1U3NA

A sod-like protein from b. subtilis, unstructured in solution, becomes ordered in the crystal: implications for function and for fibrillogenesis
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
162
structure length
162
Chain Sequence
b'VVETSAFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALLGNNEKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical superoxide dismutase-like protein yojM
publication title A prokaryotic superoxide dismutase paralog lacking two Cu ligands: from largely unstructured in solution to ordered in the crystal.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Unknown function
total genus 3
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1u3nA00
1B4TA 3RE0A 2C9SA 4N3UA 3L9YA 2AQSA 1SPDA 1L3NA 4A7GF 1SRDA 3ECVA 3MKGA 1SXBA 2WKOA 1F1DA 5KBLA 3ECUA 2R27A 4OJAA 1SDYA 3KM1A 1YAIA 1E9QA 1JK9B 5KBMA 1YSOA 1E9OB 1SXZA 2ZOWA 3H2QA 3QQDA 1F1AA 3GZPA 3PU7A 4L05A 1F18A 2JCWA 2E47A 2WWOA 1OZTG 1SXNA 2GBUA 5KBKA 3SODB 1PTZA 1IB5A 4BCYA 3GTVA 1QUPA 1ESOA 2APSA 3H2PA 3QQDB 1JK9A 2WZ0A 1HL5A 1E9OA 4FF9A 1YAZA 1P1VA 1BZOA 3F7LA 1OALA 3L9EA 1SXSA 2XJKA 1B4LA 1MFMA 3KM2A 2C9VA 1U3NA 1IBDA 2VR7A 3HOGA 4U4IA 3GQFA 4A7GA 1EQWA 2Z7ZA 1OEZW 1DO5A 2C9UA 4A7VA 2Z7WA 4MCNA 1IBHA 2AEOA 3S0PA 1S4IA 1Z9PA 2AQPA 2AF2A 3HFFA 2LU5A 1RK7A 2WYZA 4MCMA 2GBTA 3GZQA 4N3TA 1COBA 4BD4A 2ZKWA 2Z7UA 3ECWA 2Z7YA 1HL4A 1N19A 2XJLA 3CQQA 1EJ8A 1XTMA 4A7UA 1Z9NA 3HW7A 1SOSA 1PZSA 2ZKYA 3KBFA 2JLPA 2AQQA 2E46A 5CU9A 1F1GA 1TO5A 2AQRA 2SODB 3F7KA 1IBFA 3GTTA 1N18A 2NNXA 3LTVA 1OAJA 3K91A 1BA9A 2WKOF 4OH2A 3CE1A 2WYTA 1PU0A 3MNDA 1XSOA 1E9PB 1DSWA 1FUNA 4A7SA 1IBBA 4B3EA 1UXLA 3T5WA 2WWNA 2K4WA 3KH3A 2V0AA 2GBVA 1SXAA 4A7TA 2AQTA 1UXMA 4BCZA 1JCVA 1CBJA 1KMGA 1CB4A 1XTLA 2Q2LA 3KH4A 2AQNA 2WZ5A 3GZOA 3CQPA 2WZ6A 2VR8A 1SXCA 2VR6A 1SDAB 1TO4A 1E9QB 1AZVA 1E9PA 4A7QA 1Q0EA 2ZKXA 1OZUA 3KBEA
chains in the Genus database with same CATH superfamily
4XMWA 2HFEB 1XMEB 5CWSA 3FNKA 3VNZA 5F8QC 5LG6A 2R29A 5DU7A 2Q10A 5I8KL 3SJVE 4L8SA 1FVCB 3V6OE 4EN3B 5MI0B 1BGXL 1I3UA 4OZIE 4XN5A 2YAEA 1ZJAA 3ECUA 4G7YH 4Y1TA 1XH3B 1YAIA 3FTYA 3QJFB 2F54D 2HLAB 3QRLA 2MTPA 2EDRA 4N2DA 1P84J 4FAAB 1RURL 2CUHA 4NQED 1ULVA 6PAZA 1JGDA 4LLDA 3WEOA 1MREL 1YQVL 3R06B 5D7SL 4AT6B 2EICA 3CFBA 1N5AB 1AE6H 1XAUA 4YHML 1WT5C 4HUWB 2FR4B 3H85A 3QARA 3FSAA 2DWEA 3WO4C 3VXPA 3C6SB 2Q6WB 1XCXA 1MLBB 4Y16D 3T8XA 4JR9L 4ZMXA 1EVTC 3GXDA 3TF4A 2YRPA 2K9UA 2VITA 3ROLB 4P59H 2XIIA 3S5LA 4AWJC 1MLCA 2ZP9A 2ICWA 5DCCA 4EI0A 1JV2A 3GPSA 5I1GL 5DUML 1DQML 5IBLD 2EDXA 1Z9OA 5I1AA 1MDAA 2EDLA 5IFAL 5KOVC 4J23A 5DD3H 2Y9RT 4LO9A 1GSKA 3D0LB 4I1NB 3S88L 5F7HA 5GRUH 1BFVL 2WXPA 3ECBB 1AH1A 2HJFB 1ITBB 5CEXB 3ZHDA 4QRPA 3SDDB 1MFVA 1KG0B 1D5BB 4Q4IA 3ULUL 1TTUA 4X9YA 3B1TA 5G4OA 2ODIA 1GGYA 1ET5A 1MNUL 2CK0H 2EEFA 1NBYB 4UMSA 3DVGB 4P5MA 1A4JB 4UM9B 3L9RB 3P9MB 1HQRA 2PP9A 3QJTB 3FTXA 4JNXA 5TE4H 1FYTA 2A83B 5F9DC 4BH7A 1TZ8A 2IDCA 4N5UA 1IFHH 3P3UA 2QQNH 1EEUA 1IGMH 1FNSL 1BAGA 1XCQA 3MGOB 5DJ2A 3ZRSA 5GSRB 3VRJB 2EAEA 1T4WA 1QYGH 4NRXB 3X1EA 5ICYB 4R7NB 3ARZA 1RY7B 2CJUH 5EU3B 2WO3B 4N9GB 1ZHLA 4ODXB 1HXYA 1S5HA 2EIZB 1NEUA 4PJFB 1UVQA 4RAVB 2P48B 3TASA 4OIAA 5E24E 2BSSB 2WVTA 1FFPB 1OB1B 4ISVA 4W9CC 5IV2A 3WDJA 3ERXA 5LWYH 4F20A 2Q5BA 2DJSA 1U91A 1X6NA 4LIQE 1NWOA 3ULVF 1MHEA 3D69A 4WFEE 4X42A 2BHUA 1OWWA 5IMMA 5JHLL 5JHMA 1CE1H 3RX5A 3O0RL 3SOTA 1SN2A 3GSNH 3ZDWA 3KLAA 3VXRE 1RLWA 1E6JH 3NEXA 4UT9H 3UJIH 3SEPA 3C6LB 4PJ5A 4OVUA 4AJWA 3LAFA 2B1HL 5J4MA 4H13C 1EHNA 2L04A 4K94L 3FTUA 5T1MA 1XF5B 3VWKB 1FP5A 3CWGA 4K8RH 5IMOA 4Z7IA 3PAYA 5A2IH 1CR9L 3WFBL 3O2WL 4LU5L 1EDQA 1CGWA 4N8CH 2GBUA 3V4LA 3PLYA 3GSUA 1QUPA 3CLFL 2WOBA 3ME0B 5SWZD 2EDHA 4U1MA 2WQRA 3QNYB 1NC2B 1QACA 3O9WA 1EXHA 4RMVA 1DVFC 4TLTA 1SN0A 2XXMB 5DMGC 3IDMA 4ZS6D 2F8OA 3HRZC 1QLEH 1NCDL 4NKDA 4PRPA 1YC7A 2H47C 5I0YA 4F3FA 4I9WD 4W68A 4H1LH 2GB2A 2HUEA 4OJFL 5SX4I 5HYEA 2A2QT 3GHEH 3LS5H 3BRDA 5GGVH 3UJTL 1FIEA 3K6OA 3RI5F 2Z4QA 2CBMA 3EO0B 4AENA 5JXEC 1C7TA 4HKBB 1A6AA 3PV6B 1G0XA 5D1QC 4A6YH 1QR4A 5B7FA 4E41A 5L2KB 4BRVA 3CK0L 3PDOB 4OCYL 5DLMH 4U3SA 4XTRD 2M83A 4BWTA 3NACH 1F4AA 4W4OC 4UQBA 1D5ZA 2NSQA 4FFWC 3ZPDA 3V0GA 1ZD6A 2MHAB 4XB7A 3RX7A 5IEHA 4OSUH 4ZBJA 5EZIH 4XI5D 4AXWB 3CVHA 5HDOA 5A2BA 5JMRA 3FCTB 2KHAA 3PFQA 4MB3A 2EINB 2DD8L 2JTYA 4AV0A 1G6RH 1HH9A 4DKEL 3X14A 2EIKB 3KHOA 3ZYJA 4LNRB 5F21B 5CD3A 2EXTA 2Z92B 4FABL 2CMRL 3MGTB 2OQJB 4PUBH 3BMVA 4S10A 2V17L 4MSWA 4OZGA 4B5EA 1UJ3A 1EHLH 4M1GH 1G7IA 2AW2A 1DFBH 1RHHB 1IFRA 3NSYA 2XWBA 4G70B 4FQ2H 5FUOL 1V7ML 2FGZA 5EBLA 3K71B 3P77B 2BMKB 3D85D 3CBRA 1J9CT 4XRCA 5I74C 1RIHL 4DKDC 2YAFA 2G4EA 4N0FA 2IAMA 4AL8C 4RDBA 3EJPA 3PWNB 4WTQA 4Q14A 5GGRA 32C2A 2BW4A 3SO3C 1GGBH 3OMAB 2P8MB 1TO4A 1G9NH 1RSFA 3H42H 2XZQL 1CQKA 1G1YA 2NY5C 3D39E 3P0VL 1A7OL 2HN7A 4EUPG 1WZAA 3K72B 4XNQA 1BVKA 4IRSA 2H6OA 3H7BA 3BZFA 4P9HC 4O00A 1ORSA 3GLDA 1RKRA 5K5YA 3MNVB 4UTAH 4K3DL 4W4NA 2J55A 3LDBC 2X9YA 3QUZB 3ARED 3VSUA 1CWVA 2L3BA 2ZP8A 5AVRB 4ELMF 3UJJH 1KCUH 2HT2C 3GI8L 3KYNB 1E27A 1NGQL 