3FT1A

Crystal structure of pollen allergen phl p 3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
AVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEEQEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Phl p 3 allergen
publication title Crystal structure of pollen allergen Phl p 3
rcsb
source organism Phleum pratense
total genus 17
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3ft1A00
4FG2A 2BH0A 3D30A 2JNZA 1N10A 3FT9A 4JJOA 2HCZX 3FT1A 4FFTA 2VXQA 4JCWA 4FG4A 1WHOA 4FERA 1WHPA 4JS7A 4L48A 1BMWA
chains in the Genus database with same CATH superfamily
1OPGH 3TWCH 4RFNC 2NY1B 4ZFQA 3FULA 4FC3E 5FA4B 4M1GL 2FX8L 3DHJA 2HSIA 2DI7A 3ZTCC 3P02A 1YG9A 1OSEA 1YYLL 1HQ4B 1G9NL 1YNTF 4BXVA 5ERWB 5ABZA 4XP4L 1WCBB 4KX7A 4AYDC 4KJWD 1JXGA 3QULA 1P4IL 1YEFH 3VFPA 2V2TB 2J6EA 2YA0A 4G43B 1ZHBA 1GXEA 4TTDC 3MGAA 3CFCH 4PG9B 1HCZA 1KPUA 2ADGA 2GVYA 1NBYB 3U9PL 3VGHA 1MRFL 5IMOA 2D7TH 1G1OA 1AQDB 1L0YA 1W0VA 1I7ZB 1AGEB 3BQUA 1SUJA 3CFIC 3E8UL 4S1DC 3LPWA 4WO4C 4A63A 3L1OL 1PG7W 4PP1C 4ANXA 2AXFB 1YNTA 3I50H 5E2UH 5BS0B 2WUBH 3JWDC 4ERSH 1WUZA 3DO3A 4U1NB 1DJXA 4ZQTA 4LIQE 5JHDD 1TCRA 3WIHH 4D0DA 1L0QA 2LU7A 5D1QA 3PP3H 4LEEA 3EO0B 5LGYA 5BMFL 1I53A 5F7EL 4L4TE 1XBDA 2H7WA 1F58L 2P5EB 3LHPH 5EU7C 1F8TH 5BXFB 2BVEA 4HKJB 4PJ8A 5T1LB 3TBCA 5CS7A 5CJXC 2V2WB 4OZGA 4DP1X 4GAGH 2GBAA 3ZGHA 2PCFB 5BO0D 1QFOA 2FDBP 3T4AB 3T8MA 4TLSA 3KEHA 3DI2B 2NW2A 3OAZH 6PAZA 1ET8A 5IOPA 1R5WA 1UADC 2HLEB 3KLAB 5T1KD 2XTLA 3TLRA 3UFIA 2BNQA 4LXFA 1JP5A 5C07E 1J8HE 4A2GA 2K6YA 1JI1A 4OCLC 3IFPA 4YHLH 1VF5C 1RK7A 2Q3AA 1WA1X 3IN2A 5L4IA 4F9PC 5A2JH 3LHAA 3BAEH 2UZXA 3ZL4L 3D0AA 4IRJA 4IYKA 3O3EB 2NY2C 2ODHA 5F97E 4L8DA 1B4LA 3FUKA 2ZSVA 1KT2B 3JTSB 1N5YH 2GSIB 3ETBJ 1Q9WA 2F9BT 3AS0A 1I8MA 2EH7L 3CLFL 3PWPB 4AE0A 4A2FA 1QRKA 5EPMA 4JFDD 4R90H 1IVLA 1N8OE 3MSPA 1SBSL 3V79C 5ECGA 2P7TA 4XAWL 4NHUA 4NAMA 5ESVA 1HHJB 3CDZA 2FHCA 4OD3H 3ZQXA 4LF3B 2FQFA 4ZW6A 5JOFB 1HL9A 3Q8FA 4Q74A 5GS1C 3SE4C 2QQNH 3FAWA 4JG0L 1OAJA 4IBQA 1VPOL 3ZY7A 4F9LC 1E4KA 2XX0A 5E2TH 1F41A 2APVA 2IAMA 1JF1B 1UD3A 3VI3E 1KGCE 2G2NA 1LO2L 2F74B 4UDTB 2VMDA 4HVBA 3ML8A 3HUJB 1F6LL 2LLLA 5GGRY 5IJVA 3STLA 2XNAB 3D5OF 5HDLA 4K5LA 3GSVA 2XV6B 1E5UI 1QFUH 1IC5L 1JGEA 1JTOA 1Z2KA 4X8JB 1CE1H 4KKBC 2J72A 4BYHA 1BHGA 3IB4A 4UQ2B 2A9AA 2CDGA 1ECZA 1VKXA 2O6FA 5D4HA 2Q8AL 2FHFA 3R8BB 5GZOA 2APFA 5BV7L 1PZ3A 2AABH 3GHEL 4FQIL 4MXVF 1UG9A 2ZXBA 1IAIM 1OAKH 2EXYD 4NQDA 5DK2A 1JPGB 4TNVK 3Q5OA 4LLYA 4BUGA 3WTVA 4X6FA 4XO4A 5EIIA 1VADB 1JYVA 1XF5A 2IIJA 4FFYA 2O5XH 2OA9A 5C8JA 2HTKC 5IV2B 3D0VB 4M7JH 1WO2A 2DKMA 1UXWA 3UG4A 1R3JA 3OWRA 5IB2A 3NBNA 3MCYA 4KNUA 3OAWA 4WSKA 4BRJA 2NXYC 3TBSB 3TPUB 1UD2A 4KPHL 1FUNA 1K6QH 1OGAA 3MJ8A 4ODHL 5AOKA 5CP3H 2AXGA 1UM4H 4ZAKD 2Z0UA 4K0OA 1FFOA 4PLOB 2VLRB 5EBLB 3E8VA 2EDQA 1Y6MR 1GJUA 2RFXB 1FLRH 1KDJA 2YGNA 1L7IH 4N2OA 2GC4C 2O5YL 2HFGL 1U8QA 1FNLA 2BHZA 2Z91A 1H5BB 1HOEA 1NCTA 4NUMA 1ZIBA 1U95A 5GGTA 5IP4A 3UYPA 3KPNA 4W93A 1LP9B 4XCEB 4W68A 3RZCC 4AL8C 1XMEB 4V1DB 3V6OA 1KLGB 1JN6A 2ZIDA 3OLIA 4JHZA 1B4RA 2J12B 2NLJA 4LPUA 4FQCL 3BX7C 1Y1DA 2WSPA 5D72H 1JZ5A 4OR1A 1T1XA 5JIPA 3V9EA 4BFKA 2ZKHL 1YMMD 2VDQH 3IXAB 4WHTB 3EO1B 3JTTB 3E6FA 1S8DB 1J1PL 2DICA 3ROOB 3UTOA 2Y72A 2VKWA 1D5MB 4QYOB 2DLIA 2BHFA 2Z8WC 3NTCL 3RA7L 1CIDA 2OMVB 4G6FD 1GGCH 3GLDA 5CEYB 1S5HB 1T7VA 3K6NA 3BKJH 4P5KB 1A1NA 2Z34A 3GRWL 4OCXH 3T3ME 4IKKA 4JFZH 3CSBA 4BZYA 2OL3L 3CK0L 4FNQA 4OLUH 1RFDL 2ADJA 3IU3B 4ACPA 4FADA 4JPVH 2CJUH 3TNNA 4XC1H 3HB3D 1TTGA 2VMEA 4ZDHB 3V0AC 3VD0A 2UV3A 3D25A 3F5WA 4TVPH 1XCXA 4PGDA 5I82A 3T6ZA 1CGWA 5F0LB 2EYRB 3OJ2C 5GZND 1DBBL 3SY0A 5I75B 3Q05A 5C0EB 4HXBH 4D0BA 4K2UH 2EVGA 4TNFA 1K2DB 1ESOA 1HT6A 4N2NA 1DQLL 1XH3A 5I73C 1QSFA 2YPLB 3E6HB 4PB9L 4YXLL 2WUCH 3OJDB 1WEJL 3QXWA 1A9VA 3QIWD 3KH3A 3BGMA 3TJEH 4AXWB 5D1ZI 4Y1AB 3O2DH 5KZCB 5GHWH 4QT5A 1IGML 3VGAB 4N8UA 3O41A 2AEQL 1OARH 2DYSB 5DF0A 4MHHI 4WWPA 1IARB 4GH7B 4MDRA 5ILTH 2MFNA 2WIIA 3A47A 4HJ0C 2Y7QB 4U0QB 5CILH 2WVVB 4AUUA 4OAWA 4PCKA 2EXTA 3QPXH 1KWGA 4ZUWA 2Z65C 1ZANL 4R5VA 1XF3B 3D2UB 4LIQH 5GS2H 1FJ1A 4NBYB 4OZIE 3ARTA 5BCAA 3WTYA 1B3JA 2KZKA 2OULB 2VDQB 2OBGA 3HJEA 4NN5C 4K9EL 1W72B 5L2JB 3H4HA 4G6KH 4UYQA 4LL9A 1KNOB 1HE8A 2FK9A 2V17H 3KVDD 1R4XA 4PRIB 5AVYB 2Q8BH 4ANVA 4AYEC 2CKBB 4Y9GA 5D1ZC 2PR9A 2HPOA 4MZIA 4MA3A 1RUPL 4APQA 4RDBA 3Q7JA 4IS6A 1XGQA 3CX5K 2HVKA 4EDWL 3KLQA 3UAJD 5AENA 2XPYA 3H7BB 5JPNC 1XWVA 1MJ7H 2X4RA 4V33A 1V27A 1S3KL 5CD5C 1IX2A 1AXTH 1CLVA 2UXVA 3OLDA 1RUMH 3X3GH 2OZ4H 2VH5L 1DLFH 2VUYA 3V6ZA 1KBBA 4P9ML 4MMYA 4ZSOB 2FHBA 1O5DT 1KWKA 3F83A 1YEDB 4ZXBB 4ELDA 1F02I 3N06B 4QRSB 3BP4A 3D6GA 1XZ0A 3SDXA 4I0PB 4MQTB 3CSPA 4KKZA 2YQ3A 1L9TA 1FG9C 5CGTA 3UO8B 3RFZB 5DUJA 2HFEA 5JYLA 2CUHA 4O51A 3U9WA 3BWUF 5DMKB 2QV2A 4NO5B 1ZHLA 1RU9H 4AT6A 3B37A 2MIZA 3F04A 4JY6A 1X5JA 2DQHH 4V2BA 2VGLM 2XWJA 2YZ8A 5BUGA 2QSCH 5C0IA 1JI2A 3ARDB 2GITB 2WNGA 4GRLC 3WFBL 3SYAA 4HIEB 4K94L 1DBKH 3TX4A 3GMRA 2A2QT 4N90D 4YDNA 4G8AC 4Z7VE 2EH8H 2D2CC 4XB3A 2CQVA 4R0LC 1AD0B 