3FT1A

Crystal structure of pollen allergen phl p 3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
AVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEEQEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pollen allergen Phl p 3
rcsb
source organism Phleum pratense
molecule tags Allergen
molecule keywords Phl p 3 allergen
total genus 17
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3ft1A00
3D30A 4L48A 2BH0A 4FG2A 4JJOA 4JS7A 1BMWA 3FT1A 1WHOA 4FERA 4JCWA 1WHPA 4FFTA 1N10A 2HCZX 2VXQA 2JNZA 4FG4A 3FT9A
chains in the Genus database with same CATH superfamily
4XO5A 5E9DD 4ELME 1G7IB 4F2FA 2B16A 4O5LH 3O2DL 3VDCA 2GJPA 2ZOOA 1CT8A 1LTXA 1PQZA 4TSAH 4EIGB 2ADIA 2F5BH 4ISVA 3WN5C 2C9QA 2ED6A 2VXTL 3QJTB 4JPWL 2WKGA 2C9RA 5HJ3B 4UYQA 3VU2A 5C86A 3NAAL 2RMNA 5EZJA 3PAYA 4N0UB 1BZEA 2GTWA 3QORC 3FKUS 3ZE2B 5CFAA 4EN3C 1IFHH 3OAZK 3EZ8A 2IDCA 3EYVA 1TYRA 5E9AA 4JE4B 2ICEA 3DPBA 4N8CL 3BQUA 4NQDA 1II4E 1KLUB 1NC4A 3E6FB 4M1GH 3T0WA 4C83B 5BUAA 3KXFE 3S3BB 2OMWB 2D8KA 2Z35B 2J6EA 4N0YL 5D1ZA 1NMCC 3L3JA 5DURD 2OZ4A 1N8ZB 4F27A 2RIKA 3I3EA 3P4LA 2VKWA 1FFTB 1TJHH 2AKRB 3RZCA 1S7UB 4HH9B 2WC7A 1I8MB 5I1CH 3PCYA 8FABB 4PJ8A 5ERWB 3MJ9L 5I8EB 3T77A 1QLEB 2FT8A 3L2LA 5I6OA 2LLLA 2VB5A 4F2MA 3V5KA 5J13C 2FLMA 1BJMA 3EOYG 3VAEA 1Q9LA 3V6FA 3VXUA 4G9FD 2FNBA 3QJOA 4AVKA 3GDBA 5TFSL 2OCJA 1OALA 3TZVD 1E27B 3S5LG 4MJ2A 3CVHB 3LZNA 1P4LB 4KZEL 1N18A 7PAZA 3JV4A 1EJ6A 2VIRB 1D5XB 4QXWA 4M7JH 5HPOA 2ADJA 5EB9A 5EUKB 1U8OA 3L3GB 4NZTH 4PJBA 3NOIA 4RZCB 3LEXB 1U3NA 4JJ5A 1KDJA 1D5IH 3R1GL 4BFEA 4UQBA 5E7BA 1UA3A 4X6DB 5T5NF 5HPMB 1MI5D 1JUFA 2XHNA 3W37A 3C09B 1UOVA 1WVZA 3LJ3A 4R0LB 1F4YH 3FB5B 5IJKA 4KTYA 3V6ZB 2Q76B 1TF4A 2D7MA 1TPXC 3LMJH 4JRXE 5EBMA 5DSCB 3BP5A 4N2IA 4ZQKA 1MJ8L 5D7JB 1YNKL 3TPKA 1FZOB 5GGQL 3B34A 3AG2B 3FUEA 3L7EA 1XF4B 1JXKA 3QUXB 4P4KB 3P2BA 3BVUA 5J56B 3ZXAC 3ZHFA 5CN1A 5I73C 3DUUB 3FCTB 4NZTL 3JZYA 3N1PC 1YQVH 3D39A 4UQCA 5J57B 3QFJD 4JY5H 1KFAH 3RWGA 3SE3A 2VM9A 3DIDA 1A9EB 3TZVA 2XQBH 4JCWA 3DX4A 3IMUA 4L0PB 4UIMB 3DO3A 2E46A 3PWPE 4WWKC 3DX7A 5E94A 1GIGL 1MY5A 3RVTC 4KK6C 1CVSC 1T80A 4I18B 3TURA 4U4IA 2UUDK 5EF3A 1QFWL 4XE0A 5DQDH 4GG8A 2A9CA 1W16A 2BWDA 4WO4B 3K81A 4RAHA 5L8JB 1CURA 5IF0B 2NCEA 4DW2L 4E0RB 4BWUA 5DJ2A 3QNZB 4K8RH 5FM8A 4KU1A 5KW9L 2MMXA 3PS6A 4B50A 3IN2A 3ZE0B 2R2EB 1E0OB 1NH6A 1KULA 3KR3H 5IHZB 4KDVA 3BXNA 3H3BC 3J27A 3M7OA 1OSYA 2DH3A 2IAND 2Q7YA 3N50A 4GBXD 4GRLB 2HA1A 1DDTA 2IALB 2OXHA 4CSPA 2UZXB 5DFAA 1NEPA 2I26N 3OB8A 4WW2F 3Q8AA 4WNQB 3CK0H 3N41F 2WYTA 2ZIDA 2EYTB 3ZGHA 3P0VH 3D0VB 3LNIA 4X98B 3RNKA 1LEIB 1JK9B 3HPLB 3SE4A 1EHXA 4F8TA 2GPZA 1QSED 2C9SA 1QW9A 3PNWA 3L5JA 2ATPA 1YQVL 3FTSA 3SD2A 2OMVB 3U82B 4X7FC 1NPJA 5E70A 1HOCA 1QLRA 3A3YB 4M5YL 4U4BA 2ADFL 1BYPA 3EW3B 1RZKH 1U8NA 3PHSA 5JNYB 4Z3TA 1KN2H 5EV7A 4PLOB 5BV7B 1THCA 3WXWL 3MQIA 4R9HA 1W72B 4FA6A 2Q10A 2LAAA 3EJSA 4NN6C 5KVGE 4G80B 1MFUA 1HILB 3MRGB 3V6OA 2ATKB 4PLKD 4LP5A 4BFRA 1QA9B 4OF8A 3I02A 2GUYA 1VFBA 4LMQI 2Q7AA 3EBAA 4P2OD 1KBVA 5JTWA 3GB7B 1IAIM 4HJ1A 3V0IA 5JW4Q 2L7EA 3MRBB 1P7KA 1FVEB 5KG9B 5FCSH 4FYSA 4ANWA 1NLDL 4HG4K 2PPAA 3P4MB 1NGPL 5D2NC 2W9DH 4JCMA 2EDBA 2X44D 2E6JA 3SJVB 2ZKXA 3BFWA 2DM2A 3ME0B 1HL5A 3PWPD 4B95C 4WU5B 1KBPA 3HE6C 2ZSWA 4PJHB 3FQRB 3K4ZA 4FL4C 4Q4IA 2L7JA 4IHBA 1QFPA 4NUMA 5GISH 4AGMA 4GKNB 3QEQA 2FQEA 2E59A 4XH2A 1J5IA 1U8QB 4A38A 2R0WL 4AKOA 3C2AL 1S3KL 2Q8BL 5FYJL 2DLFH 3TFBA 1Q0XL 2VKXA 3DYOA 3RVXC 5DC9B 1N5AA 3UGEA 1PX3A 1E9QA 3EAKA 5AW7B 5JXAH 1G7MB 3UAJD 4NQXA 1BMGA 3BGFB 5F6IC 3MBEA 2HT4C 2DWTA 1D6EA 2WAQA 2G5UA 1XTLA 3DVIA 3MUY1 3ZKND 4LASH 2KT6A 2V9UA 4Z7QE 1NLBL 1P1ZA 1PZBA 5ILTL 3STZA 1ZWIA 1AHKA 7FABL 1LM8V 1NICA 1JNLH 5HI4D 2AEIT 2WBJC 4F92B 3MJ8B 1IAOA 1H6FA 3MNMA 3CWGA 1V5JA 2ATAA 2B5IC 1FFOA 3NJKA 1XGRA 4G3YL 3ZRCC 3PWPB 1S7WA 4R26L 2WVVA 3GSNH 1GYCA 2YBGA 4FHBD 4ILDA 4XN5A 1BVKB 2BIIA 3VCLB 2PCPA 3NG5A 5ESAA 5I19H 1K4CB 2CCLA 2HX8A 5T1KA 3HE6B 1MHEB 3WFEH 3WFBL 5KVEH 3DTDA 5DUBB 4O2CA 4S1QH 1RP8A 4OW6A 4Q7DA 2V8LA 5I28A 3H3PL 3EYOA 3MRFB 1BVNP 4L05A 3VRLE 3EO9L 4XHQA 5D5MB 3HFML 2BWIA 5IREA 4XMLL 1R4XA 3F58H 1YC8A 4NM4L 4M6AA 4M6OL 4XWGL 4I88A 3DVFA 2Q3XA 4JRYD 1K8IB 1DJXA 3VFPB 2ICWA 3S6CA 1J5HA 1NEZG 4NXSA 4A63A 2BRQA 3FONA 3G5XA 4X8CA 3MYJA 1W72A 2NNXA 1QYGH 2DLTA 3S36H 3MLTA 3ZZSA 5DFVD 3VG0H 4JAMB 3PDDA 4NHCL 1FE8L 3WNOA 3RL1B 3SJVD 1R6VA 5I74C 3ABLB 1AGBB 4GFTB 1PF3A 4TNWK 2P5WD 1BX2A 2VDOL 2E7DA 1DBAL 3NSXA 2AKRA 1S4IA 2EDHA 2MEJB 3BMVA 3WIIH 4WAFA 1JGEA 1UA6L 2BNUA 4KMLB 5AZUA 4P9HC 4WFGE 1A4JB 4X6DF 1IBYA 1KGCE 3QIUB 2HN7A 5I6MA 1Z6JT 2YPVH 5EORH 1HOCB 2NY0B 5DRXB 4FLHA 4OZHB 3UO1L 1HHGA 4FEIA 3BEVA 3RFZB 4Y7MA 3FO2B 3C75A 2WXIA 2ALWA 3SD5A 1ZLSL 3WIHL 4MQXD 2AQ1A 4QRFA 4W9DC 2Z92A 5SX5H 5CCGE 2Q7YB 4GUPA 1NOLA 3ES6B 2P8LB 4N0CC 4XB7A 3LRKA 5D1ZI 5FUCE 3ZT7A 4U3SA 3VWKA 3O45A 2H1PH 3D09A 1LDPL 4G8FB 2XV3A 3HJ0A 4WQOA 4YDKL 5CCHE 5I1GH 3IJ9A 5I6NA 1SXNA 4F1SA 4RFOL 2XIBA 3CDFA 4OD3H 1M7IB 3HS0A 1WD8A 4GSQA 1QW8A 1CXKA 3FT4B 4HCIA 2WKLA 3QS3A 1X5AA 