3WN5A 3FONB 3PHAA 4DTGH 4YR6A 2CSPA 1B3IA 5I1KL 4GAJL 4PREB 5DEJA 3HI5L 4B7LA 2D31B 4Y1SA 2H3NA 4RMQA 1T5XB 5KSBB 2E27H 1AO7A 2H1XA 2BC4B 4WU7A 3AROA 2NX5B 1GHFH 3T0XA 4ZMWA 1GA2A 4MVBC 4U1IB 1PSKH 4UYPA 1ASPA 5EV7A 4HOMA 5L9DL 3K46A 3LKPB 1U9KA 5KYUA 1BAWA 4GW5B 3GLAA 3ZTDC 1LEGB 1DBAH 2PR4H 2YUVA 2Q8BH 4YL9A 4HIIA 4ZUTB 5GISH 4AGLA 4HPHA 1HEZA 2CO6B 3MREA 4KMLB 1GL4B 4L5FL 4CU8A 3IGAA 4WFGD 5A1AA 4U1GC 3JWNE 4RGNC 4XVJH 5C0DB 1CBVH 2GJZB 3ATAA 2LE9A 4KZ0A 3VQMA 2FYYB 5EUKB 4HU2A 1GAFL 4JM4H 5LB1A 4Y2DC 4CRPA 2ALAA 1B90A 2GTWA 4F58L 4HPOL 4J3OH 1P9MC 3QYNA 2HH0L 5F1IB 4R3SA 4Y7MA 4MQ7A 5FCUH 1KGWA 3MMEB 3NJKA 3PWLB 4QXGH 3SGJC 5I1CL 5H35B 3HVDA 3KCWA 1T5WB 3QIBB 4LOUD 2BH0A 5GRWA 5HHOD 1IQWL 4HIEA 1BOYA 1RMFL 4HS8L 4JB9H 1SHWA 3DBXA 1ZRUA 5KYNA 4JHVA 2E3VA 1H3WM 1W0VA 4C4KO 4JFXA 3T5WA 3W0WA 3QZNA 4OZHA 3A21A 1HHHA 1GS7A 1OE2A 3H9SD 3UYPA 1Q38A 3CX2A 2E9IA 3L7EB 3STBA 1J9SA 3KL5A 5KSAB 4JZJC 1MRDH 3RVVC 4WHCA 1XSJA 2J71A 3TN0C 4I9XA 1NFDB 4HHWA 2C3GA 3FXIC 3GYRA 3OKMA 5AYUL 4A7QA 3AT0A 3FU0A 4WU5A 2ESVD 5DSCA 4S1QH 3GS0A 3ILQD 1DN0B 3V0AC 3KPRD 4H44C 4L3ED 3SDDC 3ZHNA 3ZTNH 2PXYA 2R4RL 2WUBL 3DVNA 4KJYA 4WEEA 5AL0A 2MWCA 2NXZD 1YEKH 3L5WB 2ZG3A 1LP9E 5DS8B 5KUMA 4QLRA 3QXAB 3NH7H 4BYHA 4S2SB 2QVMA 2GUOB 4X9BA 1J5OH 3K8LA 2FO1A 4BK8A 5F3HB 1KXQA 1YEJL 1D5IH 1AKJD 3IVKB 1QW8A 4YSDA 2LQRA 5IVXA 2Q3ZA 1TQBC 2XVLA 4QCIB 3T8VA 3AW5A 5E2TL 1C9SA 3HC3L 1BFOA 4JKPH 4QHLA 3L81A 2MNJB 2YFNA 4JDVB 1XXDC 3LMJH 4RMTA 3H0TB 4NQSB 5CEZD 4YZWA 5MP6L 2DKMA 2X2JA 4Z95H 2GPZA 4APQC 4ZW6A 5T1LB 2DDQH 4U1JA 3QIWA 4R2GB 1ZLWH 2Y22A 4LHJB 3D8MA 4ZW3A 3QXTA 2APXA 2DLHA 1EJFA 4MA7H 5JPNC 3BVWA 1FA4A 2ENJA 3I75B 2YXWA 2YQBA 4FMFA 3F12A 1BD2E 4FLOA 4LPVA 2ATKB 2Y1YA 3F6JA 3GUFA 4WUUA 5K39A 3TM6A 1I9IH 2O5YL 3LEXA 3N43B 5FGRA 4OLWH 2WQVA 5DDHA 2F5AL 1ZLUK 3DNKA 1ZHBA 4TOYL 2Y2TA 4G6FB 4XCEB 1GGTA 5D2NC 3SQRA 3M17B 5J11C 1Z9SA 1E5BA 2WXNA 5B38G 3QT2A 5C8JB 4TQEH 4ELME 1CL7H 4F7MB 1RCYA 5EZLA 5BMFL 1AACA 4DKAA 4XMKH 3WFHA 3K6SB 2DYPB 2KPNA 2I07B 2PW2B 4DP0X 4AGPA 2P44B 3QJVB 2YA0A 2LGNA 3SBWC 2J2ZB 3MJGX 5JHDE 3QHTC 1YN6B 1FVEA 4D9LL 4M43L 5F3BA 3QNZA 2KS0A 4LIQH 4OLZH 3QEHB 1TZGL 4PRNA 1MFDH 3TOPA 3FTSA 4FFZA 3PNRB 3TA3D 1KLGB 2GSMB 2BXZA 3LQAH 1JCVA 5HGGS 4TTGA 3WIIH 3KZ8A 1ZT1B 4NQDD 5C6TH 4G8IA 3ZKND 3DO3A 1BQKA 2HLEB 3Q13A 5E1QA 3V0FA 2HT4C 1QQDA 1I8IA 4IHOA 3MRFB 2VXTH 5FYJL 2VMCA 4K8RC 2DMCA 5LGHL 3AG4B 2B1AH 3TJHD 4HJGB 3VXMD 5M7QA 2B20A 3OGCA 2WQXA 5D96C 1TTBA 5D7IB 4R84A 1URZA 4JKMA 3DA0A 3VVWA 2FJSA 1JZIA 1ONQA 1UJTA 4P2QE 1J9RA 5CEYB 4PQXA 2H1LM 3L3HB 5TPWH 2Y25A 4ODWB 4BSVA 2WLLA 3QDMB 3C87A 5HDQH 1BG1A 3U0TA 3ZQXA 4OGYL 5I1IL 2IDSA 1YEEH 5F9AC 1KN2H 5ETUB 3FO1A 2WXGA 3RWFB 4GXVH 3Q5YA 4XNYH 4D3CH 1SYSB 1FDLH 2R7EB 3IETB 3ZW3A 2FIKA 1DVYA 1XH1A 3UC2A 2ZOUA 4XMPL 1N67A 3O3UN 4HH8A 4Y8AA 4LL1A 1XGRA 4QMEA 1PJWA 3S5LG 4L3FA 4TVSa 3IDXH 4UU9A 4I3RH 1AHWB 1YMHA 5LCVH 1OK8A 2MOGA 5AOIA 2XPGB 3O3DA 4WNQA 1S3KL 2AGJH 3IDIA 4QHMA 1K4CA 4X6DA 3IU3B 4ZAKA 5D1XE 4KTEL 5DEFB 3ZE0E 5IGXH 1T4KA 1OSPL 3J8F7 1VZIA 1QFWM 2AEPH 3KPSB 5ADOH 3IAPA 1MXDA 4OLXH 3DUSA 4OIIH 2CNZA 3VSQA 5GRYA 2X0VA 3QUYC 2PP8A 2BX5A 4YXLH 4IBLT 4B96A 2CO1A 5DHMC 3LKNA 3MZTA 1FL3A 5E1IA 4E0RB 5IB1B 4G7SB 4AUUA 2X41A 3CFKB 3RPIA 1U36A 3T0DA 3HNTH 4M61B 4QYOA 4TSAL 5DJYB 4JG1L 4G8GB 1RZIB 4R4FH 1DVXA 4YZFF 3RWEB 4Y9GA 4BA0A 1DANU 1TQUA 4K07A 1HL9A 5DEGB 4LDOB 2UVEA 4UV7H 4BFRA 3HZVA 4GIOA 4EBQL 4X4XA 3KGUA 1QTSA 1PX4A 2B7DT 2DM7A 1CGTA 4R96B 1G9NC 4M1CC 1HT6A 3LQZA 3L4UA 1U8QA 3UAAA 2WBJB 3TBSB 3X1NA 3BGFC 3D25B 2XWDA 3DXAB 3FQXA 4XXWA 1KJVA 3TL5A 3QXUA 5C7XL 5AVYB 3OZ9H 3ARBC 1Y1DA 4RBPK 4Y4FD 4HW6A 3RTQC 4Y19D 1ZV5A 2UZIH 1MCOH 1AZVA 3V95A 3LPGA 1A6TB 4HJTA 2BNRB 1UWYA 3QXDB 1JNJA 1OKEA 2VABA 4G9FE 3D50A 4Y5YC 3C5ZB 2NZ1A 3WELA 4Z3FA 2XYBA 1B0RA 2IG2H 3MBEB 3Q0HA 1MWAA 2OXGA 1R4XA 1U8CB 5DMIH 2IMMA 3EYOB 1D3CA 1J9TA 2G9HB 3FO2A 1YMMA 5IT2H 4LOVA 2Y7QA 1K5NA 2OJEB 3FU7A 1MIMH 2Q7YB 2OKMA 5ISZE 4LEBA 3V55A 2F1BA 2CIKB 3L4XA 4JFWA 4MGXA 1F3JA 3LCYA 4MKTA 1LXMA 3ZVVA 3S34L 3QCUL 1NGZA 3D30A 1NANH 1SMAA 5GRJH 3QG6B 5JPMC 3O81A 4PRHA 3TYFB 5FWQA 2MOQA 2Z93B 3SKOB 3VG0L 2CM5A 4YDJA 3JWNH 5CF3A 3KYMA 4GP5B 4EDWH 1ED3B 4KKLC 5DD5H 4YUEL 5C09E 1TMCB 2GSIA 3MXVH 3AT9A 1XF2A 3OKDB 4M7ZB 4XX1G 2X6AA 4FNUA 4XT1C 3ETBF 1OGTB 2C3VA 2YMOA 1ANUA 1XF3A 3GB7B 2VLKD 4EIGB 4XPTL 3KJ4B 2LFGA 3QJXA 3UTSB 1KCKA 4LB8A 4MYPA 2ZXWB 4AQ1C 1QEXA 3EAKA 3U7YL 4BFFA 1AZBA 1ZPUA 5DHYB 1JGLL 5EOCH 4AITA 2PCPA 3LH8A 5ILTL 2IXQB 3FDWA 4B9IA 3MUGA 3L3OC 1COBA 1IU1A 4X80H 4QXUL 5D7JD 2F15A 3KYOA 5EA0H 4DAGH 1URIA 3AAZA 4YQXL 4M8QA 2PF6A 4P2RA 3LB6D 5JDSA 5F0MB 2WLIA 2QQKL 2FL5A 5BCAA 1QSFD 1OIOA 3WTVA 1FJ1A 2X70B 4JFPA 1JGEA 2X53A 4WW1B 5FYKE 2XXCB 2EADA 4YHKH 5C0CA 1BXVA 2EYTA 4XN4A 1C1EL 1OP4A 1P1ZB 3DRTA 3L54A 3CLEH 4P4KB 1XXFC 2Y7OA 2XN9E 3HMXL 4W81A 1CTOA 4WDIB 4XP6H 4GLRH 4XO5A 2X1WL 3VXUA 5B3NA 1DE4A 3QORB 1R5WB 4U1LB 1CDUA 2YD0A 3KXFE 2DMGA 3VFGH 1KDJA 1CFNA 1UB6A 1BVLA 3ZT7A 2WUCL 3BHBA 3MUUA 1NAKH 5LGJB 3OWRA 2WMPA 5IHBA 2HWZH 4P5SA 3ZZSA 