3FT1A

Crystal structure of pollen allergen phl p 3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
b'AVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEEQEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phl p 3 allergen
publication title Crystal structure of pollen allergen Phl p 3
rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 17
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3ft1A00
4FG2A 1WHOA 3D30A 2HCZX 1BMWA 4L48A 1N10A 4FERA 4JJOA 4JS7A 4JCWA 3FT9A 2BH0A 4FG4A 2VXQA 4FFTA 3FT1A 2JNZA 1WHPA
chains in the Genus database with same CATH superfamily
3Q2NA 1MVUA 4N87A 3RYMA 2XN0A 1IZJA 5DK3A 5A2LH 5K9QG 3UAJC 5DC9B 4OF3A 4Z7AA 2QMKA 5T3XE 1QSVA 1BVOA 2CDGA 3G08A 3FU7A 1MLCB 3VSQA 5DJCB 2VN7A 1JHTA 1O9WA 1W0WB 2X10A 4DKDC 4OLVH 1GR7A 3IWVA 3HS0C 1XH0A 1JI1A 4M8QB 2FL5B 3BKCL 1AO7D 1JGEA 5KVEE 1SNRA 1SUHA 2DQJL 3NFPA 4PAZA 1PU0A 4Q14A 2ZXBA 2WVSA 3VFGL 4MQSB 1I8IA 5BZZA 4M6AA 3K7UA 3SO3B 5CNHA 1TENA 1M71A 1R19A 4KDTA 3IMSA 5T3ZL 4GXUM 5EBLA 3H0TA 1WD9A 2X4PB 3OPUA 1T89A 5DU7A 2X70A 4JREB 5DC0A 3IE9A 2CGRL 5E4IA 5KJRL 2EDKA 3QZWB 5TFSL 5D4JA 3CVHB 3P69A 1OGTB 4U1IB 3PREA 2DS4A 3SE4A 4WEMB 1XH3A 3RZCB 4B41A 1XF5B 4PG2A 3KR3H 3DECA 1KACB 2K4WA 3BSZL 1A6WL 1F4WH 2VR8A 4E2OA 3PU7A 3RTQA 5B7MA 4RCAA 3SGEH 4NN7B 4MX7B 4HEMA 5K9JH 4FTVD 5A3ID 5T3XL 1OB1B 3OB0K 4LVNB 1CGUA 1FVEB 5K9KB 5CLYA 2O93L 4G72B 3O4OB 3TO4D 4G6MH 1OIOA 1BVLB 1NTDA 1PS3A 1MW2A 3L4UA 3BSGA 3CZFA 1I1CA 1L9QA 1NA8A 4NO2B 3OKDB 4PJDB 4GMTL 5C9KA 5AOZA 3SDAA 3TCTA 3W0WD 5KVEL 2DJSA 5GZOC 3VX1A 4FZ8H 1INEH 5JW4R 4DN3L 3NIGB 2WAHA 3OQ3B 4OSUH 4F7MB 2CBMA 2XZCL 4FQCH 4WZ9A 3TYFA 5FW8A 1TCRB 2C3WA 2ZJSL 1MHPH 3K91A 1EFXD 1IILE 5AOJA 2B15A 1AGDB 4GQRA 3CGTA 4G43A 3FQXA 3H53A 5JHDB 5JTWA 1T6WA 4S1SL 3ATEA 2VXUH 4IHBA 5L4MA 2YD2A 1CFQA 3T3PE 1JXJA 1MRCL 2HKHL 3PP4L 3AS0A 3V10A 5MEOA 4JJ5A 1J9SA 4PJCA 3WY3A 3DK2A 5BJTA 3WIHH 1Y18B 1NBYB 5D4IA 2WINA 5I1EH 1R3JB 4G3YL 2XZAH 1FNHA 1FFPB 3GMOA 3MRQB 3P4LA 2XZQH 5IT2H 4EE2A 1I82A 2QKIB 2ILLA 1ZK9A 2HLFC 3NA9L 3UBHA 4Z7IA 3BUQA 5F7WC 2WZ0A 2E7LA 4LQFL 2K9UA 2Y3AA 4LCWB 2GB2A 2A9ML 2WOYA 4DVRH 4JRXB 3ILEA 3L13A 3AGVA 1AG0A 4ZRGA 1X9UA 4JLRA 4JZJB 2OMZB 5L2KE 3ZK0A 1RMFL 3DSNB 3I75A 3QYNA 1BD2D 4LLQB 4S1RL 4MZIA 5AOIA 3D7PA 1EWHA 4GJTB 1DJHA 2SEBA 2AVFA 1P0SE 5TD4A 4CNIA 2CJUH 4PTUA 4QHNA 5A2IH 1U8OA 3TBVB 2DLIA 5FM4A 3ESMA 1BWWA 4CL7A 3F7YA 4LOFA 1WK0A 1QR4A 3S9DB 3DOIA 4OQTA 4PJ8B 2MCG1 3REWB 4R7DB 5AKSA 5E5LA 4LARH 1YDPA 3BIBX 1E4XI 1XGPB 3MMEB 5C7ZA 3FUHA 1TO4A 2Z4QA 1YEJH 2D03H 3WIFB 3TESA 3E2HC 3WXWL 2DICA 1G7JA 4LLMB 3DXAD 1MWAA 2MRYA 4BZYA 4O00A 5D1QA 4LRIC 1KFGA 4WY7H 4FXTA 1WVZA 2ADJB 2GJRA 4AVIA 4X5WB 3DRQB 4YSDA 3HG2A 5BRZA 4PSPA 3VXME 4JZOA 2OBGA 3VFOB 5JDSB 3O2WH 2BFVH 1NJ9B 3QQXA 3BP7A 2YQ2A 3EOBA 4KTYA 1YUKB 3T0BA 4LQ1A 1FWXA 3BP6A 4YBHA 2GFBA 3AS2A 1NSNH 1SLVA 2B1AL 1MJJA 1RU9L 2ZF8A 4X6EA 4NNYA 4BE6A 1CD9B 4M9PA 1FYTD 5HHMB 1T66D 4QRPA 2WUBH 1B3IA 4LHQB 2AJYL 2VN5A 5DA4A 3QDGA 3H9YA 2ZX9A 3O6MH 4P9HH 5CBEB 3L5WB 3QVAA 1C5DB 4JPWL 1QSZA 1JK8B 4WSKA 1XGRB 2V2XA 4DP5X 4GSXA 2R2BB 3QHZL 1UXSB 4FQ1L 3ZT5A 4YZFF 4LLWA 2ZX7A 3JYCA 1EAQA 2L7UA 4F2FA 1CICD 5JHAA 3AQZA 2J8HA 3LMJL 3IJEB 3L3GB 3ZLQC 1N0LA 3ZYJA 1G7IA 1UWYA 4N0UB 2ZE0A 4IU3A 1BW8A 3QXUA 3SYPA 1MEXH 5DJZB 3WJMA 4RRPG 4ZZKA 1E5YA 5IEHA 1ZPUA 3HI6H 4AIEA 1HCFX 3DGGA 3PGFH 3T2NL 4JKNA 5KYYB 5HYJA 2EUZA 4L4TE 3QUYC 4IBWA 4FDWA 5IQOA 2YQBA 2Y5EA 4MJ4A 3CBKB 1Z3RA 2NY4D 1FLTX 5F1IA 3CFBA 4FQXA 4PRHE 1J0ZA 4OGYL 5HYSB 4KJPD 1OAXL 2P8LA 1TZ8A 2YS4A 4TTGA 1ES0B 1T20B 3IFPA 4MSWA 1LO5B 3CDFA 3WFEH 1DUZA 1UACL 3B56A 4IBYA 3VCLA 1TYEB 1TZHB 5MEND 1JVLA 4OQTH 4B60A 4X4YB 2IPKB 4KRPC 1HIML 1NAML 4CSZA 1TZOA 3HHSA 4FFZL 4JG5A 4M02A 5EOTA 5T1LA 3UTPD 1ZAGA 4EIBA 4WCYL 2N4IA 4HJ0C 4O2CA 1BVKB 4QXTA 4ODWB 3L17A 5TQ2H 5EF0A 5CCJA 4MMZC 1W0YT 2ZKHH 2P52A 4NHUB 2N3JA 1ORQB 1MWAH 2CA4A 3DYMA 5GS3A 3B7UX 2ICWA 3QC5X 2XLLA 5BOZG 4ADGA 2WCGA 5ISZD 3MNWB 5BUGA 4XN4A 1TQVA 2VXTL 2WLHA 4Z7UA 1YMHB 5I30L 1UVQA 4HS3B 2Z8RA 3INUL 4UDTA 1OVZA 2IALB 1LP9F 2IBBA 5JPMB 3OD3A 4OIIH 2WXLA 3GZKA 2BOCB 3FO0L 4YHML 4W9EC 1F02I 4F8QA 1CLYH 4H8WC 3UYOD 5GZND 3EJUA 5D72L 4XCFL 1AFVL 1T0PB 3IJSA 3FONB 1HSAA 3OC8A 3FT3A 1I8MB 5EA0L 4KBPA 2GJ6E 4E0RB 4H5SA 2WKOF 3DPDA 4I9WE 5FGBC 2FR4A 4N2HA 2OYPA 4HP5A 1SHXA 4U0QB 4ZFOA 4YEFA 1M7DB 5I76A 5T33H 3STBA 1KJ3H 4MJ6B 4A2DA 3L3HB 1S9KC 4FQ2H 1T2JA 5I1JL 2BSDA 1CGXA 2R2HB 3DBXA 3EJQA 4Y2OB 1AD9A 5BVPH 3VACA 5D8JL 2XU9A 4YHYC 2J1XA 2O5YL 2QVKA 4BGDA 5M95B 1B0GB 3KS0H 3TVMD 2VLRB 1CGSH 1EGJA 3COOA 1ADQL 3ML8A 3A22A 5FHBL 3ARFA 1YY8A 4LNRA 4R5TA 5HGGS 2EE9A 2WHVA 1X4YA 3PQYA 2UUDH 2XKNA 4XO5A 2H41A 4YXLH 4PS3A 4RRPM 3A47A 3D0VA 1RJZA 4PLKC 3VE0A 2D31A 3E2HB 3SPHA 1O6SA 4N0FA 4YR6B 1S7SA 2CK0H 2WUCH 1U3HA 1OAKH 3UPAA 2WXIA 4K8RD 4XCCH 1IL1A 3W82A 4RFEA 4RAHA 3WFBL 1RPKA 3R7RA 4MA1C 4KVCH 5HHNB 2V8LA 3V7AG 5B7EA 5ITBL 5AALA 5MI0C 2UWEA 3BYYA 5HDLA 4BINA 1BFSA 2DQUL 3ATDA 5HJGA 1F3DH 2Y9RT 3SD2A 4ESKA 3TNNA 2IOOA 3MRPA 4K9JA 3QUZD 