3RGBA 3QAZC 1NGXB 2DLEA 4MAYB 3U0WH 2TRYA 5I1EH 1Z5LB 5INCB 4E0RA 2FECI 1FSKC 2NQ3A 2X6BA 3CVBA 3FN3A 4KTEH 4NT6A 3HUJE 4OCRH 5FIEA 3VG9B 3IJ8A 7FABH 3M1CA 3LKNA 5IGXL 1HHKB 2WCPA 1MJJA 3MJ8A 1S7QB 3PV7A 2VAJA 1D9KD 4YK4B 3T2NL 1M05B 4K2UH 4E9YA 1NAKH 4DVBB 1PFOA 2O5XH 1E5BA 5CJQH 3PPEA 1HJCA 3B9AA 3UGXA 1UB5A 4HKZB 2E7LC 4LEOA 4UTAL 1BQLH 1MHHB 3AREA 3FB6B 4P5SA 4LNVA 1X44A 2FIRT 1NAMB 3TO4A 1E4XH 32C2B 3ARPA 1XAUA 5T5FA 4F7PA 5FFGA 4GI9A 4KVPA 1E4XI 1P9MA 4L2LA 4HWEL 4KI5F 1LL1A 4WENB 3KPLB 4RQQB 4EDWL 2ZT9C 2GITB 1I7RB 5TQ2H 3CFKB 3QJQB 5K9OB 4FQPA 1JAEA 3SKOA 1J5DA 5MI0B 1VFMA 3K46A 1N6UA 1AR1B 1DVTA 4I9WD 4L3EE 3P69A 1EEYB 3PUCA 4X7TA 5JDSB 3PE9A 1I85A 1HQ4A 1UXWA 3O0RL 1JF6A 2VN6A 4YEEA 1BQHG 3RLSA 3VFVB 3S9DB 1PG7H 4M93C 5C0IB 2K70A 3OMZA 2XN9A 4JZJA 1EO7A 5DFWH 2FUQA 5KEZA 5BRPA 1NDGA 1UZ8B 2VL4A 4L5FE 1T1WA 3LDBB 4NN7B 3VI3B 4ADJA 1DQTA 4ZDHA 4BA8A 1ZA3A 4NNYA 4OCMC 4P4KD 5FV1L 3CZLA 4PJ9B 4PGBA 5E8PA 4KNUA 4XNMA 1TMCB 3EOBA 4JG1L 3MV9A 4GXFA 1ZXQA 1F90L 1MJUH 1V3KA 3WE1A 3RUGB 1SNRA 5I1DA 4HALA 1A7OH 1L9NA 1XF1A 3BO8A 3WYRA 5IB4B 2C4FT 3O41A 5T1LB 1OGAB 1TVHB 2ESVD 5FA4B 4ZFZB 5K59E 5C7XL 5F3BB 4UMGA 3KPOA 3ARGA 1C8QA 4JM2F 4WHYH 1UA7A 4LRIC 4F57H 1BZ7B 2BH0A 1WO2A 5TJWK 4N5ED 4V1DB 4G11A 2PXYA 3TH4T 3LEYL 3B9KC 3UJIL 1KBBA 4AZ8B 2HRHA 4MCYA 3MLTB 3U36B 5TPWL 3KS0J 4QF1A 3DBXA 1IE4A 2A6IB 3D51A 3RWCB 2IMNA 2OYMA 3T08A 1INDL 3VH8A 4Y1AA 3GSNB 2WW8A 2JB6A 1VADB 1BD2D 2YJLA 2YUVA 3B9EA 4HWBA 4YQXH 3OJDA 3WOVA 2W59A 1NOFA 4WLCA 1UJ3B 1GGBH 1MREH 5I66A 3TWCL 3SO3C 1V7NL 2IPUK 3K2UH 3OLDA 2JI1A 2E6PA 5EZLB 1FFQA 2XWTB 3QIBA 3DURB 4XN9A 1UQSA 4N5EC 1MLCA 4GSUA 4QUOA 1E6OL 1HCYA 3P9LA 2CUMA 4S0TD 2Z0UA 5KVEE 1JDDA 1EVTC 3MKGA 1K5NA 3RGVC 4DGUA 5JW3H 5TE7L 2HH0H 4WTZA 2HT3D 2XYCA 5AWNH 2ROYA 1IKOP 1OP3H 1MLBB 5IVXA 3CDCA 2UY7B 2C7UA 1GJIA 4HJ0C 3WU1A 1ROWA 5ID0A 4JFFD 4J5VA 2WOYA 4ZOBA 1S7WB 3C5ZB 3PWUB 4MVBC 4IYKA 4DGIH 3T4YA 3GTVA 4P46D 1I3RB 1T1XA 3SJVA 3WE6B 4A2MA 1SBSL 4XN8A 2DICA 3BKYH 2ZUYA 5DD5L 5HHMD 4JR9L 2NUPB 2XY1A 1G87A 2BNRB 3MJ7B 1MJ7L 2VXQH 3PLYA 4HCRL 5KYNA 1H3WM 5GSRB 4X5XB 3GMMA 3ZZ1A 1JGVH 1OPGH 4Y4KD 5IHHA 2IBZY 2FCBA 3DX2A 1KGXA 4BFNA 2FWSA 2XSKA 3V4UL 4HWBL 4JRWA 5E5LA 4UV7H 1G7MA 2NY3C 3Q8CA 3QXAA 3TYGL 3QXDA 3AG3B 1DQDH 3BQUD 4LCWE 3SPJA 4XP5L 1EDYA 2GTZB 2X2HA 3W57A 4XCYB 3ZTCC 3VXRD 2G3ZA 2BX5A 1IAIH 4XCEB 4TRPL 2G3MA 2VR5A 3K71B 3WFHA 5DMYA 2F7IA 2R69A 4W81A 5H4YA 3SEPA 4R6UA 1ZGLM 5KSVA 4JZNB 4AX3A 1LEGA 3M1OA 1N5YH 2VJ0A 5SWZB 1E67A 1G7HA 3NRFA 4BDVA 4E9WA 3MGOA 2I27N 4OFIA 5DHDA 3LZLA 2FJGB 3ECBA 4M43H 2HLFC 4BWWA 3BDXA 1A4KB 1YMME 4YX2H 5EIIB 1ILSA 3BAEH 4RGNB 1KCKA 5FYKL 3UGUA 4RGMB 1LP9F 3HI6H 1QLFB 2CCVA 2ED8A 5HDOA 2H2SD 5FFOA 2DJUA 5AKTA 2AEPL 4MMYA 3QB7C 5DFTA 1ZVNA 4G8GA 5FHBH 3VI4B 2VDPL 4MX7A 4X4KA 4XPGL 4GRMB 5I9QB 3R7QA 2X70A 1X5ZA 1PX4A 4O9HH 2RH0A 5MHSE 4RMSA 3NCYS 3NPSB 2MCPH 3KPNA 3O8XB 5I0XA 2C9AA 2YXWA 4OFVA 2NXYD 3E9UA 4Z8FL 4WW1B 4XMTA 2F9BT 3PJNA 1BAFL 1O75A 2PXYB 3A6BL 5DJCA 1U8LB 5KJ7E 4LSPH 4ICXA 4KDTA 5C0CE 2FEDC 2VAAB 2PR9A 2G2RB 4GKZA 2W60B 4OD2B 2NX5A 3OJDB 4LZKA 3X1FA 1OWRM 5E1AA 1MREL 1VADA 4NCDA 5FUZH 3P2TA 3POCA 2XZAH 1U4FA 4PJXE 3VWJB 4NPJA 3RGVD 3R06B 4ES9A 5BJTA 1Q90A 2CH8A 1NBCA 4BKLB 4AZ8A 3QQ4B 3A67L 5KYWB 1TU2B 4QRRD 2E75C 2VUKA 2XKNA 1U8IB 4NHUA 1BEXA 3LH2H 2QSCL 3QFDA 5F3HA 3UAJC 1E9PA 3UO8B 3CFUA 4J1UA 4G9FB 2Y4SA 3QPQD 2X89D 1HZKA 2EE6A 3ESVF 2HX7A 4DCQA 1JGLH 4MQSB 2YHGA 1TCRA 3O6LH 2O6DA 1FVCB 5AL8A 1MAJA 4Y2DC 1IGMH 2F8XC 1S3KH 5FYJH 2Q8BH 3DKHA 1E28B 4IEFB 3VXOA 5I76A 4YDIL 5GGUA 4YSCA 4HQQL 2B1HH 2GFBB 5FYLD 2EVJA 3IMWA 4O02A 1F4YL 1UUSA 5E9DE 3EADA 4BWTA 5SWZE 5CZRA 5E4EC 3LN4A 5E4OA 3FQWA 4JFUA 4JFFB 5DJ8B 3FQYA 2DMHA 1OB0A 1IM9A 4LLUB 4IU2B 4AG4L 2UWEE 4N20A 3LNFA 4TNVF 4E9RA 2E76C 5HHXL 4N25A 2W65A 4M5ZH 3ZDXF 2WJ5A 4P9ML 3IVKA 4OUOA 2QTEA 2NZ1A 4OM0L 1JL8A 3JV5A 1RIVH 4MMZA 4OCLC 1DVQA 5DVKA 4BSWB 3EJCA 3KYKL 2ZCLH 5KSBF 1YRKA 3QCVL 5MEOA 2Q7NA 2X53A 1GGIH 1X5IA 5BNXD 4GXUM 4JFXB 3C08H 1U95B 3V0GA 4F80A 1PIFA 2D2OA 5GGVH 2KLRA 1O7DE 1SPDA 2VNCA 4L3EA 4OIFA 3TNMA 2C3WA 3UAFA 1SUJA 1KN2L 3FTXA 3FCUB 4IBYA 3A6CL 2CBTA 1QRNA 2LOEA 4FQHA 3SDCA 4F33B 4F7CA 2F58H 4YZWA 1KTRL 1O5DT 2Z8VC 1OAYL 3B2XA 3QJFA 3Q9QA 2DKUA 5IVOA 3RPBA 3SE9L 3OQ3B 1BEYL 2VXVH 4LPUA 3LV3B 4GQQA 1T5WB 4PS4L 3RVXD 3S36X 5CBEB 4H26A 5E8OB 4XMWA 5L4MA 1UWXH 3CUPB 4LSSL 3K8MA 5EULV 2A99A 2DWEB 1P7QA 3CVHA 4ZO9A 3E6HA 1I9EA 5EU6D 3QDMD 5KVFL 3F12B 2FO4A 4DUVA 5LWYH 4Y5VC 5K9KA 2TAAA 5FUZL 1RUML 3FBQA 1WGVA 1VFBB 2HT2C 4TS6A 2ZG3A 4TOYL 1PKQE 4Y88A 3VFUA 1DZ0A 1YEKH 1ZLDA 3DBSA 1QA9A 5LNDA 2XZCH 5DWUH 9CGTA 1ADQH 3MSPA 3L4UA 3FC8A 4NQTA 4PJ8D 4TNWF 3U46A 2H4EA 1J9CT 3WNPA 1JVOA 2OI9B 1TJHL 4Q14A 5GSVB 1QACA 3R0MA 2P8MB 4JMNA 4K8RL 3RTQB 1WEJL 3I84A 2QR0A 5GGTA 5JHMA 3BVTA 1TU2A 2B1OA 4G42B 1TNNA 5IBTH 1FGVH 3P11L 1BP3B 1NUDA 3IK2A 1NM9A 2DQMA 4QXGH 4ODWB 2VDPH 1L3WA 1LILA 5JIDA 3ATAA 1XGZA 5E1HB 2CO6B 4QHNA 3NCJL 3L9RB 4ODHH 3LZPA 4HZLA 4X98A 1NCDL 2UV3A 1IM3A 2XQBL 