3ULUE 5IUSA 2ZWYA 4HJGB 1VFBA 2HN7B 4TUOB 1C12B 2F68X 3ZO9A 4BJLA 4U1MB 4P4KD 5IWLC 5L9DL 3SGDI 3TJPA 5AYUH 3DLQR 4YXHL 3VACA 1SF5A 3D9AL 2BMKB 1J8HB 3FCGA 3NYKA 4JQVA 2FBOJ 1JNHB 5IESL 1FFPB 4AGPA 5HY9B 1TOXA 4FNLH 1G7PA 3LVTA 4HGMA 4FEMA 2Y6SD 5GRXG 3T6VA 5LGHL 2A5UA 3TBVA 4HIXH 4YHOL 2HX8A 1CI3M 4HSQA 4PJHE 1FYTE 1CJYA 1JCKA 1A6ZA 5I9QB 1AZZC 3LZQA 4OVUA 1DR9A 5AVWB 4XB7A 2QFPA 2FECI 2CHZA 2VO8A 4JVPA 1XR9A 4P04A 5HYFA 3IDGB 1D6VL 3RIFF 2ZP9A 4IOIA 5DJXA 5DTFB 4XT1C 4LEOA 3NK4A 4TPRL 1MW3A 4ODWA 4YHYC 3CSYB 2AHIA 3AGVA 3K72B 1IBZA 1HN1A 4S1QL 4DP6X 3KGSA 5IJKC 5IHZB 3U82B 5JIIA 2X4OB 2MPAH 3TM6A 3WLBA 1XVSA 3L4TA 4D94A 2DDQH 2GFBA 1NAKL 1JXKA 3QJOA 1FNGA 5D6DA 2PW1B 3M1OA 4AQEA 2YFOA 3RUGA 5DFAA 2E7BA 2ZP0T 2ODIA 1Y6NR 5SV3A 4OD1L 2DIEA 2GIMA 3DVGA 1KPRB 4KVCL 1OK8A 1MLCB 4WF7A 3W11D 3TBYA 1QLEH 3RU8L 1KEGL 3LX9A 1AHMA 3IXTB 2BZDA 4PG2A 5FX3A 4QHMA 3UXFA 1QRNE 4XVOA 3QNYA 1Q94A 2ZUWA 4UNTA 1ZCRA 3HN8A 1XZWA 4AX3A 4XAKE 3QG7L 4ZFGL 1GZQB 2AJVH 2P5WA 3FU9A 1MKFA 2JCCF 2N1KA 3W1ZA 3EH2A 2DQCH 1ID2A 4MS8C 4OBRA 3VDAA 2IMNA 1T20B 2CUMA 4X99A 3M1BB 5J89A 2WLLB 4NQXB 4MA1B 2GI0A 4ZQKB 2CUAA 3TF7C 2QVMA 1I7TB 1JWUB 1YEIH 2XG5B 4Q4EA 4RNRB 3WENA 1EAPB 5ADPL 1DQQA 2DL2A 4MAZA 2QHLA 3GIZH 4IBZA 3MXWL 3GMPA 2GTWA 3RY6A 1TSHA 3L9EA 4MAYA 3EBGA 5C08B 4FMFA 4FQXC 3ARFD 1VCAA 4FXKC 3B43A 4P4KA 3GJEB 5SWSA 3ULSB 2GW5A 1PQZB 3QO0A 3UDWC 5HPOA 2VDOL 1ACZA 1KTLB 3RURA 5I0WA 2VN3A 2MOGA 4BCZA 2W59A 4DSYA 2DJMA 2JCCA 4R83A 1A21A 4PRBB 1AI1L 1BWWA 3MNVB 4E42B 1DBJL 5L2KA 2IDQA 5DA0B 2F53D 5EHFA 1N0LA 2WCPA 5TDOB 3QDGE 4Y0GA 4Q9RL 3WJJC 1G7IB 5HVFB 2EJ1A 2G5BA 4KKCD 4C56D 3ZL1A 3GSNH 4RH4A 3VRIA 1Z5LA 3OXRA 1URZA 2X4SA 2ATKB 4N1HB 1EERB 4GEIA 2UWEE 1D7BA 3BAXA 2VSKB 3QRBA 5BOJA 1OANA 1NEZB 4BFRA 3EXLA 4KZ0A 3VSTA 1AS7A 5EC2A 5LAXB 3GF8A 2PWFA 1ADQH 4JRWA 4LHUG 3NGBB 1TTUA 3RL1A 4GBXC 3HS0C 4AE1A 4JO4H 2V7HA 3BKYL 4PJ5A 3VXPB 1M9SA 1T1ZB 4M5YH 4EI6A 3KLLA 2ENPA 3BVTA 4G5ZL 5C0DA 4P2YA 3DC0A 5AWNL 1JRHI 3FYEB 4ORGB 3IJYB 2HRPH 4OFYA 4PB0H 3TBWA 3QUXA 2OYLA 4DUXA 4PCYA 1QEWA 1G94A 3G6JE 5EUOF 2ZCHH 4QHNB 3R1GL 1YCSA 4F8NA 3D0LA 4RGMC 5E6IC 1J05A 3MA9L 4HGWB 2QPSA 1EXUB 5EOQH 2UXTA 1E4JA 3TN0C 3L5XH 3ZHDA 1EHLL 3BDBA 4N2GA 4FFYL 4YDIH 3BUTA 2AS5M 2R83A 4M93B 2KMWA 1HTYA 3NCMA 5I17B 3UP1A 3L2LA 5M95B 4L9LC 3P0YH 4JK0D 2ETWA 4U7KA 4BELD 1NCCH 1SN0A 3EFDL 2AW2A 2VXVL 4Y5YA 5DLML 3KYMA 4JPWH 1M6UA 1WF5A 4DZ8B 2WXKA 3REWB 3QWOA 3MODH 3UERA 5EUOA 3GPEA 3WE1A 1BSIA 3WS6C 2WKLA 5D1XC 4BM7A 4FA7B 3GSNB 3VD3A 2YK1L 4TMPA 5DZNA 3RTQB 2Y07H 3KL3A 4Z95L 3ALPA 3NIFF 4PS4H 4CW1B 4J3OD 5GJSL 3PNWB 3KPRA 3HC4H 1ZA3B 3DPBB 3JUYA 4Z18A 1MJ8L 3K71A 4AC4A 3QR1A 2TAAA 4GNKB 3RBSA 3HC3H 4X4MA 3RVTC 2FCBA 1ES0A 2AJSL 3CMOL 1S7VB 3TFBA 4I18C 5ICYB 2EYTA 1OP5H 5KSBE 3CZGA 2XACC 2WGNB 3VGFA 2AJZB 3CMGA 4PJIB 1CXLA 2VYRE 3W37A 5DDHA 4MLIA 4K3HA 3QZWA 1E28A 4B9YA 1S7XA 1OGTB 2XTJB 4JFHE 4Z7OE 4L8CB 1GH7A 1X7SA 1ZOXA 3NPSC 4GY4A 3MJ9L 1NDGB 4MA7H 2WQWA 4JM2C 1YPZA 4UZUA 4X5RA 1TG8A 1T7YA 4HG4K 1L6PA 2CO6B 3CU1A 1RV6X 5B7MA 5L4JA 5ANHA 2H2SD 2BSSB 4HBCH 4JFOB 4N6QA 1CT8A 4WV1A 4XMWA 2FTAA 4A04A 2YEZB 2L7JA 3IETB 1UZ8B 4LSQH 2E9GA 4PWHA 1O9WA 1NJ9A 3Q3GA 5C09D 4JHUA 4L29A 1EXHA 4XMPH 4X9HA 1I8LC 5I1EH 3UTSD 2P24A 4M3JA 3MHZA 3HAEH 2BVQA 4ICWA 1NC4B 1IAII 2B77A 4LCWA 4OGZA 3VXSA 4MYWB 3CC5B 3GDCA 1S7SA 3LKQB 3V0GA 1R75A 1USQA 3EOBB 3PPEA 3Q6FB 4J8QA 4PS8A 1GGUA 2DB8A 3WXWL 4FL4C 3S34H 2ZCLL 2GY7B 4ZUSB 3LNDA 4O9HL 4JQXC 5ICZA 5FYLD 3D50A 2YOCA 2X1XR 4AKQA 1XEUA 3C2AH 3FQNA 1ZLSH 1AO7E 4NQCA 3A5VA 2DQFA 3BE1H 4IU2B 2OMTA 4ODSL 4Z7VB 4L3EA 3RVWC 2UZYA 1ND0B 1TYRA 2VZVA 1BQ5A 4K7FB 4E9QA 4OLWL 4HALA 1E9OB 3SY6A 1OAYH 1T1YA 1XH2A 4NUJB 5AVRB 2OXHA 4P07A 1RJZA 3OGCA 4HUVA 3QUZB 5CJ8A 3MUGA 4WUUA 4JRYA 3EF7A 5GRVL 4PMFA 2Z3FA 4NUPA 5LGKA 4P5TC 3F7PC 5HGAB 1BIIA 1NBZB 2E7LC 2I26N 1O5PA 4YL9A 2X4TB 4TRPH 4B6ZA 1U8HA 3CXDH 3GBNH 3MNWA 4ZUVB 4IRZH 3B34A 4OI8A 5KSAA 3KD4A 4EI5C 3T1WA 3EKCA 1OVZA 3FZUC 1E9QB 3RWJB 4NIKB 3LSOB 4TQHA 5D7SL 2BH0A 5DS2A 3RP1A 1CXFA 3GS0A 1RIVH 1MIMH 3FQWB 1YEGL 4PJHB 1FO0H 2IAND 3FT9A 2VWEE 5C0BD 3N04A 4I77H 4GG6E 4HWBA 4M1CC 5AZUA 1IM9A 2R8SL 2Q86A 3HAEB 4X83A 1YMHB 3ROLB 1XGYL 1CICA 2YSSB 3WD5L 5A3IC 4FXGB 1H8OA 1JPTH 3ZDXE 1R46A 3MX0A 4CRPA 2G60L 2F18A 3GSXA 1HINH 5C0RL 3VWJD 1T21A 3IDYB 2VT0A 1AR1B 2R15A 3L3HB 1IQWL 3AZUA 1KUMA 3QPQD 3BRGC 5TF1L 4D7PA 2ZG2A 1JZ6A 3U6RA 4WWOA 4FFZA 3P54A 4Y89A 3T0VA 1BVNT 2Y5TB 4XCNA 3N3EA 5I8OL 1IC4L 3FHQA 4TNEA 2JE8A 2VLJB 4C4UA 2ZUVA 5C0AB 5FOBA 3MV9D 3CFNA 3MLXH 3P1VA 3UL4A 1XXFC 1VESA 4EZKA 4UOZA 3LTVA 2VUOA 3RNKB 4AVHA 1HYSD 1D9KC 5BO1H 5T5FA 4TUKH 4LNRB 1UXMA 4KGLA 3FB6A 1A8ZA 3C9NA 3KG5A 1OCWL 1WBZA 4X5XA 1VEMA 3T1FB 1TETH 4YLQT 3AG4B 4W9KC 1IGYA 2CLRA 1L9QA 2R4RH 4HEMA 4NJAL 4Z7WE 5EB9A 2D7NA 1A2YB 3DX9B 4OQ1A 3VWKC 3HS9A 3P2TA 4D9RE 5K59F 5T33H 2VR7A 1SOQA 5KWYC 3IRCA 3OAYK 2OK0L 3L08A 3PXJA 3HUJF 4AVKA 1UXSA 3MCKB 3FQTA 3FT1A 4GQ9L 3EFFA 4MJHA 4XN7A 1PDKB 1EAQA 1WQVT 1Z9SB 2P4AB 3FK3A 3QBTB 4UU9A 1CFVL 4A1RA 