2DQFA

Crystal structure of hyhel-10 fv mutant (y33ay53a) complexed with hen egg lysozyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqfA00
4HKJB 1D5MB 4WI6A 4ZO6A 3GMQB 4AENB 3Q3GB 4XPTH 3A6CH 3PJSA 3ROLB 5JXAL 1CTOA 5KSBA 4DVBA 4URTB 1EHXA 3EOAA 4IDJL 4XT1C 2EYSB 5CEXA 3PWJB 3B2UD 3H9YA 3BWAA 3FFCE 2G2RB 5HHXL 3U83A 1NC4B 5E94B 5FCUH 5K9OA 5I16B 2K7QA 3ZL4H 4FQPA 3GMRB 4LHUB 5E24E 5FEBA 1U3HC 4X4MA 5ALCH 4YR6B 5EC1B 4TNVK 2OTWA 4PP2A 3DARA 2NY5L 4FG6C 3SCMC 2YKLH 1T04B 4MQ7A 4NZUH 1RZGB 4LAQL 3EOBA 2W65B 1W0YT 5MENB 2NX5A 1D5XA 1GHFL 3PF2A 5GGQH 2ZG2A 4PJEE 4MZ3A 4LRIA 4ONOA 1W72A 3VXUB 1T0MB 2FGWH 2ATPA 2ADIB 3C2AH 5HGBB 5BS0D 4OF6A 2JB5H 4Z0BL 1ZA3A 3QEGL 4JFZH 3ISWA 2Y36L 2FJFA 4HGKC 3O11A 3D3VB 4JN1L 4OGYL 5T1MB 4LDLB 4JM2A 3QDAA 3T4YB 1FNAA 5L0QC 4LSRL 1S78C 4LKXB 5T1DL 3QQ4A 2G75B 2R2EB 3ARXA 4UINL 4Q0XH 4AEIH 3QDGB 4POZD 4BQ9A 3BRFA 4M7KH 2HT3D 1FZKB 1JYWA 4JFDD 2YPLD 2DQCH 2UZIH 1QD0A 5BJTA 1BOYA 5CJOL 4HWBH 3TIEA 3WSQL 3WHXA 1B0GB 1TETL 5I18L 1A7NL 4J2XA 2J4WL 5I1CH 3PG2A 4LLDA 1CICD 4ZO9A 3P0YL 2QTEA 2X4OA 1ZTXH 4NQTA 5BXFB 4Z76A 4PG2A 2HTLC 5SWSE 2EH7L 2AI0L 1G9NL 1O7SA 4JO3H 3DV4B 5FDYA 3G6JF 3GJFK 1XIWD 4JY4A 2HJLB 3QUZB 3LKQA 4P2CG 1RUPH 3HFML 4QXGH 5ISZA 4XNZC 3GHBH 4LSPL 4RFEA 1A6VL 5GJTL 1ED3B 5FA3B 3IFPB 1LDSA 5DFWH 4PD4K 5FKPB 3S3JA 1SYVB 2AJUL 1DUYA 2R1YA 1H8NA 1SMOA 1WJ3A 4IRZL 3I3BA 5JIPA 2AQ1A 4JREC 5GRUH 1WBZB 5F9JB 5HI5C 4CW1A 4LCYB 5D9SB 5EU3A 5CSZA 4KKBC 4IRSC 3C6LB 1I1AA 2Y9RT 2ADFL 4I0PC 2L0DA 2VWEE 3O3UN 4ZOCA 1IL1A 2VDOH 3EYSL 1UM4L 2EDKA 4M8QB 3RTQA 5GRVK 5T3XH 1FL6B 3OAUH 3QI9D 5TE7L 3WKMH 3LPWA 5AZEL 3MROA 3LRSA 4NQUA 4MB5A 1DP0A 4XC1H 4KKCD 5GSVA 3BQUC 3GMPA 1A47A 2ZOLB 3MJ8A 4Z7QF 4YHIA 5ENWB 4KGLA 3G6JB 4B41A 1JRHL 1DN2A 1YPZE 1JGEA 5F7EL 3VXSE 5DJ6B 1A7BA 3IJSB 5C0BA 1KIUA 3G9VA 2XZCL 3IKCA 4GG8B 2EYTA 5DHXB 1LDPL 4M43H 5BS0A 1PY4A 2P8LA 3K4AA 2CKNA 3C5ZB 1WTGT 4FXGA 4U1IB 4GSDH 1KLGB 3RL2A 3FQRA 4APQB 1U8PA 1NH6A 1G6RB 1JGUL 4MA1B 4ONFH 5B39G 3IDXH 4WV1C 4K23H 3HHRB 3SDAD 5C09E 2MKLC 3LKNA 1U91B 5D7IF 4YDLC 2F5AH 1LO2L 1KB5B 3LHPH 4QRRA 5DT1H 3VI4F 5C0DB 4MD5B 1EPFA 2WUBL 4LRNH 2VABB 1NUNB 4KVNL 3T8XB 4O02L 4HAGA 5HI4C 4JHAL 3OXRB 1VACA 1MNUL 3FO1B 1S7TA 4KK9C 5T5NG 2VDNH 4NQXB 5IBTH 3BGFC 7FABL 2XTJD 5JW5B 1M71A 4GXUN 2IEPA 3UJTH 3GUTB 2QV2A 1TJHH 1UKTA 3HZYA 2DQEH 3SDXE 4OZGA 3TF7C 1M7XA 3RA7H 1ZGLM 4QHKI 3U79A 1JWSA 4PREB 3VA6A 4L5FH 1BBJA 3BAEH 2X7LB 3I2CH 1MHPL 2A9ML 5DXWA 5I8CB 1J05B 3DROA 5DK0B 2AEPH 4YFLI 1FHGA 1UA6H 5HVHB 4ZXBD 1RJLB 5GGTA 3MRCA 2JJUA 1CE1L 5F6IB 3I3EA 4QRUB 1REIA 5F88A 1AD9A 1J7VR 3RWGA 1WZ1H 3KDMA 4DVRH 3D87B 1A64A 5IJVB 3RHWF 4KAQH 5JORA 2ICWB 1JNJA 3B9KC 1ZHKA 1UCTA 4AM0A 1IMHC 3MRPA 5D7IB 1HK6A 3H8NA 3TBTA 3IU3B 1EV2E 3WHE0 4AH2B 1WLHA 1IFHH 4LSQL 4K3DL 5EU6B 4N0YL 3L3KB 3Q5YA 4L8SC 3T0ED 2NXYB 2BVPB 3I6GA 1XH3A 3ZE1F 4RAHA 1PQZB 5DHYB 1FORL 2E8ZA 1I4FB 1FZMB 4V1DD 5DRWA 3LN4B 5E08L 2AK4D 5D7JA 4XH2B 1Y0LB 4PBWD 5JR1H 1DLHB 4OLWH 3QHZH 1W0WA 2YD8A 5IFAH 3TT1L 1FG2A 5FKAB 3VG9B 4FNLH 2G9HA 5IBUB 2COQA 1TVBB 3MV7A 5HJ3A 1CFTB 4Y19A 3FMGL 1IEBA 1IJ9A 3MV9A 4XP4H 5CD3B 5JPNB 3SJVA 4YWGH 2FL5B 2PO6C 5IVXE 5KG9A 1OT2A 3MLXL 2IPUG 4MJ5B 4EI6A 5F7WC 2IPTL 1KXTB 1Y18A 4YJZL 1UXSB 4HXAH 5IMKA 5H35A 3HC0B 4YZFE 3THML 4HH8A 2P44B 1V7MH 3CH1A 5TPWH 4M6OL 4ZFGH 5KS9B 3GKZA 1SEQL 4XVTL 2D7QA 5DVKA 1YC7A 5E2VH 3JWDH 3RBGA 2NY7H 3LN9A 3OR7B 1KPRA 4IEFB 2F53D 4YXKL 2W60B 3ARQA 2BJML 4XVJL 1OOAA 4M93B 2EDTA 2BXZA 3BE1L 4KROC 1S7QA 4Z7OE 3QJHA 2P24A 1PVHA 3RDTD 1VGEH 2NY6D 4O2EA 1QA9A 2CR3A 3BHBB 4P3DB 4X6CE 1A6ZB 2WSKA 2K9UA 3MRHA 1C08B 2XZQL 3BIKA 4NQSB 2V5RA 5JO5B 3JV6B 3W9EB 2C1PB 1YNLH 5J57B 3BH8A 4PRHE 4Y2DD 5CD5C 4HZAA 3H42H 4HPYH 2EKJA 5DRZB 2YBRB 3CIQA 4XCFL 4XP6H 3X11B 2PYEE 2ED7A 4XBEH 4U3HA 1JPTL 3UYOD 2HLFC 4JPVL 4CRPA 4X99A 3RGVA 5CGTA 3UCRA 5ESAA 5GGVL 1NANH 1JTOA 3EO9H 4X7SL 5HGGS 1AE6H 2PTVA 2ENYA 4OTXH 5F9WB 1OAZL 4MNGA 5E8DL 1NC2B 1HHKB 2AEWA 4OD1H 3SY0B 1MFAH 4JFED 1A3LH 3SDCB 1A5FH 4XC3H 3S5LB 3UJJL 3BP5B 1CGSH 3RVWD 3VXMB 4BZ1L 4IOIB 3AXLB 4OZHE 4MD0B 3QA3B 4NBXB 2IAMB 3MJ6A 3QIUC 3TO4A 4QHNA 3TH3T 4G8IA 3FO2A 2VLLB 1AO7B 2G5BB 3ARGA 5DTFA 5AG9A 2DQHH 4N0UB 1SJXA 3WUWG 3VFRA 3P40A 3K2UL 