1K8DB 4OBSA 3ZKSD 1ZT7A 1HWGB 2Y36L 1YG9A 1OP5H 2OR7A 1GZHA 4Z0BH 1QZNA 1SPDA 4ZS7H 4FQIH 3AWEA 5IB3B 1U6AL 2XV3A 4JO1H 2ZWNA 1IGYB 4NNPL 4XP5H 3I6SA 3Q9PA 3S3PA 1YECL 2MQ3A 4N2AA 4KK5C 4JRYA 3VRIA 2WVSA 5HI5C 4NKMB 3EDKA 3MODL 2XIDA 2WLHA 4WENB 3LHPH 3Q3GB 3RUGA 5BNXD 3UBXA 5I9QC 2E9JA 3F7PC 1IKNC 4IOIA 3C5JB 3REWB 1IKOP 1IARB 3WEBA 3WV0A 2WXLA 5EWIH 2CO4A 4JFVA 5KVDL 1CLOL 1BAFL 2ZXGA 4QTIH 3GRBA 4YZFE 5JA8B 3DETC 1JK9A 1U8KB 4NQUA 5EBWB 3E8UL 4XP4H 4BHUA 5I30L 4CC1A 3ZL4L 4KXBA 3MRQB 1F4YL 4GUCA 2XJKA 3WUZA 3SGDI 4C83B 1HL8A 3LNFA 4YDIL 5I75B 5D6CA 1UFUA 1VEMA 2P7TB 3OMZA 1GGIL 4GY4A 2HVJB 1H6FA 1H6EA 2E0PA 3KPMA 4J39A 4M3HA 3G7TA 1CK0H 1TLKA 5K9KB 2C7UB 1YC8A 2WN2A 3HZMA 2W9EL 4RZKA 4XXDA 3EH4B 3EGXA 1EJ6A 3EUUA 3IJEB 1THAA 4LBAA 1J8HB 2R69A 4I87A 4U4BA 5E8EA 2NUTA 2AEOA 2ZPKL 3S8GB 3BLPX 3V7AE 3OKEA 1P5UC 3DROA 3Q6GL 4K9JA 2OMYA 4AGMA 3U7WH 3LXUX 3F58H 3ECWA 3JV4B 5MEQA 2PTUA 1MAML 2GSGA 3HG5A 3SE3A 1YNLL 1WC7A 4RGMC 4DUVA 4YDMA 4BQ9A 1RXLA 5IQ9B 4WHTB 3RWJA 2EC9U 3C5SA 4MAYD 2JLPA 2JQMA 1CICB 2CDFB 5LAPA 5AOMA 3T4YB 4HVBA 4PJFF 3B9VA 3LQAC 1QRNE 4NZ8A 5FS5A 3FTGA 1EO8L 1OSZB 3FB8A 4FZEH 3F7QA 3KPNB 2Q86B 5HI4D 3T09A 4FQHB 1SEBB 2J6EH 5IVZA 2QADC 1T1WB 3BI9X 1I4FB 1XZWA 1OGAA 1AR1B 2OI9C 5T3XL 4NO3B 3DO4A 4HPYL 1WTGT 4XCNB 1BZ9A 3SDAB 2VDQB 3DRQB 2WWNA 2LVCA 4ADGA 1A7PL 4XNUH 4X5XB 3EBIA 3S35L 2FEDD 3GLEA 4Z23A 3U82B 3EJYD 4YDLB 2EIJB 2HVBA 1JIBA 4WO4D 1BM3H 2XOTA 1MFEH 1V7NH 2DS4A 2DLGA 2C1OB 5C86A 1B4JL 1RJCA 2CE6A 1XO8A 4DWHA 4P3CL 4OBRA 3BPLC 4MZRA 2EDDA 5ESVB 3QNXA 3LH9A 25C8L 5D7KD 4H8UA 5T5FH 5D93B 5A6MA 4GAGH 3ILEA 4LPYA 1BQHB 4R7LA 3C60A 4MNGB 3FFCE 5AAMC 3RIAF 1BSIA 5DJ8B 1E4WL 4MRCA 2YN5A 5E8DL 4TSCL 1P6WA 5HGAA 4YHNA 2OS7A 1DQLH 3EGDA 1HYSD 2VQUA 3CH1A 5FOJA 5L4FA 3BAYA 3IS1X 4MAZA 1F18A 4H25B 4UT7L 5DD0L 2F58H 1IZKA 4NKOA 1JZFA 1AGBA 2YLKA 4OGAC 3UEZA 4KKAD 4KTGA 3TWYA 1UQSB 3GIZL 2EDJA 2R1WB 3WO3B 3G5ZB 1UATA 4GINA 5AFAA 2EDOA 3QUXA 3IS0X 4Y5XA 1MRFH 4F2ME 4PJEB 2B59B 1EZVX 1CGVA 5GS1C 4F57H 5C0FA 1UM6L 2FWOA 2MQGA 3ESMA 4DN4L 5J6HB 1OF2B 5GRXG 2P5WE 3QEQD 5C0BD 3W57A 1F90L 1FNHA 2BP8B 3I9GL 3CFNA 3EF4A 3IGUA 1FV1B 3I3DA 1QWUA 3HTLX 3T4AA 2A1WH 3FUNA 3IDNB 1ZGLM 7PAZA 4FTVE 2AEQL 4BKTC 2Z6FA 4ACPA 2LW3A 3FQTA 1UD5A 4NM4H 5I0WA 4MCYA 3JQOB 4FNLL 5H94B 3L2NA 2NW3A 2YPLB 2R0LL 1JHKL 4N90E 3LKQA 5DRZA 4FULA 4R5XA 2K6YA 4GI9A 3WJJC 4YGVA 5E4AA 3EIFA 5LNGA 1TNNA 3J27A 2NY0D 4U7KA 2O93L 3ULUF 1L5GA 3T2OA 1YY9D 3HPJB 1BJ1H 1W72H 5I16B 5EEWA 3QQNA 2GY7B 3VD5A 4ODHL 3V0WH 5CSZB 5FM5M 1R5IA 4JANA 5JDJA 1KBKA 1WFUA 1NDMA 1SN5A 3SDYH 5F7KC 5DJXA 1BLNB 1G5AA 5FO7B 2YUZA 1JYVA 1WZ1L 4TLUA 4UOW0 3QJHA 1YEFH 4YAQB 3FRPB 4PRID 3FQ2A 5DRNB 3APMA 1CFQB 2HZHA 2J8HA 1NSNL 5CWSB 1BFTA 4AYEC 5HYJA 4H8PA 1ZTXE 4L8SB 1R0AH 4NC0B 4YDKH 4K5NA 2GC4C 5FFOA 2UUDH 1FYHB 3JVFC 1WV7T 1YJDL 4FHKA 4L4VE 4LKCA 1JZ7A 2V9UA 1BQUA 4HULB 1ZV9A 1I8LA 5AYTA 1JNHA 4UOJA 4N1CA 5B1BB 1OAQL 3UBGA 1JGDB 4LLDB 2V2TA 1CGXA 2FWLB 4JGMA 4UV4L 5DZPA 3CFBB 4OR1A 2FHBA 4NJAH 4PJ8A 2DWEB 3CSFA 5KSBF 1QFHA 3VXPB 1E65A 4MA8L 3VGFA 2H3XC 3T8XB 1J1PH 5E6SB 3JWNC 1T0MA 5DJDA 5BS0E 5IHZA 1CZ8L 1IIKA 2VITB 2NY2B 3QQ3A 4HWZA 4LEXL 4M7LT 3TV3L 4DP1X 5JIQA 3S5LB 3OB0K 1MLCB 3CVHL 2ICWB 3C2AH 1JV2B 1PTZA 3FTWA 3VO0A 5I1AB 5TH2B 3WD5L 1I7UA 1NIFA 3LOWA 4JLRA 1JSYA 1DR9A 1JWMA 1SF5A 3IPBA 3II3A 5IQOA 4X7SL 4M7LH 3ZTEA 1ZMYA 2I32A 5A2AA 4QRPB 2OYPA 4FJZA 1PZBA 2W60B 2HPOA 5DJCA 5T1DL 1ZXQA 2NRDA 4XCFH 2CRYA 2KL6A 2QVIA 4XNMA 3LV3A 6CGTA 3GPEA 3OF6A 2VAJA 4P5MB 3I3EA 3MV7B 1HQRB 4FLQA 3RVUC 2YD2A 5ITBH 1FYTB 2VKWA 4L4JA 3SE9L 1KLFA 1KCRH 3NIFB 4M9OA 4Q0XL 3LN9A 3VSTA 4YOKA 2ATPA 1T5KA 2DJUA 1XCQB 5DJ2B 1R33A 3BMWA 1TSHA 4XNZC 1XVSA 1P4BL 5DZ9A 5FYKH 3BRGC 3CQQA 2QLYA 3QHFL 2BSEA 3HI6L 3CGTA 5I8CB 1T83A 3KCPA 3NCJH 1ZHLB 5FXCH 1KCSL 1HNGA 1BW8A 1HXYB 2IBZY 2RGSA 2F7OA 1AHKA 1S5HB 4S11A 2BJML 5IROC 1UVQB 2RTTA 4HCRA 5JIDA 4WKXA 1W6LA 2DQ6A 3U46A 1D2PA 4ISVB 4CC0A 5IV2B 4O5LL 1FNAA 1BOGA 1NMBL 4OT1H 2WYTA 3ZK0A 1NFDF 1U91B 4Y16A 1N6VA 3IFPA 1YEIH 1MHEB 1INEL 1AXTH 1CTNA 1LK3H 3D69B 4P9MH 4PY7A 4RLDA 3RX9A 2D3NA 5IMMB 4CU6A 3QJRB 2XN1A 3DMMA 2IFFL 3CC1A 5L2KE 3KH4A 3IRCA 2YQ2A 1FNGA 3BD3A 1EXGA 3KLAB 4M7KH 2VN3A 4WGVB 1L9NA 2RH0A 3LRGA 5D71L 2A9CA 4PJ5B 1E4XH 3NGBC 1A7BA 5T1MB 4WY7H 2IDQA 2V5TA 5IMOB 2EDQA 4MTMA 4OLYH 3GKWH 4WFFD 4F8QA 2CUAA 15C8L 3BESR 5I6LA 5E9NA 4UDTB 2BNUA 4NCC2 2X89D 4U6YA 2X28A 2WKOA 1I3VA 1G9HA 3GSUB 3ULAB 1R3IH 4U1MB 2OFQA 2NUPA 3QJUB 2ARWA 3O9WB 1YNKH 4M6AA 5F3FA 3RU8H 3WOVA 3ULUE 2DW5A 5DUPL 1TYRA 3F84A 3FUDA 4NKDB 4PRPB 2F53A 4DGIL 5KZCD 4F3FB 2OL3H 4AK1A 2OCCB 3I02A 2HKFH 5IHUL 1UM4L 4Y9CA 4M48L 1Z3GH 4NS0A 2K1MA 4MQXD 2ARJA 2Z4QB 4AENB 4QT5A 5HYSA 3MC0A 2NSMA 4KJPC 4XMXA 1A6AB 1PS3A 1H6TA 4OM1L 4LPXA 1P2CA 3CXDL 5D1QD 5F0JB 3T08A 2NTSP 5BZXA 5AW1B 1WFMA 4E41B 3HCVA 1T80A 3CDCA 1ZSDA 4U3SB 4G6ML 1VZHA 1D5ZB 1C5BH 4FFWD 5E2UH 4KHXL 3W3BA 3N43F 4GAAA 2FX7H 1Q0XH 1HDMB 5IEHB 4AMKH 1HZHL 3QA3B 2XWJA 4YE4H 1HHIA 5DVLA 1GOHA 5T1KD 4AEIL 4TYUA 3X14B 2HKHL 5I6NA 2BWDA 3TWCH 1ZKAA 5CD3B 