4MAYB 1JYNA 1EVUA 2ZAIA 4X6DE 3CLEH 5IF0A 3MRGB 2C5DC 1B2WL 1FPTH 3VRIA 4YOKA 4AYID 4EI5A 2A99A 1E50A 4U3SB 2NY7H 2VJ0A 4QJ3B 1U8NA 2X4OA 3QQ3A 3PUUA 1JYVA 4Z7WA 1P53A 2DQCH 4FXGA 2FJGB 2F68X 3EBAA 2VDMB 3WY1A 1M57B 3GSNA 4DP6X 3DVGA 2AEOA 1M3JA 3DJ9A 4O58L 2CCLA 2BP0B 3C6SB 1AGCB 2J6EA 3IMRA 1CXLA 3SJVB 3HG4A 2FBRA 4AZ8A 4DN4H 2VLJA 5DD0H 1A9VA 2A3TA 3NVQA 1QD0A 3D18A 2RCSL 3BPOC 1IC5L 2IANA 4TMPA 4X9HA 4EDWL 3GC3A 4HLJA 4PJHF 4WSGA 5BV7B 2B4CC 3IPFA 3QUYB 1M9WA 4Q89A 1TZIA 2WQUA 3KXFA 3MUZ1 4ZNEA 4ILDA 1S5IL 4LVHC 1JWUA 3ZTJG 1CI5A 4G9FD 1QBBA 4OGXL 3MKGA 1ZVYA 3KW8A 5A7EA 3TZVD 4HPHA 5HGHB 1PZUB 2JH2A 4NFDA 1HDMA 2YC1B 3PWPD 3ARPA 4KRPB 1J8HD 1OGAB 3WO4C 5HHVL 4XGZA 1E4WL 4J12A 4XH2B 3QEUB 2OMWA 1I3UA 4QYOA 5M7QA 3AS3A 3DUUA 2Z7ZA 1E2WA 3B83A 2F8IA 3C09C 4AENB 3FU8A 4MMZB 5E2JA 3HLAB 3EYQC 2YFOA 4JCLA 1GYWA 3GBNL 4PY8I 5D70L 1E42A 1ADWA 3O3EA 3FHAA 3MNDA 4UQ2B 2KMWA 3D85A 1E9OA 3SCMC 5F9AC 4RGND 4CADB 3QFJB 1GOFA 3FB6B 1KIQA 4E9SA 3IJYA 2N0MA 4I9XA 3WLWD 2HFGH 3BH9B 2KUTA 4J3OH 1GYAA 4GRMA 4ZK8A 1JPFA 2VDNL 2V7NA 3E3QC 3E7JA 2HN7B 2ZIDA 1KGJA 4OKVB 1V3JA 2AEWA 4WW1A 1JK9B 1V7MH 1FNGB 3PDGA 4HPOL 1LO2H 3U9PL 1JVOA 2KLSA 5MERA 4NENA 2Z93B 5I5MA 4U1NB 2O30A 3D3VD 4IMKC 2OCJA 1WAPA 2QPEB 2QSTA 4PJBE 5FM8A 4QRTB 4UBDC 5I1GH 3HPJB 2CLRA 3T6WA 1BJMA 4GW4A 1DJWA 5I1IH 3ABMB 4Q4IA 1IBGH 1U3NA 5FYJD 5A2AA 3VDCA 3CQFA 3GSNH 4WWKB 1P6AB 2Z92A 5EU6D 2VRAA 2NY3D 3FQNB 4HCRL 4HIXL 4Z76A 4DHLA 4X80L 4WI0B 4I18B 5KS9B 3LN5B 2NZ9D 3CDZB 2WVUA 3L4WA 3O45A 3O9WD 4Q9QL 1VAHA 4NKMB 3EFOB 1FVCB 4DPCX 3K71A 1FL3A 2B7DT 4OZFA 1P4LA 3VWJA 5CZVL 4MQTB 3DMMD 3KHOA 3R1GL 3UADA 1B9ZA 1YNKH 1N4XL 2IADA 2JJTA 4FN0A 4PB0L 4X4MA 4GW1A 2VZOA 1MG2C 3STZB 1HH6B 4G6FD 4KXZH 1P69B 1MHHB 4KDTC 3M17A 4QHUA 3D12B 3U4EB 4OGZA 3GKWL 3EDKA 2WWKT 5LBSL 4CBZA 4JDTL 5L0QC 4X99A 5MI0B 4FZEH 5FX3A 5TQ0L 3AU1A 4KKQA 1IM3D 3DRTB 4G42A 1UWGL 1E30A 4Z7VB 4K71B 4UNUA 1DE4B 5IROA 3D0LA 4NQQA 3L3JA 1DEEB 4R7VA 4PG2C 4J2QA 3NSXA 4LK4A 3SPCA 1XF3A 3KL3A 2P8PA 3SKOB 1KN2H 4TTDD 5BNXD 2VXQH 4MB5A 3LKNB 4FNQA 4AYBA 3T0EA 3PWNB 1EEZB 2DWEA 4OZHE 4FAAB 4JO3H 3P9LA 4CN1A 3KCWA 1ORSB 4KWUA 3FDWA 3VRJA 4OZGE 3CN1A 4ANWA 3FFCE 3I74A 4IOFC 1SBBA 3WTTA 1N2RA 5DRZA 1DBKL 3SDAC 3OB0H 1A4JB 2P24B 4XR8C 1WS7A 4LCUA 4G8GD 1FVDB 2IGFL 4L9LC 1MFBH 1DQLL 3QJSB 1S7QA 4K2UL 4ZPTB 3CSGA 4Z7QF 3BKCH 4UTCA 3LZFH 1W15A 1E0OB 2DQJH 3VFGH 4DEPC 1CL7L 5E2UH 1IUZA 1X4ZA 5C6TH 1YSOA 5GIRB 3FT9A 2NY2C 5EOCL 5AVUB 4HHGA 3KYOA 3OF6A 5EULV 3B5GA 4JFXB 4Y7OC 2A6DB 1KLUB 2BSRB 2CGRH 1HCYA 4AKOA 5KJRH 4MHHG 3NTCL 4LCIL 1DANT 4NOBA 3WO4B 3U46B 2ZUTA 5TFSH 4OZFH 3ISRA 3IT8D 4K7FB 2CK2A 3V0WL 4LPCA 4L4VE 4KX7A 4PY7A 5ICXA 3JV4B 4AYMC 4P46C 4AM0A 5JA8B 2E7LC 1FZMB 4F9PC 3OKNB 3VXUD 5HGBA 4YDJB 3BSZH 4PJEF 4PSRA 1JRHL 5JPNC 2I9TB 1GRWA 2ZAGA 2Z8VC 5EU5A 4PH8A 2GTZB 1YPZB 5T3XH 5IVXF 2GUOB 1LILA 3TJEH 3PCYA 5GISL 3CU7A 3SCMB 3D09A 3ALWA 4BSVA 4OF0A 3ECBB 1G7QA 3O3AA 4IRJD 1Z7JA 2PTVA 1BMGA 1RUAL 1FGNH 4HXBL 1TTAA 3P0YL 1VFBB 3ILQD 3FUMA 1XGYL 2MKLC 4O2FA 3V5HB 1EZUA 3KYMA 2FWOA 2ZG3A 4OI7A 4KK8C 5KVEH 1TSHA 4R2GD 3VI3F 2FECL 4H8VA 5HJBA 3V6FA 2DB8A 3IGUA 3CZNA 3MBWB 3GO1L 1FE8L 5GRYA 5IQNA 3PLYA 4HHAB 2ZJSH 5L2KA 1LYQA 3EXJA 3AREB 4OFYA 4AC4A 4EDXB 1I8LA 2HUHA 5C07E 4G7SB 4K5PA 2WBJD 3ZE1E 5DO2D 1KJ2B 3LXUX 1EMTL 5K1VA 2YXFA 4NIYE 5BVJB 5I66A 4JFPB 4S1SH 4W9KC 3VA2C 3VSVA 3K8LA 4FF9A 1FNAA 4BSWB 1MRCH 3PP4H 3C8HA 1QYGL 1MCNA 1MJUL 1TZGL 2WW8A 5D1QC 1ZT1B 5D7JD 3IMWA 5ACMA 1Y0LA 3S5LG 3JUZA 3CXDL 2BVOB 2WYZA 5FUCC 4G3YH 3FFDB 2C9AA 2ZP9A 2HVBA 3NA9H 4HUVA 1R75A 2EVJA 3SDXF 4LQFH 3OLIA 5HYIA 3LZPA 4XP4L 5BUAA 1DVFD 1F3JB 2A9MH 4OBRA 3WEOA 4YHLL 1MCLA 5D5MA 3LN9A 1RZKL 4M5YH 1AY1L 2W60A 3QA3A 4HWZB 3DGDA 3VG0H 1D3CA 5I1KL 1RZPA 1OGPA 3S88L 2A6KA 2QLVB 4AM0Q 4XMTA 1PZBA 2OYLA 5L0QB 4KI1A 2BSCA 2B2XL 1ZHBA 4JRYB 2ZXEB 1JPTL 1PYWA 2YGQA 2HRPL 1XR8A 1ED3B 4PJ9B 4BKSC 4CVZA 5JW4Q 4Y19D 2IMNA 3BGMB 2RGSA 5CZKA 1SEBB 2PXYC 3MOBL 2OMNA 2ERJC 4YSPA 2X4QB 1IAKB 2BC4A 2YR3A 1M7XA 4Z77A 1T7ZA 1ZSHA 5FW7A 4HA1A 4MA7L 1O9ZA 5I74B 3PWUB 2F53D 4TVSa 1GS7A 2DM7A 2R2EB 2HT3C 2XV2A 4RQQB 4X6BA 3Q43A 2CLVA 2VLKE 3PPEA 2ADYA 2A9BA 3HZ3A 2D4FA 3WXWH 2X89A 4FQXC 2F7OA 1ZGLM 4WHTB 4I0PD 5GS2D 1AQMA 1BBJA 5EN3A 3GJFK 2F19L 1INDL 4Y7MA 2D3VA 1OW0A 3X11B 3KDPB 2XTLA 4JANA 3VA6A 4Y4KA 3WNIA 2NW3A 4L9LB 4TLSA 2EYTB 1NOFA 2R4SL 5DZOA 5T8IA 3V0HA 4OR1A 4TPRL 3DPBA 4NPYB 1SYVA 1J11A 2B1AH 2W07A 1P7QD 1WT5A 1RU9H 1CFBA 4L4TA 2P7TA 4JKWA 3BUIA 4PRHA 3ZE0E 4UDUA 3DDFA 4NAMA 3SZ6A 3P0VL 3EZJB 1LM8V 1N64L 1MQ8A 2AJYH 4PCTA 2H6UA 3PP3K 1KJVB 1KCUL 4RGMC 2DW5A 5EORL 2ADGB 3ENEA 1BOGA 3RPIA 4JPWH 2I27N 4R6UA 1SF3A 5I0DA 1A6AB 4X7SL 2CU9A 1GVIA 2K6WA 3GYRA 3MGAA 1MAKA 4JM2F 4OKDA 3QHZH 2JB6A 4FQ1H 2AERT 3EJYD 4ALAC 4P46B 3ERXA 2Z91B 1BZ8A 5CWSA 4NQCB 1BMZA 2X1XR 3SODB 4ZFFA 2XG5B 4CC0A 2VR3A 3LMJH 3W81A 4MXVE 3T4YA 5JPNB 4M4RB 3DURA 2YMXL 4KHTL 3RZWA 1W0VA 2WYTA 1N59A 5CZXD 1MCSA 4Z3TA 2X6VA 1UC6A 1G7PB 5ERWA 2BCKB 3QIWB 2OJZL 1E2ZA 4NHCL 5D71L 4OI8A 4P04A 