1U3NA

A sod-like protein from b. subtilis, unstructured in solution, becomes ordered in the crystal: implications for function and for fibrillogenesis
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
162
structure length
162
Chain Sequence
VVETSAFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALLGNNEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical superoxide dismutase-like protein yojM
publication title A prokaryotic superoxide dismutase paralog lacking two Cu ligands: from largely unstructured in solution to ordered in the crystal.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Unknown function
total genus 3
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1u3nA00
4OH2A 2WKOA 1OEZW 1YAZA 1OZUA 2Q2LA 3KM2A 3MNDA 1SOSA 5KBMA 1SXBA 1L3NA 3PU7A 2AQQA 1N18A 1PTZA 1PU0A 1SXZA 1Z9NA 2C9SA 3H2PA 3QQDA 2WZ5A 3KH3A 3HFFA 3S0PA 1IBHA 1OALA 2C9VA 2ZKYA 2VR6A 3L9EA 1S4IA 3KM1A 2V0AA 1SXNA 1QUPA 1XSOA 1IBDA 3GQFA 1AZVA 1EJ8A 4BCZA 2ZKXA 1HL5A 2VR8A 2JLPA 1IBBA 2Z7ZA 1TO4A 1CB4A 4OJAA 3KBEA 1B4LA 1UXMA 1P1VA 3CQPA 4BD4A 2NNXA 3GTTA 2JCWA 1N19A 1IBFA 1E9QB 4FF9A 1E9QA 4A7QA 1F18A 1F1AA 2K4WA 3HOGA 2WYTA 1SXCA 4L05A 2WZ0A 4B3EA 4A7GF 1JK9B 1U3NA 1E9PB 2XJLA 1BA9A 1OZTG 1FUNA 1SPDA 2GBVA 2WWOA 1XTMA 2GBTA 4A7GA 1KMGA 3KBFA 5CU9A 1IB5A 3F7LA 3ECVA 1COBA 1OAJA 2WWNA 2ZOWA 2R27A 2AQRA 2APSA 2AQTA 3MKGA 2Z7YA 4A7TA 2GBUA 1DO5A 2AF2A 3F7KA 5KBKA 3L9YA 3GTVA 1ESOA 2Z7UA 4MCMA 2AQSA 3LTVA 3KH4A 1JCVA 1E9OB 2AEOA 2LU5A 2Z7WA 1JK9A 1E9OA 1Z9PA 1E9PA 3RE0A 3HW7A 3CQQA 1BZOA 1SXSA 1YSOA 2AQPA 2E46A 1XTLA 3ECWA 5KBLA 2WYZA 3GZOA 1UXLA 1SDAB 2AQNA 1F1GA 4N3TA 1PZSA 1SDYA 1F1DA 4A7SA 1CBJA 3H2QA 3QQDB 4A7VA 4A7UA 1HL4A 2E47A 4MCNA 3T5WA 3ECUA 1B4TA 1Q0EA 4N3UA 4U4IA 1TO5A 1SRDA 2ZKWA 2C9UA 2VR7A 2XJKA 3GZQA 1YAIA 1SXAA 3GZPA 1DSWA 2WKOF 1EQWA 2WZ6A 3CE1A 3SODB 2SODB 1MFMA 4BCYA 1RK7A 3K91A
chains in the Genus database with same CATH superfamily
1QSFA 4HKZA 1N0XH 3B43A 2Q9OA 4FQPA 5EU5B 5FYKL 4XZ4A 1LO4L 1ZKAA 4G80A 4UMGA 1AR1B 1ETZB 3STZA 4DO5A 5EZJA 1SMDA 3PS6A 4GB9A 4WF7A 2NY3C 4R7NB 2EVFA 4NQUA 1Q0XH 1KOAA 3TM6A 1B2WL 2ESVB 5IROD 1TTBA 3BN9D 5F96L 1XF3A 1NCTA 1PZ2A 1DJGA 3BMVA 4V1DD 1AS7A 3ZL4H 4K8RC 3FTYA 5MEPA 2GEQA 1PX3A 2VXUL 3K6SB 3AU0A 2WCPA 4MX7B 3N42F 2Z7ZA 3DIFA 3LEVL 4ZZKA 3BD5A 1NPJA 2QDWA 1QNZL 3KYNA 5A2KH 4KQ3L 1UKSA 1IAIL 3M1OA 4OLXL 3K1KC 5ALCH 3JWNG 5EU5A 3MNWB 4Z7WF 4W9KC 4K7PH 4AYDC 2XNAB 4JFFB 5D9SB 4Y9BA 3OLIA 1FH2A 3BUDA 4Q6IC 5DA4A 3SKMB 4KNSA 2CGRL 4EI5C 1NCOA 3MTRA 1FNFA 4R7NA 4Z7OE 4TTDC 2VLJD 2IALA 3BPCA 2F61A 4ADGA 5C2UB 3ZE0F 3I9AA 3OPZH 2ESVA 2VMJA 1QO3B 1VACB 2W0LA 3RDJA 3DECA 4XVTL 3P9LB 3L4VA 4L1SA 1IC4H 5FUCC 4ZDHB 3BP7B 1MCNA 2BSTB 3VA2C 4D3CL 3MU3A 1WBYB 3A6BH 1L6ZA 3L7EB 4FC3E 4J23A 1IKFH 4N2BA 3F01A 1MI5E 5D6DC 3V2AR 4DKDC 5FHBL 5BMFH 4NGHL 5ANMB 2I69A 5F1OB 3VX1A 3I3DA 3PG2A 4KK5D 2MCAA 5LHDA 2C9AA 1MJUL 1X7QB 2XNAA 2X6AA 4JFFA 1I1AC 2IPKB 1IBZA 3PHQB 4MLSA 3SKMA 1P5UC 2XC8A 3M45A 3LZLA 1J86A 4F7PB 3X17A 1CPUA 5IP4A 2JXMB 1KN4H 1SHWA 3EJYD 4LSSH 4KXDA 3P3UA 3FUDA 5FO2A 4NB7A 1FH5H 1VACA 3BP6B 5FDYA 2XRAH 3K2MC 5E99L 3P9LA 1HYSC 4M6ML 4YFEA 1A2YA 2BSTA 3L7EA 1FVCB 2NSQA 2E7HA 1SJHB 5B4MC 5J9PA 5GRVK 1ACZA 4NRZA 5ANMA 3OZKA 4P8QA 5D7KE 3P0YL 3T8MA 1HNGA 2OMNA 3PABB 1S8DA 4PJIB 5JHDB 3T5WA 3L2NA 1KWGA 1X7QA 2UXGA 3SPIA 2BSEA 5AZEL 2BRRL 2IPKA 3NMEA 3GSQB 5BPPA 1ZLDA 5E7BA 5BOZG 3EJSA 4F7PA 5I8EA 2FJHB 4AENB 3VRJA 3KGRA 2NXZD 1WAEA 5TDNB 3FT2A 1MIEL 1JF1B 4QNPF 1JGDB 1R46A 2Z1KA 2EDOA 5AW0B 1VEOA 3IAGC 1DBKL 3S5LB 3EBGA 5HPMB 1MCWW 4UQCA 1QSZA 1YEKH 3WIIL 1TVBA 5F9OH 1F90H 3QXAB 3T8XB 4DZBB 1G7QB 2Y0SA 2YPLD 1FPTL 1SJHA 1X5AA 1M6OB 4AJYV 3MPCA 1CZ8H 5GZNA 3CSTA 3RNKB 3WE6B 1ASQA 1CE1H 2PO6B 3PABA 4PJIA 4EKJA 5JHDA 1HQ4B 2B7DT 4ZFZB 3L9EA 1URLA 3MBEB 1MCEA 2Q8BH 2PCYA 5HDQL 4NUGL 3U2SB 3EFOA 4G59C 5AKVA 3K1DA 4XGZA 4E9YA 1A9EB 2ZX7A 1Q9KB 3M46A 3AW5A 3RVXD 3UC0H 1JF1A 1KWKA 1JGDA 3LDBB 4HZLB 4YHZH 2CO2A 1EO8L 3CHQA 2WAHA 4FEIA 3K7UA 3BKYH 4JPSA 5DMGC 3U0PB 1EZVX 5HHNB 2VXQH 4KV5F 3MBXL 1NCAH 2QDVA 2PPCA 3IAQA 3KYKL 3NFSH 3QXAA 4PJEF 4DZBA 1Q9LB 1U8HA 4HBCH 3KCPB 2YOAA 3LZQA 5FW8A 1EFXD 5GRJL 4AL8H 4JANA 3DIDA 2IAMA 2GBVA 1EAPA 4UQEA 4WGKA 1FRGL 1A1OB 4ZFZA 4PI2A 4AEIH 3CZFB 3FTSA 3U2SA 1AC0A 1G7IA 4G9FD 4DJMA 3F2LA 1A9EA 3ZZLA 1Q9KA 2EYRB 1YJDC 3EOBB 4JR9L 2NUPA 4HZLA 5D2NB 1U4FA 2BFGA 3IJYB 3FS9A 3MYJB 1X7SA 2B20A 3GSOB 4TUUA 4DZ8B 1FWXA 1K8DA 1QFPA 3N50A 1RIVH 2P4AB 4IBUA 3MOQA 1Q9LA 4CMHC 1D5IH 1YN6B 4PBWD 4Q4EA 3WMPA 3KCPA 5IQOA 2VLKE 5GRUH 3HUJB 3T4YB 4S0TD 4P2CG 4WCYL 1A1OA 4IDLA 4YLQT 3LRHA 5FOJA 1GKOA 3LXAA 4K3EL 3B2PA 5GGVH 4OQTL 2Z31D 1F86A 1KCSH 3OHXA 1U0QA 4P59L 3NCWA 3ARBD 4PVMA 5EG6C 2EYRA 3CFBB 3JTSB 3EOBA 4JRYD 4XB3A 2X2YA 2DQ6A 3KVPA 3IJYA 4XNZC 1J0JA 3GSOA 3R06A 1EHKB 3UZQB 4NT6B 4DZ8A 3SE3A 4N2DA 2DQCH 3EHBC 2JK5A 1YN6A 3D39D 1GXEA 4IDJL 1L7TH 4YEFA 3Q6FB 4K3HA 5BS0B 5J1SC 3RJQB 8PAZA 2OSLB 2A7BA 3HEIB 4ZO6A 4LRNL 2O6DA 3EBHA 4LVNB 3KJ4C 1J88A 3K72A 2GFBB 2WKOA 1ZHNA 4GAAA 2CBPA 3SGJA 3NQKA 2XPGB 