1U3NA

A sod-like protein from b. subtilis, unstructured in solution, becomes ordered in the crystal: implications for function and for fibrillogenesis
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
162
structure length
162
Chain Sequence
VVETSAFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALLGNNEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A prokaryotic superoxide dismutase paralog lacking two Cu ligands: from largely unstructured in solution to ordered in the crystal.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Unknown function
molecule keywords Hypothetical superoxide dismutase-like protein yojM
total genus 3
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1u3nA00
3F7KA 1YSOA 2K4WA 2GBTA 2AQQA 1E9QA 1IBBA 3CQQA 3KBEA 4FF9A 4U4IA 1IB5A 3F7LA 1U3NA 2WYZA 2GBUA 3RE0A 1SXAA 4A7GF 2XJLA 3H2QA 1XTLA 1F1AA 1QUPA 1E9OB 2SODB 3HOGA 1Z9NA 1SXCA 1HL4A 4BD4A 2JLPA 1OZTG 2WZ6A 1EQWA 1N18A 2Z7WA 1E9PA 1OEZW 4OJAA 2WKOA 3L9YA 3KM1A 4B3EA 1TO5A 3KBFA 1F1DA 1JK9B 2WWOA 1JCVA 2AQTA 1IBFA 1SOSA 2AQNA 2VR6A 3GTTA 2AF2A 2AEOA 1PU0A 2Z7UA 1BA9A 3LTVA 2VR7A 1OAJA 1L3NA 2Q2LA 1BZOA 5KBKA 1AZVA 1OZUA 2ZKYA 1DO5A 1N19A 1SXNA 2C9VA 1F1GA 2LU5A 1DSWA 2AQPA 1F18A 3CE1A 4MCMA 1B4TA 4BCYA 3HFFA 1IBDA 2JCWA 4A7VA 1TO4A 2C9SA 2WKOF 1SPDA 3ECVA 3H2PA 3MKGA 3PU7A 2NNXA 3GZQA 2E47A 3QQDB 3KH3A 1CBJA 2Z7ZA 1PZSA 3KH4A 3GQFA 4N3TA 2ZOWA 2WYTA 1MFMA 1SDAB 1YAZA 2ZKXA 4A7SA 4A7TA 2WZ0A 1OALA 1S4IA 1SXZA 1E9OA 1PTZA 4BCZA 4OH2A 1KMGA 3K91A 2E46A 3MNDA 1SXBA 3ECWA 2WWNA 2VR8A 3GTVA 1XTMA 1EJ8A 4A7UA 1HL5A 1E9QB 1YAIA 2V0AA 3GZOA 4L05A 3SODB 3QQDA 4N3UA 2Z7YA 1SXSA 1B4LA 1JK9A 1P1VA 4MCNA 1Z9PA 1UXLA 2GBVA 2WZ5A 4A7GA 2R27A 2AQSA 1Q0EA 1UXMA 3GZPA 1SRDA 1CB4A 2C9UA 5CU9A 5KBMA 1SDYA 3HW7A 3L9EA 3CQPA 1COBA 1IBHA 2APSA 1RK7A 5KBLA 3S0PA 3ECUA 1E9PB 2AQRA 1FUNA 2XJKA 3KM2A 2ZKWA 1XSOA 3T5WA 4A7QA 1ESOA
chains in the Genus database with same CATH superfamily
3ABMB 2CUMA 2MMXA 4DUWA 2AQQA 4L1BA 3M7OA 1NFDF 2D7OA 5EH1A 5EMYA 1QO3A 2X6UA 1AGCA 2A83A 1WQVT 1MOEA 4D9LL 1EAOA 1PY9A 2XIBA 1AXSA 4ICWA 4G6FD 1QUPA 3DRTB 3QXDA 3N5AA 5ELIA 3GRGA 4N0RA 1U3HC 2Q76A 4RQQB 5DVKA 1QR1B 5ADOH 3BP6A 1S9XB 5HVFB 5EF2A 4AENB 3PWLB 4PRPB 4IOSD 2ZKMX 4WUUA 4J8QA 5DWUH 2J73A 5IQ7L 1OPGH 3B37A 2DWDA 1A4BA 3UTSB 4FQJH 4Z7QB 4XMLL 3VFRB 1JAEA 5I1AA 5F96L 3UMNA 4RWYL 3DTUB 4OIIL 1TIUA 5F1NB 3UTQB 3GMPA 4PM1A 4U1KA 4NRXB 1KN2L 5FAAA 2VC2H 5GZND 3WFEL 4FQQA 3ZTEA 3N42B 4TTDC 3BJ91 3H7LA 1PL3A 4FQHA 1ZA6A 1YCSA 2KT6A 3VH8A 2NY2B 4NNPL 4P57B 4AW7A 4NQEE 2MHAB 4AITA 4NBYB 3PUCA 4Z3HA 1JV5B 1S9WB 1BEYL 1LHZA 1NIFA 3VMNA 4Y19B 2QGDA 4JDTL 3MYZA 1XSKA 1M6OB 1U8CB 1MHHA 1TO4A 5DJCB 1LDPH 1QZNA 2J12B 2VW6A 4HZAA 3EGDB 4K3DL 5DMIH 1F4XL 2Z31A 3WN5A 2GT9B 1ITBB 2XA8L 4OCRL 3SDXB 1G6RA 2X1PA 3QCVL 2IOMA 1CDIA 2J56A 5B39G 1YPZE 3TTSA 4MHHI 3ZHDA 5CWSB 1KBGH 5I6KA 1HZHH 2HP4A 4G83A 1U8IA 3BRGC 1S4IA 4KK5D 2FE0A 3NJNA 4YZWA 3V4PB 4CN1A 1F4XH 5IGXL 5F97E 4K3DH 4B96A 4XTRC 4YOKA 5CLTA 2HX9A 4Y2DA 5FYLD 4PTUA 1BREA 1DN0A 4QYOB 5DS2A 3ARBD 2XN9B 3QDJD 1U3HA 4LAQL 3CFDB 1Q1JL 2B77A 5T3XD 4YBQD 1BAFH 1ZEAL 4OBRA 1B4LA 1A7QL 4LLDA 4DF9A 3LKSB 1PDKA 1FZKB 4AW4A 1IL1B 3C6LC 1BGXL 4ZBJA 4FCAA 3WKML 1SBSL 5HHNA 5F96H 5BO1L 1ODUA 2VMCA 3UGEA 4L29B 4AG4L 1FFOA 3N0PB 4YVUA 5IQ7H 5KBLA 1RJYA 4GKSA 1JNHA 4O9HH 4MJ4A 4PJDE 3ARPA 3FUJA 2XNAA 3ZE2B 1PAMA 4TQEL 4UT6A 4NZRH 2VT0A 2HT2D 2E7MA 1E50A 1HEZA 3G5ZB 4LQ1A 5E9AA 2HFEB 4HIJA 2R0ZL 4K5PA 3GO1H 4H2CA 1IBGH 4Z5RB 3NCCB 5KG9B 1L5GA 1P4BH 4R4BB 4ZXBC 4HK3N 4HUUB 3T0ED 1AS6A 1NEZG 3T6QC 2UY7B 2F53B 2GTWA 4PD4K 4FTVB 1G5GA 3STZA 3R1GL 4C8XA 3UBFA 5DMYA 1VF5C 4XP5L 4F9PA 3ORJA 3BVNB 3JWNE 4F7MB 2X0WA 2X1QA 5JXEC 2IV8A 4GAAA 2N0MA 3UAJD 1WICA 3CBJB 1SYSA 1AHWA 1RSFA 5F7AA 1JGVH 2P52A 4PGBB 5KBKA 1OTTC 3OJDB 1FH5H 3CJJA 1O6TA 3PDOB 2NY3C 4PP1C 2WSKA 4XNMB 4DO6A 3TEZA 1JDDA 1THAA 4W6WB 5SWZB 4OI7A 2VXVH 1BQRA 1CK0H 4GT7A 1P1ZA 3KE0A 1KLGA 2W80C 5I15L 5KSVA 3MRFA 3FF8A 3VFPB 1EHXA 4NQEB 2LTQC 1A6ZB 1JPTH 4GO8A 5TDPA 3GFUA 4CNIA 2Y4SA 5D1ZC 1MW1A 5LGHH 4Y19E 4ZOAA 4DP0X 4AM0B 1I7RB 3RB5A 1UD4A 5HI3D 1INDH 4WU5B 1G94A 4UIMB 2H7WA 5EUOE 2NW3B 1NJ9B 3MUJA 4PGBA 2NNAA 4HIHB 1C8QA 4UT6H 3EFDL 1RUAH 3NCBB 4YHYB 2LABA 4F2FA 1E6JL 3MFFB 3P73A 4JKPL 2OS7A 2H1XA 3S34H 5IFJA 4KK5C 1IBGL 4RRPM 2J6WA 4LDLB 5E1AB 5HHMD 4L3CA 2P3YA 5AL8A 3RVTD 4LNVA 5D7KD 3C5ZA 2YD8A 2V7NA 2XTJE 4H44C 2F53A 2GTWB 3BCDA 3VD5A 1EVTC 5DRNB 3VYPA 1MAMH 3I75B 4G6AC 4NO0A 4U6XB 2OXGB 4AGLA 4ZTOL 2YR3A 3NIFB 4M6AA 3U6XA 2CK0H 3EGXB 3ZKQD 3ZVVA 1NH6A 4F3FA 4O9HL 4S2SA 3FUFA 3ILEA 5DWPA 1YNTF 1REIA 4JFVA 3S37L 4RFOH 1A4JA 4KRPD 3OGOE 1J86A 3FQTB 3SPJA 3JV5A 2E75C 4PHZA 1AQMA 4WTZG 1N0LB 4UQBA 5F6HJ 3H3PL 3LKQA 4QRQA 4KXAA 3BSZA 3SO5A 5I19H 2W9LA 5EN2A 1J8HA 3ULVL 2EC8A 2Y2WA 4GXVL 1AQ8A 1DLFH 4KZDL 1H15B 2WJ5A 5FKAB 2C9PA 4GQPH 3UPRA 5DSCB 4Y5VA 4CSZA 5CN3A 3CDZB 1A6PA 3FO1B 1NCAL 1EUTA 2XTLA 2C7UB 3V9EA 3ARTA 4M6NH 2CKBH 3U4BL 4QXUH 1M7UA 4ZD3H 1MHCB 5ICZA 2R51A 3MX0B 4UQIM 1OTUC 2ADFH 4APQA 2Y36H 3DURA 1VACB 1PBYA 