1U3NA

A sod-like protein from b. subtilis, unstructured in solution, becomes ordered in the crystal: implications for function and for fibrillogenesis
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
162
structure length
162
Chain Sequence
VVETSAFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALLGNNEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical superoxide dismutase-like protein yojM
publication title A prokaryotic superoxide dismutase paralog lacking two Cu ligands: from largely unstructured in solution to ordered in the crystal.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 3
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1u3nA00
3ECWA 4N3TA 1E9OB 1EJ8A 2AQSA 2SODB 1IB5A 2XJLA 3ECVA 1E9PA 4MCNA 2WWNA 2XJKA 1JK9A 1YAIA 1Q0EA 1YAZA 3KM1A 1DO5A 5KBKA 1Z9NA 1OZTG 3L9YA 2Z7WA 5KBMA 3CQPA 1XSOA 1HL5A 1SXBA 1XTMA 3GZPA 1PU0A 3T5WA 2WZ5A 1CB4A 1P1VA 2WZ0A 4A7GF 1BZOA 1OEZW 1IBHA 1Z9PA 1CBJA 3H2PA 2ZOWA 1UXMA 1AZVA 1UXLA 1XTLA 1HL4A 2VR6A 2ZKWA 5KBLA 2K4WA 1MFMA 4OH2A 1N19A 2Z7UA 2WWOA 4BCYA 1ESOA 1IBFA 1B4TA 2GBVA 3CE1A 3L9EA 3GTTA 4U4IA 4BCZA 1E9QA 4A7SA 3MKGA 3MNDA 3S0PA 1SXCA 5CU9A 1U3NA 2WKOA 3KM2A 2AEOA 1SXSA 4MCMA 1OALA 3KH3A 4A7GA 2C9VA 2AQRA 1E9PB 1SDAB 3HW7A 1JK9B 1SPDA 1OZUA 2APSA 2E46A 3RE0A 3HOGA 2AQQA 1SXZA 1OAJA 2Q2LA 1L3NA 1SXNA 3F7LA 2AF2A 2LU5A 1B4LA 1SXAA 2AQNA 3CQQA 3K91A 1DSWA 1YSOA 2AQPA 2V0AA 2JCWA 4L05A 3QQDA 3KH4A 4A7QA 3GQFA 3HFFA 1COBA 1PTZA 1RK7A 1IBDA 2VR8A 2WYZA 3GTVA 2AQTA 1E9OA 1PZSA 2Z7YA 2ZKYA 1F1AA 4A7VA 1TO4A 1JCVA 1E9QB 2C9UA 1F1GA 4A7UA 2WZ6A 3PU7A 3GZOA 3SODB 2GBUA 4FF9A 2WYTA 3LTVA 1EQWA 4N3UA 4B3EA 1IBBA 2VR7A 2C9SA 3GZQA 1S4IA 1N18A 2GBTA 1F1DA 2E47A 2WKOF 4BD4A 1SDYA 2JLPA 1BA9A 1QUPA 1SOSA 1TO5A 3KBEA 3ECUA 3F7KA 3H2QA 2ZKXA 2NNXA 4OJAA 1KMGA 1F18A 3KBFA 3QQDB 4A7TA 2Z7ZA 1FUNA 1SRDA 2R27A
chains in the Genus database with same CATH superfamily
1RH8A 2VSCA 3LKNB 1EBAA 2WUCL 3BSGA 1M05A 1GZQA 2VDMH 2YBGA 3IXTB 3OSKA 3NPSC 3QUZC 3PJNA 1EDHA 3VXRB 2XVGA 1HX0A 2OSXA 1JWSB 1T2XA 5IMKB 3VD0A 1K6QH 3FTVA 4FNUA 4LCIL 3VXRD 2XZAL 1TQBC 3FT2A 2KUTA 3ZGHA 1WC7A 3MGTA 1IFGA 3ARQA 2AXJA 2IANA 5CSZB 3Q1SL 2GC4C 1RL1A 4AH2A 5FPIA 1WFOA 4U1NB 2OP4L 4NWUL 5C08A 4CU6A 5F7BA 1KBKA 3FCTA 3T2PA 1KBPA 3DJ9A 4A6YA 4AQOA 3MREB 4Z7VA 3B1UA 4AYEC 1FA4A 4B9KC 1DE4B 1W0YT 1YDPB 35C8H 1AC0A 4PJHA 1D5MB 2OSYA 4U4IA 3FF8A 2X4OB 4EKJA 1EJOH 3BVVA 5DC0A 4KY1H 1CU4L 4TS6A 5LCVH 1IGML 1TNNA 4ZMTA 1T89C 3B9EA 4DQOH 1YN7B 1F3JA 1NMAH 3B3IB 4R4FL 3S9DB 2Q8AL 5DWUL 3HW7A 3L3DB 5I1LA 5B1JC 4C83B 5E5UB 2XPGA 3GI8L 3VM5A 4W70A 4MJ5A 1NC2A 1CGWA 4F91B 4LP5A 2Y7QA 1AZNA 4JDVB 1OCWL 1Z5LA 1M9WA 2O72A 3EOAB 1WZMA 4Y1AE 2G2NA 2ZTBA 2L7EA 4UMSA 3WFEH 3N91A 3T4YA 4EN3B 4ZUTA 4HPOH 3FUHA 3K71B 2Y4SA 2AMGA 4EN3D 4OV6F 5EUOA 3IMWA 2Z4QA 4G8GB 1EZLA 5D1QA 4H5SA 3MNZA 5KVEE 3LS5H 5FLVA 5LBSA 4G8GD 3K80A 4CVUA 2DQ6A 1OE3A 2BNUA 2HKFL 1NBVH 2EH7L 2IDUA 3N50A 1SLXA 2WN3A 1VKXA 2DQDL 2NX5B 4J1UA 3Q2WA 3RVXD 2Z31A 3MV8A 4LNRA 2DEXX 2NX5D 2KZKA 1JGDA 2LTQB 3BPOC 4XNDA 5AVWB 1TJHL 1P0SE 2CPUA 1HEZB 1JGUH 2DICA 5DD5L 4K5LA 1MEXL 3NP4A 4N0RA 4K4KA 1LHZA 2PW2B 3TO2B 2AS5M 2BFVH 1K8DB 3NZSA 5JW5B 4OJEH 3QUXC 4JG5A 2AEQH 3O6LH 1I1AD 4PGEB 2PWGA 4HWEL 5IQMA 4ZXBB 1CMOA 4L4TA 3UTSB 2GK0A 4XBMA 1DCLA 4ZXBD 1CICB 5EWIH 1TYRA 3HEIB 2YAOA 4HZLB 3UTSD 1BZ7B 1CICD 4Y4KB 5MEOB 4Q52A 2BSSA 2VDLH 5EN2A 2VMCA 4BV1A 4F8TA 3TEUA 4Y4KD 1D9KB 3FT9A 1D5XB 1TQTA 2NTFA 3LVEA 3QDAA 4PJEF 3T8MA 3X1NA 3RY6C 2APFA 1EFQA 4MSWB 1D9KD 3Q06A 3IFPA 3KYMA 2EE2A 3JSSA 1P1ZB 15C8H 2ESVA 4NFCA 1W8OA 3P3RA 1SJEB 3BJLA 4PIRF 5EH1A 5F9AC 1R3IL 2ZNWA 4KDTA 2B0SH 4MJ2A 3PIQA 4XCCH 5F7YC 1NTDA 3FU8A 2FJHA 4WI8A 1HN1A 1JZJA 4H4NA 2O5YL 1IVTA 3TNNB 1A4JA 1KIUB 4UTAL 3ILQC 4TPRH 4YE4H 1DFXA 3FZUC 1D5IH 4RGOH 3N1GC 3PFQA 5H37H 2E6JA 4L8SB 2HFFB 3NYKA 4KOBA 1Q1PA 2XETA 2PYFA 1ZANL 4X0KA 1IL1B 1WA1X 2B59B 2HX7A 3KPTA 3FULA 2VXQA 3HUJE 6PCYA 2OMWB 1XR9A 3ELQA 4LOFA 5DZ9A 5A2KH 1S7RA 4QKTA 3V5HB 3MCKB 4Y5XC 1IJ9A 1X4XA 3BDXA 2FECL 2H8PA 4F7TB 2IV8A 4S0SD 2WNWA 4PJXB 3UYOD 1TVBA 1S6NA 4M7LL 2D7PA 4GXFA 4J3OG 2E46A 4Z23A 2GYSA 3GMMB 3N43B 5DZPA 1U92B 3B2VL 3COOA 1W0VA 3D2UB 3G3LA 4LLMB 3G6JA 5FO2A 4JJHA 3QZWG 5CLYA 2V9UA 3D2UD 4N8VA 2XTJE 2CCLA 3EXLA 1MJJB 3NA9H 5TE6L 1BFSA 2FO4B 1PY9A 2YAPA 3CX2A 1ZLUH 2E74C 4I8DA 1HXMB 2V2XB 3TF4A 2PNDA 2QSVA 3TWYA 1MQKH 4RX4D 1G6RA 2A74A 2BZCA 1WO2A 1IE5A 1ZPUA 1JWUB 3UYRL 1QVOB 3FFCE 4UQEA 4GBXB 4ELME 4TULH 3T0ED 4P23C 3IGUA 4GBXD 5TQ0L 4OZGF 1VEMA 2N7BA 1DLFH 4MCZA 2ADIA 4JPWL 4KKLC 5CP3H 2FRGP 4B3EA 1I7RA 3KXFA 1HT6A 5TE4H 1XCXA 1IEBB 1E65A 4MQXC 1N12A 3IDXH 4N2KA 1BZEA 1IU1A 2WIMA 3GBLA 4G42B 1A1MA 4L0PB 3WUWA 2P26A 3H9SB 4XB7A 4WHDA 1HQ4B 1ZLWK 3SE4C 3GF8A 4ELKA 4ZOBA 3RNKB 1GKOA 3QHFL 2EDTA 2EXTA 2VERN 4U6XA 4D3CH 4XN1A 5JQIB 5C0NC 5E94A 4M7ZB 2E9BA 2P48B 1PNDA 3EFDL 4OLUH 3RGVA 5GZND 3VGGA 3VWJA 3LRHA 3EGSA 4XOBA 3SDCA 2J8UF 5CGMA 2CRYA 4XNQB 3TV8A 4LSTL 1RK0B 2AI0H 4P9HL 4EIBA 2X3CA 3UJTL 3LIZA 3QDGA 4XGZB 4ATWA 2PCYA 5EFIB 2OAAA 3QG6A 4OLWL 