1CS6A

N-terminal fragment of axonin-1 from chicken
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
382
structure length
382
Chain Sequence
b'RSYGPVFEEQPAHTLFPEGSAEEKVTLTCRARANPPATYRWKMNGTELKMGPDSRYRLVAGDLVISNPVKAKDAGSYQCVATNARGTVVSREASLRFGFLQEFSAEERDPVKITEGWGVMFTCSPPPHYPALSYRWLLNEFPNFIPADGRRFVSQTTGNLYIAKTEASDLGNYSCFATSHIDFITKSVFSKFSQLSLAAEDARQYAPSIKAKFPADTYALTGQMVTLECFAFGNPVPQIKWRKLDGSQTSKWLSSEPLLHIQNVDFEDEGTYECEAENIKGRDTYQGRIIIHAQPDWLDVITDTEADIGSDLRWSCVASGKPRPAVRWLRDGQPLASQNRIEVSGGELRFSKLVLEDSGMYQCVAENKHGTVYASAELTVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AXONIN-1
publication title The crystal structure of the ligand binding module of axonin-1/TAG-1 suggests a zipper mechanism for neural cell adhesion.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 80
structure length 382
sequence length 382
ec nomenclature
pdb deposition date 1999-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cs6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cs6A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cs6A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cs6A02
4S1DD 4GBXA 1RIUH 2APXA 4BQBA 5L2KE 1CE1H 2M26A 4JR9H 3FT2A 3F5WB 1X5XA 5EC1B 2YEZB 1X5JA 2HFGH 2C4XA 3UTTD 4FP8H 5D93B 5ACLA 4LEXH 3VFRA 2YBRB 5GJTL 1QRKA 4PS4H 5DJYB 5FIEA 4JM2B 5KSBA 3KLDA 3O4OC 2BMKA 1D5XA 5EO9B 4ISVB 3BPCB 5CEZL 5KSAA 3BI9X 4U1KB 4IRJA 4CADA 1F13A 4MHHG 4YIQB 1UM6L 1NGQH 4Z0BH 5GRVL 3ULSB 1G7HA 1KTKE 3BQUC 2F5AH 2X05A 4PLNC 3FRUB 3SDCC 5GGTL 1P53A 2NPLX 2OSLA 5E2VL 3MJGX 1MVUA 4W6XB 3IXAA 4M00A 4F9LA 4LHUG 4FFWD 1JP5A 3IDNB 2IQ9H 2BVQA 1WBZA 4S11A 5CJQL 3F65A 4NZJA 1P69B 3C5ZA 4G6FD 3WL9B 1ZE3C 5BS0A 1EK3A 3EYQD 1X44A 1MCCA 1QSED 3KYNA 1NBYA 1QVOB 1ZXQA 5DRWA 3C08L 2J8UB 5ALCL 4G9DB 3MRJB 4CGTA 3TH4T 4G8GB 4P3CH 2R69H 5TDPB 3GSNB 1G9NC 4MXVF 5INDA 4N0UA 4I0PB 3VWJA 4FTVD 4Z5RA 3J7HA 3PHSA 4Y5YA 2EC9T 3D3VD 4PRNB 1KXQE 3X17A 5E00B 32C2A 2H3NA 2VQTA 2FRGP 5IK3A 2VXQL 4PRHE 4AENA 4XVTH 4R2GD 1XGYL 4PUBH 5IT2H 4LSVL 5DXWA 3ZKNC 1CFTA 1DVFA 3LOWA 4K3EL 4L4JA 4JO4H 4KK9D 4M6OL 3KG5A 2J8UF 4FFVC 5IVNA 4G80A 2NZ9C 4GRLA 3PE9A 3O8XB 2IPUG 3TA3B 3QDMB 1A2YB 5ABDE 4PV9B 3RU8H 3S4SB 2VIRA 4G7YH 2AEPH 1FLRL 4ZFGH 2CJUL 2APWA 4NRYB 4PRDA 5K33A 4CUCA 1RZ8B 5D9SB 1NCTA 1XF5B 5HYSA 1ZLWH 4YQXH 2BRRH 3MRCA 3TJEL 2H2SC 2ED8A 2G75A 1UVQB 1TQBC 2BVPA 4YHIA 3UYRL 3ARBB 2VZSA 2W92A 2R15A 3B6SB 5ELIA 5JQHC 2P8MB 4NZRL 4E9LA 2XWBB 1V7ML 3VG9C 3H2WA 5F7DB 4XAWH 3FQWA 5LGKA 1J1PH 4LCUA 4Z7QF 1NAKH 3T0EC 1AP2B 4LQ1A 5ETUA 2E7LC 1T22B 3SKOA 3VGAB 1R3HB 4RA3A 4Z95H 1IKFH 1V3MA 3VFTA 4JY5H 1LEKA 2Q6WA 1M7DB 4HGWA 4ZPVA 1NC2A 1NEZG 5D70L 1FFOB 2NX5D 1N6VA 1IKNA 4PJXB 4MA8H 3G5YA 4ZD3H 2ZCLL 1KCRH 4JFYB 2XG4A 3RWJA 4LSTH 1Y0LB 2VRAA 1FG2A 3HPJA 1S9VA 2EXWD 4RFEB 1IAKB 3CXHK 1CFNA 3E2HC 4HIJA 4N0CC 5ID1A 3IDGB 3W0WE 4ODUA 3GSVA 2XXCB 4U6HB 3GMOB 4NO3A 4RQQB 3JWDL 4LVNC 4HK3N 3QEQE 1OT2A 5KG9B 3MRQB 2VN7A 3M07A 5ILTL 4LF3B 1EBPA 2EKJA 2F53A 2OXGA 3UTZA 4Q2ZA 1Q9OA 1F3DH 2YWYA 5GXBB 5E7FA 3O11B 4X6EB 4J23A 4F7CA 4EVNB 4PJXF 3FFCD 1FVCB 1TJHL 5INCA 4UDUB 3T1FB 2ADFL 1T89A 4Y4KB 2RIKA 3IDIB 1ZSDA 2NYYC 2PETA 5F6HI 1A1MA 1ORQA 1YUHA 3U0PA 1UYWL 1KCVL 1J8KA 1H8NA 1L0QA 4PB0L 4ZTOH 4LRNH 4YO0B 3FB8B 5EOQL 2DLFH 1KT2A 4WUKH 3ILPB 2VDLH 4JRYE 3P9WB 1G0XA 5T1MA 1RQ5A 3NCJH 4ZFOA 4RWYL 1HYRC 1MAML 3BWUC 1G6RA 4KXZH 2KKQA 3SGDH 4EN3D 1S5HB 1CLOL 4KZDL 1T21B 3HC3H 5AWNL 1BZQK 4HDIA 1G1CA 1RULL 1S8DA 2DKMA 1HQ4A 2X1XR 1KPUA 3BP4B 4PJ8D 5D96B 7FABH 4XVUD 2CKNA 4U1SB 3DOSA 5KANG 3NA4A 1IM3A 1UM5H 2VXUL 3HE7B 4FQJL 1N4XH 1QO3A 1QUNA 4Y19A 1B90A 4PGBB 4XXDA 4OGAD 4JHAH 5IW3A 4HG4J 2YD7A 4P46B 3VW3H 3QFJA 3KYMB 3QWQB 3QAZC 4EUPA 5J57B 4RA0C 2D4DA 4PRIA 4HXBL 3ZDZE 3LRHA 1JHLH 3QXDB 3MJ8B 5E24E 5DTFB 1NLBH 3AS1A 3SO3B 2I60H 4R97B 5GS0C 2ZPKL 4NDMB 1UWEL 1T2JA 4IOFD 4HIEB 3SGJA 1V5JA 3TYGL 1T3FA 1MRDH 4O5LH 1T80A 2C5DC 4GJTB 2CQVA 4PJGB 1U8LA 5BO1L 3TFKC 4F80A 4X6FA 4NNPH 5IHUH 1B2WL 5F88A 2GJ6A 43CAB 5HYJA 3UTPD 4ORGB 3P9LB 3KPQB 1HI6B 5E6IB 3KLHD 1FPTL 5CGMA 3P4OB 4IRJC 3RVTD 5HGAA 5DFVC 3IFOB 5JO5B 5T3XD 4HZLA 5D71L 2APBA 3BD3A 3V0WH 4U1IB 3GUTB 2XQYK 4X98A 5D7IB 4RRPA 5LGJA 4Z0XB 2HT4C 2QQLH 1H15B 3HUJA 3MBED 1A64A 3OKEA 3AXLA 5J6HB 3GBLA 3SE3A 5C0CE 1L9MA 3EO9L 5ENWB 4JRXA 3ULUH 5C3TA 4H0IA 4OB5L 2A77H 2GK2A 3DV4A 2P8PA 4JFFA 4PJGF 5JW3H 2IBGA 4P48A 1T2QL 1FNEA 3C5ZC 1NH6A 1A3LH 4NJ9L 3BSZH 1EERB 4OCRL 5F9DC 2NY0D 1RZIB 5A2LH 5D2NC 2FJGA 3RUGA 3ZKSD 3NFPB 3DUUB 4P2YA 1I3UA 3O6FC 2BHUA 8CGTA 3CDCA 5E4IA 5C0NC 4FNLH 1HXYB 3S37H 5DFWH 1QZ1A 5D7IF 1KENL 2X9YA 2E9BA 3LS5L 4G5ZH 2HG5B 1T0MA 1QNZH 3OAUH 4IHOA 1J0KA 4ODHL 4NYLB 2VLRB 3VWJC 3EYVA 2IAND 3OHXB 4QWWC 4Y5YC 3MNWA 1N5AB 4WUUD 4EKXA 4MNGE 1GRWA 3MA7A 4XNUL 1LE5B 1INEH 5I76B 2OXHA 5MENB 3FN0L 3UJIH 5JDSA 3QJHA 2HJLA 4I3SL 4MDJA 4PJIA 1DVFC 1AIFA 5HGBB 1IAIL 2DBJA 3VFVB 2BJML 3B4NA 1MQKL 5FHAL 4YHOL 3QDGD 5DJAA 1KSRA 4I9WE 3OB0K 4MXQD 4GRLC 1CFSA 1GGIH 3AFLA 5DK0A 1T1WA 5FGCB 2VDMH 4QHLB 3BZ4B 1BZ7B 2X1OA 4GLRI 1HNGA 2ZSVB 5BRZA 1MELA 3IJHB 4D9QE 1WIUA 4UT6H 4HUWB 1KCSH 2CMRH 3BUYA 