2OTWB 3H3KA 1KIRA 1T7XA 5BRPA 2AXGB 5I1HH 4TUUA 5AW7B 5FO9A 2NRDA 3QDMA 1TCRA 3VB8A 4K9EL 2B16A 2VLRE 1QFUL 2ICEA 1ZHBB 3CG8A 4U05A 5IB2B 4IBVA 5BS0D 3UP1A 2DQJL 4GG6E 1J8RA 5I30H 4MCZA 3D2UB 2FNBA 3KL3A 1FN4B 5IBTH 5C08D 3SKNB 1QWUA 2VXUH 3EGDA 3GUFA 4TLUA 4PBDA 5FO9B 3KPOB 5AFAA 1IAIL 3FUIA 4H1LG 5EWIL 1L9SA 1LWRA 2CGZA 4GG8A 5EN2B 3DVIA 5EUKA 5AAWA 4JDVB 2E8YA 4I85A 3JWDC 3BP7A 4L48A 3FOMB 4URTB 2HG5A 4QYAA 5FYKL 4S0TD 2H4EA 4QXTA 1G7IA 1FORL 5A2AA 2MPVA 3W38A 4X50A 1IGYA 2YARA 4LFHG 5E1IA 4ZO7A 4F7EA 3L5XL 4PGDA 3VSUA 4AIZA 1KB5L 7PAZA 2BNQD 4U1LB 5GS0C 3U6RA 5IMMA 4D8PB 3DK2A 2BY2A 1CWVA 2ADIA 3LPOA 5JORB 3GXFA 4Z76A 5F3HA 1ZANH 2JI2A 4L05A 2OYLA 2WO2B 4XNXH 1A3LH 3PV6A 3FTWA 2XN0A 2MTAA 4M7ZB 1YEEH 4XNUH 3RFZB 3WTTA 3OJ2C 2AFNA 3DYPA 3LRLA 1LYQA 3MR9A 5C0AD 4EO5A 3WTSA 2OTPA 4UT9L 1IT9L 3WJMB 2I60L 2E9WA 3FQ4A 4JEGB 4OB5L 2NW3A 1BZ9B 1SDYA 12E8L 3IU4H 5K9KA 3CVIH 1I9RH 4Z7UB 3IFPA 5C86A 2GC7C 4CC1A 3JVGA 1BBDH 1JGUH 1G7IB 1YZZA 5BMFH 2A6DA 2JI1A 3IJYA 4J8RB 1BBJB 1T2QH 2EABA 4M7JH 1PZ3A 3QORD 4LHQB 4G7SB 4JW3A 3CZJA 1MHPH 4AYGA 5G4MA 4ELKB 1HHGB 3HUJA 3RE0A 4RGND 1TFHA 2V3FA 1OB0A 4NXSA 2PPCA 5JW4Q 3ZPDA 2ZNXA 4PJFA 1RHFA 3WXWL 4GLRH 5DJ0B 4X4KA 5JYMA 4WK2B 1RV6X 1M71B 5TDOA 3ROLA 4B3EA 4LDEB 1SHMA 3FONA 2I9LA 1IGCH 2QGCA 3BE1L 3C5JA 1JCVA 3HMXL 1E0OB 5C0CD 5CCGE 4PVLA 4EUPH 1U3ZA 5C0CA 4UTCA 3D6GA 4KRNA 4FABL 1JJUA 3KYMA 3Q5OA 2WLYA 1ZLSH 3O4LA 2OJEA 1LWHA 4IKJA 5DVLA 2HMID 4PJEB 5JUEH 1F90H 1N19A 1VFOA 5MEND 5DEGA 1KXVC 5CR8A 4QHUA 3KAAA 3ZMRA 2QDWA 1XF4A 3BH8A 4ZW6A 2UX7A 1QSED 2HLAB 1S7SB 4Y5XB 1W72B 5K9JH 5FF6A 1U41A 2MRYA 4BGLA 5I8OH 4I3SL 2DEWX 3QEGL 2W07A 4FMKA 4FGMA 5SX4H 5L2KB 2PXYA 4G8FB 1NCUA 1RIVH 3N91A 3EO9H 1WS8A 4U1GC 2O1AA 3ZZ1A 4KKAC 2K3TA 1IL1A 3OV6A 4S1QL 5I1DA 1Z9SA 4PGEA 4IIQA 4PJDF 3WO4C 2AK4B 4P48A 2ORBH 2QELA 1OQOA 2FX7L 3GMQA 4N68A 1VIWA 3LN9A 5BQ7A 5D7IB 4NKMA 3GBDA 4PJ9A 4OH2A 4XNYL 1ACYL 1UD2A 4HAGA 1WISA 3C08H 5ESVB 5C0RH 3BKYL 5HYJE 1JNLL 1HCYA 4EIUA 4FZEH 3SODB 1PD0A 1F56A 1IQWL 2BSRA 1YYMH 2KLRA 3FAWA 3MOAL 4PWJA 4LRNL 4CU8A 3S5LG 1VESA 2I5YL 5IIEA 3TV3L 4HOWA 3TZVA 3C12A 1N9PA 1AGEB 3UTTD 5BV7B 1H3GA 2C9RA 3MGTB 2VDRB 4HU8A 4J39A 1DUYA 4EI6B 2VLKE 1OP4A 5KN5B 4L4TE 2CIKB 2OTUA 4M7KL 3GSWB 4UANA 2YO3A 1DFXA 3IFNH 4YE4H 5I75B 2M2DA 1EO8H 1AKJA 1X5MA 4MA7H 3VI4B 1AIZA 2Q0ZX 3CZNA 3GJFB 2B59B 4KMTH 3DX4A 4V2BA 1MCIA 4J12A 5I2IA 2GSGB 3A67H 2YLHA 5CUSH 4LCCB 1XF5B 2EXSA 3SDDD 3NFPA 5JOPE 4W1TA 3VGAC 1NCHA 3C8KB 1HE8A 5DRZA 1DANT 4BIKA 2P48B 4G8EB 3RDJA 2X6BA 2OL3L 3MV9B 4KY1L 3ZTJH 1BCIA 2HAZA 3UTSA 4ZG1A 4RIRB 2BIMA 2WZ6A 1M57B 3PAYA 1JF1A 3C08L 4I18B 1KC5L 1AZBA 3L3HB 4DSYA 1HQRA 4WUUD 1GS7A 2VLRB 4D94A 2D4DA 4ZYKA 4RQQA 1QR1A 3W5NA 3P40A 5GSVB 4Y16D 4F2MB 1MCWM 5AQ0A 2YN3A 1EANA 2VR7A 1AGCB 3QP3A 5ALBH 4IEFB 4TYUA 1YJDC 1N6VA 1SXNA 5FDYA 2ICES 5EU4A 2ESVD 2IO5A 2X2IA 4KO6A 4QRPE 2ESVA 3L3HA 3FO0H 5AW2B 2O93L 2QQNH 5FYJD 3JV4A 3VFUA 4A6YA 2XY1A 1U8NB 5MERB 5C9JA 2K78A 2C9SA 3QYCA 3HAEH 3PGCB 4A55A 1BQLH 1AXSB 1F42A 1LO5B 1R47A 2JJWA 3Q2CA 2NDFA 4KTGA 2AV7A 4FNQA 5D4IA 2NX5E 1U93B 2FJFB 4YSSA 2FIKB 3N41F 5A6MA 5L8JB 4Z23A 3X13A 3B2VL 1CFVH 2GSGA 3OMNB 4HUWB 4P5MB 2CNYA 3K91A 3R0NA 2X0UA 4JN2B 4PJEA 4Z3FA 3EXLA 3TBTB 5KSBA 1A6AB 3T1FA 5ANMA 2X44D 1XL4A 4IBQA 3LKSA 5ALCL 4NP4H 1SOKA 1ZT7B 2OYMA 4A2MA 3IMVA 1C5CL 1VHPA 5GSRB 2DQMA 5EZLB 3KYNB 5E6YA 1Z0MA 2MOGA 5TF0A 5IF0A 2VLJD 2BOCB 4BH7A 4X7DC 2FWUA 4QYOA 4F7TB 2GVYA 2EXWC 4NEHB 3GC3A 4ZPTB 1AFVH 3IJSB 2H3XC 5AAWC 3QFGA 5I1IH 5I74C 3QHFH 3VXNA 1F11A 4NZTL 4WNQB 3GPSA 4P23D 2A74C 3VNZA 3IDMB 4KVPA 4ZPTA 4LSSL 4YDLC 2IGFH 1U8OB 3OAUL 3KLAB 5HY9B 2FL5A 4P06A 1GSKA 3QUMH 3BDYH 3O3AA 5IVXF 5JMOC 4H8VA 4LSUH 4TVPL 3VGHA 1MFBH 3OKDB 4JFPA 1Y6MR 5EBMA 1FE8H 3TYGH 3QNYB 1MHEA 1MJ8H 4L8DB 5L2JA 1JBJA 1EZVX 4XNBA 1I85A 1LK2A 3SKOB 2ESVB 3BFOA 4P04A 5K1JA 1D2PA 3OJMB 2A9BA 1HQ4B 4G8GD 1C7SA 2FGZA 4JJ5B 3NZUA 2PKDA 3EJYD 3VXRA 5MP6H 4YC2B 3US0A 3BGFC 3BT2H 5D1ZB 4KUZH 3BMWA 1E4KC 3GWJA 3WNOA 5E6SB 4MDIA 3BWUC 3OMAB 2D7QA 3SJVB 4HIIA 1AHKA 2VQUA 3Q44A 4MAYD 1CXHA 5A43C 5HHNB 1EAPB 2XG4A 2BY1A 4Y5YC 3DX8B 3SPIA 5C09E 2NT0A 2ZOKA 1CU4H 1PKOA 1X4ZA 2PXYD 3TU6A 4PVBA 4IQHA 5HYQA 4GUQA 1JFQH 3D39D 3IDXH 2WWMC 3V4VA 2C3HA 2ADYA 4E0RA 1XH2A 4KROD 2QR0B 4P4RA 4TSCH 4IDJH 5J11B 4M62L 3GSRB 1DBAH 1FGNL 1QLRA 4LO9A 2JXMA 4OIAA 4C83A 1DTUA 1HXMB 2J8HA 2PCPB 3MJGX 3IDNA 4HHWA 4AQ8C 2WCSA 1QWHA 3PNWA 5CLWA 5FOBA 3T65B 1VZGA 4PB9H 3QUYC 4B5ZA 2WO4A 4JO1L 1TVDA 3D5OF 3V4PH 3CFIC 1SZNA 3MLXL 4G6MH 4K73A 1MJJA 1XF3B 2D2OA 3KEDA 4TSBL 1MAJA 2RCSL 2IGLA 3S2CA 5DZAA 4ABUA 2WN3A 2ZICA 4HXAL 4HWUA 3B3IB 4QMEA 2I27N 3C5ZD 2ZQKA 3WDIA 1AGEA 3O81A 2GSMB 3OXSB 3L7FB 2W0FB 1S9VB 1I75A 2B1AL 3K0WA 3WXVL 2DKSA 4Y7OC 1QA9B 4Q8BA 2ZXGA 5DDHB 1TJIH 1LE9A 1TJMA 5J9PA 5KVDE 2JCCF 3MRKB 4QCIA 3DSFH 3DX9B 4A7GA 2DYSB 3C6SA 2IG2H 5DLMH 5FHAH 5C0DB 1XGUA 1KB9J 2WUBL 4GXUM 4XODA 1ZTXL 5LAXA 2WQWA 3F5WA 1DLHB 4KKPA 2AI0L 4K7PX 2XT1B 2BY3A 2FUTA 4QAMB 3HE7A 5K9OB 2ZKHL 3A47A 4OQTL 2AP2A 3IKCA 4HJIA 1ZS8A 5EU6B 1M1XA 