5AG8A 1O6VA 1U8IB 4N9GA 2IG2H 4IRJB 4ZPVA 1MNUH 1BAWA 3MV9E 5GRXG 3DX0A 4IRJD 3RZCA 4JJ5B 1VESA 1DBJL 4PP2B 5CCKH 4FFZL 3UCRA 3SD5A 5DF0A 2OMZB 3QWRD 4NZUH 5EC2B 4MVBC 4OAWB 4OZFG 5KSUB 4P04A 4YDVB 3PAUA 1CDJA 1HHKB 2O6CA 3QR2A 5EZOL 2WVUA 1IQWH 4Q56A 5ISZE 1AH1A 4IEFB 4OJFH 1J0YA 1RK1A 1ZVSB 3IDIB 4P3CH 1N2RB 2FQGA 5BOPA 3PDGA 3QHTC 5KOMC 2DLFL 3O2DL 3EDDA 4FYSA 3VFRB 3NRPA 1HOCA 1NL0H 1LMIA 2J5LC 4N0UE 1A6UH 3D85B 4XN9A 2ZWKA 2QVTA 1CJYA 1RURH 1ZA6A 3D85D 5IB1A 4I0KA 3GXDA 4OVVA 2P8MB 3IYLW 4AQAA 3TASA 3FU6A 3VGHA 3M17B 3OGOE 3D25B 1IGIH 1UJ3C 2F6AA 4WU7B 1RU9H 4UWQB 3EFFA 5EOCL 4NNPH 1ZGLA 3CCHB 3V0DA 1UT9A 4Z7WA 2QV2A 3MTXA 4HJJH 3OLIA 3QH3A 4LIQE 1A6TA 4HGMA 1K4DA 4V11A 4ERSH 5KVEL 4P57B 3OJDA 4QHKI 4Z78B 1WZKA 3T3PE 3BKJL 1A4CA 1JUFB 2HA1A 3GJFA 1QACA 2HTKD 4BH7B 4OGQC 2CDGB 5D1XC 4QEGA 1OCRB 1TKWB 3QI9B 1YNTF 3S96B 1NIDA 2EABA 4GINA 3K2IA 1MJ7H 3QI9D 1DO6A 1QLRA 3D12B 3EDEA 4BSWA 3SGJA 2VSKB 3O9WD 1J18A 1M7DA 4KHXH 4XAWH 4ZMQA 4LEXL 2FWOB 1F3RB 4N2FA 3APFA 5E70A 2Q8BH 2VDOB 4I0PD 2WCSA 3TPUB 2OTUA 2FZ3A 5IF0B 1I1RA 1V7NH 4U7SA 4XRCA 3F7KA 1RZPA 3GWJA 1KG0B 2H6PA 2HRPH 5ERWA 1Q9OB 3UDWC 2OL3B 4ZFOA 4LOVA 2ZKXA 1BYNA 4GRMB 1OK0A 1G7LB 5ALBH 5HJGA 4MJIA 3S3JA 4YSOA 3K8MA 2VYRE 1UA3A 3ZKXC 4OGZA 1KLFA 3VI4B 4KTEH 1EAPA 2AQSA 3CC5B 4N0YL 1A3RH 2W1NA 4NENB 2JLLA 3DUSA 2J8HA 4NRYA 4OF0A 3CHRA 3VFNA 3P0YH 5EU3B 3TEXA 1OM3L 1NDMB 1CK0L 3BN9C 1F4WH 3QUHA 1P4IL 4PLNC 4W68A 1BQRA 5D6CA 3GJEB 4GPVA 1JGLH 1M53A 4UQIM 1UCTA 3QFDA 4HIPA 1MCFA 5L6YH 2OJZH 3VFUA 4R9HA 4WFFE 3LIUA 2JCCB 4XP1H 4NM4L 4AYBA 1JYVA 2QFRA 3D50A 3D39B 3I2CH 1LP9B 3EO9H 2A5UA 1SQ2N 3HPJB 3WY1A 3D39D 4DETA 4MDIB 5CP7B 5IBLC 5HJ3A 4HPYH 1TU2B 4JRYE 2OTPA 3MOBL 4M7ZC 4PGCA 4I7ZC 4B0MM 5D7IE 3CSPA 3WS3A 4Q97A 4ETQB 5GS2H 2VLKE 5KVDH 4E0RA 1BQ5A 3GSXA 5EBMB 1N6VA 5C3IA 4PRBA 4JM4H 3TIEB 1OAJA 3L5XL 1SZNA 1DQLL 5C09A 4HUMB 4MXQC 3INUH 2D9CA 3UZVB 2FLMA 1WAAE 1SXAA 2CXKA 4IMLA 1CDIA 5G5DB 1FZMA 2DI7A 4PRPA 1CDGA 1S7TB 1TQVA 2NZ1A 4ZW7A 2LV4A 3DX8A 4UILL 1T80A 3RBSA 2AGJL 3ZKMC 3R0MA 2UUDK 5FGBA 2A1WL 4JFFB 1R17A 5A7BA 5EN3A 5EA0H 1GR7A 2Y1ZA 5DC2A 3N1PC 5EUKB 1A8JH 1T4WA 2ZYRA 4JFFD 3UMTA 2FIKB 1EBPA 1UENA 3F2LA 4JRXB 5CJBA 3RURA 3QQNA 5L7XL 3CDFA 5C0CA 4HISA 2XC8A 4JRXD 3UZEA 1FVDA 4AQ1A 2C7FA 2BC4A 4OKDA 1O9VA 4H0LC 1DQML 4HDIB 4G8EA 3WL9A 3CVBA 1X5AA 4DGVH 3NESA 4YPGB 5E2WL 4GSUA 4NFDA 3D51A 1KYDA 7TAAA 1GXEA 2VXUH 4G6JL 4HK3J 4MJ6B 1KCKA 4AYID 5DZOA 4JGUA 1RV6X 2PXYC 3B2XA 5AZEH 3QORA 3FU3A 4IOSD 4IOFC 5KTEL 5D4IA 4M8RA 4NIYE 3NEEA 5IFJA 3TT1H 5F1KC 1BD2E 3N85H 1JFQL 3FPYA 5EOTB 4JFYA 2X4QA 4O00A 4JFDA 5JHLH 2WINB 2A6IA 3M86A 1ZS8B 3N40P 1EAQA 5H2BA 4YEFA 1FL5A 4L4VE 5G55A 4XP4H 1Z6JT 1XL4A 3B2UC 3QA3A 4KKPA 5IESL 1C5BL 3IXAA 4FXGA 3ZHFA 2WLZA 1KGYE 2CLVB 4H8WH 1MIML 2N1TE 3H0TA 4K9EH 3WN5B 5HYSG 5KS9B 5IW3A 1JDCA 3P9LA 3CSFA 1U0QA 1SBSH 5KJ7E 1IILE 1P4BL 4MXVE 2VERA 4JM0A 4JKPL 4X6CB 2CCVA 1OAKH 4HS6A 4OV5B 1QNIA 3RFZB 2VR4A 5FW8A 4BFJA 3NJJA 5DUJA 3PWUA 4QXVA 2WIIA 2ZCLH 4PRIA 3RVWC 1JE6A 3CBJB 4JFXB 1GL4B 1F56A 1XSJA 5C7XL 5C71A 2ZE0A 3JZ7A 5ALCH 3OGCB 1UASA 1NZRA 3H42L 4PJCB 5JW4R 5CU9A 3TEYA 1FYHB 1QBAA 2FEEI 1FE8H 1XIWC 1PL3A 2JJWA 5E2UL 3L5WA 4Z76B 1XF2B 2Z1PA 5C0RL 4EI5C 2M2DA 3NJFA 1QBLL 4P2QE 2FR4B 1SXNA 5T3XE 1BVZA 1IKFL 4OJCA 3U4BL 3UYPA 3LH2L 5KSBE 1MY5A 1CI3M 5AW9B 4U6YB 4KXZI 4JG0L 3HCVB 4MB4A 2PW1B 5HHNA 1DQVA 1PKQE 4IBSA 3ZYIA 1CBVL 1J1XL 4HJGB 3IRPX 4PJEA 1OAZH 3HC4H 2P24B 1IZJA 3KCPA 1H3TA 2NNFA 3KHOA 5CJQH 1N10A 5FO8A 4L0YA 4N20A 4DN3H 4LIQL 1JNHB 1T0PB 1F4HA 2WUBL 3NH7L 4D0CB 2EYRB 2FYYA 4JFPA 4F8QA 2BY1A 2DZEA 1UWEL 2DQHL 4QOKA 3TH3T 1L0PA 5L4JA 3S37L 1ADQL 1F1GA 1IBGL 2BHZA 1OT4A 4TUJA 4IRSC 5HGHA 4PJ8A 4UTBH 1V5JA 1PZ2A 3KWTA 2AXGA 1WDAA 4K5NA 3ZL4H 1RZ8A 1TCMA 4UQ2B 4G9FE 2IH3B 3ZE1E 4GKNB 3IJEB 2NLJA 1A4AA 2OJEA 3O45B 4XN4A 2R1XA 5AUMB 4A6YH 2R2CA 3GXIA 2Y6SC 3EJYD 5IMOA 3P30L 1ERNA 1NA8A 3VM7A 3D18A 5DURD 5D7LA 3ZPDA 5MEPA 1U8PB 3F12B 3MYJB 4FXKB 1LO4L 2VLKD 4WU5A 1UYWL 5IEKA 1U6AH 1HAUA 3L4CA 2ZKHL 1I7ZB 2PWFA 5GISH 4N3TA 5HHOE 4EO5A 5IFHL 1QRKA 4MDJB 3U46A 3VSUA 3Q5TA 3A47A 2PN5A 4U6VL 4HHAA 4Q6IA 5IFAL 43C9A 3QPXL 3OXSA 4HKZA 4B3VA 2R1WB 4BZ2L 1F00I 4LLWA 1T4KA 4GRWH 3VYNA 4K8RC 2CA3A 5I24A 5I5MA 4L3AA 1RZFL 2ENSA 4OD2B 2VWEC 1AOHA 3KJ6L 1EHLH 3DYOA 4XZUB 1UXLA 4Z7NF 4W9DC 2YPVH 5GRZA 4OZGA 5LBSH 4R90H 5DXWA 1M56B 1ASQA 2EC8A 2VZ1A 4U3SA 1ZLVK 1KWGA 5C07A 5EZJA 1T66D 4XBGA 2YOCA 1E3FA 1U3NA 2CDEB 2GPZA 3GGWA 4NQEB 3VGFA 3ZR6A 1EX0A 4JX0A 1T7WA 5A6MA 4NQED 5K59F 3SPHA 4OM0L 4DJMA 1IFHL 1ND0B 3WN5C 4IGBD 1PYWA 1RZKL 2NW2A 5FUZH 2VDPB 3MFFA 4Z3IA 2GJZB 4HGKC 3C12A 4NKIL 4NXSA 4FL4C 1I1YA 2YGQA 3VE0A 4KTYA 1BIHA 2MSPA 3O8XB 5I2IB 3GXPA 5J7CC 4LVNB 5ENWA 2CKBB 2J8UA 2OM5A 4O4YL 3O8XD 1HH9B 3EOTL 1K9TA 3GO1L 3J07A 3PWNA 4YSUA 4Z3GA 4PY8I 3KBHE 1KENL 4LRNH 3GXNA 2BO0A 3WY3A 5L0QC 4PLKC 3VD9A 3EH4B 1ITCA 1R3JB 1K5NA 4FOMA 2KMWA 1L7IH 2B16A 4FP8L 4LDEB 5J9PA 1E9QB 1GGYA 1GSMA 1T1XA 3MODH 3H53A 3JWNC 4YO0A 1D5ZA 2OR9H 1J7VR 1FYTB 2XKNB 3JWDC 5JXED 4PGDA 3MRHA 5L2KE 