4D0CA 1TQSA 3IPBA 1RJLB 2MCPH 4U0RC 3BAEH 2AQQA 3MV7E 3ZTNH 3FF8A 4TV3A 4P2RB 2VYRE 1LP9E 3JTSA 3MZGB 4UT7H 1GS8A 1S7SA 2LQRA 4NWTH 1KELH 3ZU8A 3DV4A 4CSSA 2JELH 3ARTA 4RRPG 1ZV9A 4OR1A 3UZQA 2QGDA 1UKQA 3UBHA 4S1QH 3EIFA 2UZPA 3HPLA 3EDKA 4R7XA 3MODH 4JO3L 2VQTA 1KNOA 2MTAA 5BS0A 5DHVH 5I74B 5ADPL 1S9XA 2OSLA 3FRPB 2ZKMX 1VZHA 1JJUA 2IFFH 3QUHA 4EO5A 4BD4A 1I1FA 3ZW3A 3A6CH 4NRYB 2ZOUA 1AKJB 2XPGA 3NSFA 2XZQH 1P84J 4HQQH 4LHJB 5B38G 2MJWA 4Q0XL 3IDIB 3VXUB 4P2RA 1RUAL 5DZAA 3QQXA 3FMGL 2IMNA 1FG9C 3EXLA 1BQLH 1QYGH 2XTJC 4ALAH 3GSXB 1CFBA 3GMLB 4ZXBD 1IM3D 4QD2E 1BZDA 4HIJA 3WKYA 5T3XD 4FZEL 3TV3L 2G60L 2MWCA 4HWBH 1TTAA 5IB2B 2XWZA 1MHPL 4NN5B 4TVPD 4K73A 1LMIA 5C3IA 4CW1A 4BH8A 2EYTA 3PXJA 4H1LA 4DP8X 4EDWH 1AQKH 5IBLC 4J3OG 3EYFB 4IRSD 1J5HA 2ITDA 2D0GA 3BGFC 4XR8C 1MCCA 1EMTL 3VXUA 5BV7L 2RACA 4W9GC 4GMSL 2VO5A 1JNLL 1U58B 4IBWA 1Y18B 3P3RA 2PPDA 1I1YB 2APTA 3GSXA 3MXVH 4HJTA 3DTXB 3QG7H 1EXHA 4ZS6C 1XTLA 1Z3GL 3NN8B 2R0WH 4EN3D 2GSGB 1BVOA 1FZKB 3LKQB 3VFPA 2WSDA 1HJCA 2KPWA 4UNTA 1NBVH 1VGEL 3IMRA 1Q9OB 1NC2A 4XCEA 2WP3T 5DHXB 2P5ED 3EYFA 1E0OB 1FGVH 2VQ1A 2Y69B 1L9RA 2W92A 3F7RA 2PYEA 2CQVA 2D3LA 2H6UA 4ETQB 2DQIH 3IJSB 4J3OD 4Y5VB 4GXVH 5T5FA 3PL6A 1PJ9A 4S1RL 2RGSA 1GC1H 1I1YA 2CM6A 2DI8A 1WTGT 4R26H 4PD4K 3NN8A 3D9AL 3D51A 1CN4A 2R4RH 2GSGA 3EG9B 5CKGA 2FTAA 1FZKA 2PR4H 1DN0B 1GPOL 1KJMB 3BGMB 2Z1PA 3GLAA 1PKQB 2X2UA 5BXFB 1CFQB 1Q9OA 4NFBA 4Z7WA 3V8CA 1MRDH 1TJIL 2DI9A 1OCWL 4BHUI 3T0EB 2VZTA 2R1XB 3VD4A 4FN0A 1JPEA 4WTZA 2VR6A 5EPMB 3C8HA 1J8HB 4ZQTA 2KHAA 3MV9D 3IJSA 2JJUA 4B53A 3EYUL 2PXYB 2ALWA 4Y5VA 1K6QH 4LQ1A 2XTSA 2EACA 4BZ2H 3CDZA 4XCYB 4HUXB 2DIJA 3QIWD 4JM0A 3WO3B 2F19L 4N1EA 2BCMA 2A73A 4FXKB 4ZZFA 1PKQA 2AJSL 1BP3B 1X9UA 4TM9A 4XVSL 5KZCD 3BAKA 3L5XH 4HPOH 3PIQB 4G7YL 4HC1A 3QORB 2BDNL 2F7IA 3LPGA 3ARDC 2R1XA 1QHPA 2Z3FA 5DQDL 4OLUL 5EPMA 2BSSB 1J8HA 2EXWD 2FIKA 3HE6C 1BOYA 2WGNB 3B7SA 3NSDA 3GHEH 2FH8A 1BXAA 4QHNA 3B9KD 3WI9A 4HWBA 4KH2A 4XNDA 4ZFQA 2JKTM 4KKCC 2ARWA 3CDGB 4NZDA 4XCYA 1FGNL 3FN9A 3P11L 1A4AA 4OVVA 1PZBA 3SGEH 5G4NA 3IJHB 2HT4C 3NGBC 4PWEA 2JJTA 1QASA 4FXKA 1A14L 5HDRA 4AE0A 2WXOA 2Z7UA 1A7QL 4Y5XA 2AXFA 4XH2B 4F7MB 4FMKA 1G7MB 3PIQA 4DSYA 3IXAA 3QDJA 4K23L 3OKLA 4WW2C 5I75B 5KVEL 3FHQA 25C8L 4YHKL 3FYIB 2ZP8A 3EOTH 1HIML 2BSSA 2H6PA 3STLB 2J88L 3QIUD 1M4KA 3VWKB 2AZAA 4OV5B 1XB3A 4PGJA 1MCPH 2IDUA 5KVFH 4FJYA 5C0RL 3GRWL 5HJGA 3D85D 4Y9FA 5E51A 3R7QA 3VXNB 3D4YA 3JYCA 3HRZB 5J8OA 1TU2B 1IM9B 1AANA 2G2RA 3IM1A 3VAEA 4PLJD 3N5AA 4PJEB 3QXUA 5DK2B 1H8SA 4M7ZB 4F7MA 3OKNA 4M1CC 1SLXA 3MTXA 4JGJA 1JDCA 3V4UH 3HMWL 5FCSH 5FYJL 3RL1A 1SM3H 3SKJL 3DNKA 3GKWL 3ARFD 3IWUA 3QARA 4KKNA 2ZX5A 3BESR 1M1SA 1J5OL 1I8MB 1INEL 5C3TA 4PJXB 4PJ9D 1EDYA 5EUOB 5AW4B 5GS0D 1IILE 4LLYB 1GSKA 2PCPB 4UM9D 3RDTA 4DVBB 2MOQA 4OV5A 4GS7C 2ADJA 2OMXA 3VCLA 4QLWA 2AXJA 1TDQA 3BKMH 4MRBA 3VXNA 5D1QA 1TU2A 3M1BA 4PYGA 4PJEA 5C92A 5DK2A 1C1EH 3QHZL 1DUYB 4CKQA 2AITA 1QG3A 1NL0L 2EH7H 3NACH 5JR1L 5DVPA 5IMOB 4R96B 3J27A 1I53A 4PRID 1MW1A 4BFFA 1AI1L 5C86A 3ESUF 1W8OA 3MFFA 4CVXA 1W0YT 1P1VA 2IJ0C 4BZ2A 4NKOA 4LLYA 2AGJH 2JCWA 4I5BB 3VE0A 1JYWA 3KYMB 2MQCA 3HC3L 1L3WA 2F53D 1S7XB 2VC2H 1KPRA 2E6PA 3O6FC 2NUTB 1J12A 3RFZC 4HKJA 2E4FA 3O0LA 1GGBH 2R4SL 1T0MA 4KKAD 3L5IA 4N0FA 4NQVA 1DVFD 5TE6L 1IGTB 5EEUA 5BRZB 2OQJA 1ZANH 5CD5C 3L45A 5IMOA 4R96A 1X5GA 2AXWA 3AG4B 3FK3A 3CZNA 5FA3B 3O6LL 4ZMOA 5EUKB 4QRUB 1CF8H 4I5BA 4KAQL 1OL0A 2IOMA 2XG5A 3IBOA 1QSEB 3NPSB 5DJZB 1LD9B 1X9RA 1NCJA 3QQ9C 3KYMA 4HAKA 1Y6NR 1A3LL 5I1JH 1FSKB 4WQOA 4JFOA 1HAWA 3KH4A 5DC9B 1AZBA 2VW6A 3TA3B 2VXTH 2ZQKA 3L17A 2BS8A 1CF1A 3KE0A 3MRHA 3U4EA 2AEWA 2WXRA 4HKXB 3RY5A 2P28B 4YDJB 3X11A 5E5LA 1KXHA 2D7TH 1MAML 5LJYH 4TQPA 1DBML 1WD9A 1F1DA 5J06A 5KVDL 3N04A 2D03H 1II4E 2CMRL 1AR2A 1MZYA 4ZMZA 3TNMB 2VZVA 1QSEA 5MI0B 4B9GA 1LD9A 3JUYA 3OJVC 3Q3GB 1B2WH 3OR6B 5IGXH 3ROLB 3H54A 3CSYB 2DM2A 1ZLWH 4RGNB 4P3CL 3TA3A 2ZCHL 1SUHA 3ZKQD 4L3ED 3IT8D 4U7KA 1TITA 4YGAB 5MERB 3Q01A 5SWZB 4N2GA 3TNNA 1U8JA 4NO0B 1YAZA 1R33A 3S6CA 1AGEA 2BNUB 4UQ3B 2W38A 3TJEL 5CLWA 4H8QA 1VPOL 3MCLH 1E2WA 2GI0A 1IGFL 4HKXA 4KQ3H 4OLXH 2F15A 4PJ7B 4YDJA 5IHBA 2PF6A 2E3VA 4K9EC 4PU2A 4PWHA 3V4VH 4XVOA 3X3FH 2VC2B 2CGRH 3HE7C 4IU2B 3U4AA 3VXTA 5HDBB 4ZPTB 2C7FA 4OIFA 1SVBA 3KL0A 3QRFM 2NY5H 4O9HH 2WOBA 3Q3GA 5KW9L 1DQTA 2Z9TA 1R0AL 4G9DB 4ODUB 4XVTH 3B37A 3CSYA 3OKKA 1E6OL 4FFWC 5IBUG 5MERA 5CZRA 1J1XH 4BSWB 3KBPA 1TQCB 4D3CH 4GP8B 4QRAA 3ZQWA 1D9KD 3QJSB 4NM8L 5DJAB 5CFHA 2AK4E 4YSTA 5IFJA 4KZDL 3AITA 3C5ZC 4UQ3A 3ARQA 4AGOA 5EIIA 2HG5B 3L7FB 4X6FB 2YHGA 4R84A 3KAAA 4NGHH 4AGNA 3ILPA 1E3FA 4PJ7A 4N8UA 4JHBA 3VRLF 4MS8D 2NT0A 3JXAA 4DCQB 3UXFA 4IM8A 4WU7B 2IV9A 2X4PA 5HDWA 1W0WA 1UC6A 1OK0A 4LCCB 1BMZA 2QVFB 4DESA 2JNZA 3O45B 5B7EA 3LKNB 3VRIB 1LILA 4L23A 1ZV2A 4ELMB 4MAYD 4JFWA 3KG5A 3T1FB 3TO4A 3DOIA 3DV6A 2W9EH 4PJ8D 3EO0A 4YSEA 4GG6E 2IDFA 3L3OC 4U05A 2QKIC 1TEFA 1LE9B 2HUHA 3JTBA 1AZCA 1GSMA 2F7QA 1IC1A 3DI2B 3FQRB 3S34L 4AIZB 2HG5A 4X6FA 5BVPL 4U6YA 4QO1B 2EIBA 4AKPA 4TKWA 2A99A 2GJJA 1OXYA 3NRPA 