1G7PB 4NNXB 4KY1H 2E3VA 1QR4A 2CIIA 3I50L 3HE7B 1T3FA 2P4AB 2HTKC 4U2ZA 5F21B 4P2YA 2I60H 4U6VL 4A2MA 5F1NB 4MXQD 1Z3GL 3UTPE 4HFWB 4JQXA 5D7LD 5DJ8B 3RFZC 4P2QE 3LPGA 1FNHA 2R23A 1TTUA 1AGEB 1N0LA 1D5ZB 1HHIB 1ZT4A 1B0RB 2C4FT 3BSZL 1RUQL 1NUGA 4PYHA 4P5KA 4AY0A 3OXSB 1CFVH 3MUZ1 2AERT 2Y25A 1VFUA 3PWPA 5FA4B 1UYWL 3P4MA 5DRNB 3MLTB 3KLDA 5DQDH 4WWKD 3ULUH 2YRLA 2X1XR 3OJDA 3UP1A 2GUOB 3ARBD 2V5MA 3KPRA 3VI3E 4I2XA 2VLME 3OJMB 1TQBB 1W0VA 5C0RL 3WNPA 1DVFB 3WNMA 4F57L 3PQYE 2H3NA 4K8RD 5FXCH 5EIIA 4P99A 3HAEA 3LQZA 5EUOA 4XXDB 5C09D 1X5JA 2GIYA 2Q76B 4FQCH 2JK5B 4OKDA 4FQ1L 2Z91B 2I24N 3VFUB 2RBLA 1ACYH 3V79C 1YEFL 4PRBA 1BFVL 4JFQA 1EXUB 2QQKH 1MJJA 3RWEA 3UAJC 2V7NA 4JKKA 1DSFH 2WINB 1Y6KR 3IU4L 4BFIA 4PJFA 4KDTA 3N1PC 3ZKND 5GGUA 3LS5H 1WBYB 3S34H 3D2UB 1PZ5B 3WIFB 1JHLL 4NFDA 3QQ3A 3Q0HA 5HGDA 2CUMA 4L1HA 5E9DE 5I1HL 3E6HB 1NCAH 1FYTA 1CU4L 4XPFH 1U3YA 1E0OB 4PP1D 4F7EA 5BW7A 4YIQA 2OI9C 2FSEB 3U6RA 2NXZC 4ETQB 3TIDA 3GSXB 1FNGA 2ARJA 1B4JL 1YEHH 3MJGX 1KBGL 4R3SB 4YHPB 5IEKA 1X7QA 4O4YH 1E4XI 3VG0L 4HUKB 1YEEL 3BW9A 5JA9A 2P5WA 4DGYH 4G7VL 3LQMA 1TZIB 1I9JL 3S96B 4DTGH 1ZT7A 1KB9K 1PLGH 3WJLC 4CMMB 3FO0H 3E0GA 3KPSA 5A2LH 1N7MH 4ODXA 5D1XA 4Y5VC 3WYRA 3F62A 1FNLA 2AJSH 4YBHA 3FT3A 5HHPB 1NCWH 1S9YB 2VXVH 1O5DT 2VLRB 4CVZB 1HHGA 2CUHA 4K3JL 1MFCL 1KN4L 1AXIB 2R4RH 3KR3L 4MAYB 1JUFB 2H32A 3PUCA 4UT6H 3B2VL 1KT2B 3LQAC 2H41A 3VXNB 5CBEA 4B7LA 3G04A 1N6VA 4PJAE 3O8XC 3PABB 3GJEB 3QO1A 3GSVA 1S3KH 1PGRB 3QCUL 2HRPH 3RJDA 3TBYB 3ZHKA 3Q1SL 1T21A 4X0KB 3K46A 4LHUD 1TTFA 2VXTH 4I48A 4R7NA 5TDNA 1HINH 1ITCA 1ITBB 3MUHL 1A9EB 3MRMA 3GSNL 2CKBL 3AM8C 2R0ZL 3MREB 5MEND 3MBED 4PGCB 1JHKL 5DWUH 3HNTH 1D9KA 3NA4A 4J6RH 2Z8SA 3WFDH 3VXUD 2NPLX 4RISL 12E8L 4F15B 3NN8B 4ESKA 1VCAA 3PDOB 1BIIB 1NLBH 4G80A 4POYA 3TBVB 4PV8B 4LL9A 1LP9F 1U0QA 3SGDI 3IF1A 3O6LL 4EI5B 4ONGL 2GTWA 4C56B 1FBIH 1CD1A 5BZWB 1BWMA 5BMFH 3RJQB 1U95B 5ITFB 5C0JB 2DYPA 4XCNB 3PWNB 2WWKT 3DV6A 3L95A 3OPZL 3SO3C 5HTSA 1AR2A 2NY1B 1CGTA 2D0GA 1HQRA 2Q3AA 1DEEB 1K4CB 3LRGA 4Y16A 4XNQB 2ICCA 5IFHL 2Y5TB 1CGVA 4JZOA 4KQ3L 4XPHH 3FTGA 4RIRA 3BKCH 4NN5C 1D5IL 3BPLB 1WIPA 3GO1L 1BFOB 1GPOL 4P49A 1YDPB 3QUML 4P4KA 1U36A 4ZO8A 1PFCA 3ILQD 1HH6A 4P2RA 4ODWA 3S6CA 2ESVB 4XCEB 4GXVL 4OJFL 4XP9L 2DIBA 4G42A 3SQOH 1NFIB 4LBEA 4LVOB 1U42A 3O4LD 2X1PA 4HCRA 5JXED 3QNZA 1E4WL 1NCDL 1IBGH 2A1WL 5EU5A 2A83B 3QO0B 2P8PA 3CFKA 4OUOA 4PJ8B 3TZVC 1IQDB 4GO6B 1HOCA 4HUWA 3ZT6A 5E5RB 5DJAA 1R24B 1ERNA 1XCQB 1CIDA 4H5SB 1IILE 3U7WL 1FZJB 1ODAA 5TDPA 4YFLF 4IRJD 4K94L 1BM3L 3ELAT 4DW2L 1W8NA 1MREL 3UPRA 2CSPA 1UB6B 2OLDA 2XT1B 1C5DB 3NPSC 1H3VA 4MQSB 5DEZA 2CO7B 1ROWA 4HKJA 3I75B 1D5MA 3I3DA 1U2CA 3B2UC 2R29H 3GMQA 1NDGB 5LQBH 4AENA 3IKKA 3Q3GA 2PXYB 1MRCH 5T5NF 5D72L 3ROLA 1A1OB 4M1DL 2A9NL 3RGHA 2EYSA 3PWJA 1AXSB 4NN6C 4YHYB 1NC4A 4PYGA 5E94A 4EN3A 4YHML 4EUPH 4Z77B 5CILH 1JN6A 1MFDL 3GMRA 1IT9H 3VCLB 3GSQB 4LMQE 3SDYL 4DKEH 4LU5L 4KJYB 4YR6A 5EC1A 1OGAA 5JA8B 2VQUA 5KN5B 4H8WL 2XZZA 4G8FB 1NAKL 1T04A 2QSVA 1KUMA 2PTTB 1IC7L 1RZGA 2W65A 3MRIB 4MCYB 4QRPE 1MCOH 4ZUSB 3MMEB 1AP2A 1H0DB 4UQ3B 1T0MA 2ADIA 4NNPH 1M7IB 5HGBA 1YEGL 3MYJA 4XPAH 3GB7B 5B39B 2AV7A 3ZDXE 4GUPA 4YHOL 1MCNA 3D3VA 3L5XH 5DVOA 1HYSD 5T1MA 4FN0A 3FFCB 2FHBA 3W2DH 3N9GH 2HT3C 1JZ7A 5LXGL 4LKXA 2B2XL 3CGTA 2XQBL 1EBPA 3U36A 5KTEL 2G75A 1AIFA 2R2EA 1LWRA 1NBZB 2HN7B 3PGFH 5I1GH 5E6ID 3QDGA 1KIRB 3MLWL 1FZKA 5DD3H 1CICC 3VGAB 3F12B 1T80A 3UDWC 2Q20A 1T7XA 4PRNB 1GGCL 1Q9LB 5K9QG 5KW9L 1B0GA 4EIGB 4YDJB 1MIEL 2V5YA 1HHHA 4AG4L 3O2DH 4PJBE 4HX1B 3U7YL 1EJOL 1DUZB 4XMKL 4J23A 4OM1L 4QTIL 2W0PA 3QAZC 4AEHH 4KTEH 5BXFA 3QWRD 1XIWC 4JZJB 4R8WL 3DIFA 1WTLA 1I9IL 2Y6SD 4TSAH 3TLRA 5JPMB 3FCTA 1IM3B 4MNQA 4BQ6A 1UKSA 5D96C 3U0PA 3SKNA 1P4IH 4N8CL 1TJGL 2UUDH 2HJLA 3QUZA 3P2TA 1F90L 4GQ9H 3DI3B 1F2QA 3NCYS 1P53A 1ZSDB 3ETBF 1DBMH 2EIZB 3A67L 1XGTB 4FQIH 1ED3A 5FA3A 3IFPA 4NUGH 5FKPA 2XPGB 4DGIL 1SYVA 5K9QI 3OAZK 1OM3H 5D7JC 1WBZA 5F9JA 4LCYA 1EVUA 2P46B 4UV7H 1S5IL 2NXYD 1MWAH 4E41B 5ABDE 1KNOB 5KANG 2C1OB 2R2BB 3C6LA 4G9FB 1NAMB 3PXJA 2WW8A 1TZGL 1G9MH 4PGDA 3QI9C 5SWSB 2DD8H 5IJKC 3B9DA 2E7BA 2W07A 1FDLL 2EO1A 3AB0B 4YUEL 2DLGA 3MV8B 5I15H 2P8MB 4KKCC 4M8QA 3WIHA 4LNVA 5L88L 