5SX5K 3VI4F 3PQYE 3EUDA 4FTVD 3KL5A 3OG6B 3ESOA 3TV8A 3GIVA 1RZFH 2OP4H 3NQIA 4JHVA 2L7EA 3IGAA 1KLFA 3KPMA 4HD9A 3S5ZA 4Z0XB 4NLHA 3NOIA 3D1MC 2EABA 4E0RB 5HHMD 2IV9A 5D7KE 3GJFH 2DTML 1JZ7A 3HE7B 2DMHA 4LU5L 4F24A 2D7OA 3VFRA 4AIOA 3G5ZB 1OAUH 1D5RA 4K3DH 1HAWA 3PWVB 4YE4L 5EOCH 3BIKA 1CFNA 2EIZA 2FJHB 3PJNA 4OF0A 1GW0A 2A0LD 3BDYH 4KWUA 3GWJA 5MEQB 3RX7A 1L3WA 4YX2L 4HC1A 5BRQA 2L8AA 3PWNB 3FH7A 3VI4A 3P3YA 1HNGA 1WFTA 2QLVB 5GSRB 1MQKH 3IJEA 3ZMNA 4RSYA 4XWGL 2A9ML 4FTDA 3LOWA 2YGQA 1P9MA 4GW1B 3I9AA 4XCFH 5CUSH 1Z9MA 1C1EH 4LLQA 3BH8A 5I15L 1ZLVH 4R4ND 3DOIA 3TIEB 1QI4A 3IJ8A 3L7EA 3VWJA 4PJXB 4NS0A 1T89C 2FSEA 2NZIA 4HUMB 3C6LD 1T04B 2AKRB 3UTTE 1A4AA 1OP4A 3V4PL 5AW5B 3NJNA 3JTBA 5LN4A 2F5AH 5JNYB 4P5SA 1ZT7A 4YGAB 1A7PL 3MLPA 4L8BA 4QGYA 5IVXE 1HDMB 1VFMA 4WWKC 3OXSB 5KVGL 1A7OH 2P80A 2DBLL 5TQ2L 4JGMA 5G5DB 2BFVL 1AKJB 1U8JB 4ADGA 2B08A 4QR7A 4RGNC 2JNZA 4NKOA 2QZ5A 3GZKA 3UIZA 1H9VA 3QZPA 2QDVA 2Z1PA 3CN0A 2CBQA 1U8PB 1KBKA 1WG3A 2F7PA 3CV5A 4IMKA 5IR1B 3KYNA 5D5ME 2LLGA 1IKNC 3T3PF 1ZGLA 1HSAA 5GS1B 2WQSA 4P46D 4LASH 2YJQA 1KENL 3PE9A 2DN7A 4OCSL 1ZV2A 2GKIA 2R2HB 3SKMB 3EOAA 4IHOB 1F11B 3B7RL 4OBSA 2KZBA 4WJ5A 1FLTX 3IDMB 4PWFA 5C6TH 1MRDL 5GGVL 3U0WH 2QELA 1HOCA 1KIRB 2BOCA 4HIHA 4PRNB 4LESA 2BOLA 4PSRA 2XBZA 3DBXA 4YFLF 1YYMH 2NY7L 2E7MA 2W65A 3FCTB 5B1CA 5IY5B 2ZNXA 2WBJA 3MCLH 4XGZA 3V4VA 1HXKA 4LEXL 4M8VA 1GIGL 3ZYJA 1UWEH 3C5ZB 1E90A 1Z1WA 5E51A 1XCQB 4PV9B 1B9ZA 4EE2A 4MVBD 3L4VA 3RVXC 1S9XA 4NRXB 5I30H 3EYSL 1B3IA 5I8CA 4QXTB 1XGTA 1IM3A 4GKZA 3KZ8A 1PZDA 4MSWB 2BY0A 1P7KA 1NWOA 2AQ2A 4WEMB 2IDTA 5KSBB 3KPPA 5IFAL 1FNAA 3FN9A 3QNXA 5I19H 1AGFA 3HZYA 3MGTB 1ILUA 3GD1C 3QISA 3LS5H 3QFDB 5CGMA 2XZAH 3S5LG 4Z7OB 4PRPA 5GRJL 3VFWA 1F4AA 4BXSV 4FE9A 4K7PL 2LR4A 3L3DA 3NABL 2MQ3A 4DEUA 1MSPA 1KYUA 3C5SB 5IEKB 2J71A 1J5CA 4MB5A 3CUPA 5JHLA 4Y4FC 1WIOA 3CFBB 2XWBA 4Y16B 5LBVA 1ONQA 4DN3L 1JXDA 1KCSH 4LLVB 3SQRA 1FNEB 2IDSA 4PJ9C 4PD4K 5KSUB 1OAZL 4KFMA 4LBAA 2W07A 1L6ZA 3W0WD 2WP3O 3RZCB 3PWUA 2H0EA 2WP3T 4HUWB 5DUBA 4F5CA 2VRQA 3FB7A 4OLXL 5GGSA 2FEEL 1JFHA 5L88L 4AMKL 3PCYA 1ULVA 4KI5D 4DNLA 1D5BB 2C9QA 4JM4H 5KTEL 4Y7OC 2YA2A 3K1KC 4U1JA 1J0HA 1TZIA 2DAVA 4PJGE 1N10A 1SEBB 3GM8A 1LEKA 1RUKL 1QUNB 4ZTOL 3EOTH 2I24N 3BH4A 1QR1A 5L4MA 3BGFC 5DZ9A 4WUKL 2CBPA 1LNUB 2R2EA 3FO2B 4YMPA 1A3RH 1VAHA 1BBDH 3V55A 2VUKA 1CFSA 4JB9L 3FRPG 5AL0A 1SGKA 4M61B 4PRDA 2VJ8A 5FIEA 4ZS6C 5FO9A 2CHXA 3H2WA 1NKOA 4B95C 2APTA 3HRPA 3ARQA 2P8LB 1K4DA 2A73A 1FVCA 5BUPA 1SYSA 1LO4L 4ZO6A 3N85L 3VXRD 2VSDA 2V2XB 4QXGL 4HU8A 5D6CB 4WI0B 1PL3A 4ENED 1CBJA 4AIZA 2HT4C 5FECA 2DV6A 1PX4A 5ANMA 3VFGL 5I73B 1BAGA 3B2VH 4FLRA 3VH8A 3BWAA 3SJVB 3HNVH 3H85A 2BSTA 4MJ5B 2PTTB 2X87A 3TIDA 3NDYE 2C9XA 3NIGE 4OKVB 2A4CA 2CA3A 4B5EA 5DJDA 4N2FA 2CJTA 5EZOH 4WI2A 3WUWG 3GGWA 4IJTA 4RBPH 3EUUA 3QAZB 3OGOE 4U1IB 5I8KL 5JPMB 3B5HA 5L8LB 2RQ8A 4X8XA 5CEZH 1R3IL 4XNAA 3EYOB 4FJYA 1MH5B 5F1IA 4UBDD 4P2AA 4Y2DA 2J20A 3LIZA 4NN5B 2Z93B 2Y6TE 3BKML 4NPYA 5FW6A 3TFKD 3HC0A 2DL9A 2EACA 2Q2LA 2QSQA 1HKLL 3BP5A 1I4FA 2P8PB 1F3JB 1I31A 5F3BB 1N68A 1X5MA 4RIRB 4GI8A 1BJ8A 5CSBA 2E6PA 3IDNA 3BEVB 4FFWD 4W9CC 4I0CC 5D1ZB 1U8KA 1SMAA 4LKCB 2NNFA 1IV8A 4JFDE 1TQUA 3U4KA 1JK9B 4IRSB 4P2QA 5HHVL 4YDMA 1R0AL 1EHXA 2E7CA 1E3FA 1P1VA 5C6PB 5DFVC 3WXVH 5DZPA 3KPSE 4W9JC 4XPBH 4WHYH 2JB5H 4JG1L 3CLEL 4NIYE 3MV8B 1LWJA 2QPUA 3ABZA 1QA9B 1UA6L 1UJ3A 3EIFA 3LV3B 5MEND 4XZ4A 1NQBA 3MLYH 5GGUA 2ZX6A 5DRXB 5IVZA 4U49A 5FB8B 1S9YB 1N4XL 4R26H 2FR4A 4MQ7B 4KJYA 3MLZH 3PHSA 3NFPA 3U6XA 3HG5A 5EF2A 3H42H 1MLBA 5INCA 4PV1C 3AM8A 4NRZB 5AD0B 4DN4L 4HP5A 1PVHA 2V3EA 3KEDA 4NWTL 4FJZA 1LE5B 3DX6B 4XPHH 2VMFA 4RMQA 4JDEB 5D2LB 3QXVA 2IDUA 2OTWA 4HJIA 5HGDB 1VACB 4RETB 3SDDC 3CVIL 3LEYH 4F7CB 2G75A 3C2SA 3FUNA 2ZSWB 1L9OA 2Z64C 3S3BB 2GI7A 4BKLB 1KG0B 2VOTA 4JJ5A 1J8KA 3QUMB 3GXFA 1OSYA 2PO6B 3U4EA 1ZS8A 3ARZA 1FVDB 1TZHA 5D7LE 3CSTA 2HLFC 1IGIL 3FFCD 3D3VD 4AOFA 4R0LB 2OMZB 4R9HA 3ULUC 2GPZA 2WLZA 1IZJA 5E8DH 4ZUUB 1NCGA 1P7BA 2C3VB 3S6CA 5KYUB 2YBRB 4QRAA 3ELAT 4Y2LA 3DSFH 4JRFA 3WY3A 3LZNA 5EEZA 3ABMB 3B3IA 2F19H 3B3BA 4PVLA 4N68A 4XPTH 3PWJA 4YXKH 2ZUTA 3SDAC 3L3OB 3G04B 2HXAA 3TWCL 3MRPB 3VSVA 5ISZE 5F9DC 3BSZL 3QA3B 3CDGB 3A23A 1JZHA 1G6RH 2Z7YA 3SBWC 2D9CA 1DVYA 1M05A 4EUPH 1A0QH 1P4LA 4I3RH 5KVFE 3T65A 3ZZQA 5F6IB 3A4EA 3E9UA 4JY4B 3K6SB 3T2NH 4YSDA 3AREC 4XNMB 4ZW8A 2YWYA 3CHXA 4DP5X 1YEFL 4NZUL 4OLEA 2QR0A 5G4MA 4AENA 4J1UB 1WGVA 1YMME 3MFGB 5AAWA 4MXWL 5C9JB 5EO9B 1WP6A 4YHYB 4UQBA 2FT6A 4HSAC 4NO0A 1SJVA 3T0EB 3A6BH 2FIKB 3AG1B 3G5YB 4MB1A 5IQOA 5DZOA 3TEZA 4JPSA 4JGUA 4GJTB 3AMKA 5E2UL 2XYCA 1BF2A 3L3GB 2WBXA 2YD2A 4ERSL 1W9XA 1E4WL 4Y19D 3HG1A 4A6YH 2M83A 3KXFD 2R23B 1XX9C 5MP6H 1SM3H 5JORB 4RMSA 4OD2A 1DJGA 4KJPD 4UNVA 1ZIAA 2Z31A 3BUYB 1MFDH 5KW9H 3AXLA 3KJ6H 5IUCA 1GZHA 2H2PD 2YQGA 2CLVA 3KCPA 2F7OA 1KB5A 1RULL 2SEBA 5HGHA 3QUYB 5HHOD 2J4WH 3CFEB 3L17A 2Q20A 1NCOA 2OFQA 3L5IA 5CSZA 5HI3D 5CZXC 35C8L 4HJUA 3CFDA 4XNYH 3AITA 1RZKC 1LQBC 1NGXA 4A39A 2H0FA 3MAWA 4D7BA 