2DQFA

Crystal structure of hyhel-10 fv mutant (y33ay53a) complexed with hen egg lysozyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
b'DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 22
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqfA00
3BE1H 3L3DB 2D7QA 2YD8A 2HJLA 1D5MA 4UQ3A 5JORA 5DRNA 4ZO7A 4HV8B 4KK9D 5ACMA 1C7SA 4PJ7F 5GGRB 3KHOA 1FGVL 4G6FD 3VFGH 4Z77B 3EDJA 3W82A 5F9OH 1T1WA 1IEBA 1LNUB 3MUJA 3MTRA 4PP1D 4Z0XB 5SWZD 4F80A 5DEGA 3QEQB 4HHAA 3LZFL 4X80H 5D7LA 4KXZI 3QDHA 1NANI 2BY0A 3BEWA 5F3HA 4PGEA 5HI4D 4I0PB 4N0CD 4YBLC 3FO0L 1T2QL 3BW9A 5FYLD 3S96B 2ARJB 2APWA 4GRMA 1U8KA 1MAKA 4JVUA 1UA6L 3SQOH 3C8KB 1IGFH 3BIAX 3MRIB 3RWDB 1RUMH 5FCUL 4Y5XA 3TNNB 1CICB 3SHSA 1MCKA 1ZOXA 3MXWH 1Q38A 5BOZG 5T5NF 5A2JH 1JF1A 3TV3L 3KPPA 3CDCA 2GT9A 4S0TD 3QDJE 1NC4D 4LDEB 1RZJC 1YEFL 2OR8A 5KTEH 3PUCA 2XY1A 3SDCB 4LPYA 4MJIE 5I1EH 2NY6C 1IBGL 4GQ9L 4Q9RH 1F4YH 4XNXL 3BYYA 3RUGE 3C60B 5L6YH 1QLRB 3WUWB 2PXYD 2E8YA 4J3UA 1EHLH 3MRKA 4L29A 4P2YA 4OZFA 5GJTL 2XA8H 1DFBL 4JO3L 1HHKA 1P4IL 4GAGH 2H2PD 1AGFB 3EYVB 5IV2A 4QHKJ 4ZNCD 3WN5C 3WSQH 1LEGA 2UZIH 4Y16B 1I9EA 5EU6B 4U0RB 3RBGA 1QLFA 3WE6A 1G7LA 4W4OA 2DM2A 2OZ4A 5CKAA 5CGMA 5HHPB 1FNGB 1AC6A 4BM7A 1EXUB 3CUPB 4XNUL 4G6KL 5F6IB 3I02B 3ZKSD 2C3VA 1G9MC 1U0QA 2MHAB 3QJHB 4U1SB 3U9PH 1I1AD 2ORBH 4X8JA 2WW8A 1BZQK 2NLJB 1OCWL 1YNLL 3HUJE 1DVFD 3JWDH 5IJVB 4N0RA 4G43A 4X6FA 5HYQA 4J2XA 1JN6A 2NXZD 3M1BA 4XHJC 3ZE0E 3JZ7A 4HEPG 2YA2A 1OB1A 5CJ8A 4ZUSA 3HG1D 3IDNA 2Z31D 3QIWB 1BJMA 4OSUL 1Q94A 2NY5H 4YQXH 4JZJA 2YD9A 4LVNC 3QUXB 1BX2A 3BP6B 4H88L 4NQSA 3BPNB 5HHOD 3VXNA 5E1AA 4PYGA 1C5CL 1JGLH 2W9EL 3OKEA 3SEPA 4BH7B 2VDQH 5IB3B 5LKNA 4BUHA 4HK0B 1FYTD 4PRIB 1KB9K 4YXKL 4WEUD 3WLBB 3I2CL 4X9BA 4TSAL 3GKWH 3RHWK 1RU9H 4TNWK 4QXGL 1ZT7A 3HE6D 3EBAA 3QXDA 3HZMA 1G7IA 1AFVH 3KPOA 1HHGB 4ODBD 5GZNC 4NHUB 2F74B 5F21B 4ZPTA 3O6ML 4ZXBC 2YS4A 4KZDH 1T20B 1FJ1B 4DKDC 3U79A 1S5IH 2CO6B 4M6OL 1HI6A 3S6CA 1U2CA 3A6OA 4WJ5A 5E8DL 3DJ9A 4EUPB 2P8MA 2VDPL 1QR4A 1ZT4A 1U42A 4YXLH 1H3PL 3MRNB 3BO8B 3SKUD 4PJBE 1CGTA 4XBPB 3KPRE 3ARBA 3QSKB 2BNQA 1NL0L 3CFBA 1VKXA 4FN0A 4M1DL 3O2VL 1KIQA 3P11L 2AKRB 4JFEE 2PO6B 5D7LD 5HGBA 5A1AA 2DDQL 3DETC 1P69B 2YMXH 1W0WB 2H26B 3UMTA 1PAMA 4JFXA 3KGRA 3PJSB 1RJYA 4R7DB 4P59L 1KPVB 1K5NA 1S9WB 3LRSB 1ZAGA 1FV1A 1UJ3A 4XBGB 4WI9A 4MJ5A 4LCYB 2X44D 2V2XB 4XPTL 4NO2B 3FT4B 1BFVH 1S9VB 1D6VH 4TPRL 2CMRH 3GNMH 1A5FL 1E4WL 1ZA6B 1RUPL 1MWAL 5I1AB 1U8PA 5D70H 3TPKA 5IT2L 2IFFL 3H9SE 1NAMH 3QDJB 4HIIB 4KI1A 5CP7A 5JO5A 5JR1L 5EUOE 3ALWA 1NEZG 3IGAA 4MJIB 5DFWH 3SDYL 1NQBA 2Y06H 3HZVA 4UU9A 3GJFH 3CDFA 2MQ3A 1TVHA 3NZHL 4XCNA 2EE6A 3GSNH 3QFDA 1EMTH 4Z7NE 4KJPD 3T09A 2V5RA 5MEOB 4X7TB 4IMLA 2YC1A 4F3FB 2FH8A 2FCBA 25C8H 1CYGA 3KJ4C 1U92A 5MEQA 5BRZB 4HXBH 1ZTXH 2IBZX 3A6CL 1N64H 3C9NA 1FNAA 1A8JH 4QRRE 3VXPB 1NGYA 2WLYA 1P2CA 1F2XK 4Y8DC 5B3JF 3L5JA 4XAWH 1HZHL 3MREA 4MGXA 3MRMA 4XMLL 4NWTL 5ENWA 1FGVH 3TH4T 5CEZD 5F1SA 3D0VA 1P53A 3BZDA 2OJEA 3K8MA 5A2LH 3HUJB 5J0BA 2J8UE 3WEXA 1H5BA 4JB9L 2BOCA 3LZFH 4HDIB 2RQ8A 5EBMA 4W6YB 1RJLA 5F7YC 5TDOB 5KG9B 2VLKB 4RAVA 3MGOB 5ABDE 2NX5E 1FDLL 4HZAA 3KLDA 4F7PA 4P23B 4OT1H 1EFXA 3SCMC 1T2QH 2YD4A 5D4QA 4M8VA 1OAUL 4Y4HA 3BDYL 5EZJB 1ZT1A 3IETB 1UA6H 2X9WA 1Q0YL 4NZRL 4XXDB 5D71L 4PJ8C 4C56E 1B2WL 3ROLB 2B5IC 3ZT7A 3UAJD 4OLWL 4TQEL 4GKNA 2DLEA 3KLAB 3TO4B 3BJ91 3F62A 3JWNC 3S4SA 5DEFA 3L95A 3UJIL 2J88L 1FL5A 4M93C 1T22A 1RZ8A 3W11D 1WIPA 4JLRA 4PLKD 3QEHB 5BQ7A 1QACA 1MCRA 2DQJL 3T77A 1H3GA 4WHTB 2BY1A 5IIEA 5L0QC 1IBGH 4GQ9H 1MRDL 3H0TB 4XNXH 4PGZA 2EEDA 5DJCA 5IFAL 5MP6L 1FZOA 4QLRA 5C0CA 5B38A 2EDDA 4QRUA 4KDWA 1DFBH 4JO3H 4YIQB 3IFOB 2O93L 2CLRB 2DQFB 1HDMA 4FG6C 4LLQA 5I6XB 3D2UB 4PJBB 5EUKB 2WMPA 2VLRA 4FQPA 3DMMD 3TJEL 2VC2L 3HC0B 3RGHA 3MRGA 5E9DA 4JFEB 3ARBD 3GSRA 5H94B 4Y5VA 4Z7WE 2BNQD 3BGFC 1ED3A 3SO5A 3V4UL 3ET9F 2IEPA 5E00B 4YLQT 5E4EC 5H2BA 5EPMB 3LKQA 4GAYA 3M17A 4PY7A 2QBWA 3EOTL 4W70A 2Z8WC 1IGIL 3CH1B 2FATL 2VE6A 1N2RA 3X3GL 3V6OA 1VACA 3EFDL 5GGUB 3PXJA 1WZMA 4F33B 5IKCA 4L3CA 1M4KA 3QUYC 3EUUA 1BZ7A 3H7LA 3ARRA 1K8IA 1OWWA 3SJVA 4YHLL 3G04B 3OB8A 2XZAH 4NZTH 1RZKC 4PJFA 5EUOB 43CAB 1E4XI 5K9JL 2W9EH 4JFHD 5EIIA 4MDJB 2R1XB 4YBLB 4GKZA 3O3EA 2B39A 3I2CH 4AL8H 5HHVL 4TSAH 4UI2A 1QLEL 3QG6A 4MJ6A 4GO6B 1M1SA 3WHE1 3RWIB 5FO8A 4LSSH 3X11A 1EIBA 4TUOA 4XH2B 1HYSD 3O6MH 1UENA 4HFWA 1M7XA 2MQ0A 5C0NC 4ZYKA 2OR7A 2Q86A 3HAEA 2FGWL 4PV9B 4M6OH 4PBXA 4U1GC 1U8MA 3HE7C 2NY6B 4RFOH 5E8DH 2F8VA 2EIDA 2VDPH 2AK4E 3STZB 4TOYL 5BJTB 1MUJB 2JIXB 2YK1L 1CLYL 1IGJB 4ZS6D 2EEAA 1QOKA 5D7IE 1A22B 1MHHB 2X1XR 5ADPL 3BH8B 5TFSL 4M1DH 3ZKMC 4EI6A 3V6ZA 3P11H 3DX6B 2VR5A 2DDQH 3RY4A 5D7KE 3RJQB 3L6FB 1UT9A 2F58L 1HYRC 1P7KB 4MB4A 4NT6A 2BDNL 4YZFE 1UQSB 2BVPA 1EEZA 1EFXD 5C6PB 5ETUB 4JQXA 1XH3A 4FFZL 3JWOC 4Y4HD 3QXWA 1AKJA 5FECB 2E7BA 1HK6A 5F7HA 4G9FE 2GKIA 3BN3B 4XPTH 1WCBA 1QP1A 3IJYA 4U6HA 1A5FH 1E4WH 1RUPH 1MWAH 1ONQB 1F11A 2CUMA 1AHWC 5IT2H 2IFFH 3HS0A 4GW1B 4MDIB 5DJXB 3VI3E 