4GSDH 3EOBA 3VXUE 2FEDD 2VXSL 1SEQL 3LSOA 5C0EB 3MYJA 1VKXA 5IMKB 3WIHA 4JGMA 3RVXC 2DM3A 4YK4C 4WI4A 3D39B 4TTDC 4UILL 5F1KC 2JTDA 4NO0B 5ITFB 4NQXB 4P5TD 5IBUG 2A83A 3GJFA 4BQ9A 5FYJH 1NGXA 5DHVB 3G04B 5FYJE 2CGRH 3V95A 4JO2L 1HILB 5J12B 3PXJA 5T1KD 3R8QA 2FWOB 2R1WA 4C56B 4G9FE 4HC1L 2EDQA 4XP9L 2HFTA 1SJHA 4EBQL 1YPZA 2X6MA 3QH3A 1WT5A 5FUOH 2BNRB 5J9PB 1ETZB 3MUGA 4N0FA 1IEAB 5AUMA 3JUZA 5LGHL 1A4KB 1FE8H 3DROA 4GW1B 4L29B 5HJ3B 1M05B 1A7PL 2BSTB 3LZFL 3EYUL 5JORB 1CE6A 4QRPB 5L6YH 4GW5A 3TIDA 4X5XB 1YEGL 1MJJB 1RY7B 4JDZA 4D8PB 5I6XC 1IKNC 4WFEE 1IGYB 4CVZA 3MTRA 5CD3B 2W38A 4XP1L 5HVHB 5F8RC 5MEPB 3ZYZA 4TVPE 4JHWH 3OX8B 2PO6B 5HGHB 1OSPL 5I19L 1KIPB 1MEXH 1JI1A 3MLWH 3SGEI 3CH8A 4A6YL 1CFQA 4H26B 3KS0H 5DC4B 3LVEA 4IBLT 3GMLA 5FK9B 1MFEH 3UJTL 2EDDA 4F3FB 3CFCH 4GG8A 1R3KA 4F7PB 4PY8I 2GAZA 3ARPA 4XWGL 1IQWH 1EFXB 2L7JA 3HG1E 5ACMA 1BD2D 3S5LA 4OIBA 4M4RA 3TWCL 4R26H 1U6AL 4J2XA 5CKAA 3ZHKA 1MWAH 2CLVA 1IC7H 5GRZA 5SWSA 1T1YA 1TTUA 3D85B 4LCYA 1BVZA 1RJCA 4QTHA 1T89C 3KPRA 3QYCA 3EOYG 2NXZD 1YEKH 3IETB 5E1AB 1HK6A 1FYTB 2X70A 4M6AA 3AVEA 4OCYL 3HNTH 4PJ5B 3RKDC 1T1XA 4JLRA 5E99H 5JXAL 1NUDA 2VDOL 2YA2A 1EV2E 2NY7H 1RK1A 1KN2H 3SKNB 1MIMH 2R0WH 4Q0XH 5DR5L 3P4LA 1W0VA 3TO2B 3DO7A 4MXVE 3C8HA 4LLUA 4MA3B 3MV9B 4TUKH 3MV7D 1CXKA 1AXSB 3VH8G 3FN3A 4R8WL 2V2TB 1OM3H 4MWFA 5IB5A 1T4KB 1ZGLM 1GZPB 3DGCR 4JZNA 4D0CA 5I8KH 2DJUA 5BZDA 1JNNL 1CU4H 2XZCL 1ZA3A 2ZNXA 4O58L 1YN6B 4I18B 3WUWG 3PHOA 2CRIA 5IFJA 3HZYB 5DZOA 4MNHB 3CFDB 1NFDE 7CGTA 1QLEH 2CK0H 5FKAA 2P45B 3HS0B 4OLUH 4HUVB 1ZWIA 2J8UE 3H3PH 3D48R 3QPXH 3D87B 4QRTA 4HWZB 4P2OB 5IBLD 4G8GE 5SX4I 1LGVA 5FUZH 3C6SB 2HKFH 4OKDA 1JPGA 4QXUH 2X4PB 3QNXA 2OP4L 4LLYA 3QO1B 1HHKA 3H3KA 4M93C 4I8DA 4Q6IA 3HMWL 1RJZB 1YEFL 4KU1A 3WNPA 3TVMA 1NGYA 1AGEB 1DE4A 2AQ2A 4L4VB 3DVNA 3MROB 1ZA6A 1JF1A 2EIEA 1NAMA 2VL4A 5FOBA 2R4SL 3SGJC 1N6QH 1AO7D 4YHKH 2WM0A 3MRLA 4TSAL 3T65B 1IBGH 4KKAD 4LIQH 4ZDHB 1DQLH 3BZDA 1WF5A 4QTIL 4ZS7L 1I1YA 2R2HA 1KJ3H 1CICA 1KYOK 1KXVC 1A1NA 3LS4L 2RR3A 4JANA 4ERSH 4DZ8B 4LQFL 2J5LC 4BM7A 5I2IA 2CUMA 5C2BH 4QOKA 1WWCA 1FL6A 2WWMD 1B0RB 2EDJA 1FQ9C 4M9OA 1JPFB 4D0DA 1R3IH 1OLZA 2ICEB 3QDME 3ISWA 2C3WA 3TF7C 4TTGA 2ITDB 3T77B 3QHFL 2XV6B 4UTAL 4PV8B 3V4PL 4OLYH 4Y4KD 4UIMB 3QXAB 1DLFH 1OLLA 3ROLB 4LLDB 1XF3A 3RZCD 3P2TA 1BGXL 2VC2H 3SE3C 3X14B 1YJDL 5CWSB 4J8RB 1TCRB 1YDPB 4WU5A 3KYOB 1L7IH 4BSVA 2LVEA 35C8L 3MRFB 2B0SH 2DYPA 4NBYB 1C5BL 3RGVA 2XA3A 4LCCA 2BNUA 2GFBA 1AGBB 1Q38A 4GG6A 3NFNA 4MX7B 5D7SH 3QNZB 1FCGA 3RHWF 3EYSH 3K2MC 4PLOB 2BDNH 1A7OL 4DZBB 2VXVL 4JFXB 1XT5A 3U4BH 3QI9D 1CR9L 5DMGC 5D7LB 4J3UA 5F7UA 2W07A 2O5ZH 1IGJA 4GAJH 3H9HB 4X5LA 1FAKT 4IMLA 1F02I 3GMQA 4F33B 3H42L 4H25B 4ZAKD 4R4FL 2DS4A 3U0TA 5C08B 1TZGH 3RL2B 1EEYA 3DX8A 1CIDA 1T66C 1PLGL 3NTCL 2X1WL 3QIUA 4YDLB 4D9RD 4LK4A 4Q9RH 1CYGA 1OGAA 3DI2B 5IMMB 3HZVB 2HVKA 4ZUSA 2A9NL 3K1DA 4AQOA 3WIIH 4ZFFA 3HNSH 4K23L 5HI5D 5FCUL 5KSVA 4R96A 1LO5B 4ONGL 1AQDB 1XZ0A 1F4YH 1W2KT 4JN1H 5DEZA 2DL2A 2D0GA 1Q1JL 4RMRA 3OG6B 4RAVB 4KRPC 1PYWA 4Y8AA 1D9KB 5EUKB 1PKOA 3L3OA 2JJWA 4U6VH 1IARB 3FB5A 3C5SA 5CIPB 5IG7A 25C8L 4XCNB 4BKLA 5IM7B 5GJTH 4QXTB 3G5VB 2O5XL 2VDPH 2Q1EA 3RVVC 1NEUA 3IXTB 5GRWA 3F6IA 5ESVA 3P0VL 1E4XL 3L3KB 5BCAA 1BBDH 5JHDD 5I1EL 5ITBH 5HVGB 4S2SB 1R3LA 2X4TA 5GGUA 3BT2L 4OLWL 2NLJA 3ARFA 2Z31B 4HIIB 1JIBA 3R1GL 2ZZUT 3TNMA 1ULVA 1FVDA 2XA8L 5D7JC 1MH5A 3IJYA 1J7VR 1G7MB 1JZ8A 4LLQA 5FF6B 1YMMA 2ENSA 1B3JA 1EJOL 5E2VH 3QPQC 2H8PB 3K8LA 4OZGA 5T3XL 4YGAB 3KJ4B 3ZHLA 1U2CA 3H9SD 3MV8B 1V3LA 2ADJA 1DDHA 2WLYA 5D1XB 4PY7A 3HZKA 1QKZL 5CJQH 5MEOA 2NTFB 4KFZC 4MD0B 1CFVH 4PGDB 2HLAB 3T3PE 1NCUA 5HI4D 2Y36L 3IU3A 4YDJB 5ALCH 4G42B 4N0RA 4MVBC 2BVUA 4JHBA 1AKJA 4LPTA 3BHBB 5F6HJ 4AY0A 3FB7A 1I85C 1MCIA 3ULVC 4NSKA 3TBVB 2CR3A 1NUGA 5DD3L 4HS6B 1L7TL 2DTML 1U58A 2ERJB 2NW3B 5ALBL 1REIA 5JUEL 2W9LA 4OV5A 4P5MB 3S36L 2UUDK 2DQHL 3MRBA 3VXMD 1QA9A 5I8CB 5ANMA 5TH2A 1JFQL 5KVDL 2VXQH 2FGWL 1XGYH 3BE1L 3LDBB 3GJEA 1XF2A 1ITCA 2OTUA 4K3EH 3ARQA 4DGYL 4M6OH 3NOIA 4IOIB 4JQXA 3UAJD 2ZOKB 3IS1X 3ZLQC 3GNML 1P7QD 4PJGE 2YSSA 4JPIB 5DJ8A 2WANA 3WLBB 2D31B 2HYMA 1R5IA 3PIQB 4UINL 3RDTB 4N8VG 1IGTB 4J1UB 1FLRH 2XFXA 3CFBA 4S1QL 3T4AB 2W60A 2FATH 1SM3L 2CJUH 4LVHB 5DLML 1YNKL 4RWHA 4OCSL 5H35B 1KBGL 2GTWA 1KGCE 2J6EL 1CFBA 4LMQI 5D7IE 2FO4A 1DQTA 4X5WA 3CX5J 3GZKA 1ZGLA 1EHAA 3SHSA 3GHEL 5JHLL 1CK0L 3IFPA 3S98A 1FZJB 4N9GA 3U4EB 3NGBB 2EO9A 3UYRH 3PJSA 2QTEA 3KHQA 1YC7A 2HRPL 1NDMA 1UENA 1DQML 3MRKA 5HHOE 4XNZB 1V7MH 2WQ8A 3MXWH 5D7KD 1RMFL 2HLFC 1JWUB 4L8CB 2Y7QB 2X09A 4TSBL 2XTJB 3RWEB 4O4YL 1NDGB 2Q76B 4Y4HD 2G5BB 3TN0A 4UZGA 1XGPA 3U9UA 4L3EA 5EC2B 1A9BB 2Z91A 5GIRB 4TUOB 1ZTXL 5IW6A 4P2QA 2ZG1A 4ZXBB 4F2MB 4LPYA 4LLVA 4Q6IC 2ZCLH 4JJ5A 3TVMC 2AS5M 4U2ZA 2VLRE 2PN5A 5E8EB 5E94B 4PJBB 1GOGA 1K4CA 1L6XA 2VZ3A 1GIGL 3DBXA 4G7VL 1UWGH 5DO2D 2P5EB 2KQNA 3ZT6A 3FQXB 2IPKB 4URTB 5MENE 2A6IA 2OMBA 3MODH 1T83A 1CICC 2Y5TB 4FFYL 3JWDH 1ZVHA 4PLKC 2FNBA 1ZVYA 1B0GA 3GSWA 3O3AA 4GXUN 4Z76A 4FQLL 3HR6A 5J6GB 2VZ1A 2VLLB 5FGCE 5GJSH 1U36A 2AABH 4OAWB 3V5DA 3IVKA 5I1AA 