4LBAA 5F89B 4ENEC 3LXUX 4OSUL 5D70H 2Q86A 1SVZA 4WFHD 1HESA 4JY5L 5D7LB 3I9GL 2UWEB 3STBA 1MCQA 3NIDF 43CAA 4FYTA 2Y5TA 4IIQA 5EIVA 2NY6C 2PR4H 5I8OH 3OHXA 3QUMH 3MUGA 2D7TL 3RWIA 1TYJA 5I5IA 4AL8H 4NZJA 1HKFA 1XL4A 4L4VB 4FABL 3KXFD 3B1UA 3NIFF 3PQYB 3VA6A 4A66A 5BZDA 4I77L 5D2LF 4OJFH 4J3OD 4XODA 1MNNA 3EO0B 2QHRL 5C6WH 3LVTA 3UBXI 3EH2A 2RQEA 5DT1L 4BSJA 3TA3C 2ZICA 5C0AE 2W9EH 5F70A 1CL7L 4MHHG 1I4FA 5L6YL 4NJ9L 3MBWA 4MNGB 2Y5QA 1A3LL 4TVPH 5A2JH 3QULA 4NO5B 5TDOA 5KZCB 3QUYA 2WINA 3KPRE 5C0EA 4G9FE 2AK1L 3CVCA 4ANKA 4PRHB 1ZGLA 2HWZL 2L0DA 1U3ZA 4P8QA 2ZCZA 5DS1A 3DGCR 1HHJA 1M6OB 1ECZA 1ZTMA 35C8L 3QJZA 4L8CA 2R23B 4HK3J 5H35A 2ADYA 1DJWA 1CQKA 5FO2A 4HWEH 2V7NB 1BQHA 1KYAA 3SE3C 1NL0L 5K1VA 3SQOH 3U83A 1KJ2L 3CHPA 4RH4A 1MRFH 4GIPD 4FXGB 1SOKA 2I60H 2NW2B 5DHMC 3VFSA 4TQIA 3D5OF 1E9QB 3INUL 2G60H 3ZW3A 4Y4FA 2H0FA 1MFAL 3AUWB 3FFCE 3ZUCA 1IBGL 3QDGB 1ZHBA 4PRDB 1MW3A 2I60L 3T0EC 5L2KE 2BY3A 1W6LA 1ETZB 2EYRB 3BKCL 4PAZA 5KBLA 2CLRB 3IU3A 1SBBA 1WDAA 2NXZC 1FF5A 3AGWA 3H6AA 2COVD 4JHBA 3ULAB 1QWUA 4MNHA 3BAYA 2QHRH 3FTUA 3MRMB 1OSPH 1W8OA 2E8ZA 4UQ3B 5CIPB 2HVJA 4NRYA 4PB9H 3KZ8A 5HHMB 4PV8B 1IQDB 1IAKA 2HVKA 3W0WE 5EWIL 1W0WA 5CKAA 1KEGL 2EKJA 2WXOA 3VXSD 3Q5OA 3P4MA 5E6ZA 3S34L 3B2UC 5I1GL 4RMWA 4BFIB 4MJIE 4N2HA 3RZWA 1ET5A 5C0FB 4LHUD 4GW1B 3VE0A 4XOEA 4BA0A 2HFGH 2N7BA 2BVPA 4KKBD 1QNZL 3CC5B 4PJ8B 4YL9A 2Z7WA 4FERA 3JV6B 5D70L 4KKZA 2F0CA 3WMPA 2JJVA 1KDIA 3MLWL 1LO5A 5E8EB 2EDOA 2HKFL 5AW3B 1JK9A 3B7RL 4PY7B 5EORL 1V05A 4PWHA 3UYRH 3ETTA 2ZX9A 4A6YA 1PX8A 1GTFA 4EVNB 3BZFB 5ALCL 5I1HL 1GS7A 3QQ9C 2AI0H 4WUUE 5IK3B 3OR7B 3D0LA 3QG7H 2HFGL 1WEJH 5A7BA 4PV1C 3MRQB 1B9ZA 2HG0A 4ERSH 4HOZA 4L9LC 3PJSB 4HW6A 2VH5H 3KMDA 4Q52A 3F7VA 3T3MF 4NZRH 3VGAC 2VDRH 3NCCB 4NCC1 2DQCL 2YA0A 3VXRB 1ZS8A 3VQLA 1NCDH 3F3HA 3BWAB 2AQ2A 1DBJH 2Y07H 3FCGA 3ZTJH 2R56H 1I8IB 3GMPA 2Y9RT 4RA3A 4XVUC 3FPXA 1Z66A 4Y9GA 1FVDB 3EH4B 4LGSB 4CC4A 4MWFB 1YDPB 1GY2A 5CZVL 2F5AL 2C7FA 4LPVA 1R3LA 1OEZW 4F7TA 3LZQA 3NJHA 4Y89A 5C0CD 4LP8A 1E30A 5EO0A 3LPWA 3W56A 4W6YB 3NRPA 4MQ7B 1B0WA 1RZ8A 4R84A 2ZKMX 5K9OA 3ZQWA 3T2NH 3QIWA 1JRHI 5E4AA 4FP8H 4ADIA 1AMXA 5EIIG 1QUNB 1BQHB 3TN0A 5EU3B 3JWOC 5DTFA 1J0IA 2R2BB 2VDNL 1OCOB 2EC9U 1DUYB 3P4NB 4XP9H 2VLKB 3DXAD 3ZDYE 1IEAB 4E42A 4ODVL 4PB0L 1FZJA 3V0VB 1CFTA 5C0EB 1E8YA 2Q76A 3CXDH 1F4WH 3K1KC 3UTTE 4Q56A 5LGHL 2YPLA 4HKXA 4IU2A 1NC2B 1AGDB 5CGYD 4JKMA 2MTPA 1UWFA 3QUXA 2X6MA 4OIBA 3RVWD 3ZQXA 3NVQA 2QTVA 1OT1A 3ESUF 3HVDA 3CZKA 5B38A 3CZNA 4OZGF 5EUKA 1ZE3C 3G6AB 5IB2B 3VTMA 2J43A 2WXRA 3NPSC 1RVFL 2G9HB 3UCQA 1HHGB 1Z0MA 3L1EA 1MCLA 1KB9K 1N0XH 4RIRB 1IC5L 2CE6A 3BPNB 5AKRA 1LYQA 3HN8A 1MIEL 4ZTOH 2VR3A 1YNTF 5HDBB 4XP5H 3SDDD 1E90A 2I85A 3NZSA 5LAXB 4JHVA 4ONFH 3T8XA 4KK6D 4S0SD 1TCRB 2APVA 2J55A 1MZZA 1RZFL 4JQIA 5JHDD 4U3SB 1ZLWK 4RSYA 5AD0B 4XNYH 5CGYC 4OZHE 3IFOB 1T04B 1J8RA 2IDTA 4LOEA 4J8QA 5AVRB 4WNJA 5LBVA 2IANB 2Q1EA 2G5BB 2XQ0A 5CGBA 1ESOA 2BOBB 4R4BB 4X0KB 1AD0A 1NUFA 4HCRH 4MJIB 5E7FA 3AITA 4M7JL 5KYWA 3KYOB 4UB0H 1PNCA 5CSGA 1OOAA 2V33A 1E4WH 2BFGA 2UWEF 5JXED 3AXHA 1U3YA 2FE0A 1MCCA 3B7SA 2HUHA 4NPKA 1UVQA 1YEFL 3JV6A 5I8KH 1JRHH 1Q72L 4M1DL 1J1OL 2OK0L 2J5LB 3OVUB 2OXGB 1E5UI 2A6DB 3GS7A 2F74A 3A21A 4WI6A 3V7MA 4GO6B 1D2OA 5I1CL 4LOFA 1T7YA 2AXGA 3O3DA 5ITBH 4XBGA 3GRWA 2Q2LA 1FFRA 3V4VH 5IUCA 3ULUL 2PETA 3L5HA 3VXTB 1GYVA 3KEDA 4UQ2A 2BC4A 2WXGA 3K2UL 3EFOA 2V7HA 3ZMNA 2ZWLT 3GXUB 4BINA 5C9JB 2DQFB 3MZTA 2A6JB 3CHRA 4HLEA 2XACC 3MODL 3RVUC 3U1QA 3ZL4L 3BGAA 4OIIH 4FDWA 1KXQE 3MO1A 5DU7A 1OHQA 4UCFA 5ACZB 2NW2A 2QQLL 3FXIC 1RUAL 4HJGB 5K69A 3CN0A 4LU5H 4BZ1L 1IAOB 1G5AA 1M3IA 2KZKA 4C57C 4JRYB 1U8CB 4M7LH 2CRIA 2FX9H 3QEHB 3LKOA 1MH5B 3WKQA 2Z1PA 1MOEA 3VVWA 4P2OC 3TNMB 5LB1A 1PJ9A 3OKNB 1WWBX 4KK5D 4R3SB 1P5UB 4WI5A 5TDPA 4XC1H 3V0VA 3IE9A 4PRBB 3O6FB 1ORQB 2CJ3A 3IFPA 4HGKC 4ZMQA 3LRSB 1A6TA 4F8LA 4OI7A 1ND0A 2V2WB 1F90H 1MJUL 3LRSA 1NFDB 2D3NA 2D7OA 1KPUB 1FHNA 2X05A 2AC0A 1JRHL 1Q72H 4M1DH 5DI8A 2NMSA 3AS1A 5CAYB 3FRUB 5FYKU 2OK0H 3FHEA 1MI5B 3TFKC 5IG7A 5E00A 3BUYB 3QHZH 1LO4L 4H20H 4OB5H 1QBML 5FYJE 3PP4H 3AAZB 3NQKA 4JG0L 3HPJB 3TOPA 1KFAL 1LWJA 2FL5A 4PVLA 3S5ZA 3EYUH 5A6IA 5ACLA 1A5FL 3TBVA 4BK8A 1A64A 1ACZA 4NNXA 5KJRH 1EHNA 4HFWB 4KTDH 4PJ5E 3U2SA 5HYIA 1R33A 5K5YA 4ZMWA 1DQMH 3ILPA 1TITA 5ALBL 1AHWB 1RK7A 1OW0C 4BFOA 3DRQB 4CDGC 5K9JL 3RWFA 3KPRA 4ODBD 1T1YB 4I3RL 4OVUA 4XBGB 4HD9A 2Y06H 1OD7A 2K4WA 3F5WB 4XB8A 2VO5A 3T65B 3QQ3B 1FWXA 3TLRA 5KS9E 1IARB 1EEQA 1ECYA 1OAKH 5IHBA 4X6BA 2HH0L 3GJFA 2VR7A 1DZBA 1BYOA 4M93B 1ZGLP 5HDBE 2QFPA 4FULA 2J88H 2PWHA 1JZ8A 4YXLH 3V4UH 3OAUL 4GUCA 1KGWA 1PSKL 4MS6A 1S9YB 3R1GH 2CPUA 2AXWA 3FDWA 2P1YA 1J9QA 1Z32X 2LLNA 1UXSA 2O6CA 3OC5A 4I0CC 3S37H 4LDLB 4QYOB 2O6EA 4MXWL 3NFSL 3K2KA 4OF7A 2Y7NA 5IQOA 3LZRA 4TSBL 4WW2C 5D2LA 2BNQB 3GSQA 5DD6A 1DBKH 3HHSB 4JPVL 3F84A 4DOHE 4RX4D 5GSVA 2Q20A 3T3MB 4WJ5A 1OE2A 3RI5K 5FW6A 3BMWA 1P5UC 4BE6A 3U46B 5KVMC 3JWDC 3SGJA 5HHNB 4F9PC 1T6VN 3ARQA 4C56D 4M62H 5LNEA 1VHPA 1J8HE 2DLIA 1YYLL 1KJVA 