5IVZA 5IVXB 5B3NA 4JE4B 1EAPA 2JB6A 4KJYB 2B20A 4ZMOA 3O6FA 1WSST 1RZGA 4PW9A 3FT3A 3E9UA 4XVJL 3T0DA 4G1MA 2ICEC 2LVCA 1OSYA 5GJTH 5HHVL 1UJ3B 3BAKA 4E42A 3FOMA 5LBSA 3O41A 1HQ4A 1SLVA 2A6KA 3WLWC 1OT2A 4Y9BA 3S4SB 3CC1A 3V0FA 3S36X 1R17A 2AXJA 1RMFH 3D34A 2Y1ZA 4DVBB 2CE6A 1YN7B 1SVZA 2G0LA 4MXVE 5HGDA 2Q6WA 5BV7H 4MAUH 3O2DA 4ZZFA 1CR9L 1SN5A 1UQSB 4OZFG 3ZDXB 2WZPA 2P7TA 4YNYB 5AVQB 4OM1L 5IW1A 4M29A 3HZ3A 4UT6L 1GOFA 4GBXA 4BXVA 4Z3JA 4FG6D 4S10A 1VKXA 4QF1A 3QRGL 3ECBA 3MRMB 5DEGB 1DCLA 2ZSWA 2XTJD 3HI5L 3K6IA 1DUZB 4BCYA 4C56A 1NWOA 1VFAB 1FVDB 1F4WH 2N7SA 4AIXA 2GG1A 5HHOB 1MVUA 3ARBB 5GHWL 4BCXA 4Q9CA 2XWJB 1Y7VA 4DPCX 3IBEA 5KVGE 4FTVD 5ICZB 4GO6B 5FO8B 3L95B 1JGVL 3L13A 5DC0A 1IAKB 1FGVH 3T1FB 5DT1H 3RZCD 1GJIA 3KCPB 4GT0A 4PTTA 2WBJB 1ZIAA 4FTDA 1YPZA 5HHXH 4ZFZA 1FP5A 3JWNH 3PDOA 3MRDB 1UT9A 5K59F 4LSQL 2GC4C 1HHGA 3HUJB 1DVFA 1U92B 4R5TA 5E94B 1T20B 3DA0A 3H0TB 3MR9B 4QRQB 1AVAA 1S5HA 5IUSA 4GSDL 4B9PA 2N7AA 2P8PA 2VR5A 3D0VA 2VQ4A 4NO2B 4NQDD 5EZJB 5D71H 2X0VA 1OW0A 3P2BA 5FEBA 3EO9L 3CHPA 4WNSA 2WIMA 1CR9H 2YA1A 4E2OA 4YBHA 5J0BA 1DQMH 3MROB 2VDPH 5DVPA 5C92A 1U8QB 1I8LA 2YEVB 1FIEA 3MNVA 3FSVA 5HYQB 4NUGL 1X7TA 4PRHD 3E6FB 1DQQB 4N2MA 2WYHA 1N6QH 2WB1A 2P8PB 3LDBB 2QGEA 4H88L 2XPYA 5CR1A 4MNGA 2HUEA 1F3DJ 1XT5A 1V54B 4HYTB 1OCWH 1N2RB 1I8KB 5L88H 4HKXB 4KHXH 2Q3AA 2X4TB 4QTFA 4D8PA 5JPNB 1XCQA 3HC4L 3LN5B 4KZCA 2Z4QB 1LD9B 5B21A 3NZ8B 3MV7E 3RA7L 2IGTA 4XPFL 5JQHC 1WAAA 2UZXB 1EZVY 1OIOA 2K8QA 5EU3B 3L9YA 4X5LA 2EUZA 3RFZC 1IKFL 1NGPL 3ISRA 2Z64C 2G75A 4GS7B 2GFBB 4L8SA 3NFSH 2CSPA 4HXBL 1E2ZA 1UVQA 2DLIA 3RL2A 3S8GB 4ZX3A 3KLHC 1OAUH 3RUGB 2WUBH 5J06A 3LCYA 4DUXA 3RWCA 4NUQA 1QFHA 1QW9A 2G2NA 3ZDXE 5DHYA 1WZKA 4P99A 2DL2A 4AMWA 2AEPH 5MENA 2VC2B 1RULL 3WXVH 3ZN6A 3OLIA 3BPOC 4WTXA 3MV9D 1JVOA 1BEYH 3KPLB 1MRDH 4I0KA 1I9RL 3GD1C 3QJTB 3HN5A 5EUOB 1YMMD 3FTUA 4FFYA 4P59H 3RJDA 1PKQA 1P4UA 1C5BH 4LNRB 3V6FA 4PGJA 2NX5B 2V6HA 4HULB 4K7FA 4MZ2A 4HUXB 3F65A 2BMKA 2PYEA 3KPRA 1A9BA 5FA3B 3I6SA 1NDTA 4XNZB 3T4AC 4KXZI 4RWYH 3ETBF 5JIHA 5EU5B 3P0VL 2XX0A 3P77B 4LIQE 2BOLA 4LVHC 4ZMAT 5I71B 1E9OA 2CHZA 3PYCA 2EXYC 1RZQA 4NOBA 1OD9A 1L7IH 3QNZA 4ENZA 4KQ3H 1L9NA 4ORZC 3ZKNC 1LWJA 1GH7A 4WENB 1S8DB 3GXIA 5DHDA 2F5AL 3FB7B 4GMSH 1DEEB 4WU7B 3F84A 3VTTA 3PWUB 3SCMC 1KT2A 4MXQC 4C56E 1Z9PA 4UF7C 2X4TA 1OAYH 4AZ8A 2H41A 1CU4L 2BX5A 2HLAA 3WBDA 4RAUA 4NQUA 4MDJB 1A66A 5KBMA 1OL0A 2VSDA 4DTGH 2F53D 3WIAA 1C08B 2GCYB 4OZHB 4DQAA 2CA3A 2HRPH 4LDCA 5EEWA 1IAIH 5EWIH 1IGTA 2V5RA 4FJYA 1P4LB 4CVZB 3LSOA 1KTLB 1QTPA 2O5YL 4YSEA 3L54A 1IZJA 1JZHA 2VXUL 4S2SB 5I6LA 4KQ0A 1CO1A 1J8SA 1OD7A 2XWZA 5E8OB 1F13A 3A0OA 3IMBA 1HH6B 4KKNA 2XBTA 2ITFA 3WTUA 3I6LD 1KCVH 5GRYA 2C3XA 3BPLB 3WGVB 5L2JB 4O02A 3H4FA 4HEME 4NO2A 5D7JC 4WI6A 3GSNA 4X5XB 5E7FA 2Z31B 1MFBL 1SDDA 1T21A 4HUMB 1MWOA 4R4ND 1GMIA 1FA4A 1MVFA 3E7JA 35C8L 1FNEB 1ZJBA 3KGSA 4E9LA 3PGDB 1RHHB 3D33A 3SPVB 3LZFH 5IHZA 5K9QG 2OSLA 2YAHA 5CBEA 4JM4L 3BW9B 3LHPH 5CLZA 4O02B 5IT2H 2H2PD 3GMNB 4J4PD 4EDWL 1IEHA 1ROCA 4IGBD 3ARDA 4PJHF 4HCFA 2I24N 1C12B 1O75A 2YS4A 3C2AH 3CMGA 2EDWA 5HYJA 2NW2A 2KDYA 3FU3A 3SQBB 1I8UA 1D6VL 3Q5YA 1S9YA 4L37A 3V6OC 4DW2L 3M88A 1X4XA 5E5LA 2OMUA 4JL1A 4BBWA 2YD3A 1KDIA 1KGXA 1RKRA 1NC2B 2H8PA 4ZOBA 4DGIL 1I3VA 4AC4A 1YYCA 3OQRA 3UL4A 5CJ5A 4UV4H 4Z7VE 4GOSA 4ZXBA 3UJTH 1CVSC 2VLKD 1CQKA 1X9LA 3OAZH 2WBXA 3CX2A 3FN0H 4PJ9B 4TULH 3SE9H 1M3JA 4OCYH 3FZUD 4R7DB 3ZL4L 4O2EA 2KLSA 4K2UH 1PZAA 3BYTA 5GZOC 1AHMA 3HZMB 5C0BD 2F18A 2XY2A 1NC4D 2YD6A 4N90E 4FFTA 5ITBL 4NGHH 3ZK0A 3N44F 3QQ9C 3PE9A 1BYPA 3A4EA 2K1MA 5CLYA 3SCMB 1ZY9A 1MG3C 1A6UH 2AJVH 1UC6A 5FKPB 3GPEA 3I9GH 5E56A 3V0IA 3MRLB 1IAIM 4L4VB 5FF6B 5IESH 5EZOL 2V2TA 4B9JA 5IY5B 1FCGA 1K4DA 1GY2A 2DB8A 5HVWA 2ZWZA 2C4XA 4LU5H 2EEXA 1CD0A 2LFGA 5LGHL 4AOFA 4JFEA 5JW3L 5E6IB 1S46A 3OXRA 4I4WA 1K5NA 4HK3J 4NQSA 4UB0L 2C8NA 5D72H 3W9DA 3BKCL 4H8UA 2NY4D 1T04B 4FLOA 1SN0A 1MHHB 4HH9B 4MMZC 2L4OA 2HLFD 2BK8A 2LQRA 4Y5YA 2BFVL 5J12C 1HWHB 4EEEA 1ETZB 3MRKA 5HVHB 1YEFH 2X9ZA 2CHNA 4R2GC 3E9TA 1HOCB 1BYOA 3MBXL 3QUYB 4YL4A 3FO2B 5I1GL 2Y1YA 1K5WA 2XBZA 2K7PA 2Z7WA 2D3VA 4LLQA 3CMOL 3ZDYB 3UTPE 4U1HA 4Y4FD 3HPJB 1NPNA 3C6LD 1J0YA 1KJ2L 4HALA 4R26H 1LO5A 4B0MB 5IG7A 2E7BA 4JZNB 1PZ5B 1NM9A 3MSPA 5T3ZE 3QDGE 1KCSL 4I1RA 3WFHB 1FFPA 2WP3T 3GZKA 1TTBA 1FNFA 2DQHL 1YG9A 2ITCA 4IGBC 1LP9E 1AZUA 1NL0L 1HH6A 3DUHA 3FTGB 1JGLH 5BZDB 3U46A 2PW2B 5E2UL 2IDFA 4FS0A 4FQHB 1I8IA 3EHBD 2AEWA 4NT6B 1ND0B 5C8JB 3CE1A 3QFJD 2F6AA 2H0EA 3GMOB 3ZKXC 4BFOA 3QUZB 4XHJD 2EYRB 3MUHL 4L18A 3B34A 3QRBA 1ND0A 3BGFB 5F9AC 5C8JA 1H8NA 1UG9A 3BPOB 2P24A 5AENA 1HXYA 2VLJE 1D7BA 4N0UA 3BT0A 2MFNA 4A2HA 4EI5A 5A7BA 2VYRE 2FX7H 3IGUA 2GHWB 4OZGA 4TLKA 4YSPA 3UZEC 2AJ3A 1A7QH 2DI7A 2DWXA 1O7DC 2FRGP 4IYKA 2BNRE 5D4JA 4LSRH 5HGGS 4Y1AE 1SQ2N 1BECA 3EJZC 4EKXA 3U2JA 1PTZA 3DARA 4OLEA 4EXPX 4QRRA 1NEZB 1RAMA 3C8KA 1DVFB 3CVHL 4D8OA 1T2JA 3KGRA 4XC3H 1U8MA 5A2FA 2NY1B 3K2IA 3LRGA 5T3ZH 1UB5B 2YOCA 5HYFA 2AXFA 3V52L 3UABA 4NI3A 3TFBA 4AH2A 3JTTA 2ZIDA 2ITEA 4J2XA 2UVEA 4F27A 2J43A 