3CSYB 3DARA 3FQTB 3VXQB 2H6PB 4PTUB 1TJHH 2YN5A 1MRCH 5IJVB 3MRRB 1AGCA 5H2BA 2ADFH 1O5DT 2W65B 3PHQB 3MJ9A 1A7RL 3MUJA 4PJBF 3ULUC 5IB2A 1NGZB 1UYWH 3D39E 4M5YL 5IEKA 4PB0H 3W11C 1CG9B 3BQUD 5EOQH 1JBJA 3RGVC 4M8QB 4LCCC 3VRJA 4OI8A 1BVLA 3QJFA 1WWBX 1MREH 3X13B 4C56E 4NZTL 1S9YB 1WTGT 3ECBB 4AIZA 1CLOH 3UTOA 4KZDH 4CN1A 1QOKA 1OB1A 2AXHA 3EYFB 1C5CL 2VN4A 1KB5L 1RULH 2XRAL 4WU7A 5IR1B 3VCLA 2F19L 1FG9C 4KMTL 1WIPA 4HWNA 4K7PL 2NY4C 4NPYB 1G7LA 3LRSB 4OCNC 4P2RD 4QRPE 3RPKA 2VXUH 5BJTB 4FQJH 4AMKH 1U93A 1A02N 4H8WL 4LRIA 3MLTB 1EX0A 3FHQA 3QXWA 3QIUC 4R9HA 5HHPB 3TBTA 3QRFM 2DM7A 1DBJL 3MGTA 3CMOL 4ONHA 4XCYB 4MMXC 4YXHL 2FBOJ 3GO1H 1MFBL 5F1SA 2BK8A 5IEHA 2PW2B 3DMMD 1I7ZA 3QIBA 3WXWL 5IWLA 3KPOA 4HWEL 1QEWB 4NUJA 3U2SA 4PPTA 1HZHH 1WITA 3F62A 3JZ7A 5L0QC 4MD5B 1PW3A 1UB5B 1V05A 3WEXB 4WV1B 3LEYL 1A7BA 2DOCA 1FFRA 4L4TB 3VRIB 2F74A 3TYFA 3JV6B 4E0RB 2ILLA 3LEVH 3H0TB 2D7PA 4WDIA 4ENEC 1CWVA 4XVSH 3WDJA 4FQ1L 3VFOB 1BQHA 2NZ9D 2DJ4A 5BO1H 3TBWA 1XH3B 4Y7MA 1ZLVK 1U3JA 1SYVB 2P7TA 4XZUA 2FZ3A 4JPKL 5JIKA 4YBHA 4YFLI 3ARFC 4F7MA 4HKZA 3WS3A 1FYTE 3S4SG 5HGGS 3TLRA 5GGTA 4PJ5E 2GSIB 2VH5L 4P23B 4KK5C 5B39A 4R0LA 4LCWA 1QRNB 3EO9H 3TCXA 2NW2A 2VERN 5E9DD 2FJHA 4OB5H 5HHNB 3MV9E 2B2XL 1CS6A 1I8IA 1M7IB 3DURA 1DBBH 3L1OH 1T2QH 4J3OC 1PJ9A 3WFHA 4NJ9H 3ZDYE 4OCRH 2VUYA 3LKRB 1Q94A 4FMFA 3QUYA 4GKZB 4XNMA 3FONA 4EDWH 2DWDA 1AXTL 1X4YA 4WHDA 4NQDD 3SDXB 1RSFA 3W9DA 1MCJA 1TENA 2QSVA 4NOFA 3RPIA 1KENH 5E2UL 5C08D 3LS5H 3QIWA 4NIKB 4I77H 1A7NH 2EYTB 2PNDA 3IYLW 5KZCD 1ITBB 5FDWB 3I75A 3BGMB 4DUWA 5DUPH 3PV6A 4XNUH 2QQQA 2YHGA 1BIHA 4IDLA 4Y4FA 3FN0H 5GRUL 3LY6A 3D25B 1F6AA 4L4VE 2ZP0T 4I3SH 4X9IA 4WTWA 2X4NB 2KPNA 2DQFB 4NWTL 4AYFA 4OI7A 3SKMA 2F54D 4NQVB 1MQKH 1OD7A 5FHAH 4JQXC 3IDJB 3MQIA 3MLZL 5EN2B 5IB1A 4XC1H 2NMSA 4F7EA 5C0AD 2F8VA 3SDXF 1D9KD 3HNVL 3G9VA 5EBGA 3B9AA 4RZCB 2HJKB 3E8UH 5DRZB 1SEQH 3QQ3B 1AD0B 3VFGL 5ISZD 3STZB 4HWBH 1XGUA 2ADGA 4LP4A 1MLCB 4J3WA 5EZJB 4JREC 3HE6A 1HH9B 3BN9D 1BQHG 4MCZA 2QL1A 5LBSH 4PJDB 1AJ7L 1RZKL 3PP3H 4DGVH 2H32B 5EZOL 5DI8B 5HD8C 1AGDB 5GZOC 1LP9B 3UTTE 3IJSA 2Y4SA 1U3HB 2BRQA 4P5KB 4HC1H 5LVEA 4PRPD 2ESVA 4NFBA 1UM4L 4NKOA 1CT8B 3D9AL 3KPSA 2C1PA 5HHMB 1BPVA 4X99B 5E6YA 1NSNH 3G5XB 5LGHH 3DVFA 1RUML 1CDUA 4J12A 3VXOB 3LZFH 3EYUH 4WIQA 4CN6A 5D7LE 3TN0C 1B4RA 3VFWB 3T2OA 2X5PA 1ZHKA 2ZCHL 5GZND 3CDGA 2XQYG 2YD1A 5GGVY 5IIEA 1U8OA 2ARJA 2WBWB 2GITB 4PJDF 2CR6A 5CD5D 4BA8A 5C0FA 4Y16A 1KCUL 3EJZD 1M6OB 3DX7A 3B2UC 1LP9F 2V2XA 2WWKO 5HDQH 3RWCA 3CSPA 1OSPH 3MPCA 1A3RL 3OXSB 5K9QG 1QLRB 5F96H 2CH8A 1DSFL 2PYED 4PJEB 4A6YH 2FR4B 5TE4L 5GS0D 4IMKA 3CCHB 1ZVSB 3BRGC 3WFCH 1T83C 1DEDA 2HVJB 3O3EA 4KGLA 5DMKA 1QR4A 4XWGH 4TQEL 1RJYB 3CFKA 2XN9B 3G5ZA 1P4BH 4WENB 1LO4L 3TWCH 2I9LA 3IAPA 4A2LA 1U6AH 4Z7NE 2H2PC 1YEDB 3R4DA 3U46A 2P42B 3TFKD 2OK0H 1JHTA 4QYOB 1CVSC 3T2QA 4LLWA 2VDKL 3PWPA 1F6LL 5DUBA 1R5WB 1DQDL 1BOGB 1J8HA 5T1DL 1MI5A 2VABB 2HP4A 5I1GL 4E41B 4OCYH 4HF5L 4QRSB 2YN3A 4R4ND 5IROA 3HCVA 3SDYL 2DICA 2OBGA 4PJEF 3O9WB 1P4LB 4YXLL 2PCPB 4QO1A 4WHYH 4LKCA 2VDOH 5FV1L 1JTTA 1JPSH 2A6KA 4YHNA 1ADQL 1TLKA 5JA8B 3ARXA 1KJ2B 1VFUA 1NMCB 3DUSA 4KTDL 1P2CA 1ZT7A 3O4LA 1OCWL 4BUGA 2D03H 1AQKH 2NY6B 2HTLD 2OQJB 1T2XA 2BHYA 1EIBA 5GS1B 4KV5F 4XCEA 4RBPK 2K3TA 3L6FB 2XZCH 5HHQB 3MV8E 4YHLH 3O45A 1JNHB 4IS6B 2C3VB 3R8BB 4PJHA 3FTGB 5C0GA 3O6FD 2IFFL 5E4EB 2EH7L 4LRIC 5DK2A 4GQ9L 5C0ND 4G43A 5J11C 3BIKA 4DN3H 3CDYA 5J56B 2VZVA 1U3ZA 1MIEL 3Q3GA 4Z7WA 1CQKA 3QHZH 4BSWA 4GKNB 1VFMA 2P5WA 4L8SA 2XZAL 4ZSOB 3QIBC 1VA9A 5IWLC 3FB6A 2OP4H 1GYAA 3QUKA 1JF6A 1OP3K 1ZOXA 3CC5A 1DEEB 5ECJE 2QKIB 1DQQB 5KJRH 2EDEA 1CF8H 2CDGA 2QSCL 2G5RA 1DVFD 2BFVL 3CZFA 4WRLA 4BFIB 1SYSB 1SVCP 4XMKL 3LEXA 4TSAH 3UBXA 1P1ZB 4WEBH 4QTIH 1I4FA 1I8LA 4GRLD 1HEZB 4GFTB 4ZUVA 5C0BA 1N59B 1RIVL 2GI7A 5DEFA 4DGIL 4LQFH 4RMQA 5I8OH 4XI5D 2Y6SC 5FAAA 2JIXB 2NXYB 5F97E 4DAGL 2OR8A 1YNLL 2HFEA 4O2EB 1EJ6A 4MHHI 3RVXD 5DS8B 5E70A 5EU7E 1R0AH 5JIHA 3V5KA 3P4MA 2R1XB 5TDNA 1OQXA 2FB4H 1BGXH 1KTDB 1YJDH 1LD9B 4R0LC 5I1DB 2VQ1B 5F7WC 1MCLA 2ARWA 1EAPB 1R5VA 4M6ML 1FJ1B 4BH8B 2FYYB 4OF6A 4Z7VA 1CDJA 2B39A 5DRXB 3W2DH 4P4KD 2B8OT 5GHWL 1VADA 3FAXA 5H94A 4L8BA 5GSVA 3GSQB 3CFEB 3K74B 2X7LB 4NRZB 1D5IL 4LDEB 1I1AB 3GMPA 1A7OH 3LIZL 2BOBB 2VXVH 2YUXA 3QUXD 1U8HA 3IDYB 1K5NB 2FHCA 1LK2B 2CIIB 4KTYA 5DGRA 3OKOA 4WW2C 1KPVB 3MACH 1TVHB 2XTJE 3H42H 3HB3D 2B4CL 4W4OA 4M1CD 5C0RL 4R4FH 3GDBA 3QIWC 2PKDA 4Y1AA 2FLRT 1ZV5A 2K9UA 4D3CL 4RNRA 1D6EA 3ZKMC 1DFBH 2BSRB 3C60B 1PLGH 1IGFL 3NTCH 3NH7L 1BBJA 2Z4QB 4YPGA 4U1JB 4GRMA 1EGJL 2A9NH 4LCIH 1R3JA 4K23H 2VQUA 8FABA 4Y4FC 3QWRD 5I1IL 1Q0YL 3I50L 1UZ8B 3UPRA 5BZWA 4I2XB 2AJ3A 4ONGH 3RVUC 3MUHL 4LSPL 4O2CA 4QY8A 5BV7B 2P5EE 1A6PA 3GSOB 1VFBB 4N8PA 1U92A 5E8OB 4AL8H 5A2KH 1B6UA 5EOTB 1PKQB 3VXNB 2G9HB 1R24A 1F45A 4OCLC 4WNQA 5D1ZB 4XBPB 4LEOA 1BZ9B 1AR1D 1N3NB 5AZEL 3DYOA 3PNWA 1KUMA 1C1EH 25C8H 1NGWB 3GK8L 1T5XB 3MRDA 3SKUD 4GKSB 1NCDL 2O5XH 3FFDA 4AJ0A 5CBAB 4MCYB 4KPHL 3DNKA 3WFEL 2DLHA 3QA3A 2KUTA 3HE6C 3NABH 5CP7A 1E4XH 2C7UB 1S5IH 2IBZY 3E6FB 3HZMA 3H3BC 3BKCL 4FZ8L 3TO4B 