3Q2CA 5C0AE 1FL6A 5HY9B 1YPZF 2YD3A 3U46B 4YXHH 4BFGA 3LEYH 4QO1A 3WS6A 1BX2B 1EGJA 5SWQB 1JGDB 2YZ1A 5DYOB 2UY7A 3RX7A 3AVEA 2ZOLA 4N68A 8CGTA 5ENWA 3G6JA 2DWEB 2R0WH 5C86A 2VXSL 2XOTA 4K71B 4K3EL 1TMCB 5DJ6A 1N0XH 2R0LH 3IJSA 2YN3A 2MHAA 3Q6FB 3FHAA 3BXNB 3KPLB 5KANI 4OI9A 5I74B 3SDAC 4DFIA 1H3XA 4RMUA 3C5ZA 4WTZA 4U1IA 4C4KO 1KLGA 1I7UA 5BQ7B 4APQA 3FRPA 2ARJQ 1NCBH 4PRPB 1CDBA 3KYOB 1XF2B 1T0PB 1TFHA 3QWOB 4G5ZH 3ZTJG 3L5IA 5DF0A 1U91A 5GJSL 2XTJC 4R6UA 5ERWB 3SDXF 2XFXA 2VTFA 1KB5A 5DMKB 3K74B 1HIML 1S9VB 1LO0H 3T8XA 2CLVB 3BUYB 4YHKH 3FO1A 2X44D 4NKIH 4NQXA 3MOAL 5JW5A 1OY3B 3IFLL 1BD2E 1YPZB 3VXSB 2OL3B 3GUTA 1FIEA 2VDQH 1U93B 1MJ7H 1FNEB 3NCJH 4OFYA 2O5YH 3CZJA 2DQFB 4PREA 1KFAL 2X7LA 3X3GL 2H2SD 1HH9A 4GW1B 3VWJD 1J05A 3PL6B 5DK0A 4K7PH 2MPAL 3B8YA 1EMTL 4V2CB 5E6YA 3SGKA 5I1DB 3CVHB 3VW3H 1RJLA 3L3JB 4XTRD 1IARB 1FFQA 3MJ9A 1F8TH 1ZS8A 1NC2D 2CGRL 4QRUA 1OGTB 4G6FD 5ADOH 3GM8A 5FUCC 4JRYA 3SDCD 1JYXA 3KXFE 4NO0D 1SQ2N 3TJEH 2VLKE 4LMQI 5CLWA 4KJPD 4L4VB 4TTGA 4R2GB 5E2WH 3EGSB 4JQVA 5HVFB 3T0EC 5D7IA 5CCKL 4H20L 4RFNB 3O3AA 5D93B 1MQKL 3I9GL 3IU3A 3S35L 3SDXB 2C3WA 4KDWA 2OTPA 3WUWB 1AO7D 4AH2A 1R3LB 3WFBL 3L3OB 2VDRL 5D6CA 5EU6A 3QBTB 3LZFL 5BRZD 5LKNA 1RMFH 2BVPA 2RAMA 5J89A 3X17A 4DOHE 3MXWH 5DHYA 1CF8H 1I4FA 5TJWK 4XP5H 3LN4A 5F70A 2HJFB 4NUJA 1MLBB 4XH2A 1Y0LA 3L3HB 1DLHA 4WHTB 3NAAH 5IVXF 3ZKQD 3MV01 4OM0L 1P7QD 4I1NB 1MHCA 3VFVB 1YEDB 3WD5L 2F15A 4LLMB 1F3DH 5F7UA 1TVBA 1CFTA 3QUYB 5CD3A 3TBSB 3QQ9D 4KUZL 5JPNA 3CXHJ 4HIIB 4BUHA 2FL5A 1R3KB 4WHDA 1DBBH 5I30H 5KSUB 4MJ5A 1VERA 3SGJC 3HMXL 1E28B 1MCLA 2X89A 1UXSA 2FX7L 5EOQL 1JYVA 3HC0A 1X4YA 1FN4B 1P84K 3O3BB 4NM4L 2DLHA 4Z7OF 5I2IA 2E9WA 5FO7B 5KS9A 4R7DB 5DHVB 3O6MH 2FX8H 2YD1A 4HXBL 1V5JA 5ALBL 5EU4B 3RDTC 1X4XA 1KACB 4Z0XB 2NY6C 2W9DH 3TA3B 3NBNA 3S97C 4HS6B 1RVFL 4MYWB 4P5MA 4Z7VE 1AGDB 1QFWL 2XICA 5F7FA 4Y4KA 5BW7C 4M62H 5C9JB 3BHBA 4Y2DC 5ETUB 4P3DA 4PUBL 1E4KA 4TUOB 4L4TE 1A6ZA 2YPVH 4YHLL 5IVXB 1RU9H 5CEZE 1R3HB 4NQSA 5JO5A 2HRLA 1CTNA 2C1PA 3W9EA 4OZFG 2YK1H 1F6AB 2BSTB 2FBJL 3IXTA 3HG1E 3G5VA 3CUPB 5DRZA 4QKXB 3OB0K 3X11A 3FQTB 5EU7E 2OR8A 5TQ0H 2PUQT 4KVCL 4HIHA 4WFFE 3LEXB 1A3RL 5D1XC 4OZHF 1F58L 4MAUH 1YQVH 3RVWC 3BPNC 2J6EA 2D0HA 1HHKA 2ZNXA 2B1AH 3TYFB 5ITBH 3EOTL 2UZXB 3S5LA 2Z93B 3U30B 3JWOC 1GGUA 3BP5A 5ICXB 2GW5A 3VXMA 3AXLA 4WVRA 4MD0A 4FTVD 1N6UA 2X9YA 2IAMA 2IWGA 4MAYD 1OTTD 4XMLH 5E8NB 2A2QT 4FMKA 3MRLA 5MI0C 3T09A 3F58L 3PP3K 5CZXD 2BDNH 5L6YL 3FQXB 4N0UA 1Z0MA 4L9DA 4MXQC 3K8KA 3RIFK 5DC4B 3HE7A 5HYEA 1I85C 4DZBB 4NJAH 4M7LH 4K7FB 3WXVL 5E70A 3OF6D 1DQML 5F1NA 4HFWA 4XCCL 4KFZC 2FX9L 5CEZL 1R5VB 1U6AL 2HKHH 4OF7A 2OM5A 4HW6A 1SJHB 5DJ8A 5JOPE 4GS7B 5I66B 1C5CL 2VISA 4LPUA 1AGEA 5LCVL 3E3QE 4Y1AE 1FV1B 1MFNA 2WAHA 2DI8A 3VI3F 1HHIA 4QHMB 4KKNA 4ZPTB 3NPZB 1EEZB 3T3PE 4ZFOL 4WWKC 1CLZL 1PD6A 2HVJB 5JOFA 2ZUVA 3GRWH 3ARBC 4PB9H 1Q8MA 3CFCH 1ETZB 4M5ZH 4F7MB 3FJTA 3KPQB 3DO7B 3VRJB 4OF8A 5FA4A 3MLTA 4RGNE 5KJRL 2E7LC 2KBGA 2YMXH 4K8RC 1ZLUH 4TUKH 2OS7A 5C08B 5IGXL 2GUOA 5MEPB 3EFDH 1OW0C 2R0KH 4LNRB 2HVKA 1IZJA 3SE9L 1BQLH 4FMFA 4C56D 1DVFA 1WV7T 1WIUA 2A6JB 3EYUL 1CCZA 4FQLH 4XXDA 1QEWA 3IDJA 5IESH 5DJ2B 3MRGB 2Q8BH 3GNML 2Q76A 2JK5A 3Q6GH 2Z91A 2NY1D 3ZKNC 4PB0H 1ZGLP 1JGVL 1EX0A 3VFUA 4ELKB 5DUMH 3MLRH 1EUTA 3ZYZA 1OVZA 5HD8D 1TVHB 1EXUA 2P5EA 4NDMB 3HTLX 2C4FU 1ZEAH 2WINA 4MSWB 3X3FL 4PP1C 1UWGL 3DX9B 3MCLL 3F5WB 4KI5F 3HR5B 1WBYA 2YD6A 3D2UA 1PZ5A 1T6VN 3WIFA 5ANMB 4Y5YB 5TDOB 3P4LA 4NKDA 4RFOH 3MQIA 3E6HA 4H0IA 1QFWI 2F8VA 5D71L 4ZSOE 5CMAB 2FSEA 3ARFD 3QUXB 4QGYA 5E2TL 3QIBD 1U8HB 4ETQA 3GSXA 4WFEE 2X4TB 4KRLB 3PQYB 4R3SA 4YHPA 1XEDA 3X13B 4ODVH 4OD2B 3MUGB 1DBAH 1PX3A 2JJTA 3SKJH 4ENED 4XPTL 4MDJA 1YMMD 5CJXA 3MLPA 3OGOE 4N0CD 1U92B 4OI8A 5D8JH 5C0FB 3ZHLA 4KJWD 4RQQA 3F7PC 1TZIA 3S96A 5I0ZA 2ADGA 1EAJA 3L7FB 3WIIH 4J7RA 3UTSE 3O6FD 4L3CB 1F3DJ 3QEHB 4PJAF 1J8HE 2GAZB 1CVRA 1XF5B 5HHPA 5F7HA 2VLRA 4CVZA 3CDYA 1GZPA 2YKLL 1S8DB 3L3IB 4ODSL 3MNVB 5AZ2L 1AJ7H 3GSNB 3O9WD 1JUFA 2LVEA 3WO4C 3I6KA 3ZE2E 3WCYA 3N1MC 5GGQL 4ORZC 1MLCB 2CLRB 5DR5H 4OFIA 1QBML 2H9GB 3FRUA 3PABA 5F8QC 2FGWL 3GJEA 5GGTH 1WIOA 3TBYA 4JFZL 4X0KA 3O41B 2QADB 3QUKB 3MBEC 3S3SA 5CS7A 4N5UA 1YY8B 3DXAB 