3ME0B 1JZJA 4H8HA 2VDQL 4F2EA 5E4IA 4NERA 4ZMQA 4OVVA 3PHAA 4Q9QL 4BK4A 3GGWB 4WEEA 4J3BA 2AAVA 3AMKA 2ZTBA 1TTFA 3FL7A 3B6SA 4X5QA 4YSDA 4P2QE 3TGXA 5C2UB 4NZDA 4LLMB 1U8OA 2VH5H 4G3YL 5C7XH 1E9PB 4R4FH 3CD4A 4AL8C 1ZXQA 4OFQA 1GGCL 3RP1A 3II2A 2NQCA 3T4AA 3CVHA 4YH6A 4QT5B 4EN3C 4GAGH 2EYSA 5CGMA 2NYZA 3EO1A 3OM3B 2QSCH 5ICXB 1BM3H 4BZYA 2VXTH 2VDKB 1K4CB 3UJJH 1O9WA 5D2LE 4QRUA 4ETQA 3SE8H 4GRLD 4LEXL 5CIPB 2BH0A 4FG6C 5IF0B 3VWKB 4FQJL 2WQVA 4TPRL 3HOGA 3TO4D 2F54B 5HGDB 5GS1A 5DJZB 4LOVA 4JQIA 5E2VH 3ZDYF 5BMFL 2ATPA 5L2KD 1ZTMA 4J3OD 4PRAB 2W94A 3SE6A 4FADA 4PJIF 4G7YH 5E4OA 5C3IA 1PZBA 4WO4D 1HSAA 2BS71 3DHMA 3FU8A 3CDZA 4X7EC 3VVVA 3ULVC 4B7LA 2AQNA 2VRQA 2VL5B 4C59B 4DOHB 3CCHB 2ID5A 5EOCH 2YIHA 3A6CH 2ZG1A 5LNGA 2J1WA 4WSJA 3QJUB 5DZNA 1X3DA 3MRHA 3N9GH 3C60D 4QRRB 4YDIL 4IIQC 4GINA 4TF4A 3M7FB 4D0DA 5K5YA 3EF4A 3P0YH 2RAMA 1G6RL 4O4YH 2LLLA 4YGVA 1GGTA 1ZANL 3ILDA 3N1GC 3GTNA 2JLLA 3L5IA 5JHLL 2H0PA 4I0PD 3FQ2A 2ZSVA 2V17H 4WV1A 1LXMA 2XQBL 3CHXA 3EFOA 5TFSL 4KDWA 4AVHA 5F7DB 4APXA 3WY2A 3WG7B 3CZEA 4IEFA 3CSBA 4H40A 2VLJB 1UCBL 4LVEA 4JHWH 3OHXB 3QUXD 2XVLA 1XVSA 3L7EA 5J9PB 5C71A 2X12A 2PETA 3PDDA 3T0XA 1KG0B 3PJLA 2YSSB 3HNVH 3AUWB 4E9SA 3RKDC 1T20A 4DKFL 5SX4I 1MFDL 1P0SE 5FPIA 3NN8A 4UM9B 5A3ID 1FZJA 4PJHB 3WKPA 2BIHA 4OD1H 5CN2A 2R4RH 3STLB 4PYHA 3VVWA 4DNLA 3VXRE 1PG7H 3G5YB 3CN4A 1JE6A 2NXYC 4MCNA 3B9DA 1E4XI 4U2YA 4U6VH 4D3CL 4GUOA 1UOKA 1HN1A 3HRZA 1GZPB 4OFDA 2FJUB 3IAQA 1SN2A 2ICEB 2RALA 4KAQH 4PVMA 5IB2A 2YSSA 1NUFA 4RFEA 5EEXA 2IBBA 4JN1L 5AOZA 3ARBA 1VGEH 1CBVL 4PQXA 4WO4B 5GQBA 1NGWB 2FB4L 4TNFA 3RY5A 4Z3TA 1DO6A 1YC7A 2B14A 4XVTL 3ZLQC 3CDFA 2XWTB 5C0CE 1J1OH 2HRGA 3U7YL 5EPMA 1TZHA 3UTQA 4A6YH 4XO3A 4FQXB 3GB7B 1NCOA 1AYRA 1NFDB 3EYOB 1RFDL 4KK8D 1EWHA 2FK9A 3U4BH 1KB5A 4ZTPL 2UY7A 2XZZA 4JFFA 1EFXA 3ROOA 1XTLA 5E08L 5EO1A 3PWVA 1OAXL 2F8VA 4GQZA 4AIZB 1E5BA 3SJVA 3QG6B 3VQLA 4GW1B 3UGUA 5ABDE 2FZ3B 3ULVH 1HJBC 2X4OA 1J05B 3POCA 4IS6B 2P5WB 2XXCB 5IB4B 1KY7A 1S7WB 2XPZA 3D3VE 1MIEH 2LOEA 5C09B 2PW2A 5GGRB 1X5HA 2KPWA 1CXFA 5C6TH 3S35H 4HJEA 3B8SA 4HQQL 4ZTPH 3ARGB 3SKOA 2H26B 3DX6B 1KLFB 5CEYA 2ADJA 2P44B 4BA0A 2TSBA 3NIDF 4YXHL 2AMGA 2Z4TA 3NCEB 2NY5L 4ES9A 2V7HB 1QKZL 5DMGD 2Z8VC 1G9EA 3T4YA 2ZNWA 2ZX9A 1KB5B 5IBUG 2GY7B 4DKEL 1A1MB 1BSIA 1R5WB 3PHQB 4M6MH 1J87A 1H3PH 1OARL 1S7RA 2OXHB 1C16A 7FABL 4JG5A 5T3XE 5H35A 3IS1X 3Q8CA 1GCYA 2UVFA 4ZNEA 1BJMA 1TCRB 1V10A 1QI3A 2QQKL 4X0KB 5J1SC 3RVUD 2UXGA 3OMIB 4OTXH 2Q5BA 4PGZA 5DK3A 1YAZA 4LCVA 2GJRA 5F9WC 2AKRB 4WFGE 4PI0A 1IFHH 2KBGA 2CKBB 1INDL 4I3RH 2YC1A 1VCAA 3M1OA 5DHEA 3MNDA 5ENWA 2X28A 2R2EB 2EE6A 1EEZA 4I0PA 4NQEA 1NANI 3QJHB 4KTEH 5J4MA 3JTTB 2YMXL 1AQKL 5IW3A 5D1QC 4ETYA 4LK4A 3RGHA 4R0LA 3EYQC 3T6ZA 1UURA 2F7RA 3G5YA 5CGYD 1XH1A 2E7HA 5IQ9A 5FLVA 2BNUA 5EN3A 4PD4J 3KPNA 4JHWL 5HHOD 2YD1A 4PBVC 4PYGA 5T5NF 4ILDA 1F00I 3BUPA 1IC0A 2JJVA 4A66A 4AGPA 2HRHA 1RUQH 4O00A 5CZKA 2O72A 4LEOA 2VMEA 3CZKA 5AVVB 1AGBA 1G9NC 3WEXB 2YZ1A 4XVOA 1COBA 3HBQA 2EUWA 2Y5TB 3C75A 4D0CA 2C26A 3AZUA 3TIDB 1MI5D 3Q01A 4GBXC 4FXKB 3RWHB 3ULUL 2DN7A 4J3VA 4NQTA 4JFDA 1J5OH 3VD0A 4CN4A 2A74B 1GR7A 3MREB 2IOOA 3OAWA 5IMLB 1PD6A 3TJEL 2BRRL 3VXMB 2DEYX 3CHOA 1HXKA 3GSOB 4DERA 3MRIA 3VNYA 2WUCH 2Y5TA 1X5AA 1I8IB 4HLZH 4M5YL 2F8XC 1E65A 3HHMA 4PJXA 1WZ1H 4OJDH 4YEFA 3NSJA 2VLRA 4XVUD 3SE3C 1A14H 3WSQH 5TQ0L 4F1ZA 4Y19D 5FB8A 2WO3B 3U7WH 2WWOA 3PQYA 2TRYA 4FXKC 1L9QA 4H20L 1YDPB 4HWBL 2NY7L 4I9XA 4ZFZB 4R0LB 2HT3C 1IVLA 1WP6A 4NO5A 4NWUL 1GJUA 3D3VB 4TQHA 5L0QC 3WKMH 5I82A 1IM9D 1MCPH 4NQQA 1ED3A 3N04A 4XMZA 4XBGA 5SWQB 4KJQD 4KVCL 1QRNB 3ENEA 5F9OH 1ZHNB 1F6AB 3LQAC 3ZTNH 3PS6A 2R1XA 1ZEAH 2QPDB 2BERA 3DXAB 3WEXA 3N1FC 2CO4A 4X0NA 3IJ8A 4ZDHB 3EH3B 3QC5X 5HHOA 2ZXQA 4AGMA 3BIKA 3K6SA 3A4FA 2VH5L 2HT2C 4X5PA 3KWTA 1JHLL 3KPNB 3T2PA 4X7SH 1E4XL 2E4FA 2UV3A 3FT4B 3HR5B 3QDJB 3POHA 3U0WL 3MLWL 3FB5A 1W91A 1IIIA 2DJSA 4XNQA 2YWYA 4AXWA 5H2BB 1WFNA 4M3HA 3F00A 1D5XB 4OAWB 4M6OH 4AUJA 3FRPA 5IMOA 5LG6A 2Y9RT 3WHE1 3EOBA 4X6EA 3ZUNC 1YN6A 1XGQB 4PJ7F 1GW6A 1WC7B 3K5RA 2A73B 5JXED 3W2DL 1NBZB 4MQSB 3QEQE 4ZX5A 3VFMB 1UA7A 2Y1VA 3TN0C 4PWHA 1UYWL 3J07A 4PRHB 1E9QB 1XXDC 3MRGB 4DZ8B 5E99L 5DR5L 2R1WB 2CG9X 5BQ7B 3MLVL 4G7VL 1NIAA 1S7RB 2OXHA 4PR5B 4DN3L 2EVIA 1R3HB 4G6FB 4IS6A 4MXWH 4OQ1A 1UENA 1P7HL 1YNLH 1AQDA 1B2WL 4JLRB 4FFZL 1IVTA 4ZW3A 1UH3A 2XC8A 3CQPA 3G6JB 4UWQB 4TSAH 4LGPB 4NN5C 2W9EH 5F7EH 4CVUA 5A2IH 2OCFD 3CLFL 3ZW3A 1NUGA 5AKTA 2JKNA 1ONQA 3T0EB 4HWBA 2QL1A 5BUAA 4OFYA 4DIXA 2CUHA 3K71B 1RUKH 2VZUA 4XCCL 4BXSV 1UZ8B 5GGUB 3VFNA 2D8KA 1BLNA 3DV4A 1W72H 2KZKA 3HC3L 1R5VA 4JY6A 5BRZE 3MV8B 5I8KH 1XAKA 1T6BX 4D9LH 3F85A 2GK0B 5AOIA 3INUL 1K6QL 2VABB 3MV7B 2FDBP 5LO7A 1JZ8A 1WJ3A 3G08B 3GUTA 2NZ9D 4BFEA 3P3RA 4Y8DC 5T1DL 5AW4B 4GSQA 1M7IA 2H3NA 1FH2A 4NYLA 1H9DA 2NSQA 4UQ3B 2WLMA 1NGYA 2LTQB 5B1AB 3TIDA 3FO9B 1UWXH 2WIIA 3L3KB 2GJZA 4WFEE 2VSKB 1ZJAA 5KYWA 4R3SA 3H9ZA 1EEYA 2HJFA 4OD3L 4X6CA 5FV1L 2E7DA 4MJID 4XPTH 1SBBA 2ED8A 1XD0A 2OMYB 4S1DC 3WFCL 4UQAA 1OAJA 3HCVB 1CE1L 2QKIC 2W1NA 5CGBA 1MF2H 