 3CVIL 2WLYA 3Q5TA 4Y4KC 2BOCA 4DGIL 3HUJE 1IFHH 1YQVL 1EJOH 4S1RH 5E6IA 5M95B 4KHXH 5GGVH 1WGOA 1FCCA 5TDPB 5SX5K 5D1XB 1OTSD 1CFNB 2WQ8A 1KCLA 4PGEA 1L6ZA 1QYGH 2BNUB 3BVNA 4Y5YA 4JZJA 3HR5A 3RWCB 5FO9B 1JZ2A 3KLHC 3MGOA 3QUKB 4TTDD 5DHXB 3ZSTA 3IB4A 3V4PL 2IG2L 4ZYKB 5D6DC 2MMXA 1P7KB 2PXYC 5HYFA 3C5SB 4QY8B 5E2TL 1WFOA 4MA3B 1QRNA 1MQKL 2NY0D 5MEPA 3T09A 2AERT 5FECB 4LPCA 3BQUB 5GRJL 5K33A 1H8OA 2G75A 4P5TD 5IESH 1QSEB 4HUXB 5BMFH 4S1SL 5ESVB 4OIAA 3QDMD 4RRPA 4YK4B 3B9KB 1BAFL 1GSMA 4AT6B 5DJ0B 4F58L 5C7XL 1MI5B 1AI1L 4HIXH 4WWKB 4Z7OE 1DQDH 3DNKA 5I19H 5MERB 1LO4H 2EIBA 3H9YA 2CO7B 3T4YB 3TGXA 3EO0A 4PJFB 5DD6B 1RK1B 4DW2H 1MHPH 2DQJH 3PDOB 3PHQA 2D7TL 4MXQC 4KTYA 2DAVA 1BM3L 4ZAKD 5IHBA 5AEAA 2G5BB 4FQLH 1BP3B 2CK0H 5J57B 1WCQA 4L3EE 4A2LA 1U9KA 1T0NA 3QZWB 3LN9A 4KKLD 4KRNA 1CBVL 1Y6NR 3HI5L 2IPKB 4POZD 5INDB 3GMOA 5IMLB 3L5WB 5HHOA 2JIXA 4KK6D 5J1SC 5EZJA 1ZA3A 1U8IB 1LO5A 3HAEB 2IH1A 2CLRB 2ILLA 3QNYA 1U8MB 4XMPL 5CEXA 1B90A 1OGAE 3SCMD 1M6OB 1VADA 1UGNA 4Z7QF 4U6TA 2GAZB 3ZHDA 5JXAL 3UAJC 2MKWA 1KIRB 2KPNA 1UACH 2PCPA 4XAWL 5GZOC 3GB7B 3QDGB 2Q76B 6FABH 3KPNA 2DLFL 2EDDA 4O2FA 3ULUE 4AIZB 3OKDA 3R1GH 2QEJA 4XNYL 4NNXA 3WUZA 2OSLB 4GUPB 2YHGA 2BC4B 4A6YL 2YBRA 5IV2A 5E0QA 5EC2B 2NY5H 3E6FA 5C0CA 4CJ0A 4L8BB 3FQRB 2BJMH 3O9WA 4IRSB 4MJ5B 5I73C 4O58L 5DRWA 1ZSDA 2EYTB 1NLBH 2IFFH 2IALB 4HK3J 4QRUA 3SGDH 2VITB 4P46C 4GOSA 1T80A 2R9HC 4GLRI 4PTTB 3CLEL 1NGPH 3U0TA 4I77H 5I75B 3O3AB 1FVDB 1QNZH 3NFSH 3T2QA 1UXSB 2VLJB 3TJEL 1C08B 4IIQA 5HHQB 4FFVD 3RGHA 3MRQA 1Z3GH 4JRXD 3SE9H 4OZIF 5EOCH 1FC1A 3L1OL 1QFWM 5ESAA 5MI0B 3PDGA 5E2UL 3MUY1 2I07B 2FECI 1SJEB 4OLZH 5ABDE 2AQ3A 1FN4B 2EEBA 3ULUF 4G6JH 4J2XA 4TOYL 1HSAA 3VFNB 1ZHNB 1YY8B 1NCWL 4DN3L 3O6KL 5D7LA 1M7XA 3GNMH 4JVWA 3P4OB 4JN2B 3BPCB 3RZCC 3DYMA 3DX8B 3O4LE 4IRSC 5IFHH 4GMSH 3PHOA 3NA4A 1MCNA 3V4PH 2BXZA 1JPSL 1G9ML 5I1DA 3L7FB 1KTDB 1VGEL 3F7PC 4JFHE 3AY4A 4X7CC 3EZ8A 4ONGL 4PJ9C 3QO0A 5I8KH 5CJOH 1JK8A 1ZKAA 4K2UL 3LN4B 3HB3C 3IRZA 4QHMB 3LMJH 5ALCH 2FZ3B 3K1DA 3SJVB 2VR9A 1MFAH 2DI9A 2GQHA 5C86A 3T8XB 2IQAA 3QUZC 5ETUA 3SDCA 1U3ZA 1G9NH 4LKXA 3U48A 5FDWA 1A21A 3NACL 1YEKL 2G9HB 1G0YR 3MV7D 1WISA 3JWNC 1I8KB 1XGTA 2YUXA 1MVFA 1NDGA 4DFHA 2YOCA 2NW3B 4H1LA 1F90H 1VFBB 1V3JA 3T1FB 3HG1E 5LWYH 3E6HA 3UBXA 3TBTA 3HCVB 3U1SH 1N64L 3PIQA 1CLZL 2YUVA 4PJIF 2XNAA 4QRTA 1Z3GL 3OR7A 3SCMB 1EAJA 1IGJB 5E94A 3VFOB 4Q0XH 1RJYB 1E28A 5ANMA 1F6FB 4LDOB 1UG9A 5GPRA 3IDYB 3WN5B 2FX7H 2ZCHL 3C6LD 1J8KA 4OLXL 5L0QB 2EIZB 4HUWB 5JIPA 4JFOA 3ULSB 3MRJA 4X0KB 5T3XE 1BVLB 1IQWH 2V9TA 4K8RD 4PJ8C 2FJFB 2RIKA 1J5OL 3EFDL 1EUTA 4X6BB 1JWMB 2BRRH 3F5WA 1Q9KA 3TNMA 3D1MC 1KB5B 3QYCA 5DJDA 4QHLB 1A7NH 3GSRB 2KZ1B 3O8XC 3QFJA 5HSFA 5I1HH 1OTUC 1ORQA 4AEHL 3PDDA 1MPAL 3ARBA 5D5ME 1NEZB 3DTXB 4ZFOL 5E8NB 5L8JB 5C6PB 4JRYA 3FB6B 3LB6C 1UENA 3SKNB 1QR4A 1UXWA 1IAII 1WICA 3GMMB 2IADA 3QDMB 3DRTB 4ZUTA 4HK0A 1RUQH 3RWIA 3OAZH 3U83A 1YNKL 4R9HA 3T0DA 5C0BB 3I3EA 1VCAA 3S97C 2UYLA 3QJHA 1H3TA 4QHKI 4R4BB 5J9PA 1XR9B 5ESQA 1R3HB 3U9UB 4WTZA 1RZ8A 1CE6B 2Y6SC 4Z7UE 2VDML 2COQA 2I5YH 2YPKB 1MJJA 1CVSC 3B2UD 3CFCL 4IOFD 3K0WA 4Z95L 3G9VA 3RWJA 5CEZH 3WIHA 3BZDA 3VD4A 4Y16B 3VFMA 5IQ9A 3ZDZE 5FK9B 4PP2B 3VXPB 4PJAF 1U8QA 2WUBL 4OI8A 1ZWIA 4H8WH 5TQ2H 4I18C 4OZGF 4JO4H 