5JLZA 3WO4C 2X4TA 4EI5B 4PS4L 4BSJA 5JR1H 3DIFB 4WVRA 3FHAA 2VABB 3THML 1I4FA 5H8DA 1FVDB 2PW1B 2LV4A 3V6FA 4LK4A 1TVBB 5GIRA 5ANMA 2O61B 3DO7A 3K74B 5HDBE 2NW2B 1MCFA 1QQDA 3IJHB 2E7CA 4NJAL 4KKAD 1CFTB 5C0CD 3ZE1F 3T8XB 4XPAH 5I66B 4I77H 5D93C 4PRDB 2EICA 4HGWB 4R9HA 5HI4C 5D72L 2RFXB 1RUQH 5J56B 4N0CC 1UWGL 4M6ML 5HYJA 4NNPL 1TMCB 3A6CH 4U1NB 4P5KA 3P9MB 4WNQB 4ZS7H 3PWLB 1G6RB 1HH6A 3D39A 3KR3H 5GRVK 2VLRD 3L3KA 3RY5A 4KMLB 4NWTH 5E9DD 4L8CB 4ZXBB 1T83C 2I9TA 5J06A 1JRHH 2CKBL 2JE8A 2HFFA 4LLUA 4PR5A 4WWKC 2I26N 2X4OB 3LN9A 4FQCL 5EOTA 1MLCB 1NCDL 1T0NA 4ODWB 1YYML 2P5WE 2N4IA 2W0PA 1A9EA 1U8NA 3C8HA 2Q3AA 2JCCA 1RHHB 3ZT5A 1TZIB 5HVWA 2PXYC 1IFHH 1OAUH 1Z5LA 1DQQA 3IF1B 2FYYB 3BDYH 3V0AC 4S1RL 5DO2D 2H2PC 3TYGL 3ILPB 4A6YA 5IWLA 4NZRH 4DVBA 3DXAA 4ODVH 1ADQA 5CZXC 3SJVD 1KEGL 2Z4QB 3C2SA 1B2WH 2QQLL 1P4LA 5DD6A 3RNKB 4OLWH 4TQEH 3SGEI 3EW3B 3L5IA 5IM7A 3W9EB 1INDH 2ZCKH 3ES6A 1OT2A 2Z8VC 4UILL 1BF2A 1YJDC 2J88H 3NA9H 5FYKD 4PV8A 3TC9A 1OSZB 4TUKL 3GSWB 2XKNA 1CD1B 2G5BB 3FQUA 3ZSTA 5GSVB 1U6AL 2ED8A 4OZGA 2W9LA 1I1AC 1YQ2A 2KKQA 4LLVB 4WDIB 4MQTB 5MP6H 5IFAH 4HLZG 3WDIA 4TVPE 4KGLA 3LDBC 2NXZC 3UTSE 4PB0L 5IW1A 1CFVL 3T0BA 5FGCB 2R1WB 3NCYP 2DOCA 4HX1B 5C0IA 1RURL 2AK4B 1A6VL 2OYPA 3UZVB 5I1KL 5BS0B 3SE3A 1A1MB 5IUSA 3F12A 3EOBA 1MJ8L 3B9KC 1FH5L 4OZIA 3X12B 1BIHA 3BKYH 3TJEH 4ZO6A 4P2CG 4X6DE 2VC2H 2BRRL 3D3VA 2A6KB 3BH9A 5IMKB 4ODXB 3KJ4B 5ICYB 3E6FB 1EAJA 3V4UH 3U36B 2W59A 4HAFA 2FJHA 1VESA 4NQCA 1VGKB 1YEDA 5HGHB 3IDGA 3HE6C 1NGZB 2AABL 1KGCD 2XPGA 2ITDB 3GBLA 5DQJB 1ORQA 1IGIH 4WI4A 2CR3A 2A6IB 2FATH 5I9QC 1EHAA 4KRPD 8FABB 3WO3B 1JGUL 1N6QL 4J4PA 1U91A 4HWZA 1PJ9A 2OI9C 4S1DD 4E42B 4PGBB 5C0JA 3AREA 1AKJD 3MPCA 1BD2E 3GI8L 2G75B 2MNUA 3TPUB 2X4PB 2D0HA 3UP1A 4PJ7E 4PJXF 4YBQD 5F88B 4LSTL 1OD7A 4K3GA 1F6LL 4UUJB 3RPIA 3SCMB 4KU1A 3D85A 2KUTA 3TBWA 1CLCA 5DS8A 5HHVH 2CGRL 5F7DA 3MJ6A 3QI9A 4EVNB 4HBCL 4KK8D 4PJ8B 2JB6A 4LVEA 5EOQL 1DBJL 4KUZH 1MFDL 5DVMA 3E2HC 2EDLA 1A1NA 1B4RA 3QULB 3MOQA 1IZKA 3CMGA 2ID5A 3QIUA 5HYJD 1UB6A 4M93B 2FGWH 1DUZA 3OAYH 4WI5A 3MBEB 4JRYA 1HHIA 3D39D 1CDUA 2H8PB 1MCLA 2CLZB 3T4AB 2BNRA 5I19L 1Y0LA 2ZSVA 4TOYH 3VA2C 1YPZB 3GM8A 4JAMB 2IQAA 2YK1H 3VGEA 1CLYH 1JNJA 1R24A 2BVQA 5ADPH 5TFSH 2XWTA 2HJFB 4KKLD 2UWEA 1JUFB 1PD6A 3DRQA 4HJGA 5DJ2A 1R3JA 5F71A 1VFUA 1TTUA 5HYFA 1BQHB 1U58B 1QPXA 2DQEL 4JZOA 3CGTA 2F58H 3HC3L 5HGAA 4MCZB 2R2HA 2BXZA 5C09E 4AENB 4X4XA 4G8FB 5C92A 3BGFB 3L5HA 3L7EB 4FFYL 4FFZH 1NC2A 3K81A 3EFFA 2YA1A 3QNYB 2M8XA 2V9RA 5E8NA 1OARL 4OFVA 3O3AB 5E4EB 5CWSB 3DXAD 1O0VA 1KJMA 3O41A 5GGVL 4HH9B 4PRPB 1N3NA 3FAWA 2AEWA 4FXGB 5BO1L 4Y19B 2X1OA 2SEBB 4W4OC 4NKIL 4PS4H 12E8L 3MLUL 3OR6A 4U1LA 3T0AA 4UOW0 4F37F 2FDBP 3LB6C 1G7JB 1XR9A 3HLAA 5SV4A 2XXMB 3THMH 4MCYA 2VLLB 2QTEA 3QUYB 5F9JA 2FD6H 2G9HA 1D5ZB 1EVUA 4RQQB 3FT2B 4FHBD 4PREB 3PHQB 4ODUB 3UTSB 4JO2L 3BEVA 5BV7L 4RRPA 2YSSA 3BAEL 4GBXB 1RMFH 4DZBB 2BVTA 4JHAL 3T2NL 5D72H 2ZUXA 4G3YL 3R8BB 4NHCL 1UWGH 4M6MH 3HNTL 1Q72L 4NNPH 3UYRL 4A2MA 4LCWA 2VUOA 3LKRB 4MWFB 4B7IA 4QHUA 3IT8D 3CLEL 2X70B 4JZJC 4N9OB 5DA4A 1B3JA 1UG9A 2DWEB 1U95A 3IDYB 3VGAC 4QHLB 5HGGS 5B21A 3D3VD 1B0RB 3QUKB 1F3RB 4HQQL 3UAJC 4DZ8A 1BBJB 1EPFA 3ALPA 4WHDA 3C8DA 2CKBH 3MRCB 1OAXL 4U1GB 3HE7B 3PIQA 4NQCD 3MNVB 5HDOA 4F8TA 3W11C 1D5XB 3HG1E 2VNCA 2Y36H 2XWJB 4UIMB 4HKJB 2YRPA 3BIKB 3MJGX 4K7FB 4F7TB 3O6KH 4BSVA 3TIEA 4I1NB 4P5MB 3T2QA 1KNOA 5IHZA 4J4PD 3G9VA 4OGAD 4P48A 4CVXA 4S1RH 3ARED 2CLVA 3TBVB 1KBGL 3TH2T 1C8PA 4PJ7B 1IM9A 2R4RL 1NBZA 3M45A 4K9EC 3TT1L 3HMWL 2YPLA 1KEGH 2NY0C 2QQLH 3PF2A 1QVOB 1RZFL 4D8PA 2WIIA 4GKSA 5FO9B 3FB7B 4NUJB 1R5IA 5FM5O 5C0DA 4UILH 3D85D 4JY6A 1RPQA 3ARBC 1XCQA 2R4SL 4TUKH 2BSED 5DK2A 1QEWB 2QADD 3CCHA 3QI9D 1U6AH 3AB0C 2K7QA 1I8MA 4I8DA 4HJJL 1AHWB 3L9RA 3QO1A 1Q9OA 3WO4B 3WUWG 1N0LA 2L7UA 5JMRA 4HMEA 4PB0H 1CFVH 3CH8A 3OKKA 5D8JH 4RGND 3QIUD 1UB5B 5FHBL 3F7VA 1ZGLP 1TENA 5JDJA 3SKNB 1RURH 1A6VH 5SWZB 5I1KH 1UJ3C 1IAOB 1KJVB 1MJ8H 3QUMA 4J8RB 4JRYD 4Y89A 5J9PB 2FJGA 1IGTB 1FH5H 4U4BA 5KAQF 4WGVB 4PD4K 3LN5A 2FH6A 3AXLB 2AJVL 2BNRD 4PYHA 5K9OB 2BRRH 4DK6A 3FO2B 4LNRB 1XZ0A 3CZFA 1JF6A 1TXKA 5D93B 5EN2B 5ADOH 3SE4A 3BP4A 3JXAA 3OGOE 4AH2A 4N0YH 3N0PB 4MSWA 1FFNB 2DQDL 1GGIL 3E6HB 1K2DA 5F1NB 5GISL 5DJAB 2AABH 3WFEL 8CGTA 4ZUWB 3MFFB 4KV5E 5L2KA 4Z0BL 2E7LA 4Z7VA 3KPTA 4QF1B 2BMKB 2C3GA 3KPSA 4Z7UB 5DC0A 1JGUH 1N6QH 2VLJE 2BNUA 1HYSC 1EZVX 1NC2D 2VERN 3MRRB 1T7YA 2V17L 3WIHH 1CTNA 4NYLA 2QL1A 1O7SA 3WKML 3GI8H 2UVFA 3MRFB 1NC4B 5FB8A 4EDXA 5ESVB 4HUUA 5ACZB 5CAYB 3V4PH 5B3JE 4MHHG 1CIDA 1ZEAL 1INQA 4UB0L 3S35L 1RFDH 4LSTH 3VFSB 2HTKD 3DRTA 3WXVL 1V3LA 2PXYB 5E03A 2AXGA 3KYNB 2H3NA 4ZS6C 3DBXB 2EECA 4LEOA 2CGRH 1KG0A 4NKMB 5GS3A 3VRJB 3SY0A 4HBCH 1RI8A 2G60H 2IBZY 2NMSA 2WUCL 3CFCL 4GW5B 2P8LB 5EOQH 1ZVSA 1DBJH 2GUOB 3MLXH 3LQZA 2AEQL 1KACB 3IFLH 2VN7A 5SWQA 5AZEL 5F7MC 2LVEA 5BVJB 2XT1B 5ESAB 3BWAA 1FZKA 4D0DA 5IBUB 4LCWD 4U1IA 4I18A 4Y4HC 1V3KA 1NBYB 5CEZE 4OV5A 1I1AB 4HK3J 2YUXA 4YEEA 