4N1HB 4EUPH 1QI4A 4IRZH 5HY9B 3GMOB 2HTKD 5A6LA 3SZ6A 1E6OH 4R5VA 1KCUL 3QCTL 4LFHD 3BUTA 1YYCA 4Z8FH 3D4CA 3IRZA 3QXVA 2V3DA 4MD5A 3RPIB 3ZTEA 4LARH 1B4LA 3QNXB 5DHEA 5FYJD 1W2KT 3HHRB 4K7PX 2YAHA 4EKJA 2XRAH 1GYUA 3PREA 4RDQF 4X6CB 2DW5A 4AXWA 1CIDA 2G5RA 3G5YA 5DD1H 2HTKC 1T7XA 2PWDA 1YEDA 5L7XL 1VPOL 2I7SA 3U7YL 4DQOH 1TENA 3WFHB 4TUKL 2MQCA 1YJDH 1LQBC 5L4JA 1KV3A 3N85L 5CEZL 4O02L 3RA7H 4PJBE 2OMTA 3N1GC 4NKIH 3RFZC 3QJUB 4MXQC 1IE5A 4UIMA 5HI3D 4QXTB 3AU1A 5JPNA 1HNGA 2I24N 2G0LA 1XIWD 3BWUC 5HDLA 5ESQB 2EIMB 5HDRA 4NP4H 4J7RA 3MLWH 3SQBB 3B7UX 4DPAX 5ISZD 1RH8A 4S1RH 1SQ2N 1A4AA 4PEEA 1M53A 1RZ7L 1S7XA 3BE1L 4XNQA 4KNQA 3KL5A 4X42A 2DQFA 2H0EA 4H0GA 2Y5EA 3DMMB 4APQC 3BT2H 3RZCD 3ARFC 2YXMA 4PTUA 3OQRA 5B39B 3K72B 4YHMH 2PP9A 4PWJA 1CLYH 4EOWL 5KVDE 4ZUTB 3ZQ9A 1K8DB 5E6IC 1ZLWH 1ZT4A 1FDLH 2DDQH 4PCTA 1UENA 3F7YB 1YAIA 1G7JA 5GIRB 3ULVF 2JKNA 3FPYA 1S78C 3VFWB 1CZ8L 4HBQA 1YSOA 4IJTA 5BMFL 3UDWA 1B0RB 2E5EA 2R7EB 2XI9A 3ECQA 4PUBH 2YPKA 1OAUL 4UDTA 1Q9OB 3MRNB 1XVSA 4NZDA 5MENE 2VABB 2QMJA 3MZGB 2HG5B 5H37G 4OZIB 1DL7H 1T3FB 5J6SA 3UG4A 2XTSA 3R06A 1WFNA 5TK4A 5EG6C 4TM9A 1J8HA 2F1EA 3FB7A 3NPZB 2EVFA 2JCWA 1AD0B 1E2VA 3IDIA 2H32B 2BK8A 2DV6A 4JM4L 2Z8SA 4QJ5B 4FG4A 3QIUA 3GBNH 4ODSL 1BYNA 4N0UE 4NO0A 3KYOA 1JHTA 4XAWH 3QO1B 3DSFL 1Q0EA 3D1MC 2HLAB 2QT6A 3WNNA 2C5DC 3HE7B 3KPNB 3RQ3A 2QVMA 5JA9A 2OJZL 3DJSA 3EHBC 1QFWM 4AL8L 2MHAB 2R1YA 4BK5C 4M5ZL 5HYQA 3WNIA 5E6UB 4F24A 1BVOA 4R7NB 3MROA 3U6RA 2AV1B 2D2CC 5FAAA 3COOA 2UZYA 5BW7A 2DJSA 3FH7A 3MJWA 4HFUH 4ZNCD 2F15A 3U9UB 3TF7C 5J0BA 4Y16C 1YEJH 4Y8DC 5EOTB 5CEZD 1DQJB 2ERJB 2A9DA 1AIFA 4RCAA 4CGUB 3FOMA 5AOIA 5AALA 4AGPA 2K6YA 4KRLB 1L7TH 2HRPL 3QS2A 3FT3B 3EJJX 1M7XA 3EYSL 4NZUL 3UDWC 2AJZB 4PWEA 4L1TA 5IQMA 5D1QA 4U6YA 4F7CB 2C3HA 2EH7L 4LPTA 5EBGA 5KSVB 1MFBH 2NRDA 1TSRA 3L5XL 2FEEI 3MOBH 4HFUL 4YHOL 1KN4L 4XXDB 1UWEH 1KYOJ 2VLKA 1IC7H 3EOTH 4NI6A 5DO8A 3UTPE 3CFJA 4UILH 3RIAF 3RVWC 5EF0A 2ADFH 3D06A 1GVIA 3OMAB 4PY8I 1QO3B 3OKYA 2O5YH 2J8UB 2VDOB 4JHWL 5FM4A 5I19L 3SY6A 4DKEH 1NIEA 4AEHL 2BS9A 4OZGA 1QNIA 4HOXA 3MNWA 2EC8A 5CINL 3V5DA 4XO9A 1A7NH 4P06A 5GZNA 3QIWB 3BUDA 4TPRL 5E4IA 3WLBA 4MJ5A 3ZKMD 4S0HA 3CCHA 3V4PA 1D5ZB 1G1CA 2OQJB 3HZYA 2DKMA 5DJ8A 2OMYA 3T1FB 3CNKA 2W5PA 3PDOA 5E1QA 2P4AB 4I5BB 1OB1B 5DJDB 1KXQA 2EEXA 4PGZA 4E36A 5D6DA 3ZL2A 2G60L 2BIHA 1HVXA 1P2CB 5F1SA 3RGHA 2YJQA 4LCIH 4L8DB 1YN7A 2D3LA 2N3JA 2P24B 2Y1AA 1KPRB 1SHSA 1VAHA 4I3GA 5BZZA 2EE3A 2I5YH 3IDUA 3MRKB 3E2HB 1Q0XH 1QAWA 2EACA 2NY0D 3P9LB 1MI5E 5C0DB 3ZDYF 4WU7B 4F93B 1UM4L 1G1YA 2WN3A 2Y7LA 5HPMA 3DURA 3NACH 2EINB 3QUMB 4G3YH 1X5MA 2BHUA 3BZFA 5IIEA 3WEAA 1OAXH 3VWKC 4HIJA 1FGNL 1TT6A 1GW0A 3VXMB 4P9HL 3ZVVA 3GMQB 1CU4H 1FBIH 1PKQB 2VLJD 2WZ5A 4LGRB 2EVHA 4QXUL 4M56A 4YHML 4A37A 4MMZC 1NLBH 4YE4H 4UZUA 5ICZA 1ED3A 1MW1A 2RCSH 4U1IB 3GI8L 2HJFA 5EO1A 4E41D 4QF1B 2GY5A 1QSVA 4NJ9H 2Z4TA 2R69L 1B4JL 1CLCA 3CHXA 4B53A 3I2CL 3IN0A 4N24A 2IIJA 2JKSA 4HC1L 4AYBA 1F3JB 4N2CA 3IFLL 4LDCA 5E1AB 4U1LA 3KEHA 5SWQA 1KBKA 1RSFA 1T04A 4S11A 5GZNC 3NSJA 1T3FA 4KUZL 1G7PB 3VI3E 1I8MA 4JRFA 4DPRA 3GKZA 1JI1A 4TVUA 4N9GB 1RIHH 3S35X 3L5WA 3W39B 2NY1C 5CEXA 3B2PA 3PV6A 5GISL 1FNSH 1YPZE 3C60A 2WK2A 3DX8A 1ORSA 5BXFA 4C58B 2X0WA 2R69H 2IPUG 4W93A 3GXPA 1HIML 1D7DA 4NQEA 2Y6SC 5HJDA 4PGEB 5JPMB 2ZXGA 2DIBA 3IDXH 4Z0BL 1UM5H 3BKML 2APWA 1OWWA 1OVZA 4AUYA 1ES0B 4X9HA 2JTYA 4FI8A 1S7SA 4Z0XA 1MAMH 1TSHA 1A65A 3ISWA 4D0DA 5K9QI 5CBEA 1Q4NX 5C08B 4YDJA 2VMEA 2IQAB 5C07E 3K7UA 2WXJA 1XCQA 2PWFA 1TJGL 3NCWA 4PJFE 1GAFL 2QQLH 4IBVA 1FGNH 1YEEL 3CZFA 5EPMB 1AACA 4XWGH 3I3DA 5FCUH 2X6UA 3A0OA 3F85A 3L95A 4APQB 2DMGA 3S8GB 3O3BA 1CT8B 4U6VH 3H9SA 2BDNL 1GZHC 3HG0A 4PP2B 3P02A 2HCZX 2LU7A 4HV8B 2CMRL 5LBSH 3RNQA 3X13A 3QNZA 4NAQA 4MCZA 2J7LA 2XN9E 3P4OA 4KZDH 4FQ2H 4ZXBC 2VR8A 3QARA 3BP4A 1KB5L 4MCNA 3ZHKA 1CBJA 2QADC 3IVKB 5J89A 2AXHA 5DS8B 3AREB 3FB6A 1NDMB 4P3CL 4ZS6D 1CI5A 2W65B 1K72A 4IMLA 3SDDA 1GYWA 4Z7UF 2I7OA 1JZHA 3W0WD 3CLFH 4PJFA 4UIKL 4Q9QL 1GSMA 2A83A 2GW5A 4ABVA 1G9NC 4JRYA 5CD5C 4H25B 3AM8A 4WFFD 3DTUB 4EJ1C 3OHXC 2HKAA 2QZ5A 4XOCA 3APMA 1JCKA 1IFGA 1A1MB 5BS0A 2OI9C 1Y1UA 5F7EH 1ZVHA 4NO5A 3RVUD 3B5GA 1A7PL 2XTLA 3F7PC 2A1WL 3X1GA 4HPYL 2F5BL 2NY2C 4UT6H 1JGIA 2QLVB 4IJ3C 4EI0A 4BD4A 1W0YT 3QDHA 3IDGB 1PYWA 1A4BA 2ZXWB 4PGCA 1DSFH 2XWEA 1F00I 4JLRB 4KJPC 1N6VA 4D3CL 1M7DB 3D18B 3S0PA 3QYNA 1GOFA 4TQEH 4JQXA 1JZEA 3UYPB 1JCVA 4KKLD 5ALCH 5I1HH 1KENH 1P84K 2NT1A 4ZTOL 1EAJA 2VISB 3KLHC 1YEFH 4GAJL 3T6VA 2NYYC 2Y06L 2Z92B 1PZ3A 1ID2A 2O72A 3RDJA 4UF7C 2HLAA 2F18A 2OBGA 4JGMA 4ICWA 5KVDL 2Q87A 3JYCA 1NAMH 3DRTB 4ZD3L 1G0XA 3O45B 4JGJA 4JDVA 2WLNA 4KK8D 2Q86B 1OAJA 5FW8A 1T83A 3ZE0F 2B3RA 1KWKA 3WY1A 1A7QH 4HZLB 5A16A 3V0WH 1AOZA 3GNMH 2UYLA 3OKDA 4KJPD 4XBEL 4JO1L 4IKKA 1MJ7H 1XCTA 3IGKA 1WHOA 3WMQA 4CN4A 1FI8C 2IH8A 4NLAA 5C08E 3W5MA 1G6VK 1VACB 3RTQA 2CHDA 4H88L 5GGSA 4ZD3H 5JPNC 3U36A 2EEBA 1BXXA 2GBAA 4EDWH 4AW7A 1UCBL 3PWJB 1S9YA 3RX7A 1J8SA 3WL9B 1IC5H 1B0RA 5HGBB 1OSZA 4E5XG 1O9VA 4KI5C 