1MI5E 4P59H 1PSKH 5DGQA 3HC3H 2YRPA 2OP4H 4NOBA 4X4XA 1AD0B 3MREA 3OKYA 4PGCA 2OQJA 4Q0XL 1HQ4B 2ZCKH 1WCBB 4U1GC 3VXRD 3QDJE 4AEIL 3UTQA 3IDIA 3E8UH 4ZTPL 1QLEL 5FGCE 2DQCL 2UZIL 1CLOH 4NHCH 4HWBL 5CKGA 3RP1A 5J13B 1CGYA 3PDOA 1BIIA 4KRMB 1MJUH 4PJAB 1P4BH 4OFKA 4PV8A 35C8H 2DBLL 2AXHA 5ACZB 5KVGH 4WUUD 4EI5A 1URLA 1ZTXL 1YNTB 1QNZH 5F71A 4UOW0 1U95A 5C0JA 4XCNA 1VB9A 3PWNA 4UT9H 1DE4B 5CINH 1B2WH 2LAGB 4OQ1A 2IBBA 5F9AC 1WVZA 3C60B 3FB7B 4JO3L 5DUBB 1DEEA 2EDJA 3IDMB 3ILQC 3VXTB 4XNQA 2Y5TA 1U8LB 4KWUA 4YQXH 3RAJL 1OPGH 1RUPL 2FECL 5J4MA 4QXGL 2BNRD 1BFOA 5F96H 3RWIB 1YDPA 2O5XH 5JXEC 2BVOB 3BVNB 3MRFA 1BHGA 2AXFA 2XY2A 2ESVA 4XCEA 4QXTB 1JPGB 3QUZC 5CJBA 2FH8A 2IH3A 1IZKA 4YBLB 1B88A 4YEEA 2A83A 3QO0A 5ACMA 2JJWA 4PJDB 4PJ8A 5FYJD 4IRJC 4XNYH 1IQDA 3CSGA 1I8MB 4OLZH 1LP9A 3RVTD 1XCQA 4H5SA 3DTXB 3WO3B 1FZJA 2YWZA 4UTBH 5KVMC 1RURL 1N8ZB 2VUYA 4M6MH 2LTQB 3W39B 1FIGH 4U6TA 1BGXH 4IDLA 4XC1L 4O5LH 4IIQB 1UB6A 3B4NA 1C5DA 3QDME 4E41D 4NQVA 4P48A 4R9HA 2AABH 4G9FD 4W68A 1VDGA 5T1KB 4E9LA 2PXYA 4JCMA 3OB8A 4P9HC 3C87A 1A1OA 3MV8D 4NYLB 7CGTA 2QHLA 5J11B 1A7QH 3RWCB 1AXSA 1YEJH 2CDEB 4GMTH 1HXMB 4GSDL 4Z77A 2Y23A 3V6OE 3RNKB 5C8JB 3VCLA 1TVDA 3P4NA 1FRGH 4K23L 4DCQB 4KJYA 4ERSH 4G8FA 4HWZB 3ZDXF 2F5AL 4JFXA 4OV6F 4R26H 3S9DB 3MRIA 3DSFH 5DT1L 3E6FA 3V52H 4OLVL 2BHUA 1CK0H 4NSKA 3MODL 2EDHA 4X5WB 4ZUSA 4MA1C 3MMEA 5KAQF 1HYSC 1ZVHA 4UQ3A 1VEOA 2VDNL 5IBTL 1INQB 3O6KH 4QRTA 3IDYB 2VLJE 3GB7A 5B39A 4LSDA 3UJTL 1RHFA 5B4MD 1TJHL 2EEBA 2DQEL 3LS4H 5FGBA 3SKMB 3D39B 4LDOB 2HFEB 3FFCA 4OBSA 5GHWH 1FZOB 3TEUA 1NCUA 4L5FL 1V3LA 3VMOA 2AEPL 1UA6L 3VXPB 5HVWA 5HHQB 1CE6B 1K8IB 5CFHA 4TNVF 4KC3B 1NBZA 4PJBF 2APTA 5I76B 1RZJH 1UWXH 1UWEH 1DJSA 3QIWA 4QRPB 1WZ1L 1UB5B 3D5OF 2J8OA 4P9MH 3TN0D 5HVHC 2NY2B 4P23B 4PRNA 1Q9LA 4YDJA 3BZEA 5F6IC 2JIXB 4HX1A 1NFDF 4G8GE 4LSUH 5H94B 1I9EA 3WLWD 3BPOC 4H0HB 2VDPH 3TH4T 1IFHL 1Z6JT 1IM9A 4JZJA 4F3FB 4Z95L 43C9B 5D1ZB 2FECI 1IM3A 4MJIE 1NPUA 1OT1A 1CFQB 1GIGH 1EH9A 3GMLA 3WS3B 1EIBA 5GPRA 1CLYH 1OD9A 4IMLA 1OB1B 1NJ9B 5JR1L 5K59F 4L9LB 1JWMA 1RUAH 4HKZB 4L4VD 4OLWL 5KVFL 1ZSDA 3QHZL 5IFAL 5F9OL 2DJSA 2NXYC 1XGTA 4FNLL 5JDSB 2VDKH 1UH2A 3MNZB 4JKLA 2QKIB 3N1QC 2VOTA 2YR3A 4XMPH 4XP4L 3HRPA 4PJBB 1U58B 1MCIA 5C0EA 4YWGL 4HIJB 5K93A 5EWIH 1MCHA 2IFFH 2P42B 1F4YH 1KNOA 1IGTA 4H0GA 2DAVA 2R2BA 5M7QA 1NAMA 3NA9H 3B9EA 5IROC 1J1XH 1LGVA 4HXAL 4NN7B 5SX5H 5SWSA 4MJ6B 4WWID 2XZAH 4PLJD 1V7ML 2E7CA 1FAIH 1FPTH 1ZLUK 3HUJE 3VGFA 2P8MA 5IW6B 3R0MA 1KJ3H 3E2HC 1NFDB 4RAVB 4U2YA 2E6JA 3BP7B 5HY9A 4M4RA 3JWDL 5E2VL 2NY7L 4PJIF 3U46A 2DQTH 1VKXB 2MCPH 2IBZY 1BVKB 1DQDH 5TH2B 2Y07H 1BX2A 2D3VA 5SWQA 5HYJB 4YDIL 5GRWA 1INEH 4X9GA 5F7DB 3DGCR 5DYOA 1RK0B 5FHAH 1J5OH 1ES0B 3DVFA 2JE8A 5J6HB 4K94C 3QDJD 4IOSD 2DWEA 2FD6H 1TZHA 4X6FA 2B7DT 4G3YH 2Q7NA 3Q6FA 3MLYH 2H32H 5T3XD 4MA8H 3BXNA 3KPLA 5GSRB 3MGAA 3H3KA 1YNLL 4Y4HA 1CXFA 4HPYL 3W9DB 2DTMH 4I18C 3SDDA 1C1EH 4XP6L 4PRPA 3KYOA 4PY8I 4WO4B 4P4RB 4ZQKA 5C0AB 1GYAA 3O81A 1FG9C 2J2ZA 5ERWA 3EO9L 3WMSA 1AE6L 4X6DB 3QZWA 1S9VA 4LPWA 4OZFB 5D2NC 1BQSA 1L7IH 3BUYA 3GJFB 4OD1L 2H6PB 4MCZB 1MFAL 5IMOB 1A3LL 1YPZA 4GAJH 1A5FL 3VWJC 5IM7B 4PJIB 4XC3L 3VXSA 2UVFA 5CJ8A 2BY2A 4OCRH 2OL3A 4F9LC 1CGSL 2CLZB 2VXUH 1U93A 3D0LB 4U6HA 4ZAKD 1H3WM 4CN4A 4XNUH 1FNEA 4W81A 4XTRC 3UZEA 2DQFA 1CL7I 4RBPH 4ZD3H 5GS0L 3JUYA 1ND0B 3PL6A 4HKBB 3SDCC 5F3HB 5I1DA 1UM5H 4ZNCD 4JPWL 1NGZB 4MXVE 3M1BB 5ESVB 3L3JA 4JO2H 2DQHL 3V5DB 4K8RH 4KY1L 4NQCB 1OGTA 5FYLH 4RMTA 4KJPC 4BZYA 4JRWA 2I60L 5HHNB 3TC9A 5SWZE 1P2CA 4MLIA 4MX7B 1WFUA 4JFYB 2N7BA 2FHFA 4BKLA 3WJJA 1TPXB 2WBKA 1BD2B 2QQNH 3SDXA 3WUWA 1I8LC 1R3LA 1BPVA 1QLFB 1FL3B 5JUEH 1II4E 3STLB 1J87A 1G7IA 3U0TA 1CFVL 1M6OA 2D31B 3CVIH 4LIQH 4HCRH 4U31A 5CKAA 4MQTB 1PYWB 1T03H 1HKLL 3WV0A 1T1WB 5C3TA 3BOVA 2HJFA 1LO3H 5C92A 3L3HA 4WHTA 4Q6IC 5DD1H 5I1AB 3QQ9C 3DHJA 3HI6H 3KXFB 3D85D 4IJ3B 4KJQD 4YDVA 3VFVA 3EKCA 1YEDA 2EEDA 5LGHH 4JB9H 2VLKB 5BV7H 4FQCL 2WBJB 3VFOA 1VSCA 4L8DB 3QUYA 4MA7H 3TBSA 2XN9E 4FA8A 4HIIA 5DUPH 1ACYL 2R1WB 1R3KA 4U4BA 5KSUA 1DVFC 1FGNH 1G6VK 5IB4B 2VH5H 4IS6A 2ZWLT 4Z7WB 2VLJD 1X6NA 1FN4A 4Z7VF 3LS5L 2BNUB 1HNGA 3O3BA 5HHOB 3S34L 3T04D 2WWKO 5HSFA 3SBWC 4TULH 4UMGA 1A6PA 