4PJCA 1A6VH 1KGXA 4MSWB 2Q7NA 4OZGB 5KEZA 4KKRA 1UJ3B 1N26A 5E1AA 5IMLA 1G7IB 5IM7A 4OKVA 2N1KA 2KLRA 4XMTA 1XTMA 3SIKA 4JN1L 2XWBB 2N7SA 2AANA 4ONFL 1IE4A 3EOYG 5EBLB 5JQ6H 1NLBH 2NX5E 1NCJA 3CV5A 3P30L 3HUJA 5E2WH 5E5MA 1S8DA 1D5MA 4XRCB 1MW1A 1K3ZA 5B39A 4AYGA 2JI3A 4N0FB 2YLHA 1N18A 2F61A 2IAMB 1Q72L 1OAUL 3KPPA 3HS0A 2FD6L 5GGRB 2UY7A 32C2B 3FB7A 5BZDA 1LEKA 5SWZA 2Y6SC 2XVGA 2DQTL 3VGHA 1DSWA 3WCYA 2C9AA 2HN7B 5F1OB 5HPMA 4ZMVA 4XNQB 5BUPA 1S6NA 1BVKB 4IRSB 4ENEC 2HFFA 3H7BB 2DBJA 2YXVA 5D7IF 3BZFB 3GXIA 1ORSB 3NFSH 3TH4T 2YFOA 3TTYA 3IE4A 2NPLX 3O4OC 4YDVA 5D8JL 3B8SA 4PCKA 4F15B 3OPUA 4F80A 3QRFM 5C07E 4PG2C 1G4MA 2HT2D 4S1RH 2OR9L 1MHPL 1NM4A 2XWCA 1E27B 1NCUA 4FCAA 1ZLUH 3WN5B 3EJJX 1O0VA 3NP3A 3QQ9D 4YR6B 3UCQA 4A39A 5FGSA 2OSLA 5FPIA 2ZWZA 4QRSA 5DHXB 3FHAA 3KPTA 2H3NB 3QUMH 5EIQA 3DX9A 4N6QA 1VESA 5TDOB 4PFEA 5T3ZD 1AO7B 2MH4A 2C9XA 2VZTA 4JZOB 3NJVA 4G8AC 4WU7B 4MVBD 3ZBMA 3BVDB 1Q1PA 2BVUA 3GI9L 5IJKA 5KYUB 4MQTB 3HLAA 1JNNH 4PLOB 5CILL 1OAZH 2R56H 4ZFFA 1JGVL 4HIIB 1ACYL 4PS8A 4H88L 5DT1L 1A7RH 2AXJA 1HEZB 3MREB 1KTDA 5FUZH 3VXQA 5E1HB 3LN5B 2O6PA 3P4NA 3IGAB 3Q7JA 1BQSA 2AI0L 4IKIA 3F7LA 2EC8A 2Q8AH 1QHQA 4WWID 3MLSL 4LDEB 4XPGH 1JF5A 3NJFA 4A7GA 2OMBA 4KNUA 3OKNA 2YAOA 1EQWA 4O58L 3D85A 1IVTA 2J56A 3CZJA 2XQBH 3C09C 2FWUA 4Y2DD 1XBRA 3JWOL 2GTWB 4FFZL 4XBPA 4G7VL 5HDRA 4J3SA 3HG0A 4ECNA 2VXVL 1SZNA 3OJDA 1E28A 3QIUA 4LAQL 4DESA 4R3SB 4DUXA 4UIMA 4MQ7B 3IJHB 5DJ0A 3UABA 5CJXC 2K9FB 2ENQA 3NSXA 5AOKA 1RZ7H 1VLXA 3MRNA 1CD8A 5CJQH 1JE6A 4KVCH 4HIEB 3O6FD 4R90H 4DEUA 4ZI8A 2HUHA 3DBXB 2VMFA 3AREA 3WE1A 3O6LH 3UZQA 1W0VB 4HP5A 4JFXB 3W0WB 1MFAL 4TULL 1OF0A 2H2SC 4G6KH 4OZHB 4F5CE 1HHHB 3QG7H 5DVPA 2DKUA 1RZKL 1OM3H 4YHPA 4KX7A 3UYPB 1ZTXH 2ZAIA 3E2HB 5F97E 2GEQA 1AI1H 4WEMB 5BQDA 2Y1VA 3LHAA 2WXQA 4OZFA 5F0PB 3RVVD 5JQIB 4DO4A 4JG0H 4NN7B 3W38A 3TN0D 5E2JA 5AYQA 2A9ML 4GMSL 3OKMB 3UAJD 4N2NA 7TAAA 4WU5B 3PL6D 5DSCB 2EKSA 3MO1A 1RU9L 2X5PA 2XXFA 3SGKC 1T7VA 4OTXH 4FYSA 2FLRT 1RI8A 2IOMA 2PXYB 3DVNB 4WHYG 4KJYB 5E7FA 4JO4L 4B3VA 1BBDH 2FHCA 2FGWL 1MIEL 4XPHH 4UBDC 4FXGA 4NOFA 2WGXA 1G43A 2OW7A 5F96H 3T8MA 3FMGL 4LSPH 4NI6A 3QUGA 1ET7A 3WXWL 3NMEA 5FLVA 2A74A 5IVXB 1RZPA 2R15A 4NKIH 2E74C 5J3HC 1UGKA 2NY4C 4N22A 1F8TL 3NG5A 4GT0A 1XCTA 3RURA 1I1FA 5AWNL 1BFOB 1I3GL 4QHLB 7FABH 3APCA 2I9LA 3BD4A 1QFWI 4XAWL 4O9HL 4LGSB 3PWJA 4NZTL 2FEJA 3L1GA 3VG9B 4U1JB 3QIWB 4L23A 4WW2C 4NQCD 5HHOA 3SPIA 3UMNA 1TITA 4QOKD 1X5ZA 3N1MC 3ZDZE 4EI5C 5F9OH 4JFOA 1MG2C 5M95B 3F12B 5CGYC 3WTUA 1NUDA 5INCA 4RBPH 4WUUB 5K39B 4HK0A 4UMGA 1X5HA 2ZXEB 5IESL 1BZ8A 3H9SA 3LEXB 3BUBA 4DN3L 5D7IE 2V7HA 5SWSD 5DDHB 4MA3A 1ZHBB 3CDYA 3HMWL 1Z9SB 4DHLA 5I6KA 1YUKB 1JXKA 5JORA 1A4BA 2X1QA 1IC1A 3MLRH 1L0QA 4GAYA 1BGXH 4KVNL 5EZLB 4PLNC 2J88H 4O2FB 1W8NA 3O6KL 2NCMA 3WFHB 2RCSL 3BQUC 3HZYA 1K85A 1ETB1 4NN5C 4QRRD 4F24A 4IBQA 1E90A 3JV6A 5FUCC 1FVEB 4FXKA 4XN8A 2ZOKA 2CNYA 1RLBA 1CDJA 2R1XA 5F3BB 4HIXL 3CTTA 3QNZB 5CN1A 5KANI 4AI7A 3L4ZA 4PRNB 1MWAL 2Q20A 4GQZA 4BQ8A 4TTDD 4YHMH 5IP4A 4FJ6A 2AXGA 3ALWA 2GTQA 4D7BA 2APVA 4LCWA 1QBBA 1AKJA 4NQXA 3QYCA 2ZUSA 5GHWL 2HT4D 4JQIL 3IFLL 1QQDB 5HVHB 1I8IB 3ARGC 4IHOB 1CO1A 4TL5A 4PJBA 3ARQA 4K8RD 4JFDE 5I1GH 1VFOA 5DUMH 1DQMH 3OGCB 1SLWA 3RJQB 3IDUA 1I9EA 4YHLH 1V3JA 3K2UL 3LH2H 4NOBA 3SZKC 3S88H 1AQDA 1DQDL 1PL3A 3RL2A 2CZNA 1QWHA 4BK4A 2VL5A 1ID5I 1BFVH 3T2NL 4BSVB 2WLLB 4KH2A 3EJRA 4HG4K 1E5ZA 2J1KA 2PO6A 3P3SA 3S3CB 3U0TB 3UTPD 3TX4A 4GBXC 1O7DE 1UCBH 3U6XA 3FO1B 4PB0L 1U33A 4D8OA 5HHXL 2YC1A 3BP4B 2VMEA 1MNUH 4EQ3A 4UINL 2KERA 1IGTA 3REWA 4G8GE 4Z8FL 1JZGA 4KTDL 2FIKB 3BKYL 4JE4B 1KUMA 3HZ3A 5HHMB 2IPTL 1DBJL 2O26U 1J0KA 2D3LA 4HMDA 1XGRB 2FQFA 4FC3E 5A2JH 3AT8A 2IH3A 3HPLA 4W9DC 4UU9B 4GB9A 1FNSH 1YMHB 4CDGC 5I1EL 3O3DB 4WNQB 3F65A 5F1KC 1VA9A 4MZ2A 1JZ3A 3GSVA 3IDIB 3QWRD 1K4CB 4QHMB 4X6DB 3CZGA 1L6PA 2BP5M 2ETWA 4K3JL 4ZAKB 3ZGIA 1R6VA 4JJHA 2OSWA 4MRBA 4WJ5A 2G75A 1T4KB 2OULB 4U33A 2ZXAA 5ERWA 4IIQC 4DP8X 3IXTA 1RPKA 4AYDC 2CDEA 3DUSB 2WBKA 1KFGA 3GQFA 5CINH 1MCEA 2CLRA 1KPVA 4P2OC 5DGQA 1I7ZA 2A6IA 3CFCL 1HH6A 1H15A 3LKNB 1FL3B 1KXHA 2IGFL 4NQDA 1DL7H 4NBZB 2ZG1A 1XHHA 2DQIH 5D6DC 3RFRA 4AYID 4HFWA 1FO0A 3RJDA 3O0RH 1Y7VA 5HHVH 4S1DC 2MCG1 3RPIB 3C2SA 4QUOA 4QYOB 1QEWB 3PDDA 2KZKA 2DI8A 3OPZL 4GKOA 5JQHC 4L29A 4ELKA 2FBOJ 2R9HC 2KI6A 3UP6A 1UGNA 4K94H 5FYJE 3KLHC 3HZVB 3FT4A 4X4XB 4MLIA 1U95A 4M1CD 1CR9H 3HFMH 3QDGA 3O2WH 2NYZA 3II1A 3LQZB 3R8BB 3WFBH 1U8QB 4LU5H 2D7PA 1QATA 3PXLA 3WIHH 1KACB 4EOWL 3NJMA 3FQXB 5FF6A 1KJVB 3QEGL 1JVLA 1M56B 5CAYB 3O8XC 3ARBD 3TPKA 2VXQH 2BVQA 2VN6A 3OC8A 2HTLC 2OZ4H 4NM8L 3PF2A 4WV1A 4LHUD 1NCDH 3A6OA 4QHKJ 3A5VA 1MJJA 2VABB 12E8L 4OJFH 1XQ4A 1IGIL 4I0PC 3UTSE 3WJLA 4PP1C 3WFEL 5JW3L 4UIKL 3UJTH 2DTML 5CMAA 1Z3RA 1B0RB 4FL4B 4IKLA 4Y4KC 1MWAB 2OXGB 3WIAA 1A4KA 1UD8A 3TT3L 3FO2B 1YMMB 2IPUG 5HDLA 5K9OA 4M3KB 3CK0H 2KKQA 1MCPL 3FU7B 4OCYH 1MFMA 4N4YB 4PSPA 3S36L 1CFVL 2J25A 5B1AB 1RK1A 4L2LA 2O5ZL 4AMWA 1RP9A 5FC9A 4LSSL 2WLKA 1F3JB 4LPTA 5F88A 4L18A 2A99A 2PR9A 1NGZB 2XQYA 3HC4H 3B2VH 3NJNA 