3SODB 5FB8A 5AZEH 4OVUA 2O61B 4N9GA 3D05A 5EDXA 1DLFH 3WLWD 1PPIA 5CCGE 1E3ZA 2XWCA 4LCCA 1LDSA 3K8LA 2Z64C 3QZLA 2NXYD 4H1LG 1C7SA 3D52A 3LKNA 3EJQA 1MIEH 3SCMB 5BUGA 3C2AH 1WFMA 3RVVC 4DETA 1RZKH 4WFHE 3T1FA 2XXGA 1WA0X 1PF3A 2VM9A 2E27L 5GSRB 5IB5A 1CICD 3BSZH 4GNKB 4L9LC 3C8KB 3VTAA 3MSPA 3QRLA 3FAXA 4U7SA 3SYOA 1LE9A 1B88A 1RIUH 3LRMA 4M8VA 4AIZA 2D7NA 4KJPD 4QO1A 2N0MA 2ZXWB 4JREC 5F1SA 2CKNA 5JPMB 2P5PA 1MJ7L 3QEQD 3TIEB 2O61A 4DP2X 5C8JA 3GKZA 4M3HA 4NKIL 1SFHA 1UGNA 1SJMA 2LTQC 2ETWA 4F5CE 1BD2E 4BM7A 5C08E 5DR5L 1OW0A 3NTCL 2Q2LA 4JG9A 2HWZL 3SCMA 3BN3B 1HINL 2FECL 5T3ZL 3FB8B 1SJEB 1ED3B 3ZZQA 1CFSA 2V6HA 2K7QA 3MBXH 4PJCE 1RD6A 4N2CA 5IJKC 4HWUA 1UXSB 5DQ9B 1E4KC 3CSFA 3QPQC 3SPVB 2V2WA 5GRJH 5KANG 3T0XA 2G9HA 5JPMA 4IGBB 4JFPA 3TIEA 1R5VA 2A38A 4GPVA 3U30B 1P7QD 1HK6A 4EI6B 4LOFA 1DDHA 3VXQB 5HI3D 5ITBH 1AYRA 1NLBL 2CIIA 1MH5A 1FYTE 4UQIM 3QVAA 2M8XA 2NY4B 2NW2A 3FOLA 2WBJC 2F18A 5C97A 3KPOB 4JR9H 4IKJA 3OTTA 3FB8A 2QELA 3L5HA 1I3VA 3GRBA 3PWPB 2WYTA 1EPFA 4PJAF 1IL1B 3T8VA 3FZUC 1R75A 1G87A 2BNRB 2Q87A 4UQ2B 3U4KA 1UXSA 2C4FT 1ES0B 4BGDA 3SPVA 5KS9E 3D18B 2QADC 5E23A 4TQEH 3ULUL 4L8DB 4WCYH 4G6JL 1BZ8A 4IGBA 4EVNB 4Y19A 2VUOA 1OCRB 3V5DB 1XGUB 4EI6A 2P8PB 1U21A 3FT3B 4EF3A 4LDOB 1MFVA 3ZE1E 3RZCB 1XF1A 4ZTPL 2R2BB 4IBLT 4QKTA 5F3HA 1YQVH 1LXMA 5DGRA 2NDFA 3ULAB 2YPVL 3PWPA 4QRPA 4PS8A 3LD8C 3QUXD 7TAAA 4LLUB 3AB0C 4KTEL 5BOPA 2RCSL 2A2QT 2IQ9L 1J05B 1RU9L 4OZGE 4Z7VF 1EGJL 1SXSA 3D18A 4GKNB 2HVJB 3DRTA 1CT8A 4NFDA 3OMNB 1TUPA 4JS7A 5JW4Q 3ZKND 4POZD 1MCSA 3V5DA 4QRTB 2KS0A 4OT1H 1IQDB 1S78D 1XGUA 3VYPA 4AMKL 3W82A 4E42B 3FT3A 4GJTB 3J7HA 2CHNA 2JB6B 3BQUA 3DIVA 9PCYA 1JGEA 3B2UD 5HHMB 3RZCA 2VDLL 2R2BA 4XOBA 4Y2DD 4ZG1A 3H7LA 1LEKB 2OK0L 4KRPD 1J48A 2HKAA 2ZE0A 2IOOA 1WJ3A 3PXLA 2G3MA 1GS6X 4N0UA 4WENB 1WZ1L 3IMTA 2M26A 3CH1B 4XP1L 4JO3H 4DFHA 4BXSV 3U7WL 43C9A 2D4DA 4GKNA 4TUOA 2IDCA 5DZJA 3TPUB 5HVHB 4CC0A 3KPLB 5C09A 4QRTA 4FDWA 1TQWA 5K9KB 4P5RA 4E42A 1BQHA 4YHYB 2VLJB 4RIRA 3MCG1 4Q0XH 5JORA 1FDLL 2XA8L 1LEKA 4HCGA 3FN0L 1A7BA 1G0YR 2EDTA 2GT9B 2Y24A 2WN3A 3GMOB 3O6ML 3QDME 1JGVL 4WW1B 2W94A 2FGZA 5TDPB 1WZLA 1H6FA 4E9LA 4KOCA 3CH1A 4FZEH 5MEND 4XXWA 3FTXA 3FL7A 2G60H 3AWFA 3E9TA 4S0SD 1MHPH 4HSAC 5C7XH 1NAKH 2BVQB 2G0KA 2ZWZA 4XPTH 5L9DH 4EIGB 1Z9OA 3TPUA 5E4EB 2EE2A 3LVTA 1WZKA 3RUGE 3D08A 2FWOA 1M9SA 5FPIA 4W9HC 3UAJA 3ZIMA 1ZHLA 2MIZA 3MO1B 1R5WB 3PJNA 1E7VA 1JNLH 1KB9K 2BZDA 4AQEA 4TQIA 5F6HJ 4N5UA 4WW1A 3LQAC 4G8IB 1KXTA 3LPFA 4MRCA 3IFPA 5JIPA 3ZRSA 5FIEA 3IXTB 5HYFA 2XDHA 5B1CA 4OQTA 4ES8A 1NWOA 2W95A 2YD4A 1QTPA 2BVQA 4JG1H 4DKAA 5IB3A 2YZ1A 4LLDB 5E5MB 5E7FA 3QB7C 5E2UL 2Q7YA 5E8NB 5CJQH 1CLVA 3K74B 3GHBH 3L5WA 3EO9L 3MZTA 4XAWL 4OBRA 3MO1A 4PW3A 2DIBA 3CNKA 5CFAA 3UH8A 3CD4A 5KBLA 2C9QA 2VDQH 5ACZA 4G8IA 3WUWB 2P45B 3QYMA 4AYBA 1U8IA 1ZHBB 3T2OA 4UTBL 3REVB 2YPLB 4N0RA 1OF2A 5B1KA 3C60D 4TSCL 1G0DA 3L6FB 4A7VA 3QDAA 2P44B 4YIQB 4KWUA 2WQRA 4LLDA 5E5MA 4ZUWB 3SGKA 1JP5A 1OCWH 2C3XA 2OYKA 2XQBH 1U2CA 3EO1B 2L8AA 1OK8A 4LSQL 2RTTA 1FYHB 3B9EA 5F0LB 3VD3A 4HSCX 1PSKL 3V6OA 1IFGA 2BH0A 3TN0C 3DX3A 1G6RH 4MA1B 3HPJB 1A7PH 3C5SB 2F19H 4XB8A 3REVA 2LFGA 3NAAL 5KSAD 3ECQA 2WWMD 1QVOA 4UTAL 3QQNA 1RZ8B 3OJMB 4Y4KC 4XVSH 4P3DA 1BVLB 4X4ME 1WUNT 1JZHA 4J3TA 3GEFA 4Q6KA 3T2NL 1QBLL 3WJLA 2HKHH 1VA9A 5BV7B 2BDNH 4ZUWA 1NMCC 4N8PA 5DS8B 1MVYA 5DQDH 4Z76B 3WKQA 1KTKE 3EO1A 3TZVA 4P5TC 5AVVB 5IVXB 4DO4A 4G9FB 2KQNA 3B7RL 4XC3L 5FO7B 4MZIA 4EZKA 3V9EA 3BH8B 4AW4A 2BY3A 4XCFL 4TUJB 3EGSB 1HKLL 3HPJA 4NC1E 5DZVA 3P11H 2IDSA 3WN5B 1OGAB 4GRWF 4PRHB 3L3JA 1DBAH 4UBDD 4ONOA 3NJKA 3WTYA 1DL7L 2F9BT 2J8UE 2UV3A 1C5CH 1A14H 3WDIA 4C4UA 4LLWB 1NMAH 4OF3A 1UJ3B 5IHUL 1BAFH 1RKRA 1B9KA 5T3XH 2GJ6D 1YPZF 5AOIA 3ATDA 5DS8A 2FB4H 2J8OA 3ETTA 4FQHB 4DOHE 1S7WB 2K0RA 4LQFL 2WLJA 2HFFB 5EIIG 2VDQB 5CP7B 5FO7A 3JV4B 1SVCP 4WFGD 2VXVL 3VDAA 4IBQA 3ZUCA 1HZHH 3VD9A 1O75A 1OT4A 1X5ZA 1AJ7H 2R0LH 3WEXB 4FHKA 5L4IA 4F15C 2X2IA 2EEBA 5E2JA 4NN7C 4PY7A 3ZTCC 4IK6A 4UT9L 1OM3L 2W9LA 3C08H 3WN5A 1OGAA 4PRHA 2CXGA 3MRBB 2VT0A 4KKLD 3P77A 1GMEA 2VMEA 5EULV 2VJ8A 1K85A 4HFUL 3RI5K 3PQYB 1CGWA 5E9DE 4XP9H 2OAAA 2APVA 1E8WA 2FNBA 4LLWA 3TL5A 4D9QE 1UJ3A 3HMWH 1KPUB 3GKWH 1ZJAA 1BJ1H 1QA9B 4N4YB 4HEME 2CJTA 1RJYB 3GXIA 1P5VB 1S7WA 2TAAA 5BQDA 1J5OH 4MXVF 5DJ8B 5A3IC 1G6RB 1Z6JT 5C0CE 1B3IA 5CP7A 1KCRL 3JV4A 4PH8A 3CXFA 4OCRH 5JO5B 3ERXA 1JXFA 4FKHA 3SKNB 1OOAA 1HOCA 3DYMA 4G8GD 1JNHA 4C56E 4LFHG 5D1XB 1YHPA 3QWRD 4J3OH 4PG9A 4HS3B 3VACA 2G5RA 3QAZB 2DEYX 4XXDA 1TJHL 2ZZUT 3PQYA 3VJ6B 1NCUA 3QHZH 5M94B 1KPUA 4Z7NF 5JR1H 1CGUA 4XI5D 5SX4I 2OZ4H 5HYJD 1CI3M 1S3RA 2HJFB 1AI1H 3LNFA 1P5VA 1HXMA 4ZW3A 4M6NH 4AV5A 3CVCA 3KWWB 1WAAF 3D2UD 1PTZA 4XHJD 3APFA 4WUUE 4BYHA 5JO5A 1WWAX 3QJUB 1TTFA 1M2VA 4DK5A 2IWKA 1AGDB 4XMKL 2XVKA 2ICWJ 4HK3N 3FB5A 5D1XA 3GI8L 4HS3A 3GPEA 2F54D 4FP8L 4U1JB 4F24A 4BE6A 2R4SH 3VJ6A 4Q74A 2K9UA 5SWSE 1TFHA 5LG6A 5TE6H 4PVBA 4LFHD 4WTQA 2XWXA 1E8XA 3O2VL 3W0WA 2NX5B 5F7FA 2C9XA 3MV8E 1H3PL 2UZYB 3PPEA 5DMKA 3V0AC 1J8SA 5FGCE 4IRSB 3ZTJH 2HJFA 2M1KA 3ZQ9A 