3ZE2E 2VMEA 1YN7B 3MA7A 4OJYA 2AJSL 3DC0A 3BO8A 1TIUA 5SV3A 1C16B 4PWHA 4EN3D 5DS1A 3T1FA 2YO3A 4OGYH 1X7QB 4W93A 3B6SB 1OAXH 5E8OB 3OXSA 1ZA6A 2EH7L 4V2BA 1L7IH 5C0AD 3NABL 4MXWL 3V4PL 1UACH 3BEVA 3FTVA 1ZE3H 2J5WA 1QOKA 5C0JB 4M61A 3I6SA 1PZ5A 4XNDA 2X1PA 3LNDA 4ZSOB 2VDKL 1HIMH 1NAMH 3ARFC 2DPKA 1A7QL 3PL6B 4WCYH 3LRSB 2JIXA 3KPRB 4A37A 5D7IA 5JNYA 1KCKA 3QYCA 1B6DA 3KE0A 2WVTA 1IAMA 1RSFA 4GQZA 1U2YA 1MLBA 2OLDA 3A6BL 4FFWD 3UTTD 3E9UA 1BIIA 3ARGC 3AY4A 4LF3A 5DZPA 5I30H 4XX1G 3SQBB 2C3HA 3HN5A 3MCG1 1RUQH 3H42L 1OF0A 4YHMH 3Q0HA 1AHWC 4B96A 3EOAB 2Z8SA 4G7VL 5I8KL 5L8LB 1TO5A 1SY6A 5D2NC 2V2TA 2VN3A 5D72H 4FA7B 4G83A 4QKTA 1WUNT 4XP5L 4FFTA 4XCFH 1AFVH 4EI5C 1F2QA 3K6NA 4JDEB 2HTKD 5EA0H 3VXRA 1D5MB 4Z3IA 2XFXB 3NESA 1I53A 3A0OA 3EG9B 3K0WA 5FYJU 5I1DB 3D2UB 4KTDL 3QEHA 3RZCD 5EEVA 3BD5A 2EXWD 5I1JH 3HE7D 1LL1A 2PXYB 5DEFB 1ECYA 1VZGA 4XPAL 5D8JH 5AVYB 3UZQB 2O5YH 4J8RA 3SPVA 2CSPA 4NUGL 5ESAB 3PABA 5KYUB 2YN5A 3K6DA 5FHBH 3MREA 1BX2B 1NC2A 4ZUUA 1GZQB 4POZC 2OPCA 3NZ8B 1UOLA 5ABDE 2VAAA 2BSTB 3IJHA 1AXTL 3CXHK 5CJ8A 32C2A 3VAEA 1B4JL 2E56A 4XXWA 3V0VA 4PGDB 3VFTB 3EJPA 3N42B 3BZEB 2P4AB 2BO0A 4LLDB 4YHIB 3G04A 4UV4H 1EV2E 4K7PX 5I6NA 1G7MB 5FA3A 3UBXG 3UBGA 3WD5H 3F7VA 4AJWA 5ITBH 4CC1A 4JNXA 1AZBA 2DQUH 2MPAL 4FQQA 2J7LA 3PV7A 1BGXL 5I9QC 1WIUA 2BP5M 2RD0A 2NNXA 3CPUA 4G71B 5EIIG 3ZJAA 1OD9A 4K3EL 1B2WH 2NUTA 5C0CA 1NDGB 1CF8L 2AKRB 1ASOA 1A1OA 3HMXL 2WQWA 3WN5A 4F7PB 5IBUB 4XN1A 1P6FA 1HQ4B 2IH1B 3TXAA 5EU3A 1AXIB 2FGWL 4QOKE 1M7UA 4DTGL 1S7XB 1YYML 1S7WA 3FT0A 5F1NA 2I9LA 4JPQA 3HLKA 4MD4B 5DWUL 4N86A 4Y88A 1OTTD 1NCBL 4N9OB 3D50A 3KHQA 1MRFL 1CR9H 1Q0YH 4ELDA 1GC1H 1U8MA 4HCRA 3GMMB 4O58H 1ZWIB 3OR7B 4GINA 3CX2A 4QT5B 5GGRA 2HFFA 3I6KB 3CZGA 1SY6H 3KYAA 3ZDZB 1GCFA 4CSSA 4MCZB 1L9OA 2JELL 3N43F 2DQFB 3LN4B 1MCDA 1OQOA 5EIQA 1I8KA 4BE5A 2RCSH 3PHAA 1IC5H 2HUEA 4EDWH 3S98A 1N10A 4PP2A 3FB8B 4L8CB 3EYFB 1L9SA 2Y5TA 4MNGE 1S5IH 3H9SB 2CPCA 3J27A 2NXYC 4NERA 2D7PA 4E41B 4YHNB 2IBZY 2CO2A 4ELKA 2YBRA 4OD2A 3UTSD 1KPVB 4TLKA 5KEZA 5B1JA 4MLSA 5C2BL 2EDYA 5I6XC 3TWCL 5LBSA 1GS8A 4XO9A 1PQZA 2FJHA 2WXJA 5FV2A 3GSWA 1UT1A 4CVXA 3NJXA 4X98B 3EOTL 4HDIB 4LIQE 5SWSA 3RRQA 5HHVH 1E4WH 2EXYD 4PJBA 2LFGA 3UAJD 4ETQA 1TCMA 2QKSA 4UZSA 4GRWF 1DO5A 4HLZH 2E9GA 1BQUA 2A74A 1A3LH 1WAAF 4ZD3L 4X7TA 2LU4A 5BPPA 3GBNH 2DLTA 5D70H 1HXYB 4X6CF 3RDJA 5DYFA 3X3FL 2Y6TE 3II2A 4F92B 3ARGB 4K3JL 3RVTC 2MCMA 3IF1B 2CG9X 4BD4A 4JFDB 1I1YB 3N04A 1F97A 2NUPB 1AHWB 4OU3A 2VDNH 1G0DA 4FS0A 3ILDA 3U6RA 5D6CA 2JKTM 4UMGA 3BQUA 5D2NB 3F58L 1MI5B 3PNWB 3OKOA 4HPOH 3U9PH 4U1HB 2OKMA 1E4XL 3ELAT 4WFGD 4TOYL 2MKWA 1VKXB 1L0XA 3HNSH 1IGCL 5J13C 4YSRA 3FTZA 2CNYA 4FG6C 1BCIA 3N2JA 1IB5A 4NB7A 3ZHLA 3ZOAA 1ZGLB 3T0EC 4M8RA 4P3WA 3LKOA 4PYGA 4LIQL 5K1NA 2DKMA 2DTML 2X44D 3BAEL 4BZ1L 4HCRH 4G8EA 4HIXH 3BKML 5AW4B 1O7DE 4KXCA 2Q86A 4X80H 4BCXA 1IAIL 2E6PA 3QP3A 2JB5L 3G5XA 3MZTA 3ETSA 4Q9QH 2VC2L 2BZDA 3RVVD 4DEWA 2C4XA 5GRUL 2ZF9A 4JFEB 1WZMA 2XVLA 2KPNA 4LCYA 5CZVH 5JORA 3KBEA 4PJ7B 1N4XH 4PB0H 4EUPH 2K70A 1BZEA 1QI3A 4ORZC 4OZHA 1GYCA 1RI8A 5JOPE 1MFCL 4GAFB 2AMUA 1QO3A 5AQ0A 3RJDA 5GZOD 2P5EB 4OJDH 4ZFZB 4G8AC 3JT2A 3OKMA 3NBNA 2MPVA 1LJMA 1JZIA 3S5LB 2F7PA 3X1FA 3GKWH 2WANA 1JNHA 1KPRA 5LBSH 1F0LA 1FDLL 1JXKA 4JDTH 4X5PA 4IRZL 2LOEA 1T0MA 2ED6A 2H47C 4PRDA 5TQ0H 2ESVB 3KPSE 3RAJL 2PCPB 2ZPKL 5I9QB 4H40A 3UYRL 5IJBC 2HJLA 4MCNA 2B0SL 1UWGH 4OW6A 1HT6A 4PRID 3QWRD 4B9IA 1PLCA 4YDLB 4Z7OB 1HI6A 1IQDB 4YZFE 2IAMA 3NZSA 2DIEA 1FZOB 3CHSA 4R8WL 3WXVL 1BXVA 4LSPL 2B9AA 4TUKH 4V1DA 2JMRA 2MEJB 3RX8A 3TFBA 2DKSA 3W38A 2RIKA 3OM3B 4JX0A 3RFZA 2VM4A 4I0KA 4Y0GA 5EU4B 2FQEA 3EGSB 1CXEA 3QJRB 2HLFD 4F3FA 3MO1A 2BHUA 1G84A 2MMXA 4UM9B 2OMXB 1MW1A 3BEWB 2W95A 2QQLL 4OLZH 4L4VA 2PPCA 4W6XB 2ADFL 4XB3A 4P4KC 3AXLA 1DBKH 1AP2B 4NQDB 3P9MA 4IIQA 3TT1L 2XBDA 2H5UA 2G2PA 5JYMA 1P5UA 1BPVA 1UOKA 5AZ2H 3MLZL 3NP3A 3QUHA 2IGFH 3DVNB 3Q2VA 1DQLH 2A2QT 1OSYA 3QIUC 4K2UH 4MD5A 5BS0B 3GJFA 5CZRA 5FXCH 3THML 2H32B 5JXAL 2YSSB 1I1AD 2X2JA 4OH2A 1COBA 1JD9A 4PJDF 2PABA 3LV3B 1AO7E 1PKQB 3VGGA 3S37L 1A6ZA 2H26B 3QXDB 3NTCH 3D4GA 1J9CT 4LCIH 1IGML 4AKPA 1KIRB 1RH8A 1GTFA 4MZ2A 3KYKH 2KS0A 1D5BA 2KERA 3OMIB 2DMGA 2GIMA 4XXDA 3V0WH 2XJKA 3WE1A 2WOBA 4TNEA 5C07A 3NIFF 5E94B 4WEEA 4J2XA 4J6RL 1BVNT 2Z0BA 1LP9E 1UA3A 2CBPA 4NQEB 4MA8L 1HEZB 1NFDE 2YEZB 2NNAB 5HPMA 3JVGA 5AOKA 1VPOL 2FEDC 1D7FA 4CW1B 4D94A 4XN7A 2P8MA 3HI1A 2VLME 3GXFA 5HI5C 5GISH 3GIVB 3W3BA 3V8CA 1HWHB 4OIFA 2PMZA 4ZPVB 3P3TA 2APXA 3H85A 1RUAH 3P0YH 4FTVE 4HWNA 4L1DA 1XGYH 5C8JA 3O6FD 1KT2A 3VFSA 1TUPA 4WTZG 1F4YL 2VMJA 3QDJA 4FYQA 3LQAL 5EN2B 1PPIA 1L3WA 1E3XA 4YAQB 1FORL 2APBA 4HIHA 1GJUA 1NCNA 3FRUB 3GO1H 1FE8H 3NSYA 3CIQA 3IXAA 1V27A 5CU5A 4PM1A 3TJHD 2ZUSA 3GRWA 3QWNA 3GM0A 4WU5A 2XA8L 3K5RA 4P4RB 1OCRB 3RGVD 1EMTH 3F7QA 3RL2B 3PWVA 4JQXC 2JQMA 3VYPA 4LLUA 4NCC2 4WTXA 2VZTA 3C6LA 1VACB 3AWFA 2CO7A 4PJ5B 4YHPB 1T22B 1H3UA 2VXVH 4RFOL 4YSEA 4XCYB 3DETD 3U30C 1QYGH 3RWCB 5J6GB 3S8FB 5I8EA 2B16A 1MJUH 1JF5A 1TZGH 4QRSB 