1T7ZA 3CFKA 4FAAB 2IBGA 4ZOEA 4ONHB 3O4OB 5AW6B 5AYQA 3HS8A 5EDXA 4L29B 1QSVA 4WUUB 4A04A 2EIDA 1RHHA 4PRHE 4CADB 4WUUD 1RIUH 4Q7DA 3MRIB 4BQ6A 2W0FB 2J20A 3IJ8A 2VXQH 3IN0A 5EIQA 3LQZA 3NABL 2M83A 4BDVA 4WEBH 5D72H 5ID0B 3VG0H 1ACYL 1KBGL 2I5YL 3IFLH 2PO6B 4FQIH 4UUJA 5CZVL 4BK4A 2R27A 2PO6D 1LK3H 5E4OA 3DHPA 4RFEB 3Q01A 4PJ7B 4OKVA 1NBCA 3FPXA 3WSQH 4O2FB 2PWHA 4R2GB 5JIQA 4ZTOH 3KL5A 4X4ME 4ZOCA 3DBXB 2OXGA 2YMXH 1RI8A 5DMGD 1WLHA 3BEWA 4YX2H 3G5YA 3MLUL 5D9SA 5L8LB 3JUZA 3FTSA 4S11A 1LXMA 3FCUB 4XI5D 3SBQA 1AR2A 1QYGL 1R5WA 3KLKA 3T6ZA 1JDDA 4M02A 4A2EA 2YIHA 4LFHD 1CFNB 3AABA 3AFLA 3NJHA 4Q6YA 1FNGB 1G6RH 1WCBB 1LEGA 1YNTA 5CD3A 1W91A 4W4OA 1A7BA 2DJ4A 3DPBB 5B1CA 3SDDD 1HHIA 1SM3H 2G5RA 4MBRA 3BYTA 1UM6L 1WITA 2DBLH 1CWVA 1T1YB 1F6FB 3BHBA 1PKOA 1L3WA 2YRLA 2QQLH 2EH8H 2R69H 1AGEA 2ED9A 5FYLD 1E28A 4ZS7H 3BP4A 3NUKA 3P54A 4KI5D 1W72L 1Z7JA 4PJDE 3QUKB 1ICTA 5T3XL 3KWUA 3RUGE 3ZRFC 4S1RL 4ZAKA 3RWFB 4QI3A 1V3JA 1ITBB 2A38A 2KQNA 3FF7A 3MR9A 4LCWB 4OGYL 2CO3A 2NR6C 2V9TA 1L6XA 1DQIA 2Y0SA 3HN3A 2RR3A 3IB4A 4JQVA 1GA2A 1UWGL 2OMYB 2F15A 2VCOA 2X4TA 3RA7H 3EYSL 5BNXD 1TLKA 4QGYA 4XCEB 2X6MA 4PGZA 3FH8A 3FHQA 5TF0A 3WGVB 3AUWB 3AY4A 3IGAA 3LIZH 4JO3L 2C9UA 4HIJA 3UTZB 2I60H 3BPLB 3IE4A 2K6YA 1TLMA 4ZSOE 1QFUH 2DYPA 4O02L 4BA0A 4XOAA 3U6XA 4OZHE 4P5KA 2VDQH 1GOHA 3S35L 1LTXA 5GGSY 4EUPB 2HT3C 4KVNH 4PV9B 5ACZB 4LVHB 5C8JA 2GIMA 2BS71 5IW6A 4NCC1 4H0IA 4QTFA 3I6GB 4MQTB 4C55A 3CDGA 1KPRB 1JD9A 4NOBA 3E6HA 3WBDA 2O5ZH 1VGKB 3TS8A 4LU5H 1JTOA 3RVVD 2G9HA 1P7QD 3GRWL 4NP4H 4DO5A 2ZCKL 3W5NA 2ADFH 4HLEA 2QPSA 1AGFB 3VFPA 4TSCL 4FADA 3GUTA 1Z1WA 4LZKA 3FN9A 3P0GB 2UZPA 4JPKL 2H2PC 1T6WA 1QW8A 2XN0A 3OHMB 4NO2A 3WIAA 2BXYA 1E7VA 2GSGA 3ZU8A 1XCTB 3P0VL 3KDMB 3QWQB 3IVKB 5EOQL 5AKTA 5D70L 5IB4A 4XMXA 3S6CA 3VVVA 2HT2C 4A67A 1S9KC 2Y7OA 4NQDB 1CTNA 4M8QB 3NZHH 4NQDD 2HZHA 3PDDA 2VO5A 4NQCA 1KELL 4PVNA 1CXEA 4NFBA 1MCOL 5JQHC 5KN5B 3MJ6A 4NI6A 4YDNA 4GSXA 3FQXB 3MRBB 3QCTL 2WYHA 4OJDH 2WWOA 3E3QC 2W88A 3ZE2E 5IUSA 5LNGA 1BEYL 3GJFH 4BFBD 1JTTA 3QXWA 5J5EA 1DDHA 4GG6E 4H40A 4XX5A 1O5DT 1XGPA 3NMEA 3VRJB 3FYEB 2BHUA 4U1MB 2VMEA 4PRHD 5EU5B 1WWBX 3K3QA 5F7EH 5JORB 4ACTA 4QLWA 3AW5A 2VLLA 5B39G 4X5XA 2G9KA 1AVAA 1WGOA 2VXSH 1ORSB 5LGHL 1TMCB 4DKFL 5E8DL 4P2RB 4ZK8A 2JKXA 4EIGB 3FMGL 3LQAL 2NYYC 4WNJA 3QWNA 4M7KL 3CFDA 4P2RD 3CPLA 4PB9L 4RMRA 4AGNA 2IBZY 4ENEC 1FBIH 8FABA 1SYVA 1GC1L 2ICWJ 4LASL 4APQA 2W91A 4LLQB 2O6PA 2DLEA 3SDXE 1OLLA 2GJ6D 4AM0A 5EEWA 2EYSB 3E9TA 1Q72H 5GS0D 1X5YA 1LK2A 3MRMB 2AABL 4XXDB 4YOKA 1PFOA 3GYRA 2JI3A 5FHBL 3VSVA 4GIAA 2J2ZB 2NDGA 1HIMH 3LZFH 4MX7A 3NPZB 2UX7A 3O3BA 2DM7A 2QKIC 4NM8L 4N2MA 5BZDB 4JRLA 5A16A 4MXWL 3W11C 3MACL 1GVIA 1M7IB 5DJCB 5E56A 1QTSA 2WXMA 1DVFC 2K9UA 5CFHA 3FO2A 2LGNA 3MGAA 2RH0A 2DD8L 4WJG3 4YZFE 1BPLB 5K9QI 1K8IA 5JOPE 3OKEB 2PCFA 1P69B 3ARBC 4OUUA 2WBJC 4JQXC 5I16A 4EQ2A 4UIMB 5D2NC 4B9FA 4DTGL 4XCNA 2EJ1A 5TFSL 5C92A 1N3NA 3QIUB 4Z95L 1KB5L 4M62H 5D7JC 4OI9A 4KWUA 3WKQA 1J9CT 1ZA3B 3QIUD 4YLBA 4E5XA 2YAFA 3OSVA 4K3JL 3N42B 4P49A 1HCFX 2WWNA 1MHCB 5E4AA 5FV2A 2H32A 4LOEA 2XN1A 1QBMH 4AJYV 3NFSH 1KJ3H 2NY5H 3OAYH 3NCWA 4PRNB 1MRFH 1P4LA 4B9PA 3O3AB 4A55A 2MWCA 3BWAA 2Z92A 1FGNL 4Y4HA 3T2QA 4WGVB 1HH6A 3GB7A 3LKSA 3DO4A 2J4WL 4PJ9C 1D6EB 4WW2B 3ES6A 4FABH 3F6JA 1NAML 3MBEC 2WY3B 4NBZB 4BKLA 1G9EA 1HCYA 2F5BH 1A5FH 3HI1A 5E00A 1FFOB 3KPRB 2A6DB 4X8GA 3NDZE 4ODHL 1SN5A 3OZ9L 5FUOH 3NBNA 3UC0H 2JQMA 3HI6H 3KPRD 2VUOA 1A6WH 4N90E 1RY7B 3L9EA 3QEQA 4YHLH 3FU7B 2Z6FA 3T4AA 3DRTA 4A7SA 1QLFA 1AJ7L 4QTIH 1VF5C 5E9DE 4MMZA 2EYTA 1BAFL 4PWIA 1KSRA 5CBEA 1UURA 3H4FA 1BGXH 1R3LB 2D03H 5DRXB 1GY1A 4TXVB 4UDTA 3THMH 1RHFA 2D2CC 2Z4TA 3KYOA 2Q8BL 4GXVL 4K3DL 4XCFL 3LEVL 5E51A 5F0MB 4BELD 2BVEA 3HJ0A 3U79A 1BV8A 1T6VN 3PAYA 5BVJA 3ZIMA 4OTXH 3U1QA 2BVQA 4C4UA 4D0BA 2FBJH 5JHDA 2QFPA 4WEUD 3HAEA 2A9NH 3P3TA 1B0RA 4L05A 3TA4D 2WC7A 1N8ZA 4EDXB 4F92B 4K94H 3V2AR 4MZIA 4Y19B 1O75A 1GGBH 1IM3B 1INQB 4OCWL 5DJ2A 4M9OA 3IDYC 4Y19D 1IM3D 3GSVB 1AQDB 4Y2DA 1KCLA 3OKLB 4OR1A 1BZQK 1FFPB 1TETL 1YEFH 5IK3B 4YEEA 4CMHC 1U8QB 3FDWA 4PG9B 3ZTNH 1LDSA 3BKML 3EW3B 1QQDA 1ORQA 3FQNB 4K55A 4LVOB 3SYOA 4XVSL 5EIIG 2EUZA 3ZHNA 4QLRA 5ELIA 5A2BA 1AYRA 4WFGE 3DVGA 3D4CA 3QGVA 3BT2L 4G1EB 4TQEL 4HWUA 3QIBC 2WXQA 3W57A 1X5KA 2GITB 3DARA 4IU2B 3V4VL 3QO0A 3GSRB 3RWHA 4HXBH 2QQNH 1SEQH 3KBFA 4OLYL 1GGIL 4GO8A 3WIIL 3UPRA 3K6SA 3PP4H 4PJBE 2RCSH 3G08A 5IB3B 1F2XK 5E1IA 5B1AB 1U8CA 1UZ8A 3DUUA 2K3TA 4MA3B 3O4LB 3LD8B 1B90A 4X5QA 4HLJA 2YUZA 1YAZA 1MLCA 1OP9A 1Q9KA 3O4LD 1XF3A 4PW3A 3QUYA 1E27B 3IJ9A 3T04D 1OP4A 4JHWL 4EAEA 1T1WA 1EA9C 4GSQA 2H41A 3F6IA 2I25N 2YKLL 4WWOA 3IMSA 1J9RA 4DGUA 5F89B 1JYWA 2FBOJ 1I7UB 4E9SA 5BRZA 3P77B 5AENA 1G94A 1MH5A 2Y2YA 3E8UL 2QVIA 3UFIA 4ILDA 1UM5H 4HVBA 4F7KA 3MKGA 2XHNA 4FI6A 5E08H 1KXHA 5C0IB 1H0DB 3JV0A 3WY2A 5DDHB 3QQ4B 1VHPA 4R7NA 2CA4A 1HHGA 4I77L 4G8FA 3IFNH 1XQ4A 5E2TH 5ILTL 2DQIH 3W0WA 3Q3GA 4AUUA 4GYBA 4G43B 4ZUUA 3KJ4B 3B37A 4HWBL 2AQQA 4XPTH 3ULUL 2EQDA 4YXHH 1Z3GH 1FO0A 1FL3B 1MRDH 1RIHH 4UB0L 2FSEB 4M43L 