4R7DA 5DHVA 3KAAA 4XPFL 1I8KA 3PDDA 1PY9A 5EU4A 2WLYA 3TA3A 2HLAB 3TNMB 5D1QB 1YEHL 1F11A 3DNKA 1AGDA 2APVA 3VFPB 4O4YL 4JHZA 3V5HB 1L9NA 4DKDC 5B8CC 2DRUA 1NKRA 5C9JA 2PETA 4PRIE 3CXDL 4DGYL 2E9BA 4U1NA 4P46D 4TUOA 3ZLQC 2HH0H 5LJYH 1OP3H 5IVXA 3C8HA 4NQDE 5E4IA 4DTGL 1PLGL 4YBQC 2JB6A 1R3HA 3FO0L 5DMGD 1F6AA 3G9AB 2BSTA 5EO0B 2JJTC 2W91A 1DBJH 3OHXB 4J3SA 3LDBB 3HE6B 2VJXA 2AJSL 4EBQH 4AYFA 5C0IA 3VD3A 3CUPA 2F54E 1NCWL 3MLSH 3GK8H 3FQTA 2R4RL 1U8KB 3CMGA 3UMTA 3BO8B 3HNVH 4UT6L 3LH2H 3LEXA 5HBBA 1RZFH 5LBSH 2X4RB 4Z7VB 2RJMA 4EXPX 1OAUH 3QEQE 2R15A 2Y72A 1RJCA 3NFSH 3H9SD 1A9BB 3I85A 2VDLH 1QSEE 3OV6A 1OTTC 4MAYC 4L4TB 2Z93A 1T66D 3LKSB 2E7HA 1CDCA 5CZXC 4TNWK 1HINL 2W0KA 3MRJA 4PRHA 4U6YB 2R1XB 5E8NA 4XX1E 2FYYB 3R06B 1JF1A 3CU7A 3HG1B 4JM4H 3O2VH 5DWUL 2AS5M 3KNBB 2PYEA 4ZFOB 1RULH 3FQXA 4J6RL 1HEZB 1JE6A 1SMAA 5H37H 5IKCB 4D94A 2IQ9H 2HT2D 5DGRA 3UTOA 4DZBA 4CMHB 3T3PF 1NLBL 2P49B 2CDGB 4CADB 3UYPA 2FEEL 1SBSH 1T2QL 4OSUL 4NQEE 4NM8L 1X5KA 2OBGA 2KH2B 2QL1A 3GZKA 5I66A 15C8L 1G7MB 1JMXA 1FVDB 2VAAA 1FBIL 2BC4B 3SE8H 5BMFL 4QHMA 3B3IB 5EZIH 4IOFD 5J12C 4OZHA 1EEZA 5JLZB 4WFGD 1JL8A 2B39A 5GXBB 4GMSH 3BH9B 3RIAK 4PJCE 1ETZA 4F7MA 1KTLB 4PJ7E 5INDB 3OWEA 5H2BB 3VRJA 1VEMA 1NEUA 3WN5C 4XPHL 1UWXK 4YO0B 1M05B 3BKCL 1NGPL 5DO2C 1SJEB 5GGVY 3NCCB 5C08A 1MCQA 5MEPA 3QXWA 5C07E 3MRRA 2NY1C 3SGEH 1KXVC 4TPRH 2R69H 2A6JA 3V4UH 1CFNA 1UJ3A 2DQIH 3VA2C 5HD8C 3SQOL 3RNQA 1PEWA 1DEDA 2FNBA 1KC5H 5DJ2A 1DL7H 3MRGA 4JY5H 4UQ2A 2IBGA 2ED9A 1WWBX 4P2QA 4R97C 2ZCLH 4CAGA 1IBGL 1CDGA 3QSKB 4ELKA 3C60D 2HT4D 5A2IH 4Y1AB 1A4KA 1EGJH 1A7OH 4FQXD 3W0WE 5GS2D 3ULVD 4UDTB 4XXCA 3ULUD 1LEKA 1XGYL 3HI5H 2DKUA 4MSWA 3DX9A 1ZV5A 2D7TH 3F5WA 4LVOC 2X1WL 2Z8VC 3ARFC 3HR5A 2D03H 3PJSB 3QIBC 2GFBB 4Y5YA 3BRGC 1JGLH 3EOAB 3KYAA 3VE0B 5TDOA 5CEXB 5IQ7H 1FGVH 4YDKL 4ENEC 4LLUB 2ZUXA 3QUXA 1U8HA 2NY3B 2EDWA 3JBG7 4KJWC 1V3KA 2WZPD 3PQYA 1GAFL 1Z9OA 5FF6B 3BJLA 5JOEA 2OTWB 2VRAA 1G6RH 5DD5L 3X13A 1AC6A 3AREB 4OD2A 4U1KB 3MUGA 4PLKD 5LQBL 4MQ7B 1CR9H 2DQDH 2AXGB 2DIAA 4JPKL 4PJ5D 5DD0H 4AEEA 1U92A 2NTFB 4RZCB 4RX4D 3O6FC 5C0FA 4YC2C 1JPSH 4OB5H 1KB5H 3DJ9A 3FN3A 4PTTB 1W72B 3L7FA 4ZUUA 3SOBH 1RPQA 4GBXD 4XZUB 5CILL 3TVMD 4M6NH 5IB1B 4W70A 3O9WC 1IT9L 1D5BB 3QEHA 4PR5B 1RZ7L 3NZ8A 1TQCC 1XF5A 3QRFM 1U8JB 4UDUB 5E9DA 4U05A 4L3ED 3QRGL 3L3IA 2B1HH 3GSNA 1LVEA 5T3ZD 2DQUH 2OX5A 1F4HA 2K7PA 2CMRH 2H9GA 3VDAA 4NNPL 3CFIC 3UTTD 3BGAA 3DETD 4XPAL 5KSAB 2CRIA 1QO3B 3GMNB 5BJTB 3O41A 3L5XL 3UO1L 3QUKA 3S37H 5I71B 1YY8A 5D6DC 1MCCA 5SV3A 3DXAA 3CDCA 5KVEL 1U9KA 2GCYB 4N90E 3W2DL 4KHTH 2C4XA 4LLDB 3UTSB 3N9GL 2VKXA 4FQ2H 4NWTH 1PG7W 1AD0A 2C7UB 3CC5A 1J8HB 5IB2B 4PY7B 5EA0H 3STZB 3IDNA 1J0KA 3PGFL 3U4BH 4ZO7A 5I1GL 4Y4FD 4FFZH 1WCBA 5BOZG 2P48B 4M5YH 3J7HA 5DD3L 3RI5K 1ONQB 4YXLH 2IG2H 1YA5A 2H26A 1JCKA 1KTKE 5EZLB 5FECA 4PJAA 3D39D 3LKQB 4UB0H 2HTLD 4LSTH 3HZVB 3ULSB 3EO0B 3O2DL 4IMKC 3ZKMD 1UENA 3F6LA 5HYQB 2CPCA 1OCWL 2FJGB 4AEHL 4M7LT 4KTEL 1P69B 3REWB 3QFJE 2GYSA 5KSVA 3DMMD 1DE4A 1BREA 1VENA 4TSAL 3TBWB 1K3ZA 1KJVB 3FB7A 1T1YB 3IDMA 4FP8L 4RA0C 4KQ4H 2W9LA 1XZ0B 3VXTA 1P4IL 1X5GA 3MCKA 4QF1B 3F7QA 1JVKA 5EU7C 3RWIA 1MELA 3MLVL 4D0DB 2BVOA 3CJJA 3BVNA 2FB4H 5T1LD 3WFEH 3DOSA 2NR6C 4GRLB 4F9PA 2FO1A 5CIPH 3RVUD 4IRSD 4FQIL 1A14H 4QXTA 3RTQB 3LV3A 1CIUA 3SKUD 1JPGA 1S9WB 4P3CH 4KUCF 4YNYA 4UV7L 3X12A 3RVTC 1MWAL 5IEHB 5F93C 2BFVH 3GDBA 3F7VA 4PLOB 1T7VA 1BF8A 3DRQA 5F1SA 3WFCH 1I8MA 1JGEB 3DTXA 5FYKD 1M4KA 1XAUA 5I15L 4DN4H 4U1SA 2XTLA 1KJ2B 2EYTB 1GCFA 1VEPA 2Z8WC 4YXHL 1N8ZA 4M48H 5MP6L 3LEYL 3FOMB 4FXGB 2IQAB 1FC1A 3RL2B 1AC0A 1U8PB 4MJ2A 4N9OB 5ESQB 4ACPA 2Q8AH 3AB0C 3VD4A 1T4KB 2IFGA 4J4PD 5JW3H 4W4NA 3PHQB 2R0WL 3JXAA 5T1KA 4KGJA 2R0LL 2AGJH 5HPMA 4KRPD 2B0SL 5C70A 4NYLA 5DMIH 3DRTB 3RWCA 3CSPA 1VACB 2R4SH 1S9KC 2CDEA 1HXMA 5I6XB 5IUSA 2L7JA 3RNKA 5C8JA 1KPUB 1NCBL 4DCQA 4KTDH 5L7XL 4X80H 1I3RB 5E0QA 4HWZA 3JV0A 1BBJB 5I74C 1EEUA 1FE8H 3VGBA 1FLTX 1MHEB 3DROB 3GSRB 3D48R 4NO3A 1GSMA 4QY8B 1LO0L 2Z8RA 1A6UL 4HUXB 5B4MC 3QDMB 3MRCB 1P5UA 2EXWD 3L3DB 5JMOC 3AMLA 4HLZH 3PWUB 5C07D 3RWGB 1JZ6A 2VDQL 1JTTA 3BGMB 2EXYD 4EZMA 4WEBH 2QR0A 4YPGA 3SKMA 1MJ7L 3NCJL 4GRWF 2O5YL 4HQQH 1F00I 1FZOA 2OK0H 4XWGH 1KCVH 3IDUA 