3RY5A 1K8IB 1UZ8A 2VZSA 3BGAA 4YGAB 3U0PA 2W94A 5DD1H 1RFDL 3CXDH 2FO8A 4U05A 5KWYC 3O0RL 4X0KA 4FERA 1N8ZB 1EO8L 2FE0A 4Y4KC 1QSED 2DWXA 3IN0A 1H8LA 2OULB 3DO3A 5DFWH 1JZJA 5SWZE 4HV8B 5TK2A 2FO4A 1OHQA 2K7PA 1I9JL 2MQCA 3POCA 5E8EB 3GJFH 3MC0A 3ARBD 1WT5C 5IW3A 1IGYA 1PLBA 4YHLH 3MI6A 1EEYA 3BJ91 3CFIC 1NL0L 3GXMA 4R26L 4XP6L 5I2IA 3GMRB 1RZKH 1KY7A 1XFPA 1AY1H 5IHZB 4K15A 3MV9E 5TGBB 3M7FB 2JJSA 5DZAA 5I1KH 5LVEA 4PVLA 5HHOA 5FS5A 3EXLA 2VO8A 3CFKB 4AMKL 1DJIA 4QCIB 5EBGA 2B2XH 5DJ2B 3C75A 5ADOL 4HJ0D 4LVOC 1JPTH 2IIJA 2V2WA 3V4VA 2VITA 3HUJB 3HZMB 2HRPH 1YEIL 3ZYZA 2HWZL 3QORA 3E6HA 1LLAA 4P06A 3X14A 3EH5B 1BD2E 2FWLB 2X6CA 4NQVB 3MOBH 3WUWG 3PP3H 1A21A 2WWNA 5E8NB 4AYFB 1AHMA 5IFJB 2OMYB 1WIPA 3MODL 3F7PC 3GD1C 3WGUB 3H7BA 4IU2A 3A24A 2XFGB 3QUML 5D1ZA 3D87B 5CCGE 2QHRL 4UOZA 5F1OB 4JY6A 1NWOA 4L1HA 2V7HA 1N3NB 5DMIL 3LDBC 3DHPA 1URZA 4U6TA 5JW3L 2HP4A 3ZIYA 3H9HB 1Q9KA 1BQSA 2XIBA 2VL5A 3N44B 5EG6C 4C56B 4JFHD 5FB8A 4I3SL 5EO0A 4N6QA 4P4KB 4WHCA 4KMQA 3GFUA 1SLWA 1T21B 1J5CA 1UEMA 2F19H 1INDH 3FOMA 3CBJB 3FQ4A 2RQEA 3EHBB 4HK0B 4YSCA 1HHIB 1UM4L 4N4YB 4L4JA 3MN8A 4OCLC 3VFMA 3IXTA 3ZL4L 3LOWA 4HOXA 2R4SH 1TJGL 3QIUB 1T7WA 4TPRH 1OB0A 4Y5YA 4JGJA 4JM0A 4GBXC 3B7RL 2HCZX 4MGXA 1BXXA 4TNFA 5ALBL 3VWKB 5IB2B 3B2XA 1IBDA 2F1EA 4HZ1A 3MCKA 3P0VH 4FI7A 1N64H 4M1DH 5F9OH 5EU7E 1E4KA 5A16A 2F08A 4N0YL 1KCUH 2WTRB 5EORH 1IBYA 5FKPB 3UBXB 1JDCA 1KZYA 3V5DA 4NPKA 3AY4C 4C4BA 3BPNB 1XGQB 4X7SH 2Y7LA 2K8QA 1OE3A 4BFEA 4ERSH 3UO8B 4JFFD 4RIRB 1FYTE 4EZLA 1AKJD 4PGCB 3MV7D 4A6YL 3K74B 5LB1A 1JN6B 1VSCA 5EIIB 1BXAA 3BUPA 2V0AA 3L1FA 1LE9A 5EC2A 2VZUA 3ZQXA 3TCLB 2MQGA 4ZAKC 4HOMA 2Y24A 2YMXH 4BA0A 1SZNA 3BVVA 4JFVA 4KHTH 4RAUB 1UWXK 5EFIB 3IDYC 3CLFH 2X12A 4Z5RA 3OLGA 3A4AA 1R3LA 5JLZA 3UJTL 1EXGA 4NHCH 5D71H 4JVPA 4PRPB 4HAFA 4C83A 3ROLA 2AJSH 2WQVA 2OJEB 1FNLA 2BNRE 3ZHFA 1S9YB 1QP1A 1YNLL 4Y1AB 2ZXAA 3TTYA 2EH7H 4NZDA 4YUEL 4JDVB 4BFIA 3NABH 4MXWH 3V4PH 3TNMA 2E7HA 3WJJA 1BFVH 3FXIC 4FQIL 1ZLVK 1BMWA 3TEYA 1SN0A 2DL2A 1JG9A 1W6WA 2VDKH 3CSFA 3H9ZA 4B53A 2E27L 4HGKC 3N9GL 5JHLL 3TN0D 4PUBL 4UIKL 3ZKXB 5FGSA 3ESNA 2C26A 3Q3GA 3IYLW 1KZQA 2DM3A 5KAQG 5MENE 4I48A 2IDQA 3DJZA 3PIQA 1OCOB 1AGEA 2ENJA 2OZNA 3A6BH 1OKEA 3UTPE 2PPDA 3RLSA 4FNTA 4Y5VC 1INQB 3TPUA 2H1LM 1E5ZA 3T0VA 3T3MF 1WE5A 3MCLL 2AAAA 3ABLB 3MNVA 5L2JA 3H42H 4UZGA 4UQ3B 4N3UA 5E2TH 4R90L 4XNAA 3HOGA 1BOYA 4R7XA 5EUOF 3OBAA 4G7VH 3L2LA 2J5LB 2WAQA 4KKCC 4WUKL 3IDIA 2C4FU 4QJ4B 5HGDA 1MFUA 4XP5H 4S11A 3RB5A 3WN5C 4EVNA 4GO9A 4HVBA 1XF2B 4DP2X 5CSZB 1KIUA 5FGCB 4KI5C 4PW4A 3Q5TA 4KTDH 4QRRB 2BWQA 1T03L 3TEXA 1MOEA 2WLLA 4XPAH 4TNVF 3CDYA 4NUGH 4ZOEA 4FYRA 3SQRA 3GXIA 2YRLA 3ESOA 3BPCA 1X7TA 3C9NB 2Y69B 3MRCB 3X17A 2NLJB 3LDBB 4YHZL 1K3IA 1AXTH 1B4JH 2DQDL 4Z7QE 3G5ZB 2YIHA 1BQHA 2EYRA 1S5HA 3L7EA 3FSOA 3IM1A 1EA9C 4JJOA 5HI3D 4DZBA 1FSKC 4FFYA 2GJJA 4OGQC 4MYPA 1WFNA 4ADIA 1JCKA 1S7VB 5L8KB 4UBDD 3GNML 1A6VL 2VR7A 4MCMA 2XXCB 4WJ5A 2G2RB 3RWIA 4KHXL 2MPAH 2ARJB 4CU7A 1YECL 2PCFA 4IRSA 2HT2C 1BGXH 1LGVA 4GBXB 4IS6B 5E8DL 1DDHA 3UTQA 4RISL 4PRNB 2PW2B 1QAWA 5DDHA 4KY2A 4FJ6A 5EZJA 4K3EH 1HK6A 5BW7A 1SOKA 3PXHA 1CF8H 2A74C 5GRXG 2ZCLL 1NBVL 3HMXH 4MNQA 1NZRA 4PJFB 2J25A 2NCEA 4CRPA 3C60A 4WUUA 2QR0A 4JKMA 2FGWH 4DTGH 2HG5A 1RP8A 4LPYA 3KH3A 3AFLA 1G6VK 2LAAA 4X8JA 5IVXE 5DWUH 2NSMA 3S3SA 1MRFH 2CHDA 4MDJB 3FB7A 4QTIL 5FFGA 5DK0B 4PJAE 3BWAB 3VFNB 3ULSA 2N0KA 3I2CL 5C0RL 1Q9LA 4HUXB 3CCHA 2J8OA 3EKCA 4JPIA 2JELH 3RKDC 5I8CA 3NK4A 2BNQB 2G5BB 2OSXA 2XVGA 3FQWA 3LKPA 3VI3E 2C34A 5INDA 4BH8A 1RJLA 4P8QA 3FF7A 3APMA 4ENZA 2VDPB 1K4CA 4XZUA 4QXVA 2RFXA 1M42A 2EYSB 4G7YL 3HNTL 4PJ6A 3OGCA 4K8RL 2E8ZA 2OR9L 3L5IA 2RH0A 3CH1A 3PDOA 4XNZB 3RTQD 2NR6A 1KTDB 4LHUA 5KOMC 4GKNA 4KKBC 4NRZA 4P3CL 4IRZA 1HJBC 1NIBA 5AZUA 4R4BA 3KPLB 3O4LA 3EOTH 1AQDA 3QJFA 4G9FE 1NLBL 4XMKL 5J4MA 1IZKA 3IKCA 4Z3JA 1PG7X 4NT6A 1GW0A 5FKAB 2NRDA 5IJVA 4GH7B 3TCXA 5K9QI 4UQBA 1KENL 3EBHA 5TJWK 3SDXE 3HC0B 3QCTH 3SDAD 4D9RD 4ZD3H 1K8DA 1G6RB 4KO7A 4OUUB 5HHPA 1P7HL 4Y5VB 3CFMA 3T1WA 1MCPH 4K3JH 1AYRA 1EUTA 3HJ0A 1IM9A 3CFQA 3BDBA 4K94L 2E4TA 2G4EA 3D30A 4KJYA 3K6SB 4S0HA 3DA0A 2UZYB 1TETL 3MJGX 3X13B 3BMVA 1UD6A 3TLRA 5I8OL 3CFTA 2NY2D 2CHWA 3F58H 2EKSB 1YMME 3L45A 4RGNE 1TDQA 1J48A 1E4XH 4R4FL 4TOYH 1OEZW 3O11B 1KLGA 1IGCH 3CUPB 5DJ0A 1GTNA 4ELMF 1XO8A 1LK2B 4F5CA 3S36X 2F8VA 1E5UI 4TNWK 4DO5A 2LR4A 4XTRC 1QLEL 5DI8A 2EDWA 2UX6A 4WHDA 1UASA 3Q06A 4LIQH 2DTMH 2WLKA 3BAEH 3KPSA 4N8VG 2Q10A 2UZXA 4BZ1H 2N7BA 4HK3N 5H35B 1DR9A 3BKMH 1O9VA 2WO4A 5DQJB 3ZR6A 4F7TB 4NN5B 1IAIH 3GSOA 2JB5H 3MX0B 2VC2H 1NM9A 1Y07A 1FO0B 3L3KA 2QPDB 1P5UC 2CRIA 5GRUH 3MLTB 5EU6E 5F7DB 3H4FA 3NUKA 3RB7A 4Y9EA 3APFA 5T1MA 3F62A 4DUVA 1MFCH 2XIDA 3QNZB 3QO0B 4DGIL 2AS5M 4KK8D 3JWDL 5PAZA 4OLXL 1A1NB 1CFNB 1FV1B 5J06A 1CQYA 1RUML 1TTCA 4LLYA 5IV2B 1M56B 4IGBC 3P0GB 1JZHA 1E4HA 2HA1A 4PBXA 1FDLH 1LNUA 5JDJA 2PYEB 4IRZH 1DN0B 3RAJH 1MREL 2ZPKH 5KSAA 4HXAL 4JM4L 3UYRH 2M2DA 2B0SH 1NEZA 3C8DA 4KJWC 2DQEH 3L4CA 4U7SA 3VDAA 4IKIA 3L95B 1SLUA 