2H5UA 1G7JA 4NQCA 1HOCA 5INCA 3I50L 1WS7A 3A21A 4BFRA 1W9XA 3TT1H 5I2IB 5J7CC 3OZ9L 3EJCA 4EDXA 3ZTJG 4ZMNA 4XMPL 2DW5A 1Q4NX 3OKEB 3T2OA 4ODHH 4BWWA 2CKBA 3QQNA 3MRQB 1IO4C 2QDVA 3EO0B 4IGBA 4NHCL 3EJYC 2DJ4A 4NAQA 4WUUB 2XA3A 4GW4B 4Q0XH 4CN6A 4Q6IC 2AABH 5IESL 1OGTA 2AK1H 2VR3A 3AS2A 1A47A 5EO9B 4RDQG 2WBKA 4BSVB 2E7CA 5KTEL 4WUKL 3TA3C 5DFWH 1L0PA 1A3RL 2WLLA 4EVNA 5TE4L 4QRRD 4GAJH 1B0WA 3MRIB 4NPYB 5K1VA 3S97C 2NXYB 5D1ZA 2DQIH 2D7TL 4HLJA 2Q8AH 2MNUA 1LNUB 2NY6B 2A0LD 3F12B 1QPXA 1W8NA 2VDOB 5FKPA 1ZT4B 2OPCA 4PG9A 4CVWA 1R3LB 2Q20A 2PWGA 2ZSVB 4UZSA 4O58L 3UYPB 4IIQB 1WBZA 3MJ6A 2NLJA 4FFVC 4XP4L 3Q1EA 3T2NL 4CILA 4LCUA 1R3LA 1QLEB 3WY4A 1A25A 2ARJB 3GLEA 4EIZC 1N8ZB 4ODVH 4LHUG 1XX9C 2VZOA 1YQVL 4F9LC 3UBGA 2OI9B 1XGYL 4BDVB 5DRWB 2BC4B 1SEQL 5AG8A 1WA2X 2AQRA 3FT3B 4CJ0A 5HJ3B 4X9YA 1JMXA 4I3GA 5TDNA 3LY6A 3L5WA 5T3ZD 5C0BB 4RMQA 3D30A 1OAKH 4UOZA 4U1SB 3M86A 2VDQB 3GJFK 2G9HB 1G7LB 4B7IA 3T2LA 4K23H 1SFDA 4JM4H 3W0WE 3QAQA 5L7XH 2ZWYA 3KD4A 2JJTA 1ZHLB 3G5XB 2FGWH 4JGMA 3UZQA 2Q2EB 5ANHA 3FHEA 2A2QT 2YPLB 3PY9A 3APNA 3QXUA 4JB9H 4PJGA 3R06B 4L8CA 2V2WA 4AH2B 3KJ6H 1VCBC 2D73A 3QRLA 2E27L 9PCYA 1CF1A 4RA3A 1N0XH 4FTVE 4JRWA 2PO6A 5H37H 4M5SA 1PEWA 3IYLW 4X2UA 4NDMA 5L8LB 2AF2A 4YFLF 3NDYE 1LK3H 1MH5B 2ZAIA 4XC1L 4S1DD 1TNNA 2KS0A 2FWSA 1CVRA 3TVMB 2IH9A 2Q3ZA 4MA8L 1QX1A 4PJEF 5I9QC 1ZRUA 4WEMB 5T3XH 4BM7A 5DJCA 5F7WC 3JWOC 5JPNA 1KY6A 5E5MB 5GS0H 4MJ5A 4P2OC 4K8RH 2JCWA 3QDJE 3QULA 4TL4A 1NKGA 5B7FA 2GJJA 3CQFA 2HRPL 4FNPA 3FCTA 2WXFA 5GZNA 4RCAA 5E8PB 4NQDE 2R0LL 4AJYV 1S7WA 3V4VL 4FQQB 2P8MB 4PIRF 2MCPH 1PVHA 3DO4A 1VZIA 5T1LD 3CX5J 3AY4A 5CNHA 4G1MB 6TAAA 2PCPA 4IRSB 3WKNA 1RZGB 5DEZA 3QHZH 4BQCA 1R5VB 5TPWL 4YDKH 3D9AH 3KG5A 5FFOA 3I9PA 5IVXA 3M17B 5DZ9A 1U95A 2AV1B 5KZCB 3SDAB 2HMIC 1NOAA 5BVPH 4L4VE 4GKOA 3VX0A 1A65A 5F89A 1ECYA 4YBLC 2CLVA 3OKEA 4M5ZL 4W6YB 4Z0BL 2EECA 4M9OA 4KJPD 4KBPA 4QI3A 1S6NA 1A9EA 2MOVA 4P5RA 5HHPA 4H2AA 3GT6A 1GMEA 1YEIL 4X8JB 1EDYA 1KNOA 2MQCA 3AY2A 4KK6C 4RGNB 1ZPUA 3DBSA 3A4DA 1IBHA 3GMLB 3NJJA 5GRJH 1LVEA 5CZVH 2HT4C 4XP1L 4UNTA 1R3JB 2J8OA 3HLAA 4F57L 5DK0A 1UM4H 3HNTH 5AD0B 4EXKA 3AMLA 3BCFA 5JXAL 2DLGA 5IJVA 1MJJB 4PJDB 3IMSA 1KPUA 3VAEA 1KTKE 4YIQA 1FHGA 3LH2H 3TFKC 5BJTB 2R2HB 3CXDL 4HXBH 4R96A 3NFSL 1KFAL 3PL6D 2NR6A 4XWOC 3WIIL 4DP4X 3I02B 2Y72A 1XMEB 3INOA 3K2UH 2PWEA 3RGBA 2DJUA 4OFPA 1NC2D 4OJAA 2PNDA 2PW1B 1SLXA 2OQJA 2XKNB 1Q9LA 3I9AA 1XO8A 3ZYJA 2Q6WB 4E0RB 2EUXA 4TNVF 2CO3A 1T22A 2WC7A 1MXDA 1WIPA 5FX3A 3X3GH 2VZ3A 2BNQB 3RYMA 3V6OE 2JJTC 1KXTA 4KKBD 1JL8A 2PPDA 4G7QB 1ZT4A 4JY5L 3NCJL 4MB5A 4PG9B 4XBEL 5CGYC 2FYYB 5D2NE 1A1NB 4FNUA 5IROC 1WRFA 1WTGT 4JO3L 3SY6A 5L8KB 1XWVA 3K72B 4ZMLA 4MWFA 4YHKH 4RGMB 3NPSC 1GAFL 5I5MA 1ZLVH 5JHAA 1HILA 3NA9L 5FM4A 4GBXD 3O3DA 1G1YA 4CMHB 3OR7A 1R19A 1MHEB 4Z95H 4XN2A 3D4GA 1KXVA 2IALA 3O3EA 4HIPA 5IEKA 4MDRA 3VG9B 2WZ0A 4HETA 3OPZH 1ZGLA 3EGSA 1WC7A 5HI5D 3C60B 2YPVL 3UPCA 2A9NH 3DROA 3DTDA 3NRPA 4J3TA 2NY0C 3IK2A 4Y4HA 3L3OC 4AEHH 1L6XA 4N0YL 2AMUA 2XTJB 5FLUA 1G5AA 4UIKH 3ZQ9A 2D3LA 1AGBB 2AXHA 3GBNH 4OUOA 4R96B 2R4SH 5DC4B 7TAAA 5DJXA 3CAFA 4WF7A 1V7ML 3JYBA 4YXKH 3B2XA 4WO4C 3MFGB 4D9QD 4PBWD 4MD4A 3TL5A 1KTDA 4JPIB 2HKHL 2CIIB 2X4QA 3K2UL 1AG0A 4XCFH 3D69A 3QJXA 1F4WL 2OCJA 1U8CA 1ZGLM 5EIIG 1QRNA 4XVUC 5AB9A 2PLTA 3UX9B 3H9SD 3KLKA 4NKIH 3T3MF 4YHMH 5AAMC 4LCCA 1QEWA 2CBOA 3DOIA 4HOXA 5D2LB 3L3GA 5L6YH 1A2YA 1JPSL 1Z9LA 1VFAA 2WZAA 3HCVA 3HN3A 4OM1H 1QD0A 5DD6B 1GYAA 1U3NA 3WNJA 1TTRA 3EZ8A 4L1DA 5J13B 4U1JA 2VZTA 1ID5I 4A7GF 1FHNA 4K15A 3GSWA 1GJWA 43CAA 3MBEC 1ZLVK 2BP8A 2UX6A 4X5RA 2BCKA 4IKKA 1QSFB 2H9GA 1JK8A 5IV2B 5IW1B 2QT6A 2BY0A 3RWGB 3MQIA 2BS9A 5DHVA 1UQSA 1BFTA 2AQTA 4JFEB 5E8OA 4A67A 2L7QA 5H94A 5EU7C 1I53A 2OR9H 4NHUB 2BSRB 2JJSA 1TQUA 3LZRA 5IJCC 3DX6A 3I85A 4WEBH 5IKCB 2DWSA 1NPJA 3NH7L 5SWZE 1FG2A 2DYPB 3UZEA 1C5DA 4FFWC 4GSUA 3QUMB 4OZHA 3ARFD 2WM0A 2BINA 2EIMB 1JFHA 1E28B 3KJ4B 1WFUA 3TP4A 1T4KA 1EH9A 1PLAA 3HG3A 5E9DB 3TN0D 3LZOA 5D2NB 2BNUB 3IDUA 5DMKB 2P4AB 2UZIH 1HDMA 4ODUA 1PKQB 3O4LD 1BWWA 1NCTA 4TMPA 4Z7VF 2VE6A 2MNJB 4R4NC 3US9A 1W16A 3Q8EA 3SOTA 1AQHA 2QFPA 1XF2A 4IHOA 1CXKA 4NPKA 4I2XA 5DHMC 1DCEA 2KERA 1TJIL 4A7TA 2BVQA 1P7QD 2HX7A 5K33A 1IEAB 1RIUL 3BH9B 3D87B 1ZT1B 3L17A 3H6AA 4LZKA 2C9XA 1QYGH 1IGIL 2G2PA 3A4AA 1KIRB 3CFBA 1NOLA 4LCYB 3DLQR 5FUCC 4G70B 4PLOB 4YZFE 3S3DB 2CHWA 3BH9A 3LEYL 5D2LA 4BHUA 2RCSH 4M1CD 4M43H 1RJCA 4PJXE 1W0YT 3GEWB 5EIIB 3FRPB 1NCBH 3F83A 4LCIL 4LPVA 2WQRA 1DSFH 4XOAA 5D4QA 3O45B 1K8IA 3FUHA 4P5TD 5MI0B 1IM9A 5KSAB 1FL3B 2HPOA 5D93B 5T5FA 6CGTA 1S5IL 4JFED 5FB8B 1FZJB 3EJTA 4DP1X 4OLVH 3BIKB 5LAPA 1DBAL 1FGNH 3VGGA 5FUZH 1NFDE 5MEOA 2Y23A 4YUEL 1EO5A 3GMRB 5DO8A 1V8HA 1ZHNA 3W0WB 4AQZA 4RBPK 2LVEA 2HPTA 3GSOA 2AW2A 2HKFH 1FI8C 4NUPA 1E27B 4QXGL 5D93C 4OSUL 1O7SA 1XXFC 2P49B 4L0ZA 4ODVL 2YRPA 2R0KH 5CHNA 3RVUC 4U6XA 3VSTA 4Z0XB 3MGAA 4XPBL 2X7LA 5AAMA 4Y5XA 1JK8B 3CZGA 4Y4FA 5EU7E 2AJYH 4AEEA 4AYFA 4D2NA 3CSYB 1M7XA 3QXWA 2XVBA 4PRPE 3RDTD 4D0CB 3V95A 2Z91B 4YXLH 1FO0L 5BPPA 5GZOA 1FFQA 4C58B 