4DN4H 1TQBC 4XB8A 1CXLA 4EUPG 5IB4A 1F6FB 1DVFB 5I19H 5KSAA 3LDBB 1UZ8B 5F6HJ 3ARGA 2LAGB 1EUUA 2NXZB 4LPTA 2AXFB 3QXUA 5EU7E 1FFOB 1A6ZA 4P4RA 4PB9L 5J1SC 3QIBA 4EBQH 3HG1B 2Q76A 2Z31B 3EOYG 3RQ3A 2FSEA 4MD4A 1N8ZB 2GSIA 5GRYA 1UM5L 1WBXA 2GJ6A 5KVGH 3B9KB 2DM4A 3IAPA 3MO1B 4YHPA 1CD0A 2X1WL 2DQEH 5HHOB 3HC3H 4WTZG 4R0LA 1CE6B 3TO2A 3OB0K 4G8IB 4FFYH 4HLZH 1FYTB 2DBJA 1TZHB 3GGWB 4WTWA 3OKNB 1ZLWH 1IM9D 3BKCH 5JPNB 2YPLD 3DV4B 1NGWB 3HE6B 4C58B 2AXHA 3IU3A 2XQYK 3U4EB 2XQYG 4ETQB 3KLSA 5BO1H 2DI9A 2IADB 5I9QB 1NMAH 4NKIH 12E8H 3MLUH 4XPFL 1RQ5A 1TPXC 4MNHA 5CGTA 5GSRA 1LO4H 2OI9B 2GCYB 4Y88A 5BVPL 4LHQB 2YZ1A 4Y5VC 3HNVL 1MJUH 1H3XA 1GGYA 2I27N 4JCMA 2P48B 2HJLB 3JV6B 2W38A 2X42A 1D5MB 3HI1A 5E2VL 5BV7H 1NSNL 4UQ3B 5JORB 2OK0H 5DRNB 5TE6L 3BAEH 1A7QH 1WGOA 1F2QA 3QHFL 4G3YH 4U6XA 4NHCH 4E5XA 1Q72H 3UYRH 3V6OC 1T1WB 1IEBB 4JHBA 1AGBA 5EOCJ 3CLEH 5DEGB 5DGRA 4HHAB 5DO2C 5D7LB 1VSCA 4MX7A 2DLFL 1FC1A 3O45A 3BEWB 1T1XA 5F3HB 3GHEL 4HQQH 1QBML 4TTGA 4PGEB 2ZSWA 2X4QA 2ENSA 4HUWA 3BW9B 4MXWH 5MEPA 4H20L 1OAXH 2DMBA 4GRMB 1SJVA 1U8KB 1NGPL 3MLYL 3P30L 3K7UA 5DRXA 5E95B 5JW3L 3H9YA 5L2KD 1OSPH 4Y5XB 2AJUL 3HTLX 5KSBF 3KPSD 3K1KC 1YEKL 3O8XA 1VERA 1JF1B 2X9XA 5T3XL 3KPPB 4P2QE 3L7FA 4JFHE 2GT9B 1KBGH 5T1MA 2R4RH 4LGPB 4MVBD 3HMWH 3B83A 3Q6FA 2AJXL 1RZFH 1PZUB 1R3IH 2CR6A 3VGHA 1T7ZA 1OGTA 1BBDH 5IMOA 3IKKA 4KRLB 4FQ2L 1DBKH 1JZ2A 2ZUWA 3QQNA 5T3ZD 1KTKE 3LEYL 3MRKB 4L29B 4W6WB 4Z95L 5C0BA 4OZFB 4WIQA 3FQWA 1HHKB 2R4SH 3WFCL 4PBWD 4XCYA 5IV2B 1LEGB 4LNVA 4HJJH 4OLZH 5J11C 4EQ3A 5EZOL 1QLFB 3WE6B 4G6ML 1G7LB 4ZPVA 5FM4A 3I75A 4LAQL 4KRPC 5FHBH 2I24N 1WFNA 4S1DC 2C3VB 2ZOLA 3DUSA 5SWSA 1KB5L 3DNKA 1F58L 4X8JB 1MCPL 1ZHBA 2AJVH 1PEZA 5KSAD 1CLZH 2ED9A 3K8LA 5F44A 4G43B 1SVZA 2D4FA 4X6FB 3ARGD 5J4MA 4WV1A 5HYQB 1JN6B 1QBLL 4Z8FH 4YBQC 3U4AA 4OLEA 3PWPE 3M1BB 3QCVH 3QIBD 4IRSA 3NZ8A 5E6ZA 1OB1B 4ZUSB 3IDNB 2DQDH 1Q94B 2X4NA 3RHWF 4JZJB 4OLXL 2GJ6D 4J6RL 1BX2B 5GISH 4NQSB 4ORZC 3VGAB 3WFEH 1L7IL 2YD5A 4ZMAT 3VXNB 3ZE1E 5ERWA 5E1AB 3F7QA 1IARB 3OKEB 1GC1L 2IQ9L 2A77L 3G6AA 3U7YL 5F96H 3GM0A 3WKMH 3RBSA 4AT6A 1EFQA 5FYJE 1I85C 2MMXA 5DHYA 3QXDB 3HZMB 1JZ3A 1ZEAH 1DANT 3LAFA 1G7IB 3KPOB 1GIGL 4OCMC 3S35H 4ZPTB 1CK0H 4G5ZH 3VGGA 4K8RL 4OCXL 4ALAL 1C5DA 5JHLL 2FEDD 5C0CE 4KKLC 2NR6D 1NEUA 3CFCH 5DJ8A 1HI6B 2YEZA 1WWCA 4RGOL 4WJ5B 4IMKA 1I7RA 2B0SL 5ICXA 2P8MB 1ZT4B 5DD1H 4YUEL 2WSKA 3CAFA 1DE4A 1P84K 2VH5L 4OCLC 3ARBB 2BNQB 3CFBB 5I2IA 1VKXB 5FGBA 5T1KA 2FHBA 1QNZL 1KIQB 3AB0B 4RBPK 2F54A 4OB5H 5IF0B 5HGBB 5IWLC 4KRMB 2WK2A 1RIVL 3W81A 4OF3A 4RWYL 3V5DA 3WXWL 1UM4L 4R8WL 4JG0L 4JFXB 5IVZA 1RJYB 3V79C 4FXKA 1QR1A 4JM2F 4Y4FA 1F00I 4JY5L 1NUGA 5KVEL 1FV1B 2HWZL 1UJ3B 1ND0A 3BZ4A 4ELMA 4JKPL 1X5ZA 3EYUL 1DZBA 4HKXA 4MJ5B 1XGTA 3V6OE 5DF0A 1NMBL 4D94A 3SJVE 1FC2D 5CP7B 5JO5B 3O8XD 3IGAB 3VJ6A 4P57B 3HZVB 5DZNA 3NCEB 4UU9B 1SJXA 2DQCL 1HHHA 2WIMA 3RDTA 1TVHB 4XCNB 1JI1A 3QFDB 4YDJA 5FYKE 4JKLA 2AI0L 3TBSA 1XF1A 1GGBL 4NDMA 4XPFH 3TVMA 4IMLB 2YC1B 5DURD 1IEHA 2P42B 5BVPH 5C0BD 2Y5TA 1U92B 5I15H 5MEQB 3TH3T 4HS3A 4RISL 3HNVH 1F6AA 1NGXA 3GMPA 3C9NB 1LDPL 5H35A 1NGYB 1M7DA 1P2CB 3P4OA 1NSNH 1A9BA 5D6DA 5TE6H 4LGSB 2CSPA 3MV8A 3MREB 2RCSH 3MRMB 5ENWB 3QHFH 3OKDA 3D0VB 5DR5L 4AIOA 2OJEB 2WP3T 3K2UH 3ZSSA 1QSZA 4JRXE 5SWSD 3AREC 3D18A 3BRGC 1JGDA 2BOCB 3GMLA 2DLFH 2F15A 4FMFA 5EBMB 1RJLB 4CDGC 4RAVB 3GHEH 4LSPL 3ALXA 4F7PB 1I3RA 2XRAL 5TE7L 4WY7L 4XCEA 1EFXB 3BJLA 5CD5D 4IRSD 5CZVL 5HHQA 4H20H 5JDSA 3B9AA 4Y4HB 4JN1L 3P4MA 4X4MA 1ZT1B 1NGPH 2KH2B 3P30H 1TQBB 2QEJA 3V52H 3QI9C 1JMXA 5JW3H 1XGQA 1KLUA 2DLIA 2WINA 1N5AA 5EFIA 2IGFH 4BYHA 3CX2A 4GKNB 1CL7I 1X5AA 5T3XH 3S4SB 3QDMA 3L95B 5DEFB 1B0WA 4RGNC 3QIUC 1R5WA 4L1DA 1X6LA 1DDHA 1FL5B 1BOYA 1RZ8B 1T22B 4JLRB 4LU5L 3SDXA 4MZ3A 2AJXH 5FO7B 3T77B 1FE8H 5IIEB 3NH7H 5DJCB 5E0QA 3MZTA 5E56A 1FZOB 4EUPH 5C0CB 5B38B 5ANME 4Z95H 2CRYA 2D4DA 3LEYH 4QRUB 3G08A 3WFCH 5LGJA 5EBLA 4UNVA 1HDMB 4LLQB 1YQVH 5I0ZA 4PJDF 4PJAF 3FB8A 3MCG1 3SGDH 2C3WA 3BUYA 4LPXA 5HYJE 5EZOH 4X6CF 4G6MH 2VLRB 5JOFA 4HUKB 3VXSE 4XT1C 2ZG3A 1FAKT 1NFDA 1TPXB 4TSBH 3MRGB 4K23L 5E9DB 2HLFD 3D39E 4LAQH 3GSRB 4Y5VB 4QXUL 1ED3B 5T1KD 5FFLA 1QYGL 4CBPA 1F58H 2F54D 4YE4L 2DB8A 5C08A 5C07E 5IP4A 1E28A 5H2BB 3LH2H 4OTXL 4WW2F 3LKQB 4GAYB 3M17B 4PY7B 15C8L 1EGJL 1WEJL 1J0ZA 2VE6B 2HTKC 3TJHD 4Y4FD 1N2RB 4E0RA 1VACB 3PWNA 3LD8C 3SN6N 5IKCB 4L3CB 4OLXH 2NW3A 5JTWA 1B4JL 1BZ7B 1K8IB 1L7IH 3SJVB 2CRZA 3BKJH 4PJFB 1JV5A 4YDKL 4N8CL 4UT9L 1LEKA 1GC1H 5EIIB 2UUDK 5C70A 2A77H 4AEIH 3EYQD 2XZZA 3U7YH 4QRQA 1XCTA 3B2VL 4GKZB 3U82B 3O3EB 2PF6A 2DKMA 4JDVA 3NAAL 3SPVA 4QHMA 1YMME 3QG6B 1L7TH 4MJ6B 4X5XA 4HKBA 3GRWA 1JVKA 5A2IH 1HINH 3QHTC 2FGZA 4I13B 1G6RL 2AK1L 4F57H 5FO8B 3X11B 3TVMD 1G9EA 4TUOB 4ELMF 5C0AE 3FO9A 4HFWB 5D7SL 4ZYKB 4GG6A 5C9KA 4OCXH 5IQ9A 3HAEB 2Q86B 4H0HB 3DHJA 1LO2L 4KDTA 3DSFL 1U8MB 1FRGL 4RGOH 3GO1L 4L8DA 4ZG1A 4O02L 4O51A 2ZUUA 3U7WL 2B0SH 3T1WA 2W91A 5KS9F 3MV8D 3HRZA 4OZIE 3J8F7 5E2WH 4UMGA 1QFUL 1WC7A 