1MZZA 3HLAA 1G6RB 3SKOB 2H26A 3B4NA 2FX7H 4Z7QF 3IEAA 3UBXA 5DHEA 4EUPB 4X7SL 2FGWL 1CG9B 4L1LA 2Z8RA 4KC3B 1E4XL 3DK0A 4IKLA 4FQXB 5F9OL 1PW3A 4FXKB 3HG0A 1CVRA 4LZKA 2D03H 1REIA 4N8VG 3D09A 4UINL 5E0FA 4AYFB 1IJ9A 4TQ8A 4ZUTB 4NNPL 1A4BA 1N5YL 4EBQH 4X6EB 1CYXA 3O3UN 4PQXA 1A7RH 2EEFA 4ONHB 1MWAA 3INOA 3WEXB 3IMVA 5J8OA 3AU1A 1S7QA 2AI0H 2ZWNA 3VSUA 3H2QA 3QDMD 1Y6KR 3DXAD 4CN1A 3FUIA 2EVHA 1T5XA 3D2TA 2ZF8A 4Y4KD 5E1QA 3X1FA 2CIKB 5FV2A 4WHDA 1UOWA 2FWOA 3C8DA 5JW4Q 4OD3L 2XV2A 1J10A 3HE6A 2EE6A 5B8CA 5DS8B 4A6YB 1U91A 2Y22A 5E5LA 4YO0B 4OUUA 3QQDB 3KYKH 4KXZH 1K3IA 1K72A 2LFEA 3FAXA 3BT0A 2QADC 3SDYH 2RD0A 4FLOA 3BW9B 2HH0L 5MEPB 3ME0B 1BZQK 1RK0A 2OW7A 2R4SH 5EIIG 4PY7A 1C8QA 2QV4A 1WZ1L 1NDMA 1NC2D 4AQ1A 5LG1A 3ZKMD 1B0RA 4PV8B 4ZX5A 4PJGB 1CE1L 4BHUA 2OX5A 3GBLA 3T4YB 3QORA 1OTTC 2JI1A 5GGSY 2ITEA 4WW2C 2ESVB 1OP3H 3TA3D 1VGKA 4WFED 4KNQA 1NBVH 1WV7T 3K4DA 3PYCA 4ZPVA 5F7DA 1FC1A 4XCCL 5FM4A 1NEUA 2NT0A 3DROA 3SGJA 3MJ7B 5AVUB 8CGTA 5E6IB 1KXQE 2R1WA 4RGMB 1LHZA 3AG2B 1MJUH 5AAMC 4AY0A 1I3GL 1R6VA 2FO4B 3H3PH 5C0CA 4M7JL 4NQEA 2YBGA 3ZZLA 1ZLVK 3LZLA 3OQRA 3HR6A 3TF4A 5FUCC 5HI5C 3TVMA 3B1TA 2G2RA 3O11A 3BEWB 4N90E 4L9LB 4DKFH 2AMUA 4GRWE 3N42F 4QXUH 4XCYB 5LGJA 5MEOB 4IBLT 4N1EA 4QOKD 4I4WB 4ODXA 2MCMA 5JHBA 2GC7C 3KGRA 3RGVA 4PTTB 4XVSL 4XRCA 1HILB 1AQKH 3QCTH 4AZ8A 2DI9A 4OZ4A 4EDXB 2OS7A 3NH7H 4AM0B 1JGLL 3FKUS 5FUZL 4U1LA 2EKSA 4P8QA 1QFWI 5D1XB 4DKDC 2FZ3A 5FLUA 3IKCA 3UX9B 4B27A 3FQUA 4EXPX 4YGVA 4P4RA 3S48A 4AK1A 4KU1A 1HXYB 2FBJL 3HNSH 2W95A 2IC2A 1U8OB 2C1PB 1XCTB 5D93C 3O0RH 5SWQA 3OAUH 4X50A 1QTYT 4PR5B 1DHKA 3WKQA 1UEYA 1HXMA 2DMCA 2GJ6D 4FQ1L 4UAOB 4KTEH 4KKLD 4QF1B 2EDOA 2ICWI 1JGDB 4TSCH 2BP0B 1RZGB 1OF2B 1YAZA 4GMSH 3DGGA 1P6FA 2H32A 3VG0H 3IWVA 5CWSB 4J3TA 3WNLA 1VZHA 2XFXA 2MOVA 3UZEA 5D72L 1A4JA 4JKWA 4MX7A 2WXOA 2VDQL 1NFKA 3A22A 1UA7A 1HHGB 1W72L 1OEZW 1QTSA 2IPTH 4QRRD 4XMLL 2HAZA 1YEJL 1RD6A 1BQRA 4DTGH 1DZ0A 1IAIH 3VTMA 4WWNA 5K69A 4EKXA 5MERA 1VA9A 1JF6A 3HMXA 3WN5A 5FM8A 5T3XH 2CRIA 4G8GD 5EZPA 1XIWD 2CKBL 3H56A 5F8QC 4LRIC 4LNVA 3ARXA 3VXTA 4C83A 2G3MA 5E5MA 1BQLL 3K81A 1GC1H 5J4MA 1YN7A 3ARBB 3IM1A 3BKJL 3KPSB 4OCMC 3NPSB 4TS6A 4DO4A 4JDVA 1NUNB 2ITDA 5CZVH 2VDMH 1BFTA 2R1YA 2F7RA 4OLUL 4BKTC 2JIXA 1N6QL 2XDHA 2ADFH 2CJUL 2NY6C 5F89A 4MNHA 2BFGA 1T7XA 4JREC 2VDLL 3ZE1E 1H19A 2R29H 3D39B 1CFTA 4BH8B 3MRCB 5KVFH 3TA3A 1O6SB 4TVPL 3PU7A 2O61A 1QWHA 1RIHH 2DWTA 2VN4A 4NT6A 2A6JB 3TH4T 5I1JL 2FJGB 1I8IA 3L7FA 2VXQL 2HZHA 3IFNH 4PH8A 2OSYA 2FJFA 3QC5X 4YBQC 3OKDA 5C2BL 1EVTC 2WB7A 1N3NB 3OMAB 4N0UE 4J3WA 3M6DA 2AJ3B 4I2XA 4MNGE 4ZG1A 4GRMB 2C9RA 2EO7A 5IT2H 1IGJA 5IHBA 3ZIMA 4ENZA 1H8LA 5HVGB 1L7TH 3QHTC 4JE4B 4FQHB 5HYJD 1A47A 4UYPA 1M3JA 4LAQH 5D7LB 2OSWA 1U8NB 3MRMA 5F3HA 4Y4HC 5CBAA 5KS9E 4M43H 3TURA 3LPGA 2WANA 1N8ZB 4AYID 4JFPA 1KFAH 4MD4B 1YECL 2NUTB 4CBZA 2VISB 1CL7L 3GRGA 1V3LA 2QPDB 5ICUA 2XA3A 2F53E 2Q8BL 1L4IA 4P5TB 2P28B 1NBCA 3DWTA 3JSSA 3WU1A 4QTHB 2VR6A 3Q44A 43CAA 5BZXA 1B0IA 3HVNA 3FL7A 4L5FH 4XP6H 4C56E 3DMMB 2FWLB 3BAKA 2VDMB 5ISZB 4MNQA 4EN3B 4YPGA 2ATPB 1MJ7L 2ICCA 4YHML 4CVWA 3JWOH 2AQTA 1AXTL 3W81A 4XBMA 1RUML 3WHXB 5ESAA 1A6AB 1F56A 1E7VA 1KIUA 3IPBA 2YKLL 1JHKH 2J1ZA 5K39A 3OR7B 3QYCA 4NP4H 4LLMA 3DX7A 4XO8A 2WWOA 4LOEA 4KITB 3GSOB 4U3HA 5AB2A 4AUYA 3W38A 4YR6A 4BQBA 5FO2A 4PRAA 4PJXF 3KYOA 4NYLB 1C08B 3Q5YA 3NCJL 4PREA 5B39B 1LDSA 3M86A 5IM7A 1BCIA 2MNWA 2NNRA 5A16A 3FSVA 3RWGA 5J11B 3BXNB 3UPCA 3ZKND 1QO3A 4H88H 5TDPA 4KUCD 4X98A 5E24E 3K74B 2CHWA 4LT7A 1EDQA 3CCHA 4WO0A 3U7YL 4AQAA 4AVIA 1HHHA 2WLIA 3T2QA 3B9KA 1SVCP 4C8XA 1KV7A 3GS4A 1LMIA 1S4IA 3WIAA 5HYQB 4RMWA 3GZPA 2K0RA 4F9PA 1WS8A 5EU4A 3MMEB 1RUAL 3LRKA 1D9KB 3QDHA 1ID5I 4XC3L 2EXWC 4R4FL 2BINA 3IVKA 3RWDB 1CLYL 2DMGA 4DKTA 3F84A 4NRYA 1TFPA 3ESMA 3CVHL 3P77B 3AAZB 3S8WA 1LEIA 3FU7A 4DQOL 2E27H 1G9MC 5AYUL 1YJDL 2GY5A 5IIEA 5TD4A 1A1MA 1AG6A 3LZFH 5DJ2B 1LEGB 1ED3A 3C09B 2WXPA 4RZCB 4FQLH 2M26A 3ABKB 5E2WH 5C9KA 3UMTA 1J87A 2A74B 2BJMH 5DQJB 3NJLA 4GQZA 3IDJA 2VE6B 2J8UF 4H20L 4OTXH 1MCIA 4Z78B 5J13C 4HH9B 4JANB 1HEJC 1SLVA 2B3RA 1S5IH 3D30A 3S8GB 4MJIE 3VXUA 4H8WH 4U6HB 4HFWB 3IGKA 4JFEA 5CCHE 3HNTH 2J88H 1UH2A 4X6BB 1WH0A 3S0PA 2WMPA 3OMIB 3AUWB 4YHIA 5FDWB 3SE6A 3EDDA 2CALA 4YZWA 3WEAA 3QRGL 5KAQF 2L7UA 1E5BA 5CMAB 3NFNA 2H8PB 1L0XA 4P2OD 1T22B 3OHXC 1MCWW 2J8UA 3KBEA 4BWTA 3NEXA 1N70A 1DYZA 3ZTJG 1USZA 1DJIA 1V7MH 3KPLB 1E27B 1AP2B 4L4VA 3QIBC 4BZ1H 2OYKA 4JJOA 3B2UC 5EU6A 3WNJA 4GG8B 4P05A 2VAAB 3US1A 3MVSA 4X9FA 5D7JC 2N7AA 4OZHA 4F92B 4ZNEA 1B2YA 1AE6H 3REVB 1FVEA 4XN5A 1QHPA 1WZMA 3O6FC 4M6NH 3QUKB 5HJ3B 4OGAD 3KNBA 1HJCA 3FHAA 4EPSA 5B7FA 4G7YL 2YKKA 3GUTB 4JR9H 2CO4A 4UM9D 5FF6B 1WAAF 1SUHA 1MI5E 4CADB 1UOKA 4E5XA 4O02H 3EJYC 3MRRB 5HDWA 5C09E 5ADOL 2OI9C 4UIKL 2BW5A 43C9A 4EOWH 1VLXA 3BPCB 4X0KB 4PPTA 2AJVL 3SCMD 3UTSE 4RWYH 4OB5H 5CP7B 1BBJB 4JFVA 1E4HA 3TGXA 2Q6WB 3RI5F 4HXAH 1QATA 1R5IB 5CJOH 3IMUA 1LD9B 1GAFL 1MPAH 2IV8A 4BK8A 3EJPA 5AUMA 4QKXB 5TE4L 4AGMA 1CYGA 3DURB 3GIZL 5AOIA 3QRFM 