4NN5B 2BIQA 4XXWA 3I9GL 1UC6A 3LH9A 3UZQB 5GGTA 3T1FA 3CXFA 5DK0B 4URTB 3HFFA 2NY3C 1I9RH 2ITDB 2G75A 2R4RL 4UOW0 3R1GH 4AT6A 2AERT 3BIKA 4KQ4L 2JV6A 3HZVB 2BNRB 3EADA 2XV2A 3MROA 1RFDL 3SKMA 4EQ3A 3FUNA 1D5BB 1H3GA 4J5VA 1NGWB 2B4CH 4FG2A 2BNRD 1BM7A 1JCVA 4UM9D 3IF1B 4LDLB 5DTFA 1MXDA 2ZIDA 2MTPA 4EN2A 2CO2A 5B8CA 4TSAH 1EDQA 2WLKA 5JIKA 4JFZL 1CD1B 1LDPL 3F58H 2HX8A 4DZBB 5CGTA 4ENZA 4XPGL 1QATA 3BVUA 5D96B 4FMFA 3U2SB 4YXKL 4N2AA 1JNNH 1EXGA 2ATKB 1LO0L 1MPAH 3BKYL 1S7UA 3HNSL 5I1KH 3DMMB 2IAAC 4BWTA 4M5YL 2IQAB 3WTUA 5F88A 3IBEA 2ZYIA 3UG5A 3DMMD 3MDJA 4WNSA 1UACH 1JV5B 5I8KH 3RVUD 2ARJQ 4LLDA 5AAWA 3V6ZB 2VM9A 1A14L 5J11B 2GVYA 2R2EB 1TFHA 1F18A 1QPKA 1AHKA 5DJAB 5F3BA 3TT3H 3ERXA 4P5RA 2BOBA 1S7SB 3KWVA 4RETB 3RJOA 2OQJB 5B4MC 2D8KA 5IP4A 2IFGA 3P4LA 5JHBA 4NJAH 3S8WA 2GT9A 1FFQA 5E1AA 4L3EA 1FNAA 1S9WA 3D69A 2VC2L 3B8YA 3NFPB 5F8QC 5DUPH 2VDNH 2ZSVB 3DI3B 2ZUVA 3LZRA 1MY7A 2YPLB 3CFJB 4G6AC 2XWJB 4D94A 1SJVA 2VABA 1N5YH 2YPLD 3B7RL 5ADPH 5DMKB 2VB5A 3MRJA 3OKKB 3QCUH 4QUOA 3ZDYB 3NIGF 3QS3A 2YEQA 3ILPB 2B77A 3F5WB 4OQTL 1QFHA 3F7VA 2V6HA 2MOGA 2NXYC 4I18B 1HXYA 4HUWB 5E8PA 5DLLA 1KGUA 4HEMA 4NC1C 3CIQA 1YC7A 3SCMB 4DP4X 2COVD 5F9OH 2V7HA 2VJ0A 3RWDB 4GI6A 4ADJA 1WBYA 3SCMD 2FSDA 2H9GA 3GBNH 3C9NA 4G6KL 2IOOA 4L8CA 1RUML 3GHEH 4Y7OC 1G9ML 1OXYA 2WD0A 4KTGA 1EXUB 1X9LA 5D1XE 5AWNL 3QJSB 1TQCB 1VFBB 4WGWB 1YEKL 4QF1B 3U2IA 3ZE0E 2EIBA 2LR4A 5DK3A 1NKRA 4B7LA 4GQ9H 1U8KB 4P5SA 2Q6WA 4R0LB 3RE0A 5HYIA 4GAJL 1R75A 4DVRL 1XF5A 3AMLA 3GSNB 2VLME 3H6JA 1X5JA 4KK5D 4WDIB 1MFAL 4JFEA 5F3HA 3TWCH 3U7WH 2VKWA 2GFBB 4AE1A 1JZIA 1G5AA 1BFTA 1ID2A 4XMKH 5GJSL 4MAYB 3LHPH 5HSFA 1KY7A 3QFJB 2N1KA 5D1ZB 2XICA 4MAYD 3FU9A 1IV8A 3QFJD 3KH4A 1CFQA 2HFEB 2ZF8A 1X5XA 5D1ZD 2OMVB 3FTZA 3LYRA 1KCUH 1E4XL 4LF3A 2YD8A 2C9AA 4JO8A 3BDYL 3MQIA 1BX2B 2OTWA 5IVZB 5K9JH 4H88L 2VN3A 3MLRL 1KT2A 5FIEA 1U93B 5J13B 4O58H 3STLB 3U4EA 4V2BA 5DRNA 3ZZQA 1N5AB 5MI0B 3GC3A 1JZ4A 1ECZA 3CSTA 1I4FA 3C09C 4FLHA 1DQTA 2BIMA 3E6FA 3MXWH 1J05B 2NXZC 4YDKL 5DYOB 2D3VA 3HC0B 5CKGA 1AZZC 3KVQA 5M7QA 2JELH 3KNBA 2XACC 2GBTA 3BKCL 3I3EA 3Q0HA 3QO1B 4ODWA 4FI7A 2H0EA 1S78C 1DSFL 3GSOB 2FUQA 3JYBA 3U4AA 3L5IA 3H9SE 4D9LH 2CH8A 4Z5RA 1YPZE 3D7PA 2IPTH 3RGBA 4Z7IA 1JF5A 2XCMC 3B6SB 3PGDA 3DVNA 3L3JB 2PPFA 3QJHB 4N0CC 4A2DA 4HT1H 5FYJH 3EYUH 4LL1A 4EJ1C 1Z5HA 2YXVA 3B8SA 3BP6A 4F5CA 3KPPB 4AYSA 2H2SD 4Q9BA 5D1QC 1TJIL 2YMTA 5DR5H 3OR6A 4NRZB 2BSTA 3L3GA 5SWSA 1ACZA 4AVJA 1OE2A 3MV7A 1DVQA 4YC2B 4F9LA 3AQDA 5JPMB 2UWEB 4TN9A 2BNQA 3WTYA 5E0FA 1CCZA 3GT6A 2Z31C 3AS0A 1SUHA 4GAGL 4L3CA 1NOLA 1BOYA 3FQTA 2ENJA 4GXUM 2K4AA 2WUCH 1PZ3A 2VR6A 1EZSA 1JPGB 1LILA 2AEPL 2HJFA 1E8WA 2OLDA 4X6DF 4YJZL 2IDFA 4RQQB 3TPKA 4AW7A 1KNOB 3GBML 2AJZA 1ONQB 3DHJA 3GINA 4LCIH 1U21A 3LKOA 2XZAH 3SBRA 2X7LA 3KPOB 4S2SA 4CVZB 5HYQB 3FOMA 4QRFA 3JV6B 3Q1SH 3SZ6A 2OP4H 4NWUH 4X8JB 3BH8A 3HOGA 4OZ4B 4XP6L 4YN3A 1TEYA 5KEZA 1CLYL 1NPNA 2V3EA 4TNVK 1GJWA 3SBWA 3KS0H 5JNYB 3TYGL 4DGYL 4XN5A 4PLJD 2OXHA 3VJ6B 3HR5A 3U6RB 3OMNB 2EVIA 2FNWA 3LMJL 1TTCA 5ANME 1CU4H 1DQQA 1IGMH 4KDTC 3MUHL 4KJPC 4ZW6A 4R4FH 5DVLA 5DWUH 2Q8AH 2R2HB 2X0UA 5CWSB 2EO7A 5DQJB 3GI8H 4JGJA 3RNQB 5C0AB 2TRYA 5D2LB 4Y2OA 2BRRH 4J7RA 3AT0A 5C0AD 1HNFA 3GZOA 2AJ3A 3S35X 1OCWH 4NYLB 4WENB 4D8PA 1UKSA 5KSVA 3WJJA 2KS0A 4Y4FB 3EYVB 5CCJA 3L08A 4M6ML 2QPEB 4LPYA 3FB8B 2QGEA 4Y4FD 1DANU 4OFKA 4HWZA 3VH8B 1U3HB 2PTTA 5JR1H 2YGVA 1BP3B 3DIDA 3E1F1 4JR9L 3N0PB 3HS0A 3AB0B 4P5TA 4MMXA 1XGQB 1U3HD 2P5EB 3C8KA 1OGSA 1CGUA 1ZV2A 4JDEB 1YEGH 2P5ED 4OZHF 3GRGA 3QK0A 1LE9B 1B3JA 4H1LB 5FOBA 1LO2L 2HKFH 2EH7H 3O3UN 1BQHB 3CLEL 2HSIA 4JRYA 3V4UL 3NZ8A 2DQDH 4DP2X 4W9KC 1OTUD 4ZUWA 2OYPA 5C1MB 2FX9L 4YGVB 1JZDC 4MBOA 4AYFA 1AZRA 1TJHH 3MNMA 1R34A 2I7OA 1ZHNA 4RWYH 5CJ5A 1XAKA 3U0PA 1MDTA 1R3HB 1MEXH 4CKQA 4F7EB 3PCYA 3WTVA 3QAZB 4ZW8A 3WV0A 1T21A 3L9YA 2A74C 3EH1A 3V5KA 1XTMA 2DH2A 4FYQA 4B9JA 5BVPL 3DETD 5DJXA 1GMEA 3ZMRA 1MW1A 4H25A 2WLLB 4CN1A 4YHOH 1DUYB 4UT9L 3GK8L 5T1LB 5T1LD 2FK9A 5K1JA 4AC2A 2ED6A 5ICYB 4L0ZA 5JHMA 1I9IL 3OZLA 4OF5A 1MCBA 3HPLB 1WA0X 3U7AA 1MAJA 1CUOA 1LYQA 1CZ8L 1QSEE 2AV7B 4XH2B 3S0PA 5FDWA 1PQZA 3MGOB 3DX2A 5CEXA 2JFCA 3FRPG 4MCMA 4JY6B 4NKDA 4WJ5A 2O5YH 3L5HA 1A4KB 4X7FC 4FRWA 4KVCL 2N0MA 3NQKA 4UTAH 4U1LB 2X9ZA 3FTXA 5LDUA 4W1TA 4HAFA 5FCUL 3VWJC 3RGVC 3BO8A 4BSVA 5KG9B 3SDCC 5GGVL 5IBLD 4PV8B 3DIFA 3SE3A 2CQVA 2OMXA 1Z66A 5DD0L 3ULUF 4IS6B 3BWZA 5IB5B 2OMBA 1C5DB 2PTVA 3VU1A 4KXDA 1WFIA 2CIKA 4L9DA 1QSFA 2XFXB 1EFXB 3F7RA 1EAJA 3RZCC 5I74B 4M7LH 1NEUA 2Q7NA 5DSCB 3AG4B 2H32H 3B2VH 2X70A 4NPYA 4NXKA 4GAFB 5DZNA 3STZB 3REWB 1I3UA 1B9ZA 2DOCA 2QHLA 2P80A 4PUBL 3BRFA 3SQOL 1BLNA 2MOVA 4X5WA 3PQYA 4R5XA 2F54B 1E5UI 5ACMA 1OAQH 4U1IB 5TE6H 1FNEB 3LEXA 1H8OA 2P45B 2G0KA 3EZJB 4FTDA 5E8OA 2F54D 4FA8A 1WS8A 4XNMB 3HG0A 1BVKB 3GDCA 3K6OA 4HFWA 2VWEE 1XCWA 4IHBA 2CALA 3L95A 3UYRH 4CSSA 3SKNA 3KPMB 1NLDH 4KAQL 3PWLB 3O2VH 1G7JB 2YUVA 4IIQA 1NAKL 3VXNA 2I9TA 5TQ0H 1S46A 5BO0D 3B9KB 4KGLA 3B9KD 5FA4A 2B5IB 4XN2A 4D9RD 2P8LA 2QLVB 1PPIA 1Q0EA 3CXHK 4WWKB 4RRPM 