4KNUA 5TE6H 4MDJA 4A2GA 5IHUL 4OLYL 5TD4A 3L6FB 5KVFE 1I8LC 3NGBC 1GC1C 2WMPA 4Y1AD 5B39A 1A2YB 2E76C 4PJ6A 5CHNB 1LP9F 1DFBH 4XP9L 3V9FA 5F8RC 1JNNL 3QUML 2OMXB 2DQUL 1J5HA 2P5EE 4QO1A 4E36A 2IAND 3QWOB 1HI6B 2HLFC 1L9OA 2EE9A 5GGTA 1XGPA 1IGFH 4LCWA 3UERA 1CI3M 5CIPH 1G7PB 3IXAB 4MMXA 3KVQA 4YWGH 2NQDA 1L6ZA 2OZ4L 2QKSA 3D69B 1M9SA 4HC1A 3UC0H 2XRAL 3BQUC 3IXTB 3JXAA 1MFVA 5AAPA 1PZSA 4LLYA 3IGAB 4HW6A 4U1NA 4N3TA 2EJ1A 3WMPA 4KO7A 3REVA 5F93C 4GKNA 2DH3A 5E9NA 3B2UC 4ZMYA 2ZYHA 3D18A 1TR7A 1IM9B 5DUJA 1B9ZA 2EDLA 1WEJL 4PJ7B 4QT5A 5JPMA 1X5YA 3Q2WA 2DQCH 4A39A 5JW5A 3ERXA 2XCMC 4NFDA 4NP4L 4F8NA 4FYQA 2QLYA 4AQ8A 3MACL 4M03A 1ORSA 4TNWF 3TZVB 4A7UA 4XPHH 3WN5C 2DBLH 1EGJH 5EV7A 4LPXA 3QQDA 4MNQA 3ZDXF 3LRSA 3GYRA 1TEYA 2B3RA 4QKXB 1JK9A 3G08A 4HIQA 3DUUA 4HIXL 2AKRA 4P2YA 3UTZA 1AO7D 4N85A 4WI2A 3N42F 1TKWB 3RWCB 4FMVA 4WKXA 5F1IB 3MV8A 2WANA 3KGTA 1KN4L 3OSKA 1SOQA 1H8OA 1JZIA 4RBPH 4GNKB 3QG7L 4N0CC 4L8BA 5HJ3A 2HRLA 3WIFB 4I88A 2QQNL 1JHTA 5JZ7C 4JFTA 5HVGB 3SDCA 3VRLE 2VUYA 1KACB 3TT3L 3QZNA 4FXLA 3C5SB 2FQGA 1VB9A 4LVOB 5I8KL 5JDSA 4KVNL 1KPVA 2DMBA 1PIFA 2PXYB 4G8FA 2ICCA 1TSRA 4PLJC 4QKTA 4KKRA 5IHLB 3HVDA 4ERSL 1CDHA 5IHHA 1ACZA 4U1IA 1DBJL 2BFGA 2XVGA 3X1FA 1FDLL 1SUHA 2IANB 1CFSB 4P23A 4PWGA 1P2CB 2R2CA 3UACA 3P77A 5L4FA 3NIGE 3LNDA 2X42A 2ZXAA 3MV9E 1KC5H 2NY2D 1G9HA 1E5ZA 4FFZH 4W4OC 4EJ1C 3QUZA 1IKOP 1RZKH 4PTUB 2KHAA 5DJDB 1N4XH 1BOGA 4P2OD 3GSXB 4HS8L 1H3XA 4WO4A 4AL8L 5F7HA 2KQNA 1W80A 3GXMA 2W0FA 1KJVB 1QTSA 4KPHH 4Z7WA 3JQOB 3TIEB 1Z1WA 2OXGA 3KXFD 2B08A 4KHTL 1TSHA 3QR1A 4ZRGA 5E5MA 3MHZA 2NY4B 4AYBA 4F2ME 4KI5C 5L4IA 5DC9B 4RIRA 4AYEC 4YBQC 5A6IA 1XIWB 1PZ5A 4OCWL 2CO7A 1P53A 2BVYA 4OLWL 2VERN 3D08A 3VWJA 3ULVD 2DQDH 2MHAA 1YEWA 2B0SH 3Q6GH 3VQ1C 1RXLA 3MA9L 4W9EC 2AK4E 2V5YA 4Q9RH 3QWRA 2LU4A 1ZHKB 5C07B 2DBJA 2JXMB 2Q8BH 4I87A 1G9NL 1SJEA 4ZPVB 4WI9A 1T04A 2P45B 3EFFB 5J13C 3M8OL 1FNHA 2XN1A 3SDAA 5GS0D 3OWRA 1WAAF 5C0RL 4NKDA 2VDOH 1SHXA 4RGOH 1WHPA 5DD5L 1DE4B 5L9DH 4FFZA 1T5KA 1Q9WB 2CCWA 1VZHA 3GHEL 2AGJH 4AYDC 3BIBX 2EZ0C 1A0QL 3DWTA 4ZO6A 1PZ2A 5HDRA 3U7WL 3I2CL 3LX9A 1T03H 1QLEH 2K9FB 1WIUA 2XWEA 2WAQA 4YNYA 1R4XA 2X3CA 5L4MA 4N0FB 3HFML 3P11L 4M93B 3PV7A 4HHAB 1DHKA 3QEGH 3FCTB 4XE0A 1WFJA 3ZSTA 2DQEH 1CUOA 3NMEA 1RU9H 3WUWG 5KYUB 1YEHH 4JKLA 4S11A 5LDUA 1XSJA 5FYLE 3D3VD 4O51B 4S1SH 3EOYG 1YUHB 4TN9A 1RVFH 2QSVA 3IE4A 4DGVH 1KPVB 2GTZA 2NXYD 2VDMH 4GY4A 5JUEL 4HSCX 2N59A 1D7CA 4JDVA 3UEQA 2YD9A 5FYKD 5IWLA 4HGKC 3K72A 5F3BA 3VWJD 3RY6C 4Q97A 1MW3A 3TPKA 3FFDA 4RGNC 4FABH 5IQ9B 3VU1A 2VL5A 4M1GH 1INEL 2ZP9A 2GIMA 3T4AB 2TSAA 1XHHA 4M8UA 4MCZB 2V2WB 1VGKA 5DEFA 4XCEB 1IKNC 1P1ZB 1I1FB 2AJSL 1HVXA 2V5SA 3U1QA 1YNTB 3FU5A 5EB9A 1V3MA 1IM3D 1D5RA 1UD5A 2VSCA 2X38A 5GS2H 4HJJH 4X9GA 2YAPA 1BDYA 4JREC 1ORSB 2P80D 4QJ4B 4Q9BA 4GRMB 4MQ7B 1MI5A 1VACA 2OTWA 2ZT9C 1EDHA 4ZUVB 4LPYA 5ICXA 2YN5A 1CFQB 4TUKH 2YA2A 1O6VA 3HC0A 2GUYA 3TBCA 5C0AA 1XCTA 5E1HB 1WWAX 1FNSH 1PSKH 2IDUA 4FQ2L 3IJSA 4WK0B 4AEIL 4N0UE 1JWMB 1B4TA 5CLXA 1U93A 4NNXA 2EDJA 1A6VL 2FBJL 4TOYH 1NC4A 2NXZC 4KXZH 2QQKH 3TA4D 5KVEE 2BVPB 1NMBH 4Z5RA 1CG9B 4MMYA 2A9ML 2QBWA 1NGXB 4DP5X 5MEPA 4N8VA 2A6DB 3IJYB 1BMZA 4J8RA 7FABH 5J11C 4DVBA 1KLFA 4IU3B 2D3JA 3FFOA 1KJ3L 3GSNH 3OKKA 5KYUA 2WLKA 1S9WA 3ISYA 4EZLA 2BSBA 3P02A 3GMLA 1KGIA 4UTAA 4ORGB 2YGVA 4JDZA 1BIIA 4XNXL 3DGGA 1MI5E 5B38B 4YHYC 1BD2E 1CGYA 3D85B 1CLOL 2UWEB 3UAEA 1UUNA 3RI5F 5DURB 5CILL 2FZ3A 2VR8A 5IB5B 1EJFA 4DN4H 1F4YH 1Y18A 2DDQL 3ABZA 3GJEA 4PJXB 3BEWA 2VN3A 2NTFB 3QUXA 4PRNB 3I75A 1BX2A 4YFLI 2O5ZL 4OZGB 4I77H 2XZCH 4Q6YA 5K69A 4MD5A 3GZPA 2IVFC 4WW2B 4EUPB 2FYVA 1NBQA 4PJGE 4FQXA 2ZUSA 4K3JH 1MIML 1N59B 4XWGL 3BQUA 4K94L 4IRSA 4ODSH 4IMKA 3WFBH 1J0ZA 5ESAB 3FH7A 2B3IA 4FXTA 1VFMA 4PS7A 5FHBL 1ZLUK 4RISL 3RNQA 3RWJA 3VU2A 5I26A 3FO2A 3QAZB 1LE9B 1E4KA 1R46A 3BZFB 2ZUVA 1IE4A 3BP7B 3LKRA 4UINL 5IQLA 3BD3A 1I9EA 5EULV 1P7QA 2CRIA 1MCDA 4FLSA 3TO2A 3LQMA 2YXWA 4YEEA 2DQJH 2F7PA 3F7LA 1BZDA 3IDYC 4TUJA 3T3PF 3HPLB 3RHWF 2HFFB 5KVDH 4ZW8A 4O2FB 5IV2A 5E2TL 4AEFA 1D3CA 4UT7L 1A21A 2VWEE 2MTPA 4LLWA 2K4AA 3JWNG 5DFTA 1XF3A 3FTYA 3HPLA 2EC9U 5I1HL 2SEBB 3Q6FB 4UTBA 4Y19A 4EBQL 1WA1X 3RNKA 4MNHB 3OMZA 2DTSA 4N2DA 3RQ3A 2E4TA 1AGFB 4Z7IA 1H0DB 2ZD0A 1NKOA 4WNJA 2HLEB 3LV3B 4OZFB 3VRIA 5EZIL 1Z3GH 3RWFB 2DMGA 5FDWA 4HMEA 4IBLT 4K94H 4JFZH 5E5RB 1GHFH 1NCAH 2ISDA 1T89C 5DYFA 3PHSA 4ZX6A 1A8ZA 4KQ4L 1DLFL 4M1CC 4IOIA 4ZOCA 4KZDH 2LU5A 3LS4H 1BQKA 5IEKB 4J3OH 3HLKA 2AK4A 2IQ9L 5I19L 2IEPA 2OMZA 3T4YB 2J21A 3HEIB 2H1PH 3NFNB 4MSWA 1OAZH 4KK6D 4TVPD 4AQOA 1VEMA 2E0PA 4X6DE 4J3OF 4R5VA 4UBDC 3BUYA 5CMAB 1H15A 4ZODA 4OY9A 4L3EE 3WHXB 4XXWC 4XNAA 5HDBF 2ZAGA 4IJ3B 3MRHB 4AKQA 2Y3NA 4RFOL 2OSXA 5TH2A 2VLKA 3NJLA 1HCZA 2W60A 5T1JA 2WXHA 3HBGA 2EIKB 1EMTL 2YSTA 3B1UA 4GH7B 5F71A 5IB4A 4F15B 1JYNA 1KXTB 1AXTL 4KOBA 5G4OA 4WI8A 4W9GC 4AQ1C 3TWYA 2G60L 4W6XB 3Q1SH 1H19A 1T1ZB 4NCDA 1K8DB 3AAZA 4MJHA 4Y1SA 3D39A 1J18A 2EO1A 1R9FA 4R90H 2RQ8A 1XZWA 1Z5YD 5GGRY 5DZPA 2PW1A 3BI9X 3P3YA 3TF4A 3RTQA 4M02A 2W9DL 3ZYIA 4F2MA 