3ROOB 3RKDD 3BT2H 4N9OB 5HI3D 4KH2A 3KAAA 3R1GH 1P7KA 3HI5H 1FGNL 1HOCA 2VAAB 4HC1A 1MLBB 2XA8H 3DXAA 5ADOL 3RWDB 3GSXB 3B9EA 4P4RB 1I7UA 5LKNA 3L3DA 4XC3H 1ZLVH 2IH3B 3MRNA 5IOPB 1KJVA 3BZEB 1S7UA 3MUY1 3BP6B 1A6VL 5T3XH 2HN7B 2ITCA 3I6KB 1UH2A 2X4OA 5DD0L 3ZO0A 4ODWB 4O9HL 1S9XB 2WBJD 3D0VB 5HGDB 5F9AC 5T1LD 5IB3A 4MJ4A 4XBEL 3CLEL 1H8OA 4WI9A 1FFPB 4DVRL 4YFDB 4DJMA 2IALB 4DK6A 3FQNB 3QUZB 1HQRB 4N1CA 4Z77A 4OM0L 4YFLF 3QXTA 1GGBH 2E7CA 1FVEB 3VU2A 5IF0B 1QSZA 4HPOH 1XF4B 4PRID 3I6GA 1P5VA 5C07D 4YGVA 3H7BA 1H3UA 4Y2DC 4XPHL 5FB8A 2X41A 3B9KD 1QSEA 3L3JB 4A6YA 1INDH 3VXTB 5DD3H 4PB9H 4WTZG 2J1KA 1SJEB 2DTMH 3AB0B 1BF8A 4FQXB 5ALBH 2BOCA 4IMKC 5JUEH 3N9GH 4L9LA 4V2CB 1UH3A 5DFTA 3S36H 5CJ8A 4PJ9D 4JGUA 2R2BB 3L3HB 3L3GB 2IPTL 1A9EB 4ETQB 4W4NA 2FGWH 3GMRA 1FL3A 2NZIA 3T8XA 4FTVA 4OZHA 2G2RB 4HSQA 2FSEA 4I3RL 1PSKH 3D3VA 3LKNA 1V7NL 4L4TE 5F1NA 1G7PA 1OTSC 1TZIB 1CGTA 1ZHLA 4HIXL 1DN0B 1KV3A 3MOQA 2DQDH 3QZWB 5DQ9B 4NT6A 3V5HB 2W0PA 3TCLB 3I02B 4U2YA 1OAZL 5FO8A 1FCCA 5C9JB 3RL1A 4N68A 3TP4A 3V4UH 2HFFB 4LLMA 3ARSA 4S1QH 1FNLA 5IROC 5CHNA 2ZUTA 1SM3H 1GGUA 5DLMH 3S7GA 1YNKH 3VDAA 5B8CA 4XH2B 2J6EH 5IVXB 1HSBA 5EU6A 4JFEA 3MXVL 1YMHB 1L4IA 1FV1B 5ERWA 4MJID 1D6VH 4J4PD 3GHEH 5JHLH 3O4OB 5A3IC 2R8SL 1WAAF 3RP1A 2AEQH 3C5JB 4FQ2L 2R4RL 4NQCD 5F9OL 3TPUA 5HHMD 3IGAA 4JAMB 3U7WL 3LMJL 1D5ZA 4CKVX 4WW1A 2QR0A 5CP3A 5DMIH 3VI3F 5KANI 1RMFH 1BLNB 3SDCB 3MREA 3QEUA 4B41A 4WFGE 4QHMB 3SO5A 4IOSD 1IAOA 3WHXA 1CXIA 4EXPX 4L8DA 3SDXE 2X2YA 4L8SC 1ZTXH 4PRAA 4ETYA 2EIZA 2Z93B 3IU4L 2GUOA 5JPNA 5DQDH 1CD1A 3F58L 1MCKA 1SY6H 1OGTB 4DN4L 1RD6A 2AAVA 3MNVA 2YPVL 2VYRE 4FMKA 1S7SA 4M6NL 1NCCL 4UOW0 4JFDB 5HPOA 1NC4B 5MP6L 2LU3A 4V1DB 1ZANH 1FZMB 5EWIH 4F9PA 3RNKB 3ZZ1A 1UJ3A 3OR7A 3RNQA 1UQSB 1CI5A 2W0KA 4X8JB 2NX5A 4G7VH 4EDXB 3QWOA 1XCQB 1YECL 1I8LC 3BPNC 1GHFL 5EO1B 4JHZA 2AV1B 1KJMA 3B43A 4FFYH 3L7FA 2XQBH 4MXWL 1NCAL 4OFPA 4NM8L 4PGZA 1WCQA 5IMOA 6FABH 5K9JH 1BHGA 5DGQA 1KF9B 4HH9A 4NC1C 3ABZA 3L5WA 4F15C 4KDWA 1F4WH 1CBVL 5GS0L 4PLJC 2EECA 3RWHA 1KIRA 2MPAL 4TNWF 3P9MB 5AEAA 1HINL 3LKSB 1N2RB 4E41D 2Q8AL 1F4XL 2IAMC 3ES6B 3D2UA 4YDIL 3JV4A 3ZE0F 3QQ9D 2GSGA 5D7JD 2H32H 3SCMB 1GXEA 4N5UA 3QRGL 3FO9B 3ARDD 3FFCA 2AVGA 3WKML 4ZOEA 2H9GA 3EO0A 1LP9E 3N1QC 3PDOA 4NRXB 4NN7B 2EYSA 3OKNB 4YXKL 3VMOA 5FGBA 1DUYB 3JTSB 4K8RD 2V5TA 4WGVB 4XCCL 2GY7B 2VR9A 2F19H 3LAFA 4KMTH 4U1MA 3RWFA 3U1SH 4K7PH 4W4OC 3DIFA 4F7TA 1RZJL 1KC5L 1KULA 3TBYA 4EN3A 1TQBB 1KG0A 4MVBD 5C09B 4H8WH 2QADC 3LB6C 5DRNA 2CXGA 4YHZL 3CMOH 4OGYH 2E7BA 3G6AB 4U31A 3VG9B 4O2FA 4YXHH 3A67L 4RBPH 4XP4L 3CGTA 4OJFL 5F6IC 2IG2L 4KROC 4KKCC 3WXWH 4G8IB 3D0LA 5FV2A 3T0EB 5I66B 4K94L 2A9MH 2ID5A 4DCQB 3PG2A 2E6QA 2LTQC 2YD4A 1JK8A 4C54A 1E6JL 1HXMA 4PJEE 1CL7I 3GMNB 4NNYA 2ATKB 1YEJH 4EQ2A 2IWGA 3LEYH 1GPOL 4F57L 2XN9E 3V6FA 4OM1L 5F21B 5HYQB 5FEBA 2AJUL 4LSDA 2AJVH 2VE6A 4FQ1H 4MA7H 2AXGA 4NZDA 4OD2B 3KPRD 1OP3H 4MAYB 4CVXB 1JNLL 3D6GA 3B2VL 2ZUUA 4JPKH 3E2HB 4P9ML 2JK5B 5DMYA 4LSRH 1Z9MA 4MMZC 3GIVB 3X3FL 3TPKA 4L9DA 4C4KO 1MVFA 4EOWH 4M43L 2VH5H 3S35X 3EFFA 2UWEA 2BNQE 5D5MB 1EXUB 2VOTA 4JPVL 1DN2A 1UXWA 4LMQE 3GBML 3P11H 1NANH 3TZVD 4LHUB 3WBDA 2R23A 4QRUB 2V9RA 4NGHL 5T5FL 1H3XA 2B2XH 1QSFD 4Y88A 4HEME 2MJWA 5SWZA 3UO1L 2B1AL 1NLDL 1DQJB 4OUUB 5C0DB 1LEIB 4KKLD 3BDBA 5TGBB 5I30H 1ZT1B 2OL3L 3OKYA 4HS8L 1HHJA 4PD4K 1C5DA 1QYGL 4JG1H 1AXTH 2W59A 2ICWB 1ZAGA 5D1QD 4UQ2B 2JB6B 4GAYB 1J88A 3VGHA 2ATPA 3V6ZA 1I9RL 4TULL 1FDLH 5IFAL 3EYQC 1DLHB 2XY2A 1KACB 3GB7B 3WUZA 4HKJB 5D5MF 1A6AB 3DUHA 5EPMA 3FOMA 1BX2B 1TTFA 2WIIB 2PF6A 3QG7H 4ZSOE 4FXGA 1HHGB 4L9LC 4UAOC 1S7TA 2Y06L 2KL6A 2NQCA 4MJ6B 1G7QB 4IJ3B 4OTXL 5GRUH 3MRGB 3UTSB 2YRZA 1PX3A 4NWTH 3BW9A 2OJZL 3FT3A 1W8OA 3OKMB 1JYXA 4YUEL 3QAZB 4UIKH 3WNLA 3UYPA 4R2GC 3VE0A 1E27A 2CUIA 4JFOB 2VLKB 1RIHH 1JGDB 1INQB 3AS2A 4XNQB 4KK9C 5DUMH 4GBXB 4U6TA 4BZ2H 2LQRA 3QDGA 2CK2A 3FT2B 5K59F 4JO3L 4RMWA 1NCBH 1WC7A 4JZJA 2J6EA 3BKML 5EC1A 5FHBL 3HI1A 5B8CC 3T2NL 4Y5XC 2EE3A 1Q72H 2LVCA 2RAMA 1Z9LA 3BP5A 4OZFH 3VFRB 3W11D 2XTLA 1X5YA 1YN7B 5KSBB 3MLRH 1BFSA 3WFZA 1D5XB 2F9BT 5EO9A 4ISVA 4K07A 3HC4L 1JZ4A 1T5WA 5KSAB 2I25N 4IRJB 4CADB 2V5YA 4P5TA 1CLZL 5L7XL 1K3ZA 3U9PL 1U8NA 1RAMA 3RFZC 4MSWB 5EUOA 1G7HB 5J1AA 5JHDE 4OIIL 1BEYL 1RUMH 2NR6C 5D2LA 2E3VA 5T1KA 1KB9K 1MVUB 1LVEA 2NY4D 4X7TA 4RFOL 3IXAB 1GGCL 1TITA 2CDFB 2ZCHH 2J4WL 4X80L 2BVQB 1WBZB 4K3DL 1OGAD 3AROA 4Z7UA 2DKUA 3C5ZB 5KSBF 1KCUH 2EICA 1CDCA 1UFUA 2BY0A 3WMSA 2FGZA 2YRLA 3KYNB 1NBYB 3MLSL 4F9PC 5DRWB 1OVZA 1UJ3C 2J8UA 4PJ7B 5BVJA 5TQ0L 4FZEL 4XGZA 1DSFH 5I73B 5TE4H 2J88H 5TDPA 5J1SC 3GSNA 1FH5H 1A4JA 5HDBF 3LN4A 4I2XE 1NJ9A 5INDB 4TQEH 5GGSA 1PGRB 2EXWC 3OAYK 4N0UB 4TOYL 3VWJB 4ENED 4OF3A 1PKQE 4Y5YB 3UJJL 2ZUWA 2VLME 3MV01 2H3NB 5IK3B 3WSQH 4AENB 4WGWB 2ICWJ 4QRRB 3FL7A 2QJDA 4WO4B 2VDKH 1CFTB 1FBIL 3FMGH 1BD2A 4TPRH 1NPUA 4JFHE 3ARFD 2DI9A 3REWA 1QFWH 4PJ7F 4XX1E 4G80B 3TV3L 5ADPL 1QFWM 1CGUA 3SDYH 5GS2H 4YXLH 5EA0H 3ZTNH 2ZNWA 2VIRB 4CMHC 5E8NA 1ADQH 4Z8FH 4NP4H 15C8L 3GIZH 4KK8C 5FGBC 4LARL 4HFUH 3UTQA 4HIHB 3Q1SH 4PRDB 4OLZH 1KB5A 1LO2L 