3TBBA 3PNRB 3L3OA 2EIJB 3BGFB 3DDGA 2SEBB 3I75A 2Z7WA 1W72A 1BJ1J 2EC9U 4I48A 4UU9B 2ZWLT 5IR1B 3CSYB 3HAEH 1I3RB 3AY2A 3QHFH 3L3IB 1KLGB 6PAZA 3GMQB 3AWFA 2Z34A 2APXA 3MRGA 2H47C 5HGBA 1GH7A 3II2A 2VL4A 5GGSB 4MQSB 4QNPF 4P2OB 3EFDH 2ED8A 4JM2F 4WI9A 4WF7A 4HSQA 4D2NA 4ZBJA 4H26B 4P2OD 4JMXA 4WHTA 2MH4A 3SGJC 4XBEL 5C2UB 4IK7A 4P9HH 1DANT 3U25A 1G0YR 1MJ8L 2EKSB 3FB6A 3RX8A 5AW4B 2DI9A 1F45A 1IEAB 4WTXA 3QQ9C 3RKDC 4O02A 3EG9A 3JWNE 4KOCA 2JVUA 4DGIH 3K4DA 2FCBA 3PUUA 3VMPA 1NGQL 4FFZH 5I76B 1I8MB 2NDFA 4HCRL 3QAZC 4DP0X 4ZO6A 5J06A 2GSMB 4BFEA 5LGJA 3PNWB 3P3SA 3QRLA 3C60B 4MWFB 1II4E 1CGXA 2FQEA 3H56A 4KMTL 5EZOH 3C60D 3GIVB 5H37G 2DYRB 4DZ8B 2IFFL 3GRWA 3H9ZA 4MZ3A 2V0AA 3ABKB 3G9VA 4AQEA 1M4KA 2YQBA 1URZA 3H7LA 5KUMA 4QRQA 1PZ5A 4QO1A 1F90L 2DLFH 1HWGB 3DGCR 3O2DH 1ZIAA 1RJYA 3VXSE 2XWTA 4PJ5B 3T3MB 4Z6AT 2LT9A 4HOWA 4N8UA 2AKRB 1UD5A 4PJ5D 3DX7B 5BRPA 3EHBB 1CE6B 4M5SA 3VXME 2WQWA 7PAZA 4OB5L 4ZFFB 3EHBD 4G9DB 4OZIB 3NT0A 4AM0Q 5EOCH 3VRIB 4TUOB 4XAKE 4F2MB 2OYMA 1BQKA 2C7UA 5KYUA 5AVTB 5K39B 3V6FB 1G9NH 2NT1A 3T2NH 2LLLA 1Q9LA 4X7TA 2JKSA 3RGHA 2VDOL 1FCCA 5AKVA 3KLLA 1CDYA 3BKJH 2YO3A 2NY5C 3ZUCA 3FOLA 4R97C 1VADA 4XN8A 4Q0XL 5L88L 2DMHA 2XV6B 5CZRA 4Z7UB 2WMPB 3SQBB 3H3KA 3PHOB 4YR6A 1M2VA 4KFZC 2ROYA 4TYUA 5IB2A 3GXFA 5CS7A 3MX0B 3KYKL 3V5DA 1QLEB 4LEXH 4I3RL 2R2BB 3S5LA 3MJ7A 2CLZB 1Z9NA 1J5OL 4XWOC 1GMIA 1FZOB 1DVSA 2Z0UA 3NGBB 1MF2L 5FGBC 4L1SA 1YMMA 5IVXE 4XP5L 2Z8RA 3EKCA 2AK4B 4WKZB 4ZMYA 3WFDL 1U58B 3B1TA 4ZPTA 4UQ3B 4JDZA 5GGTH 2DY2A 2AK4D 4YBHA 4HC1L 3UZEC 2VXTL 1FH5L 1NCNA 1S5HB 2JJTA 4AEHL 1ZY9A 4J3WA 1MIEL 1I8AA 1XTLA 4OT1L 1MFDL 3EO1A 3VFVB 4N0YH 4OLVH 1WHOA 5MENB 1UH4A 5EO1A 5I5IA 3PUCA 3K7UA 1CFSB 2IH1A 2G60H 2VLRB 3POHA 1OM3H 1LNUB 1CK0H 1P4IH 2VLRD 1G1KA 5HYEA 4DP1X 3QORC 2DIBA 5T8IA 3VO0A 4QY8A 4TVSa 3H2WA 4FX5A 3R7RA 1J8HB 2BFGA 4K94C 4Y1TA 2XQBL 4RVBA 2C4XA 3FO1A 1DBAL 1J8HD 2APSA 3BGFC 1SVCP 4NM4H 2Y24A 4GY4A 4JPIA 4PJIB 3CFEB 4DEPB 4ZW5A 5ID1B 4MQ7A 5EZIL 1DVXA 1NUFA 4K5OA 4FXGC 3C5XA 4NZ8A 4MB5A 1VACA 1XR8A 5DVMA 1WFUA 2ZXQA 3MOBH 4EE2A 2BX5A 3VMOA 5DRWB 1SVBA 4AIEA 1KB5A 2ZOLA 4TLKA 5KSAA 5J12B 4LCCB 5I1HL 1IO4C 2EC9T 3L54A 5AZUA 3WNIA 3C6LB 1OVZA 2Y5EA 3P4OA 4XO8A 3TFKD 2G3NA 4P8QA 5E6IB 3C6LD 1RZQA 2JIXA 1TO4A 2WWMC 3B34A 3L5XH 1YC8A 4FG4A 5E6ID 1YLBB 4DW2H 1H8SA 3PU7A 4B5ZA 4H20L 3ZO9A 3VTMA 4PWKA 2CGRL 4JFTA 2HT4C 2WOBA 3CZJA 2O6FA 4LLYB 1OF2A 4OCLC 3MRKB 2X4RB 2BY2A 2VOTA 4X6DA 1EO8L 2VMFA 1TYJA 4RGNB 4YDMA 2F1BA 4UILH 2R56L 4JREB 5GHWL 4RGND 3QNXA 1ASPA 4R8WH 3DHMA 1MREL 2BHFA 4AITA 2A1WH 1RVFH 2EXWD 4GW5B 4G5ZL 4O2EA 3MBXL 4RA0C 2X9XA 3E3QE 3KPSE 4MHHG 4HIQA 4OQ1A 1J5HA 3CFCL 5DVNA 3SY0A 2V5YA 3CZFB 4RIRA 2GABA 4RMUA 4N0FA 2C9QA 1DQMH 2DQUL 1U4FA 2IPUK 3BAEH 4JNXA 5E2WH 4JY5H 3FT1A 3SPJA 1GYCA 2HKHL 4HH9A 3SJVA 3GSWB 2Y69B 4KTDL 5MHSD 3TVMA 3BUTA 3MKKA 4CVXB 4NRXB 3RUGA 3RY5A 2VDRB 5E8EB 5KTEH 2KZ1B 5BS0A 2R1YB 4FQ2L 4JKNA 4IBUA 3UH8A 3NACH 3DX1A 2EINB 4PJ8C 2IPKB 2R0ZL 5CZKA 5I15L 4FLOA 4Z77A 5IESH 1C5BH 3D07A 4NJ9L 3WMSA 1UQSB 2C3WA 2X12A 5E5MB 1MIMH 4AIZA 3FTGB 3V0HA 3C5JA 1IC0A 3MNDA 3MXVL 1JDAA 4PGJA 4Y9CA 1Z9SA 2WXRA 2W07A 3QZOA 5F72S 1EAOA 1P4BH 4HK0B 4HW6A 3N9GH 4JKPH 4OZHA 5DHVB 3MRFA 2E7MA 3JWDL 3JUYA 2YA1A 3R18A 3AXHA 1OGAD 2P7TB 1LVEA 5I19L 2HMIC 4RDQF 5H94A 4YGAB 1OCCB 3GJFK 3R06A 2JB5L 4PJXF 2B4CC 2DWEA 4KV5E 3ARDA 1E5YA 2VDML 4HKBA 4Q6IC 5T1MB 1HHHB 3N43F 4NSKB 4LCWE 3U36B 5AVXB 5K33A 1F4YL 2V7NA 2J8OA 4S10A 3H42H 4NQSB 5D2NE 4E41A 1UD8A 1T1ZB 3Q8EA 5SV3A 1P84K 2GI7A 3P2TA 3UO1L 4EDWL 1FH2A 2MKLC 3FT4B 1KCRL 3O6FA 5E2UH 5FM4A 3O41B 3IJYB 1G7PB 3PREA 5C0RH 3PV7A 4NO3A 1QBLH 4S0HA 3U4BH 3PHSA 3TN0B 3LH2H 4BQ9A 4XTRD 4WQOA 3QJTB 1YEEL 2FATL 4N3UA 3TN0D 4IK6A 4JG0H 4WHCA 1NDGA 5D5ME 5DC4B 3RVTC 4TTDC 4DOHE 1UEMA 4Z7OE 3GD1C 1AP2A 1J1XH 3TZVB 2IALB 1LO5A 2ZXDA 1RAMA 3L16A 3C6SA 2NZIA 1EJOL 5I8EB 3TZVD 2Y23A 1NPJA 1BG9A 1DR9A 4KY1L 1HQRA 4LIQH 2DAVA 1FHNA 2WUBH 5F6HI 1NGZB 2YBRA 5DI8A 4J3OH 4DQOL 1J88A 4QTHB 1UWEH 1NMAL 2Y3AA 2DQHH 5GIRB 3X1BA 1NFIA 1YCSA 3R4RA 4HIEA 1KXQE 4TUKH 5J12C 1EDYA 3JV4A 3S37H 3QR0A 5EZPA 3DX4A 4FNTA 3UAJD 1A64A 4HBQA 3Q1EA 4XCYA 1Y6MR 3IM1A 1XH3B 4URKA 2LAGB 1E2VA 5DT1L 1XD1A 4MRCA 2H5UA 2VJ8A 4HWBA 5SWZB 3D6GA 1FV1A 3MRNA 3UMNA 4ATTA 4WV1A 2ZSWA 5HVWA 5SWZD 3P30H 2NNRA 3QPKA 4AV4A 4MZRA 1C12A 2BVTA 2ZX7A 2F8VA 1GW0A 1LO4H 1ZLDA 1FWXA 3LZLA 4JZJA 4ISVB 1WS7A 2X9YA 1UYWH 1NBVL 2F53A 2WWKT 4UOJA 4Z0BL 2ZKHH 4UI2A 1PNCA 2X4UB 4UT6L 3SEPA 3UL4A 3OQRA 1ZTXH 5IFHH 1YYML 3HI5H 3QDMB 3VFWA 2ATPA 5FYKU 3REVA 3NCMA 3QDMD 4U6VH 1ZWIB 2OMUB 4FXTA 5T5FL 3QPXH 3OG6B 4B9CA 2J3SA 3FT3B 4PCSA 2HT2D 4XC1H 4YDJB 2BFVL 5I71B 2FBRA 5IOKA 1DTUA 1ZTMA 2BZ7A 3I9IA 4G3YL 5EULV 5L2JB 1AXSA 3DECA 2D0GA 3IDNB 4LCUB 3UBXA 1RZFH 5I30L 4B9GA 2H1LM 1TIUA 4AVIA 5DD1L 3F7LA 5INDB 2XBDA 3KPQA 3VFOB 2N56A 3K91A 2MNUA 4M4RA 3LKQA 1V05A 3ATDA 1T5XB 4I85A 4FKEA 2HJLB 3K8LA 5KANI 1DBBH 1A9EB 2MQGA 3GQFA 2G3XA 3T6QC 3ZW3A 1PZSA 3X1EA 4OCYH 3HRPA 2W80C 1FN4A 3AG2B 4OM0H 5A2FA 1IFHH 2X1QA 2BP5M 3ALPA 2Y1VA 1FAKT 