4YZWA 2H6PB 1HOCB 4R8WH 4AYSA 1HVXA 2WSKA 4LSPH 5D1QD 4NS0A 3VXNA 5IOPA 4OCSL 2YJQA 4GAAA 3ARWA 5BRZD 3JVGC 5CF3A 1WCBA 1X5LA 2AITA 4G5ZH 1EHNA 5DJYB 1AO7A 3PV6A 1AQKL 4JE4B 2NY1D 3NJLA 1T4KA 5TTRA 5GRZA 5IQMA 5FYJL 2Y7QA 2HB0A 4U33A 5DQ9A 3QWOA 3LH2L 5TDOA 2QQLH 2WVVB 1IBZA 3T4AA 3WUWB 2ADFH 2O26U 3TX4A 4A7GF 3LKSB 1SXAA 1LP9A 2KDGA 3NZHL 3CSBA 3TT1H 2YGNA 3MJWA 4QRPD 1NFDA 5LGJA 4AGPA 3QDGD 1KXQA 3AXIA 5LXGL 5T1KA 1KXVA 5E6ZA 3MLZH 4PRAA 1SJEB 1YPZF 5SX4I 5IKCB 1OSZA 1WD8A 5C6WH 1LEIB 5G5DB 3SHSA 4HH9B 3O6LL 5HDRA 1E3ZA 2WWMC 1URIA 4HT1L 4DH2A 5DHVB 1TKWA 4NYLA 4CGTA 1U8LA 3BP5A 3NPSB 3PHOA 4ADJA 5JXAH 5B39G 2OXHB 1TFPA 4IKKA 1BQHG 3V0GA 2FATL 5GS0C 3C5JB 4GG6F 1HXMB 3ZDYF 1J88A 1QLFB 3FRPG 2VMCA 4YDVB 4KQ4L 5HI4D 1G9NC 3TO4A 1D6EA 1IGMH 1AR1D 5B38B 5HYJD 2HT3D 1JF1B 2QDWA 2AXFA 2ZSWB 5JIDA 2CIIA 1E9PB 3CFCL 4XOBA 5I19L 4N2LA 4Y16A 1B2YA 4ONGH 2XWZA 4J6RH 1AANA 3BP4B 4FQXD 1LEKA 2DEYX 3WTWA 2QFPA 5C9JB 2FJUB 2X38A 4MA8H 2EEDA 1HESA 4S1DC 3U4BL 2P5WA 4NNXA 3U48A 1KDJA 5GSRA 4HC1L 4I0CC 1DTUA 1VPOH 1SDAB 3MTXA 1EFXA 5EEWA 2JJSC 4MNHA 1KJMA 2NY5C 5LCVA 5IMKB 1TU2B 4ZXBA 3BXNA 1XXFC 4H0IA 3VXUE 1L9NA 2W9EL 3LVEA 5DS8A 4AW7A 2R0WL 5T1LD 3NIDB 1A3RH 3WL9A 3H6AA 4HZLB 3TBSB 4UUJB 2IXQB 2VGLM 5SWZA 5I5IA 4HGWA 1M05A 1F4YH 2FIKB 4U1LA 4L8BA 5C70A 3MV9A 1YZZA 3B3BA 5D1ZC 4K07A 1T7XA 1HWGB 3J07A 3GMNA 5AL8A 1JPGA 3D08A 2KZ1B 4P2RB 2PW1B 3MRLB 4U2YA 4RFOH 4XPGL 2WJ5A 2EVFA 3ZDXB 1PX4A 3FCSB 3QZMA 4WFFE 1OAZL 4PGBA 3EYVB 3CVBA 4G5AA 2Z4TA 3HG1B 5FO9B 3VFPB 2XYBA 1EO8H 2FLRT 2ENQA 4NC2B 4Q9BA 2DWYA 1UATA 5ENWB 4Y5YC 4Y9FA 5CEYB 1I9JH 3UP6A 2JKRM 4PTTB 5IQ9A 2A4EA 1K2DB 2Q3XA 4HETA 3IDNA 1G5AA 2EDOA 4R26H 4XP6H 3QEQB 4H8HA 2J8UB 4HQQL 4MWFA 5DJXB 4ZW6A 2BIHA 1IARB 3JV6B 3A4FA 3UYPB 4IGBB 5DJAB 3GMPB 4N8UA 4OAWB 3A4EA 1OT2A 4Y5XB 4AMKH 3SDCC 4MCYA 3ARFD 2F74A 5EO1B 2PCYA 2ZXGA 4WF7A 3DV4A 1P1ZA 3P02A 3PQYD 1NGXA 3S3PA 2LU5A 3D4CA 3D39A 2HWZH 3HKZA 5I0YA 4U6XB 3PGCB 5FM5M 3AAZB 5HHQA 3I9PA 3VXSE 1U3HD 1KGXA 2RA1A 3MODH 5TDNB 5FR3A 4I85A 4U1SB 2KQNA 3MBEB 1ET5A 4C4UA 3ARGD 5C09B 3VFWB 3QUMH 1MHCA 1KBPA 1ZHKB 2QHRH 4HUMB 1MHEA 1QMUA 4TL5A 2VABA 4ZS6D 1EK3A 5LCVH 4PJCF 4J3OG 4TVUA 5CJBA 3EYOA 5E00A 5JW3H 1NBZB 2IBZX 5B22A 2AP2A 3T5WA 3MFFB 3Q01A 1THCA 3DWTA 4PVBA 1RZFL 3TEWA 1R5VA 2LLLA 2F54B 3T65A 2O6EA 5JA9A 1UWXH 5KANG 2V5SA 2F53E 2XQYA 5BO1L 4JAMB 3NSDA 4EI5D 3RWEB 4D3CL 5AW8B 4LOUD 4UU9B 4AQZA 1HILA 4HIIB 1UM4H 5J5EA 5DSCA 3PXLA 1ILSA 3ZL4H 1JXGA 4FG2A 1TJGH 1WBZB 4XPHH 5FK9A 4XBMA 2BVEA 4ODUA 4P5SA 3WFHB 2IG2H 4PJGB 2GT9A 2FWSA 3UG4A 4X8CA 1UADC 1A6TA 1NM4A 3JWOC 2BNRA 4DEUA 1MFAL 5ALBH 1ZLVH 3FK3A 3DARA 3WHXB 4GRWE 3DROB 2ICES 2VLJD 4X42A 3NFNA 4N0YH 1I31A 1WAAE 4W9HC 4YO0A 5IQLA 4DP7X 1BAGA 4JFED 2FDBP 2E6QA 2IAND 4POZD 5SX5K 4DOHE 1I7RA 3H55A 1FG2A 3QSKB 3AADB 5F6HI 1MUJB 1DVXA 2C9RA 1XH1A 3RNQA 3QULB 3V95A 4JZNA 5EO9B 3H7LA 1O7VA 4A6YH 2DJ4A 3KXFD 2QL1A 2FH6A 2O61A 3N41F 1NEZG 2XWTA 2AXWA 2DQ6A 4M6NL 5J9PB 1GA2A 2X4RB 3HZVA 2VDQB 1AQ8A 3TO2B 1GYUA 1C9SA 4FOMA 4XWOD 5DCCA 3I9AA 4HISA 1MH5B 4C55A 1GKEA 1I8AA 1RHHA 1BM7A 2P80A 1BXUA 1WBYB 2BSEA 1CG9A 2OA9A 3ASNB 4LCVA 1NOLA 3TEZA 4MB4A 3GEFA 1R17A 1YNTA 2YD8A 1YNLH 5E2WL 3R0MA 1LQBC 5KSUB 4YUEH 5LNEA 3T09A 4FQIH 5DJDA 1XZWA 4YWGL 5C0DA 3RDTB 4APXA 4GKZB 1I3VA 4P2OC 3D85D 3JWNE 2FD6L 2D73A 1JTTA 3N9GH 5AVSB 5L4JA 1HC1A 5HXMA 1XZ0B 2XN9B 4PUBH 4UIKH 1DLHA 1HSBA 1V54B 5CU9A 3D51A 3QFGA 1HHGB 3NCCB 2DTSA 3FQRA 4IMLB 1OF2A 3TBTB 2IF7A 3VGFA 2IQAA 4HIEA 4PJXB 1T04B 1B6UA 1WGVA 3MV8B 5A1AA 5E6YA 1KLFB 3KD4A 4ODHL 1Q1JL 3RVUC 3ZR5A 2YD0A 3BJLA 2AQRA 3IDXL 4QIRA 3MCLH 1PEWA 1BP3B 3KPNA 2UY7A 4ZUSB 3IMVA 1F6AA 5EEYA 1QNIA 4R90H 5JQHC 1CMOA 1A4CA 1U42A 1CD1B 1RK0B 1XX9C 2EDRA 2NXYD 5DC2A 4GW5A 1K6QL 1XGUA 3GK8L 2UV3A 5IG7B 4WUKH 5CHNA 3OAZK 2E47A 4FNPA 2EO1A 5EBWB 2A1WL 2R1XB 2X7LB 3RURA 2CWRA 3EGXA 3GIZL 4NKOB 3OMAB 3C60C 2J3SA 4XPTL 3RWDA 4KKAC 4L0ZA 4KXBA 3SDCB 5MHSD 3EO1A 3VWJD 3C08L 4N5UA 1ZLEA 1RZIA 4AOFA 4DGVL 3EF4A 1RZQA 1AZCA 4YHOL 3C2AL 1OCCB 5IB5A 3WIIL 1T03H 4KV5F 3U7YL 4RMTA 4M5TA 5D93C 4F2ME 2HJFA 4G1EB 3MV11 3I6GA 1AGFB 4U6VL 2PR9A 5BOPA 4K3HA 4KO6A 2B59B 1K5NB 1M7IA 3B9KC 3E6FB 2CDEB 1JZDC 5DMGD 4BCYA 1X5JA 4EI6A 4L29A 3G7TA 1L0PA 4YHZH 2A6JA 5FFLA 5AOLA 4H13C 2A0LC 4N8VB 3P4NB 4QTHB 5INCB 5IVXA 1PD6A 2BRRL 5IROD 3PE9A 3PJSA 2W9DH 2X1QA 5JW4N 4PJAA 1KB5L 2OW7A 4ODBD 2BSBA 2XV0A 1KCRL 1U8IB 4L2YA 3H4HA 1BM3L 1ZTXE 2J72A 2NXZB 3BVUA 1F11B 4ODXB 3GNMH 4KH9A 4PJDE 4DZ8A 1A6VH 2PR4H 1PNCA 4PCYA 3QG6A 3T0ED 4KHXH 4NNPL 1YECH 1IVTA 4OZIA 3NIGE 5E8DH 4E9WA 2R59A 4XRCA 3SQOH 5AYTA 4JRFA 4W1TA 4RMUA 4ZUVB 3SDDC 5IVNA 2EVGA 3DSFL 3MSPA 3NIFE 4D0BB 3L1OL 5CJOL 2ZCLH 4EIGB 1NBVH 4G8IB 3ZUCA 1A1MA 1NMBL 2A4CA 1Y1UA 2UXTA 2J57A 5JHDE 3V6OE 2CALA 8FABB 2P46B 5ICYA 5E1AA 3BWSA 1PSKL 4MJ5A 4MKTA 1U92A 1DQVA 1NC4A 2AV7A 3R4DA 5PCYA 1JZ7A 1X3DA 1RK1A 3ARDB 3BZFA 4OVUA 4UNIA 3N06B 1T3FA 2F5BL 3G6JA 4BKTC 4U6YB 5DUPL 4ZO9A 1CYXA 4BK5C 5C0RH 1DBBL 3I2CH 3DX4A 3P40A 2CRYA 5LN8A 5DJ8A 1EERB 