3K8MA 2IBGA 5FYLE 2HVBA 1JWSA 5EEXA 2A77H 3MJWA 1WAAA 4YFEA 1BEYH 2CPCA 4JQIL 3Q9QA 5KVMC 1MCPH 2E7HA 3P4OA 2YQ2A 3L95B 1CFMA 3QSKB 4XHQA 3OPZH 2OTUB 1AC0A 1GYWA 1Z5HA 4H8VA 1A1OA 4ZW3A 2P44B 1J0YA 2WWMC 3NA4A 4UZSA 2EDWA 3FOLB 5I6OA 3HG2A 5I1HL 5TJWK 4FX5A 2I9LA 3WEOA 4HYTB 2XN9A 1RERA 2N56A 2AGJH 1JFQL 2LFGA 3GSNL 2I5YH 4PU2A 4D3CL 1AZUA 3B6SA 5E9DA 5EIQA 3S36H 2VIRB 1LO3L 4H2CA 3TONA 4N0YH 1QASA 2F5BH 1FHGA 4NZRH 4DH2A 2MKLC 4QKTA 3FB8A 3V0EA 1TVDA 1I1AB 1R3KB 1RZJC 2Y06L 4O02B 1NGZA 4UOW1 2IANE 2R27A 5C0BE 4MXQD 4HJTA 4HLJA 3U30B 2BSED 3QIUD 3WJMA 5IROD 4TNVF 4FI8A 4MAUH 1IT9H 3WNPA 5H4ZA 3DV4B 3KWUA 4E41A 1FFQA 4P3CH 4BGLA 5I66A 4PGEA 3HBQA 4KX8A 1MJJA 1O7DE 3DV6B 3PDOB 2DQJL 1KC5H 2CPUA 3RWIB 2ZCHL 2ZUYA 4JPIA 2NUPB 3ARRA 5E8NB 4YJZL 4IGBA 1QBAA 4IRJC 1JAEA 3RJDA 4ELKA 4PCSA 5IMLA 1WHOA 3VFSA 5I6XC 2J2ZB 2GT9A 3BUIA 4YDJA 4N6RB 4HOZA 1QYGH 2NSMA 2X9XA 4HSCX 1TIUA 3DJRA 4RMTA 2PCPA 5E4EB 2N3JA 4KQ4L 1OGSA 4YSAA 3LEXB 3MNZA 1K8DB 2WTPA 3A21A 3DNKA 3DX8A 4G8IA 3AACA 4KKAC 4M00A 2ED6A 1WS7A 3D12B 3GI9H 3QG6A 4M62H 1FL6A 1F42A 4DFIA 5IMMB 5KYXB 4NO2B 3IU4L 1WC7B 5DJZA 1G7LA 3MTRA 3P4NA 3N43B 4JKPH 1XF4A 4KJWC 3UZQA 2B4CC 4LPYA 1KYAA 2Y07L 2XG4A 4PRHD 1MY7A 5IQMA 2YPVA 2A6IB 3Q0HA 3SHSA 1O9ZA 1E4KC 2BC4B 3X12B 3ZSSA 1JYXA 2BDNL 4I3SH 2Z9TA 4H0LC 2QGCA 3ATEA 3OSVA 3M88A 2FJSA 1UZ6F 4UTCA 1X5YA 5DD1H 3LIUA 2EDXA 1X5KA 2OQJB 2ZE0A 2XN0A 5KS9B 1W0WA 2K8QA 3PAYA 3PAZA 5D2LF 2P48B 2W9LA 3KHQA 3WFZA 3VAEA 4JM0A 2BP3A 2BIPA 4R3SA 5LKNA 4MA8L 3WEBA 4G82A 1OSZA 2WSKA 4FYTA 4P9HL 1A14L 4AUJA 1KIPA 3LVEA 3ZDZF 1TZ8A 4R96A 3LD8C 3PV6B 4LHUB 1CURA 3IWUA 2DLHA 4F2ME 2A9BA 3BZ4B 1OM9A 1DE4A 4KQ3L 4OGXH 4ETQB 4C56B 2XWTB 1GSKA 4NKMB 3MUUA 5H37G 3RKDD 1KB9K 4LSDA 3SZKC 1AMYA 1AH1A 1LK3L 2KYIA 2NY1D 2VMJA 5DUMH 5C0GA 3NN8A 5IG7A 1VZGA 3RPIA 5LB1A 4ZPTA 1NMCC 2EIDA 2C7UA 4FZ8L 4LOFA 2UZIH 4GRLA 1DTUA 1QW8A 3QK0A 3ZMRA 5B1KA 1B6DA 4LHQB 4OIIL 3RL2A 1I82A 1HJBC 5I1EL 4N2BA 3EGXA 1DO6A 5ACZB 1XGUB 3TYFB 4IDJH 4U4IA 1AFVH 4JPKL 4G2AA 2JV6A 1I9JH 2OMYA 5K1NA 4F33B 3G5WA 4HFUL 2BRRH 3OKEB 4DW2H 3EJZD 2PYEA 3HMWH 3PRZA 3MRNB 4NNXA 5GSVA 5HYSB 3MR9B 4J3OG 3LPOA 4NP9A 4P2RE 1J7VR 2IH1B 3N1MC 5HI4D 3V6OC 4JMXA 1XGRB 3MRIA 3ES6A 3SEPA 5BS0D 2COQA 3QWRA 1AZBA 5AYTA 3B9DA 3LB6D 1BREA 4G11A 2RBLA 1GHFH 2AEPH 1YN6A 5I0XA 4HMCA 4TUJA 1NAMB 4MMZB 3MBWB 1JTTA 1RZ7L 4L23A 1HI6B 2P5ED 1OAYL 4L1HA 4I5BB 5ECJE 1XSIA 2ARJQ 5T1LD 3WELA 5GJTH 4LCYA 3PDDA 5LN8A 3DSNA 4Z76A 5F0MB 2DWEB 4DZBA 3WSQL 4WU5A 4EJ1C 4JO1L 5JQ6L 4L0ZA 4DAGH 3FSZA 4ILDA 5KYYB 3V7AG 5JZ7D 4R2GD 4YBLC 5EWIL 2VCOA 3RWHA 1ZA6A 5T1DH 1I75A 1EGJH 2KI6A 4M8QA 4MJIB 2VL5B 3F6LA 3X2QB 5A6MA 1OAQL 4IBYA 2GB2A 5DT1H 4DFHA 3QS2A 3FSOA 4S2SA 5IJKA 5FYLH 5HBBA 3T0AA 3FO1A 1JYNA 4NKDB 9CGTA 5LHDA 3A6CH 1A6UH 4Z77B 5IW1B 3U7WL 2BNUB 5IW6A 2ZOOA 5EORH 4FQQA 1SLXA 3WLWD 3WL9B 1R9FA 3WTWA 4KO6A 5AVQB 3ULVC 5DYOB 1RZIB 3C6SB 4G6ML 3PHAA 5EDXA 4I88A 4YWGH 5F72S 1HEZB 3QEQA 3PWPD 3UAAA 1UB6A 3P73A 4OJEH 3V6FA 4BZ2A 5LVEA 5E6ZA 1W8NA 1HINL 1BJ1H 4JVWA 3C8KA 4ZAKC 1NFAA 4LSVL 3MLWH 1OM3L 3TV3H 4AEEA 2AEOA 1UT9A 2JKTM 1TU2B 4GIPD 4LCIL 3QT2A 4OCRL 4PCTA 1LQSR 1YQVL 4YSEA 5FFOA 1GC1C 4J39A 1F6FB 4M1GH 3KLDA 1CYWA 2FX8H 4F7PA 1BF5A 1KZYA 5KSVB 4JLRA 5DJAB 1A25A 1FV1A 3MRKB 1I7UB 2OJ1A 5I6NA 4UT9A 1G9NH 1Y18A 2G30A 2X6CA 4HWZA 5SWZE 3TNMB 3G5XA 1MI5B 3AMLA 4RAUB 4XP4H 5EOCJ 5CLXA 3W0WE 1INQA 4LLWB 4APQC 2VM3A 1JF5A 2CCWA 3DHPA 1G9HA 4UM8A 5EH1A 4G9FB 5TH2A 1TETL 1SQMA 2QGEA 1CC3A 3GSWB 4WVRA 3UCRA 4F3FA 5ACMA 3U9PH 1BOYA 1LM8V 2BNRA 2K3TA 1MRFH 1A3ZA 3MC0A 1LWHA 3H9ZA 5DRNB 3CAFA 4EVNB 3E8UH 3L6FA 4XMXA 5F8RC 3L1OH 2IO5A 3RIFK 4RRPG 5BVJB 3WJJA 4MJ4A 1T6VN 5EFIB 3ZE2B 3GMMA 3W5NA 1OIOA 3UTQB 2AQSA 3OX8B 5F7MC 3HBGA 3MV01 3RQ3A 2PCFA 5D96C 1UJTA 3L3JA 3T4AA 4JCMA 4DOHE 5BW7A 1GA2A 1PJ9A 2CSPA 2OP4L 4WDIB 3KLAA 4XHJD 4F7TB 4YSPA 2ZUUA 5BMFH 1ZS2A 4UQDA 5F7EH 2MCAA 2F54E 5CLYA 3DX2A 4FULA 4F8LA 1ZGLM 5FFGA 1W91A 3L45A 3HB3C 2A9DA 2JB6A 1FP5A 1MELA 2CAKA 4PJBA 3B5GA 4X8GA 5DO2D 1OAUL 2VLRD 4QRTA 3HS0A 3VXRE 5KYNA 2QTEA 1TMCB 4K3JL 3BDYL 1FG2A 5H35A 4MJ6B 1F5WA 4F15B 4N2MA 1F45A 1M7IB 1MCCA 4H0HB 2NX5A 1XF2B 4ZYKA 2EDHA 2MCPL 2CGYA 3FC8A 4HK3J 1MUJA 3ZKQD 4CVXB 3PNRB 3QIWC 2DYRB 5FK9A 1BQHB 4PTUA 5I6LA 3CN1A 5FEBA 4L2LA 1MAKA 2L7QA 4XCFL 4Q89A 3FFDB 2WYTA 3H3KA 2VZUA 3ZL4H 1YNKH 4C4BA 3HKFA 1P7QA 2KPWA 4V1DD 3MBXH 4ZO7A 3K8LA 3S35X 5D2NC 1T03L 3TN0A 4YHKL 5E1GA 2FGZA 3G5VB 1HHJA 5JIDA 1N2RB 1SDDB 3WIHA 5JOFA 4F1ZA 1N26A 3CLFH 2GUYA 3FU3A 2V7NA 1CDBA 5E4AA 1I8AA 5E8EB 1BP3B 1PKQB 4N3UA 3S3PA 5EN2B 3BUBA 5DJ0B 1OLLA 3IJSA 4M7ZC 4UDTA 1OGPA 4JHAH 4XAWH 3WO4C 1ZDQA 3WS6A 1EFXB 2DEYX 3CFQA 1IC7L 3ILQC 3MN8A 4H5SB 1D2PA 5HHPB 1CBVL 4JG0H 1PG7L 1ZSDA 2X12A 3UAJC 1DSFL 3RY4A 1VPOH 1U8IA 1DN0A 4NNYB 4AITA 1NGWB 4BQ9A 3BC9A 2IDFA 3MRQB 4Z7UE 1AHKA 1LO2H 3B9AA 3SKUD 4UOQA 1RSFA 3WMQA 5C0JA 3MRBB 4GW4B 3LEVL 3UADA 4I8DA 4MDIB 4HAFA 5MENE 1QP1A 1UVQB 4JM2F 1FN4B 4AL8L 2TRYA 5HHXH 1IC5H 3STBA 1HHIA 2VDPL 3ISYA 4RQQA 2YPLD 3FT2B 5D6DC 