3D3VE 3T0DA 4EI6B 3V6ZB 3OPZL 2XTLA 3O3DA 5J11B 2C7UA 3KXFE 4RFEA 1HQ4A 1KELL 4B7LA 3VXUA 4KKCD 4RWYH 3WXWH 2Y7QA 4NZUL 1UM4H 2J8OA 5D9SA 4NT6B 3QCTL 3NA4A 2BVPB 1EEZB 4M43L 4KRPB 5KVEH 1XH3B 3REVA 5GS0D 1PGRB 4LLAA 3N85L 2HWZH 3FB5A 4ONHA 1AKJB 5EU5A 3CVHL 4JKPH 3EYUH 4HMDA 4KTYA 1BQHG 1A3RL 1WCBB 3IJYB 2WQ8A 4U6HB 1X5IA 1F11B 2XTJE 3RVUD 1V5JA 3HS0B 5JLZB 3S88L 1I1FA 1CDGA 1NMBH 1K9TA 2X4TB 3WNMA 5JHDA 4R3SA 5KOMC 3SOBL 4PJCA 3FCTA 3QDMD 1I4FB 1JWMA 1YYLH 3T0VA 2RHEA 4KTDL 1E4KA 2V2WA 1J87A 2VZOA 1ZGLA 3GB7A 2APXA 3V6FB 5ANMB 3DO7B 4L4TA 4LQFL 2AI0H 1BFSA 1GGBH 1QQDB 4ZFFA 2CK2A 4PG9A 1OPGL 2AGJL 4LCIH 2YZ8A 4URTB 5LGHL 1ZKAA 4JPIA 5HYJB 4RISH 5IROA 2GEEA 1TTFA 3VXSB 2VL4A 4P5KB 2IANA 4AJ0A 4GSDL 6FABL 4XPHL 1CF8L 1LDPH 1HH6B 3D39B 3GJEA 2J12B 3L3KB 3O3BA 4LQ1A 2ICEA 4OCSL 4OD3L 5DR5H 1TTGA 5JUEL 2CDEA 4IHOA 2M2DA 2I9TB 2IH3A 4OGYH 4F7CA 3GHBH 4R7NA 1U93B 4LSVL 4LLUB 2HFFB 1GGUA 4XVSL 4PR5B 2MTPA 2VXVL 4AIZA 5EOTB 1SEQL 3BN9D 5C08D 4MVBC 2AV7B 1T0NB 4QRSA 3QFJE 1MOEA 5JW4R 2UYLA 4LGRB 4L9DA 4P2OA 2FLRT 5D1ZA 4JR9L 1GOFA 3MJ8A 1A9EB 1U8NB 2JCCB 4X8XA 5CZVH 1EERB 1Z5LB 1DQQB 3FT3A 1AI1L 4PJGA 3BDXA 1F4HA 4A6YB 5FM8A 3NPZB 4DVBB 3DXAB 1VPOL 4PJEA 3WDJA 5HY9B 5J57B 3AY4A 1P4LB 5DD6B 2Y6SD 5IM7B 5L8JB 3RL2A 1LO0L 3T0EE 1ZA3A 3OGCA 3ES6B 4IM8A 2MQCA 3QNXA 4PV8B 2BP3A 1FN4A 2XKNB 1YDPA 3FQUB 4I18C 3JV0A 4L8SC 1RZJH 3MYZA 4OZGB 1IC1A 2EXYD 2UZYB 4Q9CA 1UKSA 4N1CA 1MRCH 1PG7H 1OQOA 2YPVL 5KSAC 1VFMA 1CXFA 2B1AL 1J18A 2CDFA 2VRAA 3ARGC 3KYKL 4M7JH 4MXVF 5IW1B 3ARPA 5J3HD 2WQRA 3QIBC 1KPUA 4NNYA 2EDHA 5C0IB 2YR3A 4IJ3C 1BEYL 2KL6A 3F12B 3EOBB 1CGSL 4OZIB 4LCWE 1QFWI 5DDHA 1JI2A 4R0LC 3V8OA 3D3VB 3PGFH 3BESR 4KI5D 4Y4KA 3GJFA 3VFUA 2JJWA 4QXUH 3T1FA 1QYGH 1E6OL 4YE4H 1G9MH 2FJHB 4K94C 5I1JL 5JIIA 2K1MA 4HC1L 3DV6A 4NQCB 2DLGA 1TLKA 3ULVD 4OTXH 5E5RB 3VXUD 5ID1A 3IDGB 3SKMA 2XPGB 2VDLL 5DC9B 1EGJH 1MI5E 1ORQB 1WEJH 2UVEA 3GEWB 3QQ9D 3WJLC 5FUOH 4LDOB 3PHOA 1U91B 4HWZB 4RGMC 2JELL 1GPOL 5C0JB 3MOAH 4PJIA 3AREB 5IK3A 4BFBD 3Q0HA 4KI5F 3EYOA 4WFFE 4O5LL 1MQKH 5ALBL 4TVPL 2G5RA 1RZKL 2FB4L 1QSVA 5F1IA 4AY0A 3LEVH 3RPIB 4EN3A 5JHDD 5I8OL 3B2VH 3D85B 3TBWB 3IDXH 5I1HL 5DS8B 2B4CL 5F7DB 3W0WE 3QI9B 4KVCL 2JB6B 1G7MA 3O2DH 4L4TD 5A3ID 4N90D 4TUJA 4V2CB 4M6AA 1G6RH 2AK1H 3D0LA 4NQXB 1FG9C 1A1NB 1FO0L 1B6UA 3ILQD 5B39G 4ZD3L 4MB5A 1SJHA 5FM5M 4RGNB 1C12A 2DM7A 3QIUB 2HT3D 4KK6D 3UBXG 1UB6B 2VXQL 1P7HL 1LO2H 1DUZB 4N1HB 2IAND 1MCEA 2EDWA 1FRGH 3DSFH 3G6JF 3V5HA 4QGTA 4JRYB 1ZSDA 4BELD 3OG6B 1MY5A 1HHIB 3U7WH 5KSBE 1KCKA 2BNRB 1Y0LB 2ZSVB 3MBXL 2X2YA 4S1SL 4CU8A 1Z9LA 2IQAB 2CRIA 1JHKL 1M6OA 4RNRA 2NXYD 1R24B 1QFUH 2WANA 4YPGA 5AAWA 5IBUG 2BVQB 4TN9A 2XWTB 3O8XC 4XWOD 2UWEB 4NO0A 4PP2A 4F58L 4NC2B 3DRQB 5K9QG 4HJGB 5DJ2B 2ZPKL 1MQ8A 1R3JB 4MNGA 4JRWA 1X4YA 3AC0A 1YEEL 4JZOB 1MCOL 5HGAB 4P2OD 5D1ZD 2R2HB 3DVIA 2OSLA 3QCTH 2EYSA 4X4XB 2MCPL 3V0VA 4M43H 3BPCA 3GSUA 1NC2B 1MREH 1UH4A 2IPUK 3EFFB 3VFRA 2IPUG 3CVHH 3KPSE 5E8NB 3K46A 4MQ7A 3G5ZA 3BMWA 3VW3L 1KJMB 3O41B 3DWTA 4M03A 5HGDA 3QZWG 1X5FA 2FX7L 1N3NB 3S88H 4U1LB 3OR6B 2F8XC 3LD8B 2VQTA 4O2EA 4ZUTA 1XR9B 3HLAB 3KWWA 3VH8A 4MCYB 1OP3K 3U83A 5F9JB 1MPAL 5T3ZE 2G9HB 1FSKC 1KFAL 4YGVA 1CT8A 4FQJH 3BEVB 2AGJH 2YSSB 1EJ6A 4KAQL 4PJGF 5J6GA 5LGHH 4U1KA 5DD3L 1JCKA 4ONGL 1V8HA 1ITBB 2NCMA 3HI5H 4IRSC 1Q1JL 4OF7A 4LCWB 4E41E 2E6PA 1GAFL 3N9GL 6FABH 3U30C 4XPHH 1DL7L 4QHUB 2LFGA 1IMHC 2H32A 3VWKA 4KGJA 1U95B 2IMMA 1SEBA 1J8HA 4OQTA 3V7AG 5J6HA 4Y4KD 4DZ8B 1GRWA 4OCSH 4OD3H 5JUEH 3VMPA 4UV7L 3ZKQD 1CG9A 2NY7H 4LSVH 1H3VA 4NRZA 4OUUA 5CP3H 2VXVH 3LCYA 1MI5B 3PIQB 1BJ8A 2HVJA 4OFDA 3MGTA 1X5XA 4JR9H 4BSVB 5LQBH 1CQYA 1MF2L 4KQ3L 3BQUA 5IHZB 1T7VA 5FK9A 4CVXB 1SBSL 1AI1H 1AH1A 3I6LD 3S7GA 2CLVB 5E2UL 1IM9B 2YXFA 1NBZB 1UWEL 3P40A 3RY6A 3UTPE 2YPLB 2CXKA 2GTWA 5CEYA 4D8PB 5L7XL 2WIIB 4GKSB 2CJUH 4IMKC 3B5TA 1N0XH 5LG1A 1YNKL 1LO0H 1R5IB 4EN3D 5C0DB 1AC0A 1NCTA 2HLFC 4JY6B 4NWUL 4RMSA 2VSCA 5L88L 1XCQB 5FHAH 1YJDL 2ADJA 5DK2B 3CCHB 1VB9A 3REWA 3ME0A 1I8MB 3S97C 1I9IH 5CJQH 3JVGA 3SDAC 2YPVH 3L9RB 1AIFA 1Q9OB 3QO1B 3F7PC 1I1YA 4KHTH 2B1AH 3KYKH 2Z8RA 3OKKB 4MQSB 1WSST 3TJHC 4Y4FC 4JDTL 1O7VA 1UKTA 3F7VB 1NCCH 4AG4L 1MWAA 1XF5A 3QUMB 1CGSH 4CRPA 2FJGB 1A4JA 4BK4A 3LN5B 1DR9A 1EV2E 1XZ0B 2GTZA 3CZFB 2XWBA 2V5YA 3BP4B 1TQCC 4AH2B 3MYJA 5B8CC 3M07A 1JP5A 1FL3A 4MSWB 3BP7B 1PX3A 4NO0D 4ZFOA 4RMWA 3S9DB 2ARJQ 3RDTC 1K2DB 1ITCA 1II4E 2VDLH 4Z6AT 3R1GL 5L2KB 4Z7VB 5IR1A 3KPSB 3TVMC 1JHLL 4GT7A 3UTTA 4M8QA 2BNUB 2JELH 1GPOH 2QKIA 4WGWB 4NYLB 4GOSA 5FB8B 2KDGA 4EDXB 1JTTA 4HUUB 2HRLA 4O5LH 2JJVA 5ALBH 4TVPH 1SY6L 1INQB 1RZKH 2FB4H 5TF1L 2ITCA 3G5VA 2DL9A 3DRTB 5D6DC 2R23A 4OLUH 2AXGB 4NBYB 2H3NB 4LEOB 2W60A 1KG0B 3SY0B 4HCRL 3RTQC 3VFMA 4KVCH 1YN6A 1ZVSB 4QRTA 3LQZB 2DI8A 3UPAA 1LD9A 1FO0H 2J2ZA 4YX2L 5SWQB 2AQ3A 1S78D 4ZD3H 3A6BH 3R0MA 5D2NC 1Z9OA 3BWAB 5DJZA 1FZKB 4D0DB 2JJTC 2VXUH 4U1IB 5GS0C 4I18B 4NQEE 2ZCHL 4M00A 4OV5B 5DMIL 4R96A 3BSZL 3VWKD 1P7QA 2B2XL 5IB4B 5IW6A 5KSAB 5SWSE 