3C5ZD 4HPOL 3MA9L 3QWOB 1K4DA 1Q0XH 2DWEB 3ARBC 3HI6H 4KHTL 3WBDA 2J88L 5D2NA 3GMRA 2VUYA 1FCGA 4PRAB 5TF0A 1NGXA 1ZVYA 2FL5A 4U1IB 3GGWA 4OB5H 4X7TB 1W72B 5DMKB 4RFEA 1P1ZA 4KMQA 1S9WA 3O8XB 4UQ2A 3HC0A 1CICD 1SVCP 1EX0A 4HKXA 2RJMA 1FFQA 2XQBH 3DV4B 4JGJA 5FO7B 5F21B 4NZUH 1H9VA 3TFKD 1FVCB 2C4XA 3RL2A 4X9IA 4KKBD 2EDQA 2ARWA 3BZFA 4G42A 5JOPD 2BVPA 2H3NA 1CLYL 3RRQA 5ERWB 4APQD 3VMOA 2RGSA 3MLZL 3SKJL 1Y0LB 4NNPH 3FN3A 3VD9A 3LQMA 4ZFFB 3GUTA 5GZOD 4NRZB 4LLWB 5IFHL 1LEGB 7FABH 1F2QA 1Q8MA 1CD1B 1T22A 4Z7WB 2KQMA 4KFZC 4CVXA 5HGHB 3VXSE 4LP5A 4JRWA 4NKMA 4GG6B 2E27H 4LMQE 1D5BA 5FM5M 4NP4L 4UB0L 3EJZD 3OV6A 5C07B 2A6IA 5SWZB 2ERJB 2NY2D 5GS0H 4WFHE 4LVHC 3S4SG 1T5WA 1RV6X 5EFIB 3REWA 5I16B 3CX5K 1AO7E 3PHSA 1CGTA 3V4VH 1MCWW 2CRYA 2VXVL 2WINA 3OAYK 5GS3A 5J1AA 1YNKH 5J7CC 3U0PA 3RTQD 1AGBB 4IOIA 2XA3A 4FQIH 2H6PB 3AS1A 2I60L 1MJ8L 5BVPH 4N0CD 5FYJU 4HUVB 1SY6L 4LHUD 2J8HA 5I73B 1EHXA 4IRZH 4LU5H 1FO0B 3O2WL 1MSPA 1F90L 5LWYL 3W0WD 4BQBA 4FQQA 5EO0B 3ZT6A 3CFDB 1I3GL 3CVHA 5C09E 5D6CA 4I0PB 4RGND 3VJ6B 4KZDH 3RVXD 3ARFB 4WHTB 3DUUA 4QXUH 4PP1C 5B3JF 3PV6A 1MUJB 5JA8B 4P49A 1X3DA 1OGAD 4M7JL 2Q7YA 1JTTA 2Y5TA 3G5VB 4EVNA 4AG4H 4MLSA 1DEEB 5AYUH 4WFEE 5I1AB 3OJDB 5SX4H 1CGXA 4HIXL 2NZIA 4YAQA 4UI2A 3OQ3B 1KPVA 3P77A 4M1DL 2UVEA 3GI8H 4LHUB 3BI9X 2YSSB 3Q6FB 1S5IL 4X5WB 4E9LA 4N0YH 3G5YA 1Q94B 3JXAA 4WI9A 3RUGE 1S7RA 4EJ1C 1D5IL 1RMFH 4WO4A 3QEHB 2V5RA 3DUSB 4K3EL 4FFWC 5GRJH 1KJ2A 4K94C 3FB8B 4FFZH 1IKNC 3RQ3A 1MWAB 1OM3H 3BUYB 5IBTL 1T6VN 4MA8H 4RNRA 1G7IB 3MBXH 4WIQA 4X6FA 5C70A 3ARDA 4UBDC 2JJVA 3LRSB 2V5SA 4BJLA 4X8JB 5CP3H 1A6ZA 5AD0B 3P30H 5KVFH 3W0WE 1FZMB 4CADB 2CQVA 4J3VA 4XPGH 5FYKU 1BVZA 3IXTB 3HPLB 4O02L 1HHKA 4LASL 5DURB 5I18H 5E9DB 2AEWA 2DQGH 3DVIA 3LKNB 1E6OL 5D7JA 3C8KB 3ES6A 2OBGA 1OP9A 1IAIH 3CH8A 3BT2H 4UV7H 1MCPH 2VLKD 4OB5L 3L3DB 1HH6A 1A1MA 4PS4L 3WNMA 5EORH 4I3GA 4KI5F 5E5UB 5C08B 4KHTH 3IJSB 1ITCA 1OSPL 4YGAB 2FBOJ 3OAUH 3PWPD 5E6IB 1FORL 1NFIB 3BJLA 3MRPA 4WHYG 2XZCH 4M62H 4MCZA 5FM4A 3IFLH 2H32A 5JOFB 2I25N 4H0IA 4M02A 3TIDA 2X4UB 4NO2A 4PJ9B 4NN5C 3P0VL 1UACL 3JV6A 4LVOC 1KXTB 3FN0H 4LHUG 4M1DH 1MIEL 4IS6B 1GGBH 4XXCC 5E08H 2OP4L 1J0KA 5FECA 4PV9B 2BCKA 5FYJD 3UYRH 5L2KE 3SDXF 5DUBA 2X4NA 4HUXA 2Z91B 3FFCA 2OTPA 2YA0A 5DGRA 2PO6B 5DDHA 5A1AA 1GGUA 4HZAA 4PJHB 3CLEH 4EXPX 2ZUUA 1UEMA 3X3FH 5C0DB 1LQSR 1OPGH 2VDKH 2BDNL 4DCQA 1UWEH 1H15B 5HGAA 4AENA 3GMPB 2CK0L 3TJHD 1NBVL 4LLQB 1JJUA 2OR9H 4WHDA 2BMKB 3O2WH 3GKWL 4IRZL 4JFHD 4TULH 1KCRL 4FN0A 2X1PA 1D7FA 4QO1A 1Z9SA 2JF1A 4NKDA 3CDGB 2H26B 2VLLA 3BW9B 2GCYB 1WC7B 1HNGA 4Y4KA 3T2NL 3BZEA 1T0NB 3G6JF 3JWOH 3WFHB 2NY6D 3OBAA 3CVHL 2X9WA 1E6OH 43C9B 2P5EA 2EYRB 4GRLC 4N0RA 5TDNB 4M48H 2HLAA 5EU6B 3ME0A 1NGZA 5JXAH 4YH6A 4TQEL 3AS2A 1ZA3B 4P4KB 5SWZE 4X5XA 1AGEA 1U8MA 4Z9KB 3TIEA 4JKPL 2R4SL 4LVOB 4HIIB 1NMCB 3BEVB 1G9MH 2AJVH 3D85B 4WFFE 3IDGA 1H0DB 1WFNA 1YNTA 5C0AA 1EHAA 2ARJB 4M8VA 4UT6H 5GS0C 3GMNA 2NY2C 3QUXD 5D2NE 5BVJB 4FFZL 2KH2B 2PCPB 3O11B 1IC7H 1JL8A 3VI4E 4HHAB 5H35B 4TUOB 1X5HA 4J1UB 2W60B 1A6AA 2H1PL 1KULA 1G0XA 5IB5B 1GH7A 4TUKH 3HMXH 3QJFA 1LNUA 4PJIB 1TPXC 2PW2A 1FGVL 1P84J 4LRIC 1WSST 2B1AH 3RAJH 3RWDB 1DN2A 4MAUL 4RAVA 2BNQD 3GRWH 3Q48A 3OXRB 3M1BA 4PJBE 3O3BA 4GMTH 2P8PB 1INEL 1P4LB 4FRWA 