2CKBB 1RZ8A 2FX8L 4YK4B 5D9SA 3GM8A 4KI5F 3HMXL 4H20H 4KXZI 3SGDI 5JW4M 5JW5B 3MRCB 3NIGF 3MV7A 2G75B 5MHSE 3JWNC 4EN3C 3STLB 5EORL 2EH7H 4CNIB 3ARBA 2X4SA 3NZHH 4GQ9H 3N06B 2APVA 3GSRA 1MHHB 3WN5C 2P8MA 2V5RA 2XWBA 3NAAL 4XVUC 3J8F7 1QFHA 3FQWB 4LASL 2XZAH 1EVTC 1JMXA 4LCUB 1N64L 4G6ML 3X11B 4OGAC 1I7RA 4QRQA 4QXGH 5ETUB 3SKOB 3WFDL 1JUFA 3I3DA 1LEKB 2O93L 3ARGD 1N0LA 2Q6WB 4HGWB 4QT5B 4ZPVB 1NC2B 1KEMH 2QSCH 3ZDXE 5I6XB 2ZCKH 3UXFA 5CCKL 3PWNA 4PJXA 3G5YB 4BZ1L 4JFYA 5AZ2H 3KXFE 4K7FA 1X7QB 1WAAE 5DD1L 1S9VB 4PBXA 1T0NA 1MRFL 4WFHD 5I1CH 1RIVH 4IOFC 1CFNB 4HIJB 1AO7A 4G6KL 1PG7L 1L6ZA 4YBQD 3MC0A 4ODUB 3GSVB 1QBLL 1WICA 1YNLH 3O2VL 3GMOA 4NO3B 3VI3E 1MPAL 1RUAL 4GRWB 5KG9A 3MRQA 4LGPB 3HI6L 1ACZA 2F53B 3UTZB 5IGXH 4Q2ZB 5AAMA 3KLHC 3BKJH 1Q9OB 3RVTC 1WSST 4YLQT 4ELMA 5IVXE 4UT7H 3WIHL 3CVHH 4GQPH 1YYLH 4UDUA 4Y4KA 4C57C 3IDIA 3RZCA 3DSNA 5GHWH 1MOEA 1TXKA 3U0PB 3LKPA 4ZFZA 1YQVH 1FSKB 3Q6GL 2YPLD 4RGMB 5HHXL 4X6BA 2DBLH 1KT2B 1WUNT 5JIIA 4EXKA 3TN0D 3RA7L 2OI9B 4ZFOB 5T1MB 3VXSD 4YHML 3NPSC 4GRWF 2B4CH 1G6RB 2NY0C 1W72L 3OSKA 4HLJA 3RBGA 4HDIB 2W9EL 1S8DB 1GAFL 1HQ4B 4K8RL 4R4BA 1KPUB 3B2UD 1IGFH 2BC4B 5FYKD 3NH7H 2X4QB 2R0ZL 4JB9L 4U1SA 1FLTX 2AKRA 3QR2A 1IM3B 4ZAKA 1EGJH 1CDYA 4Y19B 2JLLA 4PGBA 2QLVB 4JFDE 4ZUWA 1DUZB 4HHAA 2VDQH 3ZE0E 2BXYA 4EUPB 4OV6F 1G9NH 5FCSH 3LV3B 2RCSH 3EGSA 5TQ2L 2AXFA 2AJSL 3QXDA 4NOBA 3MJ8A 2LE9A 5L2KB 4HXAL 3VXRD 2D4FA 3B5TA 5DTFA 3HA0A 3NA9H 1CTOA 1DBKH 5DZLA 3T0VA 1J1OL 2FDBP 3GK8H 1K6QH 5KVFL 4P2CG 4X6DA 4JZJC 1N0XL 3W81A 4HIEA 1T3FB 3WFEH 4OZFA 5D93C 4X9FA 3LQAL 4AEIH 3BKCH 1U8LB 3NN8B 1IILE 3QEGH 2F58L 5JW4R 2R29L 5F88B 5HYJB 43CAA 4ORGA 2J5LB 5F7HA 1HI6A 5ADOH 5E6IA 3P4OA 2GT9B 5HGAB 3CSBA 1WV7T 4P5TC 4XVJL 5JO5A 4HZLB 4KHTL 2PR4L 3BEVB 4X98B 5DD5L 5B21A 5D7IA 1A6VH 5LGJB 4I5BA 3N1PC 3HUJB 1FC2D 1G0YR 2AV7A 2QHRH 4WY7L 3OKEB 3WNMA 2XWTA 3AXLB 4KUZH 4FOMA 1NBZB 5DD0H 4JKPH 5EIIA 3WHE1 4O9HH 1AE6H 1T7XA 4JRXB 4XBEH 3CLEH 2XPGB 3QDJD 4PTTB 1IJ9A 3DV4B 2P8PB 3VWKD 4JFFB 4GXVH 3H9SA 5MERA 4DW2H 3MBXL 1F11B 1TNNA 3LHPL 1MCOL 3QIBD 3CVIH 4XPHH 4UT9L 3RUGB 3S3JA 5A2FA 2LAAA 4NM4L 3RZWA 4XP6L 4M48L 3VGEA 3T0EE 1HXYA 5JR1L 3HUJF 1T0MB 2IPTH 2DQEL 4I0PC 4F58L 1NMBL 4EI5B 1I3RA 2P24B 3MNWB 1N5AA 2CDEA 3JV0A 2XXMB 3MA7B 1LE5A 3VXMA 1I1FA 4WCYL 4HIXH 3QB7C 1MHCA 5CEZD 1UCBL 5MENA 5JDSB 4RGOH 3ARED 4MDJB 4PJIB 1AIFB 1OAZH 3VFVA 5CBEB 1DR9A 5BVPL 4GKOA 3O6LL 1PZUB 1TETL 5K9OB 1CFSB 4KRPB 5DK0B 4WWKD 1T1WB 1ADQA 3IDMB 1MJUL 2SEBA 4XAKD 3EOBB 3MXVH 4X7FC 3LSOB 3MYJB 1VKXB 5C0EA 5IMKA 3VH8B 1G7IA 5D5ME 4FFZH 2R8SH 4OZFG 4RGND 2V2WA 1WZMA 2R4RH 4NO0A 1IZJA 2A83B 3GJFB 1NBQA 4A2MA 4APQB 3O6ML 4JFQA 3BGFB 5CJBA 4XRCA 2DJSA 5LXGL 3BH8A 3PQYD 4PJIF 5A1AA 3WFBH 5BMFL 4LOUD 3IDXH 3WUWB 1HILA 3EBAA 3FO2B 3I3EA 1QHPA 2FWOA 1NL0L 4MJ5A 3FRPA 4UDTB 3ARBC 4FQHA 4M02A 4YDKL 2ORBL 3QH3B 5CAYB 2DLEA 2BNRA 5J9PA 2O26U 4N0FB 3U82B 3ETBF 2LV4A 1NQBA 4HZAA 4L29A 3IU4H 1M05A 4HV8A 5HJ3A 2BSTA 2VKXA 1CE6B 2XY1A 4KJWD 4DN4H 2R0KH 3VGAC 1NCCH 4GW5B 4NNXA 3TIDB 5K59E 4OZIA 5JOEA 4Y4FD 5MP6H 4JDZB 5SWQB 4OFIA 1ZLSL 4CVZB 1Q9KB 4RSVA 2VLJD 3CXDL 1W0YT 5DSCA 1U9KA 1YECH 3EDDA 3UTSE 1X9QA 4PYHA 1IT9H 5HGHA 3W0WB 2MCPL 5FKPA 4G6JH 4NQED 4NM8H 3T1WA 1CFQB 5DJDA 4MLSA 4KKAC 3WXVL 5IESL 3QEQB 5FK9A 5GPRA 4GG8B 2VLKE 4F3FA 1R3KB 5DZNA 4F7PA 2GAZB 5C92A 1CBVH 4WJ5B 1JJUA 2XKNB 5GS0H 5TF0A 3M8OL 1S3KL 2MPAH 3GJFK 3HE6D 2JCCE 1XAUA 3N85L 1N5YH 4PBWD 4F8QA 5A40E 1RJLA 2WWMC 2CLVB 3DVGA 3F7VA 2Q8AH 1F4XH 3RBSA 4YDIH 4KUCF 5SWSB 5FGSA 1T1YB 3SPVA 4MAUL 2IGFL 2JB5H 1MF2L 4LCYB 3QRGH 4IDJL 1JCKA 4Y4KC 3WKMH 5KSBE 5EIVA 3RZCC 1OWWA 1IL1B 2IQAA 5E1AA 2X70B 4Q9QH 4YXKH 3UP1A 4JLRB 4RMSA 3MGOA 2F5BH 1E6OL 1RK1B 4XCCH 1TZHB 2CXKA 1X5LA 4NHCL 5HDBE 1S7QA 1MJ7L 4P59H 3DO7B 4MA3A 1S7XA 1AXSA 5IB5B 1RZJH 3S88H 3T3MF 1KC5H 3MRIA 1T4KA 4D0CB 1GZPA 3Q0HA 4JZNB 5IJKC 4HJGA 3GI9L 5BZDB 1ZA3B 4MNQD 4Y2DD 4U3XA 3PHOB 1RUKL 3HE7C 1OW0A 3A67H 3I6LD 1SVZA 4P2RA 1I9JH 4AM0A 5BS0E 3CFDA 3ZKQD 3PP4L 2JJVA 5FKAB 4AH2B 4H1LH 5ICXA 2YK1L 3MOAH 1NGPL 4NFDA 2H1PL 3RY6C 4JVPA 1A6TA 4JM4H 4PJ7E 4S0TD 4R90H 4LL9A 3B9VA 3LQZB 4QRTB 4NZUL 1IGMH 1AGFA 4OCXL 3P0YL 5F72S 3QNXB 2X4PA 3DMMA 1OF2A 1HHKB 5HPMA 4Q6IB 1T03L 4OM1H 1OTSD 1RJZA 3SO3C 3TVMB 1NGYB 2AJUH 4N0UE 1FHGA 1DE4B 3CPLB 3IAQA 1ORSA 4R97C 2NY3D 3DVNB 1JF1B 3JXAA 5FOBB 5TPWL 4NQTA 4L5FL 4OI9A 4KI5E 2IBBA 1JNLH 1ACYH 3B2VH 1HHIB 4P9MH 2BERA 3U30C 1RZKC 2R0LL 1I1YB 2R2HB 1CICB 4IRSD 3S35H 3KLSA 4JANB 2E9IA 1F6FB 3BESR 4M43H 4QOKB 5E6IC 2AP2A 4M7JL 3O4LD 2GJJA 2WV3A 4D0DB 4W6YB 4YJZL 2VO5A 4ONFH 4MD4B 5A3ID 3OPZH 4LPWA 1JNJA 4PV8A 3TBSA 3QXAA 1JZ2A 4NGHH 4S1RL 1XF3B 3ROLA 5T5FH 3MJ7B 4ZYKB 2PTTB 3UO1H 2B1AH 1NLDH 3QNYA 4UTBL 3IAGC 3BN3B 4HPYH 2APTA 4BSVB 1TIUA 3MRFA 1RFDL 2DYPB 3TT1L 2HJFA 3RGVB 1IGCL 4LCCB 4H0GA 3C87A 5E9DA 4XPFH 2GFBB 4GG6B 2ZUYA 5CS7A 3Q6FA 3NFNB 1FO0L 3M1BA 1UA6L 1F3DJ 4TULH 5E5MA 5GGSY 4DZBA 1KTRL 2H45A 4ZPTA 1TFHA 3SE8H 1NMAL 3KR3L 2IBZX 1BFOA 2ICCA 1IGJB 4RAUA 5HI4C 5K9QI 1LDPL 1WWWX 4IMLB 3GMQB 4NQDA 4CW1B 3NCYP 3SDDD 5L8KB 1JWMB 3U0TB 1T7VA 5IBTL 5C08A 