4S1SH 5E7FA 1J8HD 4YH6A 3LQAC 3S3PA 3ARGB 3N06B 3RVUC 4BZ2L 4ZAKA 1A6ZB 4M1GL 4P4RB 3QIBB 1FCGA 1NJ9A 3PGDA 2Q76B 4IJ3B 4F58H 2NPLX 2FSEB 3EZ8A 4MD4B 1OAKH 2GJ6B 1WBXB 2ZPKH 2DAVA 3HB3D 1S7TA 2E8ZA 2R0ZL 4YHPB 1YEEH 1MCOH 1BIIA 4R0LB 1AD9A 1QSFA 4YJZL 4LOUD 3ZO0A 3TO2B 2MCPH 3MNZA 4IOFD 5KANI 1CE1L 3BQUD 3NN8A 4X0KA 4JO1L 4PJDE 5SX4I 1JYXA 3JWOH 3TBYA 1DQML 2VYRE 1JGEA 4X6CE 3VW3H 4ODSH 1SYVA 1G0XA 2ZWLT 3IU3B 1CCZA 2FX7H 4B53A 3U46A 5IHLB 4JFFE 1DLHA 4MNHB 1OGAE 3ARUA 5GSRB 4OCNC 2OZ4L 3ZYIA 5CEZL 5GHWL 5C0GA 5BXFA 1DUYA 3N1FC 4W4NA 2XFXA 2OM5A 3BN9C 5D7JA 3T3PE 2HH0L 3HI1B 3A0OA 2X40A 4KAQH 1YEHL 2K7PA 3HUJF 4XP6L 2VWEC 3EOAA 4FQLL 3OR7A 3IRPX 5DD3H 4U6XB 3B43A 3OKMA 4ONGH 4E5XB 1F8TL 1Q1JH 3N9GH 4IOSD 1AGBB 2W9DL 5FYLH 1AQDA 4MX7B 2VTFA 1XR8A 2ED7A 5DGQA 2YOCA 3O45B 1ZE3C 3WFDL 4WI8A 5IVXA 3B8SA 2F54E 1T1XB 4ZFGL 3GMMA 2GYSA 1JNLL 1ZWIA 1MFEL 1NLDL 2ZSWB 4UV7H 2X4QB 4HUWB 1OF2A 4U33A 1ZLUK 4UINL 1NBQA 4U1MA 5MEPB 4XZUA 1YEJL 3TN0A 4M6NH 1YZZA 1PW3A 5DRXB 2EXYC 4QHNA 4ELME 2BX5A 4KTEL 2XZQL 2VZ3A 4KKBD 1MF2H 4KQ3H 1TFHA 3UTTD 1MCWM 1DANU 3O8XB 4G6JH 4NRXA 3NBNA 3HZKB 5LVEA 1SBSH 1G1YA 3L7FB 4H26A 5J3HC 5TPWL 5T1MB 4QOKA 5FUCC 1OAZL 4JE4B 2QSCL 5F8RC 1AP2A 3VFVA 3Q6FB 4KDTC 1U8HA 2ICWJ 3CXHK 4K9EL 5KS9E 2DQIL 1P4BL 1OGTB 1FFQA 5IMOB 2DL2A 3LKSA 3PGCA 1YNKH 1CGYA 5DURB 2AAVA 3LHPH 4KI5C 3PP3K 1VEMA 2AEPL 5TGBA 5C0BB 3FQWB 1YJDH 5GGVY 4PJBF 1W72L 1TIUA 4BKLA 4XCYB 3FFCA 1XGUA 2BVOA 3MR9A 4AEFA 1LVEA 5E6IA 2AJSL 5SX5H 4RA3A 1Q9WA 4YXHL 5EIQA 3ULVC 3EJYC 1HCFX 1YEIL 4Y5YA 4ZPVB 3QQ9C 3I75B 2QHRL 3MROA 4JDTH 1K6QL 2EKJA 3QQ3A 1LQSR 2ZUVA 5SWSB 2ZOLB 3DUSB 2EH7L 4JGMA 1FSKB 1P7QD 3H2WA 3ZHKA 1ZHBB 1IAII 1PYWA 3Q6GH 2N1KA 4ZTOL 1HSAA 4WV1B 2DTSA 4GRWF 5LCVL 5FV1L 4ZAKD 3PABA 1JHTA 4IRSB 5HYSA 3NZ8B 3O6LH 5IESL 1NGQL 5D2NE 4X9HA 2X4NB 3U30B 5DK0A 2IMNA 2ZKHL 4HIXL 1E4KC 5IBTL 4JPKL 4KUCD 5A3IC 3R1GH 5ERWB 4CGTA 1QSFD 4X4ME 2CO7B 2J3SA 1AJ7L 4WUUA 1JHLH 3ILQC 3G6AB 1AY1H 1Z6JT 3LMJL 2D9CA 4WI7A 3UO1L 1IC4H 4AT6B 2XN9A 4XCCL 3QO0A 5L8LB 2HT2C 2HT3C 4I3SL 4KK6C 5D6CA 2XNAA 1FPTL 1KULA 3QDGA 3ARFA 2PYFA 5DHYB 1YUHA 2DBLL 2IPTL 5TF1H 1EX0A 5LBSL 3TZVA 4ONOA 5GGSA 5MI0C 3LN4A 3SDXE 1IC5L 5JIHA 2WUBL 4JY4A 2CKBA 4WFED 3S37X 2NXYC 1OVZA 4OBRA 1C5DB 3VMNA 4O58L 4XWOC 5DJ8B 2YEZB 2DTML 2NTSP 2OCFD 3TCXA 1WFOA 2OXHA 4M62H 4Y0GA 1I7RB 1CS6A 3CNKA 5ICXB 3QISA 4P2OC 1UH3A 5D1ZC 1KB9J 3L5XH 4FTVA 1DE4B 4FP8L 1EEQA 1FLRL 5I2IB 1NFDE 1MCCA 3GBMH 5T1KB 2ZCHH 2F5BH 4OFYA 2F54B 5DMIH 5DLML 5EC1A 3BSZH 2B2XH 2VXSL 3NACL 1QA9A 3DUUB 4IDJH 4ISVA 3B2UD 5HXMA 3V5DB 4MXQD 4OZ4A 3ULUF 3VD7A 4BZ2H 1LO5B 5IVZB 2A83A 4RMUA 4FXKB 4M1GH 1QR1B 4NO3A 4Y4FB 4UV4L 4CN6A 1EBAA 2R0LL 4YHYC 5DQDL 1SBBA 1ND0B 3BZ4B 5FYJL 3TN0D 4ELMB 4HKXB 1XGTB 4C4KO 2R0ZH 4V1DE 5T5FH 5MHSD 1TJGL 4HH8A 1PSKH 3F7YA 4MQXD 4MXVE 1WWBX 1CE1H 3L3OA 5B8CB 4JO1H 2ZNWA 4H25A 4DN3L 3VJ6B 4WENB 2NYYD 1DQMH 4OZFH 5KS9B 4QOKD 1HHHB 3RDTB 2JK5A 1F3JA 1HXMA 1W8OA 4OGXL 4YDJB 1J05A 4FMKA 1J10A 3TBSB 5GRJL 4NDMB 2IBBA 3TVMB 1S7UA 1YA5A 3VCLA 1J0JA 1PX4A 5D2LA 4Y4KC 5H37H 1A3LL 1KSRA 2OZ4H 3WIIH 5CEZH 3IXAA 2Y5TB 4JPVL 5GHWH 1E4XL 4HS3B 4M7LL 5DRWA 2JJUA 1XEDA 3FFCD 1F6AB 1W0VA 1NGXB 3GMPB 1ES0A 5E6ID 4WU5A 5HI5D 4BQCA 1RV6X 4PTUA 5H35B 1U3JA 5FUCE 1M7DB 4L4VA 3P4OB 3L3GA 1DTUA 1A9BB 3QEGH 5GGRY 4U0RC 4XP6H 1YEHH 2X05A 3MV8B 2E7HA 4FQLH 5ITBL 1FBIL 1HE7A 4JJHA 3OKDB 4PY8J 2F5AL 1F8TH 4L3EE 1S7WA 6CGTA 4NM4L 3RWCA 3WHXA 3RTQB 4LKXA 4OI7A 4KI5E 1P1ZA 2VUYA 4OCWL 3D18B 1JGDB 3GMLB 4GFTB 2J6EA 5GS1A 3RWJA 4FRWA 4JFDA 3QBTB 1JNLH 1I3RB 1MFEH 1NLDH 3GI9L 3NIFF 3ULVE 4XCEB 5HYIA 2FEEI 1U8JA 4EN3C 1H8SA 4UINH 3O9WA 5HHQB 1CDBA 5JDSB 3K3QA 3P4MB 1AGCA 4OF5A 2O5XL 3HPJA 4OFKA 3X14A 4PLJD 5FYKL 2LABA 2OL3L 3H7BA 4CW1A 1XGQB 1KLUB 1UEYA 2X89A 2WINB 1RZIA 3NCJL 1N5AB 3BPNC 1WIUA 5EFIB 1ZLVH 1YECL 5JW5A 4WUUD 4P2RE 3WS3A 4CN1A 2Q7YA 3X3FH 3QDMB 4LPWA 3G6JE 2YWYA 1R5WB 2XN9D 3DROA 4MZ2A 1OAZH 1KTRL 1DDHB 2B1HL 2QSCH 2LTQC 5JHDE 4K3EL 3QDGD 4PJCE 5M94B 3SDXB 3ARFD 5FIEA 4K9EH 2VQ1A 3SQOL 2DQIH 4P99A 3TZVD 4FFVC 5DUBA 3VXQA 2AEPH 2D03L 4LSUL 3MXWL 4LRNL 3OTTA 4PGJA 4WFHE 1XF4A 3G08B 5LGJB 1W72H 5EBLB 1I9JL 3UDWA 3FB8B 2R2EA 1G7HA 2AJSH 3BUYB 2A73A 3QRGL 4FZ8L 1HH9A 4Q97A 1YEIH 5JOFB 1Q0XL 1NFDB 4Q9RL 1F4YL 4DGYL 1U8IA 5L6YL 4FTVD 2QHRH 4MB3A 3GSOB 2L7JA 4IS6A 2XA8L 5JIPA 4GAGL 4OFYD 5DQ9A 1E28B 4G80A 1H3UA 5FA3A 4ZTOH 5LCVH 4ODHL 4OUOA 4DGIH 2D7PA 4E0RB 3PWNB 1T7WA 4ZDHA 3V2AR 5IESH 1NGQH 4K7PH 2P5EA 1G84A 4HIXH 2ZKHH 2Q20A 2NW3B 3U9PL 5IBTH 1FIEA 5CJXA 3UYPA 4PJGE 1JV5B 2VO5A 5E94A 3O4LA 3JWDL 5BW7A 4IOIA 1LEKB 1AJ7H 1FVEA 4PJEE 4JQIL 4HIEA 4OV6F 4QRQB 1S78C 1XCTB 1MHEA 3LMJH 4JDVB 3UO1H 2D0GA 3SPVB 3LPFA 4QHMB 4I3SH 2NY5L 4X5XB 3D9AH 3FOLA 2DBLH 2IPTH 4P4KA 2JB5L 2HN7A 3MLTA 3G5XA 1S7SA 1TCRA 3KPNA 1IC5H 1JGLL 4CMHC 1OOAA 3FO9B 1OQXA 1L4IA 4N0FA 5F7FA 4GG6B 4WU7A 5IQ9B 3RIFF 3VRLF 4MA3A 1YPZF 5AAMA 4L8DB 1JF5A 1RU9L 3HB3C 4O51B 4S10A 4WW1A 1CGWA 4L4VD 2LQRA 1M71A 5E2TL 4UDUA 4EZMA 