1I9IH 3ZKNC 5GHWH 1T03L 2A6DB 4ETQB 3FO0H 1JNJA 1QFUL 4KK9C 2AAVA 4BFGA 5IT2H 3MROB 3SJVD 1FSKC 1U3YA 2C9AA 3UC0H 4QNPE 1S9YA 4YHZL 4MDIA 5HI4C 1JPGB 4GRMA 1CIUA 3G6DH 4PV8A 4PRDB 1O5DT 3QEGL 3QIWD 3K7UA 4LSTH 4I0PD 3NMEA 2B1HL 1NUGA 1BQHB 1J1PH 1A7PL 5CP7B 2I07A 4K94L 3U0WL 2JJSC 4GG6F 5F70A 2R4SH 3QIBA 5JDJA 2PYEE 3MR9B 2D2OA 3KVQA 4OM0L 3QQNA 3MV9D 5FDYA 3QWRD 1A7QH 3NN8A 3VWKD 1B0RB 1RZKL 5D8JL 4PRBA 4Q74A 3QUMA 5BXFA 1PLGH 4BZ2L 4YXLL 2IJ0C 2DLIA 1XF3B 1ZVSA 4WUUE 2O93L 1VFAA 5K9JH 5CCKL 3SDYL 1VEPA 1GJIA 5SWZD 2NX5A 1NCAH 5FXCH 3ARGC 3LV3A 1JK8B 5GJTH 1G7QB 4RIRB 1UB5B 4M43L 1TENA 3PWUB 1RJLB 2OZ4H 4FTVE 1K3ZA 1KNOB 2VE6A 5CWSB 3VXRA 2BFVL 3PWVA 2W9LA 3WLBB 1KJ2H 1MCOH 5ECJE 5KSUB 2GYSA 1D9KD 2VAJA 4ZFOA 1TJGL 1P7QD 1KCSL 2F53E 4OLXH 2VXVH 3BKJH 1T3FA 1X9QA 3FAWA 3K46A 5EO9A 3O2DA 5C3LD 4HWEL 1LO4L 1B6DA 5TQ0L 4NHCH 4JFEE 2R0KL 3QHZH 2FGWH 1IAMA 2DMKA 3V8CA 3VG0H 2R0LH 3BIKA 3FFCD 4M6NL 4OZHB 5M7QA 1AKJB 3O8XD 1MJ7L 5E00A 5HY9A 1IAIM 2CIKA 5IEKB 4NBYB 3S88L 1GGYA 2VL4A 3EOAB 4NKIH 3O6FA 1PX3A 3ROLB 3LB6D 5KW9L 3CMOL 5BW7C 1WAAE 7FABL 2EDOA 1I85C 1JGUH 2QSTA 2OLDA 3QULA 5GHWL 3Q1SL 1P2CA 1EEYB 4MNQE 5F9WB 3JWDC 2P24B 4YHLH 5F9JA 4QHLA 1T2XA 1I7RB 4Y19D 2AK4B 5FHAH 2CIIA 1JWSB 1JVKA 1RFDH 3NCJL 3TBYB 3CLFL 4PRIE 1FJ1B 5DJZB 3NGBB 2EICA 5C0BD 4GW4B 3HMXL 5F6HJ 4PB0L 3GMMA 4I5BB 1A5FH 1IM3B 5DMIH 5GSRA 4AY0A 4JQVC 1IGYB 4JM4H 3CJJA 4P2OB 2DYPB 4Y4FB 5J6HA 15C8L 2VLKE 4E41B 1BZ7B 2AXFA 4Y4FD 1RURL 4X99A 3MRBA 1JGLH 4WU7A 5DRNB 2WUBH 3BDXA 4LLUB 5C2UB 1EO8L 4EDXB 3TBWB 4G7VH 5I1LB 5MENB 5ICXA 4XPBL 1IGFL 3FO2A 4ZUWA 4UIKL 5GIRB 4Z7UF 3S96A 2L7JA 4MJIA 2J12B 1R5IA 3QR2A 1YMMD 1A6VH 2I9LB 2YZ1A 4POUB 2FECL 4NFCA 4P9MH 1LE5A 4MSWA 5FV2A 3TWCH 3OKMB 3ROOB 3QCTH 3LD8C 4ESKA 2VQTA 1K4DB 1WIPA 1MI5E 4U1HB 1TZHB 5IROA 2BVQB 3RI5K 2KL6A 3GBLA 3OB8A 1NKOA 4HXBH 1YY9D 5IKCB 3I3DA 3GGWB 2B4CC 4R4NC 1F8TL 1RJZB 2B20A 1ODAA 1XF5A 3HRPA 1RHHA 1IZJA 1UCBH 2EDTA 4JAMA 5F1IA 3V5HB 3LS4H 4ZUVB 1T1ZA 1T66D 1U3HC 2OJZL 1AY1H 4DZBB 3RL2B 4OD2B 3ZT7A 4DAGL 1OCWL 4N8VA 2BVPB 5I74B 2J1KA 2HG5A 4X83A 5MHSE 1AKJD 1QFHA 5ACZB 2DBLH 5MP6H 1FIEA 2ZOKB 5GRZA 2C1PB 3QUXC 3KPRE 3ZSSA 1JN6A 3KPLB 2IQ9L 1K4CB 3CC5B 3FTGA 2YZ8A 3O0RH 3NCEB 2DS4A 2E7CA 4NOFA 2DD8L 3QXTA 4OCLC 4R26L 5DJAB 3G04B 2XN9E 2Y9RT 3G6JB 3OB0H 1D5BB 4ZS6D 4ODUA 1NCNA 3T1WA 1VDGA 35C8H 3D3VA 1DEDA 4PBWD 1GAFL 2CKBL 1CZ8H 3MX0A 4OZGB 2AJ3B 4GSDH 4QRRD 4EBQL 2B1HH 4OZIB 5MENE 5IFJA 1DL7L 4XH2A 1X7QB 2VIRA 4IRJC 2VXUH 4MXVF 1NKRA 1H3WM 1HILA 3TN0D 3CSPA 3QI9D 5CS7A 3MJ7B 4I0CC 2RB8A 3UTTB 3MRHA 5IUSA 3CK0H 3RZWA 3D39A 4UINH 2P8LA 1CS6A 2AEPH 4P4RB 4LCCC 1YEHL 3BRFA 1KXVC 3DRQB 4D0BA 5T3XD 2ADGB 2I26N 5F7EH 4F37K 4XVSH 1F3JB 4MYWB 5B38A 3ULUC 1FO0A 4PS4H 3HAEH 3ET9F 4JN1L 3RIAF 3CMGA 1SJHA 3OSKA 1B0GB 3QZWG 4Y1AD 1DQQB 2UZYB 4PPTA 2D7OA 4H26B 2GW5A 1AGFA 4G8FB 3MTRA 1NFDA 3WIFA 1KC5H 2H2PC 1MFAL 2NXZB 4G8IA 2P8MA 3HAEG 3EYOA 1S7SA 3KXFD 2APTA 3BH9B 4BZYA 4N9GA 3TVMB 3VFWA 4N90E 1I9JH 1RFDL 3DVFA 1S8DB 3GSWA 3TN0B 5IJVA 3MRKB 2UWEF 3TA3C 3ETBF 5E8DH 1ND0A 1KLUA 1NGYB 5DF0A 3HG1A 3O4OB 1DVFC 4I18A 4PJ5D 4HX1B 3HC3L 4K8RC 4PJ8D 5HPMA 1F97A 1R24B 3NIGE 2FEEI 4MA8L 4YHNA 3E8UH 4J6RH 3BQUC 4G7YL 4LCUA 3FRUB 2ZWLT 1BF2A 2RR3A 1SHMA 4I2XA 5ICZB 4PJGA 3PABB 4U2ZA 