1GJWA 3TO4A 3CHQA 1H15A 4I89A 4MCZB 2NNAA 3EFOA 4M4RB 5C3TA 2CRYA 1GZPA 5INDB 5BV7H 2K4WA 3GHEH 3MCLL 25C8L 4Y1AD 4FQIH 3RPKA 3SPVA 3RIAF 5KZCD 3N55A 2HLAA 3EHBC 2E9IA 2GK0B 3EYVA 4HLEA 1OQOA 2OV0A 2X4NB 3LDBC 5DD6B 4KNSA 4WW2B 2D4FA 3UCQA 3MNMA 4HIIB 4F1SA 4NDMB 3K5RA 4PG2C 2APSA 2YC1B 2BVPA 3D2UD 4A2MA 2YMTA 2IGLA 8PAZA 4F2FA 3U83A 2K9UA 1J0ZA 4JM2A 4GO9A 5LXGL 1PSKH 3FRUA 4CNIB 1T2QL 2IG2L 2PPCA 4KPHH 2GEEA 1B4JL 4ELMB 5I74C 3OMZA 4ODHH 4X4XA 2JKIS 1ETA1 4PVNA 4R4BB 5I1DB 4O00A 1KGYE 1DFBL 3E2HB 3STZA 2MHAB 4PRID 3FFCE 4PWEA 3D3VE 5AG9A 2XWEA 5HD8C 2WN2A 4E36A 1JK8A 1OSPL 3FOMA 4MAYC 3EYQD 2HFGH 4P4KC 1K8IA 4GLRI 4QAMB 2BVOB 3PGCB 2XA8H 4POZD 1P6WA 5D93B 5F3FA 5FM5O 5FO8B 1CF8L 2UUDH 4N0FB 4D9QE 3TU6A 3GMQB 4JQXA 2H9GB 1HHKA 1PLAA 5D1QE 4TVPD 5E1AB 4NI3A 3NZ8B 3MUJA 4FQCH 4JFQB 3SO3B 5CGBA 1JGUL 1MCSA 3NJHA 4ZXBD 2Y6SC 32C2A 3ESPA 4JKLA 1YUKB 3NCEB 4P5KA 2ZKHH 1UFGA 3APDA 5CU5A 1II4E 1F2QA 4P23A 3DUSB 4I0PD 2EVIA 3IU3A 4NM8L 1J1PH 3BZ5A 2EO9A 3FTXA 3DIFB 3GBDA 1OT2A 2Y3NA 1Z3GH 4G8FB 1SFDA 3QZOA 5DSCB 1DQJB 3NTCH 2LV4A 1A66A 3I02A 4P2RB 2IH3B 3AQZA 1IBDA 4DP2X 2IQAB 1CIUA 2X28A 3GRWH 3GB7B 2DS4A 2E7LA 3ARDD 1KTRL 2OL3H 3CK0H 1HESA 4GT0A 5GS2D 1RFDH 1A3RL 1BBDL 2OLDA 2ICWB 3OC5A 5CZKA 3VH8G 4EI5A 5DK0A 5DFWH 1M2VA 2DQIL 3HRZA 4LARH 2NY6B 4Y19E 4H2AA 4IIQB 1TQCB 4JREB 1G7JB 3QUXC 3KXFE 4DVRL 3O8XB 1DBBH 4QJ4B 3FTZA 4YS4A 2VR8A 3U46A 1FZJA 2Y0SA 1DQLH 2ZYHA 4NQUA 3UAEA 3KAAA 6PCYA 1U2HA 2DJ4A 4NCC2 2PXYB 2VLLA 3DRQB 3D2UA 4PB9H 3LNHA 1WEJH 3QDJA 3AC0A 4LL4A 5HHOE 3ASWA 4HKXA 3T0DA 1NKGA 4GAYB 2DI8A 3MYJB 2C1OA 2IADA 2EDKA 1IGMH 2OCFD 3GDBA 3HNVL 1S78D 5I2IA 1BVKB 5GGRB 1QQDA 3O9WB 4JFFA 3SQBA 3IMRA 1I9IL 4XBGB 3QHFH 2X6MA 4P59H 2PYFB 4Y5YC 1ZANH 1IL1B 3K1DA 5B38G 4HZLA 3H3BC 1ZLWH 1UWXH 1P2CB 1QI3A 3LN9A 3QDAA 1X6NA 2X0VA 1T5KA 3VA6A 3ZYIA 1EANA 1U4FA 3ARFC 3PL6B 3D4CA 3KMDA 5CEZL 4K9EH 3QUML 3H7BA 1AQHA 2JXMB 1DEEA 5HGGS 2XWCA 2J55A 3DO4A 4FQPA 4XZUB 3MBEB 1F4XL 3IBOA 3HHSA 4BBWA 2GBUA 4X6CB 1FL5B 5FLVA 3B2MA 1QR4A 1PTZA 3WHE0 4HQQL 4YL4A 5LUMA 4PHZA 1AD9A 1YY9D 3C60A 2XQYG 3Q2CA 2K70A 4FJ6A 4EDWH 4ZXBA 1TLMA 2AJUL 1NGYA 3QDME 3DXAE 4YSUA 2BERA 2PW2B 3S2AA 5LG6A 3V0IA 5A2KH 1A4KA 1NTDA 1TQTA 3MUHL 3CX5J 2AQ1A 1ROCA 3F7YB 3N5AA 2XQBH 1FRGH 3A4FA 5EZIH 4L0PB 1F86A 4JS7A 5SWZB 2VH5H 4Q6YA 4AV5A 2BSCA 3O2DA 3O4LB 1ETZB 4X9IA 3VRLF 2WQXA 2WBKA 3QQ3B 3OD3A 3TT3H 2O72A 1NFDF 1OGAE 3B7SA 1VB9A 2W80C 2GTZB 4R5XA 5DWUL 5IFJA 4MXVE 5FKPB 4FFTA 3OF6D 2JKRM 3FRPB 4I85A 3LXAA 1R24B 5E94A 4ADJA 1OW0C 4OF5A 4PJ7B 3H42L 4NPKA 4L4TA 3UEQA 3LQAH 4WU7A 4AV0A 2DKUA 3ESUF 3TCXA 3W9DB 1TTCA 1NGPH 4UTBL 4HJGA 4WV1C 3P4MB 5JQIB 3BOVA 5C08D 1I1FA 2HMID 4WFEE 1QZ1A 5IEHA 4U1MA 3F7VB 3OB0K 3BLKA 5A1AA 4DOHB 3W9EA 1W6WA 1TMQA 2NPLX 3TYGL 1U8CA 4P5MA 2F54B 5C07A 2XYBA 1J8HA 3GUFA 5ITBL 3AADB 3FQYA 4X8CA 1MAMH 2AANA 2R0WH 2VR3A 3MZGB 3JYCA 3BP6A 2JI2A 4K5NA 4NQSB 3ZTEA 2D7QA 2Y1VA 2R9HD 1CE6B 4IU3B 4L8SC 4NSKA 3CFMA 2OZ4A 4RMRA 4EQ3A 1T89A 4KUZL 1BYNA 2FECL 3PS6A 4QOKE 5E8DL 4BZ2L 1G7MA 2ITCB 3D9AH 3VQ1C 1KJ3L 4M7LL 3V9FA 5BUAA 5DEGB 3QWQB 1ZXKA 3H9SB 1WITA 2OZNA 4EIGB 3P9LB 1AR2A 5IB4A 1CDCA 2XPGB 4QHUB 4WWKA 3ZJAA 3VI3F 5IESH 2B20A 2W0FB 1KLUA 3OB8A 2BM3A 3CVBA 1QVOB 5DRWB 3BFWA 1N59A 4HS3B 1GGYA 4U4BA 2EE0A 2X2HA 4G1MB 5I1LA 1BZ7B 3VG9B 5LGHH 5FAAA 1IQDB 2YRBA 3F85A 3OWEA 2RMNA 4J3OC 4UT9L 2TSAA 1DVFB 2GJ6E 3DTXA 3GSUA 4YHOH 2X4OA 5DI8B 3WNIA 5HGBA 1OZUA 3ZBMA 4KXDA 1ZDSA 3U79A 2DEXX 3US9A 5ALBL 1KCUL 2VLKB 1IKNA 1DVXA 3ZK0A 3P3SA 4KO5A 2WXJA 1FFNB 1ILSA 3II1A 5DRZB 3PIQA 3ZTNL 1C5DA 2Q9OA 4RCAA 4PJDF 1JZ8A 5IJDC 5KSAC 4S1RL 4NOFA 3VI3A 3WFHB 4S1QH 3PGDA 4QRRE 4UQAA 4N9OB 3DOSB 1Q0XH 3DVNA 3BJ91 2K8MA 3HLKA 2CLZA 2I7OA 2QLYA 1NAKH 3HG4A 3S4SB 4G8GE 3A6BL 4KXBA 3PHOA 1GPOL 4L1BA 4OD1H 2J43A 2XT1B 4N8CH 3KWVA 3QFJE 4KVCH 4O2FA 4L1DA 4N5ED 3QI9B 4TOYH 4A6YL 2VXSH 1EEYA 3O6FB 3GHBL 3RU8H 3KYAA 1NPJA 2M1KA 3LNIA 4GSQA 5EBGA 5KOVC 3SE8H 3V5KA 5MP6L 4PJDA 3MU3A 4FOMA 2CH8A 3EGSA 4B5ZA 3OJVC 5KW9L 1BXXA 1P5UA 3FPYA 3KJ6L 4ZFGH 3CPLA 4LB8A 5ITFA 2DD8L 5K9OB 2DQGL 3ULSA 2OI9B 3IMBA 1BPLB 3RTQD 3B83A 2MH4A 4J6RH 4PGJA 3BRDA 1TPXB 1OB1A 5J57B 3VXQA 5EF1A 4L05A 1SDYA 2O1AA 4KROB 5ADPH 2H3KA 4XNYL 3ISRA 3MXWH 1MREL 2NNCA 2PPAA 4PLNC 1VFOA 2FX7L 2NY4B 2Z1KA 1LK2A 3KM1A 1ZD6A 2VDOH 2Q10A 2ZOLA 4QMEA 2G3XA 4Y4FA 1X5IA 3IPFA 2DLFH 3WE6A 5HYJE 5EA0L 3CFUA 1AI1H 3VFPB 1DBJH 1ZHBB 5EU5A 3W39A 4ADIA 3HI5L 4WKZA 2XUWA 2UY7A 2ADGB 2X89A 2XBTA 5GRZA 4Q9RH 1NMAH 1S46A 1JRHL 4OZFG 3S36X 5IMOB 2K3HA 1W0VB 2AI0L 5CD3B 3BQUB 9PCYA 2XTJD 3NSDA 2Z4QA 2X0UA 4YAQA 1YNTB 1HZLA 3BAYA 4X7DC 1X4YA 3ARGA 5A2BA 1A9EB 4D0DB 4IOSD 5D1QB 2Z92B 4H0GA 2K6WA 4F58L 3H6JA 3UTZA 5DUPH 5I76A 3S2CA 2A6DB 4JO2L 4FA6A 3JT0A 1ZVSA 2OMWB 4OGYL 3BKYH 3MGOB 1OCZB 2CR3A 5JIQA 4PJ8B 1HH9B 1YEEL 4F57L 1KPVA 1WAPA 4G5ZH 4HGWA 4OZGB 5AWNH 1SLUA 1NC4D 3G6AA 2XSKA 3BH9A 1WZKA 3ZQ9A 2NW2B 5IOPB 1R5WB 4TSBL 1BX2A 2JJVA 4UIMA 5C92A 3PXHA 2BNQB 2AQRA 3MLSL 4ZODA 4QRUA 1P9MC 5E00A 2R7EA 3UYOD 4LOVA 3WFCH 