3CK0H 4K7PL 3EW3B 3VXPA 4PJ9B 2DQGH 4XNMA 3EIFA 2XWBB 3RL1B 3WE6B 3VW3L 5HHQA 1CE6A 1K8IA 3TN0C 1A7PH 2MWCA 4LCWD 3BD3A 5AWNH 1F8TL 1U2HA 5I76A 1OL0A 3IS0X 4F58H 4QRPA 3C08H 2FO4B 1UB5A 2AJYH 5KSBE 4GXUM 3WLWC 4P23A 3TJEL 1WEJH 2Z92B 3RX5A 1S9XA 4D3CL 2JIXA 5E2WL 5IOPA 1DLFL 4DN3H 3G08B 2DKSA 3ECBB 5H94A 1WT5A 2VQTA 4X4ME 4F3FA 1T89A 5HJ3B 1SVCP 43C9A 5JHLH 5C0CE 1EO8H 1Q1JL 2YPKB 5D1ZA 1RMFL 3MV9B 3EHBD 4ZDHB 1N64L 2ATKB 3DHMA 2NX5E 3ZT7A 1CFQA 3MXWL 3QJFA 4Y7MA 3V95A 1CF8L 3C6SB 2X10A 4RFNC 5D93C 2IGFH 3U0WH 4XP5L 2CR6A 5A40E 1IAIL 5DURB 1Y18B 1OB1A 1NJ9A 5IMKB 4L9LA 1CD8A 3NAAL 4GRWB 4HKZA 1VFBB 4KRNA 2PO6D 5DJCB 4I4WB 2EDXA 5JHDE 5D7KE 5JDSA 5I73B 5GQBA 2DDQH 3MNZA 2ICWJ 1F2XK 4M6AA 2QKIA 2DMCA 2JELL 1MCDA 2MMXA 3B9VA 3HUJF 4X7TB 3GI8H 2IANB 4PJBA 3OR6A 1U58A 4PLJC 3VGDA 1QBLH 3BEVA 2YA0A 4WTZG 5KOVC 1ZVSB 4HIJA 5I30L 1S7XA 3VFSB 4X7CC 5DJXB 2EC9T 1S7QB 2XIDA 2O61A 3QJHB 2P24B 2DL2A 4LCUB 2FGZA 4MJ6A 3V8CA 4KDVA 2IMNA 4QRSB 1HSAB 4PJGE 5IW6A 2N56A 4PLNC 3BIKB 5DJZB 1NFDA 4RAVA 3O6ML 4XVUD 3RVVD 1VKXA 2DN7A 3BH8B 1BVKA 5DD6B 2W9DL 1SBBA 5HYJA 4LGSB 5F7DA 2XRAH 1RK0A 1DBKH 2VL4A 3LQAL 5J6HA 1P9MA 1AHWC 4KKLD 5GZOD 3OAYH 4M62L 3MACH 1MFEH 1JZ3A 1K5NB 1KTRL 2OTUA 5HHOD 1C8PA 2YPVL 4GKNA 2RHEA 4J1UB 1X6LA 5JTWA 5GSRA 1ZT1A 1GGYA 3Q48A 1MCSA 4NWUH 4WU7B 2ITCB 4WW2C 2EIBA 1T83C 1RIHH 1U8MB 3W9DA 1YYMH 1H3TA 4PG9B 4W6YB 3DYPA 4WO4A 1JTPA 4P4RA 3CDGB 5C0AA 1Z9SA 3UC0L 5J0BA 1X5AA 3ARGB 5DTFB 4MAUL 4EEEA 1YQVL 4OZFA 5IK3B 4ZAKC 4JFFD 5E1AB 3GJFA 4K2UH 4NPYB 5EPMA 2H6PA 4MCZA 5FM5M 4QXUH 1IKNA 2B1AL 5ITBL 4MXVF 4QXWA 3O45B 3U9PH 3GI9L 4PJIA 3HE6D 5IM7A 2CLZA 1KEGH 5IBLD 1BAFH 1BFSA 4K7PX 3NIGF 3MA9L 2P7TB 1YEKH 2F5BH 2BMKB 4N0RA 2J1KA 4XMLL 4KU1A 4YLQT 5FUOH 1RFDL 4HKBA 5C71A 2ZUQB 5F3HA 2BDNL 4XPBH 1NGZA 5ESVA 1KG0B 3M1BA 4ORGA 3U30C 3L1OH 5IMLB 3N1FC 4M1GL 1ZT4B 3TCLB 4NQCA 2BNQD 4P5KB 2CRZA 4MGXA 5J06A 3PWPB 5HHNA 4AK1A 3ZKSD 5C0BE 1QYGH 3ZTNH 3BFOA 1FL5B 4LF3A 4MX7A 1AGBB 4JFYA 2HKHL 5BS0E 2V9QA 3OJDB 3GSUA 2YOCA 2VZVA 5JW4R 1BD2A 2W0LA 3WL9B 4M9PA 1AGCB 4ALAH 3MOBH 3ES6A 3MA7B 2VZSA 4RMVA 1VFMA 1FAKT 1QLFA 1FL3A 2QHRH 2ERJC 5J1SC 3STLA 2B4CC 3GRWL 1IAII 4PB9L 2D31A 3CFCL 3V6OC 1TLKA 2N1KA 4GRMA 1PYWA 4KJQC 3HMXA 4JFQB 5EDXA 1ZLSH 1FH5L 2YMXL 4TUKL 3DUHA 3KHOA 3EFDL 4FABH 5HYSG 5I1AA 2R0KL 4JFDE 2YPLE 1BWWA 2HA1A 1BQLL 1ZA6B 3KXFA 3BJ91 2CQVA 4XRCB 1N3NB 1U3HB 4KHXL 4P5TD 4TYUA 1BECA 4UI2A 5SWZB 5HGDB 4UU9B 1RD6A 4OZGE 5MERB 4FQLL 3SCMB 2VLKA 5IESL 5CEYB 5L2KD 2Q8BL 5HHXH 2WBJA 3Q6GL 3DUSA 4L8DA 1J0JA 3U6RB 4JFPB 4PB0L 5I8KH 3NOIA 3HN3A 1EFXB 3TIDB 2R1WA 3IYLW 1FNGB 5DUML 1IGCH 1X7QB 1FVEB 3DVIA 5IB4A 4H25B 2WM0A 5CP3A 3QG6B 1RV6X 2BNUA 2M2DA 1U8NB 3B8SA 4OGAD 3OG4B 4U7SA 1OLLA 3DSNA 3ZT5A 1F02I 4RFOL 4RMRA 1ZT7B 5K9JH 3SO5A 3IGAA 4IHOA 4WI2A 1OQOA 4HAFA 1IGYB 2HLAA 5D1QA 1C5BH 3QEGH 4J12A 4P46C 1MRFH 3FFDB 4ODVL 3R8BB 1HNFA 1DBAL 3SKJL 3NZHH 3SEPA 3BX7C 3V5HA 4LVEA 1N5YH 1BF2A 5DMGC 4X4YB 1YJDC 4JHWH 2XN9B 5DDHB 4BK4A 3AU1A 1NCCH 4YX2H 3DX7B 3G04B 4F37F 2WUCL 4MWFB 1UEYA 3WIIL 3GSVB 4S1SH 5DSCA 5EO0A 5A2KH 3OHXA 4EDXB 1OAYH 3RY5A 2APXA 1VPOH 3TJHD 5CJOH 4HJ0D 1U3JA 5IWLC 4HH9A 3ARED 3FT4B 3SE3C 1A7NH 1AJ7L 4O00A 2D2OA 3BO8A 3WLBB 1MPAH 3MRMB 3P30H 2NX5D 5LGJA 2NW2B 2X4RA 4Z7VA 2EDRA 1T66C 1D9KB 1KELH 4N8PA 2RB8A 4WI7A 1FFPB 4H26B 1E27B 5GGTL 3ZYIA 4XNZB 5BVPL 2OZ4L 4NOFA 1A9BA 2EH7H 4PRIB 1LEIB 4I5BB 1G9NH 4L4TA 4WI3A 2KQMA 3MGOA 2GT9B 3ZDYE 3KYMB 4U3XA 4JM2D 5CJQH 2NZ9D 2W59A 3MFFB 5BCAA 4P59L 1PSKL 3VRIB 4JREB 1QLRB 3HC3L 4U6YA 1ZWIB 2OP4L 2Y4SA 2R1XA 4LASH 4YEFA 2JJSC 2FYYA 3R06A 1OWWA 3HG1A 1BP3B 1H3GA 1DFBL 2F54B 2HT2C 2R2HB 2MSPA 2F9BT 5GJTH 3L3GB 2QADC 4ZFOA 3H3PH 2VAJA 1ZLVK 3BKYH 2ZCKL 4I0PB 2ZSVB 1XCTB 1HEZA 5IKCA 4S1DD 1I7ZB 1CLOL 4NHCL 4X9IA 2B20A 4Y16B 1BQHG 4CADA 2CDGA 4JZOB 3QEQB 1P4BL 3HNSH 35C8L 3M8OH 4IOFC 4PJCF 1Z5LB 4PJ7F 3UPCA 2XTJE 4P4KB 4QLRA 5FYJH 5KVGL 4BQ8A 5F7LB 1G7MA 5E8OB 4ODWB 3BQUB 1FCCA 2BC4A 1QNZL 1OAXH 5DS8A 1J12A 1UM4H 3RZCB 3B3IA 5J13C 4G42B 5JLZA 4B5EA 4UT9L 5IQ9B 1B2WL 5AZEH 3RWJB 3BH9A 3QNZB 4OUUA 5INDA 5H2BA 5I1KL 4YQXL 4O2CB 4YO0A 1M05A 3MUJA 3RIFF 5F96L 2O5XL 1NAMH 5ISZD 5E2UH 5F7EH 1J1PH 1UC6A 3C60C 4WV1B 2HT4C 1YECL 2DJUA 