3WE6B 3UROR 2NY3B 1KJ2B 1MH5A 1JGEA 2UZIL 4HZLB 4G9FB 2ATKB 3MODL 2N7BA 4HPYH 5EG6C 1X4YA 1YEEH 1JFQH 3S88H 5CLWA 3WXWL 1J8HE 3BPOC 3QIBC 1UJTA 1MRFH 4M6NH 2HJKA 5DQDL 3OGOE 3B43A 1UWXH 3N50A 3L5HA 2P7TB 2EDFA 1OQOA 4HQQH 4JREB 1JRHI 5DC9B 4TUJA 5FYLD 2PYFA 2DD8H 2FHCA 2NX5E 4ODTL 4M6OH 5D7IE 4KKLC 1LO3H 2B39A 1P6AB 5D7KD 3TF7C 1GYAA 3QUYA 2ZSVB 4AQOA 3EYQC 2VDRH 1H8NA 1N3NB 2X1OA 3VE0B 1LEIB 4PJ7B 3CZFA 5BJTB 5DI8B 2CRIA 5DJ6A 1DQJA 5E8PA 3D85D 5C0JA 1NC2B 1N0LA 1FAKT 3B2UC 4RWHA 2YXMA 3MJ8B 5FA4B 1T1XB 3V4UL 1TQCB 1WBYB 4P9HH 4KXZI 3IJSA 3IAQA 4TSCH 1FLRL 2W07A 4ONHA 2XPGA 4F33A 1IRAY 4QOKD 4KXZH 3U79A 1CGYA 4MD5B 3UBXG 5EU6D 3CU7A 4FABH 3IETA 4M7LL 2V5TA 2ZCKL 2ESVE 3FMGL 3EAKA 4QRSA 3UYRL 1DLHA 5T1KB 3H2WA 4OFVA 3FT3B 4XMLH 4GG6E 4KK6C 4GKNA 1GGBL 3DSNA 4L1HA 1HKLH 5A2FA 1F11A 4QRPB 4Y4FC 4PJEB 5A3ID 4WUUD 2E3VA 1V7NH 4BQCA 4GBXA 5T1MB 3B9KD 1I3RB 3PE9A 2CK2A 2CLZB 5HYSA 4G9FE 4PG2A 5L7XH 3U2SA 3ULVE 3C6LA 3H9SA 1QACA 4LARL 4ZQKA 3F7VA 1PY4A 1J8HB 2VZTA 3RFZC 2X4NB 1H5BC 2FB4L 3ARDD 4UU9B 2NY0B 2VQ1A 2O26U 3V0AC 5DMGD 4YXHH 2YRLA 3HNTL 4FMFA 1P4IH 1S7XA 1U8LA 2WANA 3SPVB 4X9GA 1HHGB 5GGVL 3FHQA 4WU5A 3X13B 4NBZB 3FL7A 1C12A 4UTAH 3OGCB 4QRRE 2DQDH 3KYNB 4CKVX 5T33H 2WBKA 1J0ZA 2XKSA 3PWLB 4JN1H 3HZKB 5I17A 4CN4A 1GVIA 2QADD 3EYUL 1CCZA 2F9BT 5C9JB 2FD6H 1EH9A 2JB6B 1KOAA 4HC1A 3F7RA 4QTIH 4BH8A 3W5NA 1G1CA 1ZLUK 4O4YH 3EUUA 4P3WA 5BO1L 4U7MA 1K8IB 3TCLB 1QLEH 5DQ9A 4RQQA 4X6DE 5E24E 4NQXA 2VDMH 3RVTD 4ELME 3N0PB 3TIEB 4M5YL 4PYGA 1CR9H 1WFTA 4GKSB 3FB7A 4JFZH 4LCCB 1DDHA 1EBPA 3C08H 4YFLF 1I9JL 4DTGH 3P9MB 3QUYD 1YQ2A 2ADIA 1VB9A 2X1QA 4HAFA 4TVSa 5KOMC 5ITBH 2AK4E 5K93A 5EC1A 3VFGH 3ZT5A 4Z0XA 2P5WE 2WBJB 3PP4L 5D72H 1DJSA 2PW2B 3KPRD 5EOQL 4WFHD 3S98A 5F1NB 4LIQL 3O2DH 4XPTH 1FNHA 5EIIB 4LEOB 5D1QD 3ULVD 2AJUH 2I27N 1I9EA 4EUPB 4U6VL 2EC9T 3QAZC 5I8CA 3KPMB 4ZFGL 4QGTA 2VDNL 2BVUA 2R2EB 1MJ8H 5HDBF 5KAQG 4OF7A 1NQBA 1VKXB 1U8IA 2Z4QB 4QHNA 1T1WA 4HS3A 1S9YB 2JCCB 3CZJA 4L29B 4X8XA 3CFJA 3MCG1 2A77H 3KJ6H 2F54D 1NBYB 4FP8H 4QNPF 4YHIA 5EH1A 4DKFL 3QWRA 4GW1B 1OP5K 2P49B 5F7KC 1YEGL 3T2PA 4X5LA 1CLOH 1OGAB 3TO4D 3JSSA 3QIWB 3HI1A 3BESR 5I1CH 4HEPG 3MODH 2V2TA 1W8NA 4FQ1H 3L3GA 2MPAH 5JW5B 2DICA 3TM6A 3RWHB 3GSNA 1OVZA 4GG8B 5FCUL 1BOGB 3TO4B 1CTOA 3I9GL 5DS8A 1CFVL 2W9DH 3ILPB 2NYYC 4OCNC 1EDQA 1VA9A 2BOCB 2GTZB 5E95B 1FLRH 3GIZL 5IWLA 3E6FB 4WI4A 4EIGB 1KLGA 4PRBB 3B6SB 5TDPA 4IRSA 4MJ5A 4CMHB 1CFNA 4N90D 2EYTA 4HBCH 5F6HI 2NX5B 1TDQA 1G9MC 2BERA 1I8MB 2C4FT 3FRPA 3V6FB 3M17B 1FNGA 3K2MC 2F19H 4XAKD 2XTJD 2DQCL 2LAAA 5KG9A 4F7CB 2GSGB 3HE7B 1QRNB 4KJWD 3EYQD 3C08L 1KGCE 4YIQB 1YECH 3D3VD 1XGPB 4HH9B 1UM5L 3KPRB 4L3AA 5KSBE 3QUXB 4IOFC 1S7TB 1OAUH 1S3KL 1BFVL 5DEGB 3VA2C 2SEBB 1JZ7A 1KTLA 1C08A 1QSEA 2WLZA 4NFDA 1A6VL 5DRZB 4LASH 1RUMH 4PRPD 2A2QT 4RGMB 1NJ9A 1T3FB 1KEGH 4NKIL 1ZHNA 3OKLA 5E2VL 3UTSD 4QTIL 5A40E 5E2UH 1AKJA 2V2XA 3LKRA 5I1DB 4QRPE 5DJYB 4DVBB 1QSFD 2NXYB 1KTDA 4OLEA 3MUGB 1IEAA 1BWWA 1XCTA 3EDKA 1PSKL 4XZUA 3KWWB 2B2XH 2D4FA 4DUXA 3CLFH 5HHME 3P4MB 5GRUL 1BLNB 2IGFH 1RZJH 1L7TL 1HIML 4LSPL 2FX9H 1MCKA 2MJWA 2PUQT 3QHFL 4R7DA 3ARUA 1JWSA 3JWDL 4P46A 2VDPH 1VHPA 2QR0A 4JO1L 5GISL 4RISL 4XPAL 4BSWA 3INUH 3A67H 3KPPB 1I8KA 1XGTB 4XVSL 4C56D 4O9HL 1KIQA 4GW4A 4D9RE 2JK5B 