4CL7A 5JXEA 4LOUC 3HRZB 4FP8H 2VDOH 4IOFC 4X83A 5IVOA 1FLRH 5B39A 3EJZD 3BQUC 4LLMA 3L3HA 1WC7B 3OMZA 5MERA 4Z78A 2EO9A 3UBXA 4LVHC 4KJYA 3O3DB 2VXSH 4C59B 2C7UB 3AROA 4RFEB 3NACH 4D0CA 1HQ4B 3VXUB 4A6YL 1N59A 4POYA 2XG5A 4NQUA 4BJLA 2Y7QB 4JFDD 5D9SB 4YXLL 2R2CA 1EHNA 3ETBF 2ESVA 4UV4H 4NN5C 2R0LH 2NTFA 4RAUA 3REVB 3O9WD 5DQDH 3I3DA 1IJ9A 5FGSA 1MFAL 1M05A 3FB5B 4ONHB 5EU5B 5FYJH 3AFLA 3AMLA 4BFGA 1RULL 2AW2A 3PDOA 2X89D 1TJGH 1MLBA 2YMXL 3I6LE 4PJIE 3JVGC 5C1MB 4QT5A 1I1FB 1F4AA 3VXOA 3R8QA 5F7EL 5JHDB 2JTDA 4R3SB 5TDPA 4PJCB 3TO4C 3FCTB 1N7ML 3UBXI 3WDHA 4DN3H 1H9VA 1ORSA 3CSPA 1JWMB 2V2WB 2WLZA 4X7CC 2A38A 5HVFB 3GB7B 5A16A 1ZGLB 5I0DA 4L4TB 4WCYL 4XI5D 2CMRL 5GRJH 3BVNA 4ZFFB 2X4UA 5D70L 4PG9B 4PJ5A 3QZWA 1CDYA 1BPVA 1UCTA 3FONA 2CXGA 4JPIB 1E4XH 2R8SH 2CIIA 5F70A 3GIVA 2IANB 4PJ9A 4WI2A 5TF0A 5I6XC 3P0GB 4I2XA 2C9AA 3MUY1 3GSNL 2BVUA 3AAZA 2GAZA 3GJEB 4RRPG 5KVFH 5MI0B 1LILA 1Q9LA 3O3BB 5K9KA 1FBIH 1X4ZA 2ICEB 4KKBC 4X5WA 2CDEB 2NXYB 3P4LA 4IHOB 4X9IA 2IH3B 4NM4H 3EDEA 4F7CB 4R7NB 4HXBL 4AIZB 4QRSB 2CH8A 2UYLB 4P2OB 5D1ZB 1BM3L 2P46B 3MJ8B 2BSSA 1IQWH 3GI9H 2PTVA 3CFIC 4NM8H 4XAWL 4C54A 4HD9A 4Q74A 1U41A 1JGVH 1T3FA 3IFNL 3NPSC 3MXVL 4UT7L 1R0AL 4XNQA 2P5ED 3QDAA 3FT3B 2P1YA 2O5XH 4PJGB 5FYKH 3FRUA 3B3IA 2OL3H 2GSGA 4YFDB 3WNLA 4PJEB 2Z35A 4WFGD 4YFLI 3NCJH 4XGZA 5IEKA 1KV3A 3O4LD 1YECH 3WLWD 1ZA3B 3OGCB 1VFAA 4XP9H 4OT1L 4YHYB 1F4XH 3QNXB 3V5KA 4HWUA 4KFZC 4R2GD 3CX5J 3JSSA 2B1HH 1FN4B 4LAJH 1YDPB 4K3EH 2VLMD 1CD8A 3HAEH 5SV3A 4ZUUA 4P4KD 3TNNA 3BZEA 1A1OA 4JFQA 5AWNL 2CDFB 2D03H 4LSUH 1YC8A 4CU6A 4LRNH 4ZAKC 4GQPH 1ODAA 2VR9A 4LPVA 1I9JH 1KPUB 4NNYB 4GKOA 1X5YA 4NC1C 1DEEA 2DQUL 1L6XA 3QRGH 4FZ8H 3JTTA 5DDHB 1Q0XH 1TJIH 2GHWB 4DGYH 5JXED 4Y4KB 5F1OB 3B4NA 1FNSL 2VDNL 3GJFB 5J1TC 5DC4B 5T5NG 1H3WM 3T1FB 1J8HE 4YBHA 5GS2D 3P9WB 4CKVX 1KCRL 3K2MC 3AVEA 5DMKA 3DV6B 2OMNA 4HWBA 4Z7UF 5ID1B 3I3BA 1F5WA 1LP9A 3SKMB 5BRZE 9CGTA 2X1PA 4QEGA 3ARDA 3S98A 1AD0A 3HI6L 4ODHH 1M7IA 2ESVD 3PHOB 5IB5A 5C9JA 3X13A 4PJIB 3ULUC 5HHNA 5IK3B 1NDGA 2R29L 1A6PA 3EYOB 2X10A 3FN0L 1KCVH 3TF7C 5D7JC 3CDGA 4OCYL 1PVHA 5F1IB 4JQIH 4MA8L 3RVWD 4EN3B 5HDQL 5GZOC 4NOBA 4EI5C 3C09C 3ESUF 2VLKE 3LKPA 3H42H 1OP5H 1EEUA 2HJKB 2E9JA 2P8PA 3RVXD 3ZTJG 4AMKL 2GK2A 2DKUA 3HMXA 1G7MB 1OD9A 4TUJB 1IZJA 5I30H 2JB5H 1K3IA 2XZAL 4NZTL 3D0LB 3B2UC 4PJ5D 4ORGA 4MXQC 5DVLA 5A2KH 3CSGA 2P24A 1SJHB 1MNUH 3STLA 1UWXH 1C12B 4JG1L 4HWNA 3SGEH 3MRJA 3C5ZA 2LTQB 4AL8L 1X4XA 4PJ9D 3GK8L 4DKEL 3TN0C 2DI7A 3V5HB 1ZSDB 1A6UL 4QTHA 4Z5RA 5J8OA 2B20A 4GAFB 1CZ8L 5E2TH 2NY4D 4X4YA 4H8WC 4HWEL 2BY3A 4LSSL 4U6YA 1M6OB 2EIBA 4RNRB 4YPGB 2RIKA 4RFNC 2BOBA 4NO0B 2NYYC 4FABL 3OAZK 5FGRA 4MNGB 1XF3A 4A6YH 2Y1VA 3MX0A 4RFOL 1ADQH 2EEBA 3DMMA 2OSLB 2E27L 2EYSB 3V0VB 3BPCB 3GSUB 2YUVA 3E8UL 3S34L 1MFAH 3VFRB 4Q7DA 5DJDA 2GITA 4C83A 2PR4L 4MQ7B 5ALCL 1B88A 3G5ZB 1RULH 4YFLF 4X7DC 1UM6L 3MLRL 5HGDB 1C1EH 3PV7A 1RUKL 3LS5H 4Y5YC 5F7EH 2CK0H 3DVNA 1KB5A 1N7MH 4O2EB 3TWCL 1P6AB 3FB6A 3KWWB 4ZUTB 5IHUL 3VH8B 1UFUA 1HQRA 4NO2A 4YDVB 5ID0B 2APFA 4WCYH 1MCHA 4YGVB 1CT8B 4GRWE 3QUML 3TFKD 1GJIA 2EC9T 5J6GB 1KN2H 4U1KB 1U8QA 4J1UA 4P3WA 4LSQL 3RUGA 4HBQA 3MRPA 1KYOJ 1T80A 2H32B 3VWKB 2KQNA 4PLJC 5TJWK 3O0RL 1SEBB 4CMHB 1J8HB 1FLTX 2VMFA 5DYOA 4O2FA 5J6HB 4CAGA 1WVZA 4KV5F 3SO3B 3BPLC 4XPAL 4OI9A 1TNMA 3JTSA 4I77L 1IGCH 2V5MA 5C7XH 3IKCA 1CG9B 1RUQL 5C0RL 4NRZB 4OUUB 1X7QA 3WFZA 4R97C 1F3DJ 1JWSA 5EU6D 3EAKA 4NKOA 4QYOA 4ZS7L 7FABL 2HVJB 3ARFC 4NC1E 5CSZA 3KR3L 3MGTB 3VXMA 2R69H 3ARDD 1BM3H 1J5OH 3TZVC 1OHQA 1JMZA 1ZHLA 3IFNH 4UT7H 1R0AH 3MXVH 2IC2A 3BQUB 5FK9B 5T3ZL 3UYOD 4LVHB 1JRHL 3DGGA 5DUPL 4ZOEA 2GTWB 5CEYB 1WK0A 1UXWA 1QO3A 3WFBL 3MA9L 4LVOC 3BOVA 2EDEA 4NN5B 2DRUA 5CJBA 1CVRA 1IFHL 2K9UA 3BGMA 2ADJB 3BPOC 1OW0A 1T7XA 2BSRA 4POZD 1IL1A 2X7LA 4N68A 3REWB 2XI9A 3ULUE 4ODVL 4GXUN 4JN2A 1CDCA 1AIFB 3B5HA 1Z9MA 1I1YB 5AWNH 3AS1A 1JIBA 2P43B 1FGNL 1INDL 2ZCKL 3NA9L 3IDMA 1FP5A 3C5ZD 1OTTD 1MWAB 4BQ6A 5HHMD 1CIUA 1XF5B 4LP4A 4R26H 3MV9A 2DQUH 1ULVA 4W68A 4OLVL 1A4JB 3MBEC 5T3XD 2GTZB 4HPOL 2XWBB 1FNSH 2VDNH 3MYJB 5DJYA 1FL3B 1UYWH 1WQVT 3FMGH 1KCRH 3KJ6L 2PTTA 4ZFOB 2Y07L 4K94L 3KPRA 4MNQA 1D7FA 1BP3B 3SE9L 1FFPA 1FCCA 3HI6H 3BKYL 5IR1B 3UTTB 4M8QB 2DQGL 4LPUA 1GZQA 2QKIB 2Z93A 1N26A 1YNTA 1UADC 1A6WL 2R29H 4PD4J 1JZ6A 5I16A 1RHFA 4KK5D 3FN0H 3IXTB 2C1PA 1VHPA 5JMOC 2VOTA 3UTZA 4OCYH 4ESKA 1DSFH 2ITCB 3G5VB 5DEZA 4MA8H 4C4KT 3CVIL 2R23B 5HDQH 3NPSB 4NKQB 1UVQA 2YPKA 2W60B 3EJZC 4L5FL 4IDLA 4GRWB 3VFMB 2KZWA 4LRIA 3CJJA 3H9SA 1CXKA 5DUML 3P3YA 1NPUA 3QH3A 4AMKH 1YN6B 4AEEA 4DJMA 3ARZA 3O4OC 5GS1C 1LD9B 3MZGB 2D31A 3NIFE 3SBWA 2DWDA 3QDJD 2YD3A 4J3TA 4GBXC 1H8NA 5DJZB 4JG1H 5JXAL 3IVKA 4Z76A 3VXRA 3GK8H 4DKEH 4R96B 1A6UH 1P7QB 1RK0A 1CZ8H 3P77A 5IW6B 1KCSL 3IU4L 4M48L 4F7EA 4KUZL 1LK3L 3IDYC 3B6SA 4HWEH 4ZAKB 1QZ1A 4QRRA 3RL1A 1NJ9B 3PGDB 1AXIB 4FABH 5EZLA 2XZCL 2N7AA 1D5IL 1S7TB 1OLLA 5FGCE 4Q0XL 1K4CA 3MOBH 1BIIB 3VXMD 4K8RD 1AD9B 1QSFB 1MUJA 2E27H 5BS0E 3MNZB 2J8UA 