3BH8B 4YVNA 1EAJA 3RDTC 4ANKA 1U8LB 4NC2B 1QASA 4WHCA 4MKTA 3DX2A 1JZGA 5JIMA 1NCNA 4X6FB 1OGTB 4MNHA 3F58H 1DJXA 3EJQA 1EEUA 1T89A 1L7TL 3ZZSA 1BVNT 3H3BC 4WFED 4TTDD 2V4LA 3EDEA 1BF8A 2YD2A 3US1A 2A77H 4XP6L 2VNCA 3B4NA 2QTVA 1RZIA 1XGPB 4MB3A 3RVXC 1M2OA 2R56H 3PFUA 4P3WA 5I76A 4HPHA 1MCJA 2EDHA 5BV7C 2JKRM 1PLCA 3PP4H 5DD3H 2PABA 5CEZL 4UUJA 4EAEA 3OB0K 3FH8A 1Q72L 1TETL 3QORA 3WJMA 2IH1A 4K5NA 2W81C 3CN2A 3W82A 5EOTB 1NWPA 3BQUB 2JELL 1MJ7H 5DD0H 3BZ4A 5LCVH 2XYBA 1U33A 4ICXA 4IKLA 3N1PC 1RU9L 5A2KH 3U6RB 1RY7B 4N2OA 4ECNA 4Y9GA 1ODAA 1N10A 2COVD 2FX9H 1CC3A 2Z93A 2HH0L 2Q7YA 4ANVA 3FS9A 4X80H 1HSBA 1K8DA 2ZWLT 3AAZB 5B38G 2D2CC 1IC5L 4MCMA 1IAMA 3LSOB 3S48A 5CCKH 3VD9A 4BE6A 1DVFD 2EC9T 3OAYK 4G43A 4IMLB 2Z92A 5GIRA 2CGRL 2VR4A 2HWZH 2OJZH 3LZPA 5GGUA 3VFNB 1CD9B 3BVDB 2CGRH 5F3HB 1AP2A 3B83A 2H6PA 4RGOL 4YC2C 8FABB 4PWIA 4AZ8B 4HJGB 1KIQB 3LKOA 4FERA 4JRYD 2OMWB 2PPFA 4HUXA 4ACPA 2QFRA 3F7QA 4CKVX 5I16B 2Z8WC 5I71C 3NZSA 5LQBH 4JK0D 2IBZY 3WMSA 3ROOB 3V0VA 3THML 3PWUA 2G9KA 1N64H 1G0DA 1X9UA 2G2RA 2GJ6D 3ECWA 4DAGL 3L9RA 4PJ5E 4HOMA 4LLQB 4KDTA 3ARFB 5I8CB 3GRWA 3H9SB 4G80A 3P30L 4RX4A 3HMXA 4BZ1L 5EBLA 4HWEH 4K71B 3PWJA 4RESB 4ZXBD 2CHXA 3T0EC 1A3QA 5DGRA 3WL9B 4PJGB 1CD8A 2DKMA 1CLZH 3S3CB 3O4LB 1MCBA 2R9HD 5JHBA 3QCVH 3VM5A 3RUGA 1KCKA 1PNDA 2HFTA 4LHUA 2QZ5A 3WE1A 3LRSB 4ESKA 3LPFA 3MLSH 1JMZA 4LP8A 5C07D 2JKTM 3SOBH 3VFTB 1RK7A 4F93B 5HYSA 4GAYA 2IH3B 3V7AE 3K81A 4HFWA 4P2RE 3A5VA 1K9TA 4PRPD 3FFCE 3AY4C 4AXWB 4J6RH 3DNKA 2D31B 4JM2C 1O9ZA 4NC1C 3QJFB 5M94B 1CF8H 3AREB 4ZNCD 2O6EA 3W1ZA 4OZIA 5KBPA 3FQUA 3CQQA 1SUJA 2J8UF 1YEKL 3J7HA 2WXJA 2OW7A 3ESUF 4UB0H 3AFLA 3QEUA 4I9WE 2XJLA 1E8ZA 2F1BA 2BNRA 3MRLA 1G6VK 3NJFA 4G8IA 4XMLH 4KNQA 3LXAA 3ZBMA 3MCLH 4CBPA 4C55A 1G7PA 1TOXA 3IXAA 3JZYA 4HJSA 3D4CA 3CVDA 2BHUA 3L9RB 4M8QB 3MV01 1JN6B 1Y1UA 3B8YA 5EZOH 3KPQA 3S37X 4R7NA 1WFOA 2ROYA 3ZTDC 1RURL 2AJVL 2MQ3A 3KDMB 2AITA 2WNWA 5D8JL 4D7BA 2AEOA 2GIXA 1AMYA 2E8ZA 5EORL 1ZSDA 1F8TL 2J55A 3RILA 3WFDH 1OF0A 3KYKL 2X2HA 4K2UL 2FIRT 2Z3FA 1I7ZA 5E9DE 1KN4H 1LP9B 4JFQA 4HIIB 2UXTA 5A6LA 5TQ2H 4DGYL 4XO9A 2V8MA 2Y7MA 1IZKA 3C6EA 3CX5K 1FNLA 4X7CC 3ZKSD 4FJZA 3FUMA 2BVEA 4XHJC 1DP0A 1QO3B 3ZHLA 4OVUA 4LSPH 1RJZB 4UQ2B 5F44A 3B7YA 3G6JF 3H7BA 3ELAT 3U46B 2CBQA 4MD0B 3ULSA 3ARDB 1PLGH 1HHIB 3RDTB 3GI8L 4YHZL 3PIQA 3D12B 4JZOA 3BDBA 2DIAA 2IQ9H 3UTTA 1W6WA 2DQCL 1V27A 5DJ0A 3DJRA 4U4BA 3EJZD 5D4HA 3VWKA 1T1XA 2HUHA 4PWEA 3HPJA 3GSVB 3VWJC 5AZEH 3IE9A 2FD6L 4B9CA 3RZWA 3QCTH 3IT8D 1NJ9A 1OGAD 1U4EA 2ZCZA 3MLUL 2OKMA 2VRAA 2XRAH 4ONHA 5DUPL 1OTUD 4PY8J 1LEKB 1G1KA 2HX8A 2UUDH 1OP3H 3RIKA 1NGYB 4QXWA 3OHXA 4A2FA 1RZ7L 3K80A 1LM8V 2H2SC 2PCFA 5DQDH 4AVKA 1A7NL 4POZC 1BZ8A 3V7AG 3MNZA 4XP9H 4P4RB 3MDJA 1CJYA 3PAVA 2WZPD 5HSFA 1BZ9A 5AB0A 3AQZA 3D06A 1O9VA 3EJPA 2B2XL 1O5PA 1AIFB 1UATA 1X9QA 3ZE2E 5TE6L 4JM2D 5GGSB 1P9MA 3V9CA 4EN3D 3RTQD 3CSPA 3KXFE 5AUMB 3BXNB 3WNIA 3EYSH 1NLBL 4U1IB 5KVFH 4XPBH 4L9LB 3HI6L 3AXLA 4GKZA 4HJ0C 3SZ6A 6PCYA 4M93C 5A2CA 4GP5B 2GTZB 1U8JA 2OSYA 2JB6B 5H8DA 4FI6A 5LBSL 3NFNA 4XMXA 1LO3L 1KELL 1AXIB 3V7MA 2JI3A 5I1EH 4OF3A 1MRFL 3AQDA 1IBYA 3GMRA 3ZO0A 1D5ZB 4WJ5A 2P24B 1K3ZA 3BUDA 1G9MC 2J5LB 1PZCA 2QPSA 2BNRD 4OLUH 4MBRA 3TYFA 3CSFA 4MNQB 4M4PA 3CPUA 4ADJA 3OHXC 5BZDA 1F18A 5J6HA 32C2A 5CWSA 4XB7A 3DDFA 3IKCB 5IVZB 25C8H 1YEJL 4KX7A 2EYTA 1FL6B 3BWSA 3D0AA 3TFKD 4I0PC 3LEVH 3WFHA 3JT0A 4IKIA 3WN5B 5AKVA 3CIAA 3QZWB 5BS0A 1NMBL 1TZHB 2ZWSA 3BJLA 4XWOD 1JF6A 1Q9KB 4P59L 4Z7VB 3SO3C 2YD4A 4G5ZL 2P1YA 3IJHA 5BZWB 2X6VA 1TTAA 1ZHKA 3MRRA 4UDTB 3U79A 4KRPB 5KSAD 4QHNB 5JA9A 1DVZA 1E8WA 3BC9A 3NRFA 3RWFA 3DURB 4IJ3C 3S88H 1FFTB 1A02N 3K1KC 3DV6B 3MLSL 5MHSD 2FHFA 3BUTA 1J5CA 4JQXC 1QBBA 1R3IL 1XAUA 3IN0A 4IM8A 1QATA 5FECB 1LDSA 5A3IC 4YR6A 4ANUA 1MZZA 1VFBB 1JGDA 2F1EA 4GYBA 5GZNC 1H5BA 2Q3XA 2MWCA 3B3IA 15C8H 1BWMA 1YEGL 4BZ1H 2QR0A 1RZ8B 2IIJA 3SSGA 2GJZB 2NY2C 3LXUX 1T6WA 3Q13A 1FZOA 4KTDL 2QZQA 4GRWF 5FYKE 1HEHC 4WW2A 1OF2B 4EUPA 2OFQA 1YUKB 2WV3A 1HX0A 1IJNA 4E9RA 1OT4A 3H42H 2GEEA 3BZFA 3LKRB 4M1GL 4OCXH 4PV8A 5EIQA 3DC0A 1I4FA 4IRSD 2IWEA 4LVNC 3RNQB 1ZWIB 1I3GL 3ZRCC 3FQTA 3OB0H 2ATKA 5FGSA 1Q38A 3BIAX 2V2TB 4PJCA 3CFUA 5E0QA 4APQD 2EUVA 1JWSB 3U48A 4OD2B 4ORGA 2L04A 3PAZA 3HBPA 4MS8D 1M05A 5E6UB 4HC1H 1RZFH 2F8OA 1WZLA 4HIJB 1URLA 4LSDA 4TL5A 1OM3H 3PWPA 5T1KA 4QLRA 4TLSA 4IU3A 3F2LA 3MRCB 1U4FA 1KJ2A 1IEBB 3H53A 5I0ZA 3BZEB 2SODB 1RZ8A 5KW9H 2XWBA 4J1UB 1U8JB 4U6YB 3Q5TA 3TXAA 3ZDYE 1DN2A 2IFFH 2X2YA 3MFFA 3P3UA 3ULVF 1W2KT 3U1SH 2GAZB 1BF2A 1DBMH 1U92A 2FHBA 3G3LA 5I1JL 1JPSH 4GKSB 4JPVH 3WELA 5IUCA 1T03L 5CCJA 1FL3A 3BZDA 1IARB 2V9QA 2BP0A 5DRXA 4BKSC 1JZEA 4YHML 5AVUB 5GGSA 1OK8A 3TJPA 4FE9A 1Z9MA 2IMNA 5L9DL 4UDUA 2Q2LA 3S5ZA 3M45A 4GKLA 4ZS7H 4ODXB 5CP3A 1LMKA 2X9YA 3PP4L 2E9JA 4E5XG 1B9KA 1KTDB 4YK4B 1F3RB 3LDBC 1B6DA 3N85H 1WV7T 4DK3A 3GBNL 3SKUD 3APMA 2XYCA 3LV3A 4OZFA 4FLHA 2I7OA 4FYTA 1WBYA 3MNWA 2J1KA 5ID0A 4F7TA 1MCWW 3B9KC 3TV8A 4Y2NA 3X17A 3TBSA 2XPGB 1MRCH 4M3KB 1LTXA 3SDXA 3GDBA 1LE5B 4HIEB 1ZGLB 2BS8A 3PP3H 4O2FA 