5HVHC 3OF6D 3MPCA 3ZHNA 5BQ7A 3D0AA 2F7IA 5IWLC 3D5OF 2K7QA 1BIHA 1D2OA 1O7SA 4JRXE 3SYQA 5A40E 1UOVA 2QHLA 2Y1ZA 1D5ZA 2QVTA 4TUOA 3HNTH 4J3WA 4N9GA 3CV5A 4K8RH 3GJEA 4B3VA 1JGDB 5F88B 4U6HA 1R5WB 2Y2WA 3BVTA 1U8CB 4HHWA 3IDMB 5CILL 4CBPA 2GTQA 4EIZC 1LO0L 1YMMA 4E9LA 3ESPA 4P3CH 4P2OB 3LXAA 1SMDA 4AMXA 3BAIA 1N0XL 4XMKH 3APNA 3Q8FA 3UTSE 4XNBA 5AW0B 5B4MC 5DD6A 4DAGL 2C7FA 2YHGA 4Z7WF 1KENH 3QUXA 5DMJB 4GNKB 1OD7A 1YG9A 3FT4A 5B39B 3GMQB 4ZTPL 3CC5A 3HAEG 2YQ3A 2CMRH 4WNQB 4A2MA 4MASA 3FH7A 5GS1C 1O75A 3FRPB 3FTGA 3CSYA 1M1XB 1CFTA 1QATA 4MZ3A 5L2KD 4OFYD 1YQ2A 2N7AA 3OHMB 3ZZ1A 5F1IB 4K94H 4KY1H 3LEYL 3ETBJ 4L8SA 4JUTA 4PJIA 1TETH 5L4IA 5KSAC 2YPLA 1Q38A 2LV4A 3HCVB 4GAYA 3KDMA 4BDVB 5I8OH 4W4OC 1HH9A 1ZT7B 2DYRB 1W2KT 4HD5A 4D0DB 1DVZA 1FFNB 1QSFA 3OXRB 1IX2A 1U33A 4R4FH 3P2TA 3QJHA 2R51A 3DMMA 3CZUB 3GXDA 3GB7B 3QQ4B 5C0GA 4MHHI 5KSBA 5HHME 1QLEH 4M5ZL 4AJVA 2VW4A 4AL8C 3LZRA 1RERA 4WFGE 2ZNXA 3EDEA 2NY6B 3ZYOA 1XIWC 3PHQA 1WLHA 1J0YA 3UTZA 4LMQI 4AIZB 1IEHA 2H2SD 1WWBX 1DQML 1E27B 4JM2A 3ARRA 2OTWB 4KDWA 1NCUA 5ITFB 4Z7OF 2FEDD 1Q9OA 3B9KB 2ICEA 2AEIT 4DO4A 1QTSA 2WZ6A 1AAJA 1OAQL 1A9EA 4WRLA 5ELIA 3FZUC 1FQ9C 5AYUL 4L8DB 1DJYA 3RFRA 4WU7A 4P2QB 1ZS2A 4PRPD 4AGQA 4NZJA 4N0UE 3BIKB 3H2WA 1U6AL 4I1RA 5DTFB 3CWGA 4X9GA 3QQDA 1H6FA 1A8JH 4DGIH 5ANMB 3JWDH 4HUWA 3S7GA 4AT6A 3K4ZA 5ADPH 1MRDL 3VD9A 1RUMH 1NCDL 2FR4B 3MRJA 4XNMB 4NO5A 3L3IB 3HW7A 4JL2A 4AQ8A 2IDUA 3I02A 2VZ1A 2VISA 4S2SB 2A38A 3K72B 2N1KA 3EJJX 2GQHA 2IGTA 3MRMB 2CJSA 4J23A 4HXAH 4JM4H 5D7SL 3PRZA 4QDGA 4UT6L 4Y16C 4FKKA 4QHMB 1CTMA 1ETJA 3MRIB 2X89D 3KPTA 2CR6A 3MRKA 4X8XA 3SDDB 3FHEA 1BEYL 3SGJA 4HJJL 4OCSH 3MRHA 1BF5A 3HE6A 5CXPA 4ODTH 4PRIE 2XKNB 4Y4KD 1AQKH 2AJZB 3WMQA 4R83A 2AV1B 4ZW5A 5CEXB 1JS4A 3QEGL 2D7QA 4HLEA 3IS0X 1MAJA 3LH2H 4NKDB 2RALA 2XXFA 3MRRA 4L4TD 5DHYB 3JTTB 3QHTC 4B9ZA 4OCWL 4EIUA 4YDKL 5F70A 2F8OA 3BT2H 3N3EA 4PRHD 3VH8A 4HBCL 3NZHH 1A9BB 4J3BA 1BZ9B 2FYYA 3U9UA 2H3XC 5LXGH 3P77A 4OM1L 1FA4A 4FLOA 4A2LA 4Z78A 1NGZB 5H94A 2W5PA 4MBRA 5TE4H 3MRPB 3DIVA 2WKGA 2X0UA 1OAYL 3O6LH 3PAVA 5CBAB 5SWQA 3ET9F 4HT1H 4N0RA 4ANXA 1QLRA 1IGIL 3CZKA 2J1ZA 4NRXB 1YA5A 3QRLA 2XXMB 4RMWA 3ZU8A 1H19A 3DV6A 1J5OL 2FATH 1MCOL 4JFSA 1SVCP 1U8NB 1Q9WA 1ZT4A 1QHOA 1A7PL 2NY0D 3LHPL 3K1KC 4JUSA 4KQ4H 1WEJL 3SOTA 3IETB 4GT0A 3G5VA 4JPVL 2DWSA 1R5IB 1XCTB 1AC6A 3QW9A 5ES4B 1HZLA 4ONHA 3MLPA 3OJDA 3L4YA 1K4DA 4F2EA 3U0TB 5I19H 4BRVA 2IPTL 5C0FB 2VLRE 4XXCA 5K9OB 2D2OA 4UWQB 2XC8A 5J1AB 3U83A 5IGXL 3U7WL 3MJ7A 3KCPA 2X4UA 1QW9A 2H7WA 3U4BH 4BA8A 5EUOE 3S5YA 4HC1H 1G7LB 5GS1B 4DPRA 2F61A 5ESQA 4YFLF 1JV5B 4H0GA 4W4NA 5FUOL 2QADC 3IRZA 3SKJL 5C3LD 4UV7L 3ECWA 4LEBA 3T6ZA 2W9EH 4Q2ZB 1ZS8B 2P48B 1A7OL 2R0WH 1U8QA 4OV5A 1VENA 2ROYA 1R3IH 4RWYL 2BY2A 2JIXD 5EZPA 3TIDA 1TMQA 4CKQA 3LIUA 3ZMNA 3S35X 4I2XB 4DK5A 2WQAA 4N2CA 4QI3A 2F15A 2LW3A 3OKLB 1NGWA 2ZKWA 4DT2A 1Z32X 2IFGA 5L7XL 1FIEA 5LUMA 3LZOA 4XO3A 2OMWB 2N59A 3BFWA 3ZTEA 1LDSA 2EINB 4KKNA 3EDJA 3HG5A 1DVFA 5FOBB 3K1DA 4GS7C 4IBTA 5HBBA 1U95B 4YBLB 3RWFB 4PS8A 1XIWB 3VM5A 5F0LB 5C0BB 1OSPL 1IEBA 2Y07H 1WP6A 4XPGH 5KG9A 2BM3A 1TLKA 4ZAKD 1LWJA 4MMXA 1OAZH 3QIBC 3VXSA 2NW2B 4LSUL 5IFHL 2JI2A 3IJ7A 2D9CA 2FQGA 5CN1A 3KLHC 2EZ0C 3TPKA 1Q94B 4LHJB 3VXRD 4J6IA 4Y4HB 2PKDA 3T71A 3RL1B 3SJVE 5DRNA 1RV6X 4YXKL 1H3TA 1NKOA 2CCVA 4ZDHB 1KGCD 1YEWA 2JE8A 1AGBB 4XOEA 1AIFA 3WS3B 2W65B 4U0RC 3BW9A 4WI4A 3RWHB 2RMNA 1EIBA 5FYKD 5KN5B 4WGVB 4GKSA 4AQEA 1QFUL 5DWPA 1EHXA 3I3DA 2BNUA 1QSEE 4HQQH 2NQ3A 2X9WA 5J0BA 5AW6B 3ZZSA 3VD0A 5ID1A 3QNXB 1NINA 5DUBB 1VZIA 2XOTA 3C2SA 2EE6A 3FB5A 3VXOB 3SE3A 4OD1L 3MLSL 2Z64C 3V9EA 3L6FA 3GSRA 5DO8A 4R9HA 1HYSC 3TV8A 2I5YL 1VERA 5FO7B 4W81A 4RAVA 1OGAE 1REIA 4L18A 2JKSA 3ROOB 2NYZA 3BUYB 5SX5H 3QI9A 5DRXB 1NBCA 3RY6A 1FHGA 2IADB 2G3MA 1WAAA 4FG0A 3QXVA 1Y7VA 1ZSDB 2J2ZA 4C8XA 3MQIA 4HKBA 1IEAA 3WS6A 5IB3B 1PFCA 3MUJA 4LSSL 3NP4A 2E4FA 1FJ1B 5FPIA 3VFRB 1RZFH 2C1PA 2KKQA 5JW5A 5C0CD 1V3LA 4HIJB 5BQDA 5BO1H 4YLCA 1UB5A 4D3CH 1D5XA 1E8XA 1FLRL 1JV2A 2HJKB 5D5MF 4W9FC 2A6IA 2VIRB 2HRGA 2HH0L 1ID2A 2X4SB 3MBXH 3M1CA 2Z31B 4FKHA 4KI5D 4DKTA 2CJTA 4PBDA 3HJEA 3HB3C 4XZ4A 4WV1A 5F7BA 4X83A 4LEEA 2DQGL 5CJXA 1IC1A 3BHBA 1XR9B 4KMTL 3WE6A 4HF5L 1MCHA 2E9IA 1MFAH 3O3BB 1SXSA 3MLWL 4TRPL 5F89B 3T8XA 2RACA 1QRNA 2EJ1A 3OJVC 5D9SA 1HL8A 5AUMA 3CN2A 4W6WB 5HD8C 3SDYL 1R3KB 3FU6A 2J55A 2ZSVA 4EN3A 1S7RB 2QGBA 1UWEL 4UNVA 1JZ8A 2Q2LA 5EWIH 3VRJB 1V7NL 3OAWA 5I1LB 5F9JB 1NFAA 5KS9E 3UPRB 2GW5A 5JO5A 2DIAA 2UY6B 1DANU 1EJOL 3STLA 3I9GL 4G80B 4M6NH 5CCKL 2XPGB 2FSEB 3BCFA 5EZLB 3RX5A 1RIUL 4BQ8A 1ZY9A 3EJRA 2GCYB 3IFNH 1RP9A 3RJQB 1AQHA 2QADB 5AVRB 2CQVA 3AQXA 3UBXI 5SWSD 3W9DB 1ONQB 5F0PB 2HT2D 1GZHC 1KGUA 4ELME 3G6AB 2K78A 4XE5B 4H8WL 1MLCA 3OAZH 1MW3A 5DJCA 4FKEA 5E2WH 5GS2H 25C8L 3RA7L 1W0WA 3DX3A 3N1MC 1GCYA 4XAWL 4M8QA 2FL5A 4YWGH 5DEZA 3V52L 4WO4B 2FD6H 2OI9B 5LHDA 3ZQWA 4GRWH 4HH8A 1SFHA 3HBGA 4L37B 4AM0B 1CDGA 4CVUA 4L1SA 4F1SA 4GS7B 4PGEB 5DFVD 2G9HB 3BVXA 2FT6A 3ZRSA 3JZYA 2R0KL 4OJFL 3MAWA 5CKGA 