2B8OT 3I3EA 4QNPF 3NN8B 3E8UH 4X0KB 3S34H 4M61A 3WN5A 2N56A 4RCAA 3TBYB 2NX5A 1N6UA 2PR4H 4ZNEE 5ALCH 1JGEB 5TDNA 1T0PB 3UDWC 1SYVB 1T4KA 1UM6H 4K2UL 3MLRH 2DJ4A 2AVGA 1RUKH 4S2SA 3U46B 1DLHB 4UBDC 3TWCH 4C56A 2H9GA 3FZUD 3SGKA 5IHUH 5CCKL 1T2JA 4OM1L 5C0GB 5BXFB 1WF5A 3L3IB 1DUYB 1GGCH 2XFXB 5D7JB 3QUMH 4D3CH 2CRMA 5A43C 3CFJA 1SYSA 1R3KA 3EOAB 3WNNA 3OR7B 3RIAK 1MHPL 1HNGA 3C09B 4GH7B 4J12A 4KK9C 3OKMB 2GY5A 3BD4A 3LKOA 4LSQH 4N5UA 1QRNA 1ZVYA 2LVCA 1AQDB 2I07A 2FD6L 4PP1C 3MV9D 1VGEL 1MVFA 1XR8B 1S7XA 3O0RH 1JPGA 4P46A 1R5VA 5CJXC 5IVXB 4LSRL 5BW7C 3GMMB 3WLWC 4QGYA 1ZWIB 4MD0A 4HUMB 3ZDYF 1RMFL 2RFXA 1OF2B 5FKPA 1WAAA 5C0RH 4U1MB 1QKZL 4S1QL 4XZUB 4R2GC 3TN0B 3FQNA 4CDHA 4XP5H 1OTUD 4KROD 3KPRD 7FABH 4MNQD 1CR9H 4Z7WA 4TTDD 5HBBA 4QHNB 4P4KC 5LAXA 4O2CA 5KJRH 3VG9B 3FJTA 4AK1A 3KPMA 3UPCA 5CIPA 2FL5A 4RFNB 1EAPA 4APQA 4NRXB 5T3ZH 2BXYA 4RDQG 35C8H 4G7VL 3VRLE 4MS8D 1YPZE 4H26B 3IDUA 4QOKB 3W5NA 1AP2B 3VFVB 1YY9D 5DUPH 3N1QC 1U8HB 1BQSA 1BWWA 3U48A 4S11A 2Y36L 4X9GA 3LKSB 3MA9H 3PGCB 3WFBH 3O6KL 5JXEC 5T1LA 3DURA 5TGBB 3PV6A 1OT1A 3GMRA 3VXTA 4BKLB 3FFCB 1XGUB 3H9SD 3I9GH 2BVOB 3MR9B 1J0IA 3GFUA 5E6IB 3VI4F 4X7SL 3Q48A 3BI9X 1Q9WB 3JUYA 4KJQD 1A02N 1PZ5A 4Y5YB 4L1HA 4CU7A 3S36L 5F7KC 1FGNH 3CVHA 3MROB 4PRPE 2D7OA 2MKWA 3QQ3B 4LHUA 2ERJC 4Y19E 3VXRD 1A47A 3Q5OA 4FQIL 4OLVH 1MCJA 1PYWB 4H1LA 4OKDA 1DVFC 4HPOH 1HSAB 3T0XA 3H9ZA 3PABB 4KMTL 3RVWC 4QRRD 5IMLA 1JHTB 3FRPG 5HYSB 3QPXL 4JPWL 5D8JL 4MMXC 4PJFF 1MCIA 3OKOA 4KJWD 5DK0B 3KJ6H 4I4WA 2Z31C 2NY6D 2Y07H 4K94H 3FQXA 3RWFA 3RVXC 3SE9H 4FFWD 3F65A 5D7IA 2QLVB 3LV3A 3OG4B 1A7NH 5KOVC 3MA7A 3BPLB 4BK5A 3VA6A 4WUUB 1AXTL 2UV3A 5J12C 2DQGH 5ADOL 3TCLA 5JZ7D 4N0YL 4R97B 3MLPA 3FKUS 2XN9B 3QO0B 2NX5D 1A6WH 3VD4A 5D6CB 4EQ2A 2P4AB 1XIWA 1J0YA 2XNAB 2AS5M 3QDGB 2F53A 3ARFB 4PJ9C 2L4OA 2PYFB 1YUHB 1IEAA 3MQIA 5ILTL 4M5ZL 3U6RA 3TZVB 5GGSB 2NY4C 1XGYH 3LN4B 3CVIH 4G9FA 4JY4B 1CDIA 2CKBB 4V2BA 2NY3D 5CP3A 4C56D 2I9LA 4L5FH 3RVVD 4DQOH 3WIHL 5DUMH 3UX9B 1CL7L 2XIDA 4UZGA 4XXCA 5CD3A 2BY2A 3F8UB 3KS0H 4N5ED 5AUMA 3V4PL 4OZHA 5F88A 4LVOB 1RFDL 2R56L 4FTVB 5IHBA 2ZCLL 5I1GL 5FDWA 5JXAH 1QD0A 3BPOB 5DD5H 2IBGA 1MEXL 5GGTA 1QRND 5GS0L 5EC1B 2G60L 3DVGA 1QA9B 5C0FA 1KCSH 3IU4H 4ISVB 4M48H 4P46D 1LK3H 3MLXL 4OZ4B 3IFLL 1LO3L 3LQAL 3WUZA 2A83B 3EDKA 3QXTA 4D9RD 4NO3B 3EYFA 3LSOA 2XZCH 4LDLB 1D5IH 2W0LA 2FECL 2WWKO 1NLBL 4Q0XH 4DN4L 1KJ3H 4NCDA 1P84J 3F7YB 3DPBA 1MRFH 5SWZE 3TFKC 3DECA 4Y5XC 5GRUH 4GUPA 5C6WH 1H15A 3L3OB 4GLRH 4APQD 2YD7A 1A7PL 4H25B 4JHWL 5IB1A 4EBQL 1GCFA 5HPMA 1AR2A 2P5WA 2PNDA 5C71A 5EIVA 4F8QA 4DUWA 2JK5B 4CNIA 1F3JB 1HXMB 4K2UH 5KVGL 5CSBA 5FYLE 1J05B 5L9DL 2VLME 1FHGA 2XKUA 4FQQA 1S7UB 3VCLB 4KJPC 5T1LD 5F6HI 5D2LB 1KTDA 3GUTA 5IBLD 5CCKH 3IXAB 4HC1A 1EBPA 4ZO9A 4JGJA 4OM1H 5DRWB 4YO0A 4Z7UE 1W0VB 2VZUA 1ES0B 3BKCL 4WU5B 2DF3A 4PTUB 4OAWA 4YWGL 2IJ0C 4L4VB 4OIBA 4XC1L 3RX7A 2L0DA 3ARDC 1Z0MA 2YHGA 2QR0A 2EDJA 1NMAL 1MHPH 1S9XA 1O5DT 3A67L 1G7PA 5F7WC 1LO4L 1S7WB 3RWCB 1W2KT 4LHUD 3WHXB 4LKXB 1P1ZB 1MJUL 4QKXB 1VGEH 4KVNL 3O4OB 2R1YA 5AG8A 2JCCF 5GS1B 4J23A 4NC0B 3RWJB 2Z91A 1C08A 1KUMA 4JFDB 4LSRH 2OK0L 3C08L 1HOCA 3WS6A 5DZLA 5B3NA 1A7QL 4F37K 1U8JB 3V95A 1NCAH 1QKZH 3CXDH 4X6DA 1MIEH 4S1QH 3DX9A 1A21A 1AGCB 2D7NA 1DQJA 3HPJB 3X14B 4POZC 5KN5A 2ESVE 1FO0A 1ROWA 4CW1B 2XKSA 5CZKA 4U1HA 1RZIB 4BH8A 1WBZA 5JW5B 3EIFA 1VDGA 3WS3B 1ZK9A 3V0WH 2Q7YB 4OZGF 4G7VH 4KDVA 4YK4C 4YHZH 4MXWL 4OJFL 1T0MB 3DROB 1XIWD 3C5ZC 3VGDA 1OTTC 2F53D 4YGAB 5E99L 1PQZA 4PLKC 1IGYA 2VQ1B 4CJ1A 4LF3A 5DMYA 2BHYA 1BD2A 1OSPL 4DOHE 1KXTB 2MOVA 3AS2A 4G9FD 5DUBB 2HKHH 3VXQB 1KJ2L 2BHUA 4HFUL 1P5VA 3DYOA 5HHOE 1BGXL 1MIMH 4U7SA 1XF4B 1WTLA 4OZIF 2VAAA 1ACZA 2R2EB 1FYTE 1G7HB 4X7SH 4YAQA 2A73B 4IIQA 1HH9B 1R3IL 3ULVL 1BBDL 3DMMC 1U8IB 3S36H 1DBKL 4PGDA 4ZFZA 5CBEA 2B7DT 4PGCA 1A64A 4IS6B 2ZJSH 2J4WH 5ISZA 1KIPA 5DQ9B 1KLFA 4FQIH 4CADA 1EJOL 4G80B 4OLZL 5FA3B 1T1YA 4KK5C 4L9LA 1I75A 3GJFK 1QBBA 3MRHA 4KMTH 5DRZA 5TQ0H 1S7VA 4G6FB 4ZDHB 2OTPA 3QG7L 3QPXH 4JPWH 2P5EB 1OAQL 4OZHF 4NGHL 1WZLA 3V7AE 5BV7B 3MJ9L 2G2RA 3AUVA 5E94B 2X9YA 3O4LB 32C2A 4IOIB 1CLZL 1FVEB 5DHVH 5D7LE 1AXTH 2QSTA 4HIEB 4Z8FL 1MHEB 3QCVL 3U9UA 1QSEA 1XF2A 1LWRA 2P5WD 4R2GB 5C0EA 3E6HA 1OM3H 4M7KH 4BSWA 5C09A 1KLGA 4K71C 5F7UA 2MPAL 1T2XA 2YKLL 3FOLB 5FXCH 1DQTA 5ILTH 4M5ZH 5KAQG 4P4KB 1Y18A 1ZHKA 2HN7B 1I8LA 5AD0A 3G5XB 3MLTB 1S7SB 1TCRB 3KPNB 4D2NA 1IT9H 2NZ9D 3T0WA 2IPKA 4N0FB 4WU7B 4H0IA 5F96L 4WWKA 3IAGC 4F9PA 1BQLL 1BVLA 1GZPA 5BZDA 5FEBA 4XNMA 1K4DA 2P49B 5D96C 1CL7H 2HTLD 4MA3B 4WW1B 4PUBH 3OF6A 1M71B 2YRLA 2FJFA 4UDUB 4K8RC 1HWHB 2R56H 4JANA 4F7MA 1XAUA 2UWEF 1CK0L 5IGXL 2OJZH 4G5ZL 2ZCLH 5I74C 5I1GH 5J89A 5B39B 3HN3A 4LLMB 3L3HB 1MEXH 3OXRA 5MERB 4Z78B 4UAOC 5GS0H 3L3JA 3UBXB 4KJYB 1I7TA 4D0CB 1H5BC 2YWZA 1N59B 4NNXA 2EYTA 1LO3H 2CDGA 3LQAH 2ATKA 4WEMB 5DD1L 4X5LA 4AYFA 5C2UB 2EDRA 2ESVB 1G0DA 4M9PA 2A74A 2NTFB 4RAUB 2ERJB 4G9DA 5ITFA 3FZUC 3JUZA 3CFEA 1M05B 1OW0C 4RAHA 1NLBH 4OB5L 3PDOB 