2R69L 5EF0A 2K78A 1LEIA 4PRHB 2EE2A 3MBXL 5L8KB 1TTCA 4HD5A 1YSOA 4PJEF 3HBPA 4YDJB 3KYMB 1V3KA 3QCVH 5BZZA 3VWJD 2V17H 2BIMA 4KKLD 1PG7L 3MOBL 4RFOH 1M7UA 1X5LA 2GSIB 3BT0A 3HHRB 4NAJA 4J6RL 1XF2B 2JKXA 1G7QA 3N9GL 2GCYA 5DQJA 3VXNA 4HX1A 2ZIDA 3FT1A 1YQ2A 2L7EA 4BKLA 5DHDA 2C3VB 1XF3B 1JF1A 2R4SL 2ZT9C 4O02A 4ZMLA 1V7MH 4KROC 5DK0A 1I9JL 2DWTA 3HE7C 4J3OD 3ZZLA 5ID0A 4IYKA 1RIHH 4CILA 2CWRA 3RFZB 3QZPA 2PCPB 1IBYA 4NZRL 3V8CA 2QVTA 3MUGB 4X4KA 1WFNA 2XZQH 3P0VH 3KYOB 2M2DA 4H5SA 3ARDC 4Y4FA 4FNQA 3AAZB 2C9RA 1YYCA 1SQMA 4M8QB 2ZCKL 4P2RB 5JDSB 5PCYA 4LCCA 1TJMA 3ARWA 4C55A 4MJ2A 4HZLA 3MUJA 3SYPA 2WLIB 1JZDC 4K3DH 4UOZA 1UACL 3SJVD 2WD0A 2FL5B 5CLYA 1S9YA 3BXNA 1FJ1B 4JFPB 1JGEB 4CDHA 2VDNB 1L3WA 4A7UA 1H9DA 3GI8H 4FQXA 5C0CB 2EYTB 1LWRA 2AK1H 5DWUL 2AVFA 3DRTB 4GAJH 2WYHA 3VXUB 2XWZA 3HI5H 1DE4B 5FHAL 4YVNA 1T0PB 1RJZA 2EUWA 1CFNB 2XWTA 1UB6B 2N3JA 1BVLB 4CUCA 1GW6A 3BHBB 5L9DH 4NRYA 2W07A 1IJNA 4KO5A 2WMPB 4JCLA 2FAUA 2TAAA 4AKOA 2C4XA 3MLPA 3DPBA 1ZT7B 4ZMPA 4JPQA 1INDH 4HUVA 3EJSA 3M8OL 1LNUA 3B3IA 1BXAA 4QRUA 1NH6A 3FYIB 1IKFL 3CJJA 3AJ7A 4KXZI 1QZ1A 2E9GA 4KK5D 1WZKA 3GXFA 4JRYB 8CGTA 2VLKA 3VRIB 1NOFA 5HI5D 1BMGA 2YIHA 1SOQA 1A9BA 3VGGA 4JUSA 5FO8A 2WAHA 3RUGB 3I9PA 3UBXB 1JG9A 1GAFH 3DHJA 5A2KH 4S1SL 4IOIB 1S7UA 2H6UA 3L9BA 4IRZH 4WWOA 1YVLA 1TXKA 4HPOH 1F4HA 2HH0H 3DETD 2DQGL 1J0JA 5D7JA 1JK9B 2GJPA 1WS7A 5I1CH 1KFAL 2P4AB 4HF5H 1IQWH 4Q6YA 3DJ9A 2ARJQ 1JWUA 4LASL 3CZUB 2WANA 4LOFA 3LPFA 4HS8H 5D6CB 5IF0A 3ZR5A 4ZOBA 4OF6A 3KPMB 4I1PA 1ZS8A 3A67H 3C08H 1A22B 3MTXA 5FDWA 2ZXBA 3O4LE 2BRRL 3PXHA 3HZMB 4XXDB 2DPKA 3BAEH 3STZA 3EGXB 1RPQA 5AB2A 4PG9A 2IALA 3KWTA 3HHSA 5E8EB 2AJ3A 2NUTB 3S5YA 5LHDA 1UWXK 2GW5A 1M9WA 3NIFF 3OKEB 2B5IB 3DROB 2OMYB 1FRGH 3W39A 3NAAL 2F5BL 2ZXQA 5AYUH 5MEQB 2GSGB 4V1DE 3VD3A 4XXCC 4N2MA 1NFAA 1WC7B 5L4MA 4FFYH 4FNSA 3RWJB 3C5SB 2WUBH 2R4RH 2LTQC 2Z1PA 4TQ8A 3TO4C 1RUQL 2WYZA 3FTGB 1SBSL 3UBXI 1M2VA 1UCTA 3FB8B 5HTSA 1HTYA 4LSTL 4PI2A 5F9WC 2QPUA 4K55A 3VXRD 1A3LL 2XJLA 5EBMA 2QADD 5IVZB 2YS4A 2DN7A 1OGAB 1RJYA 3OB0H 2Y7LA 1YEJH 3UIYA 2NXYC 2AABL 4PJEE 1BZ9B 5AOJA 3OAWA 1ECZA 1QOKA 3L45A 5AL8A 4BM7A 1NC4D 1ZDQA 3NABL 3SCMC 3G5WA 1W2KT 3LXAA 1DCLA 1ZK9A 3PUUA 3MX0A 4KO7A 3P40A 4P5RA 3BYYA 2UXGA 2AJSH 1A66A 4DQAA 3V4PH 1AXSA 4YX2L 4LHUG 4J7RA 2VMDA 4JFZH 1DDHA 1F41A 2K6ZA 2VDOL 1MQKH 3KWWA 3D09A 5MP6H 1DFXA 4M7JL 1NCWH 4BBWA 5DHVH 3NCYS 5KVDE 3VGBA 1T89C 2JKTM 5CLWA 1ZA6B 3QNXB 5FK9A 3B7UX 1RZFL 4HHAA 3W5MA 4X4YA 4PB9L 3C60B 2XRAL 4I0CC 1Q0EA 4YN3A 5HGAB 1HHKA 5LUMA 4CMHB 4BCXA 1P7KA 2O30A 1R75A 3EGDB 5ICUA 3T04D 2O5YH 3CH1B 4U3XA 1U8NA 2YGVA 4IU2A 5EEXA 2F5AH 3NTCL 4NKOB 2E6JA 1AGBB 4OGAD 1K5WA 2XBZA 2VW7A 3EDDA 4MD4A 2V5RA 2ZQKA 2ADYA 5A3IC 4NZFA 4AYSA 3QUXB 2XTJC 4Y5XB 2BS9A 1A1OA 3VGAB 1GGUA 2Y3AA 4DO6A 5C0FB 1CURA 2GQHA 4MAYA 3QI9D 3GMPA 3SOBL 1JTOA 2Y07H 1HXMA 4JJ5A 4KKCC 5BOZG 3W1ZA 3D4GA 4J3OG 4TUOA 1PZ5A 2MCPL 4D9LH 5ABDE 2X2IA 4YBLB 3RJOA 3GT6A 2X1XR 3FC8A 2X4QA 1FLRL 5EU7E 5CIPA 3FQTB 2G5BA 3J07A 5GJTH 4HCRL 4MCYB 1SXSA 4U4IA 2NW3B 2X40A 1KB9J 1WITA 3ARRA 5A2LH 1UWGL 1U58A 3LKQB 4NERA 5DRZB 4E9RA 4YGVB 1X5IA 4OZGF 2FVNA 1XSIA 5T3XE 4K94C 3BDYH 1IGCL 1GIGH 1FORL 2B14A 4JPVL 1QI5A 5KW9L 1D6EA 5LGHH 1I8MA 1L5GB 1S4IA 2APFA 2QQLL 2TSBA 4HIJA 3GK8H 2F2HA 2WXMA 2NNAA 3S37L 3EKCA 4F7PA 1NGPL 3MUY1 1R5IB 4HH9B 4JANB 4YHOL 2WSPA 5FLUA 3VXTA 3BE1L 1NDMB 1NKGA 3RWGA 4PS7A 2CJTA 1EBAA 5DJXB 3VNYA 3AS1A 1K3IA 4PS3A 4MB5A 5HP5A 2IO5A 2PPCA 3QJHB 3HC2A 5FAAA 3ARYA 1LD9A 3BUDA 2WSDA 5HYJB 1NAMA 2IOOA 2JKSA 2OTUA 5CS7A 3WTWA 1RPUA 4N8VA 4XMPH 5JTWA 3UZEA 5E56A 1GYUA 3Q2NA 3VH8G 4L3CA 4ZD3H 2ODHA 3SQOH 4LKCB 4YEEA 4OV5A 1Q9OA 5IHLB 3A4FA 1S3KH 2MPVA 3T0AA 1JNHB 3G5VA 3OMNB 3EJCA 4KOCA 4A7TA 4H0IA 4TUKL 3N42B 4DP5X 5F93C 3VMNA 1FYTE 2V2TB 4KI5F 4BUGA 1OSPH 3NIFE 3RFZC 4G1EA 4JRXD 2ZYSA 4X8GA 1XEUA 4PJ8B 3EH5B 4IGBA 5E6IA 4PLJC 4HMEA 1W91A 3VAEA 5E9DE 3QZWG 1CF1A 2UZXA 5CJ5A 1T0MB 1ZLDA 4JO2H 5IHZB 3WDIA 4JVPA 3QQ3B 2VT0A 3HJ0A 4HWZB 1WDAA 1ITCA 2VDOB 3UIZA 3S2CA 4RGOL 4UQDA 2HP4A 3T71A 4PJHA 3B7RL 3AY4C 3QBTB 4EUPH 4LSRL 4EI6A 4W9GC 1I7UB 3OHXC 2D03H 4HV8A 4JLRB 3N1FC 3HIZA 1JWMB 4JG1H 4MD0A 2QTVA 1EVUA 5DRWA 4MMXA 1KCLA 2OLDA 3CN0A 2E47A 3F2LA 4H0LC 4QXTA 2ZSVA 5KVFL 4XR8C 1CTMA 5DJCB 3RGVC 5BRZA 1TUPA 1TJHL 4XNMB 1PW3A 3LV3B 2JFCA 2X4OA 2VDLB 2B1OA 3BPCB 3DDGA 3RVUD 4PJ5E 1SJXA 4ZFGH 1HHJB 4PRIA 3UCRA 4Z7AA 4JL2A 2VZOA 1KLFB 3GBDA 1A8JH 2ATPB 4KNSA 3PP3K 2CK2A 2YJLA 4WUKL 4JO5A 1QPKA 1FIGL 1GOGA 2ZP0T 2VE6A 3KCPB 3SYQA 4XGZA 3SSGA 4G6AC 5IROD 2LU5A 3VYOA 4OZHF 1PKQA 2WY3B 2XPYA 4ZMQA 1NZRA 2NTFA 3DUHA 4PRPE 3U46B 3ESVF 5CLXA 1FLTX 1TNMA 3KHQA 1J88A 1WT5A 2CALA 2FDBP 3BKMH 2YGNA 5B7MA 1BOGB 3ZZ1A 3WTSA 1U42A 2V2WA 3SY6A 1T03L 1KDIA 3E38A 3LVEA 4Y16B 3RHWF 4TN9A 3IFPB 4XX1E 1SJEA 1WEJL 3EDEA 3QCUH 3MA9L 3O3AA 4MDIA 1CI5A 4PY7B 5EN3A 3R0MA 4TLSA 3VXSA 1YEWA 4NKQB 4JO3L 4HUCA 2NY6D 3DMMB 5J1AA 4OD2A 5T5NF 2D4DA 5HHNA 4WEBH 3LTVA 4A04A 3CFTA 3BGMA 3IJ7A 3KAAA 3PP4L 2DLTA 4WTXA 4YUEH 1F11A 3N5AA 4GW1A 4ZRGA 1L0PA 1OV8A 3RY6C 1AS6A 