4OI8A 3O6LH 1SN2A 1KCLA 4Y8AA 3QJOA 4A37A 2EKSB 1KYDA 1SN5A 2B1OA 3KWWA 3QUYB 4KAQH 1ORSA 4A7GF 5GQBA 3SE4A 1AGDA 2IANE 5AL0A 4B7LA 4PGDB 2YD8A 2QL1A 4JQVA 4EN3B 1I7ZB 3LB6D 4JDEB 3TEYA 3ULUF 3QO0B 3LQZB 3UMTA 3HRPA 1XIWC 4Y4FA 3U30C 1IB5A 5LGJB 4WEBH 1DEEB 2I27N 1CL7L 4ZNEE 2JTYA 4E41E 2EIDA 2NX5A 2JI1A 1MDTA 1NGPH 4CC4C 3CXDL 1I7UB 1MAMH 4ZX3A 3L16A 2VLLA 5KVDH 4DP9X 3MRCA 2Z91B 3GRWA 3F7KA 4W6XB 2XQYA 2EKSA 1CFNB 3QUYA 3MQIA 3UTSE 1THCA 1CD8A 3PFQA 4LL4A 3G5VB 4JM2D 1CO1A 1T83C 3CLEL 4WY7L 3FUMA 4G6AC 5D2LF 2FO4B 4PGDA 1NBCA 3FU3A 4JDEA 3QO0A 3N85L 4HDIB 4J8RA 3SPCA 4PJHB 4PTUB 2HFGH 4JX0A 3ZHDA 3L9RB 2A9BA 1PZSA 4I0PC 4HPHA 4G6ML 2WUCH 4XPBL 1EAQA 1XD1A 3W39B 4OSUH 5GRXG 4HG4K 4H7VA 4YHMH 4Z3JA 4JN1L 1UT1A 2GG1A 2ZX8A 5IJVB 2AJ3A 2V5YA 4QHMB 3SDDD 4B7IA 1CFNA 1IARB 3HG1E 4ODTL 4QYAA 4GFXA 2Z93B 4JPWH 2WWKO 3ATBA 3G5VA 2WYIA 3BE1H 4YEEA 5KW9H 3TJPA 5K1JA 1R0AH 1HH6A 2FO4A 2ZXEB 2OCFD 1NBZB 4LEXL 5GS0H 5K69A 1E27A 4WHYG 4HDIA 4HWNA 2AMUA 4OF8A 3V0HA 4PJHA 4PTUA 2WLLB 4PY8I 3L9RA 1BEYL 2LU3A 4NQDB 4YDNA 3LXCA 1TIUA 3GZKA 5F8QC 1AD9B 4OGZA 1GCFA 4HS6B 3NPZB 1GW0A 2OULB 2HTLD 2HP4A 1L9TA 4NM4H 3T2QA 4OZIE 2I60H 2IQAA 1QLEH 4OGYL 4J3SA 1Q1JL 2Z93A 2H47C 4N6QA 1JFQH 4FTDA 3AUWB 5KBNC 3AQYA 2GTWB 2Y3AA 1BQHG 1NBYB 2OMZB 4XXCC 3F83A 3QCVL 1NSNH 2FNWA 4AQ8C 2V17L 3PE9A 2EILB 2WLLA 5DVMA 4NQDA 5AG9A 3DJTA 2GK0B 3IGKA 2MPAL 5BVPH 4QGYA 1TKWB 3NK4A 2A4CA 4BXVA 5H37G 3B6SB 1T5WB 1ET8A 3U79A 4QWWC 3RWJA 2ZSVB 4WV1B 5F7EL 3GMNB 4ZUUB 5IOPB 3PY9A 1RPQA 1HOEA 4PR5B 1JPSL 3QIUB 1N7MH 5IB4A 3C9NA 4KRMB 2OI9C 4DTGL 2O5XH 2YD3A 2JCCB 1PG7L 2DW5A 1TR7A 4LDEB 4F37F 3D85B 4ANKA 3DX1A 2B0SH 2E27H 2BWIA 3TBYB 1NCWL 3VQ1C 5KAQF 2V8MA 2VDML 3CC1A 1S7RB 3B6SA 2NY7L 1MY5A 4PRBB 1EWHA 4X5LA 1ASOA 4WV1A 3P3YA 4M7KL 3GMNA 2FK9A 4ZUUA 4L8SC 5IOPA 4PR5A 5E2VL 4RFNB 2ZUXA 5KBPA 3DYPA 3ZLQC 2G5UA 3MA7A 2CO6B 4Z7OF 3TONA 2JCCA 3NTCH 4LHUB 2HWZH 4H8WL 5JMOC 4JNXA 3S97C 2CLVB 1UZ8A 2GITB 5FF6B 4DP6X 3TBYA 4HUWB 4X50A 4FFZH 3D8MA 3E1ZA 2CK0L 1RURH 2WZAA 3GT6A 5DJYA 2YGOA 1U8PA 3BAJA 3RL2A 1F4YL 4NNXA 2VZOA 3SD2A 4H2AA 1QLEB 2Z8SA 1RZJC 4B9JA 1S7RA 2H32H 3HS9A 2HB0A 4PRIB 2F1BA 4PRBA 1MFEH 5CZVL 1X9LA 3AY2A 4I4WB 2OMUB 1NLBH 4X0KA 3CPLA 1OZUA 2YXWA 4WO0A 2A6IB 1SOSA 1KEMH 4LHUA 4QF1B 5JIQA 1D7BA 1FFPA 1N18A 5BJTB 3L4UA 4MJIB 2QFPA 4Q89A 2CLVA 3P73B 3V8OA 1P7BA 1RIHH 4G7RB 4P46B 5AW9B 4HUWA 4FD0A 3CN4A 3VU2A 1FF5A 1CLZH 1DVFB 4WUKH 3QDGE 3RWHA 5EU7E 1AZVA 7FABL 4BK4A 4HXBH 4RWYL 1A6ZB 4QLRA 4BH7B 1NAML 4Z7IA 1GOFA 1YPZA 2UY6A 2L04A 1SLVA 3WFCH 1MRFL 2OMUA 4BUGA 1U30A 2A9DA 3CHXA 4ENEC 3MBWB 2BIHA 2NZIA 4ZTPH 5L7XH 2AXHA 4ODXB 5HYQA 4LPVA 3FQWA 1LO5B 4MJIA 5TD4A 1IO4C 2YPVH 1QX1A 3IBEA 4OLYL 5K9OB 4P46A 4H8HA 5BVJA 5F9DC 5KJ4A 5LAXB 4M5SA 4ZSOB 1TTCA 2IQ9H 2RCSH 2AKRA 2RIKA 4HWZB 4KXZH 2E7BA 4YHOL 5I6OA 1U8NB 1EGJH 3D0LB 2DQUL 4XE0A 3OWRA 5C0BA 4NCC1 2XV3A 1A6ZA 2A0LD 1BZEA 5FO8B 4MKTA 4AMKH 3B56A 4Z18A 1HT6A 3IDNA 4GINA 3H9SB 3MBWA 4AH2B 1RCYA 3VQLA 5I0WA 4A7TA 4P9HC 4QAWA 2GBUA 5K9QG 2VDLH 3FUIA 2H0FA 1XWVA 3GMMB 3HI5H 4NI6A 1CLOL 2VR9A 4QOKA 3O4LD 3W9EB 2ZUQB 5CN2A 4X9FA 1DANT 4C58B 4L3EB 2H32B 4GMTL 4X6CB 5LAXA 3JT2A 1D5RA 3FO2B 4XP1H 1NUFA 4ZSOA 3RIFK 3M8OL 4F20A 1U8NA 3U7WH 3D0LA 1FL6B 4LSRH 3WIFB 4WI9A 4F92B 2O5YL 2IWEA 2Y7MA 5FO8A 3OVUB 3TT3H 5I76B 2AEQH 2J20A 4TNVF 3CZEA 3K71A 5DZOA 3H9SA 1FNSL 5E1HB 1WAAA 4IRJD 4RETB 3ECUA 3F3HA 4XNQB 2AJVH 3GMMA 3L1EA 1ID5I 2ROYA 4NQEA 1KN2L 4LGRB 3PREA 1NDMA 4P2OD 2MHAB 3FDWA 2OW7A 1AY1L 3BQVA 2AERT 4GRLD 5G4OA 4GO6B 1VENA 3HAEG 1A66A 3FO2A 1YEDB 5I15H 3Q5YA 4WI2A 4KK9D 4HIPA 1FL6A 1TQBC 4MBOA 2UX6A 4YDVA 4MWFB 5DK0B 3O9WC 3NCJH 4HF5H 4PFEA 4WO4C 5I76A 2D7QA 1XF5B 4UCFA 4AYFB 1E5YA 2IPUK 1P6WA 1ONQA 1KGCE 2AFNA 3B2MA 2C4XA 3AAZB 4NUPA 3C87A 3HBGA 4B50A 3CN3A 3U2JA 2EQDA 1R24A 1ZEAH 5C07B 1TLMA 2YAEA 3ILQD 3R18A 1W6LA 3G6JE 4PJ8B 5F44A 4KK8D 4ZOBA 4RDBA 4JK0D 1QUNB 8CGTA 1KV7A 2X4UB 5DD5L 3HFMH 3NUKA 4JL2A 1H5BB 3U9PH 3DUHA 4HJ0C 3S5ZA 5DK0A 2VDLB 1BW8A 5C0EB 1ZAGA 4GLRH 4PJ5D 2YPVA 1OZTG 2DD8H 3EW3B 3IK2A 3ZMEA 1T22B 2NXYB 3EO9H 2J3SA 3AAZA 3KR3H 4AGQA 1LP9F 2UZIL 1Z0MA 4OW6A 1HQRA 5C07A 1SEQH 3M7FB 1EGJA 2K1MA 4TSAH 1CICB 2DQMA 4P2AA 5F1KC 1PY4A 4Z3TA 3KHQA 4UTBH 4X7SL 4DPRA 1KTBA 1QRND 4MCZB 4K8RD 2FEJA 4TSCH 4TQ8A 5KYUB 1CGSL 3RP1A 3V9FA 1N6QH 4AQ1B 3DRQB 3LTVA 4MJ6B 3QEQB 4NC1C 2BP3A 2J6EH 1ZHKB 5C0EA 3WTSA 1MREH 1WRFA 3JWDC 4F2FA 2B3RA 3NVQA 4XMTA 4LSQH 1N8OE 2GJPA 2YFNA 4LB8A 3V52L 5C0GA 2E46A 2Q3AA 4AQAB 4B6ZA 4EI5D 4NQCD 1WA2X 5DZNA 3RWIB 3SQRA 4TTDD 3ENEA 1JZIA 4UDTA 4QYOB 5I8OL 2XQYG 5FYLE 3L3KB 4YFLF 15C8H 1PIGA 1ZT1A 1FZMB 4KNUA 3REWA 4X9BA 2N01B 4MCZA 3DDGA 3SE9L 2WXLA 2IPTL 4S0HA 5HVWA 5T1MB 2B9BA 3DXAD 1TYEB 4K2UH 3PAVA 4JY4B 4AQ1A 1QBLH 5EBWA 2EUWA 3DRQA 4MJ6A 2DWDA 1D5XB 4FKEA 4RGOH 4YWGL 5GGRB 5HGBB 3RY6C 2ZPKL 1H0DA 4IKIA 4NN6C 5CBEB 1UACL 4N8VG 1JZ4A 1I1AD 2VLMD 1TNMA 4XWGL 4AQAA 2Z4QB 4DGYL 1I3GL 4AIXA 1MAKA 1F6FB 1GGTA 3BZFB 1INDL 4F7TA 2OP4L 2JKNA 3L3KA 3PAZA 3THML 3L1FA 1DZ0A 5LBSH 3SSGA 4JCLA 2VL4A 2HAZA 4Y7MA 3C6SA 3S0PA 