2DYPD 1TZIA 3H7BB 4CUCA 2VDNH 3RZCB 1KTJA 4LSDA 1E5ZA 3KVQA 1N4XL 1JFQH 4PG9A 2X88A 1GC1L 3IJEB 3IE4A 3KBHE 4GI6A 3JV0A 4YH6A 4BQ8A 2PPCA 4NQCA 1VZIA 3FHAA 4S1DD 4XC1L 5IWLA 4TQPA 4HBCL 4FFZL 1A9BA 5FW7A 5T1MB 1XH3B 3VYOA 1TTCA 4GAGH 3MTRA 3ZT5A 1K6QL 3VXMD 2XFXA 3B3BA 3CFEA 3HG1A 4JDEA 4CU7A 1AP2A 2EDXA 5CCKL 1CD0A 3VQMA 3O11B 4AQ1A 5L2KA 5AOZA 2KI6A 3WIAA 3ULUE 4R7LA 2KPWA 2WKOA 4LLWB 1U58A 1AC6A 3QH3B 5B39A 2A9NH 1EERB 5TE7H 4RFOH 4HHWA 4B9CA 2VZUA 1FN4B 5I6PA 3FQ2A 4NGHL 4LSPL 4R5XA 4KV5F 4W4NA 3ZE1E 4BZYA 5ESAB 1M9SA 4QNPF 3V4VL 3V4VA 2EIZB 2DQIH 1BAFH 5MEOB 5CR8A 3ZT6A 3B2DC 4XC3L 1HHJB 4GKLA 4KVNL 3GGWA 4F9PA 2VSCA 5F7LB 5LLIC 1YNLH 3TBCA 2DL9A 2ZXBA 4AIZA 1KTLA 2CLZA 3EUDA 3T04D 3GBDA 1BQ5A 3BOVA 4MMXB 4AGLA 4YXHH 3QUHA 3ERXA 1MNUL 4YSDA 5ENWB 1AXIB 3HRPA 2V17L 2XG5A 3HNSL 4BQ6A 3P77A 1PTZA 4YZFF 5E03A 2OTWB 1BBDL 1HSBA 4C56B 3GZOA 1NGYA 3E1F1 3GUTB 3MV01 1SLVA 1L5GB 4Z7VB 5D1XA 5EU4B 5GGSY 5EN3A 4ADGA 5EUOE 1M71B 2Z1KA 2CXKA 4TULL 4XTRC 1CBVL 3HE7D 3NJLA 4MJHA 4N2DA 3AWEA 5MERB 2HKHL 4NCC2 1DJHA 2X4UB 3NCJH 1IKNC 3QVAA 4LBEA 1MCPL 5AB2A 1HHIA 2A4EA 2VLME 1OOWA 1VA9A 3MJ6A 4WWPA 5KVGL 1ZLEA 1ZT1B 1K5WA 4OFYD 1D5IL 4P2RD 4XC3H 2BY0A 1E27A 1OPGL 3WHE0 3IETA 1MW0A 2LVEA 3IJ7A 4JKPL 3RWCA 1EZVY 5D5MF 3L9BA 5MENA 3E1ZA 2AQRA 4HEPG 2IWEA 5CEYA 6PAZA 4L0YA 1GMEA 4IBZA 4PTTA 3D85D 5DJCB 1F4WL 1MCWW 3AY4C 3SDCD 3GSOB 1XGUB 2UZPA 4ACPA 3HFFA 4Z7NF 1YEKL 2DJMA 2LABA 4QHUA 5SV3A 4OD2A 3LD8C 4ELKA 3QWRA 3V0AC 4G8EA 2IGTA 2IC2A 5JYLA 1F3JA 3PABB 2IH3A 3PL6D 4CBPA 1Y0LB 1BG9A 4H4NA 4BSVA 1T4KB 1XT5A 4OCYL 4L8SA 4P5KA 4AGQA 1I8KB 1A2YB 1EJFA 3Q48A 4WHYG 5KSUB 4DFIA 3NJVA 4HS6B 3IXTA 2FRGP 1UOKA 3UPRA 2GHWB 3GSVA 4PY8J 2KLSA 1ZLSH 1S5HB 3AMLA 3D3VD 1JGDA 4Q58C 1H3PH 4IS6A 4Y4FB 2HFFA 4OF6A 5KYUA 2B3IA 2XXGA 4PJXB 5JHLH 5KSAC 4X7TB 1I3GH 3VFSB 3D6GA 3FB8A 3OKMB 2AMGA 1BM3H 1G6RB 1R5VB 2CO7B 1KB3A 2YBRA 3FNKA 4ZPVB 5DUBA 4POYA 3JWNC 5CBAA 3LNEA 4M6ML 3J07A 2ICWJ 1MVUB 3C5JB 1QBAA 1FZJB 3OF6D 3ABMB 4D9QD 2ZQKA 3A4FA 4IOFC 4LAQL 4KHXH 3MNVA 4EOWH 2O5YL 2MCMA 3CSBA 3JUYA 2IJ0C 5DRZA 1PDKA 3VGFA 5J6GA 4GH7B 3T2QA 1SFHA 4HK3N 4PH8A 3SDAD 2ZXCA 2RTTA 2OQJA 1BAGA 1S7TB 4KDTC 3HJEA 1XZ0B 5AG8A 5I82A 2VWEE 4FG2A 2QQQA 1S7TA 2BIMA 3KPPA 4FXGC 5DS8A 2Q3ZA 2B1HL 3BEWA 3GBLA 4ZXBB 2VQ4A 4NIYE 2YGOA 1AC0A 4OLWL 2CUAA 3IMRA 4J6RL 3TXAA 4XCFH 4BK5A 4HMCA 5GS1B 1C16A 1KJ3L 1ZJAA 1BAWA 2HTLD 4YPJA 1IT9H 3WELA 2ZWKA 2AXJA 1T0NA 2ESVA 2P45B 5ECJE 2P5PA 3CPLA 4FXLA 4B9JA 4QRSA 5I2IB 4LO9A 1QLEH 5GRJH 4HKJB 3T3PF 1W0VB 4PRHD 3KPSE 1BA9A 3Q43A 2J1KA 3MC0A 5HYSA 3QFDB 4QJ3B 5JR1L 4AIEA 1AR1C 3HS8A 4XX1G 4LHUB 4E9SA 5C0NC 4WSKA 2ZUQC 1NMBL 4ZK8A 5C0JA 3QRGH 2VDMB 5I1JL 5F9JB 1PMYA 3P11H 4XPHL 2ZUXA 5IQLA 5E2WL 2AEWA 2VE6A 3S35H 2HT3C 1CB4A 4AJVA 4P2QA 2IH3B 3WFBH 4N9GA 1A6PA 5IGXH 4PRAA 3BN3B 1S6NA 1VZHA 3JWDL 5F3BA 3RWJB 4OCYH 1T1ZB 4AQOA 2O26U 5CHNB 4WSGA 3CN2A 5FA3B 5IY5B 5LXGL 4B9PA 4KHTH 3VXQB 1AS7A 4AZUA 5I71C 4XPAL 2A74C 3LH8A 3BVDB 5C0ND 1NSNH 3KPRD 2JJUA 1OGSA 3IGAB 4GSXA 1PZ5B 4JPSA 1WSST 4N90E 4CBZA 1C5DB 2YK1H 2QEJA 4U1IA 2W91A 1BOYA 3MV7A 2Z93B 2AZUA 5C0IA 1L3NA 5JHAA 1COBA 3SE9H 1MCKA 2WGNB 1AY1H 4ZDHB 4MAYC 5EC1A 1BW8A 4MAUL 2VR6A 4H5SB 3UIZA 5F0LB 1I9RH 4FQCH 1BFOA 4YIQA 4FQHB 3WSQH 3BPOB 2AVGA 3CFKA 1KTDA 2YKKA 4POZD 2QKIC 2R0KL 2Z34A 3K6NA 4XPFH 2ZNWA 3LN5B 4X6EA 5CP7B 3LB6D 4A7TA 5AW0B 1MFDL 3H3KA 4OM0H 1DTUA 3AREC 3U4BH 4WO4A 1LK3H 3ECVA 4GJTB 2GEQA 5K59F 3H8NA 4NX0A 4MDJB 1INEL 1MHPH 2FNWA 1TQTA 5EU3A 3ULSA 3FUDA 2A74B 2VOTA 1OP9A 2P28B 2BXYA 2YEQA 4HPOL 4QHPA 5DGQA 5I71B 1U8KA 4DP1X 5BPPA 4OCWL 1BFVH 5BS0B 3DX7B 5E94B 1E40A 4ODXB 3UJJH 1I3UA 1H3VA 1WAPA 2N1TE 5FO9B 4Y19E 1KLFA 3IYLW 4L29A 1NKOA 4PGDA 5EF1A 2VO8A 2WXLA 1RK1A 3GGWB 5CUSL 2VERA 3OZ9L 3U4AA 3H4HA 3V0JA 1MZYA 1ODAA 5GHWL 2OYLA 5E9DB 4XNAA 3VFMA 2GK0A 2WSKA 3AM8C 1EGJL 3IGUA 1F41A 3Q06A 1IQWH 4BUQA 4EN3D 4Y5YB 1XO8A 2Q0ZX 2AMUA 1K3IA 2EDEA 4XXDA 1SJEB 1J0ZA 4C8XA 2X2JA 3IKCA 2JVUA 1U6AH 1TG8A 4Q6YA 4AYDC 3SE6A 5F1IA 2VLLB 4D2NA 3ROLB 1EZVX 2OTUB 1ADQA 5D5ME 2OR8A 4G83A 1BPVA 3BDYL 2D3VA 4XPHH 1FIEA 3D8MA 3TBWB 2ZKYA 4LF3A 4NKDA 2WO2B 3RVTD 1GPOH 4LRNL 1NCBH 1NDTA 2JKLA 2BJML 3X14B 4ZX3A 2W0PA 5IB1B 5GS1C 4FKHA 4FNQA 4PJGA 5KSUA 4XAKD 4OF3A 1A8ZA 4JFHD 4R7NA 3GC3A 4G1MB 3U6RB 3HNTH 1CTOA 1H0DA 1FC1A 3MLYH 1J0JA 2QQNH 2ZXAA 1QLEL 3OHMB 2WQWA 1BEYH 5DMGC 5C07D 3DX3A 4OZHA 2K3HA 3H7BA 2R2CA 4HK0B 3TZVC 3FT2B 4ERSL 1OSZB 2WBXA 3QG7L 3FO1A 1QFWH 3ZLQC 1DVYA 5F0MB 4AOFA 3EYFB 4ZS7L 1LK2A 1ASPA 4L3FA 4B0MB 2EH7H 2Y25A 4P5TA 3R4RA 4PY7A 2EO9A 3H42H 3GSQB 1A6AB 2G3XA 2XY2A 3IMTA 3LSOB 4QTFA 1OARL 1J8HB 3UTPD 1JJUA 4NDMA 2QHLA 3OL2A 4ZFGH 4U1KB 3QAQA 2FQFA 4PJ5D 5CU5A 5DZ9A 4Y5VB 1ZSHA 4GW4A 1KCSL 2V3FA 5ICZB 1L9TA 4FA7B 4W6XB 2P44B 3ESOA 1OHZA 4GSDH 3TBSB 5IVZB 1V7MH 4F3FB 1X9QA 5C3IA 1EJ8A 1INEH 1MHPL 5HYSB 5HXMA 5IFAH 4H2AA 1IJNA 4U33A 2BIOA 2BFVL 3KJ6H 4Z7QB 3GIVA 4YWGL 4GAYA 1QFUL 4K7PL 1HEHC 3ATDA 3O4LA 4HJJH 4XCNB 1SRDA 5FV2A 2W07A 4YHYC 3W5NA 3CFQA 2X4RA 3RURA 4DETA 4JZNA 