2AXGB 3I6LE 3LDBC 1H3PH 3T3PE 5KVDH 2G75B 4LFHG 3X14A 4EI5A 1NSNH 4RMSA 1FBIH 4OQTH 2CJUH 2VABB 4OCRL 1N59A 4OKVA 5GZND 3MV7A 4O2FB 4DVRH 1U41A 1ZS8A 2VXUL 1TTUA 1A3LL 2C7UB 3RJQB 2IWGA 3ARDC 5BZDA 1WV7T 4GAJL 2AXFB 4XBEL 5A16A 5C0CB 3GSOB 4HT1H 4XNZC 2Z9TA 3O9WB 1F3DJ 2A83B 4P9ML 2HLFC 2R4RH 3PDOA 3U82B 3ULSA 1TJIH 4LCWA 2ZSWA 3VRIB 3VXQB 5D7LE 4ZUWB 5IBLD 2PYEB 2Z0BA 1MIEH 2EYSB 5IQ7L 2YD7A 5L2KB 3QIUA 5KN5A 1JWMA 5E2VH 4R97B 4K23H 3MRMA 3WUWA 3IU4H 1YJDH 1DUZA 4YHZH 3FQNB 3UC0L 4ODSH 1UXSA 1PZ5A 4IIQB 1U0QA 3V2AR 3BP7A 5K59E 1RJZA 4MNGA 3HS0A 1INEH 5D1QC 1NPUA 3RVUD 4WFFD 2HWZH 1ZEAL 5ITBL 3WO4B 1D9KA 1VADB 5EZIH 1FN4A 2HT4C 1NC2D 1QHOA 1E4JA 2HFGL 5F7YC 4YPJA 3RIAK 5F93C 3WIIH 1YY8A 3RVXC 4MS8C 4NZUL 4JHWL 1PG7W 3ILQC 4OZFB 4CW1B 3VXRD 1D5MA 5D7JD 2WAHA 5FYKE 2H1PH 5DEZA 3KR3L 5KBNC 4UIMA 4JEGB 2DKSA 3NCYP 1ULVA 4FQPA 2MQ3A 2CMRL 4U1KB 4JFXB 3ALWA 2BC4A 3GEWB 3PL6C 4TPRH 4NRYB 2ZG1A 2H2SD 1A3RH 4FG6D 4GBXC 4C57C 5H37G 3LN4A 4KUZL 3BGFC 3BWUC 2FZ3A 3F7QA 4Z7UB 5IQ9B 5AAWA 4CVZB 5CBAB 1U8QB 3CK0L 1EMTL 5IHUH 3ZDZF 3K4AA 3C2SA 3I6GB 5BRZA 4R8WL 4Z5RA 4LF3B 3V52L 4BUHA 3TJEH 5EU4B 5FB8B 4NJAH 3WFCH 3PP3K 2FR4A 3QQ3B 4GKOA 1HXMB 3LS5H 5T33L 1S3KH 4WHCA 4M61B 1TJGH 4MNQB 4HKXB 1QBLL 1JGDB 3FHAA 5KS9F 3GI8L 2FRGP 2Z31B 3EGSB 3UBXB 2IMNA 3DPBA 3PIQB 4QLRA 3I3BA 4KJPC 5AYUL 3IVKA 4HGWB 4Y8DC 3VWKA 1B0GA 4G43A 3HE6D 2R1XB 1SJEA 3MFGB 2NTSP 3CX2A 4LLYB 2DKMA 4K7FB 5CJ8A 1OAYH 1PKQE 4XB8A 3UTSA 5J13B 1E4XI 2OZ4L 43CAB 4RX4A 3O41B 3BP6B 1JWUA 2F15A 5GGRB 2XG5A 3KG5A 5KZCB 3GSWB 2OXHA 2GEEA 1KCVH 2BNQA 4KJWC 1NCWH 3H3PL 2FJFA 4LRIA 5HYJE 4TOYH 2X4RA 2CR3A 4EXKA 4HWBA 1N8ZB 4FTVA 1PYWB 3MO1B 3T0VA 4R3SB 1SYSB 3BGFB 2JELL 2M8XA 3BH8B 5I75C 5DK2B 3BSZL 2FGWL 3EDDA 3V5DA 3D25B 4FQXA 2YPLB 4DEPB 4N8CH 2BY3A 3U0WH 4MJ6A 4KVCL 3QWQB 1OOAA 4W68A 4JPVH 4OFKA 4XBEH 2H6PA 2NY3C 4PGZA 3QDMA 2CKBA 1NCUA 4HK0B 1I9RH 4ZNEA 5LGJA 4FXGB 1NDGB 1GIGL 1QFWH 3RU8H 8FABB 1BBJB 2NW3A 5D71L 5HGDB 4OQTL 4KV5E 3LOWA 3TYFB 2YXFA 4O58H 5JO5B 4R4BA 1AHWB 1FL6B 3PGFL 3VH8G 4UNUA 3VCLB 3DO7B 1YEDA 4FQJH 3QXUA 4OKDA 3VGBA 1XGQA 3MSPA 5TPWL 2QKIA 4P57B 4PGBA 2VDPL 1MUJA 5D7IB 3TVMC 5C8JA 2VDLH 4LVNC 1TXKA 3KHQA 3FQWA 2Q7YB 4UV7L 4LSPH 2EIZA 3CNKA 1DEEA 3VFMB 4HUWA 1X5XA 4JFFA 4M9OA 4PJAA 3H9HB 5MEOA 5JHDE 4F33B 4LNVA 3L9RB 4I9WE 2GFBA 2NLJB 2XQYK 3PNWB 3S36L 1Q9OA 5D7SH 3L95A 3U4EA 4NQED 1EO8H 3TO2B 4PGCA 3TYGH 5C0CE 3D0VA 5HYJB 3IYLW 5MEQB 1IMHC 4JG0H 3DVGA 3VFRB 5L7XL 3C8DA 2LVEA 1U8KB 3OJMB 5KW9H 4QRPA 3ARDB 1IAKA 1E4KC 1JF1A 2XZCL 4DGYL 4KGJA 4O4YL 1BREA 3KPSD 1A6ZB 1N6QH 5EU5B 1N2RA 4YHPB 3BOVA 3OPZL 4HJ0D 1HQ4A 3CDYA 4TQEH 3EO1A 3EFFB 1BIIB 3BAEH 2Z93B 3RWFA 5JIIA 1EJOL 4S1RL 3ARPA 5EBMA 2BSTA 3FQXA 3BPOB 5F9OH 1T22B 2E8YA 1XF2B 1FFOB 1A7OL 3WS6A 5FOBA 1JPFB 4HF5L 4RA0C 4XVTL 3SPVA 3U9UA 3OG6B 3X13A 5I1GL 1RK0B 1GC1C 3QEQA 3PWPA 1MAKA 3KYNA 1DSFL 3MA9H 4M5ZH 1I85A 5F8QC 5I16A 5BMFL 5L2JB 1DR9A 2EECA 5DQJA 4Q9RL 1EGJL 3RPKA 2HT4D 4YE4L 3QFJD 4Q6IC 1K9TA 1Y6MR 4TNVF 4E41E 3W2DL 2ZUYA 3BP4B 3T2OA 3SGKA 3PWNA 2EDEA 1UB6B 1A2YA 2XXMB 1P1ZB 5K9JL 2XN9A 5DVOA 4HGKC 3VI3F 5MI0C 3TYGL 4UQ2B 2HN7A 1H5BA 4RMTA 5FF6B 7CGTA 1K8IA 3MBEB 3TCLA 4RWYL 1FGNL 4IS6A 5D93B 1A1NB 5B39B 2E7LA 1FVCA 4FG6C 4F3FA 3ZKSD 1QSZA 3WMSA 4G42B 3I50L 