5J11C 1HYSD 5TE7L 1XDTT 4WVRA 3WHE1 2WUBH 2X3AA 4JY4A 5AUMB 4F2MA 4WKZA 4XBGB 3DJ9A 2VTFA 5B4MD 4GQQA 4NHUA 4DEPB 5HGBA 4Q9RL 3K80A 1H3WM 4QKXB 1BJMA 4LQFH 3BPLB 1TO4A 1CB4A 4ZMTA 4JRXD 1J0IA 2DYPA 4DGVL 1ZTXL 2APWA 3A67L 5F9AC 3OXRB 4Z5RA 3S98A 2AEPH 1K3IA 2Y06L 4KHXH 3QUXB 3HOGA 1RK0A 4X6DB 2IH3B 5E1GA 4CGTA 4NP4L 3WJJC 4HFUH 2EINB 2NTFA 1IQWH 5AUMA 4WIQA 1MCQA 2H4EA 5D96C 4XBGA 4B9FA 1Y0LB 5ICYB 2J2ZA 3C2SA 5IV2B 3ZDXB 1MFNA 4HHAB 1HNFA 5EU6D 4Y2DB 4CADB 1QSFE 4M3KB 4UTBA 3OXRA 4KRPB 2DQJL 3HZKA 2XWBB 2CIKB 1T4KB 5EZOH 4HLZG 3UBXB 1I8AA 2IH3A 4F58L 3GIVB 1MXDA 1VLXA 4WFED 4FERA 1J9TA 5DMGD 1AAJA 1LNUB 2J43A 1LO2L 4J2XA 4QRQA 4HUMB 2VXSH 2E8YA 1KTLA 5D7JB 4F8NA 3D50A 5ICXB 4UZSA 4L1TA 5ICYA 5SWQB 5IV2A 3RGVC 3L3IA 2W9DL 3PGCB 4Y1SA 3GMQA 4MAZA 4IIQA 2ZKHL 4XMWA 4UTAA 3UC2A 1HC1A 3JT0A 4HMEA 3VTMA 4FP8H 1W72H 4DK6A 4P5SA 2NW3B 3D6GA 3BPNB 5IR1A 2FHCA 2B1HL 1I8LA 3DX4A 1KCUL 1OAKL 3O2VH 3WXWH 3BRFA 2ESVE 5D7JA 1E2ZA 2BOLA 1H3PH 2BM3A 4G7QB 2XBDA 3JVGC 3VFRA 3I02B 1G9HA 4GAJL 1T80A 2DWTA 4DKEH 3SQBB 3PGCA 4LMQE 4XX1G 3S7GA 3I6LD 1H15A 3NH7L 3QHFL 3UG5A 4KTDH 5F89A 1UYWL 2APFA 2C3WA 1DBJL 1EXGA 4JFFE 1OQXA 3ETSA 2A4ZA 4PBVC 5F21B 1MQKH 4KUZL 2VAAA 2W0FB 3OQ3B 4MHHI 4G70B 1KPVA 4LHUG 3HNSL 1G9NC 3K6NA 1ILUA 1CL7H 1DFXA 2EDLA 5LXGL 1XGPB 2NYKA 3EHBD 3L4TA 3OKYA 2VH5H 1M71A 2ITEA 3FFDA 3U2IA 2BK8A 3GS0A 4UT6L 1NC4D 4A7QA 3FT9A 4ZPVA 1F18A 3LXBA 1U91A 3P69A 4UT9A 3QJTB 4I18C 3NRFA 5K9JH 5CILL 1ADWA 4HYTB 5FCUL 2NNAB 5ANME 1SPDA 3RWEA 3NZ8B 3SZ6A 1NGXB 4YX2L 1BQUA 3T4AA 4MNQB 3EUUA 5EU4B 2DBLL 4ONGL 1UA7A 3N85H 2DDQH 1K2DA 1IZKA 2DMCA 4XBEL 4ABUA 5DSCB 3C60B 3CCHA 1XGPA 3EYSL 4OLZL 5DTFB 1H6UA 2IF7A 2YMXH 4HS8H 4RMWA 3HZYB 1BF5A 3QJFA 1VKXB 2F1EA 2AXGA 2JJSA 3MLWL 3BKJH 3AG2B 4Z6AT 1I3RB 1EEYA 1QR4A 4OCLC 1GTNA 4GI8A 3MLYL 1W72B 2OPCA 4XNUH 2EXYC 3DK0A 3NZ8A 4N25A 4PJIE 5JHDE 1AKPA 1B0RA 4LIQL 4LOUC 3VWJB 1HHGB 4MNQA 1NQBA 1ERNA 1EZSA 2AQ3A 2XTJD 5I0XA 4NAQA 3FTUA 2XX0A 4FQJH 4N2LA 5DTFA 5BZDB 1NIFA 2WSKA 3WO4C 4JJ5A 5F93C 1H9VA 2WV3A 5IBLD 4BUQA 1I3RA 1I3UA 4MJJA 5GRWA 1NH6A 1EQWA 2QPUA 1JGLH 5HGAB 3V10A 1EDQA 4YQXL 3OJDB 4OB5L 3PFUA 2QPEB 3SOBH 2AZUA 5J13C 3US1A 5IZ7A 3TPKA 1Q9WB 2MNJB 3VWJA 3VXRD 5GGUB 4N2AA 4E5XG 4PB9H 3AREC 4MA3A 5TPWL 2V17H 1MCRA 5ENWA 4ZS6D 1DVXA 5BZDA 3I74A 1YNTB 1EAOA 2IH9A 2ZP9A 2ZSWA 1PL3A 5JUEL 5C0NC 5AOJA 1OPGH 5ICZB 4HOZA 2ARJB 2A5UA 1DFBL 1JVKA 4O2FA 4KROC 3NESA 4NX0A 5F7EH 3IDXL 1NDTA 3U4BL 5I8KH 4MMZA 5AW1B 4Z77B 1JPSH 2ICES 2CHWA 3IPEA 5HGAA 1GYVA 3MRQB 1PG7H 1GZHC 4PI0A 4PGEA 3H3PH 4X5WB 1JPTH 3FTWA 5H4ZA 5CUSL 4NNPH 3EYOA 3QXDB 2RQ8A 3DMMC 1XMWA 4ABQA 4MB5A 1TZ8A 4AQOA 1CLYH 2JI3A 5I5IA 2Y7QB 2CO4A 1YNTA 3I85A 3TEUA 1E7UA 2ARJA 1KMGA 2OMWA 1T20B 2BIOA 4M9OA 3HI1B 4M7KH 1QZNA 3RWDA 2VW4A 4OCXL 4NWUL 2EVGA 5FO9B 1HXYB 5EU7C 3MRQA 3E8UL 2XY2A 1MFBH 4EOWL 1FI8C 1Y6MR 1XX9C 4G8GB 4BQ8A 4X5WA 3QO1A 3BRDA 1RLWA 3WEMA 3ZKSD 3VXSD 2HJKB 1CFTB 3DTUB 4UINL 3L3GB 1JXKA 4Z7UF 5F7DB 2I9TA 4B5ZA 1G94A 2WD0A 5FKAA 1ZGLA 3CVIH 1OE3A 4JFZL 5I1CH 1D5ZB 3WENA 4Y16C 2ENJA 5HYJB 2BY1A 5CEZE 2L4OA 5CZVH 1IGIH 1T20A 4AYMC 2RBLA 1NIEA 5I1EL 5I8CB 2Z35B 3HI1A 3V6ZB 1KLUB 4Y88A 3FT1A 1CTOA 2FX9H 1UD2A 2V3DA 2YK1H 1ZXKA 3ARDD 3LY6A 4MQTB 4QCIA 5BS0E 2BHYA 1NJ9B 4IBVA 4YSRA 2IV8A 3MUJA 3HE6D 4X7FC 2PETA 4I1RA 3FQXB 1DE4B 1KC5L 2HJKA 1CFTA 5EO1B 5JYLA 3OJ2C 3QEHB 4KKCD 4KDTA 4PB0H 4R0LC 5A16B 4M43H 3KLLA 4DKFL 2WOYA 4D8PA 5I1KL 4P2RE 1A22B 1D5ZA 4PN6A 2X41A 2GI7A 2HT4D 2MQ0A 3UCQA 3ZUNC 4RWYH 4F1SA 4ATTA 1LK2B 2WANA 2Z35A 2DRUA 4XCCH 4ANUA 2ZOKB 3P1VA 1DN2A 1MRFH 1VDGA 5CZXC 1FA4A 1YNLH 4MZ2A 3RTLA 3ZDZB 3H2PA 1NCBH 3KH3A 5C6TH 1ZY9A 3QFJA 2YZ8A 1I8KB 2ADFH 3BPOB 3H2WA 1ZVNA 5EO1A 2XG4A 2O1AA 3TT1L 2DICA 4U6HB 3D25B 3S88L 1IUZA 4X8GA 4UAOC 2X6VA 3VXUE 1UOKA 2R23B 2WKGA 1ZVHA 1E30A 2DQUH 1ZDSA 1U8LA 4QUOA 3V0VB 5LGHL 3UTTA 4LF3B 3L2MA 4M1CD 2ZOOA 4UDUA 3GTTA 3OLDA 1RJZA 3GK8L 5FA4A 1XBRA 1AO7A 3KLHC 4JQXA 1YYML 1FLTX 1TPXB 1S3KH 3PNRB 1CG9B 2EIZB 2X4RB 3FFCA 4JM2B 3DX9A 4M6OH 3CFDB 1G7PB 2X1XR 1ANUA 3TBSA 3A6OA 3ABGA 1ZS8B 4X80L 1I8KA 1KYUA 1NKOA 3BWAA 2PYEE 1MCOH 4PJCF 4LCYB 2BOBB 3D25A 5CJXA 4FG6C 4HWEH 5AVRB 3RPIB 4Q56A 4AYGA 1EHNA 1DQVA 5DC2A 3L54A 4HUKB 4NS0A 1QFWM 1DUZB 2IWGA 1XGTB 2O5YH 3V0VA 4TNVK 2EYSA 1BOGA 2MH4A 3J8F7 2YBGA 5KAQG 5I6XB 2Z8RA 3V0IA 5ID1B 5JDSB 3SY6A 4G3YH 3SDDB 1OE2A 2BSRB 1FNSH 4C47A 4NLHA 3GLDA 3BVXA 2EIZA 3W5NA 4GXUN 3QZWB 4LOVA 4OIAA 3CFDA 1G7PA 4JPKL 1S7TA 1KN2H 1J9RA 1PY0A 4Z7WE 2ADYA 2BWQA 4C54A 2EUZA 2WXIA 5EF0A 3H1ZA 2UXFA 1AMXA 4LCYA 2OJZH 5F9WC 3O6FD 2DQHL 4BZ1H 1DSFL 2XZZA 3ABKB 4ES9A 1BZQK 3ZE0E 5I19H 4UAHA 2LVEA 2X9YA 5IJDC 1DUZA 3KPRB 3LKSB 4NHCH 4N2KA 2I07B 2G75A 4AMWA 5ID1A 5CD5D 3IMWA 1W9XA 2BSRA 1P9MC 1AQ8A 4XO3A 4Z95H 2C8NA 1DQLL 4MB4A 1PKQE 1T0NA 5KOVC 5D1ZB 1QLFB 2EABA 4FJZA 5I17B 3KNBA 1TZGH 2WCGA 1PZCA 4XNXL 4RMTA 1E2VA 3RA7L 1GYCA 3QQ9D 4YNYB 5FR3A 4L2YA 2X9XA 1NAMA 2IGFL 2NMSA 3TJHD 1J8HE 4L8CB 3MACL 4JHWH 1AVAA 3K2IA 1KZYA 2KI6A 1RUQL 2WO2B 1I9RL 3KPRA 4OFIA 4RWHA 3MGOA 4O5LL 3UTZB 5HI5C 1OPOA 