4ZW7A 1Z9OA 1BLNB 2ITFA 1EAOA 1VERA 2IPTL 3ARFB 4OD1L 5FS5A 2F7RA 3D2TA 4A7UA 4JFHE 3H0TA 4I18A 4D3CH 5M95B 1KPUA 1MRDH 3X12B 4HWBH 2FH6A 3TJPA 4MNGE 4WTXA 2ZPKH 1NEUA 4RGND 1KTLB 1IZKA 2EVIA 1ZGLB 3WKNA 1XGRB 3WTUA 4H8PA 4OT1H 5F7MC 2JQMA 1N3NA 4MJ5B 3PWNA 1JZ5A 1F3DH 4NWUL 5E00B 2WLLA 3E38A 4BZ1H 3QULB 1HYSC 1A1OB 2YPLD 3DI3B 4P9HH 2A74A 5D7LD 1BPLB 1OV8A 2XCMC 3PP3K 1EH9A 4FTDA 3SSGA 1A7NL 5B38G 4IGBA 4LRNH 1G9ML 2V2WA 1CFSB 1OGPA 1LLAA 4KH2A 1UCTA 3SKMA 1I7ZA 3PAUA 3MNVB 3LEYH 3MA9L 2EIZA 1PLCA 1ZT7A 2MPVA 4HF5H 4XNUH 3VXNB 3VD9A 1R3JA 3ULUH 3W9EA 1JK8B 3FT4A 1OAZL 3ME0A 2ZWNA 2YAMA 1D7FA 3DPDA 1RZGB 1YQ2A 2E27H 4W68A 1MCBA 3KCPA 2C4FU 3PY9A 1P6AB 5SX5K 3DETC 2R29H 2XWJA 2WV3A 3TU6A 4QRAA 4Y5VA 4P46B 4Y8AA 4J1UB 3MRIB 4NFBA 3HC0B 2NCMA 3VH8B 2EE2A 4YLBA 5D96C 5AOKA 4AQ1C 5F96H 5A40E 1LO0L 4TVSa 1AZUA 2B9AA 2CR0A 1B2YA 1WAAE 4Y2OB 4F2MB 3Q8FA 3RIKA 3BAIA 5EUOA 3FF7A 1OZUA 4UWQB 4EI5D 5F96L 5KSAD 3H2WA 3PGCB 1IL1B 4HUXA 4QRPA 5FOBA 1SF3A 1UJ3C 3N40F 4TKWA 2CKBL 3FT0A 2AQQA 3CBJB 1GZQA 2IQ9H 1GL4B 4PFEA 2DWDA 1Z7JA 3SCMB 5JIPA 4NBZB 4OM1L 1HL9A 4L4TE 1P4IH 1WCBB 2RJMA 1OE3A 2UX7A 3UBXA 1VEMA 1NKGA 1TLMA 3C8DA 2WZ6A 5AW4B 1G94A 3TEZA 1QVOA 4YS4A 2ICCA 4ZUUA 3BUQA 5IMLA 1JXGA 1RD6A 2E27L 2FBJH 3KPQA 4GOSA 3BXNB 1RIUH 4JPKL 5FXCH 2WHVA 5BW7C 2D0HA 2KBGA 5FM5O 2OXHB 4G8GE 2BOCA 1DVXA 3ZX1A 3FFDA 3LKPB 2NNRA 4KZCA 4NQUA 4UTBL 1QTYT 1AQKL 5BS0D 4XO4A 2HT4D 4JFQA 1UD8A 2CUHA 4NP9A 5BQ7A 2AJVL 2ZUTA 3QXUA 2JELL 4UT9L 1K4DA 4Y2DA 3SY0B 1YY9C 1RURH 3D7PA 4IRJB 2P8PA 1QSEB 1T5WA 4CW1A 3I6LE 4NWUH 2WVVB 4I3SH 2AJ3B 4MTMA 3PDOB 3KPMB 2XQYG 1DO5A 5E1IA 1KJMA 3HZYB 1HL4A 2VLRD 3S37L 4AKQA 3WAJA 1MCIA 4K2UL 4A2HA 5FFLA 4RWYH 4FC3E 2GKIA 2IADB 4HZAA 3QISA 2DQEH 3GUFA 1X6LA 4TLKA 1RZ7H 3ZTJG 3VMPA 4NIKB 3KM2A 3I9AA 2JKRM 4JFXA 5B3JE 1J18A 3BZ4B 3FQXB 2WPGA 1D5BA 3UH8A 3NZ8A 3L1OH 3MUUA 1KIQB 3AY4A 5DMKB 5BZXA 2UXFA 4AV4A 5EU7C 4P2OB 5I16B 3ALXA 1EHLL 5I75C 2RD0A 1CFVH 3S96B 5C6PB 5CEZH 4OFDA 5KAQF 1HHHA 1CLZH 2EDFA 4Z3JA 1NA8A 2AITA 1T66D 3FQNA 1XFPA 2CG9X 2DBLH 1WD9A 3G04A 3GSUB 2XJLA 3BSHA 4MXVE 4OFKA 3OPZH 4XT1C 3Q01A 5I75B 3TIDB 5C08A 3E3QE 3QUYD 3RYMA 2LFEA 1JMXA 2YQGA 4N68A 2OSXA 4WV1A 5HGDB 4V1DD 1FSKB 2YOCA 5DUMH 3GZQA 3OX8A 1KIRA 3DJTA 2D3JA 4PWFA 4QTIH 1U93A 2Q6WB 4IJ3B 2FJFB 3BAKA 4YDIH 4P59L 2CM6A 2WKOF 2IQ9L 4LCUB 4YSTA 3NJXA 4L8SB 4PYGA 3LZFH 2X4OB 3RUGE 1KXVA 4U6XB 1F1DA 4X7DC 4FQJH 4HDIB 3TEYA 2IBGA 3O6LL 4I48A 3D0LB 4M8UA 1BBDH 1CD1A 1MIML 3MRJA 1NIBA 3U7YH 1ANUA 1JV5B 1JHTB 4K8RC 2W81C 2R9HD 1WGOA 2ZXDA 4ZFQA 2C9XA 4AJWA 5FR3A 3ZPDA 4HHGA 1F6AB 4JY6B 3NIFB 1SMDA 1CG9B 3BHBB 3L9YA 4QAMB 4AW4A 4U3CA 5D2LB 1IGJA 2NNAB 1L6PA 2BOBA 2ZUSA 4LARL 4QJ4B 4FTVB 2PYEB 2WTRA 5BUPA 2WWOA 2N59A 4KI1A 1RUKH 3NJNA 5T1DH 2FX7L 3IU4H 3IWUA 3RB5A 4KVNH 4Z3IA 5I74B 1KYOK 4GG6F 4HBCH 5JIIA 1KF9B 3O6KH 4UINH 3VQ1C 3BPNC 2Z7UA 4ISVB 5AW2B 4N1EA 3VX1A 1A3ZA 2QGDA 1DQIA 5C07B 3IM1A 2WIIB 5ISZE 4FNLL 4OV5B 4JO4L 3UYPA 5LN4A 1NGZA 2J57A 6FABL 1RFDL 3MRLA 3UEQA 1J1OH 1MWAA 4EZMA 3LXAA 1I7ZB 4PV9B 5AOJA 2YAOA 5DYOA 3TGXA 3P77B 4JGUA 4ZFOA 2X1PA 4M02A 1UB6A 3DK2A 1ZHBB 2DL2A 1ZVSB 1MFEH 2FBRA 4EUPA 3WS6A 1BJ8A 1ID5I 5B8CB 3PWVA 4PJCF 2A4CA 2WBWB 3O6FC 4A2GA 1A4KA 2J21A 1M6OA 3LPOA 4FLQA 4JMXA 3N43F 4JPKH 4MB5A 1F13A 1Z9PA 4WW2A 1EEUA 2Z31A 3WEXA 5K9QG 3EYUL 1BZ9B 3PGFL 3RWEB 3IKKA 3FN9A 3N42B 1KEML 4F5CE 4M3JA 3LNGA 3MACL 2EP6A 1NDMA 1I4FB 1RZKC 2P43B 2R2BA 1QO3A 4CILA 1DO6A 3DC0A 1QUNA 5MEPB 3SGKC 1BWMA 1YMHA 2XG4A 2GJRA 1C08B 3G5VB 1A6TB 4ZS7H 2YD9A 4XNXH 3P73B 5CXPA 1QASA 3N40P 2WP3O 3VXME 1RZKL 4F7KA 2QKIA 4LCYB 3WN5A 3HI1A 3OKEB 5D6CB 1VKXB 1AG6A 4TVPE 3LS5H 3TVMC 4U1GC 3AWGA 3CG8A 1DANU 1UQSB 5GRUL 3S88L 4WKZA 3VYPA 2YSTA 4WI7A 4K3JL 4XN1A 4K9EH 1DHKA 3U7WL 4R2GB 1L0YA 1YN6B 2YK1L 4WDIA 3KDMA 4ODHL 2XZQL 1QSFE 5G5DA 4NRXB 1E6JL 2VDQL 1AH1A 1MLBA 3ZZQA 4QRQB 3NIGE 1G5GA 3HEIB 4W9ZA 2NX5E 3FO0H 3P3TA 2GQHA 3EO9H 1IGML 2V3EA 1TMQA 2EDMA 4E41B 1KIPB 1FGVL 2DQTH 2WO3B 3LQZA 3T2PA 3ARBC 4H8HA 5HHQA 3MUZ1 2K78A 5DLLA 4CSZA 1D2PA 4TF4A 1I8UA 4DEPC 4UBDC 1ACXA 3GSOA 3U6XS 1FL6B 3PWLA 3V2AR 3JWOH 3T2OA 2NY2D 2CGRL 3ARDD 4H0LC 4XCCH 2RHEA 1AGBA 4JG9A 5KBKA 2B15A 1U30A 4FTVA 3U6XA 3IDIB 1O7VA 5DD6B 4DP8X 1HINH 2F54B 4YHNB 3C8KA 1VGEH 4UM9A 5DJYB 3U30B 4GQPH 1E6JH 1QP1A 4ORGA 5JR1H 4AQEB 1ZHNA 1PLBA 2YD2A 1LO3H 4M7KL 4UQDA 2ROXA 3TO4C 1PS3A 2NYYD 3VB8A 1N9PA 1EDHA 5D4JA 4QY8B 2IOIA 3KPTA 4IBUA 1SOSA 1T20B 1Q9KA 3MRCB 4AE1A 5BV7C 5EBLA 2R2HB 5EOCJ 4XCCL 4U0QB 3RTLA 2V2TA 1X5FA 4D9LL 3NP4A 4Y5XA 4TLUA 1N70A 4UOQA 3II3A 5LAXA 1IC7L 2IV8A 2UVFA 2QZQA 3EOTL 1WUZA 4HS3A 3ARDB 4J6RH 3AQXA 1HFUA 3UP6A 1MHCA 3SPIA 4RMQA 3CC1A 3PHOB 3FO0L 3OF6A 4HUKB 1IUZA 2YMXH 1GSKA 2C3GA 2I9TB 3DYPA 4EUPG 5C97A 4Y4HA 3D12B 1FYTB 1WZKA 2V9QA 5DA4A 4ZSOA 2H7WA 4OU3A 4XGZA 5CIPH 4XMVA 2C3VA 4E9LA 2AS5M 3QQNA 4NYLB 4OLVH 3TV8A 1XD0A 4GRLC 5B4MD 2KL6A 1OGAD 3ETBF 1ZY9A 2X4QA 3MJ9A 4LSUL 3UJJL 5I6XC 1JN6B 3EZJB 2CDEB 4HWNA 2WXMA 4FXGA 3BVNB 3S8FB 4MB3A 5HYJB 5HDQL 3ZTNL 1UB5B 