2X4PA 1EZLA 3T3PB 3BQUD 4TN9A 1HQRB 5ANHA 6PAZA 1UCTA 2R15A 3QZWA 4P9ML 3QIBB 4ZMVA 2I60L 1WISA 2JJVA 4BIKA 3CVIL 4ODHH 1OGSA 1Q1JH 3CVHA 1OGTA 2Y36L 1Z2KA 3J2PA 4U1IA 3O3AB 4MLIA 1TSRA 3SGKA 2HLAB 2LLNA 3IDXH 2OS7A 3SZKC 3RZCA 1XF5A 2N56A 2EC8A 4TV3A 1IJNA 4NXKA 4DKEL 1KCSL 7FABL 3HRZB 4U0RB 4MX7A 4YFDB 3TJPA 1TQTA 2FCBA 3DTUB 1OB1A 1YAZA 3GK8H 3HAEB 4Z0XB 1GJWA 1VEPA 2A1WH 2BW4A 1FVEA 5K9KA 5HYQB 3KLAB 2QQKL 3ARVA 3GIZH 4YXHL 2JQAA 1BVLA 2ZICA 2CPUA 3MCYA 3C08H 3KGRA 4DO6A 4NC0B 3PGDB 4NO2A 4DGVH 1N5AA 4PJDA 1BG9A 2XWJB 3JWNH 2CO4A 3C2AH 1N70A 1U4FA 1UA7A 2FEEI 4UANA 5CP3A 3WIIH 1OALA 2Y1VA 3GHEL 3U7YH 1LK3H 1PAZA 1D7BA 1EJ8A 1V3KA 3FJTA 5HDOA 4F7MA 4U6VH 2WXNA 1TCRA 4PGZA 1XB6A 5D7IF 3JSSA 3WLBB 2NQCA 3MXVL 4FXKB 1AGDA 3PWLB 3Q44A 2WO2B 1DQJB 2YZ8A 3ZGIA 5JHDA 4J3UA 2F6AA 3O2DA 5DUML 2VDRL 1F3RB 1RURL 2MCPH 5DLLA 5KBKA 1YPZE 3LRLA 2GBUA 2BRRH 3OQRA 3CE1A 2IAMD 1Y18A 1NBYA 1R3JA 1KB5H 4V1DD 3MRQA 1FFPA 1Z5HA 1QG3A 2QKIA 3IGFA 2F9BT 3VXMB 3WTXA 4AYDC 1CTNA 2WBWB 3QZNA 4N0CD 2B4CL 3E3QE 3ILPB 1QQDB 3JTSB 3PXJA 4PWGA 1PYWB 5E9DB 2GC4C 3LPFA 4BKLB 4LE8A 3ZDYE 5AAWA 5KBNC 4GG6E 4LCWA 4CILA 3CXFA 4NNPH 4MQXC 5DEGB 4G6AC 4WW2B 3KGUA 4JRXA 3HB3B 3FNKA 1W91A 3RBGA 5J56B 5JMRA 2DJMA 4JZJA 4L4VD 2HVJB 2OMZA 1G4RA 3CTTA 3DSNA 3DSFH 3HFMH 4K73A 4LLQA 3L1OH 5CJOH 1DBJL 4I5BB 5DJ6B 1NAMB 3EH1A 1NMBH 5BZWB 4F80A 1CK0L 4E42B 4JW3A 3VXPB 4HD9A 5CD5C 4AEIL 1PSKH 1MCBA 5T5NG 4A1RA 1KCLA 4G7QB 4JFQB 3FPXA 3TBVA 3V0DA 1AS7A 1KFAL 2D0GA 4OCXH 3QS3A 3ATFA 2F5BH 3UTSA 4R84A 3MJ9A 5E2VL 3DX2A 4JY4B 5DUPH 1PX3A 4PJ8A 3ESVF 4ONOA 1WC7B 5K9JL 3ARYA 1DBBH 2OSYA 4X0NA 3REWA 4R7DA 1BBDL 3ME0B 5F7EL 3V7MA 1I1RA 5C97A 4GEJA 1I1FB 3DJTA 4HGMA 4A7TA 1XGPA 2GTWB 2IWEA 3MA9H 3MMEA 5GRWA 1I7ZA 3KM2A 5F3HB 2IWKA 1GGTA 2QMJA 3DPBB 4G6ML 2WWKO 4PV9B 3WIFA 2H1XA 1CGTA 1CVRA 4XWGH 3C8KB 1ZTXH 2JWYA 4LLMA 4M6OL 1F5WA 1NFKA 4KJWD 2G4GA 3I6LD 5C07D 2V5MA 4DETA 1VIWA 2QVMA 2ADJA 1MDTA 2BS9A 4KNSA 4X5WA 3DRQA 4X9BA 1MIEL 3VFOA 1SHMA 4OSUL 5JDSA 5CILH 5F8RC 2I25N 1NJ9A 1LO0H 3HS0A 5CIPH 4GRLC 3IMUA 4HK3J 2H8PB 1EXHA 2BVUA 2GSIB 1N0XH 1WS8A 5TDPB 5IB4B 1TLMA 3CZEA 3BAJA 4JKLA 2ATAA 4KXAA 4HEME 4DAGH 4J4PA 4KI5F 3NEOA 1UKTA 3B2UC 1U36A 1PVHA 2HFEB 5CBEA 4ZTPH 2EACA 3QFDB 4Q58C 4ZO8A 3QDJD 3L5WA 1L9PA 1C5DA 4FLRA 2WLIB 1JK8A 4KRNA 2XVKA 3SBWA 4FRWA 1XGRA 3S3CB 2V3DA 2GY7B 2R2BA 3IJ9A 1UXSA 3AITA 3ZL1A 3HA0A 2C4FT 3GM8A 1GMIA 3CSPA 4HZAA 4AQ8C 3J7HA 4D9RE 3NK3A 2AXGB 3LEYH 4KROD 2WWMD 1R46A 3IJEA 1CD0A 3L3GA 4YX2L 2ZUQC 4N0UA 2R23B 3MLUL 3HN8A 4AUYA 1DVTA 3Q8BA 3QUKB 5DJZA 3WMPA 3VTMA 1UD5A 3B43A 5GS0D 2W91A 2Y2YA 5KYYA 3SGJC 1JBJA 2FIRT 3UOAB 4JE0A 3HE6C 2GJ6B 1U93B 2BERA 8CGTA 3TIEB 1BLIA 1Q1PA 2CJUL 3CFEB 5TPWH 5HYSA 4M5ZH 3LTVA 1TVBB 1WFJA 1TQWA 1ES0A 1T20A 1LO5A 4PJCE 1HKLL 1WA2X 2NTSP 3U9WA 4PJBF 1TVDA 1TZHA 1QEXA 4S1DD 5AB9A 1NPUA 4ANKA 5DZ9A 5JHBA 4X4YA 5DFTA 3L7FB 2IPKA 5AW5B 1CDIA 3EO0B 2D0HA 3P3YA 4LARL 2YOAA 3BGFC 4IJ3C 2XWEA 3BMWA 5HHOD 1E5AA 1H8NA 3BZ5A 4NQCE 1BVKA 5AYUH 4ZOCA 1ZLSL 2VR9A 1QKZL 4ODWA 1YEJL 5E51A 1NANH 4PRIA 2LE9A 2X0WA 4GOSA 3O3DB 2P43B 1U6AH 3AJ7A 1ORQA 5FYKU 4WY7L 2WLJA 3AMKA 4IHOB 3UL4A 4WFHE 1J10A 1E8YA 3MNWA 4CAGA 3Q05A 2MH4A 1MRDH 5BXFB 1EFQA 1YMHA 4NQTA 4WQOA 3W9EB 3GSQB 3ABKB 3C6EA 3QZWG 4HS3A 4X5XB 5JPMA 5D1ZD 4PV8B 3DHUA 3WKYA 2DMKA 1LE5B 2ZUWA 2BOCA 4RSVA 43CAB 2DLFH 4BXVA 1NSNL 3BN9C 1ET7A 3NA4A 3VYNA 3AB0B 3JV5A 4CDGC 5D7SH 3BX7C 4UT6H 4X6DB 1YEEL 2YLHA 4XXCC 4XNQB 3SPVB 1UD4A 5F44A 3FONA 5HVWA 4P9HL 1XD0A 1I8MA 1BEYH 4E0RA 1DQDL 4HJJH 1NC2B 1XCQB 4ZUUB 2G3NA 3IEAA 1HYRC 4NAJA 1WGOA 4XBPB 5AD0B 5I24A 1M7DA 5IUSA 4KVNL 3MRFB 4LVEA 5FYLE 4QXWA 5K33A 4MJ6A 4IOIB 3L3HA 3QEGH 5AVVB 1H9DA 2R2HA 4Y2OA 3V0VB 5D1QE 3S5ZA 2FX8L 5KSVB 3B3IB 1RZJC 4J8QA 5BRZE 5FUCE 1B0GA 3MYZA 4OCWH 2VLRA 5TK4A 4OZHF 4HBCH 3HI6L 4PWFA 3VQMA 3WSQL 2NZ1A 4HJTA 2RBLA 4L1LA 4BELD 1V10A 4OM1H 5E6IC 3DX8B 3FCUB 4WO0A 3FQTB 2CA3A 4KNQA 2WXMA 1YEDB 4YR6A 1MELA 1OAYH 1FI8C 1RULL 4QRPE 4PLOB 2ZCKL 2YKKA 5JOEA 4DK6A 3NIDF 3QDGE 3U1QA 5AW2B 2A83B 4XAKD 4QY8B 5HHNA 3NRQA 1J5OH 3NPZB 4GRLB 3H2QA 4MMXC 1A7PH 3NGBB 1WEJH 1HCVA 4MA3B 1ML0A 4P5RA 1T2QL 4JPVH 5E1HB 1AACA 2FHFA 5MP6H 5ACZA 4MAYA 5TQ2L 2CR3A 3MRGA 5FYLL 5T1DL 2IPTH 5CD3B 1MPAL 1E28B 3UG3A 1MFMA 1OE2A 3VYOA 2Q8AH 3U7WH 1XMWA 4U3SA 1IE5A 4FADA 3NT0A 4WTWA 2QSCL 1S46A 4EUPB 1IKFL 1S7UB 1ZVHA 3MLRL 3SKJH 4UV7H 3LS4L 1TJXA 3UZVB 3ZBMA 1DCEA 2BP0A 2ED7A 1MVYA 3C6SA 3SE3C 2GABA 3SJVA 4RWYH 3AABA 4O51B 2OYMA 3F5WB 4A67A 2P44B 4NO3B 3RI5F 3GUTA 1X5GA 1QBAA 1OQXA 2V9QA 3QO1B 5E9AA 1JXDA 4OI9A 4KV5E 4HU2A 4KTGA 3P3UA 3GSWB 5IBLC 3MLYL 5L7XH 3QI9C 3QUYA 2J8UF 4OCYL 2WZPA 4TF4A 3OVUB 4ZX4A 3L1GA 2NYKA 3N85H 3PYCA 4LP8A 3U2IA 4WIQA 1RJYB 3RY6C 5T33L 2ITCB 4FX5A 1MDAA 4YSSA 1MW0A 3DVFA 1UWFA 5L6YL 4L48A 1OSPH 2D0FA 2HG0A 2YC1A 3VNZA 1OGAA 4ICXA 1FBIL 4IJ3B 5A2FA 2CIKB 5IFHH 1NMCC 4XH2A 3QEUA 4G2AA 2H1PL 5B3SB 2LGNA 3AY2A 3LNIA 1IJ9A 1G9MC 1PJWA 2BSSB 4NQXB 5F3FA 5CR1A 4AENA 2X88A 4YXKH 4MMZA 3HLAA 4EAEA 2VERA 2CHXA 2GITB 