1D7CA 1JERA 3IFNH 2ZUWA 1DQQB 1MG2C 4CNIB 3PAUA 1NPNA 5D1ZA 5I17A 3G5WA 1YEGL 2UZIH 4IHOA 3QDJE 3KDMB 1MI5D 3GM0A 4UOZA 1IGYB 5KJRH 5FOBA 3GNML 2QQNH 1N19A 2CKBH 2KBGA 3UPRA 3UTPE 4G1MB 3INUH 4FF9A 5AG8A 5KUKA 2OXHB 5ESAB 5E94A 1OAXH 4QNPE 4A6YL 1IEHA 4KUCD 3UTZA 3QW9A 3EYVB 3Q5OA 3WV0A 1DQQA 1JZ7A 4FYQA 3JZ7A 1D6VH 3HE7D 4NZJA 5DRNB 1T6WA 3KDMA 2P42B 2C9RA 3QUZC 5I8OH 4DP1X 4YE4H 5FM4A 1IGYA 5D7KD 3ARWA 3RPBA 4IOSA 3MKGA 5IMLA 2FD6L 3TWCH 3SE9H 2OXHA 4FFWD 5ESAA 3ZIYA 2IPTH 1IC5L 1V3LA 2HTKC 1KBBA 4UUJB 5LDUA 2AV1B 4O2CA 3CXHK 4FA6A 1D2PA 2AEOA 2HLAB 4JG5A 2WQSA 2E7DA 5BQ7A 3C5ZD 4B9YA 1AS8A 5D1QE 4N85A 3EYVA 4PJEE 3DGDA 2DMKA 5BO1L 3G6AA 3AGWA 3MLRH 3N6YA 4ZUTB 1UACH 3D07A 1RK1A 3M07A 1FV1B 1ZIBA 4NERA 5I1AB 3U0WL 4Z0BH 1IEAA 1NZRA 5I1DB 4K7FB 3HLAA 4GBXB 2XN1A 2Y7OA 5I16A 4O02L 1MFCL 1P4IL 3HKZA 4PJXE 3MJGX 4FQCL 4K55A 4J1UA 4FXGB 3QNZB 3GBLA 3EH4B 1X5XA 3UX9B 4CJ1A 3F6LA 4UUJA 3B83A 2HH0H 1T7VA 2HLAA 1IEBA 1G43A 2FJGA 4TOYH 5HHOB 4BRJA 1WQVT 2YD6A 4ZUTA 3TCTA 4DGVH 1F6LL 1MAJA 3A67H 4NJAL 2CKBB 2H0EA 3Q1EA 2LVCA 5I1DA 1CK0L 4K7FA 3BX7C 3OG4B 4GBXA 5FGSA 1BQ5A 3R7RA 1WBZA 1N9PA 3KWTA 3QJQB 4NSKB 2ERJB 3RVVD 3E1F1 3FTVA 3QNZA 5TK2A 3QXTA 4JZNA 1KFAL 4GEIA 4OD1L 1KCVL 3ZDYF 1BV8A 2P48B 4ZMPA 5HHOA 2B1AL 5DLML 3ZT7A 4AI7A 3IGUA 4X7TB 1W2KT 5ES4B 3DVFA 3IU3B 1IBFA 4TLKA 4ELKB 5FDWA 2Q8AL 5BRZE 3SPHA 1KGIA 3D3VA 1M7UA 2X4NA 2VLKD 4J12A 4B3EA 2YJLA 5KVFE 2WK2A 1JV2B 3ZYIA 4NSKA 4K94L 4WWKA 5FECB 2G5BA 4Z7UA 3GJEB 4HIXL 1YCSA 1QSEE 4G8AC 3IJ7A 4G42A 4BA8A 1LO2H 4ZT1A 2GTQA 5AQ0A 1HNYA 5I6NA 5F7MC 3QXWA 4DIXA 1T83A 2O30A 3QPQD 2FUTA 4LLVA 4N0YL 1KB3A 4JFQB 4RMVA 3VD1A 1YNKH 1LO0H 1P4LA 2FYYA 5DJDA 2FO1A 1T7YA 1IJ9A 5DFWH 4PHZA 1PVHA 1OCCB 3CH8A 3WU1A 1T2XA 4N26A 1BVZA 4TSBH 2WBJD 3IYLW 4AYSA 3KHOA 4FA7B 5FECA 1V7NL 4P57B 4Y5YB 4OD2B 1E3XA 5FV1L 4QAMB 4AK2A 2B1HH 5T33L 2E7LA 5SV3A 5AB0A 3FZUD 3QP3A 3MV7D 3NCXA 1S7QB 4RGNE 2YSSB 4QXGL 2QADD 5DURD 4ZAKB 1G7LA 4U1LA 4OU3A 4A7UA 3IPFA 1LDPH 3AADB 5LXVA 1RMFL 3Q7JA 4LP5A 4U3XA 2WQWA 4PJ7E 2YA2A 1GHFL 5IHHA 1MWAL 1KF9B 1UB5A 3AT0A 1NCHA 4QPEA 1KJVB 3VG0H 5GGQH 2HSIA 1RVFL 3TC9A 1KIUA 2X89A 4KKRA 2NQDA 3VFNB 5HDBE 4P57A 1WC7B 4Y5YA 3HNSH 1G7HB 4OD2A 5DO8A 2VITB 4TL4A 5DHYB 4A2MA 1XGYL 5GZNC 5HYSG 3OWEA 6PAZA 1QKZL 1S7QA 1YEIL 1JHKL 1LK3H 2YSSA 3HNVL 5LN8A 4ZAKA 2C1PB 5DMYA 1YUHB 4O58L 5D7IF 4PJ5B 3IF1B 2Q76B 4N2OA 3RKDC 4JFDD 2R0KH 3BJLA 4H88L 4O4YH 3WKMH 5HGGS 2JF1A 4OM1L 1EVTC 2FWLB 1A7RH 4B5EA 1W8NA 3DHPA 3G5XB 3GI9H 3OG6B 2YD5A 2H3KA 1JHLL 4I48B 4OFVA 2UVEA 2VR4A 2UWEB 3VFNA 5GRYA 1WC7A 4XBEH 4OGQC 3QJHB 1HL9A 5B7FA 1A6UL 3PWNB 3SJVA 4NENB 1T3FB 5D72L 3EYSH 1OLLA 2IAMC 3MAWA 2E8ZA 1JD9A 5LCVL 4KKZA 1MLBA 1OWWA 4OD3H 3NDYE 4OGAC 5HGHB 1J0KA 2VZSA 2C1PA 4A2GA 3QR1A 5FYKE 3ESPA 3IF1A 3N43F 4IEFB 3EDDA 1UA6H 3F5WA 3QDHA 4G6KL 3UJTL 3MLYH 2FR4B 3QH3B 4NQCB 5F7BA 4B9KC 3G5XA 3UGXA 4I48A 1L5GB 3KBFA 1VFAA 1BDYA 4LIQH 5HPOA 1HX0A 4G6FD 1OD7A 4XP5L 5KWYC 3JV6A 2UWEA 1ROWA 3GBEA 1ZTMA 3QJHA 1MFAH 2Y07L 4NENA 1AE6H 2R7EA 1A0QH 4PWIA 5AYQA 1YEJL 1EEZB 4HAGA 1L0XA 4JGUA 5HGHA 1CU4L 4JGMA 3SDCA 3CFCH 1TCRA 3OSVA 1OGTA 3OHXC 4OTXL 1S9VB 3Q2CA 4MSWB 5LAPA 1I1AB 4J39A 1JN6B 1T1XB 1P5UB 4FE9A 2FR4A 5IHLB 4CU8A 1L5GA 1VB9A 4JM4H 3WFBL 4HGKC 5C3LD 1MUJA 3TLRA 1NLDL 2CR0A 4HFWB 5DS1A 3SE3C 2V5TA 4ZO9A 2YD9A 2NY0B 4OIIL 3HHMA 5G5DA 1SY6H 4BFGA 2X6BA 2D31B 1QZ1A 3FCSA 1AC6A 4U4IA 5DD3H 1EEZA 5DRXB 1MNUL 2W60B 4IOFC 3NABL 2Q1EA 3SDYL 3SGJC 1RFDL 2CO7B 4P4KA 1A02N 2H0JA 2E7CA 2PPFA 1IZJA 1S9VA 4JRXB 4MSWA 5JTWA 3GIZH 4ATWA 5JW5B 1FC2D 5I6PA 5IMKB 3BWZA 4GUCA 1OOWA 3WIAA 5CCHE 1FAIL 1UD3A 4NLAA 1SBBA 3IWVA 4Y19E 4YDKL 5CUSH 3EJRA 4R3SB 2MNUA 4W6YB 2GTZB 5HHPA 3LHAA 1EBPA 3P0VL 2J7LA 4UT6A 4ZS7H 3ZTDC 3QI9B 1AXTH 4M5YH 3T0WA 2D31A 1KULA 4L5FL 1YY9D 1IGJB 1ET5A 1QPKA 5E9NA 1GJUA 2EVHA 4LVNC 4P05A 5DRXA 2W60A 3CZKA 5F70A 3QJXA 1SBSL 5B39B 2J5LC 3PWPE 4FADA 4QRPE 3ULVL 2D3JA 4YE0A 3SKUD 4K07A 5CEXA 4LAJH 1KGXA 1AG0A 4WU5B 2K3TA 3FF7A 2XLLA 2R9HC 3N40P 3U1SL 3CN1A 5EU6B 5EOCL 4JW3A 5F88B 2Y1VA 3CC5A 5IMKA 4G7VH 4EOWH 3S37X 5HJBA 4JKPH 5LQBL 5EF3A 5C2BH 3PWJB 4PGCB 1IX2A 4F91B 1UXWB 1T1ZB 3WXVL 2A3TA 2NDGA 1V3MA 1NGZB 1YA5A 3HNTL 3TN0D 3QI9A 1F58L 4TF4A 4M4PA 4HW6A 1IGJA 5DO2C 1BFVH 1UA3A 5IIEB 1AD0B 4P48A 4Y4KD 1KENL 3LZOA 4N1HB 4N0UE 3IETA 3NIFB 1J8KA 2VE6B 3K8MA 1RUKL 4WU5A 3CV5A 4OZIF 4XNAA 5I30H 5ABAA 1MPAL 5F88A 3TEXA 1RP8A 4UIKL 4P5TD 2E86A 2F8VA 3O8XB 4G43B 5EHFA 4BHUA 3OXSB 3OX8B 2DQGL 5EBGA 5L0QB 2ITCB 3GTVA 5EORH 4MVBC 4OJDH 5C09E 5I73B 1UXWA 3F6IA 1U3JA 4MDJB 5DHMC 2NY6B 1V8HA 2FQDA 3VW3L 5DJXA 5HHME 5IF0A 5GGTL 4CBZA 1JZEA 3ATFA 4DKTA 1OAYH 3DUUB 5F6HI 3ZDYB 1AD0A 1I7RB 5JIIA 4WJKB 3NCFB 2IG2H 4W9DC 1A4JB 5DZ9A 4BQ6A 3QQDB 1I9IH 3MUGA 2KUTA 2J56A 1F8TL 3PL6C 5CSGA 3O8XA 2YFOA 4FABH 4PLOB 4AKQA 3OX8A 4N3UA 2ITCA 1MCFA 3FPYA 4XMZA 5A2JH 1DBBL 1FO0H 2LAAA 3RX7A 1U3HA 2DQEH 4WGWB 4MDJA 1N5YL 3K4AA 1J87A 4ZX4A 4R90L 3LN9A 1UM5L 3WNPA 3FSVA 1SF5A 4HBQA 4YJZL 3JWOC 1FZOA 3DUUA 5I9QC 4NUJA 5LGHH 4FFTA 4JE0A 2EDXA 2UUDK 1NC4B 5D4QA 3E6FA 