5T3ZD 2R56H 4MQ7A 4U33A 2KBGA 3UMTA 3DX8B 3BPLC 1F90L 3ULUF 4KY1L 5IHLB 5HY9A 3C6LD 3QIUB 4NKDA 2OJZH 5C0BD 3HAEA 5BXFB 2HVKB 4ZUSB 2WUCH 1I7TB 4YUEH 5DURB 4ZFFB 5FYKL 3OKDA 4GG6F 3K4DA 3RX7A 1FORL 3GFUA 3P0GB 4R96B 3PL6D 4WHTA 1XZ0B 5EOCH 3T2PA 4PLJD 2F54A 5L0QB 1U95B 4Z6AT 3UAJC 1K8DB 2AXJA 5I74B 4WI3A 3VXUB 4GRWH 5C0AA 1JMZA 1D9KA 4YZFF 2PYFA 2OCFD 3T2NH 3BEWA 2IAMD 4RISL 4K7PY 4GRWE 1MCEA 1XMWA 1M71B 3FB5B 5GRJL 1D3CA 3C5SB 3KJ6H 2HT2D 2I07A 5IG7B 4BKLB 4C4KT 2F53E 4XCNA 2ZKHH 4YWGL 1HHHA 1L0XA 5J3HD 1YNTA 2ZUQC 3QUML 5ESVB 4WEMB 5DJ6A 3HC4H 2P8LB 4PGEB 5B4MC 1CLZH 2X4TB 4CJ0A 2WBKA 5GGUB 2NLJB 2OTPA 4HIIA 1KTLB 4HCRL 4BQ6A 3IJYB 5CEYA 4YNYA 3W5MA 1BEYH 4TRPH 5ICYA 1YMMB 3R06B 4TSCL 3VDBA 4YC2C 2LAGB 2Z92A 4PRPA 3CSGA 1GGCH 2H8PA 3W9EA 3GKWL 4HKXA 4OZGB 1G6RH 1OAUL 2QADD 3NCFB 2ADJB 3LB6D 5D1XA 3HZKB 3MLVL 3MO1B 1IGIL 4KQ4L 5MEOB 4NHUA 1JHKH 2HWZH 1MFDL 3C2SA 4KROD 2HKHH 3MLSH 1FAIL 3IU3B 1GC1L 5TQ0H 4Y19E 2VDNL 4RMVA 3BH9A 4YEEA 5HVHC 1AKJB 2AK4B 2RFXA 3BHBA 1W0WA 5KVGL 4EUPH 1VGKA 4LAQL 4NSKB 3LPFA 3HRPA 3TBVA 3QFJE 3GBNH 4EI5D 4KDTA 4ZOCA 4PRHD 4TOYH 4HMCA 4K2UL 5ACZA 5M95B 5DO2C 1JV5A 2PYEA 3UJJH 4OV5B 4OZGF 3MRBB 1MCDA 1Q0XH 1QA9B 2UYLA 5ANMB 4XNXH 4LKXB 1AXIB 1X3DA 1KLFA 3RWGA 1FBIH 2C26A 1MWAB 1XF2B 2OTUB 4MZ3A 3C8DA 5C6TL 3L5HA 4U49A 5IQ9A 3LN9A 3OJDA 3DXAD 1KLGA 5SX5H 3MR9A 3TV3H 5DT1L 1BQLL 5DJ8B 1YY8A 4JPIA 2GJ6E 1EH9A 5HYJE 5EZIL 3PGDB 3CFBB 2W60B 4OF8A 5L9DL 5I9QC 3O3BA 2FX8H 5C7XL 4P0DA 5M94B 3HMXH 2FO4B 2A38A 3HUJE 2B4CC 3BJLA 1LDSA 4DOHB 4P99A 3OKLA 1ZGLB 3I2CL 4OLVL 4HX1B 3IFPB 1FZJA 4X8XA 5HYEA 3DGGA 2KZ1B 4JRXE 5EORH 3PJSB 4JM2F 2PTVA 1NDMB 1NFDB 1ZHNA 4JFFE 3MRKB 3KPNA 3QO0A 4S1SL 5LJYH 3NAAH 1JZ3A 1WBYA 1JI2A 2O61A 1OW0C 2P43B 5D2NA 4RCAA 1JWUA 4LASH 3DX9A 4H1LA 3O6FA 3F7YB 5F7KC 1WZLA 2Q76A 3RUGE 4M9PA 4L3EB 1UKSA 3SJVB 1X5ZA 2R2CA 1Z0MA 2Z91B 1A9BA 1LK3L 3ZSTA 5F9JB 4XCFL 4P2QB 4KUCD 3UYOD 4ZXBA 5CCKH 3DMMC 4M1GL 3RAJL 2QBWA 4LLVB 3P30L 4PBVC 4BZ1H 5TJWK 4JJ5B 5CJOL 4OD1L 4I3GA 4LU5L 4XPTL 1F97A 5DD1H 4PJBA 5KN5A 1K4CB 3DVIA 3DBXB 1NFDF 3GRWL 3QEQD 4G6KH 3FQXA 2A6IB 3KWWA 12E8L 4M7LL 4PJIE 5KAQF 4JQIL 5JOFB 3O2VH 2FX9H 3DO3A 4UOW1 4ZOAA 1MPAH 2JF1A 5FYLH 1H3TA 1A3QA 4K71B 3HI6H 5EU6D 3B5HA 4JFED 3GSWB 3EDKA 4ODTL 5FYLE 4Z76B 2VLLA 4LVOB 4M3KB 3V5DB 4OAWA 5I1AB 5BRZE 1ED3A 1BAFL 1IEHA 4N90E 5JZ7D 3TM6A 3WIHH 5FECB 1AGCB 3QEHA 5H2BB 5B38A 2N7BA 2GJZA 2W65A 4YHYC 1WIOA 3KS0J 4JRYD 3GJFH 5IB2B 2OL3A 1NGZA 1UKQA 4NUGL 5L2JA 5IEKB 3BXNA 3VI4F 3Q6GH 1OAKL 2NR6D 4ZO6A 5HHXH 3VRJB 4ELKB 3PGFH 1BVLB 1OSZA 1EHXA 4NCC1 3QJFB 3JWOL 1A6UL 4XPGH 4P4KA 4HK0A 1J10A 4YHMH 3EOTH 1C08A 1FIGH 1QLFA 2FL5A 4JJHA 4LVEA 1CZ8L 3BRFA 3TIEA 1S9YA 4RDQG 4AIZB 1JGLL 1YPZE 1K2DA 4GMSL 1EA9C 1W72H 2DN7A 3QUXA 4FRWA 3DRTA 4WU7B 2W9EH 1FZOB 4NKQB 1GAFH 3DLQR 1TMCB 3V6OA 2WUBH 3VCLB 2CKBL 2MFNA 3C2AL 3OKKB 1Z9OA 4ZNEA 3HHRB 1KOAA 1B4JH 2R0ZH 4JB9H 1TPXC 5C70A 1EDQA 4P9HL 5FA4B 5BJTA 1SHMA 2HH0L 5AD0B 2G60L 4U7MA 5IUSA 1U42A 2HTKC 4YFEA 1H0DA 4NC2B 3TBTB 5J11B 3IT8D 2GCYB 1WCBA 4XCYA 1OPGH 1KCLA 3JBG7 4ZUTA 1IVLA 4NKMA 5IEHB 1I7ZB 3ULVH 5TQ2H 2BVOB 1BWMA 3QWRA 1QEWA 4NUJB 1JRHL 3BMWA 4HXAH 3ULVE 1I3GL 1MCRA 4G8FA 3V4VL 1J1OH 4YX2L 3TESA 2QSTA 4U1LB 1N0XH 2F74B 5CZVH 2AEIT 1D9KC 3TYFB 1OARL 1CXEA 4WDIB 1VPOL 3D2UD 1WFTA 4MB5A 4KZEL 1RVFL 1BQHB 3LQAH 3T3ME 1CXHA 3TBWB 1S7RA 2R29H 2DD8L 1EEUA 2P7TB 3MCLL 4ZTPH 1WK0A 5SWSE 2DIJA 2PXYD 3FCTA 2C3GA 3BN9C 4Z78B 4KK8D 1RUPL 4XVJH 3EDEA 5E6ZA 1EUTA 4F7MB 4HKZB 5DJXA 1KFAL 5C0CD 3WS3B 1G1YA 3KDMB 5DD5H 1IC4L 4B0MM 4AT6A 3O0RL 4P23A 5B39B 1EO8L 4R0LB 4J6RL 4LCWB 1JPTH 1QRNA 4U1GB 3LKQA 1DZBA 2FJHB 3A6CL 5I8EB 5HYSG 3KJ4C 1Z9SA 5D1XC 1I8IB 4KC3B 5GGRA 4OT1L 2DLIA 1A6ZA 1JGEA 4NBXB 3V79C 3MBXH 3WFHB 3KYKH 5LAXB 1QFUL 3U36A 3LHPH 2LU7A 1Q94B 1MCOH 2WBJA 3CXHJ 1AD9A 1Q9LB 3QUYB 5T1LA 2CLRB 2ZSWB 3FONB 2AK1L 5GZNC 4M3JA 5B22A 4UT9H 2DWDB 2RQ8A 4YHPA 5HHVH 4NM4H 1DBAL 5EBWA 5FUCC 3SDXA 5CD5C 3W9DB 4M48H 3EJZC 3RPIB 3QIWB 5C07A 5MI0C 4KDTC 4TN9A 3B9KA 4F58H 1NMBH 3CH1A 5F3HA 3P73B 3PV6B 3REVB 3QG6A 5I1JL 4M62L 4PJ9A 2MKWA 4U05A 2NY2D 1NAMH 1UCBH 2YZ1A 4I9WD 1F6AB 3T3PF 4MQXC 5GGVH 5GRVK 5T3ZL 1A8JH 2DQFA 3SKMB 5ID0A 4UV4H 3L3IB 4X9GA 3UZEA 5BVPH 1BIIA 3IDJA 1XIWD 2NY5L 1KLUA 1J0IA 4D9QD 1CL7L 1MJ8L 1Z6JT 3M45A 1FRGL 5D4QA 9CGTA 3BD4A 1EAJA 1X5AA 3X3GH 4R7DB 4GS7C 1XGRA 1FYHB 3OZ9L 2ADIA 4HUKB 4QOKE 1RIUL 5DRZA 3UPCA 3SGKA 3EZJB 4R4NC 5SWZD 4LVHC 3STZA 5FYJD 3SKJL 1XGUB 2ADGB 1JZ7A 3HMXA 1MLCA 5EFIB 4HJJH 5KOVC 4FP8L 2D7MA 4MCZB 4LEXL 4PP1D 4G9FD 3H7LA 4PJDA 1RZJC 5FO9A 5LXGH 1UXSB 4MJIA 1AGDA 4J4PA 3ILQD 3OB8A 3ULUE 3IJSB 2HTLC 4IRZH 1GH7A 2QV2A 5HHOB 1A5FL 1NL0H 3RI5F 2ESVB 4NQCA 3DWTA 3KPSB 4GG6E 2WNGA 3MNZA 2OMNA 2YR3A 4U0RC 1NCNA 5GGQL 3G5XA 2NNAA 2VZUA 5CILH 3VRLF 4B7IA 3QT2A 4M5ZH 4QF1B 4K94C 2GHWB 3VXOA 1LEGB 2WINA 4WFED 4I0CC 3WNOA 4JFPB 5DJ2B 2MNUA 1WTLA 2P47B 1O0VA 3CDGB 3RTQD 4TVPD 4M7KH 4ZXBC 4YZFE 5IIEB 1U8OB 2ARJB 3W5NA 2IC2A 4UUJB 3RI5K 4KK6D 3HLAB 2NY1B 5C0JA 3IF1A 5C0FB 4Y16B 5DD6A 3DX7B 1TJGL 1M6OA 2V2XB 2PW1A 5KW9H 4OZ4A 3RWCB 3K8KA 4JDVA 