4NC2B 1EHNA 1MF2L 2UZIH 2BXYA 2FX8L 1EEZA 5T3XL 5HVGB 4J3XA 3ORJA 4WJ5B 2R1YB 1FPTH 1EV2E 3VFUA 4OF0A 3MLYL 2VJXA 1J1PL 1PFCA 4JVPA 4G9FD 1NGWB 3HC3H 1H15A 3P77B 3GMPA 4M6ML 4UT9H 3TP4A 2XZZA 2GJJA 4AIXA 1BBDH 1FNEB 4LLQA 1HI6B 3ARGD 2BMKA 3G5YB 4WI7A 4GBXD 1AD0A 1EVUA 4DGVL 5DXWA 1TVDA 4WO4B 1OTUD 5D71H 4MVBC 4PJ7E 5C07A 3OR6B 1S5HB 2BDNH 4PJDA 1BM3H 4WI6A 3EJJX 4AEFA 1F4XL 2CUMA 5FHBL 4XHJC 1MFDH 2OJEA 5E8EB 4AM0B 2V9QA 3UBXI 1CXEA 4L3ED 3I84A 1X44A 1FNSH 1IJ9A 5IFAH 4Q6IB 2Y4SA 4Q97A 4OBRA 5EIQA 2NXZD 5EU6A 3DMMB 1CL7I 2W1NA 1KF9B 4WDIB 5EOTB 1AI1H 4P4KA 3AY4C 5C7XH 2RQ8A 2PTVA 3HPLA 5I76B 3OKNA 1FG2A 3DHJA 4R90L 4WEBH 1M05A 3HRZB 3CX5J 5AWNL 4NT6A 1PEWA 1OHQA 4Z7NE 4KROD 1I1AC 1FNLA 5CMAB 3NCFB 1CZ8L 4Y4HB 1P5UA 4ODHL 4OM1L 5JTWA 4C54A 2WUCH 1TVHB 4YHYC 1HWGB 2MNUA 1A6AB 4N0YL 4JB9L 1S5IH 3GMQA 4TNWK 1LDPH 3L1OH 4O51A 2VSDA 1R3IH 5J56B 1KPVB 1VERA 4Y0GA 4LHUA 3QPQD 5CZVH 4JRYE 1CGUA 1CF8H 2ZUQC 1W0YT 4XCEB 1L6XA 4OZ4A 2CDFA 3BEWA 2R69L 4OLVL 5FCSH 4GMSL 4LPYA 1U8NA 4JDTH 4L4TA 4GRLB 2EXWC 1QR1A 4D0DB 5JIKA 4X6FB 3MLVL 2OR7A 4HH9A 4MDIB 4LCIL 4QYOB 4EUPH 1YJDL 1I8IA 1NFDF 5D1ZC 5AD0A 3WXVH 4OV5B 3HG1D 3SKMB 1XZ0A 1C5CL 1CGWA 4LCYA 1AIFB 1FIGL 1UZ6F 1ED3A 1KPRA 5IEHB 5EOCL 4NWTH 1J1XH 3R8BB 2IPUG 2ERJC 4ZPVB 3QEUB 3VD3A 5CBEA 3CFKB 4Z78A 1A4JB 5DYOA 2BVOB 3AS3A 1N6VA 3MRDA 1A1MB 2V2XB 4U1JA 3QDME 5C08A 1IGFH 3LKQB 4G6ML 5DJYA 5ENWB 4RWYH 4P59H 4JFQB 4X4MA 5GXBB 1TTGA 1OF2B 4HWBH 1WC7A 3VWJA 4M7LH 4J4PA 1A8JH 3MREA 3WHE1 3CD4A 3V8OA 2UUDK 1NBVH 3RTQC 3H7LA 3SOBL 4NO3A 5EUOB 2CLVB 3EO9L 3KS0J 3SKOB 1UB5A 3QI9A 3WNKA 3QG7L 2HLAB 2F5BL 3SDDA 5IVXF 1SYVB 2AABH 3MLYH 2X4UA 2YN3A 4R7DB 1PGRB 1B6UA 5C0AE 3RBSA 1KELH 5IW1A 5EBLB 1ZHBA 3DGCR 1TQBC 4QXWA 5L88L 4JR9H 1C5BH 2DBJA 5FA3A 2BSED 4LBEA 4MA1B 2FSEA 4F15B 2E8ZA 4MQXD 3KPSB 4F7PB 5DUBB 1HHIB 2KKQA 1BD2E 1S7WB 4PG9B 1VGEH 4UUJA 4X4XA 3TN0C 4J1UA 2W60A 3OHXA 2RCSH 1I8LA 4P5TA 1BAFH 1M71B 1NGQL 3MGTB 2NTFA 4N0UA 5BOPA 4XPHH 4PJIA 2XWBA 4ELMA 4F57H 3GSOA 4OGXL 3IFOA 3QISA 3WL9A 4ORZC 1DBMH 3L7EB 2XFXA 4G9DA 4RAVB 1VFUA 4DWHA 2EE6A 3GHBL 3MNVA 3QZWA 5LCVL 2WIIB 3F58H 1ACYH 1Z5LA 5FV1L 3MNWA 1E27A 3WD5L 1YNLL 3U4BL 2DWDA 1KT2B 4UILH 4KKCC 3SGEI 1JMZA 3WUWB 5BQ7A 5TE4H 4GAYA 3QG6B 2YMXL 5GRVK 2CLRA 3FQNA 3GRWL 3RHWK 43C9A 1HHHB 3AM8C 4OLWL 5CEXB 2YWYA 4HFUH 2CIIB 4U3CA 3TA3D 1P7KA 1MCWM 4W4OC 3QB7C 2R2HB 5I8EB 3VWJD 1X5AA 4KI1A 1ZMYA 1DBAH 1OP3H 5E6YA 2B0SH 3CXHK 2DDQH 3ZMRA 5LJYH 1XAUA 1A7RH 3PXHA 1DLFL 1AGEB 4OAWA 2W65A 4DGIH 1R3IL 5FHAL 4HIIA 3Q0HA 1CXIA 2Q8BL 3S34H 1J87A 4HKJB 4NNYB 1IC1A 1WT5A 3UMTA 4XAKE 1ZT4B 3WSQH 4BH7A 3G5XA 4XCCL 3UJJL 4OZFA 4NNXB 4CW1A 2D31B 2R23B 4RAUB 2NR6C 5I1HL 5IVOA 2YBRB 3SDCD 5IV2B 5FYJH 5D2NC 2IG2H 3ZKMC 1UJ3C 2YKLH 3EO0B 4LLUA 5BXFB 1JYXA 4HWBL 5C0NC 4U1KA 1VFAB 3MLXH 4LGSB 1ADQH 4ODWA 5ICXB 1GIGH 4R90H 1LNUB 2IALA 2AKRB 3IDXH 1LD9B 2V7NA 2HA1A 2HJLB 4QRUB 1A7QL 2NQCA 1NGQH 4RFOL 2OYPA 2OM5A 2AQ1A 4PRNA 2G5BA 4NN5B 5JPNA 1N4XL 2NMSA 5HXMA 5HDQL 2AV7B 2Y36L 2VZSA 2OZ4A 4OCSL 4AG4L 5E7FA 2F8XC 3ARZA 5KANG 1I1AA 3C9NB 1EPFA 4YFDB 4N5EC 4U1HA 4Z5RB 2JELH 3DWTA 5F89B 3PWVB 1KJMB 4TSCL 5EZJB 4UDTA 1I7ZA 5FUOH 3X3GH 2Q20A 3AROA 2IH1B 3HAEA 3MV9E 4Y5VA 5ESAB 5KSUA 4S1DD 1CBVH 3DX7A 4M61A 1B9ZA 4MNQA 5ILTL 4CRPA 2VLRB 