5C2BL 4FHKA 3REVA 4KXAA 2ZWYA 2JSFA 2Z31C 5JA8B 4OZGB 2JJTA 5GGQH 4LVNB 2YPVA 1IGCH 3C6LA 5B1AB 4YJZL 4XN7A 2GB2A 4S1SL 2EZ0D 1CYXA 1CMOA 1E9OB 3H4FA 1AGCB 4NQVB 5IR1B 1AS8A 1F8TH 4WWKB 3BKCH 4L9LA 2VW4A 1HTYA 4X4ME 3TPUA 5C0AD 3IRPX 4YC2C 4FYRA 1IBGH 1WT5C 3BESR 2FATL 1NFDF 4NSKA 1JOIA 4FQXA 5HI4C 4OZFG 1U3HD 3BI9X 1U8PA 3D05A 4QD2E 4APXA 2VZVA 1Z3RA 3ZZLA 3QUXC 4DESA 4N3TA 2GUOA 4NUGL 2I25N 3P30H 3B8SA 4L23A 1HAWA 3F6LA 5ANHA 1U4EA 3O2WL 4M3KB 2UZYB 1NIFA 3LAFA 4Y2LA 4AY0A 2GSGA 5KZCD 4CC4C 3VWJA 4IIQB 1A4JA 2RALA 2YSSA 3SZKC 5C09E 3A23A 2HJKB 1MEXH 2XN0A 3QQDB 5LBSA 3RU8L 2CR6A 5AL0A 3C09C 4BK4A 4F8NA 3QRBA 2QPSA 1YG9A 2VQTA 4U0RC 3WNJA 1BOGA 5HY9A 4YDLB 1JVLA 4DK3A 2LQRA 3FUFA 2XKNB 5CMAB 4ONHA 3PWJA 5EEWA 1SN2A 3WEMA 1G43A 1ZANH 3Q13A 4AQEA 2YOAA 3L5IA 5T33H 2PYFB 5CZVH 5G2NA 4KY2A 4QKTA 1HXYB 4P5MA 4IKLA 2VCOA 4OM1H 4J2XA 3FB7B 2F19H 5F9OL 5E5MB 4ZJ9A 1NCWL 4IKIA 4DGWC 1VEPA 3KHOA 5GJSH 3NQIA 2DQCH 2FSEB 4YDZA 1OTTD 4TUJA 1BFVL 3KPSA 2C1PA 1M2VB 1D9KC 4IQHA 4MNQA 2VZ1A 3SE8L 2CJUH 3T65A 5IQ7L 5IWLC 5BCAA 1R0AL 5M7QA 4ZFFA 2FHBA 4KJYB 3X2QB 4M48H 5T1LD 3CPLB 3WDJA 4OZIF 1LNUA 4XNYL 5MEND 3EG9B 3MAWA 5EU7E 5D6DC 3VSUA 1R3IL 3N06B 4ZMNA 5I0DA 1X5XA 1XSKA 3U0PA 5GGRA 3UX9B 3HZMB 3L4YA 5ICYA 3O6ML 1LEGB 3CH1A 3T6QC 5L88L 2QV2A 5BO1L 3EGXB 5F7AA 1IC4L 1CFSA 1N0XL 4LKXB 1PW3A 2K0RA 4KKCD 5DF0A 4PHXA 4ENED 4ZG1A 3MCYA 3ZK0A 4E5XB 1S7XB 3JUZA 4OLUL 4GXUN 1FH5H 5LGKA 5AKSA 3GKWL 5EOQH 3WN5B 1VKXA 1CFMA 1U95A 3MNWB 3HUJA 3VJ6B 4FA8A 1XGPB 1IRAY 5ITFA 1BZ9A 3C12A 4MB4A 5LQBH 1ET8A 4TL4A 5F9AC 4HEMA 3CFDB 4N0RA 4IMLB 2DM7A 4A39A 4DEUA 1NC4D 4U1SB 4Z7NE 3DECA 5IROA 1G9MH 2DIJA 5KBMA 1GGUA 1XF3B 4G5ZH 4HYTB 4BHUA 4LNRB 4P4KC 4CDHA 3CVHH 4Z5RB 2D7NA 3L4TA 4PJEF 1U8QA 3H9HB 3RHWF 3QDAA 2BSRB 3HG3A 3GWJA 2PF6A 5DZPA 4IOIB 4KKAC 4XMPH 1WIPA 2NY6B 5KVFE 1X4XA 3GHEL 3LCYA 5BRZE 5FKPB 5HP5A 5CJQL 4QXVA 2CD0A 1NTDA 3CDYA 4UTAA 1QBLH 3CHSA 4ZMLA 4OBSA 3D52A 4TVPL 5I76B 4B41A 5KYYA 3LXBA 4Y5XC 1MCDA 4W9HC 3EO0A 1XR9A 2W0FB 4P2CG 1Z9SB 3CQPA 1UH4A 2UY7A 5EUOF 3D3VE 1RJCA 4IHOA 3U0TA 5HHME 4ANUA 2AJVH 3P3YA 1P4LA 3FQRA 1IKFH 4PJ6A 4R7DB 4KROD 3SPVB 1CG9A 3BHBA 35C8H 5E2UH 1CGSL 2HMIC 1C1EH 1OQOA 3HE7A 3PJLA 4P5TB 4X7SL 4XWOD 4F3FA 4X8GA 4MNQE 3EYFA 2LT9A 1CICB 3DX9A 5FHAL 4K7FB 3T09A 2LU5A 4KAQH 1AQDB 1J1XL 3TNNB 3T0ED 4N8PA 1DQML 1G6RH 5D7IA 2OL3A 3VXUE 3QYMA 1CDIA 4FI6A 3PFUA 4NN5C 3IBEA 4CU8A 3ARBA 1XCTB 2XIDA 1T7VA 1IEHA 2R15A 4FXKA 1NFIB 4JO2H 1JWSA 3TN0C 3C6SA 3DBXB 2WVTA 1DVFA 4HIEA 3RY6C 3IDJB 3H42L 1YEHH 1UM6H 3PXJA 3GLDA 4ZFOL 2HMID 3U4EB 3N41B 1NMAH 3IEAA 3O3AB 4FYQA 4Y9EA 1EK3A 5C0FA 1DBAH 4G7YH 1U3HB 4WEUD 1S9XA 3ZE1F 3EYVB 2JKWA 5DRNB 3OKKA 5TQ0L 2FJHB 2ZSVB 5ECGA 3FT2A 4YGAB 4EN3B 1LE9B 1G7JB 1KCUH 3QCTH 5GIRA 3G6JA 3Q6FA 3QORB 4YN3A 1UXWB 1OP3K 2WBKA 4PRHE 1CGXA 4D7PA 1N6QL 1CLZL 2BS8A 2VDMH 3KJ4B 1VJSA 4JM2A 4V1DE 4ZX4A 2FX9L 3HZ3A 1YMMA 1WYJA 5EC2A 2CO4A 1PYWB 3DJ9A 1FO0A 3BAXA 2F19L 1ADWA 1CK0L 1P5VB 3QWOB 3T0BA 4DGVH 3GSXB 3QQ9D 3QWRD 2YPLB 3ATEA 2W88A 4DSYA 4GAGL 1A6WH 2IAMC 1PL3A 4NENA 4W1TA 4F8QA 2R39A 3MKKA 4G43B 2ZF9A 3GMNA 5I30L 1XZ0A 2HUEA 4DVBA 2XG4B 2JIXA 1MVFA 3L3HA 1B0GA 2FO8A 4A67A 1CFQB 4JVUA 4F20A 4XVUD 1WBXB 2BVQB 2ARJB 4DZ8A 3QXDB 4F7PB 1RY7B 4X5RA 4URKA 2J8UA 2LW3A 3GZKA 4N9OB 4ACTA 1JPGB 1YEDB 3VFNB 4Y2DB 2EIEA 2GBVA 3NMEA 4RAUA 2IXQA 2VXSH 4WJKB 5EF2A 1YY8B 3UBHA 5L9DL 4X4YB 3QEGL 2VN5A 4TSBH 3BN9D 3BVNA 4KTDL 1X7QA 3U48A 3OC8A 3GPSA 1J1PH 3GMLA 3C5ZC 3V0WL 3CVIL 2IAMB 3QZOA 2KUTA 4QKXB 3BWUF 3WMSA 3ES6A 4RZCA 1DFBL 2AK4D 2VLKD 3WFZA 3EGSA 4MMXC 4GQRA 2EYSB 5IVXB 2HFEA 3MOAL 4OAWA 5CJ5A 3BWAA 3QORA 2GC4C 2ZX8A 1WICA 1FVCA 3VFGL 3EDFA 5T5FH 5CKGA 5MEQB 2HN7B 3WTYA 4I3RH 2E3VA 2OJ1A 1ORSB 3IMVA 4LOVA 1JGEB 2BNUB 3FSZA 4PMEA 4JO3L 4DN4L 1ITBB 3TP4A 3L5WB 1SLXA 3QEQE 1M1SA 2C9PA 5JUEH 1UD6A 2P80D 5KSAA 5FLVA 4NB7A 5FOBB 1RZPA 2KYIA 4LVHC 4WFFE 1MUJA 2LVCA 2BRRH 2VIRA 1VPOH 1AY1L 1VACA 2ALAA 2WZPD 1HEZB 2KPNA 3EF7A 4QHNB 4ZOCA 3ZKQD 4ZX6A 5DA0B 3MFFB 1GS6X 1DVFB 4HIEB 3LEVL 1PCXA 4DIXA 5J11C 1JHKH 1XIWB 4Z7UE 4BZ2A 1T03L 1K85A 5KVDH 4Z3EA 1AQDA 4N2FA 1UH2A 3RP1A 5IJBC 3GSWA 4FEMA 4HJ0D 4EDXB 3I85A 2AK4B 3MUHL 4XBPB 4UI2A 5CHNA 1RHHA 3IFOA 3QDJA 1FORH 2ITCA 4H8WL 5LXGH 2VSDA 3MNZB 3KM1A 4YSUA 3QUZB 4FNLH 2NY5C 3JWDH 4P49A 2RAMA 4NXKA 1NANH 1R5WA 1UEYA 5E0QA 2KZWA 1FNAA 3APCA 3OXRA 5KSBA 3OJ2C 1OGTA 1Z9SA 1NBZB 4KPHL 3EO1B 4M4PA 1O7SA 2K45A 1ETA1 3AZUA 2YAQA 2X1XR 4N8VA 3GXNA 4N26A 5LDUA 3SKUD 2ARJQ 1RULH 3KWVA 2CHNA 2GSMB 5TDNA 2WQVA 5E8OA 5JW4N 3TBYB 3MV8B 4OUUA 4C56A 4B5ZA 1UFUA 4LU5L 1R3HA 3DTXB 4R97C 3MRIA 3CXHJ 1DVFD 3ZKXC 4MS8C 4P5TD 2CA3A 1HQ4B 1A1MA 2IAMA 4JO8A 1JMZA 4A2FA 4LQ1A 1JDCA 1FRGL 3DHPA 5JPNB 5CSZB 3W1ZA 2H41A 3H56A 2ICEC 3QFJA 4O2CB 4JPWH 1SXSA 2R1WB 4OZFH 4PREB 7CGTA 3GJFH 5F1KC 4AV5A 3CJJA 4FFZH 4KGJA 2J73A 5ESQA 4KJQC 1G7IA 4HSQA 3FRUA 3RY4A 1CFTB 1YPZF 3P9WB 2BRRL 4YX2L 4DAGH 2X89A 4WO4D 2J88L 3VRJA 3OLEA 3VI3F 4RZKA 1TFPA 5DRZB 4QI3A 6TAAA 1B3IA 4W9GC 5DO2C 3CX5J 3IS0X 4KK8C 2YRZA 