5H4YA 5F1IB 4R7VA 3ARVA 5BMFH 4JANB 3MRCA 4YE4L 4XOCA 2YGNA 3BRDA 3DXAA 1KGWA 1RSFA 4NKIH 4AMWA 2HP4A 1NLBH 3ZT5A 3SYCA 1AR1C 2GJPA 4JM2A 2RIKA 4N2LA 3U30C 4Q9RL 4W4OC 4O4YH 2JXMA 1GW6A 2LAAA 1KJ2A 1MCCA 2GCYB 4HJ0C 3QYMA 1U95B 3AGWA 1KENH 5HDBE 1PD1A 1N7ML 3CUPB 2IWFA 3ZDZE 4OGAD 5IKCB 2ZYHA 5JYLA 3AREA 5KVDE 4F8PA 1FLTX 1R1CA 1BF8A 1WK0A 4FP8H 1JPST 3IT8D 3TCLA 1GYWA 3QQDB 4FE9A 3BQUB 4WK2B 1I31A 1G84A 5I0YA 3K46A 4ZAKC 1FUNA 2OMNA 3BQUD 3MLXL 3IKCA 2QBWA 3NOIA 1ZT1A 5KYXA 1VZIA 4XMWA 3QRFM 1SHXA 2YA2A 4NBYB 3EBIA 4JQVC 1BMWA 4KJYA 4W9GC 3VI4F 1KIRB 5AEAA 3HZKB 4PW4A 2EEFA 1H15A 2EDEA 3QNZB 2GEEA 1YUHA 3DROA 2ZP8A 3NZUA 5HVHB 4FQQA 4M56A 1MHPL 1SHSA 3AY4C 1GCFA 1P5UA 5D7JD 1VFAA 1X44A 1ACYH 2I5YH 3UAFA 3ARFA 2NY0B 2ZJSH 3DA0A 3TNMA 3VXUA 4J23A 5CHNA 5IG7A 4GKLA 4IKKA 2KERA 1G1CA 4PEEA 2W94A 2RHEA 4F7MA 4U3CA 3OQ3B 3FQRB 3WTSA 2JCCF 5HGGS 3WLWD 3B9DA 4JFQB 1LP9F 1R3KA 4GO9A 2P8PA 5I1AB 3SDYH 1SY6A 1X7TA 4HXAL 4K71C 3PL6B 3H3BC 3MLUH 4JFSA 1BXXA 3N1QC 3PL6D 3HN8A 5JA9A 3FSWA 2QQQA 5L4FA 1QYGH 5IV2A 3QHZL 2E7CA 2VITB 1QWUA 3NRQA 3Q43A 2Y2TA 2F2HA 4Z3TA 3TBWA 5BXFB 5K93A 1HSAB 4MNQA 1W6LA 2AEWA 3OKNA 4HPHA 5CD5C 7PCYA 3NIDE 2NMSA 3JTTB 3A3YB 2AI0L 3LXAA 1IM9B 4AKQA 5E7FA 5CMAB 1UM6H 3RWGB 1CL7L 1IM9D 2N7AA 2R29L 4FQPA 3X14A 3V6OA 4M3KB 1UZGA 3WOVA 3LKNA 2IG2L 1MNUL 2VAJA 4X4YB 1BJ8A 2A4CA 3IXTA 3CC1A 2Z35B 5CCGE 1OWWA 1G4MA 3VXRA 1S9XB 1JWSA 5T3XH 1W72H 1UOWA 4J4PD 3JV5A 4NZUL 4KKZA 4S1RH 1NFDB 3BX7C 2MOQA 3M45A 5CSZA 5EO0B 4OGYH 4U1NA 4ZNCD 4U3XA 4B5EA 8CGTA 2ZF9A 4NUJB 1UWGH 3MREA 3SDAB 4HV8B 4FTVB 1DE4A 3EYSH 2DL2A 4M48H 5I28A 3VI3F 1YDPA 2WAQA 4NC1E 3SDAD 4KK6C 4FTVD 1D5MA 4QJ4B 3BD4A 1A6UL 2A0LC 3KDPB 2X4OA 4JO3H 3N55A 4KNSA 1MRCL 4LSUH 1ZAGA 4CDHA 3APDA 2EXYC 5C0BB 4O02H 4NPJA 2MMXA 4Y16B 2BPBA 4ZQKB 2BIIA 1U8JB 5C0BD 3L48A 4APQC 1YN7A 4Y16D 1X3DA 2X0VA 3B3IA 4LBAA 4TL4A 3S35H 3L3DA 4C83A 1E4KA 3OHXB 5DJDB 1DHKA 4JFHE 4RZCB 4TNFA 4KITB 1HEJC 5BOJA 4EIUA 3ARTA 3E2HC 5DK2B 4PREB 4JDVA 3ULSB 5I66B 3X11B 4RAHA 3EOAA 3GRWH 2ZCKH 3ABLB 5ITFB 3WDJA 5F7WC 1NSNL 4EN3A 5FCSH 2CDFB 4TSCH 3K71A 1MVFA 3NK4A 5KS9F 5DRZB 2ZX8A 2V9QA 2VDKB 4G8GA 1M7XA 4APXB 5IMMB 4JPKH 4ZD3L 4X6CF 3I9AA 3O6KL 2IANE 1MJ7L 1HI6B 1KGXA 3AAZB 3GTTA 3P3YA 4PRAB 5C08E 4MMYB 4KHXL 3P0VH 2NX5A 4Z7VE 4OM1L 5D70H 3RKPA 1V7NL 4PJHE 4BSJA 1QHOA 1HEZA 1JK9B 5GS2D 2QR0B 4PJCF 1MCOH 1ZV5A 2D7TL 2PW2A 4L9LB 5IM7B 4LCYB 3TO2A 3QCTH 3K8KA 1K8DA 2FIRT 2K0RA 5JW5A 1N59B 1BEYH 4PGEA 1G0XA 2KT6A 1T22B 2NY0C 4ZXBA 1MCLA 2FB4L 5CSBA 3UTSA 1UFGA 3ZGIA 1HCZA 4Y4HC 1CICA 4IU3B 1F4WL 1QEXA 3BZ4B 3MCYA 4HZLA 3DJZA 4N2CA 1K4CB 1BZ7A 2FEDD 3G5XB 4Y4KA 1ACCA 5MEOA 2YXWA 4S1DC 1JXDA 4MCYB 4DKTA 1GRWA 2GC7C 2CHXA 1D9KA 2E9IA 1D5XA 3OL2A 4Z18A 3KGRA 3W2DH 4DKFH 2OJZL 3BAIA 5E8DH 1QI5A 3QSKB 4MSWA 2BHYA 4XP1L 2FO8A 1P1ZA 4QIRA 4L1DA 5EUOE 2FTAA 4NHCL 3I2CL 1SJEA 1T3FB 4PB9H 4YFLI 5D1QE 4JQIA 3WUWG 3T4AC 1GC1H 4YAQB 4LASH 2HTLC 2V5RA 1D2PA 1CXKA 4UT9A 1H5BB 4MMZC 2OYLA 3FU5A 4HPYL 1KIUA 3TNNA 4TVPD 1AZUA 2B3RA 3IETB 2A3TA 1E4XI 2AABH 3MV8E 5FHBH 4F3FB 2CRZA 4L8SA 2HFFA 1IL1A 2B59A 2WN2A 4MD0B 1W15A 5GS1B 2OMWA 4PJGB 3CK0L 3G5ZB 3OMZA 3N1MC 4JM4L 3OAUH 5I1GH 5F6IC 3V5HA 1UCBL 3MCKA 1LEIB 3P2DA 4N2HA 3BCFA 2LVEA 4MXWH 1N9PA 3H85A 1ZPLA 3DGGB 3GMRB 3LN4B 4LLAA 4PJXA 5DA0B 4F7TA 5DVPA 1IZKA 1NCUA 3IGKA 3IFOB 4L4TE 4C56B 3GMMA 1U92A 1XT5A 3D2UA 4LLMA 4LPVA 2W81C 1UZ6E 2NUPB 4P9HC 4Y2DC 4XPFL 4Y9EA 4DTGH 3QYCA 4M3JA 3EDKA 5SX4I 1MJJA 4Z95H 1KB5H 1Z9PA 2FO4A 4U0QB 4IMKA 1U8MB 1Q0XL 1HXMA 2ESVE 4RX4A 2V2XA 4K3JH 4QRRD 3EOYG 1N19A 4CRPA 5EF3A 4LGRB 1JWUA 1QVOA 3ATBA 4GEJA 4GBXA 4L2LA 4NZJA 1Z2KA 1FGNH 4UNIA 3L5JA 1P6WA 1MZZA 2VXUL 3FSZA 2GEQA 2X6UA 1LD9B 1JZ2A 3FTUA 3ME0B 4M6OL 1IEBA 3ML9A 4Q9QH 1RMFL 2UZXB 3CHPA 3VVWA 4U0RB 3FK3A 4G42A 4N25A 3OZ9H 4ODHH 5T33L 3H9SA 1HQ4A 2RGSA 4QHMB 3RNKA 1OHZA 3KLHD 2FGWL 3QUYC 1QI3A 1BAFH 3VTAA 5DZVA 5GZNA 4X9FA 3VNZA 3L4WA 4MYPA 5DD3H 5C7XH 1U41A 2BZDA 2A9BA 3FQUB 3K6FA 1X9UA 2FNBA 3LEVH 2FH6A 2WQRA 4XCFH 4XNQA 1OF0A 4ZMAT 1Z32X 1RK0A 3OWEA 1G9NC 4H8HA 5F9WC 4XGZA 4A7UA 4DO4A 4NC2B 5CEZH 3VQ1C 5EFIA 1H9VA 2CBTA 3HJEA 4HKJB 4JO1L 1QG3A 1U8IA 4PV1C 4IRJA 3DOIA 1E5CA 2O6DA 3VD3A 4GUOA 3B2MA 3Q2NA 2V8MA 3O3DB 4JJ5A 3W39B 2WXJA 3HMXA 4PP2A 2RBLA 4XHJC 3QWRA 3FFDB 3QJZA 3WELA 2OMZA 4TV3A 5G4NA 5EC2A 5KSUA 4OAWA 3RL2B 1EUUA 3ROOB 4KKNA 4YDVA 3KXFE 4CJ0A 4XNYH 1RUAL 1JAEA 1FLRL 1HHKA 3ZHKA 3FCSB 3K74B 3W3BA 2I32A 4IEFA 1TETH 4RBPK 4EEEA 2R59A 5L4IA 2DWSA 2G4GA 4WNQB 4NWTH 1ZVSA 1TPXB 3IDIA 3IJSB 5GRJH 1N2RA 3FUIA 3BKMH 4XXWC 2WTRB 1Z3RA 4JRWA 4ZQTA 3VFRA 3LS4L 4Z7QB 1I75A 4B27A 1HWHB 5L4MA 3D85A 5I1LB 2YRBA 4NQQA 4OFQA 1QZNA 1MHHB 1OTSD 3P73B 4TQEH 4UDUB 5HD8D 5DJ6B 1MCSA 1ZDQA 3HC4L 4U1KB 2OS7A 2P8MA 2R23B 5A2IH 5AAMA 1VFMA 3F8UB 3M17A 4PJ7F 3RTLA 3UTPD 3D25A 4KZDL 4BFIA 4H0HB 4WU7A 2X4NB 5HHVH 4GRWB 3HG1B 5B8CC 4XR8C 2E4FA 3BP7B 4OLYH 4QYAA 3QDGE 3HG1D 4RMWA 3CCHA 3GMNB 1PY0A 4ZUVB 3RB5A 5AAPA 1TMQA 2ZWZA 5GS1C 3BLBA 5FHAL 1RULH 4P57A 1IBFA 4Z78A 4PTUB 1OKEA 3ZZ1A 4JLRB 4E9YA 1JUFA 2L4OA 