1B2WL 4LQFL 3C2AH 3VU2A 3ZE1E 4XPTL 5IHZA 4KY1H 2C3WA 3SN6N 3GI9L 5B38G 3FZUD 1VGKA 4JZNA 5EOQH 4ZFZA 5I1JL 3EO9H 4KU1A 4LLYA 4NUGL 2Q76A 1MJUL 4L3EA 4QRQB 5IEKA 1BD2D 3I9GH 4JANA 1KIUA 1RIHH 1PBYA 4N8CL 1CXKA 3O41A 1BOYA 3QO0B 1V3LA 2NCMA 1TFHA 4RA3A 1GC1H 1FLTX 3WHXA 4X7EC 2Y07H 4L8BA 3FQRA 2H8PB 4IDLA 1KENL 3G6JA 3QHTC 3QULB 3SY0A 3B9AA 2NY6C 4KQ4L 1HE7A 2EDKA 4U6XB 1N6UA 2IANE 4FP8L 4DKFH 4JJHA 5C6WH 1RULL 1PY9A 1JHLH 3DUHA 1G9EA 2F53D 5E4IA 3W2DH 3B2VH 4MA3A 3D25A 4X9HA 1N26A 1LEKA 4K3GA 4LSUH 1EAPA 4MA7H 4GS7B 4YPGB 5AG9A 3VXRB 5J06A 4H1LB 1UM6L 4RMRA 3H0TB 1G1YA 2VDOH 4FQLL 4PRHE 5GS0D 4S2SB 3WJJA 1F3JA 4WGVB 5KVGL 1VACA 5CD3B 5ISZD 1LGVA 2GSIB 4KI5E 2ICEA 2VC2H 3O3DB 2X70A 3QQ9C 4H5SA 5CGTA 1A6TA 3S37X 2CRZA 4NKOA 1IARB 1MHCA 1NGPL 1LE9A 5TE4L 1JHKL 1LK3H 1Q0YH 3GK8H 1EFXA 1DQDL 4JFOB 4B53A 1QLRA 2HH0H 4OZHF 8CGTA 5CJOL 1GGIH 5IJVB 3L7FA 1UFUA 3OG4B 3OPZH 1R5IB 1NGYA 4GXVH 3GHBH 2C1OA 4MSWB 12E8L 3TA3B 4PJAB 1DQLL 1FP5A 5HGBB 2A74A 1ZT1A 1TZHA 1Z6JT 4Z7NF 4M7ZB 1DBJH 5F9JB 3O6KH 3TO2A 5E8NA 4K3EH 5DO2C 3NH7L 2YPVL 4XAWH 5C09A 3MLUH 3ZE0E 3NZ8B 1T83A 2EZ0C 4YHOL 4NN6B 3V5HA 2HJKB 2PO6D 1GL4B 2E7HA 5AAMA 2R0LL 2JB5H 2GAZA 5D7KE 4OD1L 2PTTB 4OZFH 1X5GA 3C60A 3BKJL 4OT1H 1W0WA 3RY5A 2PW1A 1JGVL 3F6LA 1MJUH 3ILQD 5ACLA 2NY4D 5C0FA 4I77L 3X12A 2A9NL 3OKEB 3VWJC 4PY8I 1XR9A 2Z93A 1K4CA 3RWFB 3DX9B 3V4UH 1I1RA 1BZ7A 2J5LB 1J8HD 5EC2A 1XF2A 2YPKA 1FFOA 2LABA 1KFAH 2MOVA 2X42A 3WN5A 4NQEA 5IG7B 4KKCD 4ONFL 4YXHL 4XHQA 3EDFA 5KJRH 5IVXE 5DRWB 3O45B 1LO2L 1EEQA 4M93C 1T1XA 4HS6B 5E6ID 3TEUA 5ITFB 1DQMH 1LHZA 3BN3B 5GGSA 3GSUA 1OTSC 3VFGL 2EDYA 5C08D 4X7TA 3RUGF 4KI5C 3BDBA 3S5LA 2VC2L 3C6SA 4N8VG 3S4SB 4LAQL 1WTLA 3TBSB 3DRQA 3ZTJH 2VLJA 5IB4B 5HHQA 3HR6A 1CIDA 3MRQB 4XCFH 1F11B 4ONGH 2YEZA 4JFZL 2VR5A 3FB6A 4AIOA 3GIVB 3I02B 2WW8A 1SEBB 3VFPB 3P0VH 2H3NB 3WJJC 5LQBH 2ADJA 5DFTA 2WV3A 1QQDB 5EIVA 4DKDC 2X40A 3C6LB 3LSOA 1DCLA 3A6CH 3BYTA 3ULVF 2IAMB 5FM8A 3AC0A 1AC0A 3WN5C 4MCYB 4Z7VF 1S8DA 3MJ9L 2VYRE 5E4EB 4NQDA 2QSQA 2AI0L 2NR6D 3LEYH 4ZODA 1S7XB 1U8LB 4HMEA 5LBSH 3HG1B 2APBA 2APWA 4I18B 3C60D 2QHRH 4F8TA 4M8QA 1KCUL 5F9WC 1T6WA 2X1WL 4P0DA 4JCMA 1GOGA 3CVIH 3CCHA 4R0LA 5FGRA 3GHEH 1FNSL 5IIEA 3OR6A 5DVLA 3MLSL 3X11A 5I8OL 1EGJA 5CP3A 3GSNL 4OCWH 2DF3A 4LKXB 1FGVH 4FQXD 4LPWA 4J3WA 5C9JA 3C5JB 1HILB 2OMBA 2P8LB 4L4VD 5JXEC 2JE8A 1UM6H 4FOMA 1G6RA 4F9LC 5CEZL 2BHZA 3DV4A 2ADGA 2IANB 3HCVA 2D3VA 5D2LE 1BF8A 1FFNB 5E4EC 4G80B 1IM9D 1JHLL 3BD4A 4X6DB 5AZ2L 4I4WB 4NCC1 2CDEB 2X1XR 3VE0A 4GKSA 3QO1A 1R3JB 3S8WA 1HYSD 1WCBB 4YDVA 2CGRL 3FB7B 3CZFB 3ZDYE 3S3SA 5BJTA 5DJ6B 5E8PB 1S7SB 2VXQL 4XCFL 3OAYH 1JF6A 5C0JB 4IRJB 3BH9A 2UY7A 4OFIA 4WV1B 5I1CL 4Y1AB 2Z35B 5J11C 1N5AB 4ERSH 5CUSH 3UJTL 4Z7WA 2IPUK 5L88H 5CIPA 2C3GA 1ADQA 1Z2KA 3QQ9D 3JWOL 2AK1H 4NYLB 5FFLA 1FZKB 4M7JH 4NM8H 5JPMA 2KZWA 2C4FU 1G7HB 1CFBA 3IU3B 3LKSB 5C07D 4N0FA 3E2HC 1QKZL 5HBBA 1DE4A 2W0KA 4OZFG 2OJZH 2DQFB 4GKNB 4KDWA 4XCYB 5CGYC 2P4AB 1YN7A 4XCEA 1WITA 2R0WL 3SDYH 1WWAX 1S9XA 4G9FA 4UTBH 3U0PB 3TH2T 1KXQE 4P59L 1TPXB 1JE6A 2AEIT 4ZUTB 1T21B 2X7LB 4JY6A 2O61B 4M6OL 4XNMB 3U9PH 3RDTB 5E9DA 4PREA 2DQEH 1JF5A 3P0YH 4D2NA 3HZYA 2F5AH 3RI5F 5D9SB 4YDKH 2JCCE 4O2EB 5F7WC 1EO5A 1GZPB 1RZGA 3LVEA 3U4BH 1CK0H 5J9PB 5IEHA 3BGMA 1HH6B 