3SDDC 3U82B 1T1ZA 4Y4KB 4HFUL 1FAIL 5DZOA 2WWNA 1Q0YL 4ONFL 5DUML 2W0KA 5D7JA 2GI7A 3LYRA 1QNIA 1ZV9A 4JVPA 1JERA 3QO0B 4HKJB 5CD3A 3SDCC 3W57A 3EYQD 2LLGA 3VH8B 4MAUL 1SMAA 3O11B 2NMSA 4N0FA 3IMTA 3ZE0E 2YQBA 1I7UA 4CVZA 4DP2X 1T0MA 2F58L 2WQXA 5E51A 4HLEA 1T83A 3ET9F 4JHAL 4JRXA 2B1HH 1SYVB 3O6FB 5B3JE 3DMMA 1N12A 3N43F 1A7RH 2FJSA 1YUHA 3IAGC 4ZUTB 1KV7A 3NG5A 5IBUB 3RLSA 3W81A 3FOLB 3BKMH 3FQRB 1JRHL 2BW5A 1LEGB 4K5OA 2FSDA 3EJRA 3D85D 3FTVA 5A2LH 2WQ8A 4NO3A 1TYRA 4PU2A 3VXUB 4DKAA 1QHOA 5C0CB 1NCWL 4H1LH 3SIKA 1JNJA 1AI1L 1H5BB 3HA0A 1H3TA 3V0EA 2ZYSA 2P8MA 4XXCA 1RLWA 3BGMB 3VXME 3QG7H 4JJOA 1FC2D 1E9OB 3CXDH 2GIYA 3D1MC 3HE6A 2J6EA 3FB8A 1GHFL 5D1QB 3SGEI 4F8OA 2W0LA 2J88L 1MG2C 1Z3GL 1OW0C 4JFXA 2JFCA 3VYNA 3RPIB 2CQVA 2JK5A 1U8KB 1I9IL 2VM3A 4JO2H 4PTTB 5EUOA 4A63A 4F57H 3E1F1 4AGQA 5C2BH 2XOTA 4BJLA 3QJHA 3ARED 5JOPD 2X6AA 1BZOA 1JWMA 2DJMA 2IXQA 3IDIB 5EG6C 2VDNH 3ABLB 4I89A 1QRNE 4D0BB 4M1DH 1N5YL 1WEJH 4X8JA 5IK3A 2CDGA 1IAOB 2EIBA 2IBGA 3Q9QA 3QXTA 4L9LC 4N8CL 3CZFA 3EOAB 4YSUA 4ZFOL 3VWKD 1F0LA 4M3JA 1IGTB 2J88H 3CV5A 3LVTA 2R9HC 5F1OB 4ELDA 4MYWB 4N1CA 4FLRA 1E5UI 3TBWB 3ZDZE 4Z8FH 1IEAA 2XSKA 1YNKH 4R7LA 4UINH 4L1TA 5D6CA 5D2NC 5BVPL 1BFVH 2NCMA 3BWZA 3JV6B 1SJVA 3JWDH 1KYOK 4P23C 5IQNA 2Z7ZA 3O3EB 4X98B 5FWQA 4AUYA 3P4OA 3T3MB 1OAQL 4JR9L 5IJDC 2CPUA 2O61B 1HDMB 4UTBH 1UFUA 1Y18B 2OV0A 1Q94B 4WU7A 1JFQL 2MEJB 3OF6D 4HJGA 4JUTA 2MCPL 3HNSL 3VE0A 4OLYH 4B97A 1GGYA 4PSPA 1DQVA 4NRZA 4WFFE 5F1SA 4B50A 1GY1A 4U7KA 2CBMA 3EDDA 5AUMA 3QJOA 4BQBA 4QRSA 1FO0H 4OKDA 5E9DD 3FXIC 2BHZA 3BSGA 4ZMZA 2DDQH 2P42B 2PTTB 1N6UA 4NENA 1KTBA 2WZ5A 2EILB 3TH2T 4M48L 4OIBA 1S78D 3IPFA 1QACA 4HAKA 4Q6IB 4QTHA 1JDAA 5FCUL 1D9KD 1A7PH 4HWZA 1VERA 1D9KA 3HJ0A 1MCSA 3MNZB 1X5ZA 3AM8A 5IFHL 2C3GA 3QIBA 3IF1B 1KCUL 5LG1A 2B5IB 2DQ6A 4N2EA 4Q56A 4AMKH 3FU6A 4W4NA 1GYVA 3GLDA 1CYXA 4JAMA 4MJIB 4HHGA 3FB5B 2HG0A 1GSMA 4E9XA 3BHBA 1BPLB 4JQVA 4LSUL 4RZCA 1YA5A 5EOTA 5EDXA 4ELKA 4OLVL 1JF5A 2J20A 1BQHA 2GBUA 1JYXA 4LOUC 1SXAA 5EA0H 1MCFA 3G9VA 2AERT 1W0VA 2DPKA 1MDTA 3QHFL 1MEXH 3QQ3B 2NSXA 3VFSB 3KZ8A 5EA0L 4M7ZC 5E03A 4AWJC 4XCNA 4UTAH 1KEGL 1DVYA 1UWEH 3FRUA 2XICA 5HJDA 3V5DB 2V9RA 2G2RB 4NZ8A 5AZ2H 3OKNA 4TV3A 1ROWA 3QDMD 5D1QE 3EJSA 2DL9A 1A4KA 3O0RH 1ADQA 1BYNA 4PFEA 5CSGA 1UH4A 4S0SD 4CVXB 4YN3A 3GMMA 3NCWA 2BSTB 3WLBA 5I18L 1OV8A 4O02L 1UOVA 2MKWA 2ZX6A 2APXA 4BK5A 5DZJA 1SNRA 1RCYA 4QRPB 1B0RB 5BVJA 1CI5A 2WIIB 3ECBB 3L3KA 2GJ6E 2F8IA 2A6IB 4M48H 1DQQA 3OAYH 3KW7A 5IFAL 4PPTA 2JF1A 4JKKA 1HHIA 3RDTA 1JTTA 2VERA 3WGUB 1A4JB 3ZGIA 4H13C 3ATFA 5IMMB 1AGDA 3NQKA 1KJVA 2WKOF 3N0AA 2Z1KA 3KWWA 3NSYA 4XMKL 4HHAA 2A74A 2VDML 2YEZA 1NCIA 1NDMA 4AK2A 4WWKD 2IF7A 1IQDA 2P5WD 2UZIL 5JIQA 2DQIL 1QEXA 3AXHA 2VLLB 1PKQE 5TF1H 3V0AC 4MRBA 3UBXI 3GMOA 5C09D 4LE8A 4ELMA 2VR9A 1WCBB 1KLUB 2GABA 4JFQB 4JR9H 1II4E 1AC6A 1EERB 3LB6D 2BNRB 5DUBB 2I32A 5CINL 5HBBA 1E6OH 5ACZB 3ABGA 2VRKA 1PIGA 3OLDA 2VO5A 3ZKXB 3JTSB 3LNIA 1H3UA 3FCUB 3BUQA 1X6LA 2OR9L 4WWID 3QDHA 4GI8A 3U30C 1BD2A 4NQDA 1HSAB 3COOA 3UCRA 1MH5A 1M7DA 3K74B 3KLLA 3WD5H 2C9UA 1D5BA 1ZVYA 2CO2A 3SD2A 2YXFA 2YAOA 1HIML 1P5UC 3WU1A 3CLWA 2ALAA 4Q4EA 3B7SA 4YX2H 3WFCH 3AGWA 3S0PA 4FFYL 3RX9A 4C54A 1CGXA 2B59A 2Y5EA 4BK5C 3ZKMD 5C2BL 2BOBA 4OD3H 3CDCA 4X0KA 1BQUA 1AZCA 4XB3A 4XGZB 5D5MB 3VXNB 1EHNA 2LV4A 4X99A 3QYNA 2VN6A 2QQLL 4DQOL 5FW7A 5D2LF 3PF2A 2UY6A 4LBEB 5DD1L 3QZBA 4NM8H 1A7OH 1GIGH 4FNRA 4Y2DC 1RSYA 3DYOA 3LAFA 3LRHA 4MQXD 1ZTXE 4PN6A 5H2BA 4TRPL 3IFNL 4YE4L 2HFGL 5CZXC 2DLFL 4OJFL 3X14A 5A2JH 5MENB 4JFXB 2FX8H 2EZ0D 4LHUB 4FRWA 3HG1D 4Q6IA 1NFAA 4YHIA 5BXFA 3REVB 2NY1C 1H3WM 3QZMA 3MCYA 2FECL 3H56A 4UILH 3QDGB 4JN2A 4EE2A 5CN1A 4YDLB 2R69A 1KB9K 1UB5A 3NJGA 3SGEH 1CFSA 3QK0A 1K85A 1UJ3A 4E42B 3ASOB 4AL8H 1G7MB 4JO4L 3ASNB 4N0YH 4CW1A 1AOZA 1UTDA 2A9DA 3QWOA 4NRXA 3N40F 1NBYB 1XB8A 3DUSB 4JS7A 2OMXA 5ISZD 4FQIL 4AIOA 4PS8A 3QJVB 3S8WA 5HVHC 2XXFA 2BPBA 5IMKA 3JTSA 4K8RC 1U58B 1I1AD 1PQZB 3A23A 1DR9A 1CE6B 4GXFA 1QFWL 5C0IB 5ILTH 3VFUB 4EOWH 1CL7H 1MFNA 2WWKO 5JQ6H 1AKPA 4PJBE 4BQ6A 3C5ZB 3BP6B 1XF4B 3FMGH 3ARBC 4E9VA 1S7XB 4YSRA 1AZZC 1KBKA 1NAMB 2LR4A 4N20A 4RFNB 3WV0A 3G5VA 4FG4A 4P2OB 4P07A 5EPMB 5JW4M 2EYRA 1FFNB 5DUMH 3MODH 1XB3A 3CFCH 4NAJA 2JKSA 1VEPA 4KTYA 1T1YA 2UWEA 2IADA 4RAVA 1MCHA 3EYSL 1HSBB 3QIUB 1M6UA 2DLFH 5HI4C 4U7MA 1U8IB 4BCZA 3RJQB 3A24A 4WI0B 1F90L 4WFHD 4P3CL 2PCFB 1GIGL 4CL7A 1WYJA 3HI1B 4Q89A 4NNYA 2CMRL 4OAWA 3VO0A 5HYSG 1H8LA 1TU2A 5FYJH 5BO0D 3GZOA 4L3CB 4O5LH 4OCNC 1MCCA 3SGDI 4N3UA 4XNMA 1S3KH 1USQA 4ZAKB 2W92A 4JZNA 3RWDA 3BLPX 4LF3A 4MD4B 2R69H 5INDB 4P8QA 1KZQA 3IRZA 5D1XA 4PJAB 3NFPB 4NIYE 4X9IA 4X6CB 4CMHC 3LPPA 5ESQB 4P57A 4PY8I 4B9YA 2PO6B 3DYMA 3ASWA 4FOMA 1KFAH 4JZJB 5D96C 5DUPH 3TBYB 3P2TA 5FWRA 4V2CB 1R3KA 4UQ9A 1QLFB 2BWDA 3L3OA 4Y4HB 2J2ZB 5AW0B 1DQIA 3JWNC 1UWGL 1NMCC 2F9BT 5CJOL 2NPLX 3MGOB 2WNKA 1CT8A 2PP8A 4HEPG 2WSDA 4NWTH 1GYCA 1JS4A 3SYQA 2OI9C 5IP4A 2FO1A 1X9RA 5CZVL 3REWB 4MQXC 5E6IA 1OCOB 1OSEA 1ITCA 2DQUH 1W0WA 1OM9A 1JGEA 1U6AL 1OVZA 5E2WH 5GJSH 1CFTA 4Y9EA