4Z7NF 3IFPB 4NX0A 4XNZC 5FPIA 4OZIF 3KVQA 4DZ8A 1MCJA 3NEOA 3MA9H 3VWJC 3U4AA 1IEHA 3IT8D 1EHLH 1Y0LA 4FFYH 2UZXB 1HZHH 2ZG3A 5HDOA 4NWUL 2FUTA 5E4IA 2JQMA 3BMWA 3H3PL 2DM7A 2ICES 3TZVA 2XV0A 5KN5A 2ZSVB 1H6EA 5DMIH 2VXVH 5BQ7A 1Q9WB 1I8MB 2YAFA 2DWXA 1MFNA 3QUZD 1AY1L 1RVFL 4JE0A 1HYSC 3BPOC 5EPMB 4NXSA 5IFHL 4LOUD 1ADQA 1U42A 1WBXA 4GIAA 4OZIA 4Y88A 3NZUA 1AQKL 5DU7A 2YK1H 2P7TB 1CK0L 2W38A 5DURB 4CVZA 5ESVB 2V8MA 3CDZB 1QEXA 4IMKC 2DIBA 1S7VA 4Z95H 3ZTDC 1UXLA 3L4UA 4KHTL 2HFTA 1RJCA 4IDLA 3BI9X 2ZCKL 5GJSH 4WAFA 3WNKA 3C08H 2IAMB 1AS6A 1MJ8H 1KJ2A 1AJ7H 2RACA 4ICXA 2I25N 3EJJX 1EJFA 1CU4L 2VDRB 3CMOH 2AJSH 3STLB 5IJVB 3FPXA 5DC9B 1KIQA 3S37X 3GSVB 1JVLA 2X9WA 1U93A 3PPSA 4NC1E 3UMNA 4D8PB 1JGEB 5FFLA 2X3BA 1Q9OB 3S7GA 2WBJC 2YJLA 3HG3A 3O2WL 3Q5TA 5KVGE 1VKXB 1S9VA 3EG9A 5BRZD 3WIIL 4B3VA 3LYRA 2CM6A 1YZZA 3B9EA 5AZEH 1IAIL 1XD0A 2A9NL 4NQDB 1M1XA 4RMVA 1NKRA 1AR1D 2YEZA 3LD8B 5DK2B 5T3XL 4LLYB 2NY0B 2X9ZA 4X6FB 2A0LC 3MUZ1 1XF5B 3I6KA 3V4LA 5DEFB 1KGJA 1KXTA 5C8JB 1Z6JT 4IJ3B 1UXWB 1NIBA 1R3JB 3G9AB 5DQDH 5SWSE 3ZYZA 5IB2B 2VLJD 1UCTA 3ULUF 5C0AD 4WTQA 3ZKSD 1OGAB 3HHRB 1SLWA 2B16A 2CK2A 4CL7A 3MJ8B 3KWXA 4HG4J 4DO5A 2JCCE 4I1PA 3MA7A 2R29L 2BOBB 1U36A 3SDDA 2AXGB 4GSDL 2W9DL 4U2ZA 1A3LL 4U1GC 1FFOB 1IGCL 4R4NC 5L2KE 2J5WA 1KN2L 4GUPA 5CEXA 3W82A 1N7ML 1RK1A 5TGBA 1RIHL 3C6LC 4XMVA 2OJZH 3SDCA 4IBTA 5J3HD 4K9JA 1NCNA 3T0XA 4MJ2A 3WXWH 3K7UA 2Z91B 2FEDC 4GW5A 1BYOA 2ZCLH 4K7FA 4HJ1A 1LL1A 3ZDYB 1DL7L 4O9HH 3CH8A 1U95B 2VW7A 3UYPB 3KPNB 4WFGE 3QUZA 4S1DD 5BVPL 2ED8A 4EIUA 3EJUA 3ILPA 4WO4D 2I9TA 1AMXA 2CRZA 5DJ8A 1JN6B 4PP1D 5I0DA 2FO8A 4Q6IA 1BAFL 3AWGA 1V8HA 1I8UA 3SDAA 2EDLA 1T1XB 5LDSA 1S9KC 5K1JA 1G1YA 1M4KA 4PJ5E 3AY4C 4WGVB 4ZMOA 4P46C 2EINB 3E6FB 3SBWA 1GMIA 4PJCE 3QQ9C 1KFAL 1ZT1A 1HWWA 4CU6A 2JJTC 5K9KB 4G8EA 4W9DC 1LJMA 5E1HB 1FYTA 3AREA 4JGJA 2NOYA 5AW2B 1FDLL 2DIJA 1ZLDA 3ARSA 1XDTT 3RVUC 4UNIA 1WPCA 1A1NB 1DJYA 1SNRA 3BZFA 4XO5A 4L5FL 2KZ1B 2ADJB 2BIHA 2YSSA 4RESB 1BLIA 3ZU8A 5FYKL 4ZFZA 5D7SH 3PJSB 4ZS7H 4ZMNA 3WS3A 1NINA 3N50A 3E80A 2J56A 4QRBA 4MZ3A 5EBWA 3TBTA 3D25B 3GNMH 3F5WB 2RCSL 3LH2L 4PGDB 4X7TA 3I9IA 2R8SH 3D51A 1SXAA 2B39A 4D0BB 4ZMLA 1XGYH 4OT1H 4YLBA 3C8HA 5C6WH 1XH3B 3SBRA 5EUOE 3UJIL 2Y5TA 4OCWL 3ZR6A 3CU7A 3BP7A 4G70B 2HJLA 3CXHK 2C8NA 1M7UA 1XGPA 2FAUA 3BGMB 5FS5A 2LW3A 3WN6A 5C0RH 4HULB 1AKJD 4QT5B 3O41B 1BW8A 2IGTA 3CH1A 4FDWA 5EDSA 1IQWH 4FYSA 1QRNA 3SOBL 1SXBA 2WIIB 3NRPA 2OR8A 4GUCA 4OAWB 3NDZE 2HUEA 4PIBA 4AYSA 3KPRE 2A3TA 2HJKA 5I8OH 3QFJB 1L9PA 2HJFA 4E9YA 3BZEA 1IC4H 2WSDA 3B9VA 2NQ3A 1NUDA 2ZTBA 4YDVA 4S0SD 3L9RB 2HB0A 3BN9D 2SODB 2ZX5A 3VD5A 2B7DT 4NFCA 4IRZA 1AZCA 4LRNL 3GT6A 4J8RA 4O2EA 3VRJA 1ADWA 3HPLA 3NCCB 2J44A 2Z4TA 1OCWH 4OLVL 1OLZA 1X4XA 3NIFE 4MA3B 1FO0A 4WI7A 4APQB 4IS6B 2JCWA 1VFAA 3QJRB 2HVKB 2D3JA 1RZ8A 5I1IL 2OK0H 4Z0XA 3BAIA 4KI5C 4E0RA 4GQ9H 5HPMA 2X4RB 1XXDC 3D4YA 2BJML 2JKSA 4PRHE 3HE7A 1JD9A 3B8YA 1IUZA 3D06A 3QDGA 1CFVH 4FMVA 1URLA 1XEDA 1Y7VA 1HU8A 3V6ZB 4MMYB 3DYPA 1SHSA 2MKWA 3VXMA 1FSKC 3WMSA 4F93B 3GBEA 3GPSA 4GKNA 4YK4B 3ZE0F 5LQBL 3FUFA 1EO7A 4JFUA 4HUKB 3BP4B 3X13A 1XZ0B 3LAFA 3G6JF 2WO4A 5EO0A 3SDXB 4WW2F 2UWEA 2DTMH 3P69A 4OJCA 2YD9A 4LU5H 2FQDA 5IF0A 4Y2OA 2B15A 2DYPA 3QARA 4GINA 4AH2B 2JELL 1TVBA 2HFEB 3IMTA 4O51B 1JG9A 2VERA 4JFHD 1ZHLB 5HDBB 4AT6B 4YX2H 4JY6B 1U30A 3U48A 2NY3C 5AKTA 5EZLA 3ARPA 3QZMA 1XH0A 5J6HA 3VDBA 5AYQA 5KJ7E 3PWLA 4BFIA 5JNYA 4XPAL 4XWGH 2VO5A 5JDJA 3OBAA 4M8RA 3AT8A 4Y16D 3GMRB 3OKLA 3G6JA 5I15H 4XN8A 1KN4L 3MLUL 3I2CL 3Q8AA 2ARJA 1U8JA 1FFRA 3IGUA 3NCWA 4OQTL 3LRSA 3OZLA 3V4PH 3RZCD 4JR9L 2AERT 4JO3L 1A7PH 5I5RA 2HRHA 5IBTL 5IQ9A 3TCLA 4HOWA 5KVGH 2DBLH 4UBDC 5TQ2H 2EDMA 2BFVH 2G0KA 1FZMB 1XR8A 3GJFA 3Q6GL 4HXAL 4K8RC 3SKMA 3SPIA 3UEZA 3TFKC 2WNXA 5F6HI 2BCKB 4E2OA 1N6VA 3SGEH 1DUYB 3W57A 1G7PB 4LSTL 3VFNA 3K0WA 2EVFA 4FFWC 1OD7A 1JV2A 3WOVA 4ALAC 2ZWKA 5D7HA 5AKVA 3FT0A 1JZ3A 3TBVB 5CO1A 2DW5A 3QEGL 4K94C 4M4PA 5BS0E 4LBEA 1UM5H 1WA2X 1JPST 5CCGE 4FNRA 4W9ZA 2O6EA 1KENH 4OCSH 3B8SA 3NSCA 1XR9B 4XPGL 4HDIB 1AAJA 1AHWA 3C5ZA 4CKVX 2WM0A 1MRDH 5GGVH 5DJXB 4RFEB 1MOEA 4ABQA 5DR5H 4ODWB 3U1PA 2WXGA 1R33A 4QRPE 3QJTB 1N64L 5KJ4A 1L5GA 3CZNA 1BD2A 1SY6A 2NY7H 1MFUA 3WLBB 4CC0A 2QVKA 2AAVA 2GFBB 2GIXA 5JW5A 2WAQA 1FNGB 4DCQA 4LEXH 1GIGH 5KSBA 2AGJL 3SJVD 4AQEB 3RUGB 3PFUA 4FQ2L 1X6LA 1NWPA 4WI4A 3TTSA 3LN4A 3DVGB 4U0RC 3D85A 3EHBB 2XC8A 3LKPB 3QFDA 3KGTA 4DKEH 3EYSH 4N0YL 4NENA 2F5BL 4HJ0D 3TBYB 2Z31C 3FH5A 1MW2A 5CU9A 3V4PB 4OJFL 2W9EH 1GZHC 2Y1ZA 2C5DC 3D4GA 3DTUB 1TR7A 2JJSA 5H94B 4QHMB 3NJXA 3QNYB 1Q94B 5IFAH 4IK6A 2F61A 4RAVA 3BPLC 2P5WB 2WKOF 2D3LA 4OF7A 1P1ZA 1F1DA 1MHCB 1U3HA 2IWFA 1FNEA 1MVUA 2ORBL 1M2OA 3CJJA 4X99B 4MASA 3X17A 4KZDL 1U21A 3C5JA 3FU6A 5GRJH 2AP2A 1DQQB 3KLHC 5D1ZD 2BS9A 4K7PH 3NABH 3GMPB 3ARWA 3GMNA 2GTWB 5AW3B 2BSRA 4IRSD 4MAYB 3C12A 5CN1A 2Y1YA 1M7XA 4L1SA 4KRPB 5SWSB 1MY5A 4RMBA 3VCLA 4HUCA 3QO0B 4Y5VA 3CVCA 4DN3H 5I6PA 1S9WB 4MBRA 5CD5D 2J8HA 4NN7C 2WKOA 2JCCB 2WOBA 1XB8A 3MV8D 3SYOA 2FT8A 