4A6YA 1CE1H 5F88B 1B0WA 1WAAF 3KJ4C 3ZE0F 4WU5B 4XI5C 1YEEL 4GAGH 5CBEB 2WP3T 1RUKL 1F4HA 2F8VA 1ZHKB 5DD0L 2Y5TB 3G5VA 3NH7H 1NC2A 4PP2A 5K59F 3VXPA 2GTZA 2LTQB 3MBED 2MHAA 2NY1B 1G0DA 4I3SH 2BNRD 4PD4J 3JV4B 4IIQC 3C5ZB 3VMNA 3VW3L 1TLKA 4QKXB 1QFUH 1LP9F 3LZFL 1V3KA 1F4YL 4JREC 5EBWA 3Q6FA 2NW2A 3DECA 3KR3H 4XVTH 4CN6A 3K8MA 4HCRA 5T3ZD 1C16B 4NO2B 3SE8H 3FT3A 1CLYH 3RZCD 4ZD3H 3O8XA 5F7LB 3JV6B 5C2BH 4WW2C 4AQ1B 4NCDA 4LSQL 1G7IA 2GSGA 1REIA 2AJXH 2VZOA 5EUOE 3CSYA 3BAEL 3L6FB 4YIQA 2E6QA 4JG1H 4FXKB 3MQIA 1AO7B 3GSQB 1QRNE 1HSBA 3MXVL 1JPSH 5I71C 2DMBA 1NMCC 4OD3L 1F13A 2YD6A 4UILL 1IKFH 2FATH 5DK0A 4BK4A 2A1WH 4MJ2A 4M1GH 2CUHA 4ZO8A 2HVJB 3A6CL 3AMLA 3KPSA 4F7PA 3FQTA 5GS1B 4KH2A 4YBQD 2A6KB 4ODSL 4QRPD 4UU9A 2VB5A 5KSVB 4CVXB 2FHBA 3ZYIA 4IJ3C 4EI5C 3PL6D 3L3DA 3D3VE 4NKMB 5EC1B 5GJSH 2WZPD 5JW3H 3MBXL 4NC1C 4JDVB 1E6JH 2ZUWA 5DD1H 15C8H 4Z7OF 2XWBB 2LQRA 1JRHH 4OF5A 3EYUH 5DLML 3TBVA 2D03L 4GAFB 3NAAH 4QOKB 5JW4M 5DZNA 1D5IH 1RMFL 1AR1C 4KQ4H 4HMDA 5IK3A 1M1SA 1UQSA 1TETL 4JFFD 4Q0XL 2B4CL 3C60C 1AGBA 1IGCL 4IOIB 3HUJB 5EUOF 3AB0B 3TIDB 4PUBH 4JO3H 3O81A 4HUVA 4X5XB 3QPXL 4HUUB 3S3PA 4TN9A 1BMGA 3SQOL 3A0OA 2R2HA 5GGVY 5I8EA 3ARSA 3KHOA 4RQQB 5F7FA 3ZDXF 3KYOA 2HJFA 1A6WL 4XPFH 2FLBT 4OZGE 5BRZE 2DQTL 4ZPTA 1F4WH 4FA8A 3C2AL 4L8DA 3PV6B 3MNZB 4QTHB 3GSNB 1I4FA 2MCG1 3JWOC 3MV7B 4GG8A 5DDHB 4QCIB 1ZS8B 5CSGA 3SDAC 4F7MA 3M8OH 5KSBA 2C7UA 1ZAGA 5IB5A 5C0GA 3MRIB 3UPCA 5JORB 2JB5L 5IM7A 3JZ7A 2VL5B 1NMBL 2R0KH 3FN0L 2EH8L 4OCSH 4QGYA 2ENYA 5L6YH 1X4XA 1S7RB 1PEZA 5F1OB 3V9FA 4P23A 5DFVD 5EOCJ 1XF1A 2DQEL 4LSRH 3STZB 2QSVA 3VDCA 2YRZA 4Z7VE 2FWOB 3BW9A 4KDTA 3SDDD 2WP3O 3ARBD 1SMOA 4RNRB 1EIBA 5A3IC 2AV7A 2WSKA 4JLRA 1MCLA 4HK3N 2EH7H 1I1AB 3C9NA 4X8JA 4RX4D 3MLWL 5TDNA 1AXSA 3AFLA 1K6QH 1FO0L 5DRZA 1DVFA 3C8HA 3IXTA 4M1GL 4KPHH 5E1AB 4V1DA 4ZTPH 1IKFL 2FATL 4MNGB 3BRGC 2Z8WC 1QKZH 1HQRB 4R4FH 5HDLA 3H3KA 1ZT7B 2VDQH 4OLVH 1UM5H 1NJ9B 2H9GA 5ISZA 2UWEE 4G5ZH 2AK1L 3MV9B 4IDJH 4MD4B 4OIIH 3BISA 1L9MA 5T5NF 1J05A 1T7VA 1UH3A 1I7TB 4O2CA 3FKUS 4BSJA 3PXJA 3JTSA 3MCLH 5D70H 2BSRB 3DBXB 5BOZG 5ID0B 1FQ9C 5ALBH 1MCIA 2VDOL 1EZVY 3FT2B 4JB9H 2P47B 1XCTB 3MOBL 3D69B 2QADC 3KYMA 1IGTA 2VNCA 5CEZD 3RNQB 1CDGA 1YC8A 4L4VB 3BD3A 3HNVL 3ARXA 4U1NA 3KJ4B 4MB5A 5ADOH 2PNDA 4NQSA 2VE6B 2APXA 3RBGA 5DUMH 3L3OB 1FE8H 1RUKH 5C9KA 5CJQH 4HBQA 4GSDL 4F7CA 2QR0B 2OXGA 3RHWF 3ULUL 4XWGL 4YC2C 3MROA 2EDLA 2HT3C 3KPPA 2K7PA 3RL1A 4BK5A 4S10A 3QDGD 3TH4T 1AXIB 3EZJB 5KS9B 1DANT 4LSVH 4XI5D 3KPRA 4YNYB 4XWOC 4GMTL 4XC3H 1II4E 3EOYG 2SEBA 3LEXB 3Q2CA 4OIBA 1XEDA 4AEIH 5F7MC 3V5KB 4MQXC 1WWCA 2B1AL 4KQ3L 4M7KL 5DA4A 1ZLSL 3VA6A 3EOBA 3RIFF 2GSIA 4YFEA 1MCBA 2PF6A 4PJ7F 3VRJB 1IQDA 3T0EB 1JIBA 5BV7B 4PP1D 1D6VL 4NZDA 3MR9A 2A83A 1MCFA 2D0GA 4Q7DA 4POYA 3NCMA 4N5UA 3Q6GL 3QAZB 1CGVA 1OTTC 2DTML 4JPWH 4YXKH 3BZ4B 3LKPA 1AQDB 3O4LB 1XF3A 3RPIA 3QIUB 5KN5B 2J8UB 5FKAA 2CDGB 4LKCB 3QPXH 5E56A 3I75B 5J1TC 3LCYA 2ZG3A 5HGBA 2ZCLL 1I7RA 4HC1H 1JPTH 3SDXE 4XVUD 5C6TH 1MCSA 4NN6C 1PZ5B 2ZPKL 3V5DB 5L2KD 4MB4A 4YBQC 4OM0H 1QD0A 3BQUA 2QQNH 2K3TA 2QBWA 1OWWA 4OBSA 1NANH 1LILA 2DN7A 2Q7NA 3HMXA 4ENED 3PGCA 1ZOXA 4K3DH 1QTYT 5C0CD 3MA7B 1A64A 1OAQL 3FQUB 4OGYH 4E41A 3X14B 1XIWD 1A14L 4WUUA 3M07A 3E1F1 3JWDH 3ARED 2W59A 5JO