4XWGL 3N2JA 2A38A 2XZAH 1L7TL 1QFUL 1VPOH 4LVHB 4UZUA 4FKEA 4M56A 3NSFA 2QELA 4M6ML 5DFWH 2HJLA 1T21A 2BNUB 4XO8A 1KSRA 4U6YB 5IVXF 5JXAL 4JPWL 2AK4A 4OZGE 4HSQA 5FA4A 4QD2E 2RACA 5AW6B 2NUPB 2KQMA 4GEIA 4K3EL 3U7YH 4KZEL 4J3TA 4F8PA 1RUAH 4WEUD 4JUTA 4R7VA 3X13A 1IBZA 2F53B 2ZSWA 4P49A 2FJFA 4YQXH 4UT6A 3I02B 5LLIC 2ZX9A 4LPWA 3LIZH 1EO5A 4P23C 3PJLA 2ARJB 1MJ7H 5HYSB 1Z32X 4LVNC 4QT5B 5KTEH 5I1JH 5BW7C 1TJIL 2ZOWA 4GUQA 4LESA 5LKNA 1NLDL 1P2CB 2QQKH 1Z66A 4R8WH 3VA6A 3KLDA 1ZSDB 2NCEA 3LEYL 3IFOA 3AXLA 1B2WH 4JFED 2WP3T 5EO9A 4HEPG 5SX5K 3Q48A 1C1EH 3MSPA 4Y4HD 3WIFA 3HMXH 1JXGA 5FHBL 2XWJB 1HHIB 5IB5A 5DUBA 4MMYA 4UF7C 3UBHA 4IJ3C 3SDXE 4Z7WA 1XMWA 1KIPA 5AZ2L 3WNKA 2CGRL 1RIVH 1CPUA 2VJ8A 4PJCB 2AQ3A 1U3JA 2B4CL 2OYKA 5F7YC 5JHBA 4N2CA 5E1AB 5IMLB 2JB5L 5IM7B 1JMXA 4OKVB 3LYRA 2Y36H 3KPQA 3U1SL 4DZBA 1BF5A 1A0QL 3FH5A 4MCNA 3TZVC 1AO7E 1Z9PA 4HJEA 1TPXB 4CMHC 5D4JA 3FSWA 5E94A 5E5MB 1S8DB 3I6GA 4MCMA 1D5MB 4OQTA 1YECH 3KWVA 5B39B 3TBWA 5C0NC 2VSCA 5I71B 2Q1EA 3KPPB 2UZYA 2X89A 4UOQA 3O6ML 3HS0B 5D55A 2UY7B 5F6IC 3FB7B 4H0HB 2YPVA 1LEKB 4U1HA 2Y6SD 5SWZB 4A2EA 5BZDB 3P4MA 3MXWL 4FMKA 3VGAC 5HPMB 1DVFA 4ZPTA 5AVZB 5KVDH 1CLOH 1BAFH 1FNLA 1E4HA 4ENED 1CE6A 3HRZA 2GTZA 2HFFB 4HWEL 1W8EA 4IRJC 1LO0H 3SO5A 2XG5A 2PYFA 3O41A 5I30H 1A6WL 4GSUA 1D9KC 4KTYA 4YDVB 1GMIA 1F4YH 1DN2A 4YDIH 2LVEA 1SXAA 2R0WL 5D1QA 2IQ9H 3N1GC 1UXSB 4CADA 2UWEA 4W4OA 2OSLB 1R17A 2W9EH 4QRSB 5D1XD 1IAIL 2Q9OA 2J4WH 3LZFL 4E9VA 4QHUA 4G82A 3DX9B 2ZPKH 3VB9A 3DI3B 3OAYK 2H32A 1E40A 1RV6X 1I82A 3Q6GH 5T1KA 1T7ZA 5IVNA 4MMZC 1WZLA 3W0WE 3HLAB 5I8OL 4X6DF 4X9IA 3TCTA 4ZFFB 3N40F 3ZDYB 4BJLA 1J48A 3VXQB 1KTDB 1NGXB 2BHZA 1NFKA 1H3PH 2C34A 2Y7NA 3P4NB 4IKKA 4OCLC 4N68A 3QQDA 4JREB 3B7TA 3CVDA 1AMXA 3GZPA 3NPZB 1KJ2H 4PJIA 5GZNC 5TFSL 3O3BA 3OKNB 3Q8CA 3D85B 5CJOH 1N7MH 3UGEA 2CIIA 2GC7C 3JUZA 5EORH 5DYFA 1XGYL 2HX7A 4L1LA 5EIIA 3AGVA 2I27N 4MASA 4HPYH 4ZO6A 3MLWH 4UWQB 4XBPB 1K2DB 4DPCX 4K7FA 5IQNA 1A7PH 3OJDB 1E28B 3QIUB 4FG6C 3D51A 3S35H 4UIMB 3BP7A 5IK3A 4NO5A 5DJ0B 4KKZA 5DVNA 1M7XA 4I2XA 3CFUA 2JJTC 4PJXE 4B97A 3MRNB 1LDPL 4Z3GA 1U4EA 1VADA 4J5VA 4LEOA 1F6FB 5E23A 1WO2A 3CN1A 3VU1A 1B4JH 3QISA 1FFRA 5IVXE 5I5IA 5CEZL 1BF2A 3PYCA 4Y2LA 4P3CH 5F89A 3AREB 4WHDA 2M8XA 4I4WA 7CGTA 4EVNA 3HG3A 3CBJB 4NX0A 2WO4A 2H2SD 5I6XC 1KELH 3TURA 2ED9A 4ZW8A 4ZTOH 3MJ6A 3GBNL 3K4AA 4YHPB 5MEOA 3OG4B 2AJVL 4KDTC 4ES9A 4TSCH 4BZ1H 5CLTA 1X9RA 4OZFB 1IM9D 4ABUA 1NKRA 4XVOA 2NYYC 3MV11 4XC1H 3MV8A 4UT7H 5ISZD 5DD0H 3Q44A 4UYQA 4RRPA 2BHYA 4NN6B 2EKSB 3MO1B 1QO3A 3GIZH 4JHZA 5G5DA 43C9A 4AIXA 4EMZA 2YAHA 2E7LC 2EH8L 3U6RA 3AACA 2DMBA 1UM6H 4DN4H 2BY1A 5JIPA 4RMRA 3WFZA 3V6FA 2C9QA 4OD3L 4FXGB 3KYAA 1HKFA 4Q9RH 3FT9A 2O6CA 3RY5A 5LBVA 3TVMC 5KJRL 3B6SA 3LN4A 4ZUVA 2N0KA 2YD3A 1GH7A 2A74B 3MUHL 2PYED 2JLLA 4JY4A 2YWZA 2NY4D 4WWKD 3VXOB 4Y2DA 2AXWA 1XCTB 4FNLH 1I1FB 4UANA 4LSQL 2I9LB 4YL4A 1JHKH 3KBEA 3MNWA 1P9MA 4OLEA 2PPAA 3PWJB 1PLBA 3UFIA 2ZUTA 3SGJA 3R1GL 1D7CA 1FO0L 2Y69B 4YHIA 1DLFL 1W0WA 3E0GA 3WEXA 5HHOB 3O6FA 4HWBH 3BZ5A 3RZCC 4JM2C 1CD0A 4EI5D 4JFOB 4OU3A 3DJTA 1INQB 4L8CB 5CGYD 3FYEB 4RNRA 2PCFA 4Z7OE 5INCB 4HK0B 2UY6A 5B21A 5C6PB 4GJTB 1A64A 1UHVA 3ZTJG 3H9SB 1UB5B 1WZ1H 2V7HB 4MNQE 2RQEA 1BZ7B 4MA3B 4HKXA 4JZJA 5FYKD 3QR0A 5EZOL 5IBLC 4FMVA 2ERJC 3TN0A 4Z3TA 4U6XA 4EQ2A 3BPOB 2XN9D 5FW6A 5JORB 2UXVA 1KYAA 3LS4L 2VZ1A 3KXFD 2Z0UA 4RWHA 3BQUD 1YJDH 5D7HA 3SDDA 2FJHA 3HZYB 3FPYA 1GPOL 2JCCA 5D5MA 5EB9A 5C2BL 3JV6B 4FXKB 2A7BA 1QAWA 1SHSA 1BJMA 2R1XB 2ZOKB 2NXZB 5HHME 1LE9A 4OAWA 1SM3L 4LRIC 3WDHA 4POYA 4PEEA 2AXGB 2NDGA 3QWOA 2RQ8A 3EBGA 4LCWB 2AV7A 1AKJB 4WGKA 1I1CA 4XVUC 3EH3B 2D3JA 1NBZA 4NQXB 2KH2B 2P26A 5EO0A 1CZ8H 5KAQF 5AG9A 4TMPA 2OYMA 3ARGD 4LEXH 1MCQA 4NRXA 3TV3H 1FAKT 3CVHH 4TSBH 4PJBB 1DANT 3K4ZA 4KC3B 3T2PA 3WD5H 3HS8A 2WAQA 4APQA 5I17A 4PJFA 2ICEC 5DJ6A 1AQDB 3RL2B 5L2JA 3BKCH 2VL5B 2YEQA 4K71B 2Y2WA 3UTTE 3MU3A 3DX7A 4X7SH 3VI3E 2PO6B 1RVFL 4YIQA 5BV7C 4QOKA 5E2VL 4GBXD 5JPNA 1I3RA 5L4JA 3RUGF 3F3HA 4O02L 2FLBT 4IDLA 3SBRA 2YC1B 2AXFA 4XP9L 5HVFB 2F7RA 1IGTB 4NUPA 2VISA 1F2QA 3M1CA 1YYMH 2VW6A 2Z35A 3FBQA 4MWFA 3MFGB 1DJWA 2ILLA 4NI3A 5SWSA 5A2FA 4MQSB 5KBNC 4FHBD 4R0LC 5EIVA 3RDJA 5D2NA 1KENL 1BEXA 1SGKA 2IH3B 4Q0XH 2PABA 1ZVNA 1TPXC 2A4CA 4F8NA 1GS6X 1NBQA 1SVZA 3ECVA 3GSVB 4NUGL 3QHFH 1VIWA 3FQ1A 2GI7A 1GC1L 4WJ5B 2G75B 4GI6A 4OJCA 3SBWA 5ERWB 1VSCA 2BJMH 5LBSH 3IXTB 3REVA 5GS0L 1E5AA 4YH6A 2CDEB 2IC2A 1N10A 4Z9KB 1ZIAA 3O2DA 1HIML 2BOLA 2VJXA 1QBLL 2CLRB 1KPVB 1QRND 2WTOA 2IWEA 3MLZH 4P2OD 4O5LH 4ZS6C 2QSQA 4AM0Q 5FYKU 2FATL 3JWDH 3ZT6A 1I7ZB 2A6IB 2G30A 2VL4A 1HH6B 2UXFA 1H15B 2ZUQC 3FTZA 3GSNA 4NQDB 4QHKI 1INEH 4PRDA 5FW8A 5F1NA 4HFWB 4K5OA 2JH2A 1ZLVH 1FO0B 2YGPA 1AQKH 4HSCX 4S1DD 2IFFH 3QS3A 1NQBA 3LD8C 5AVUB 4L29B 4ELKB 1WWAX 1GY1A 2Z34A 2R9HD 1WP6A 4XTRC 3RBSA 3KLHD 5E95B 1MW2A 4MZ3A 3FT4B 1U95B 2H3KA 4NIKB 2P46B 1O6SA 2OAAA 1CFTA 5IMKA 1UADC 4BWUA 4PGJA 1J5CA 5IQLA 2OCFD 5FF6B 3MLUL 3KG5A 3O8XD 4H1LA 2Z92A 3T6WA 5FGCB 4B41A 4HUXA 2BVQB 3FFCD 4OGQC 3HG1A 1KBWA 3WS3A 4MAUH 