4BQCA 5CCKL 1HZKA 1KSRA 1UD4A 4GI6A 4DO6A 4H1LH 3S5LA 4PD4J 5L2KB 3SODB 1AO7A 4UM9B 3WKML 4K3EL 1N0LB 3HUJE 3GI9L 4HUUA 4F8PA 5L88H 3VTTA 4D9RD 4BHUI 1WWCA 1WTGT 4NFDA 4ZOBA 1DQMH 2G5BB 2W81C 2XWRA 2ZOUA 4M61A 3T5WA 4AC2A 4JKPL 4DT2A 2YAHA 5FA3A 1Z5LB 3VRIB 3OXRB 4AQZA 1EO8L 2X4SB 2ZXAA 3HE6C 5IK3B 5B8CC 2DBJA 1RUKH 2FLRT 3D18A 4ZTOH 3MROA 4WK2B 1VFUA 2MJWA 4WUKH 1PZ5A 2V2XA 2J1KA 5EC2B 3OHMB 4H1LG 4FNSA 1CXHA 2E59A 4LFHD 3IAGC 1HH6A 4HIPA 4PJ7F 4LLUA 3RL1B 5CJQH 1UCBL 4FHJA 5CEZD 2V7HB 4PJ5B 3NT0A 1WICA 2PO6D 1XB3A 2VM4A 1FNFA 5C0DB 4W70A 1AC6A 5MI0B 4NQVA 1J9TA 4YH6A 2N1TE 1FCCA 1JUFA 1NAML 3FQ2A 3N85H 4CC4C 3TBWB 1PZ2A 4EXKA 3QUXB 1BZOA 1FZOB 4OKVA 4KJPC 4HD5A 3RNQA 4NZFA 2QSVA 3EJCA 2EICA 2VLRE 4GG6A 1OB0A 1GTFA 3SGJC 5IGXL 1RPUA 3VD7A 3D0LB 1J05B 1TJMA 1B0GA 1HQRA 3E7JA 3DTDA 2KLSA 3NJGA 1MH5A 3G3LA 5HI3C 4F8OA 3J8F7 1OOWA 5DUML 3ZHLA 1X4ZA 3TVMC 4K5PA 5E2VH 1PIGA 4HJEA 4RIRA 3F7QA 2RIKA 1CLZL 2C26A 4WFHD 1G7HA 4Y5YB 1CD1A 2HG5A 5AB0A 5I8KH 2XKNB 5E23A 3RGVC 5BNXD 3QWOB 4V1DE 1R3IH 4ZTPH 4IRSA 1P4UA 5EUOB 3SPJA 1T0MB 5J12C 4J4PD 5EO1A 3GTTA 1I85C 3BKMH 1TLKA 2Q7AA 1HKLH 3PDGA 5F44A 4DGYL 1MRCL 1KTBA 4S0HA 1PEZA 3WUWA 3N0AA 3HMWL 5DRXA 3T0ED 3KPRB 4XX5A 1R0AH 5KBLA 4U1KA 3CIAA 4Z7WA 3K71B 1DQDL 4JG1H 3CLEH 3R4RA 1ES0B 4X5PA 5C2UB 2KHAA 3ZRCC 3KS0J 4NRZA 1UA6H 3ZKXC 1M57B 1SJHA 2EYTB 3ZRFC 1CD0A 2BHYA 2UVFA 2IBZX 4GAAA 3L8QA 5C7XL 3FJTA 2DQMA 3CZUB 5IB5B 1Q9KA 1N4XH 1MHPL 5DDHB 3PQYA 3WN5C 5EBMA 2FX9H 1C5CH 3IAQA 1E28B 3QZWB 5GJTL 3QUYD 1BJ1J 3QJQB 4DUVA 4OI7A 3Q13A 1BZ9B 4DVBA 4MS8D 2YPLE 1LO5A 4HCRA 4NWTH 4PRHB 4YNYA 3QCUL 1OTUD 2XVGA 3OHXA 4Y1AE 4MMXC 5HJBA 4RX4D 3MXVL 5DT1L 1LVEA 1CGYA 3CVIH 4POYA 3VMNA 4ZFFA 3TA3C 3CZJA 5H2BA 2RGSA 5G55A 4FQXD 4X5WA 2XY2A 3GSRB 1LTXA 3QIBA 1TJHL 5JR1L 1A6UL 5IVXF 1NJ9B 2H6PA 2IOMA 4L29B 3ABGA 3CIQA 4ANWA 3IJHA 4HWBH 2P24B 3JV0A 4AKOA 2BVQB 2CK0H 5D4JA 3VXSB 4F5CE 1YEWA 3IF1A 1S7SB 3ZYOA 3MRPA 1Z5YD 3DJZA 3JUZA 1UKSA 4YWGL 1QOKA 2VJ0A 4GOSA 2WNKA 1E6JL 4UTAL 3QA3A 3SZ6A 4QXWA 5F7UA 4Q9QL 1H8NA 4B7IA 2C9VA 3SSGA 3GZOA 5E4OA 4PRIE 4AWJC 3UTTA 2XWXA 5E0QA 4JY4A 3FQNB 4NQCB 2EDNA 5FCSH 3TV3L 2DQFB 3QH3A 5I0VA 3CWGA 3RIKA 2VMCA 3EYFA 4HS8L 1J5IA 5DHVA 5IVXA 2QMKA 2OMTB 2GBTA 2P8MA 2P47B 2W91A 3CDYA 4L3EB 4R84A 3BSZH 5A2CA 5CIPA 1I3UA 5GS0C 1RZKL 3OKYA 1MNUL 3HZ3A 2OXHB 4LVNB 4WNJA 3OGCB 3AXHA 4KMQA 4TVPE 4ZSOE 3V8CA 3MUGB 3K2IA 2JKWA 4WUUB 4JRYB 5BOPA 4GBXD 4HETA 1RL1A 5D5MA 4MB4A 5JO5A 4NZUH 1Q72L 3JV5A 2WV3A 2X42A 4EKJA 1DVTA 2BIIA 2WO3B 4P99A 1BIIB 1MEXL 1H0DB 1U8HB 4Z8FL 4MXWH 3MNWB 2PETA 5LBSL 5KSAB 1XO8A 5DK3A 5EEUA 1U3JA 2ESVD 3C87A 4OZGF 3BO8A 1G6VK 3BUYA 1FPTL 4ZD3L 3K8KA 4FG6D 4N2KA 2VQ4A 1XIWC 5E6ID 2VDNH 4LGPB 1E4WH 1TZGL 2VLME 1A3QA 1IM9B 2Q86B 1J5DA 1NUGA 4Q14A 1CICB 2X4QA 3HR5B 4RAHA 3L9BA 2BIQA 2DQUL 4QRPB 4ZOCA 3UROR 2K7PA 1G6RA 3MX0B 3GSXB 1RULH 3F7RA 1T21B 1CG9A 4CA4A 2WZPA 2FL5A 3RDTA 5D1XD 2VXUL 1BFVL 3U6RB 35C8H 4M3KB 1TKWA 4R2GB 4P2QE 3VGDA 2EDJA 3B9KC 3GC3A 3FN3A 4XCNB 3RTLA 2EXSA 3MREA 2EE2A 5CFAA 5FOBB 5B3JE 4Z1PA 3VX1A 4ONHA 4X7SH 2FGWH 7FABL 3VUAA 2PPDA 3RI5K 4LCUA 5F9OH 4ES8A 1E4XH 1MAJA 5EF3A 3U7AA 1P5VA 2JKXA 3IFOA 3LZPA 1YNKL 2NDFA 3SKNA 3FB6B 1B2WL 3MBXL 2LU3A 1TQWA 2UVEA 4UINH 1E2ZA 1WTLA 3HZVA 5C70A 4NZJA 4R97C 5TTRA 2CIKA 1J1XL 1WBZB 4QTIL 4X5XB 4IKIA 4NNPH 3M46A 2Z8SA 1JNLH 4UQIM 1IGYB 2CLRB 1Q1JL 2ZAHA 5TFSH 4A2DA 4YDLC 3VFUA 1A6VL 1WFIA 2UYLB 1VZIA 1JV5B 1SXSA 3QQDA 1UXSB 2D8KA 2WD0A 1D5ZB 3FQTB 3EFFB 1JZFA 4QRFA 1V3MA 4CMHC 1SBBA 4GUQA 5C0ND 1QSVA 4JHAL 4UU9B 4N8VA 3ARBD 1XSJA 2VDNB 3H1ZA 3KPSD 4FEIA 3APFA 3GIVB 2W0LA 4PV8A 1QBML 2E7DA 4H44C 2AQNA 3IGAB 2VERN 2ICWJ 2H3NA 3GZQA 2B1AH 3JWNH 3KPMB 4JG9A 4PJGA 4B9PA 4B9CA 1TXKA 2HH0H 2X2IA 3ILDA 3V5HA 3D39D 2VN7A 1K4CA 3VFRB 4JBSA 4MDJB 3NJIA 1WZ1H 3VGGA 5FO7A 4BQ8A 3BIKB 1CFNB 2EIZB 5IB3A 2PR4L 8FABA 3FCSA 3EDKA 4X5LA 5HHXL 5K1VA 1PZUB 4L48A 4WI9A 2DZEA 5JHDA 4GXFA 4I9XA 3VI4B 3NIGF 3VFOA 3UBFA 2R69A 3ZL2A 3IJEB 3DECA 1I3RB 3I3BA 5HP5A 2AJYH 1QFWL 4XCYA 1FQ9C 3ETTA 4W6WB 3MRHA 4XCCH 5MEOA 1RUQL 4LLQB 3BH8B 1CXEA 3SIKA 4J7RA 1X5AA 2IPUK 2AVFA 3EDFA 1MHHB 3L7EB 5B7EA 4EDXA 5AAPA 1I3GH 2FSEB 5C08E 4AM0A 1ZLUK 4AEHL 1CGSL 2BP8A 1KTDA 3ZDYF 5D7LD 5IBUB 3KBHE 5T1KA 4JFXA 1OT1A 1PSKL 3QC6X 5F1NA 1VGEL 1ZT7B 4BWUA 2WGXA 3L3KB 2GAZB 4L8BB 4YC2C 4CSZA 2C7FA 4XVSH 1M53A 3AG3B 4YZFE 1D5XA 5T3XD 4HUNB 3MLVH 1JGLH 2CM5A 5FUZH 1RZGA 3BCDA 4NKOB 2BY2A 5J6GA 4P5TD 2NYYD 4B96A 2RHEA 3BD3A 1FE8L 3JXAA 2FBJH 5JW4M 3DMMD 2Z6FA 5TK2A 4U3CA 5I71B 3KYNB 5ISZD 4EN3D 2P1YA 1R47A 2XA8L 1ZGLB 1CO1A 1HSAB 4OVVA 3D08A 3OKOA 1EHKB 4FQ1H 5FGBA 3EOAB 4PBXA 2ZXQA 4JFDA 2WO2B 4WJ5B 3V4UL 1SEQH 3DKHA 3WCYA 1V55B 3DUUA 3U2SA 1HOCB 2BOCB 5DD5L 3GBML 3HZKB 4XOBA 3I9PA 5HDQH 3ARBA 4HIHB 3DBXB 2F8VA 2W65B 4NC1C 2AQ3A 4LPCA 2D73A 4QTFA 1W72H 3U9UA 4E9RA 3L4WA 4XMLH 1YEJH 2WBJB 1YHPA 2YRLA 1FORL 1PD0A 4XGZB 3BD5A 3V4VB 4ZW5A 1ZTXE 4E9VA 3T3PB 1OHZA 1Z3GL 4DK3A 4N2LA 1FH2A 4Z23A 3MRCA 2CKBH 1EMTL 2NDGA 1S9XB 1BQLH 3RJQB 2VXTL 4GO8A 1ZE3H