4FQXC 1T22A 1FLRH 2CUIA 5E5UB 1K6QL 3ULVC 4RNRB 3ULUC 4NQEB 4E42B 1CXEA 1SHMA 2RQ8A 1LDPH 1FFNB 5ADPL 4WHYG 1MAML 5FUCE 4PFEA 5TFSH 4Y1AA 5JZ7D 1OHQA 4YGVB 4X9HA 1ORQB 1XR9A 2HG5B 2FRGP 3AS0A 1I1AD 2FIKB 4XNYL 4KK6D 1UH4A 4OLZL 4BUGA 5DVLA 2BSRB 3T0EE 4PJ7B 6FABL 5GS3A 1KSRA 4QNPE 4L4JA 4UTBL 2WUBH 4R4BB 2GFBA 3VE0A 4LLYA 2R39A 1S7UB 3RTQD 4V1DE 2Q3ZA 4E5XB 1NBYA 2AK4E 1KOAA 2W38A 4M6ML 4PLKC 4EN3B 1MNUH 4LSSH 1FIGL 4ELMF 3JVGA 4OGXH 1JN6B 1CFBA 4LLUA 7FABH 2FR4B 1BGXL 3EYQD 1S7WA 4O5LL 2QQQA 4KZEH 3MFGB 5FF6A 1OGAB 2AABL 4Y89A 3SE4C 4U1KA 2H45A 3AREA 2VC2H 4MB4A 3UYRH 3V7AE 2FJHB 4Q97A 4GBXC 2AXGA 1GC1C 3PGDA 3TVMC 4HGWB 2LTQC 1MHPH 2NTFA 4RZCA 1ZLWK 1BFTA 5C0BD 4D9LL 5IW1B 4IIQC 4BYHA 4PTTA 1A7QL 1AP2B 1IGFH 3EYVB 1YEJL 3B9KB 1CE1H 4JGJA 4GMTL 4XZUA 1OWRM 3MYJB 1AGFB 5IB1A 5IVZB 2AV7B 1D5BA 4GUPB 3GBNH 4PR5A 2CRYA 3F7YB 4ERSL 4OZIF 1U8JA 4UDUA 1KYOK 1G1CA 2OL3H 2ZKHH 4ZSOA 2M8XA 5C0ND 1QP1A 1UG9A 3DETC 4L8SB 4FZ8H 2F53E 4XBGB 3DSFL 5EFIA 4QRRD 3U36B 4P2OA 1CK0L 1AIFB 1QSFB 3OAYK 4WI4A 4MLSA 5DZNA 3PE9A 2C5DC 3CVHH 4HFUL 1FNSH 4K3DH 3O6KL 4NCC2 4U7KA 4TVSa 4BK5A 4C83B 3MX0A 5KSAA 1QO3A 4HWBA 3GMNA 1AR1D 4ELMB 1ADQH 3LS4L 3ZO0A 1XGUA 4GKSA 1FORH 8FABB 5J56B 4L8CB 4Y4FC 1R3IH 2GCYA 5E08H 4W6XB 1HHHB 4X5XB 3UTSA 3RY4A 3QULA 1VGKB 5I19H 4JVPA 1DN0B 3FQNB 2DI7A 2C7UA 1J8HA 3BD4A 5IB2A 4PY7A 3STZA 1EVTC 1NFKA 3DIFB 1UWEL 1E6OL 1ONQA 1AY1H 3FCTB 2R56L 1G7QB 1QRNB 4JZNB 4MNQB 3ZKMC 4P9ML 2P5WE 3KS0J 1W2KT 1I1YB 3U0PB 3SKNB 2DLEA 5EZLA 3MLXH 5I1IH 3EDFA 2IPTH 3HZVA 3ULSA 4LGPB 3EO0A 5IR1B 4OZIB 3DMMC 3KPSE 3BKMH 4JFEE 1RZIA 1V7NH 3THMH 1T5WB 5HYQA 2DOCA 3KYKL 4LSUL 2FJGA 5ILTH 4KROB 4Z78A 4JRXB 4M6OH 3REWA 4BSJA 3JUZA 1SEQH 1TCRB 1XFPA 2WV3A 1MI5A 2FDBP 2CRMA 4X4ZA 3TBWA 4WDIA 4ZTOH 1MWAB 3IXAB 1KJVA 5IV2B 1T1YA 3QT2A 4XVJH 1XZ0A 3RVUC 2BRQA 4QF1A 3OL2A 2P43B 4PGDB 1CLYL 1A6WH 2BY0A 3DURB 5D7JD 3DYMA 3I02B 4D0DA 3T0AA 3QG7L 4KK8D 1A0QH 4N1HB 4GRLA 1SVZA 3TWCL 2Y06H 2XZQH 1YUHB 2VDKL 1KGCD 1E4XH 3AY4C 4B50A 1S9WA 4QHLB 3L5WB 5D7LE 3MV7D 4Y19D 2NY0D 3KG5A 3MV9D 4HK3J 4L9LC 4N1CA 3SJVD 3S4SG 5EWIL 1F97A 5IEHA 2IFFL 1WWCA 3NA9L 1QSZA 3QFJB 1J1XL 4KPHL 4QYOB 4BQBA 2XZAL 1YC8A 3T4AB 1FAIL 2V7HB 4LPVA 1FPTL 5GGVH 4M7JH 3QNXA 2MHAB 4A6YL 2EECA 3QP3A 4HLJA 1KJ3L 4QOKB 1KJ2A 1OAZH 4J4PC 4WUKH 2DQTL 2V6HA 2MCPL 2I25N 4WNQB 1DQDL 3FOMA 3QIUB 2Y07L 1I7UB 2IQAA 3FZUD 4NN7C 3MGTB 1INEL 1DR9A 5ESQA 3O3EB 1T4KA 4KRPC 1J5OL 1JNLL 3IDGB 5FYLE 1GOFA 3PHQA 3PP4H 2FD6L 2XFXB 3HC4H 3HZMB 4MA8L 3JWOL 1Z0NA 2X41A 2HFTA 4GT7A 4AZ8A 3DRTA 2YD7A 5F6HI 2DMKA 3ARDB 2BY1A 1IC4L 1HILB 3FB6A 1KPUA 2HMID 1C1EL 4X98B 3WUZA 3U7AA 3DECA 4FZEH 1JPST 1I3RA 1UVQA 1WBXB 2EXWC 3WNKA 3RGVD 1HH9B 1MHEA 3GSRA 3RY6A 2OR9L 4QY8A 4HUXA 3QDMA 2EXYC 1L7IL 1LE5B 2IBZX 4LSVH 3CX5J 3L3DA 1ZS8B 4OZ4B 3SGDH 4POUB 3FAXA 2IADA 2UWEE 3PWUA 4GAJL 4W4OA 4JRYB 3QDHA 4OCRL 5J1AB 3BGMA 4M7ZB 5CUSH 3OKOB 4NKQB 4XNUL 1N4XH 1HKFA 4ZD3L 3S88L 2B4CH 3QFDB 4HJGB 2XQYK 1IKNC 4PJ9A 3TO4D 2NY4D 3WE6A 2JCCE 1UM5L 2XWBA 1VADB 3O3AB 3RL1A 4CVXA 3RBSA 5C2BH 4NJ9H 3ARGD 4JO2L 2VZ1A 3VFGH 5I1EH 5D6CB 4K8RL 5FYLL 2GSIB 1FNFA 4LFHG 3C2SA 1T7ZA 4JFHD 2FO4A 2VQ1B 4M61B 3AGVA 2XYCA 1T2XA 5C6TH 4Z9KB 5GRYA 2Z92A 2DJ4A 3TT3H 4NUJB 2OI9B 4UAOB 3IU4H 4S10A 1GL4B 4HMDA 2NXZB 3EHBC 3BP4B 3G08A 1MHCB 3ECBA 5IP4A 2GK2A 1XR8A 5JUEL 2YPKA 3JWNC 1CBVH 2DI9A 4ZDHA 1E6JH 4HCRL 2ATKA 5MENE 3WEXB 1BBDH 3PWPD 4UZGA 3C6SA 5HHMB 1KBGH 4HMCA 3VXUE 1LO3L 5DD1L 3KPRD 1VFBA 3HI6L 3R1GH 5DJCA 4I4WA 5I2IB 5EIVA 3OX8B 1PJ9A 5LGHL 2HYMA 2NNAA 3RZWA 4JB9L 3MRKB 5BV7L 6CGTA 4X7TA 1TIUA 4MA7L 4Y5XC 3EZ8A 1TENA 2IANA 4PJGF 1BJ8A 1P1ZB 4ETYA 1YJDH 5DUPL 1JRHI 1ZVSA 4G8GA 3U48A 4P5MB 3VFSA 5DJXA 4QCIA 4IJ3C 3A6BH 1FGNL 2K3TA 4WCYH 1WQVT 3NFPB 2VH5L 4LCUA 5HYSB 1I7RA 3JV4B 3PHOB 3QDGE 4XVUC 4Y4KB 1CLCA 2VZ3A 3RVVC 3V0VB 4MJIA 4QRSA 4HUMB 1HSAA 1RAMA 5DJZA 1NDMB 1G9MC 5FO9B 3QZWG 4OCXL 1FYTD 3BZ4B 1UM6H 3HMWH 4KKLC 5GZOC 5DD6A 3IXTB 4NC1C 4OCMC 5DK3A 3VDCA 3G5VB 5JHDB 1N26A 1T7YA 5MHSD 2E9JA 5FGSA 4G43A 2D7OA 5FIEA 3O4LE 4HIHB 1K5NA 4QEGA 2P5WD 3D6GA 3TFKD 5D1QC 3GSNH 1L0QA 4J1UA 1JHKH 3GHEH 1OP5H 1ZHNB 2GKIA 3S36L 4EOWH 3KPSD 4TOYL 1DQQB 4U0RC 4WU7A 1I9RH 2ITCA 4BFBD 3MLUH 3QPQD 5D1XD 