4YGVA 2X1OA 4XN2A 2E75C 4HJEA 2WNXA 4AK1A 3KJ4B 2DL9A 1A4JA 3TBVA 3F6JA 1SXZA 1Z9NA 3QQDA 2W0PA 4P23B 4Y5VC 1Q72L 2ZYRA 4OJFL 2XBZA 3QSKB 5A3ID 3GEWB 3P4MB 4U0RB 1QR1A 5IW1B 5IESL 3CFTA 5EWIL 2WTOA 2X10A 3CVDA 3KW7A 4XMXA 4XZUA 2MOVA 1YEWA 1CVRA 4AY0A 4P0DA 1EVUA 1YYLL 5AZUA 1MFDH 2VO8A 4Y4HA 3T0VA 4M7JH 4MNGB 1JZDC 2APXA 1E9QA 2DMGA 4XMLH 2WMPA 4ALAC 4BE5A 2KC0A 1AHKA 4EDXB 4I88A 4QTFA 4P23A 4FQQA 4ZFGL 4JPKH 3P4MA 2D2CC 3PYCA 3FSAA 4F8TA 5IW1A 4FOMA 4POUB 1GOHA 1S7VB 1IC7L 2H3XC 2PLTA 2VJXA 1VEPA 5DJCA 2JJTC 2P47B 4FXKC 5F3FA 4Y5XC 5TDOB 2YEZA 2W65A 5DMJB 1RZFL 5CGMA 3V6OE 1VCBC 2W8CA 3EUDA 1Z9LA 4MNGA 1MHEA 1ROCA 5K33A 4F3FA 5JXEA 1F6AA 5D7IB 3DC0A 3QNXA 2YR3A 3HR5A 2E6JA 3PUUA 2HVKA 2V3FA 4EDXA 3TH3T 1FO0B 5LNGA 4QJ3B 3BFWA 4ZW6A 5IFAH 1U93B 2DM7A 2QPSA 2V7NB 1TJGL 4L8BA 4G2AA 1XH3B 3VXRB 3QFGA 3EFDL 3DX0A 1S7VA 2D4FA 4YMPA 3HCVA 4B0MM 3Q8AA 2IGFH 3WY4A 2I9LB 4GP5B 1GAFL 2AW2A 3K2KA 5TDOA 1E43A 5K1NA 3M88A 1ET7A 1ZA3A 6FABH 1XIWD 4GQPH 5ALBL 2H3NA 4OLVL 1JZ5A 1GC1C 4PS3A 4ISVB 1K4CA 5D7IA 4AVIA 4M9PA 3RDTC 4OCYL 2ED9A 4HLEA 1PZ3A 1NM9A 5AOKA 3OC8A 4BCYA 4CAGA 2V7NA 1YEGH 2AK4D 2WTPA 1RI8A 4UNUA 5CGYC 3WY2A 1OEZW 5D1QC 3BUPA 4U1SB 3TYFB 2GVYA 3GNMH 4G6AD 5IVXE 3PWVA 4G9FE 4M7ZC 5AAPA 4JFYB 1JXJA 3RVUC 2FGWH 4OZFA 3PV6B 1Q0XL 4WI8A 3S36X 4RZKA 4A6YH 4HU8A 3NZUA 3CN0A 2VCOA 3ZL4L 1OGAE 4PRHE 4ISVA 4I0PD 3EJZC 5JHAA 5AOLA 1OIOA 3G6DL 4MS6A 4AXWB 2CDFB 4Q9BA 2W07B 2BC4B 1CE6B 1NMBH 5IMMA 1XGZA 3MLXH 3CBJB 3V6BR 2W5PA 5I0DA 2RJMA 3MLZH 4OZ4A 4P4RA 1DLHB 5EO9A 1ILSA 4U1SA 1ZPLA 3RKPA 3UAEA 4S10A 1UZGA 3IFLH 1CGYA 4QJ4B 2FD6H 5DK3A 4JFYA 4MYPA 3QXVA 1IC5H 2ADGA 1KSRA 4IU3A 1BA9A 5C71A 3MV8A 4PJDF 2ICWI 3VVVA 3GUTA 1M1XA 4XTRC 2GBTA 3CQFA 5KN5B 1IC4L 1NEZB 5D71H 4WFHD 3PQYE 2C26A 2VSCA 2BC4A 1CE6A 1GH7A 1X9QA 4C59B 2JKIS 1H9DA 3LVEA 4N6RB 3VMNA 3HE6B 1YDPA 1MZZA 5IKCB 1PZAA 1XEDA 2APSA 5JPNA 3G6JF 4L4VB 5EC2B 5JIMA 2RQEA 4FQCH 2ARJQ 4RISH 5GZOA 3KLDA 1A8ZA 2R2EA 2IWFA 2LU5A 1KN4L 4LSSL 5CN1A 1P4BL 5LLIC 3NGBB 4PRDB 1FH5L 2CGYA 5AD0A 1BD2D 3W2DH 5C08D 1MNNA 5D1XE 4K15A 4PRPA 2YO3A 1EEQA 1ZT4B 4RFEB 3AQDA 4XPAH 2BMKB 5AENA 1T89A 5LVEA 1NEZA 1QW9A 3N0AA 3VDCA 4WW2B 1Z32X 3GSWB 4QWWD 3NPSC 3SY0B 3FUJA 5KANI 3DETC 1JIBA 2N56A 1HSBA 4Y1AB 3AS1A 3W0WE 3RX5A 1SYSA 2DM3A 5KYXB 1JS4A 4N6RA 3M1CA 2AAVA 2NCMA 2MEJB 3TA3C 4A6YB 3QT2A 5DVLA 4NDMB 1NEPA 4L4VA 2BVEA 5EC2A 5BO0D 3D48R 1E5CA 4G8FA 3NIDB 2OV0A 5E00A 1Q8MA 4XN4A 1FC1A 4HIEB 1MSPA 4ZQKA 4O2EA 2VDKH 1FYTD 1C16A 4L1DA 4PHXA 1KCVH 4KI5E 5IHZA 1MWOA 1YG9A 4RFEA 1I9JL 4AG4H 2VISA 2B1AH 2BHFA 5DLMH 5F9OL 1F90L 1CYGA 2R1WB 3IE4A 5KVEE 3NIGB 4Y1AA 5KYXA 2NX5E 3ZO0A 3ZMNA 3BKCH 4X7CC 3UACA 4GS7B 4RGNC 3DO7A 1TTUA 5DJ6B 4A6YA 1AQMA 1KBKA 3DKHA 3T77B 3QZMA 2CO1A 2Q8BL 4FQ2L 3ZE2F 3I6KA 1JPST 3FAWA 3BSHA 3MRKB 3ULVF 4G8EB 5F7LB 4N86A 1XF2B 4HIEA 1J10A 1GZQB 2X70B 2BFVL 3UC0L 1YVLA 3WS3B 1PZDA 4GAYB 1C8PA 2ZOTA 4M1DH 3BKYL 3NCCB 2UXTA 2VXQL 3Q1SH 3NFSL 3SYAA 4HA1A 4OZIA 3KVDD 1XMEB 3GSNL 1A7OH 2WXNA 4Q9CA 4FI7A 1ZDQA 3II1A 1NA8A 5CP3A 4Z7QB 4AL8L 2PABA 3FHAA 4OKVB 5F9JA 5LNDA 5ACMA 3TO4C 4QRSB 3T3PB 4FULA 4FFYL 3OHMB 2K78A 2QGBA 2ZCKH 1BF8A 4M61B 4K9EH 1TQCC 3T77A 5HI4C 4AEIL 1V7NH 3O6FB 5KYWB 4OF7A 2ICCA 1XF2A 5T33H 2VSMB 1OGSA 1YEFH 3MRLB 1LJMA 2X70A 4X8JA 3WS3A 2BOCA 1R3JB 1ZLEA 4UZGA 1AOHA 3PWUB 4YOKA 2NZ9C 1BG1A 4LP8A 2R29H 1RIVL 1YECH 4LCCC 4O02A 3VXMB 1PJWA 4PJHE 1D5IL 1FVEB 2VGLM 2EE3A 4XN5A 3B2DC 4TPRL 4RNRA 2VLRB 1I4FB 2M2DA 1AMYA 4ENED 3U7YH 4AYEC 4JFEA 4KNQA 1RVFH 5GGVL 5DF0A 1EEUA 1MCHA 3ECWA 2XYBA 4NO2A 4CVWA 3SEPA 5KYWA 5T1LB 3O3DB 2P80A 3LRLA 4QHPA 3WTVA 5CSBA 4PREA 4KZEH 4ORGB 1YEIH 2X1PA 3PWUA 1PZUB 1JHKH 5CGTA 3WHXB 4UZUA 4QRRB 4DGIL 2DQCL 3SQOH 3QDMD 3VXMA 3EJCA 4H88H 3W57A 1FVEA 4NQDE 4OM1H 5GSVA 1OW0C 1D2OA 3PDGA 2WINB 3SCMC 4QMEA 2VLRA 4I9WE 1EJOH 4WI3A 5DD0H 3BAYA 2QV4A 5IEHB 2EVIA 2WZPA 1DR9A 4HUNB 3OGCB 3KPSB 4X0NA 3UJIL 5T1LA 4F7CA 1A6UH 3BAEL 3UYPB 1LTXA 4NEHB 3ZTNL 2IVFC 2CHZA 4UT7L 1QATA 4NWTL 5JPMC 5LCVH 1FZJB 2BNQB 3LEXA 5HGDA 3DLQR 2C3VB 4AGLA 4QRRA 1MCKA 2J25A 3MUUA 4RBPH 1W91A 2L0DA 4S1QL 3UP1A 3MODL 1NFAA 5KVDE 1E8ZA 2PW2B 4X99B 4G6KH 1QTYT 2WINA 4M6AA 1RZGB 3Q43A 1EX0A 2YXVA 1KV3A 2X4TB 3FCGA 5IEHA 3A6CL 4XP5H 3DPDA 3KXFB 3BVUA 3OGCA 2XZQL 3KPSA 3N91A 4XPHH 2H8PB 1WHPA 5F7HA 2Y07H 3H9YA 5F0JB 2FQEA 2JCCE 1NCCH 4FLQA 1V05A 4I2XB 4IGBC 1FZJA 2BNQA 3C5ZB 1BQLL 1QYGL 3LCYA 1YN7B 5HVFB 3DX7A 4YHLH 4YC2B 4RMBA 2WLNA 1P84K 3HZVB 2XZCH 4FI8A 4YPGB 1JAEA 3O9WD 2PW2A 4WO4D 4X99A 1AIFA 2APBA 5E1AA 4XX1E 5AYUL 3RPKA 1CR9H 3WFBH 4EDWL 3QUMH 1NLDH 1WP6A 1XSKA 3HS0B 3E2HB 3KXFA 2VN4A 1ULVA 3ZYJA 4KX8A 1U95B 3CGTA 1KBWA 2H8PA 2ZCLH 3K0WA 4ZI8A 4F2EA 1QQDB 3GBNL 3L3OB 1L4IA 3TBTB 1CXKA 3IGAA 4H0IA 2QKIB 4I2XA 4ZRGA 3CLWA 4G5AA 1N67A 2W1NA 4LLQB 3QIBA 2ZONA 3LKOA 3NABH 4FX5A 3GHPA 1BGXH 1RFDH 3QG7L 3WNKA 4HJ0D 1MWAA 3X13A 2R0WL 1W15A 3BQUC 3RILA 3RZCC 2OR7A 3IE9A 5AZ2H 3ZX1A 1P69B 2R15A 1FAIH 1YPZE 4KVCH 5FS5A 1NWPA 4PQXA 1FGVL 2GB2A 3FSWA 4EBQH 3H7BB 4ZFFB 2X3BA 1LQBC 1HEJC 4JKLA 2OMTB 4OLEA 1U33A 