2Y5EA 2MCPH 3HG1D 2A73A 4IIQB 2A1WH 3PDDA 4P3CL 3PABB 4EUPG 2EH8L 1I8MA 4XB8A 1NFIA 3NCMA 5DMKB 4NO5A 1RJYA 2LU4A 3G5ZB 1S3KH 4XI5C 2I9LB 1S9KC 5IW1B 3U46B 1OOAA 1JHTB 1ONQA 4FABL 4JM2D 1VEMA 4QYOA 2EE6A 3OMZA 1BJ8A 2IGFH 1A7QH 5I0DA 3PWPB 5DUBB 1FZKA 4HULB 2ARJQ 1J8HB 3EKCA 4JCLA 1MI5B 1HWHB 4E41A 2VISB 5JXEC 4WTXA 4YBLC 3HCVB 5D7JA 4R7NA 1P4LA 1PY4A 4LKCB 4AEHH 3ARDA 1E6OH 1J87A 2A6KB 4PJFA 2Z0BA 4YHNB 4P4KC 1MJ7H 2AEPL 3DUSB 3NPZB 1P2CB 1ZT7B 2FHFA 1CGSL 1YMME 4RRPG 4ZQKB 5F7LB 4ZFGL 1WZKA 1ZS8B 1W72A 3QCUH 3T0DA 1E4WH 3MRMB 1LO0L 2OQJA 5JLZA 3QUXC 3V6OC 4WI6A 3GI9H 4OZGE 4XCEB 4LBEB 1A14H 3L6FA 1A0QL 1IFHH 3HB3C 2X4RA 1TQCC 2XNAB 4M1CC 4PJHB 3EZ8A 4KKBC 2MTPA 1UGNA 4OCWL 4XT1C 1U8MA 4G8GD 5DK2B 2Z8SA 3EOAB 2XKUA 3PP4H 2OYPA 1LQSR 1RZ7H 4R6UA 3BIKB 1NGPH 2I27N 5FYJU 2CPCA 2YA0A 3Q3GB 4Z7WB 1CD8A 1I85A 4BSWB 5I18H 4NZUH 3DHMA 2P5WB 5DQJA 1MNUH 4I0PD 4L8SB 5GSRA 5IVZA 1J1PL 2AK4E 3FB6B 3O3DB 5E0QA 1QD0A 3MLUL 4EIGB 3GKZA 3CC5B 4YH6A 4Z95L 1IKFL 3ARYA 1DQQA 2DQJL 2V17H 4JY5L 3G6JA 2CDGB 3VXPA 1YEIH 4D2NA 4QHNB 5TPWH 3CZFB 4BFIA 4L5FH 2COQA 4XPBH 3VFMA 5ANME 4LSUL 1M7XA 2XZQH 3UBXB 5DHXB 4LSTL 5I75B 1AR1C 1PAMA 1I4FB 3QCTL 2CRZA 4OBSA 4JPWL 3O8XD 3TA3D 4DQOH 3QDMD 5DEFB 1PG7W 2AW2A 4XBGA 1QHOA 4Z7WF 2FIKA 1FGVH 2Q7NA 2HFEB 4F15B 1L9NA 1QBML 5TDOA 5EU4A 5HI3C 3KNBB 1EO5A 4OIAA 5DS8A 4HLZH 4PP2A 1XR8A 3V5KB 3P4MB 4S1RH 5TDNB 2R1XA 4P23C 1SEBB 4UTBH 1RU9H 1LD9A 1T6VN 5GRYA 1R5VB 2BSED 5IHZA 4KVNH 1F00I 1FJ1A 4DOHE 5KOMC 3ARBD 1IGCH 2FYYA 4KI1A 4Z7VB 3TZVA 4RIRA 1QSFA 1VADB 5GSVB 3RVWD 1FO0H 3CFEA 1C16A 1UA6H 2M2DA 4NRZA 2WBJC 3OR6A 1HSAB 4ZTOL 1AH1A 3GMPB 5HVWA 2DLFL 5E2TH 1U8HB 1NMAH 3KR3H 1K5NA 3LN5B 4DKDC 2DAVA 3NCJL 5IQ7H 3OKOB 3QISA 3UZVB 1KPVA 1TVHA 3Q5YA 5D1QA 1H3VA 4Y1AB 3BGAA 5IBTH 3HC3L 1IEBB 4L3EE 3SJVE 2DDQH 1H3WM 2VTFA 3TT3H 1BQUA 4LSSH 1D6EB 3B9KC 4RNRB 2EDLA 4ZNCD 1F90H 3C60A 4P2QE 3VGGA 4KY1H 4JY6A 1M4KA 3L5XH 2Z4QA 3X12B 3K0WA 4YPGB 4Z7VF 1UM5L 4PJ9C 4QEGA 3ZDYF 5C8JA 4Q58C 1S7VA 3V9FA 1N4XL 1AFVL 5FYKH 1R3JB 3GSUA 3EDFA 8FABB 4D9LH 2E8YA 1FORH 1IQDA 1MUJA 4CMMB 3UPRB 5BZWB 1A6WL 4LIQE 1LMKA 2LTQB 2V7HB 3VW3L 3VI4E 4QY8B 4WFFE 3SDAB 2ICES 1VFBA 5E8OA 2X9WA 4BH7B 3V7AG 1NCWH 1JHLL 1R24B 2OR9L 4WNQB 5JTWA 5D1ZA 1VERA 4XBPA 5KTEH 4RISH 4MS8D 2I60L 3PNWB 4M8VA 3S5LG 3SGKC 1X6LA 3D69B 2YC1B 3FFDB 1YEEL 3BRDA 1G9EA 3QA3B 1TJIH 3RKPA 5CP7B 5KSUB 1XGTB 1J0ZA 1MRDL 1Z5LB 2C7UA 2FH6A 3E6FA 3HZMB 4O5LL 3UTTB 3MJ9H 3TO4A 1RV6X 2ZUXA 1BJMA 2Q8BH 5IHUL 1NBVH 1P7KB 4J4PC 1HOCB 5D8JL 2VAAA 4P57B 4HCRH 1MLBA 3RWDA 3NCCB 4OCMC 1I7UB 2OJEA 2ZOLB 3ARTA 3MRNB 5JMOC 1FC1A 2MMXA 1S7UB 3BZEA 5EU3A 2QQLL 4DWHA 2DQTH 1OAUH 2BVTA 2ITCB 4X4MA 2X4OB 1IGIH 5K9KA 5KVMC 3HE7D 1DL7H 3P77A 5HGDA 5IB3B 1KEGL 1F58L 2CLZA 1MFDH 2A77L 4PJAA 1HQRA 4Z77B 1FAIH 4P46D 1F2XK 1KYOJ 3TNNA 3ZTJH 1D7FA 3VFUB 2VDNH 3BSZL 3BZFB 4G6FB 3I6GB 4YGVB 3IS0X 4KQ3H 5FB8B 1YZZA 1G7JB 3LH2H 4LAQH 3MOBH 1QSEB 4A6YB 3BP7A 3Q2CA 4FXLA 1VENA 4HWUA 1SJEA 4K2UH 5FOJA 4J3XA 2BOCB 3CLFH 4UAOB 3S37L 5CKGA 4G5ZL 4X7DC 1OAQL 1QNZL 4DFHA 1A9EA 2WQRA 3GMRB 4NJAL 2QEJA 3NZ8A 3PWVB 3PP3K 5DHYA 1FL3B 4M7LT 1CGVA 5HDLA 4OZHB 1ZGLP 2FSEB 4K3GA 3D3VB 3LKNB 5F1NB 4WEUD 5C6TH 1G7PB 1INEL 2EXYC 1VEOA 2J8HA 1C12A 3UJIL 5E6ID 3QZWA 4NT6B 5DQ9A 4GMTL 3I02A 5DT1H 4G8EA 1WWAX 2ZUSA 5CEZH 5JPMA 5EZLA 3RL1B 2P1YA 3FQUA 2BVEA 5CEZE 1UM6H 4LLMB 3O6KL 2HFFA 1KGCD 2YD3A 3ZYJA 3QQ9C 5CHNB 5E5UB 3TH2T 4QCIA 5L9DH 3ARDC 2VDML 1OT1A 5GGTH 2UZIL 5B8CB 2DQCL 4X9BA 3FT4A 4Z7NF 4UT6L 1HSBB 1KCSL 2CMRL 1NMCC 2WP3T 3ZE2E 5ERWB 1CDGA 1IRAY 3I2CH 3PF2A 3F8UB 4U7KA 4ZS6D 4LCWE 4OZHF 4K8RC 3C5JA 5GS1C 1XGQA 5DEGA 5FYJL 5E03A 3WYRA 2AJYL 2CGRL 2QR0B 3C08H 5EU5A 1F3JA 1BLNA 4JG0L 5J0BA 2FECL 3MREB 3QEUB 4X7SL 1K8IA 5FUOL 1IAOB 3WHXB 4U6XB 2VLRD 4PRAB 4W81A 2EIZB 1WVZA 1BFVL 1CD1B 3L5JA 2NY1D 1NKRA 4M1GH 1H5BB 3RAJH 3MNVB 5JOPE 1CQYA 1O7VA 5CJOH 4OD1H 1IC1A 3OTTA 1CGYA 5MEND 1EZVX 3U7YL 4V1DA 4LSVH 5LG1A 1CTNA 3ARGA 5IV2B 2D7NA 3OR7B 5DJCB 3RNQB 3S36X 1RI8A 1UQSA 1QP1A 2NX5B 2AJZB 4X8JA 5I0ZA 4EDXA 4M61A 4TVPL 1I9EA 3LQAC 4K9EL 3QWOB 1ZLUH 3AS3A 1XCQA 12E8H 4M7LH 4JHWL 1KJMB 2WW8A 3L7FB 2Y07L 1MEXL 2YZ8A 3VFPB 4AQ1B 3RIAK 1RZGB 5T5NF 3SQOL 5EO0B 1MFEL 1EBAA 1QSVA 4ODTH 3S8WA 3K1KC 3L5WB 4AG4L 4YEFA 4LPUA 3N0PB 2OTWA 3VRLE 3RWHB 1FFNA 1KIRB 4LLAA 3D39D 4NO0D 4P49A 5B4MD 5GGRY 1MWAL 5E8DL 3ES6A 2X89D 3JV4B 4OUOA 3TJEH 2GSGB 3SCMA 2ZWLT 4C56D 3T0WA 3FFCB 3FO9A 3TZVC 1W8NA 3AAZB 4NO2A 2H9GB 1CN4A 3EO0B 1FO0A 2APFA 1A6UH 4CMHB 2BNRD 4NZRH 3PDOB 3D1MC 4KKLC 2ZG3A 3HNTL 5DVMA 2ESVE 1CZ8H 1DUYA 2DRUA 3CFIC 3KPSE 3WCYA 2YPLA 4GMSH 1J12A 1QQDB 2NY7L 1KN2L 1MIML 4Q0XL 4QRPD 3T08A 3LPGA 4O02L 3C2AH 4TUJA 3VXSA 3L9RB 5JQ6L 4U1MB 1M1SA 3FHAA 5D1QC 3VG0L 4DK3A 4F7TB 3QDHA 5D70H 4P9HH 3TBYB 1QBAA 5CZXD 2A6DA 1JN6A 2HH0H 4PJCA 2G60H 3HC0A 5C09A 3C60C 1A22B 2X9XA 4X7EC 4KMQA 5DRNB 2PO6D 3SN6N 4PJ8B 3LPWA 2VZOA 3ESUF 1QLEL 2PUQT 2CK0L 3D0LB 2EYRB 4MA1B 5I66A 1OP9A 3FO0L 4OLUL 1JRHH 1JK8B 3GSNL 4JY4A 1EFXD 3ZYIA 1MHPL 5JDJA 1HXMB 5DJZA 1GZQA 4NNYB 3GMNA 4ODXB 3V4VH 3TC9A 2VITA 4YX2H 2HMIC 5ILTH 5D1ZC 