1UEMA 3CHXA 4NFBA 4WV1B 2TRHA 1D7FA 2QVFB 2WNGA 5ESAA 5K9QG 4E9SA 1KTJA 1MJJB 3LZNA 4IOSD 4C56D 4F9LC 2RAMA 4I0PD 4PP1D 5IHUH 4G8FA 1UM4H 3OX8A 2LU4A 5CJ8A 4HJJL 1S7QA 2EILB 1WBXA 2FUQA 1TTFA 5CMAB 3JT2A 3PHOA 1A4KB 1VKXA 1AGCA 4XBMA 1WE5A 5HPOA 4KFMA 1T04A 1UWXH 5K9OB 2C3HA 4TF4A 4FYRA 1RK1B 4LHQB 1G6RA 4KHXH 2AQTA 1CBJA 2P5WD 4ADJA 2DLIA 3FUHA 3WNOA 5F88B 5TDPA 1JPTL 5EO1A 3DC0A 3QUYA 2PKDA 2YBRA 3PS6A 4HQQL 4NXKA 4F2EA 4EN3D 4AEIH 4FTVD 1LEIB 3D05A 3F05A 2HKHH 4ONGH 3PAZA 3V4VH 3AXHA 5C0CE 1XBDA 4UQIM 5L8LB 4Z1PA 3EJTA 1SRDA 4KRPB 5F72S 4BFJA 3VXUE 1DJXA 4H8QA 5DQJB 1G7QB 4K9EH 2GCYB 4HX1B 3RAJH 2VDRL 3H8NA 4QHNA 4BKLB 1JF1B 4O02B 4ONFH 4KROD 2IDTA 2QV2A 3HE7D 5DK0B 3NJHA 5ID0B 3NZSA 1CGUA 1R5VA 4F1ZA 5GGSY 3R18A 2QSTA 1H9VA 3PCYA 1LDSA 3PJNA 1BYPA 3N85L 4RDQF 4Z3EA 3OHMB 1Q72H 1OAUH 2VNCA 2VN4A 3V0IA 3SODB 1UT9A 2YSSA 3X3GL 2FD6H 1XGTA 1IBGL 1OAKL 3BIAX 4AQAA 4XPFL 1N8OE 3OJMB 4UTAA 1OTSD 3ARBA 3S7GA 3LZRA 2X10A 3ARDD 4H5SB 4Y4FB 3RTQA 3DX6A 2SEBA 1U8MA 2YAQA 4BV1A 3IM1A 3FU3A 4DEPB 1NPUA 3QZMA 4JRYE 4LCCB 4UILL 4ZT1A 4HZLB 4LAJH 2WIIA 2X6CA 3CX5J 4TXVB 3IMBA 4IU3A 3VB8A 3RUGE 4Y5YA 5D8JH 5A43C 4X83A 1S9YB 2BW5A 3BXNB 4XVSL 3BCDA 2A74C 3UGXA 1Q9LA 3OLGA 1B0GA 2EUVA 4L4VD 4H4NA 3EXLA 2OR9H 1MHPH 4FQXB 1N0XL 3D87B 8PAZA 3OMIB 2NR6C 2E75C 4IOFC 2DI7A 4Z7QB 2N7AA 4N87A 1K6QH 3TBTA 2R2CA 1M6OA 3ZKMD 2GYSA 1MRCH 3KR3L 1WUNT 2XWTB 4N86A 2IOIA 5GRVL 1N19A 2EC9T 1R1CA 3MFFA 1Q94A 4LOUC 1MN4A 2K4AA 3TIEB 4NRYB 2W07B 5JPMA 2VXSL 2O5XL 1MPAH 1I1YA 1WGVA 3DPBB 3T0BA 5BS0D 3L13A 4G59C 5DA0B 3LSOB 4DW2L 5EC2A 1JDCA 3N42F 5I1LA 4HUVB 3T6XA 5DT1H 1LNUB 4Q97A 3B3IB 2YO3A 4TPRH 1FBIL 4QRUB 4NZDA 3SKJL 1G7MA 1PLGL 2JB6A 3GHBL 3AB0B 3PWPA 4J8QA 3TEZA 1R47A 5I15L 2VLKB 3NJJA 1A8ZA 2VDKH 4HEMA 4O58H 4MD5A 5E4EB 2JSFA 1A9BB 2XICA 3GJFH 5FO8B 3EYSL 1JTTA 3VXOA 5EFIA 4AQ1A 1A47A 1S7UB 3JWOH 5I0ZA 4E2OA 4FFZH 4PS4L 3U2SA 4G7VH 5IKCA 2VXVH 5CSBA 3ZMNA 5EU6E 4X4MA 2J1WA 3L3OA 4GSQA 4LAQH 1EX0A 5D7JB 3FB6A 1E9PA 4H26A 2PLTA 1JPFA 2O61A 3V7AG 4AE1A 3PGCA 1EUUA 1OGAE 5AW8B 5FR3A 3S2AA 3RILA 1A1MA 4FTDA 3UYRL 1JWUB 3V9FA 2AQ1A 1IC4L 1DSYA 1P6FA 4PMFA 4XVTL 5IF0B 3NZHL 2A6KA 2JXMA 1XIWC 3P3RA 4WCYL 5FDWB 4ODVL 5GGTL 2JJUA 5AUMA 3EBAA 3MJWA 3CN3A 1MFAH 3STZB 2VUOA 4PG9B 2IALB 3HHSB 2AJ3B 2AMGA 1MY7A 4D9QE 1J8KA 4KPHH 1KC5H 2EVHA 1S7RA 4H0GA 4HBCH 3W39B 1EERB 2A9MH 2J7LA 3PV7A 5C08A 4OCSL 4WTZA 4XBGA 3KL3A 2YKLL 1RU9H 2XFXA 2VDRB 3BUIA 4X7FC 5E70A 3ALXA 1XR9A 4Y0GA 2J73A 3VW3L 5DQ9B 1EDYA 4K23H 2UVFA 4JO4H 2VZVA 3U2JA 1WFJA 1G7PA 1M2VB 4UZSA 5DR5H 1SLXA 2FZ3A 1FFOA 2EDWA 5EBMB 1T7XA 4KUZH 3NSJA 2FYVA 2E8YA 4HDIA 5TE6L 1KCVL 1RJYB 4GIPD 3DARA 5AG8A 1KXVC 3DK2A 2NXYD 4RVBA 3M17A 1WLHA 3MDJA 4MDRA 3SCMD 1AOZA 3T0EE 1B3JA 3MX0B 1F8TH 1IKNA 1I3GH 4JCMA 1SVBA 4HC1H 1AXSB 4IM8A 4YXHL 3HAEA 4XAWH 1ZY9A 2IAND 1HSBA 4O9HH 1DDHB 3KWWB 4OM0L 2LU3A 1I9RL 2VC2L 3KBFA 1X5KA 4LSUL 4NZTH 2IPKA 4KH9A 4Z76A 4KUCD 4M93B 5AKVA 2DQJL 5DUJA 1DBML 2AMUA 2W95A 2H9GA 5FK9B 4ZFZA 5CGMA 4FQJL 3TA3C 2FWSA 4HHAB 4X4YB 2WKOF 1Y07A 3Q2WA 3QJZA 4AUJA 1UOWA 2J8OA 3J7HA 3VMOA 5EH1A 1XB6A 1HHKB 4QAWA 3W9EA 1P7KB 2WK2A 4B53A 4E5XA 5IESH 3ARFC 3P54A 3SN6N 2CRZA 4DN3H 1U8NB 1E3XA 4IU2B 2VR4A 5AW4B 4B9YA 3BIBX 4CKQA 3M07A 3TJHC 1P5UA 3M45A 4MD4B 3CZSA 3WLBA 2DQMA 3ISWA 4J3VA 2G9KA 1A1OB 2EDBA 3L3HA 3QH3A 4QKXB 5J8OA 4C58B 4PIBA 3TFKD 3O6KH 1X9UA 2OSXA 4LSDA 1VJSA 2D7MA 3PRZA 4MAYB 4FI7A 3GMPB 2EIDA 1S7TA 3PDGA 1M05A 4AVIA 2ZJSL 3MACL 4E9YA 5HYJE 1HXMB 3JWDC 4KKCD 4JJ5B 1PX3A 1PZ5B 4PSRA 4TUOB 2XTLA 1NBVL 1MWAH 3CDZA 4ONOA 2X4QB 5CIPB 4HUNB 2G5BB 1X6LA 4XOEA 1OK0A 1QSZA 1LILA 2R83A 1IJ9A 2F19L 3RVWD 1XZ0B 4GS7B 1U58B 4I77L 4DO5A 4PJCF 5IUSA 4W9ZA 4JQIH 2D9QB 5ABZA 2W1NA 3WNLA 3IMTA 4ZUUA 3RKDC 1YEDA 4TVPL 1D6EB 3S36X 3N40P 4WSGA 2EO9A 2R2BA 5D7LD 4AZ8A 1I8MB 3C5XA 1G1OA 5LO7A 5CXPA 7PCYA 4HIJB 4KKQA 3K2UH 5KYXA 2YN3A 3KYKL 2BVEA 4FADA 2DH3A 2XA3A 1VACA 2NNAB 2JTDA 3BWUC 3DBSA 4F7PB 3GTNA 4B60A 2VKXA 3VXTB 1WAAE 3GHPA 5AW2B 1MI5E 3RWGB 3WMPA 4PJ9C 4NHCL 3WKPA 3F62A 3VD7A 5AAMA 3OAZK 5C07D 4PW3A 4N2LA 1V10A 1PG7X 1LD9B 4UINH 4Z8FH 1OVZA 5LCVA 1NAMB 2HT3C 3BKYH 1TQCB 2OTUB 4N8VB 2FJUB 1DBJH 1PIGA 2B9BA 1GKEA 1JPSL 1SY6H 1EJ8A 4L3CB 4KXZH 2EXWC 3K6IA 1HESA 1BXXA 5I1EH 1KNOA 1U8HA 1Q9OB 4OV5B 4WRLA 3V7MA 1KCBA 4XAKE 3G5VB 3LNDA 4UT6L 4DVRL 4K3JH 4YC2B 3OAUH 3WKML 5GS1A 2EZ0C 5SX5H 2B39A 3IPEA 4RMBA 1JV5A 4C8XA 2BSRA 1AZUA 3D34A 2IQAA 4G1EB 3P4OA 4IGBB 3IN0A 5E6IB 2DM4A 3E9TA 4I1RA 4PLJD 1F56A 3MNDA 4K5PA 1OCOB 1CF8L 4XPAL 4JFQA 4B27A 2UZXB 4D94A 3B8YA 3NCCB 4U49A 1PY9A 2L8AA 1GZPA 4XNAA 4NJ9L 4YMPA 5IUCA 5ALBH 4K9EC 5CFAA 5EU5B 3U1QA 3WJJA 4PJHB 3ZDYF 3QK0A 1JZ5A 5BJTA 3Q1SL 5JW4M 4HA1A 4EI6B 2QGBA 5DMYA 4HV8B 4Z7NE 5IOKA 4A38A 3OPZH 4MD0B 1GY2A 3BAXA 5DRWB 4KQ0A 4MMXB 3QPXL 3VFVA 5BQ7A 3BKJH 2OJEA 4BSJA 4YK4C 3CFEA 4A7GF 4QXTB 2ZSVB 2XKNA 4R26L 1B88A 3RGVD 3L2LA 5BRZB 3AZUA 2C3WA 3QAZB 2DQEL 3EYUL 2X4OB 2AXHA 4Y9FA 1HOEA 1SHMA 1N64L 3M6DA 4IMLA 1DQKA 4OQTL 1AY1L 4EOWH 4N0UA 1I31A 2CHNA 3BVNA 3QEGH 4PRIB 3G6JE 2EH7H 3NPSB 