3MRBB 4N90E 4WV1C 4H8QA 3TBYB 3BPLC 1QFUH 4UQ2A 2ZXWB 5IR1B 2XPYA 4KVCL 1XSIA 4CADA 3GEWB 4JKKA 3FB6A 4ENED 3H9SE 2CKBB 2E86A 4AJYV 2VR4A 4OF7A 3ECUA 3BH9A 1RUKL 2R1WB 1SJXA 4E5XG 3MLSH 5L8JB 1J18A 3RWJB 2HN7A 4OKVA 2P49B 2YK1H 5DURB 1WFUA 3CLEL 1JK9A 2NYYC 2I5YH 4HULB 2L7JA 2Z93A 2HX7A 4U1NA 1T0NB 1WZKA 2DF3A 4LFHG 3KLLA 2NY7L 2K3TA 5IJCC 5DK2B 4A7QA 4QRTA 3PQYE 2W0FB 1JP5A 5FGBA 1ND0B 3HPJA 3GXPA 5I0VA 2VDMH 2ZXCA 3NSFA 4WWKA 4ALAL 3FQNA 3QR2A 2EDLA 1SGKA 2JKJA 4WI0A 4M29A 3V0FA 4OZGB 4I18A 4M3JA 2HX9A 5F6IB 3FFCB 5KS9A 3LN5A 3CDZA 5EZIL 5F1SA 3OV6A 1KY6A 2Q1EA 4IK6A 5DD0L 1J0HA 2FQDA 4NKMA 2GJZB 1FVCA 3PFQA 4F37F 4MNQD 3LKQB 4XVUC 3C60D 2W9LA 4WUUD 2DIBA 1T0MB 4NO0B 3WN6A 5GJTL 3GUTB 2YBGA 4LL1A 1IC0A 5E6IB 5H2BB 4DNLA 2VQ1B 4YVUA 2OP4L 5D2NE 4Z3EA 4ZFOL 3D1MC 4M00A 1OP9A 3STZA 1HH6A 4TLTA 4XT1C 1MHHA 3Q2WA 3KPMB 2DQGH 1BZ7B 2K4AA 3U4EA 4HF5H 3SGEI 4TRPH 1NGQL 4ZFQA 4YSUA 1GIGL 3CH8A 3IPEA 1AOHA 1DCLA 1CE6B 4O5LL 3D2TA 3ULUC 2AAVA 5AW1B 3FH5A 1EGJL 2DQMA 3SDYH 1JNJA 3DRTA 4Z7VA 2UYLB 1UWEH 4IBUA 3SGKC 4JQVA 1DE4A 3JZ7A 3BRGC 1V7NH 4B7LA 2A0LD 3BDXA 1DEEA 5DGRA 5HJ3B 2VLJE 3AXLB 3FOLB 4WEBL 1EJOH 3P4MB 4NN7C 4IIQB 4JFEE 4HIPA 3S4SG 3SKOA 2WSPA 5CCKH 4XNYL 3P30H 4PJ7E 1I75A 4MJIB 4MBOA 1IBFA 2NR6D 3QZLA 4LHUD 1EEZA 2NTFB 2J73A 5LN4A 3V6BR 5J6HB 2DDQL 1ORSA 3O4OC 3DX6B 1UD2A 3O4LD 3FUNA 1X9QA 4MXVF 2P5EE 4L3EB 4N25A 4AQAB 3ARQA 2CRZA 1G0XA 4FEMA 1UKSA 4H8WH 1A4JA 1FIGL 2XTJC 2P24A 3KBHE 5J1TC 25C8H 2V4LA 1A5FL 1FVDA 1EAPB 4XAWH 4XC1H 2ESVE 3O8XC 4L23A 2Y6SD 1WWWX 1OTUD 2D3LA 1IFGA 4ZPTA 4EXKA 1H5BB 2JCWA 3ZKMC 4Z7OE 5BO0D 1C12B 1IBGL 3MNZB 1PD1A 2D2CC 1IM9D 3E8UL 4ANUA 3GSNL 2FUQA 1A0QL 4XMUA 1DHKA 1P6WA 2J6EL 2R0KH 4OJFH 2A6DA 1KLUA 2M8XA 3ZY7A 2BSRA 3QJVB 4P9MH 1KB9J 2I60H 3U46A 3CVIH 4K7FA 2Y36H 2CR0A 1DQQB 4QJ5B 3JV4A 3NEEA 2GSGB 4KK6D 5ETUB 5AAWC 1FZMA 5ICUA 3OKNA 4GFXA 4YDJA 1WAEA 4NQDE 1ZLDA 4DKEH 1KCSH 7FABH 2F58L 2I9TA 1F41A 3FPYA 3KPSD 4H25B 4HAKA 5DD5H 1UD3A 3L5JA 5DA0B 2GTZA 1YPZA 2GUOA 3KPQB 4HIHB 5LG1A 5G2NA 3SCMA 2AJXL 2R0LL 3D8MA 3IDGB 3NMEA 1EHAA 2QQKH 2HTLC 3ECBA 4YXHH 3WG7B 3ZT6A 1S3KH 3RIAF 1VFBA 3C5XA 4H2AA 1UH3A 3V5HA 3CFDB 1NEUA 3W11C 3C6LB 4OD3L 3P73B 1PKQE 4LO9A 3REVB 3GHEH 3PF2A 3G5YB 2YD7A 4RRPA 3RGHA 3MBWA 3DIFB 1ETZB 5MHSE 4IMKA 4PJ8C 4N68A 2C9PA 2PTTA 1SXNA 4HHAA 3KAAA 2F18A 3AREA 2CXKA 2ZP0T 1TVHB 3MXVH 5IVZB 1KN4L 4EDXA 2IC2A 3DUHA 1KJ2A 4X4ME 2OZ4A 4JO3L 5BVJA 3GSVB 3DTDA 2FO4B 3JV0A 4JFPA 4PWEA 5DUMH 1BQRA 1ZV2A 2VDRH 1RURH 5C0IB 4ES8A 4BSWA 3OTTA 1CLOH 4OGAC 2VLKB 2Y72A 5KSAD 1T2XA 3ZRFC 5I2IB 1ZT1A 3FYEB 4PI2A 2BX5A 2JJUA 2BVOA 3U1PA 3FFDA 1GGYA 3B9EA 1MFBL 3NCFB 5I82A 5HPOA 2EDJA 2B4CH 4QRQB 1OO2A 1SVZA 3LZFL 4B9GA 1U8JB 3QORB 1F3JA 5E2UL 3TT3L 2A4ZA 5C6TL 4XMZA 4NBXB 3D05A 3V4PB 3HBQA 3BH8B 2EXSA 4FQJL 4HWZA 4R97B 3C5ZB 4FYTA 4UCFA 2E8YA 2YN3A 4J4PC 3QRBA 4KU1A 1BLNB 2WXHA 3ZE0B 2VDKB 2AK4B 2APWA 5IB1B 3T0EE 4PWIA 1DBJH 5B7FA 5D4HA 4RMRA 1U8HB 4B6ZA 4JRYA 3M45A 1NAKL 1CK0H 4MQ7B 3SBWC 5T1KD 4PJ5E 4JFTA 2FZ3B 4AEIH 4K7PY 1ED3A 2VLMD 4BV1A 1A3ZA 2H9GB 4PRBA 1HHJB 1KFAH 1SEBA 1TZAA 4ZZFA 5A6IA 3TF4A 2X4QA 1IAKA 4NZRL 3K6FA 3LEXB 5E2VH 1O6VA 3IFOA 4OF8A 3F6IA 4U1GB 1PBYA 2CUAA 4LPWA 2J1WA 1BBDH 3KVDD 4ZQKB 1W6LA 5F7EH 3TJEL 3BN3B 1SUJA 3OWEA 2V17L 3WNLA 4Y4FB 5IHWA 3LQMA 2R2EA 3PDDA 4RQQA 5BZDB 1FGNL 4J1UB 1P2CB 2WK2A 4AGOA 3UCQA 4M6OH 3WNOA 4WHTA 5ECGA 1DSWA 4IDLA 4Y16D 4KZCA 3SIKA 2AVGA 1U8KB 2XTJB 1CURA 2MOGA 4PB9L 2OL3B 3X11A 1MIEH 4XX1E 5DYOB 1KYFA 1ZDSA 1S8DB 2P5WD 2QJDA 2FJFB 1BQKA 2NDGA 3O8XB 4L9LA 4U1KB 4CUCA 2EYTA 4BUQA 3ZGHA 1F6FB 3I3BA 2R8SL 4NPYA 2AC0A 1VGKB 4XN9A 3F8UB 4ZXBD 4UTAL 5JOFB 4N2FA 2OZ4H 1JPEA 1A7BA 3BYTA 5DHMC 5EMYA 3UROR 2WIMA 5F3BB 1T1XB 1WSST 3K4DA 1Z5LB 4HUUB 3BIAX 4MJHA 4ZW3A 3QDMB 5SWZD 1U4EA 3FUDA 3AZUA 1KJVA 4FLSA 3QXAB 2ADGA 3SE9L 2V8MA 5FV1L 4BH7B 1R3HB 1X5IA 1A6AA 1KCBA 2ZWSA 2XY2A 3MV9D 3M86A 3N1QC 5H37G 5JPMC 1LHZA 4C56E 4P46A 4H1LG 2Z91A 1UXWB 4QTFA 4F9PA 4NQCA 2CKNA 5IMOB 2XG5A 4F9LA 4G6KL 1VADB 2J12B 1NDTA 4YX2H 3LQZB 1P7KB 5JPNA 4M4RA 1B4TA 4BFIB 3MLUH 3C5SB 4M5YL 1ZMYA 2ZX8A 4HS6B 3VG0L 1AC0A 2WXGA 2O6PA 4BK4A 4J3SA 3ZTCC 1G7PA 4ZMAT 2BCKA 3EGDB 3QIWA 1YN7A 5EOQH 4DESA 1C16A 5HGAB 1ZLWK 2FBJL 1X7QA 2KLRA 1QPKA 2FNBA 3B6SA 3P3SA 5E8OA 3VD7A 3WKML 4BBWA 3OAUL 1HKLH 4KXDA 5EUKB 4NKIL 4HS8H 5C0JA 4NP4L 4KAQL 4ZSOA 2YPKB 1CBVH 2WBXA 3PL6A 1CF1A 3LRSA 2X5PA 1XSJA 4W9IC 4Z7NF 1J7VR 4XHQA 3KPRA 1ZLSH 1QKZH 1UZ6E 1SMOA 5D5ME 2PO6C 1GOHA 3LSOB 2VE6B 4C4KO 3D39D 1Z9PA 1FNFA 2I07B 1OZTG 4L05A 1E2VA 1KELL 3D07A 3KGSA 1AJ7L 3SPIA 3TA3B 4BWTA 2EIKB 4PRPE 1CDUA 4Y2DB 3SQBA 1CDJA 1R4XA 4E9TA 6PCYA 4HMCA 2LHAA 1GJIA 3LH8A 5GQBA 2K45A 3A5VA 3BWUC 4BFRA 4P99A 4FULA 3ISYA 2BVYA 3EOAA 2E7DA 2X53A 5F7YC 4MAYC 1P9MC 3A67L 2CM6A 3GINA 1YEEH 3EADA 3LVTA 1D9KB 4JDEA 1FF5A 4KK5C 1D5MA 1BDYA 1DQDH 3LB6C 2XFXA 2KYIA 2PETA 4QOKB 3EG9A 5I5RA 4KVNH 1PG7W 5I1DA 3D2UA 4AG4L 4PREB 1B0IA 4E5XB 5E8PB 3ZW3A 4MTMA 1IFRA 4NUQA 1VJSA 2PXYA 4H7VA 5DEFA 4P5KB 2FX8H 4HJUA 2QZQA 5CINL <