2O5YL 1JYVA 4N0YL 4YE4L 1VPOH 3VXRA 2VE6B 1RVFH 43C9A 2AXGB 3D85D 2XACC 3C9NB 4OD2A 3QUMA 2DD8H 3ELAT 2IFGA 1N6QL 5I71B 4W68A 3MCLH 2JELL 3FZUC 4MB4A 1IBGL 1DQLL 2GK0A 4KJPD 4RFNB 1FYTD 1MFAL 3F12B 3NIFE 2XWJA 1QG3A 1KCVH 1KJ3L 3PWPE 1Z2KA 4PJ5D 4Q74A 3TO4C 2E9JA 1J8HE 4HCRA 5J7CC 1MI5E 4X6CA 1KFAH 2EEBA 4J3TA 5IP4A 1WFNA 3EFFB 1KNOA 2UWEB 3V52L 3MV9D 1Q9WA 4J6RH 4HLZG 4RWYH 1MAMH 3RQ3A 1UXWB 4OLYL 4LHUA 4OD3L 3A6CH 2R23B 5AWNH 3O4LE 4PGJA 2YUZA 3MBEB 2V7NA 2FJFA 1DQJA 4I48B 4OT1H 1L7IL 1QFUH 1ZT1A 4HD9A 2B0SL 4PREA 3OGCA 2YS4A 4H88L 3IRPX 3QDJA 2AK1H 1C5DB 4QHUA 4K7PX 5IMLA 4CAGA 1VCAA 2R1YA 4PJHE 3S96A 3VWKA 3SE4A 4HKBA 1DBAH 4P2OD 3NPSB 5D7SL 2JB6A 4GAYA 2ATPB 3EYSL 5KAQG 2QQKL 4U1HA 2NY0B 4HXBH 2W91A 3BVNA 1I75A 4HKJA 4Z7WE 2P5WE 1AHWA 2FX7L 2RGSA 3FOMB 5CEXA 2WIIA 2D7OA 4CDGC 3LQMA 2E6JA 4L4VD 1VDGA 5T33L 1S7TB 3BFOA 2ZPKH 1X4XA 1UWEH 4U4BA 2Q7YA 1NUFA 1EVUA 3WIFA 3TYGH 3MRGA 4FQQA 4YAQA 2IANB 4F8TA 1H9VA 3BW9B 3U83A 5C1MB 4Q9RL 2AGJL 4WUUB 5CGTA 1K4DB 3K4ZA 5H37H 3WIIL 1B2WH 3K81A 4DEPB 1CL7H 2X44D 1E27B 1FRGH 2QSQA 4JFOA 1FPTH 2VLKA 4CJ1A 5J89A 3AREA 2X40A 2Z9TA 3OZ9H 1JGDA 1INQA 3QFDA 4JN1L 1QFWI 1S78D 5CMAA 5D71H 2FEEI 4FHBD 3QDGB 2VNCA 2EDRA 4NC1E 2YMXL 1F5WA 3ZKXB 1WC7B 4JZJB 3SKJH 5DYOA 3HI1B 4WWKA 1CDBA 1FL5B 4U6VL 3BP5B 2VWEE 2D0FA 1HNFA 1YN7A 2XKSA 2BVYA 2VDPL 4G3YL 3GHBL 5IB4A 1D5MA 4LP5A 1A5FH 1T5WB 1BBDL 5ITBL 3BO8B 2GTZB 1LO3L 5C9KA 4Z7VE 4P5TB 3FO1A 3THML 1U8NB 5D7LD 4WI2A 2E27L 1Q8MA 4MSWA 2Z8RA 5EUOB 1T7ZA 3ZKND 3PQYA 5J1AB 5GGQH 4BFGA 5D2LB 1H3PL 5T1KB 3K7UA 1XR9A 3BIAX 4WW2A 2C3HA 4X7TB 3VD5A 2CDFA 1DTUA 4JZOA 3NACL 2HTKD 1J05B 4ODHH 5A2IH 4LNRA 1NEZA 4Y1AE 2YXFA 4Z7UB 5E7BA 3HR5A 2XZZA 4EEEA 1TJGH 3AU1A 2Q86A 1CFVL 4YDVB 3ZTJG 1KELL 3ARGC 1GGYA 1Y6NR 4PJ7A 5BVJB 3GRWA 4XGZB 1IAIH 2JKXA 4OQ1A 1CDHA 1EMTL 1IAIM 2BJMH 4ZOBA 5I17A 2EH8H 1PX4A 2VLJA 2XIDA 4YHOH 5EUOF 1A4JB 3DRQA 3LN4B 5CJXA 1NJ9B 5GGSB 5D2LF 3CUPB 2I5YL 1RK0A 4Z18A 3CD4A 4NQEA 3BAEL 5J06A 4YBQC 4FABH 2VXSH 3GGWB 1G9MC 4QRRA 4RX4D 1WISA 4WO4A 2P49B 2RB8A 4Z7UF 4PRBA 1BD2B 4UILH 2VJXA 3U48A 3B5GA 4BFEA 2Z31D 2EDYA 2BZDA 3REWB 2VSDA 2MSPA 1OHQA 4JO2H 4ZUUA 3SCMC 3PWJB 5F3BA 3G08A 3DTXA 4Y5VA 4XP9H 3FOLA 4PG9A 5E8NB 4EBQH 2NXZB 3DXAE 3OQ3B 1B9ZA 4NN7C 1BJ1H 5FO7A 2BY3A 1CGSH 1JF5A 2FATL 2CSPA 3UTQB 3MV8D 4HIHA 5D1XD 4JN2B 1KB5B 3VJ6A 1A7PH 1LO0H 1KN4L 1VACB 2CKBA 5B39G 3VFNA 5AYUL 2P46B 5E95B 2VXTL 2DQIL 4U6YA 1YEGH 1J0JA 5I1LB 1AI1L 5JW5A 2CIKA 3OBAA 1JZ6A 1A0QH 3MV7B 5JW4N 3STLA 2AQ1A 4OCWH 4CNIA 2X4SB 4OKVA 3GSRB 3S97C 4XP1H 3Q48A 1MHHA 3K3QA 4MNQA 3EIFA 3MXWL 3T4YA 4Y2DA 5I19H 1BQSA 1FNFA 2UZXB 1CGWA 1QR1A 5DA0B 5A16A 1I7RB 3X11A 4QRQB 3MLUH 3E6HA 1QSEE 4NN6C 1JUFB 4M4PA 4PR5A 4RMTA 3UJTH 3V0VA 1N8ZA 4KJYA 2DQJH 3CIQA 2BY2A 4QT5A 4MQXD 3WJJA 3PWNB 3ET9F 4LSUH 1K85A 2DL9A 1DCLA 4K7FB 1U8PA 1OTTD 5CJ5A 3QCTH 3EYOB 1X7QA 4FTVE 4OZHE 5I16A 1T0NB 4JPWH 3D3VE 4MAYC 1AY1L 1UWGL 1DBML 5CGYC 1HIML 1AO7B 3RDTD 4HG4K 3MODL 3CFJA 4QHKI 4PGCA 3N50A 1VHPA 1QBMH 4IRSA 1I8KB 1URLA 5JXAH 2BNQB 1HH6A 1MHEA 5DR5H 1HDMA 2FIRT 2AQ3A 5GJSL 4X0KB 2AABL 4ELMB 4R8WH 2EKSA 4POZD 5EU6E 4JFEE 3UCRA 1MRCL 3OJ2C 4HFWA 4LSQL 3EDJA 1JNNH 3RZCB 4UI2A 4O58H 3L5IA 3LKPB 3EFDL 2I9TA 3MCKB 3VMPA 2OZ4L 4ZFZB 3MLPA 1CLYL 2ZG2A 4HS3A 4X6BB 2XTJD 4KRMB 1GC1C 5CP3H 3VWKC 3WO3B 3SE4C 1MREL 3VDCA 4X4YB 2IADA 4ZXBD 4KVCL 5TFSL 5J13B 4LDLB 1RURL 3QI9B 1CDIA 4ODVL 4I4WB 5F7MC 3N1GC 1AHWC 1MCWW 4J3SA 4R4BB 3HMWH 4ELMF 1YEFH 4K3JL 3LD8B 4FG6C 2BC4A 3WO4C 2X4QA 3AM8A 2AKRB 4ZAKB 3SDDA 1T20A 1JE6A 1AFVH 4AMKL 3HRZA 2R4SH 2XYCA 2P5ED 4IJ3C 4ZUWB 5F89A 1DUZA 3P4NB 4HHAB 1KIQB 1TCMA 2A2QT 3PWUA 1T7WA 4ZS7H 1FN4A 1A6WH 2NX5E 3C6LA 4O51B 5D6CA 4HMEA 3LS4H 3GO1L 2EDTA 1YY9D 3LV3A 3EGSB 2AXFB 2OR9H 3AREC 4E42B 5L2KA 4EI6A 1HZHL 3PL6A 3W39B 3MYZA 4GBXC 2X42A 5TF1L 3QHFH 4UTAH 3V4PH 1WFOA 1WGOA 5EBMA 4X6DB 2RHEA 1YEEH 4WWKC 3GM0A 3LEVL 4OZFB 4XVSL 3U30B 5JXED 2IAMA 1T1ZA 4JDTL 5EB9A 2YUVA 3NN8A 35C8H 1NFKA 2I26N 1C5BH 4YR6A 5D8JH 3O41A 1U2HA 3SOBL 4J3VA 4RGNC 3LKOA 4U1NA 5KSAC 2GT9A 3FN9A 3FFCE 5JHDB 3EHBD 4D0BB 3BEVA 1CR9H 2YPKB 1XEDA 4HMDA 2W0FA 4I5BB 4LOUC 2AV7B 2DKSA 1MAKA 2XWTB 4B7LA 2L7UA 1NBZA 3M17A 2ICWI 3MSPA 4LFHG 5EIIB 4FXKB 4QKXB 3K46A 1U8KB 4F9LC 3EUUA 4X6DF 1KEGH 4KKBD 1F58H 2XPGA 4PTTA 4UBDC 1FNGA 4BQ8A 3A0OA 3H9SB 1UG9A 4BJLA 3L1OL 1DBBL 5MERB 4KJWC 1F11A 1WZ1L 4BELD 2CRMA 2DQGL 5FCUH 5CSGA 2RJMA 5DVKA 4ALAL 1U8QA 4EDWL 1VGEL 4N5ED 5I73C 3MFFA 3RWIA 3Q5OA 1LE9A 1K9TA 5CJXC 2F8XC 1Q1JH 5BQ7B 1OAQH 1UB6A 4I77L 4L4TD 1A7NL 2GW5A 3MLXL 1FIEA 4NJAH 1ES0A 2R9HD 2L4OA 3BPLB 4EI5A 4PRHA 1I3RB 4BK4A 3DV6B 5BOPA 1UH4A 4GW4A 2P24A 1X5IA 2CDEB 5DUPL 2HT3D 1U8JA 4KI5C 3PUCA 4HH8A 3VXMB 1I1FB 3WLWD 1BECA 1MHCB 3UBXG 3WD5L 4WO4C 4GMTH 5K93A 3P0VH 5H37G 2Z8VC 5F7EL 5I1EH 3QQ4A 3P40A 1T04A 5CBEA 3K2UL 1BP3B 2VL5A 4OLWH 2J2ZA 3O6KH 4JKLA 1EEZB 2DMCA 1E28A 2EZ0D 3KLAA 4XC1L 5K9OA 2VKWA 4TVSa 3V7MA 4P23D 3JWOC 4Y5VC 1P7QB 1OWRM 2D7QA 3IDMA 3VD9A 2UZIH 3D18B 3EJJX 3T0XA 2DQCH 2MHAA 2SEBB 1EJOH 1QRND 1PBYA 2X4UB 4KAQL 1PZ5A 3O2WL 1S7WB 3UTPE 1E0OB 1B88A 3E8UL