2RR3A 2E8ZA 1Q0YH 2ZCHL 5F7DA 5TD4A 1ED3A 2YPVL 3FULA 3J2PA 1JFQH 3KW7A 4Q89A 2W81C 5A6LA 1NEZA 2Q3XA 2W0FA 4GUPA 3HS9A 3FT2A 12E8H 4KZDL 2JIXD 4XZUA 1UWEH 1NM9A 2VE6B 3T0VA 3NJXA 5C0JA 4XGZB 2DTMH 2X6BA 4HT1L 1K9TA 1SFHA 5TK4A 1PKQB 4A55A 3TBYA 1AGFA 3OAYH 2NTFB 2F53E 4DP4X 1MCPH 3KLKA 3UG5A 3S36H 4JRXA 1BG9A 2O5ZH 3WO4B 1NEPA 2V2WB 4LSSH 1KZYA 5AVWB 4YSOA 3CD4A 2IF7A 4MFHA 5JIMA 3Q5OA 1G9MC 1SJEB 4MDIB 3O3AB 2YHGA 3UC0L 1BXUA 2V5YA 3DIDA 5I19L 3VXSB 3MV01 4OQ1A 5J1AB 4OD2B 5EC1A 3MBXH 5HHNB 2VJ0A 2I9TA 3BGMB 4OJEH 1PG7H 2XLLA 3MOBH 1OPGL 4ZOEA 1PZSA 1F11B 4GW1B 1JHTA 4H20L 2AQQA 3F5WA 2OBGA 4J6RH 3MCKA 1TO5A 1X4YA 5F44A 3ISYA 3JWOC 3TJEL 2HJLB 1T21B 2FX9L 3CVBA 1RFDL 1IIIA 3ZR6A 4PJCE 2AK4B 4UQAA 3BWSA 5FA4B 3C9NA 4U0QB 1SHXA 3US1A 3B7SA 4R4BA 5I5JA 1KOAA 4MB1A 3SPVA 4OD1L 5DXWA 3DSNA 5KVFE 4N25A 4AL8L 3X13B 2ZSWB 3C6EA 3HUJE 2FJFB 4Y9BA 1NL0H 1NCHA 2ZCKH 2NY5L 3V0JA 2ICCA 1BYOA 4IBYA 4P23D 4LSVL 4X8CA 4FFVD 1NIEA 2F08A 2EVGA 2EVJA 2GK0B 4P9HL 4PN6A 3ZQ9A 1QSVA 1OP3K 5IROA 3QSKB 3UO1L 5D2LE 3IFOB 3AXLB 5CZXD 2VW4A 1SJMA 5EO9B 1UG9A 2R27A 1JRHI 1UD6A 5DWUH 3GLZA 3WIFB 5CCJA 2XUWA 5IG7A 3AM8C 2DWYA 1SXZA 2YEZA 1G94A 2J5LC 5A16A 4JHWH 1LP9A 5FHAH 5IB5B 5I76A 5DUBB 4MMYB 2AERT 4ZMYA 4R7DA 2AJZA 4Z7WB 5DJAA 1DUZA 1KIPB 2BNQD 2YD7A 3HE6C 1JOIA 2NZ9C 4ESKA 1QKZH 5T3ZL 1I53A 1RUML 2P7TA 4JHBA 4WQOA 1L0XA 1K72A 2CHWA 3P4LA 4PJAE 2G3MA 3KPQB 4DZBB 3TEWA 3WNPA 3TZVD 4HKZA 1AQHA 3B4NA 4JFDD 1RULH 3SD2A 1N6QL 5E94B 1JI1A 1QD0A 3I6GB 1FAIL 5KSUA 1IKFH 2X3AA 4HGKC 1CUOA 4G72B 3TBWB 3ZYOA 4ZPVA 5DD1L 2UZYB 3EUDA 4YFEA 3ZDYE 2FLMA 1IMHC 3CDFA 4U1HB 5I23A 1NICA 4XODA 3P4MB 4S1SH 3RIFK 4PJBF 1DVFB 4ZPTB 3HEIB 1Z1WA 1LMIA 3FHQA 3FAWA 4B9PA 1CE6B 3HRZB 2GTZB 3D0AA 2DQGH 4IRJD 2O72A 5KZCB 2XG5B 2PYFB 1CLCA 5FYLH 3O41B 5GGVY 1EHKB 4KOBA 1D9KD 1ROCA 4XX5A 1KTBA 4AQOA 1E4JA 1MJ8L 2ZKYA 4LASH 5EOCJ 4PGZA 3U0PA 3OQ3B 1F6LL 3US9A 3K3QA 1YRKA 5D1QB 2J72A 1OTUC 3OG6B 2GFBA 3DX1A 2YXMA 4CADB 2UWEB 1OAYH 2BRRH 3D3VE 3JTBA 1P7HL 4JFEA 4QHUB 1A3RL 4PVNA 4NPJA 2VM4A 4UCFA 3EJYC 2QKSA 2JKRM 2H32B 5E5UB 2JE8A 4WO4C 2IBGA 4UQ9A 4Q6IC 1LL1A 1KJMA 4NB7A 3FUIA 4J3BA 5IBUB 3DDFA 5T1KB 3S37X 3NAAH 2F5BH 2NT0A 2Q2LA 4DP9X 2B2XL 4AE0A 3TT1L 4K7PL 1E5CA 3ZUCA 4Y1AD 3VFUA 4HCGA 4JQVC 4M5ZH 5D9SA 3WNJA 2J6EA 3NP4A 3WKNA 3LZPA 4MNGA 4LEEA 1RUQH 4KMQA 1FZOA 1A2YA 2EYRA 5E6ZA 3IGKA 2WW8A 4LSTH 5GZND 4FYQA 4PJIB 1A3LH 1MSPA 4J2XA 1J8RA 3O3BB 2H5UA 2KLSA 4RA0C 3QC6X 2CIIB 5I74B 2WGNB 4PV9B 5EIIB 3MLVH 3P69A 2AABH 1CIUA 4EO5A 1ZLEA 1FGNH 1A4AA 3NABH 4K7FB 3SO3B 4NHUA 1MEXH 1O6TA 3BP7B 5IK3B 4NO5B 4N0YH 3VM5A 1YPZE 4WFGE 4I2XB 1TETL 3QPKA 4YX2H 2JJSC 5FM4A 1VADB 4LEOB 2XNAA 1KB5A 1CIDA 3DX0A 2HTKD 3VD0A 5C9JA 5GRUL 4TRPL 3LDBB 2IIJA 4M6OL 1LK2A 2F68X 5F89B 5ACZA 4N26A 4I4WB 5ID1A 4PG2A 1JI2A 4EVNB 1CS6A 3FUJA 4HBQA 3UTSD 1VFBA 1RZFH 3BAIA 4B9JA 4PB9H 4EKXA 2CK0L 1AKPA 4V2CB 5MEOB 4EAEA 2WLJA 3AGWA 4LLWA 2EDKA 2CGZA 1I85C 3D4CA 5HHOE 3WHE1 2AC0A 2NYYD 3MV8B 2NY0C 3GMOA 2VZUA 2Z65C 3HFFA 2DIEA 4JFFE 4MHHI 1RK7A 2D2CC 1QO3B 5G5DB 2FK9A 1QYGL 43C9B 1PEZA 4JRWA 3HAEG 2OMZA 5AEAA 1E6OL 5C0IA 3X11A 3U6RB 5GRVK 5HGDA 1OANA 4Q7DA 2ZUUA 2TRYA 1J7VR 1R3HA 3V6FB 3ZYZA 4M8VA 1R3JA 2Y23A 4PBDA 4RGNB 2IGLA 5EN2B 2MCPH 3TVMD 3B6SB 1RZJH 4JY6A 3LN4B 4ZUVB 1ZHNB 3QORD 4GXFA 4ORGA 1FLRH 4YNYA 4GRMA 2IH8A 4JY4B 3WXVL 1I7RA 1NMAH 4LKXA 4PBXA 4B0MB 1EZSA 3DX8A 3O2DL 4Y2DB 4KITB 1E50A 4H8WL 4AIEA 1RJLA 4M02A 3WY3A 5EOQH 3MNWB 4U7SA 1OM9A 3D52A 3CN2A 2FSDA 3CZFA 4YO0A 5AKRA 3GSNL 2X7LA 5GJSH 1PZUB 1Q8MA 3Q2VA 5CJXA 2H6PA 1FORH 4JPVH 3THMH 2X4SA 4YHIB 4PJGA 1W0WB 1R3KA 3QFDA 3WEXB 4LCWE 3O6FB 4X98B 5DFVC 1MFNA 3DWTA 2QPSA 4K8RL 1V27A 4JM2D 3WS6A 4BKSC 3RZCD 3UEQA 1BYNA 2VDPB 2EQDA 3L8QA 1W16A 1NGPH 4YHOH 4N8CL 3WUWA 4RNRB 3BE1H 2FB4L 2PCFB 3GMMA 4PJBE 4PIRF 5L6YL 1YHPA 2UY6B 2ZCZA 5FYJU 5CEZE 5IB4A 3K81A 1LLAA 2OMUB 4UNVA 1CFSA 4F7TA 4HKXB 4JZJB 2YR3A 3W2DL 3ZIYA 3FCBA 1IM9A 5ALCL 5TH2A 1B9KA 3TN0B 4U6XB 5K9JH 3L2MA 3L3GA 5JW4Q 5JMOC 2WPGA 3PL6B 4FQCH 3OZLA 2MMXA 3SGKA 4BH8A 2FJHB 1MQ8A 2W60A 5L88L 4M5TA 2OP4L 2JCCB 4JPIA 5D5MB 2DL2A 3GIVB 5DZVA 5JQ6L 4TUKH 2AZAA 1LE9B 3AC0A 4OAWB 1A6PA 4W9EC 1M71A 3MV7A 4Z7QF 2C4FT 3MRGA 4IDJL 4G6JL 4OSUL 3QWOB 5LVEA 3LZOA 3RQ3A 2AV7B 1BQRA 1QUNA 4XVUD 4AG4L 5HYFA 2YMXH 1MW0A 1NBZB 5HYQA 1TQBB 2N01B 3N3EA 2PYEA 5EO0B 2ZD0A 5ESQA 4FLHA 2WWKT 4JDZA 2EUZA 1W6WA 2AQPA 1JCKA 5I8CA 4RGOH 4ZMZA 3WI9A 5DD6A 1EHLL 4M1GL 1OP9A 3II2A 2M26A 4LSRH 3RIFF 1IEBA 2AJUH 1OSYA 4APQB 3KGSA 5I17B 1DFBL 4GSDL 2FBJH 5DJ6B 3WMQA 2FT8A 4ELDA 4WW2A 5FM5O 5L2JB 3OVUB 4NQCB 2WVVA 4PGBA 1LQBC 1CXHA 1CU4H 1H3TA 3DX7B 4PRBA 4YIQB 1C08A 4JDTL 2WBXA 4QOKB 2V5SA 5JPNB 2CLZA 4EI5A 1I3RB 1JWSA 3M1BB 5KVFH 4M03A 4YSSA 4HGMA 1RAMA 2P45B 2R0KH 1B0WA 1TJHH 4WI6A 5CGBA 2FH6A 2RALA 2AXFB 1UXWA 4A2GA 2VISB 4HZ1A 3O0LA 4MWFB 1G9NL 2Z35B 3H42L 5K1VA 2A6JA 4MJ6A 1BJ1J 3AQYA 1JVKA 5SWSB 3O4LD 5E00A 3SBPA 4ZX4A 1PZ3A 3OSKA 1IBBA 5D2NB 5J11B 3IF1B 3S3DB 2ID5A 1N59A 3X12A 1VEPA 4AV5A 3QDGE 1AZZC 3M7OA 3MYJA 4ZQTA 2XN9A 1Q9KA 4WUKH 4FA7B 4UTAL