2OR9L 5CIPH 2HKFL 3FHEA 2DQIL 4L9LB 1QQDA 1TO5A 3EDEA 3DJSA 1TTRA 4K71C 2NNRA 9CGTA 4KFZC 4GXVL 3WEBA 4PJDB 1LQSR 4YSAA 4MJIE 4LCWB 4FHBD 4HMDA 4FTVB 2FT7A 4LLQA 4U1IA 1SBSH 3IMBA 3IB4A 4MZ3A 4XNYH 5GPRA 3K6DA 4R26L 3QJZA 2WBKA 2R4RL 5LGYA 2DQTH 2PR4L 3L08A 4GKSA 1AGFB 3MYZA 1A8JH 3NA4A 2EXSA 3WL9A 5AAMA 3V5HB 1F4WH 1V5JA 5C0BE 5C9JB 4AEHH 4PJIF 5LQBH 2X1QA 3N9GL 2VRAA 2VDOH 4AJWA 1M53A 3UP6A 4YBQC 3H7BA 4ZFFA 5LCVA 3EADA 4XXWC 1GZPB 4HV8B 1RZIB 3FSZA 3VD7A 4EUPG 5BRPA 3MRPB 2WGXA 1F58H 1PS3A 3VFUB 4DN3H 4ONFL 4PJDA 5HVHC 4OFKA 4LCWA 4QOKE 4FTVA 5FGBA 3NJFA 2QT6A 1TF4A 1RUKH 1VFOA 3QUMB 3UAJC 4YHYC 3L5JA 3MHZA 4OZFG 4ZSOE 3KS0J 3F58H 4JMNA 1VZIA 3IS1X 1L9SA 4UIKH 4JPVL 3QWOA 4LSTH 1FFOA 2FDBP 3L5XL 4HPOL 5E9DD 3WNJA 1Z1WA 5C9JA 5EBLB 4D9QD 1WBXB 1C08B 3GBMH 4PGBB 3QQ3B 4KO5A 5SX4H 5T3ZE 3DX8B 5HHQA 1GZPA 4HV8A 2CAKA 3BZDA 3QFDA 3H9SE 1BFOB 3VFSB 1WAAE 2ICEA 5EB9A 5GGTH 3GHEL 2FX7L 2NNCA 2MNWA 5C0CD 3K6OA 4QXUH 4NQEE 5JW4M 1D5BA 4MB1A 1TXKA 2ZD0A 3AU1B 2JE8A 2ZYIA 5DURB 3MRIA 1QEWB 2GW5A 4FQLL 4C56D 2NY2C 5KEZA 4U1NB 4HUUB 4MB3A 1F8TH 3CX5J 2BP0A 2IH1B 5JOFA 1B4RA 4UQDA 2LW3A 1WBXA 4JJHA 3QQ3A 5JLZB 4PSPA 1DBBH 4NOFA 2A6DA 2F68X 1AQHA 3DX8A 3ZR6A 1N5YH 3EOTL 3VFSA 2XETA 5ECGA 3V4PL 4KPHL 1V3KA 2PWEA 1HU8A 1WA1X 3RVWC 3QPXH 1MCPL 2Q0ZX 3CFKB 4A38A 1G7JB 1AZZC 3HVDA 4QIRA 5EMYA 3SGKC 4WUUD 1R47A 3CFJA 3BAWA 3LQAH 1QEWA 3LV3A 3ULUE 4L29B 1KIQB 5DT1H 3BH9A 4JFDB 5I5RA 1AXSB 3AQXA 4U1NA 3WTXA 1Q72H 4XO4A 3V4UL 3V6OC 1IAII 1TEGA 1UOWA 4QEGA 5SWSD 3E80A 3HUJF 1ICTA 4AM0B 3V7MA 1XR9B 2CRIA 2WKOF 1S9YA 5FK9B 2VN6A 2V2XB 1T5XA 1QPXA 4BSVB 5IEKB 4YLCA 1ORQB 3CFKA 2X38A 5JA9A 3GPSA 1AGCB 2BP8A 5KUMA 2X0UA 4KKQA 5C07E 3VB9A 2LLNA 3P4NA 2WLIB 4PYHA 4AZ8B 1FP5A 3BGAA 2NSXA 4L29A 3TZVC 1M57B 2IAND 1KIQA 2QQLH 3QZNA 3WFEH 1OWRM 3JTTA 3QE5A 1HWGB 2E4TA 4U3CA 3RGVD 2EH7L 3NACL 3ZKMC 4U3SB 3SBWA 4AM0A 1Z5LB 5J6GB 3MCYA 1XR9A 4E41D 1IC7H 1F11A 1KIRA 2EC9T 5FK9A 2V2XA 2I24N 4BSVA 2AGJL 5IEKA 2WBWB 5BZWA 1T7XA 3QWQB 1DQJA 3ABZA 5BV7C 2VC2L 3UTSD 1JMXA 4JFSA 3IDYB 1JYVA 1XR8B 2YLHA 1GGBL 1WPCA 5IW3A 2JIXD 1N4XH 3DPBB 1DVSA 3TEZA 4TXVB 4PJBF 1JWUA 4U3SA 1QP1A 3DGGB 1W0VB 3O4OC 5GGTA 1Z5LA 3EFDH 3WN5C 3PJSA 2R69L 4GW4B 3O2DL 5J6HA 1PCXA 3DGCR 2V37A 4KNTA 2H9GB 1XBDA 1UJ3C 4DP0X 3CBRA 4PP1C 1OM9A 3HG1D 2AS5M 3BDBA 3BZ4B 4UU9B 1YZZA 4KJQC 3GFUA 4BBWA 1ZA6B 1XR8A 4XVUC 2VXTL 2DLHA 4YXHH 5KSVB 3VDBA 3DPBA 3FULA 3UG4A 5B7MA 5EC1B 4IKLA 3EBAA 4XMPH 4F2ME 1T21B 1W0VA 1CGXA 2D7TL 1B3JA 4YSCA 3RTQB 2NLJA 3SDXF 1KLGB 2D03L 2DJMA 4IRZL 5C0DB 2YXMA 3TO2B 2BY2A 3D33A 5IGXL 3BZ4A 2SEBA 3RQ3A 2A74B 3HC4H 3CAFA 3NT0A 4JLRB 3GXMA 2HRHA 2VIRB 3UTOA 2C3HA 5KSVA 4RLDA 3G6DH 4F7EA 3LAFA 5EEWA 1IBGH 3HTLX 5EC1A 4ANWA 3JSSA 4A63A 4GSUA 3MCLL 1WWWX 5D1XC 4L0PB 5DRZB 2DLGA 1Q38A 3RTQA 2EXYD 3V4VL 1ETZA 3ZHLA 3X3FL 1KLGA 2COVD 2CUMA 4LLMB 1ID2A 4LOUD 2ZX9A 1R3KB 2X9ZA 2H41A 1OTTC 4X4ZA 2F7PA 4K3DH 2NY5L 4O9HL 3G5ZB 3L13A 4NNYB 2J73A 5I1HH 4HJGB 2A74A 4Y4KB 3CDCA 5AVZB 2NR6A 4JDTL 1NFIB 1P6AB 3QA3B 3S9DB 1J1XL 2B16A 3K6SA 2JLPA 2R0ZH 4MX7A 1NMCB 5E6SB 2BWDA 3UIZA 4FG0A 3CZJA 1THAA 4YHIB 2XICA 2XA3A 3SE4C 3WE1A 1A21A 4KI5C 3S96B 4Z3EA 1FJ1B 3MNWA 3VI3B 3WDHA 4JQVC 1NBQA 2NT1A 5D9SA 4AGPA 4WWID 3UAAA 1OSEA 3PGDB 4Y4FC 2WN2A 3ZDXE 2YUXA 4LVOB 2CH8A 2XUWA 4HHGA 1TZAA 4XAKE 4CVUA 3DBSA 1P4BH 2BS71 2WWOA 3ARED 3O6KH 1QO3A 2WJ7A 3ATEA 3GJFK 3DURB 1F3DH 1XCXA 3MRJB 2W9EL 4FL4B 3OB8A 3SE8H 4ZDHA 5F1NB 4FQXD 3BP7A 5C0ND 2DB8A 5T8IA 3RRQA 2VDPL 1WBYA 3QUYC 3WY1A 4CU6A 2YRBA 3I84A 4KROD 4YHIA 4K5MA 1WFOA 4JFHE 4J3WA 4KHTH 3FUEA 3QNYB 4L4JA 3VI3A 3ES6B 3LX9A 3PHQA 4B97A 3PGDA 4F15B 2WLMA 1DLFL 4DUVA 4NN7B 2YGVA 4X4YB 3U6RB 5D55A 2JXMA 3DMMD 3BP6A 1O5DT 4UF7C 3C2AL 2DTMH 3DURA 5EA0L 4DQOL 1RZKL 2PKDA 4QGTA 2JKRM 1I9JH 1OAUH 3BSZL 5C9KA 1D3CA 4V2BA 2KYIA 3A4FA 1RIUL 1FVCA 2QPDB 3LS4L 2R59A 3LS5L 3N1QC 3BIBX 1SHXA 1H19A 1LVEA 3O3EB 4BA0A 2WNKA 3QNYA 3QDGD 1TT6A 5D4JA 4JY5L 4QHKI 1I7TB 2OYLA 3GSQA 5DC0A 3ARZA 2XJKA 4FQ2H 3H3KA 1ACCA 3UZEA 2H1PH 3GZPA 3K81A 2FJHA 2QGCA 1N59B 3U6RA 4AENA 4X4YA 2J1WA 1I85A 1MFMA 2WXFA 4DAGL 3AROA 5I0VA 5TDNA 3H2QA 1U2YA 2BFVH 2Z65C 2GSMB 1QACA 3TFKC 3V6FB 2P9RA 1JOIA 3KWVA 2IBZX 3S4SG 3S5LA 5HPMA 2YAQA 3C12A 3F7VB 4Y16D 3WTTA 3LNIA 3ML9A 3T8XA 2CNYA 3N06B 3AFLA 3B7TA 1G7QA 3FUHA 3GSNH 1PU0A 2IOIA 2C9SA 1M6OA 2EDDA 2DLIA 3O41B 2B8OT 3QGVA 3RNKA 3WE6A 2PO6A 1PFCA 1UJTA 1HQ4A 4FFYH 1H8NA 1I7TA 2MRYA 3MBEA 4XN7A 4UOW1 2OJEB 4PJXF 5ITBL 4IKKA 5EUOF 5K9QI 1N59A 4ZMYA 3NJHA 2DLFH 2TRYA 3TFBA 3QISA 1IVLA 2CU9A 4NPYB 2BVYA 4MASA 4H26B 2EUXA 3V6FA 1F2XK 3ME0B 2OMVB 3U0PA 3H9ZA 4M7LH 4MNQE 1P1ZB 2QVKA 1GJWA 3AT9A 5HHNA 3HBZA 1JD7A 3VGGA 1J0HA 1KBVA 4A66A 5E6IB 4WSGA 3W81A 1Z9MA 3S3CB 1USQA 1UH3A 3O41A 3HG5A 1LO3H 4LASL 4TPRH 4W9ZA 4NZFA 1P7KB 4KJYB 5CZXD 1UWXK 4TQEL 4FA8A 1S7UB 5F7KC 1E5ZA 1LWRA 1K5NB 2BS9A 1WLHA 5FHAH 3CZFA 1GR7A 1FFNB 2AJZB 3FU7B 2G0LA 3NZHH 3A4EA 4OCNC 3L4YA 3OKMB 2F6AA 2XKSA 4ZODA 1YQVL 1SQ2N 4RESB 5D2NA 5CNHA 5PAZA 4WV1C 3MLSL 4CRPA 3CIAA 3MYJA 1P1ZA 1IKNA 2JVUA 5D7EA 2P46B 4LPWA