4BH7A 5AOIA 2R9HC 3D4YA 2CDGA 3DO7B 1IAKB 3APMA 3X3FL 2BW4A 1TKWA 1I8IB 1CFVH 1SYSB 3QI9A 5AVUB 5E0QA 4DNLA 4JHWH 3D4GA 5AAWC 3S96A 1WBZB 3V7AG 2FJFB 2FDBP 3PYCA 2YKLH 2FWOA 1ZLWH 1E42A 3BPNB 4J8QA 1KYOK 4KK9D 4OLXL 3TPUA 4QJ3B 3QULB 5IF0A 3VFMB 1KZYA 3AROA 1NQBA 5KYNA 3VQMA 1N4XL 1KG0A 3JT0A 3KE0A 1Q9OA 2AQPA 2OL3A 1EUTA 4GRMA 1G7LA 4KI5F 4XNXL 3LX9A 3UBFA 4V1DB 5GSRB 1KGCE 5KW9H 4KV5F 3BVTA 4V1DD 3VI4A 2WYZA 3ASOB 4M3HA 4L8BB 4DAGL 2Z7YA 3MUY1 1OL0A 4CU7A 2D3NA 2NY6C 3CC5A 4NENA 1M6UA 3ULUH 4HWBH 4YMPA 2ADGB 3NCYP 2XG5B 5EU3A 1NDMA 3OXRB 1JK8B 1ZJBA 3QDJB 4WSJA 4Z7WE 3CD4A 5HGAB 4UB0H 4M43H 3QDJD 1AKJB 1JHLL 2QMKA 3I9GH 5AOLA 2EDOA 1A2YB 3GJEA 3HIZA 4R90L 1UFUA 2R4SL 5E4IA 2JJSA 2G2RB 4MB1A 5DHMC 4ABWA 4HC1A 3ZDXB 2JNZA 5BV7B 1IT9L 2R4RH 1F1DA 3QEGL 2JCCA 3WO4C 4F93B 1EHXA 2VTFA 3GSUB 4GXVH 1JZ7A 3D39A 1LP9A 1R5IB 3ILEA 4NZTL 1RFDH 1SLWA 5HPMB 3HPJA 4DUVA 1LLAA 4N85A 4MDIA 5CP7A 1WIOA 1TU2A 2CPCA 1MELA 4ZUSB 4JFZH 5F0LB 1LDPH 2B9AA 1GJUA 4ONFL 5DEGB 4XPGH 4ETQA 1EJFA 1XB6A 5EBMA 4H8VA 1NCOA 1V10A 2XJKA 2HN7B 5EB9A 3ARWA 4YXKH 3BKYH 2XN2A 1LO0H 4NQUA 3FN3A 2P52A 3HNSH 3HLAB 4MJIE 5DLMH 3R8BB 3TIEA 3WJLA 1MWAB 4M5YH 4WSGA 2CUHA 3UZVA 2CGYA 3OF6D 5IJKA 1ZIBA 5G5DA 4FKHA 3P4MB 3OBAA 4J2QA 2DM2A 3LZNA 4ODUB 1S7TA 4KX7A 4KROC 3MODL 2O93L 1D2OA 5E95B 2V5TA 5E1GA 4H2CA 2K45A 2OR9L 3HHRB 4PWHA 2AEIT 2E8YA 5K1NA 4HS3B 2WTOA 4J8RB 4JFFA 3KLAB 3N04A 4P4RB 5EBWB 4CNIB 5EUKA 1ZT4B 2DWYA 2FIKA 4JRXA 4KKRA 3E1ZA 5I9QC 4N24A 2O5XL 2VR3A 1TG8A 4POUB 1SLVA 4HDIA 4KPHL 4OQTH 2HX9A 5ESVB 1KJ2H 4YPGA 5FGCE 4WEBL 3WHE1 4YK4C 5ES4B 4QRUB 4MJ6A 4IOSA 2OFQA 2EDWA 4MNHB 4G6KH 2XVKA 2UV3A 3V9CA 1RUMH 1G9MH 4UOZA 4G11A 4AX3A 4R7DB 1BF5A 2WAHA 5EOTA 1F2QA 5C09E 5AWNH 3EJRA 4F9LC 2WINA 1YEKH 1MUJB 1ZS8A 1KCSL 4YX2L 3V9EA 2CSPA 1TEFA 3IAPA 4QPEA 3VQLA 3FAWA 2B7DT 5HHXL 3VWJD 5IZ7A 4GAJH 4DVRH 4KH2A 3MLZL 3AS3A 5IBUG 2CLVA 4ES8A 1OT2A 3GEFA 1H3UA 3WN5A 1MFAH 3I6SA 4AZ8B 1A3ZA 1OW0C 1ZRUA 5HBBA 4WFED 5KS9A 3IK2A 1BYPA 1KY6A 1CC3A 3PRZA 4X6CA 2J57A 5F9JB 4OW6A 3OAZK 3J7HA 4OV5A 1BZ9B 2P9RA 1E4XH 3RFZA 1SDDB 5PCYA 3BDYH 4K7PX 1WVZA 4H88H 3MLRH 3D52A 5DMIH 1U8NB 1JV2B 5DD6B 4KRPC 4HUCA 4JFXA 4PRDB 4TNVF 4NZFA 4UNVA 1FGVL 3KL0A 2IDSA 3OGCA 2Q10A 3SBWC 4PJCA 3EYQD 4JCMA 3E7JA 1XGUB 2XVLA 4YDKH 4HFUL 1XB8A 2UY6B 3MUGB 4D7BA 1XF2A 4Z76A 3DRQB 5DZAA 3VFSB 3BKCH 3DX6B 5LGYA 1P7HL 4LK4A 1DSFH 3M8OH 2FR4A 4JFDE 5AW7B 4HJEA 3N42F 3M1BB 1P9MA 3AADB 1AS6A 2ZYSA 4U6YA 1KGJA 2ZWNA 5SX4H 3SKJL 3VFTB 3HCVA 5IHWA 2PW1A 1NBQA 5INCB 1AZBA 9CGTA 2WBXA 3CN3A 1ZK9A 2VT0A 1QRNB 4HJGA 4N8CL 3WJJC 2UUDH 2P24A 4ECNA 4FQHB 4OCXL 1JNHA 4D0CA 2EYRA 2EE0A 3AU1B 1PEWA 4WW2F 5AVSB 2WQUA 1J0ZA 3HS0C 4P5TC 4MMXC 1ZLEA 1TJIH 1CLCA 1WH0A 3FN0L 4QHKJ 1IBYA 1QWHA 1SHMA 2KPWA 3N2JA 1F42A 1OLZA 2EIZB 4PRIE 3AXLB 4JFVA 5EZLB 3PXJA 1JYNA 5A2AA 4WCYL 1DYZA 2BVUA 4GKNA 3IJEA 1MW0A 3O45A 2CKNA 5AUMA 2ADFL 4Y5YB 1HL8A 1G4RA 2VL5B 2AEPH 3FHAA 1MKFA 3ROLB 2CLRB 1XB3A 4P2AA 3DKHA 3ILDA 3GBMH 1U8PA 3F12A 3S34H 3MYJA 3ETBJ 1YHPA 3QQ9D 4FXKA 3RKDD 4Z8FL 4GRLB 3TJEL 2XNAB 3LQMA 5I1JL 4MAUL 5C86A 1I7ZA 4MA1C 3RWCB 4OI8A 3N41B 4GRLD 1HJCA 4U1GC 2ZKYA 4MDJA 4LVEA 3VFGH 4GSDL 4XP6H 1OAYL 4LL9A 1HHJB 3LZQA 4PJEE 2WZ6A 3T08A 1CLYH 3GIZL 2XA8L 4NN7B 2ZXWB 2R1WA 1AQKL 1OSZB 4DGYH 1NCDL 5DFVC 2C3GA 2C9SA 2X09A 2R7EB 3Q9PA 4KVPA 1Y1UA 3LMJH 5C9KA 4QOKE 1P7BA 4UT6A 4MNGB 2NW3B 4OD2A 1BFOB 4FFVC 1URIA 4PWGA 2Z91B 4DKEL 4ELDA 2J1KA 4LMQE 4XZUA 4X99B 4WKXA 3HMWH 3V4LA 5F7EL 1KWKA 2P42B 1CLOL 4G8AC 4RFNC 1IAIL 5T5FA 5JUEL 2PPAA 4P0DA 3SE3C 2EDFA 2P47B 2CDEA 2VAAB 1S5IL 4NQEA 5AYUL 4NI3A 1OWRM 5D7LE 1AIFB 4JR9H 1ND0A 1QFPA 2E6PA 4KU1A 2RAMA 1WZ1L 4DUWA 1NINA 3EJQA 2XWCA 3HE6B 5C0DB 2GJZA 3L17A 5K9QG 2CK0L 3N3EA 3BZEB 1A6AB 5CM1A 1LO2H 3O8XA 5I2IA 3TIDB 3V4UH 2Q7AA 5I5RA 2CKBA 3BP5B 1HH9A 2GSIB 4Y8AA 4PRPB 4QRPB 2FX9H 2W9EL 3L4XA 4PRPD 1HOEA 4GAYB 4GEIA 5F1SA 1B6UA 2ZONA 5DS8B 5JPNB 2HUHA 2ROXA 4OBRA 1R3JA 4LHQB 4WTWA 4R6UA 1O0VA 3A24A 3W56A 5MENE 4C4KO 1E9QA 5D71L 3AQYA 4JFWA 2QV4A 2WLNA 3LSOB 4D8OA 5T3ZE 5JXEA 5BVPH 2DM3A 2WXLA 5IROD 1T0NB 1AC6A 1FYTA 2XKNA 2J73A 1AO7B 4JQIH 4OZGE 2ARJB 4CAGA 4MB3A 5C0CD 3V0JA 1AO7D 1WJ3A 3DSNB 4ONHA 4PR5B 1XWVA 4UT9H 3MC0A 3T2LA 5CJOL 2Z0BA 4L29A 4WUUA 1DLHB 1BQLL 4ORGB 5C07E 5JZ7C 4CADA 1X7SA 4M62L 2NSQA 1DJHA 1UHVA 1X4ZA 1KFAL 3MRIA 4PP1D 1I8LA 2W0FA 4G5AA 3EUDA 5FAAA 2ZXEB 4OF8A 3ULVD 1I9IH 1IGCL 5F7UA 3L3OC 1T20B 4DO6A 1CZ8H 4YZWA 5I0DA 3JBG7 1QBML 2YRPA 5ID0A 3W9EB 1QWNA 1A8ZA 1PW3A 2NY5L 2PO6A 1MRFL 1F3DH 3GKWH 1LE5B 5HDWA 3KW7A 1ZHLB 2BIHA 3M46A 4N2IA 4JHBA 2ZUSA 4KVCH 4XVTL 1T5WB 4PJ7A 4RFEA 4AK2A 4ANXA 2J8UE 4A2LA 4O2FA 5FCUH 1EEUA 1IGYB 5ABDE 5LXGL 3DBXA 5GGVH 4KKCD 3TJHC 2DMBA 2L7JA 5FUOL 1A6WL 5M94B 4G6ML 3RTQB 3JQOB 1NMBL 3BUIA 2J6WA 4KBPA 3RTQD 3M7OA 2MPAL 1TFPA 3BMVA 1E3ZA 1EJ6A 3DLQR 1CFNA 4NQXB 3NEXA 4OF3A 1H6TA 1FNGA 4WI4A 2D03L 3SOTA 1WCBA 1ZLVH 2X1XR 3UTQB 1U36A 3VSTA 2OA9A 5A3IC 3DPBA 4NPKA 1FG9C 1DN2A 4FZ8L 2BINA 4UINL 2PYEB 4LSRL 4R4NC 5E8NB 4PUBH 1G7IB 2Z7ZA 2XX0A 5GGUB 2EACA 2WXPA 3DPDA 