2ATPA 1MLBB 3H3BC 4M1CD 3KDMA 5FOBA 4XMKL 4QT5B 2DIAA 3OBAA 5CFHA 3VXOB 4GXVH 4HZLA 2WM0A 1IQDA 1DEDA 5CMAA 3MCKB 5TDPB 4MMZC 1A7PH 4ELKA 4JHWH 1S9KC 1ORSB 2GIYA 3BD5A 4ERSL 5JQ6H 5A16B 2VISA 2IH1A 3MO1A 4DOHB 3AGVA 4XVJH 2GFBA 4PJHA 4WUKL 4XBEL 3VFNA 4KPHL 3UROR 3BVNB 5L9DH 2X4UB 2D2OA 4Y1AA 4PJ5B 1BD2D 3QZWB 2QV2A 5J12B 1HIML 2ZUYA 4KKAC 1BLNA 3RWHA 3FONB 3NGBC 2VL5A 4F15C 3VH8G 2CIIB 3GIVB 2HKFL 2KPNA 1NAKH 4PJ9B 3UCRA 1JZ4A 3TESA 4I2XB 4YWGH 3BXNA 1D6EA 2FHCA 1OTUC 4KROC 3AAZB 2GAZB 1GH7A 4XC1H 3U2SA 2NY4B 1Q9LB 1I9RH 4TTDC 2HMID 5K9KB 3CPLA 3A67H 4X5WB 1FZMA 1NUNB 3ZTNH 1BZ9A 3ELAT 5ISZD 3BYTA 2VDML 3OJDA 1AR1D 5I15L 4MS8C 4OM0L 1G1CA 1SY6A 5EBWA 2EKSA 2HFTA 4KVNH 3BP5A 3JV6A 1YY9C 2KBGA 5HDLA 3I84A 4XPBH 3C08H 2BSSB 2PYEA 1JPFA 3C6SA 4HCRA 2RCSL 2BC4A 4GMTH 3G6DH 5FF6A 1T3FB 4XNQB 1T03L 5DT1H 3WMSA 3K2UL 1T1ZA 2OTUA 3FRUB 3B3IB 4LRIC 4X99A 4JGUA 2GSGB 4I9WD 2BNQE 2Z35B 2N7BA 4XGZB 5IEKB 3GRWH 3GMNA 4KJQC 3MLSL 4UTBL 3SBWC 1VFAB 1QSED 3V5KB 4OJFH 3MLVH 3ARWA 2J5LC 5C09D 5E99H 3PWUA 4CVUA 2AJYL 3V52L 2VLJA 4ZUUB 1PDKA 1S7QA 4JEGB 2R9HD 3BZEB 2EE2A 3AMKA 1A1OB 1REIA 4XC3L 4JFQB 2IGFL 2CIKA 4MA7L 1KJ2H 4HFUH 5C8JA 1TVDA 1BGXH 2DMCA 1MFCL 4I5BA 4NP4H 4WWKD 2PN5A 1ACYH 4LARL 1HEZA 2Q3ZA 1NCBL 3MMEA 3VFOA 1DEEB 3KPLA 3ZL4L 4RZCA 3QEUA 4KJWC 2XYCA 5FA4A 1ZVHA 2FZ3A 1V05A 3OF6D 3JTTB 4FFWC 4P9HC 3JV5A 3ULVH 1FE8L 4QNPE 1PBYA 3NH7L 3MRQA 1PEWA 5EO1A 1V7ML 4GAJH 2I5YL 3GZKA 3R0NA 3VGFA 4FQXA 4WWID 5JZ7C 3QP3A 4LFHD 4OFIA 4DEPC 5CZXD 4LBEA 1YQVL 1RZGA 4Z7VF 2YA0A 2DIBA 5I76A 5DMKB 2JF1A 1EJOH 2FIKA 2ZP0T 2YUWA 4U6VL 5IEHA 1LP9B 5IOPA 3B9VA 3ARDB 43C9A 3FHQA 2BFVL 1AD0B 5TH2A 4YR6A 3SKJH 4X6EA 4TSBL 3CSBA 3CK0H 1M7IB 1MSPA 2JJSA 1RUAL 3VFWA 3QG7H 3VXME 5IB5B 2Q8AH 2NY3C 5C9JB 3X13B 1UXSA 4JQXC 1OAQH 1X5HA 3SGKC 4NGHH 2X4RA 4G8EA 5HHNB 3RVVC 1NDGB 3MJ9H 4FQ1L 4HS8L 3E1F1 3SQBA 5HTSA 2ZUSA 3LH2L 1HSBA 4GS7C 1FORL 3CDGB 4M7LT 4N5EC 1ZS8A 3U7AA 4AZ8A 3T08A 1FQ9C 1KN4H 1E27A 3LKPB 5FDYA 3D48R 1HN1A 2EC9U 3B9KD 1JNNL 4P5TA 4TNWF 2P8PB 2MPAH 2YKLH 3LEXA 4KK8C 5KW9L 3BKJL 4P46C 4Y1AD 3ZDYE 4ORGB 1MCNA 2P24B 1F3DH 3STLB 4OQTL 4AEIL 3MLWH 4YK4B 1BQLH 3VRIA 3MRJB 3C5ZB 5I75C 1ZLSH 2C4FT 3IDIA 5HHMB 2EE9A 3OL2A 5KBNC 1L7TL 1WLHA 1C7TA 1G9NC 4QTHB 4Z5RB 3ARTA 1ZT7B 1BVKA 1F42A 1HINL 3IRZA 4X4YB 3MSPA 3KYAA 3MV9E 4F57L 4U6YB 5IGXH 1P9MA 3TNMA 5KANG 4PJHF 3KPQA 4APQC 2BOBB 5IW3A 3NABL 3WL9A 4KZEL 3NFSH 3SDDA 1XF3B 1U3ZA 2XV6B 4HKZA 1VCAA 3LVEA 2AJZA 3DMMB 3R06A 4YC2C 5I1IH 4Z9KB 2PYED 4RA0C 3L1OL 2FBOJ 1W72A 4MNQE 5E2WL 3TA3A 2VLRE 1QFWH 3BUTA 3QXAA 3EJJX 4Q58C 5IBLC 3VI4E 1NUDA 5DJDB 5E9DE 2GITB 5IF0A 4C83B 1G7QA 4XP4H 3RWGA 4MYWB 2GJZA 4XMKH 2HA1A 3CZJA 1EHXA 2O5ZH 4M5YL 3S8WA 5DWUL 3DVNB 5F97E 1KB5B 1K5NB 4N8VA 5E8PA 4ERSH 3FB6B 5IB2A 4KY1L 1HQRB 4YPJA 4NFDA 4WUKH 4XBEH 2VLJD 3CFDA 4HF5H 4KPHH 2A2QT 1CFNA 4HUXA 1CFQA 4P2QA 2V7NA 1U8PB 2QQKL 1J86A 3RA7L 1HIMH 3WKNA 1WITA 4CJ0A 4PJFE 1FAIH 1U8QB 4P57A 5CJOH 4J1UB 2HKFH 4F9LA 3RUGB 4RMRA 1YYLL 1FVCA 4K71B 3MRPB 4YHNA 4U7MA 3SE3C 4ZFOL 4DVRL 2VN4A 3VXRE 2F19L 2D7TH 1A3QA 5DYOB 4O2FB 1I7ZA 1AQKL 4LCIL 3JTSB 4FQXD 2EYRA 1HXYA 2VDMH 4X6BA 2HRPH 3IKCB 1NCUA 3PL6A 3I6KA 4OM0H 1X7QB 5D96B 4HK3N 1FYHB 1JWSB 3QCUL 3S36X 4NKOB 1BOGA 1XIWC 3R4DA 4QYOB 2AJ3A 5CSZB 1R6VA 4ZQKA 3VXMB 1LMKA 3LB6D 1ZHLB 3AU1A 5I74B 5JA9A 3HFML 2OR9L 4ZUVA 1T03H 3HCVA 2PUQT 4UAOB 4J4PC 4OGYL 4OGAC 3GHBL 3FN3A 3T04D 3INUL 3RNQA 3WEXB 3DGGB 1H5BB 3PWPA 4D9LL 4D0BA 4MLSA 2ZG1A 4XXCC 4BQBA 1T89A 5HVHC 1UXWB 1QO3B 3MLSH 4UTBH 3OAYK 2DICA 2F9BT 4Q9BA 4NKDA 3FO0H 4PRBA 4IEFB 1MCWW 5B4MD 1KGCE 1CN4A 4XAKD 5TQ2L 4HEME 3BGMB 2RBLA 5C86A 2BSRB 1IL1B 4P5TD 2X7LB 2COQA 2QADC 1B0GA 2AJYH 5GPRA 4LCCA 3UZQA 1U8LA 2W65A 5FCUH 1KPRA 4JN2B 5IJKA 4HUVA 3HRPA 3MV11 4XC3H 4TRPL 4MA7H 3TV3H 1MFCH 4LARH 1NCBH 3IDMB 2H6PA 2VSDA 3ZL4H 1YEFH 3QWOA 4WRLA 3RWEA 2ICCA 3AM8A 3MV9B 5FO7A 5I17A 5BQ7B 1KT2A 1I7UA 1RZJL 5INDA 1B6DA 3RKDD 1MRCL 1PG7L 1QRNE 1V7MH 2I5YH 5F8QC 3NGBB 1A6AA 5GJTH 4F15B 3Q5TA 1X5KA 4M7JL 5FOJA 1P4IH 3Q3GA 2IALA 1OWRM 5DJYB 3O81A 2BCKA 1NFIA 2NY0D 4JFYA 2PTTB 4D9RE 3SDDD 4U6VH 4LLYA 4KROB 3KPRB 4MNQB 1WAAE 3MRDA 1FFPB 1CFSA 1RJCA 1F45A 2BFVH 3QA3A 1U3HA 4JDZA 3PGFL 5HYSG 1RUAH 4XNUH 3TA3D 4G6KH 2NZ9C 4ZSOA 1GZQB 2Z93B 2Z92A 3FRPA 1YNTB 3P73A 3OB0H 3RKPA 4FQ1H 4HS8H 3ULUL 1G9ML 1OCWH 1YNLH 3OKLA 3D1MC 2HTLC 5I16B 1CXEA 1F90L 2C1PB 4OBSA 1FORH 1G6VK 2APBA 3UTZB 5BOPA 3T3PF 2WWKT 4U3CA 1FL6A 5I8CA 5FUOL 1UVQB 1UJTA 4OSUH 2YPKB 3LIZL 1JNNH 3MOAL 3H9SB 4H88H 4YHIA 2JCCE 3QH3B 5GXBB 2W1NA 5DSCA 2RR3A 1QBAA 1SMAA 5KW9H 1C5CH 2H32H 1MQKL 3BMVA 4P2QD 3ZDXE 2D31B 3PNWA 2DWDB 3STBA 4JJ5A 3VGBA 3DXAE 4YXKH 2R15A 4OQTH 3LEVL 3KLHD 2B4CC 3WS6C 5LGKA 2OL3A 3IDXL 3IVKB 1EH9A 4Z76B 2J5LB 3VXRB 4QXGH 5IFHL 2Q1EA 1QHPA 5JQHC 5F9WC 1RK0B 3O2DL 1KENL 3P77B 3IDJA 4TNVK 4F7EB 2E5EA 4H0GA 4ACPA 4FNLL 4M1CC 3B6SB 1L9NA 4H8WL 1I3UA 4OZGE 1HNFA 4MAUL 4QRRB 3RL1B 5DVOA 2NNAA 3PL6D 3TBTA 5EZLB 3NABH 4KZEH 4RWHA 4OFPA 3P4NA 4Z7QF