4UU9B 4OLYH 1B0GB 1ZTXL 2HT2D 5IJVB 3LKRB 3SBRA 3REVB 3HN3A 3S5LA 2GBTA 1ULVA 3L13A 4HXAL 1JYXA 4YK4C 4MA3B 1X3DA 1XR8A 3QEQB 3RGVB 1T0MA 1I9JL 1F4XL 1ZLUK 3RY6A 4N2OA 2LGNA 4WGWB 1RZIA 1A3RL 1A5FH 1V8HA 1H8LA 2MKLC 4X99A 3K2MC 1R3KB 1UUNA 4HHAA 5C9JA 3MLZL 4MFHA 5KJ4A 2FEDD 1YO4A 3SBQA 4KZEH 5JUEL 3IXTB 5D4QA 2ADGB 1AO7D 3OHXB 4HAGA 1ZVYA 5I8CA 5L0QB 3NT0A 2CAKA 1NSNL 1HZHL 1YPZA 2V2XA 4MQXC 4PRNB 5JXEC 3MRQA 4K07A 1I1AB 3MRGA 2P8LA 5CWSB 3B9KB 3NEXA 2R2HA 3NEEA 4Q9BA 4LLAA 5HBBA 5TGBA 4HKBA 1FFPB 3FFOA 4TYUA 3ARXA 3GB7A 1UJ3A 4JRXD 3QIUC 1UJTA 1X7SA 4DKAA 2QSCH 4QAWA 5D7SH 4U1HA 1KTBA 2ZUUA 3Q2CA 4HMDA 5C0CA 5FKAA 2X4PB 5ADOH 4N0FA 1JD9A 1IBZA 3ALPA 4G8EB 3V55A 3Q1EA 2Y2WA 3FUIA 1WLHA 3HAEA 1PLAA 3CE1A 1VFOA 1S5IH 3NH7L 4PCYA 1KG0A 4HLZG 1FG9C 5BZWB 3HR6A 1U92A 2XBTA 3KD4A 3HA0A 4XNZB 4PTTB 5KSBE 1RULL 1AAJA 4OI9A 3K74B 4ZYKB 4U7KA 4EZJA 3IDYC 4H1LA 5C92A 3QIUD 3MBED 4GXVH 4FP8L 2CNYA 4ATWA 3ZDXE 3QP3A 2N4IA 2Z7YA 2X6AA 4NAJA 3NCYP 1RPKA 2RFXB 2ISDA 1D7CA 4GS7C 4GP4B 4N0YH 1QBBA 1ZA3B 3DRQA 5I5MA 3QIBC 1PD0A 3O4OC 3K6DA 4G6AC 2CLRA 4QRUA 4YBHA 1RXLA 5LO7A 1SY6L 2NOYA 3ILPB 4IMKC 3C60D 4HX1B 1TQBC 3OX8B 4PRDA 1QPXA 2VL5A 4Z7UB 4FQLH 3PGDB 1TEGA 4XNQB 1ZV5A 2EXSA 4XOAA 1IC4H 3MGTB 3WLBB 2WLJA 3KL3A 5DO2D 4TQ8A 3MR9B 4K9EL 2MQGA 2BERA 4L4TB 4K5NA 5DJAA 3VM5A 4KQ4L 5DI8B 2VDRL 1LP9B 6PCYA 2OTWA 2GT9A 4MA8H 1KGJA 2H6PB 1DR9A 4U3XA 1RMFL 1ORQA 5I23A 3QIBD 1JPSL 4G6AD 4I0KA 4ZMZA 4DUXA 2E8YA 2WBJB 3MREB 4AK2A 4LLVB 2CLVB 2VDPB 1NFDA 4FFWC 4NEHB 5KANG 4LCWA 2JIXB 4HJEA 4H8VA 2YA1A 3CSTA 4TTDD 2BOLA 5GGVY 1QI5A 2DKSA 4BUGA 1RAMA 5FO9A 1XGPA 3L3OC 5ITFB 3WGVB 5C0BA 1Y6KR 3VMOA 3ZE2E 5D1XE 2Z31B 1KBWA 3WEXB 1BQUA 4ODSH 3ROOA 43C9B 1BG1A 2ZCHH 2H3KA 1XDTT 1JPTL 2EDJA 1LHZA 4FTVD 3OAYH 1KPVB 2VN4A 1K2DA 2DAVA 1XL6A 3NDYE 1H15B 2FHFA 3T4YB 1I1AC 1OP5K 3ETSA 5KVEL 4JJ5B 5DZJA 1N64H 1CO1A 4JKKA 2E9IA 2CIKA 2NPLX 3B6SA 3OB0H 4IKNA 3QJRB 5D7IF 3ULVE 4MXVF 1Q94B 3PL6C 2XV2A 5IVXE 2YR3A 1A6VH 2AXGB 3O3DB 4U6HB 1T21B 4XXWC 3IJEA 1CI3M 3GIVB 2YZ1A 1IVLA 4GW5A 4X7EC 5D7HA 4JUTA 4N2LA 3DIFA 5AAWA 5EBLB 1B6DA 2V4LA 4QWWC 4TUOA 5IUSA 2XC8A 2XKUA 4OD3L 1FVEA 3VI4E 5KG9A 1M2VA 2UY6A 2GABA 3UEZA 5AB0A 1J48A 1O6SB 5I8EA 4FE9A 4AK1A 1HX0A 4MJJA 3ZYOA 2VMFA 2NTFA 4YDKH 4WJ5B 2YD0A 3DNKA 5F3HB 3MBXH 2PYEA 2WTRB 2H32A 1QTPA 4PRAB 5I26A 4NHUB 1U8MB 12E8H 1UHVA 1NC2D 2JB6B 3BEVB 3IMSA 1HEZA 4KVCL 1U8MA 4Y1AE 5MP6L 3V8OA 2FX8L 3TJHD 1DQLL 1PG7W 1C12A 1TZIB 1F6AA 2OCFD 3T0VA 5I1JH 3GRBA 4MVBD 1EQWA 1LK2B 2VAAA 2ICES 3D69B 1WK0A 4GRWF 2IPTH 1SZNA 3FRPG 4NJAH 4K7FA 1NCAL 1Q9OA 1M1XA 1CQYA 1PEZA 1Q1JH 4HKBB 4UT9H 3ASNB 5IP4A 4N2AA 1TQVA 4YHIA 1DBJL 2Y07L 4RNRB 5DEZA 2EDDA 1KNOA 4Y0GA 1FPTH 3HKZA 25C8H 4HLZH 3F7QA 4JFEB 4JN2A 3P40A 4XRCB 3K4AA 1A7RL 1D9KA 4M48L 2V5TA 1DBBL 5LQBL 1Z2KA 4N87A 1BD2B 5HVWA 1A7BA 2CJUL 4GLRI 1R0AH 3GNML 4PRIA 2OX5A 2AQPA 4B3VA 4PTUB 2ICWB 3CGTA 3EHBB 4KQ4H 2XA8H 1QD0A 2J6EL 4K5OA 1NJ9A 4O58H 2LTQC 3B9KD 5CLTA 3TBVB 1OT2A 1CDHA 2APBA 1HOEA 3LIUA 4NC1C 2OW7A 1L7TL 2X2IA 3QHZL 2FL5B 4OB5L 2DN7A 4R2GC 2VLRB 3QDJD 3GMLB 4NBYB 4FFWD 2FYVA 4RRPM 3BEWB 1JZJA 5SWZA 3O6MH 2YQ2A 1HCFX 3RGVA 1H6TA 3KH4A 4UV4H 3H9HA 1BZDA 3O0RH 4K73A 1OY3B 3JTTB 2GITA 5ACMA 4PRID 3TC9A 2DQIL 2DI7A 5I24A 3SPGA 1KXTB 5HYJE 5DMKA 4EN2A 2R23A 5H35B 1Y18A 1PDKB 2CU9A 2B4CL 4LPXA 3NZ8B 2A7BA 3CAFA 1A7PH 4PVNA 3KYNB 3L1GA 1A8JH 4LOUC 4P5RA 1WAAF 1BIHA 3ARVA 1CVRA 3HVNA 1BQSA 1FNEA 4A7GF 3BQVA 2NXZD 3RPKA 3WKML 2PXYC 3UAAA 2BVEA 1NCAH 3UPAA 4AJYV 5DC2A 4QT5B 4X6CF 4XB3A 5BOJA 1V3JA 1PZCA 4UIKH 5HYJA 5E6IB 4Q9QH 2UXVA 1E43A 4LKCB 4OGAD 2QJDA 4E5XA 4X9IA 1DEEA 2CDEA 2Y2TA 4FQ1L 1UB6B 1NFAA 3QORD 4QTHA 4JDTL 1T2QL 4OT1L 4PRPA 4IMKA 2IQAA 4LPWA 5BRZB 3CLEH 4QRUB 2CDGA 4YPGA 2FWOB 2YRBA 1TQBB 4NKOB 4O02B 3KWWB 1WPCA 5HGAB 1KSRA 4JB9H 3GF8A 4MAYA 4RLDA 5GGUB 2C9UA 2OZNA 1TVBA 4HIHA 4QRTA 5ADPL 4KTEL 2XPYA 3VWJD 3MA9H 3MUGB 3SYAA 2OULB 2Y3AA 3L9EA 1O5PA 1GYAA 1HL8A 4D7BA 1BFOB 2GTQA 2M83A 1ZKAA 2VITB 3W39A 4JQXC 3IDYB 3PJSA 3O3AA 1OZTG 5DHVH 3KPSB 2IG2H 3VW3H 3DGGB 2R59A 3IDJA 3QXTA 1TJGH 4GUPB 5EOCH 2ZF8A 4CN6A 4QHUB 1HS6A 5T3ZL 1Q9KB 3CBRA 2ENSA 1WWCA 2C34A 3HBZA 3GSNA 4PJCA 3GLZA 2YD5A 5I1LA 2PYFA 4YGVA 4Z77A 4Z7WB 1G9EA 1EXHA 1AXSB 1A7QL 1ITCA 4KROB 4NS0A 3CC5A 1T4KA 2XNAA 4FFVD 4PJ7E 4Z7WA 4YGVB 5LCVA 3RBSA 2K9FB 5D4HA 1HJBC 2KHAA 3PV6B 4GBXC 4YEFA 1Z9NA 2F54A 1N4XH 3NESA 3FUNA 4YSQA 3UO1H 4GO8A 3NJGA 3H6JA 3MRJB 3DDGA 1B0IA 1N8OE 4M4RA 4X7CC 1ML0A 4QO1A 2NTFB 2K7PA 4AT6A 3D48R 1E7UA 1Y6NR 1YUHB 3FFCA 1A02N 2VJXA 1QSFB 2CKBH 3WJJA 2J6WA 1E3FA 3A6OA 1YMMD 2QFRA 4OZFA 1BQKA 2H9GA 1QATA 5E0FA 4K94H 1D5MA 4LLMA 3ARUA 2BSDA 2FHCA 2MQ3A 3NJMA 3NUKA 5AB1A 1JGLL 2GK2A 3B9DA 4Q6IB 1JV2B 1UZ8A 3O2DA 3RJOA 2B2XH 5L0QC 1IFRA 1YN7B 1MKFA 1ZT4B 5L7XH 4LHUA 4GRWH 1FL3B 4HPYH 3HC3L 1V3LA 2B59B 1MF2L 1MNUH 1NGQH 3VI3A 1FNLA 5F7EL 4U2YA 1Y1DA 1VDGA 4KRPB 4PRPB 4TVPD 4KRMB 4YSOA 5CCJA 3CDGA 2EILB 1AGDA 1GMIA 3IDMB 5F93C 2DYPA 1RZGA 3KJ4C 5CP3A 5JYMA 1JVKA 4AUUA 2VYRE 2H0JA 2LAGB 1T0NB