2X6BA 2PYED 3HB3C 4I9WE 4JAMB 2EP6A 4L8DB 1T1YA 1MAML 4XPHL 5KBKA 1RUQL 4DFIA 4K94L 4XB3A 4NN7C 3NCEB 4MJ4A 4HMEA 2WXOA 4JE0A 3NJGA 1A25A 1TXKA 3QUKA 4KAQH 3RWFA 8PAZA 3ZKNC 5CR1A 5JDSB 4QXUL 4G80B 3ARBA 4LCWA 2BRQA 5GZOD 2XN9B 2AP2A 2XWEA 1UZ6F 1YEFL 3LV3B 5PAZA 5JW4Q 1BVOA 3QXVA 5FK9B 3ZDYF 2OMYA 4BFNA 4AJWA 1UTDA 3LRLA 1JS4A 2CAKA 4XCEA 3SGEI 1NH6A 4M1CC 1NCJA 2JI1A 3IDGB 4R5VA 5F7NC 5C97A 1JFHA 3UTZA 2R51A 3P11L 1NEZB 3WO3B 5I82A 1XVSA 3LB6C 5D5MA 1M3JA 4NN6C 4NT6B 5AW8B 2ID5A 3ZZSA 4PJ8D 4P4KB 3CAFA 2WOYA 1WWAX 5CAYB 3TEWA 1JXKA 2GJJA 4EUPA 4P4KD 4HXBL 2QQNL 4I2XB 4PV9A 5GS3A 5ACZA 3HRZB 3I6GA 1NCBL 2EZ0C 4XBEH 1KPRA 1M3IA 2P1YA 3BH9B 1FDLL 1FC1A 1VGKA 1MJ8H 3CZKA 3MO1B 3KPNB 1QX1A 3UTTB 4AWJC 3Q2CA 1O6SB 1T5KA 1NM4A 3CDYA 4LLUB 5HI5D 1AGFA 3UACA 5JPNC 4W9HC 1GC1C 4C4BA 2DQFB 3BUDA 6CGTA 4NCC2 1NGQH 1H19A 4HCRH 2IMNA 4J28A 3Q5YA 2B39A 2JK5B 3ISYA 3Q05A 3ZTDC 1EMTL 4J3SA 5E6ZA 1XCTA 2BIPA 3KDMA 3IVKA 3CVCA 4B9IA 4LNVA 5E4EB 2MEJB 3ZZLA 4NQDA 3F7QA 5LLIC 3ZKSD 4KMQA 4M8QA 5DMYA 2YQGA 4GI8A 2COQA 5KN5A 1BDYA 5E08L 2L8AA 3K0WA 1CD0A 3FQXA 3LDBC 1BECA 3MRBA 1KV7A 1OGTB 3JVGA 4E5XG 1EZUA 4ZMXA 3IFNL 5E2TL 1FNLA 2DQIL 4U1SB 3SYAA 3I84A 2A7BA 2FWSA 3LPOA 4JKWA 4YXHL 1CE1L 3VRJA 2IC2A 1JJUA 4M93B 4CGTA 4U1MA 1MRDL 5EU5A 2PWDA 3O6ML 5JORA 3SYQA 5DS2A 5D4JA 2ZOUA 3WFHB 2W9LA 5KSAC 4BQCA 4CBZA 3EIFA 4XMTA 3U0WL 1MHEB 2XU9A 1ORSA 2C9PA 3SPVB 1UA6L 2NW2B 2RQEA 2VDOH 1J87A 2XXMB 4LPXA 4P2RA 5IQNA 5IHHA 1NCHA 4QRSB 4PBDA 3EJZC 2YQ3A 2O5NA 4POZD 2OL3H 4HALA 5DHEA 2B4CL 2L04A 4LLQA 5L88H 3VCLB 4Q0XH 3ATFA 5AOJA 2F1AA 5EC1B 1RXLA 2EYSA 4K07A 4Q58C 1D7DA 3MRMA 2ENYA 4M5TA 4N5EC 4XXDA 2UWEF 3KYKH 1J10A 1T03H 4I3RH 4MJJA 2J2ZA 2FT8A 1J5OH 1MVUB 4NQCE 1SNRA 1Q90A 1JNNL 2Y22A 3F83A 5T3ZL 3R7QA 2E7BA 2L7QA 5FFGA 5TDOB 5HHQB 4XP5H 3EF4A 5BZDA 2AEOA 3WFDH 1M7IA 5DJCA 5I8KL 4D9QE 2YR3A 3HAEG 3NDYE 5D7SL 4HC1H 4LSSL 4X9BA 2VXTH 1FH5H 1QFWL 4AEHH 2X2UA 4W9IC 3JYCA 1MIEH 3TT3L 2AW2A 3VDAA 4OT1H 2E3VA 1MFDH 4P05A 5KYYB 4RWHA 1MVYA 4MS8C 3OKEA 4WO4B 4FDWA 3FKUS 3CZGA 3AMKA 3HZMB 2EKJA 4L1LA 4UIMA 2E56A 4WO4D 3QJXA 1AD0B 3TVMC 4WFHD 3VYOA 3B7SA 2IWEA 1SJMA 3QIUA 4PY7B 3AG3B 2Y1YA 2DQTL 1BLIA 1ZA3A 3VD1A 3VXPB 3FQWB 2XQBH 2NY2C 4XWGL 1R24B 5DJYB 1MHCA 1UA7A 3NIFB 4IKNA 2J44A 5TQ2L 4NAMA 4U2ZA 4WI0B 3WNOA 1TSRA 4PRNA 2ZAHA 3L2LA 5JIPA 3O3AA 2FQDA 1NGPL 5JO5B 3LRKA 3D3VB 5AD0B 3QJOA 4ZX5A 5F97E 4B9ZA 3D3VD 5D2LF 4GS7C 1D6EA 4WW2A 5AW1B 3L9RB 2F5AH 5J0BA 2H0PA 4OU3A 1I3GH 1CL7I 2VLJB 1AHMA 4GQRA 1PGRB 1FFOA 3KPRA 2A6DA 4LAJH 3GMOB 2VLJD 4HZ1A 4X9GA 2FX8L 3C5ZB 4HZAA 3FU7A 1FFNB 2X41A 1OY3B 3C5ZD 4H13C 3QXAB 3S88H 2CGRH 1KZQA 3ARDC 3C8HA 5LG6A 3SPIA 1R3LA 3GKZA 4QHNB 1Q4NX 5DRXA 2CWRA 4XVUD 3QPQC 1EO8H 5DJZB 4MCNA 5B38B 2C3XA 5FYJD 1ILSA 2P5WB 2R56H 2EIKB 5GHWH 3GLEA 3ZMEA 4PLOB 4CC4A 3W9DB 3GFUA 1YQVL 1MREH 3O6FC 1P7KB 1HYSC 2VDRL 4G5ZH 3WFCH 2DM4A 3ZTCC 5T1DH 1N0LB 1VZHA 4J6IA 1YY9C 4DP6X 3PXLA 4EDXA 5EU7C 2B14A 4RAVB 4ZS6D 1D7FA 4Y19A 1KTRL 1IM3A 1INQA 3PWPB 5AVZB 2DQUH 5KBLA 5FKAB 1FPTH 4K7PY 5D4HA 5E1QA 5H35B 3GSVA 3PWPD 1ESOA 1AQDA 4MA8H 5JXAL 3OKLA 2HKHH 1FFPA 4OCRL 1AYOA 1F4XL 5CF3A 1JGEB 5I1CL 5C0GB 4GSRA 4RGMC 5IK3A 4I0CC 3WKPA 1U8QA 1GZHA 1IKNA 2P43B 3AACA 4PG9A 1MI5B 4CL7A 4F7CB 5H8DA 5ANHA 4PVBA 1MI5D 3FQNA 3QEQE 5HYJB 4PCTA 3VD2A 1TEGA 2AV1B 3S3PA 2H45A 2R0ZH 2YGOA 4G1EA 2FHFA 4UIKL 2XIIA 2Y1AA 3GMLB 2QTVA 3NSXA 3ULUC 4YIQB 1XFPA 1TYEB 3EYUL 2CBPA 4NJ9H 5KVMC 4WV1C 2GITA 4IU2A 5HI4C 4BKSC 3NCYS 3GSRA 3SZKC 4JVWA 5ABAA 3LXBA 3JWNH 2QADB 4LHJB 4FFWD 4NZRL 3QEUB 4JZJC 5JHDE 5IB3A 2H4EA 2QADD 3CBKB 2HLAB 4IJ3C 3TOPA 4FQXB 4X4ZA 4MA3A 4FA7B 1ZD6A 3O4LA 5KJRL 2A6JB 3BOVA 1FCGA 2JB5H 4OCNC 2VMDA 4WTZA 3RWIB 1FJ1B 2GTWB 2AXFB 1F6LL 1E27A 1XGTB 1NANI 2Y2WA 1KCBA 3IWVA 3MVSA 3S4SB 3RPBA 1F4YH 5E5LA 1AQ8A 3T65B 4PVMA 2DMKA 5FOJA 3N40F 1S8DB 5F89A 3UO1H 4EDWH 1A6VL 1A1NB 1I7UA 4AENB 3P77A 1KCRH 4Z7NE 2XYBA 2OI9B 2WLYA 1KIPB 3WXWL 3H3PH 4YFEA 1YEEH 2FATH 1SOXA 1H0DA 5C0IA 5DDHA 1DJGA 3QQ4A 4HU2A 2ADJB 2X4SB 4MD4B 3IRZA 2B2XL 3NRFA 4A66A 2VW4A 1MCPH 5K59E 4G43A 3QIWB 3U9UB 4FN0A 3QIWD 3H9HB 1X5FA 4B0MB 1FL3A 5ESQB 2FSEA 3WEXB 4QRBA 1XMEB 4A1RA 3FUMA 5GRYA 3UZQA 2BRRL 3MNWB 1JYXA 5DK0A 2X9WA 4JM2C 1SJXA 2ITDA 3D9AL 1VSCA 3ARPA 3I6LD 4KRMB 5DT1H 3HZVA 1NGXB 2BNRA 3QEHB 4LLVB 3SGEH 4BCYA 5IJVB 1D5BA 4NUQA 1NGWA 5CSGA 4I1PA 2OR7A 5JR1L 4YHPB 3IF1A 2EXSA 2F74B 1JMXA 4O9HL 3AREC 4GFTB 4KO5A 4AGOA 1CD1A 5EU6B 3P02A 5FGRA 1YEGL 4DZBA 5BRZE 2ZXGA 1H8LA 5EU6D 2MKWA 1G9MC 4LRIA 1E9PB 4Y2NA 3S3CB 3MUUA 4Z0BH 3U2SA 4UT6H 5IHBA 2LVCA 3AITA 2ATKA 2WQSA 3FW6A 3D09A 3KD4A 4HBCL 3DMMA 1YYMH 2I07B 4NUGL 2IQAA 1KB9J 3BUPA 1UKQA 1OCZB 4FG0A 5HI3D 2ETWA 5I75B 4PJFB 1JV5A 3AJ7A 5FKPB 1DP0A 1XF4B 4YVNA 3V6ZA 3W0WE 5T5FH 4RWYL 2R2EA 4AC4A 5DJAA 3GHBL 1S7SA 4G3YH 2OQJA 1I1AB 4X7EC 1P5UC 3K2UL 4CW1B 4LO9A 4RESB 1KN2L 3V0VB 5BRQA 3VDCA 3ARFC 5B1KA 3VMNA 4B60A 3NFPA 5I30H 1UWFA 3QS2A 4YHOL 1KIQB 2WCGA 2ZSVA 2VDPH 2YPLA 3CFJA 5DD1H 1RJZB 1XCQB 2XWJA 1BAGA 1WHPA 5B3SB 4RRPA 2FD6H 3T3MF 1ED3B 4M00A 5DMKA 3OKKA