1U8MA 1H5BA 1JNHB 3HUJA 4EBQL 4PV9B 1FO0L 4PG9A 4OAWB 1KULA 1IAOB 3CDGA 4Y88A 5C7XL 3SO3B 3DVGB 3NIDE 3LH2L 1BZ7B 3MRLB 1RZFL 5LBSL 2JTDA 3HE6C 4NFBA 3V6BR 1OAUL 5IBLC 5IK3A 3V2AR 5E1AA 2X42A 3NFSL 4NPYA 5F3BB 2VDLL 3O45A 3V6FB 3L5JA 2F74B 1SY6H 1NL0H 3EOYG 1UACH 2BSSA 2X2YA 2FIRT 3VGEA 2P7TA 1D5IH 5ID1A 2BMKA 1QFWM 2VISB 4JM4L 3O2VL 2ZOKA 1A2YB 1NCTA 4NRYA 1KG0A 1RULL 4GXVH 3IJYA 3TZVB 5IMLA 1D9KD 1H8OA 5FHBH 3TCLA 4GLRI 5IHLB 5JOFB 3G6JE 1GGBL 3S8WA 2IPKB 2QQLH 4JY6B 4OQTH 2WLZA 4WJ5A 4U1MB 1S7SB 2ZSWB 1FL5A 1AGBA 5GS2H 3ULVH 2B5IB 2L4OA 4LVNC 2Z31A 3LN5B 2YUZA 4PBVC 3WL9A 2HVKB 1AGCA 4TQEH 4YHNA 3NPSB 1QR1B 3SE8L 3U7WH 3MA7A 5EZIL 2NMSA 4K07A 5FYLD 4D9QD 1QEWB 3IDJB 2DYPD 2V5TA 1J1OH 2EDBA 1BM3H 1BQHB 1R3JB 4OZGF 2PW1B 4OF0A 4OCNC 2EDFA 3HCVB 4JR9H 4Y16D 1JF6A 4P5TC 1CZ8H 2P5EB 2BY3A 4NN6B 4LVHB 1TXKA 1CT8B 3WNOA 4J3VA 4P4KD 4XNXL 4WEMB 3P9LB 3FN9A 1BEYH 1KCSH 3VDBA 1ZA6A 1I1CA 2F58H 4P2RD 4XRCA 4TPRL 3STBA 1N3NA 2R69L 1U3HA 5D72H 5SWZA 5EBWB 2DQIL 4NKDB 4UU9A 4U3CA 5MERA 5I8EB 3SCMA 2I5YH 4XPGL 1KC5L 4HS8L 5CEYA 1DL7L 3BT2H 4JY5L 4PS4H 1IGJA 5EOCH 1NUDA 1YN7A 4YHMH 4CN1A 2RR3A 4JFPA 2ZCLL 4HSQA 1GC1H 1EFXA 4P9HL 2NZIA 3K81A 1A7OL 4OGAC 1G0DA 4PJXE 2W0FA 4LCCC 3HI5L 5I9QC 1FVEA 5A2FA 4H25A 5FM4A 4MDJB 3QG6A 4HZLB 3ESVF 4JQIH 4XB8A 5GS1C 3OTTA 1D6EB 5TQ2H 1U8NA 4RQQB 5T3ZH 4JGMA 1JGLL 4ZFZB 2ADGB 1F3RB 1FGVL 1MCBA 4GOSA 1IGYA 4JFDB 2YPLB 4O51B 2FZ3B 3KWWB 2LFGA 3P0GB 5T33H 3V6ZB 3FFDA 1G6RL 3FL7A 1GZPB 5DMYA 1CR9L 2DQDL 1CICB 4X4YA 5DD0L 2XN9A 3I6KB 5DDHA 4Y8DC 3S36X 1JPSL 4WRLA 43CAB 5CBAB 4OB5L 2XQBH 1HCVA 2WWMC 3TJHC 2NY3C 3DX7A 2Q7YB 3FRUB 4MWFA 4HJ0C 2KL6A 3SOBL 1NC4D 3AREC 4M6NL 4EN3D 4AL8H 1O0VA 4EDXA 1KIPB 3V9FA 4F7PB 3EUUA 2C26A 2YUVA 4ONHB 4XWOD 1GGCH 1AQDB 1OGAD 1NBVH 4LRIC 2B1HL 3FT4A 3ZTJH 3VGHA 2X09A 3WLBA 2DLFH 4U1HB 4AG4H 3KLHD 2DQUL 3IVKB 4X4XB 3ZDYF 2IH1B 1EJOH 1WC7A 5D96B 4XMKH 2NW2A 2H8PB 2OQJB 4QTIH 4DUVA 4UIMB 3BI9X 3UX9B 1FFPA 4H26A 1E27A 2NZ9C 4JM2C 3UTQB 3IDIB 1J18A 4MD4B 1I9IH 4PRIA 3IAGC 1LEIA 4I5BA 3S37L 4NQDA 3D3VD 5DVNA 1N2RB 5KS9E 2GT9A 3KYMA 3MFFA 4KKAD 4CU6A 2YD2A 3VRIA 3FB8B 1QLRA 4FQ2L 1BQUA 1ZWIA 4NWTL 1LO4H 2A6DB 3LKOB 4S1DC 5F1OB 4F7CB 4OI7A 5EA0L 2F54A 2R2HA 4YE4H 3A67H 4MDIB 4MMZC 3L3GA 3U4BL 5F7KC 5I71C 4FFZL 4I0PA 1F6FB 2GJ6B 3QI9B 1MEXL 4HV8B 2ZSVA 1XCTA 4M5YL 4DGIH 3QDGD 1T1XA 2CXKA 4YXLL 3LVEA 1I7ZA 4G7YH 4RA3A 1Y6MR 1DQJA 1S5IH 1Q94B 5FOBB 3QEQA 3HLAB 4UB0L 2I26N 3U4EA 4LSTL 3VGGA 5C6PB 1Z5LA 3L7EB 1TZGH 2V2XB 4PG2C 4S11A 3TYGH 5DA4A 3MLZH 1RHHB 1RZKC 3MRFB 5E8OA 4CN6A 1FDLH 2AXFB 3BQUA 2BVEA 4TNWF 5D2NE 2F8XC 5FYKH 4JVWA 3RZCA 2VIRB 1CG9B 4K3GA 1F13A 5JIHA 5IQ9A 4GAGH 5C9KA 3RWJA 1A7RH 2IH3B 4GKOA 4NO5B 4KQ4L 5HDBF 4MNQD 1CYGA 4O2CA 1NCNA 4TSCL 3SDAB 3QUZD 4YFEA 3NCMA 3QYCA 1X3DA 2FB4L 1LP9B 3WFEL 3T1FB 2OJZH 5E8EB 1A14L 3KPOB 4WV1A 5JZ7C 3ZYJA 4N1EA 4RNRA 1AQKH 2XKUA 3VXME 4NQEA 4R4FH 4E42A 1I1AC 3P0VH 1FFNA 1RJYA 4KK6C 5DJYB 4J3OC 4QNPF 5CLTA 4CU8A 5FDWB 4LLQB 1FSKB 3RWHB 4GRLC 1AO7E 1LO5B 4YGVA 1ORQA 1XF3B 2HG5A 4NQVB 4JHBA 3C6LD 2FIKA 4HBCH 3RTQC 3WFCL 3RIAF 5BRZE 2H2PD 3KJ6H 2BSRA 1NSNL 4GJTB 5J7CC 4PJ7A 3VFNB 4ZXBB 3EYQC 2FLRT 4DN4L 25C8H 4R4BA 2WIMA 1S7UA 2BXYA 4E5XA 4G6KH 4GG6E 4M48L 5D70L 3S4SB 4S2SA 4PJEF 4D0BB 2FR4A 3IFLH 4JJHA 1J88A 3P4NB 5JW3L 3CMOH 5CSBA 1LILA 4HWEH 2EH8H 3BEWB 3OZ9H 1X5ZA 4N8VG 1Q9KA 1ULVA 3LB6D 2FJHA 4JFXB 4NP4L 4HGWA 4WY7H 3LOWA 2X4SA 3E6FB 2OR7A 4X7EC 2AGJL 4KV5E 3ZSSA 1KCLA 2FCBA 4NSKB 3W0WA 5DMIL 4BZ2L 5IW1A 3M17A 2R4SL 3EYVA 3B9KA 3CFBB 1PG7H 4OZFH 4QRTB 5EORH 3C5ZD 5C0NC 1AGFA 3GJFH 5IVZA 4OLUH 1MCWM 4APQD 3SKOA 5EOCJ 3F7YA 3LMJH 4Y8AA 4S1QL 4X80L 4UT7L 2AK4B 2FLBT 1GGTA 1FE8L 1SEBB 4L8SA 1FFRA 3F65A 4XBGA 3D25A 1PDKA 5DQJA 4MQXD 1OTSD 1AR1C 1QSFA 5GISH 3NVQA 4BQCA 3WDIA 1MQKH 5AYUH 4DQOL 4B0MM 4FQJH 2FH6A 2VDRH 4NC0B 4C83A 4HC1L 3QIWB 5AAWA 1EERB 3HB3D 4GW5B 4ELMA 4WEBL 4PJEB 4XBPB 4HQQL 8FABA 1JZ2A 4L8CA 1S7RB 4OFYD 5MEQB 3BZEB 4X5XA 2QBWA 1YEIL 1VGKA 2GY7B 1DN0A 2DQGL 3FQNA 4MMXC 4OM0H 4EDWH 1A7PL 2GEEA 4ZPVB 2MFNA 1IM9B 5GGRA 1H15B 5EO1A 4F58L 3DO3A 3C08L 1G7QA 1QRNA 4JZNA 2AJYL 4JRYD 1NLDH 2ICEB 2RFXB 4NZRH 1I1YA 3GMLB 5KOMC 4C4KT 1WEJL 2X70B 1EO7A 4IMLB 3RDTB 5IR1A 4OZIA 2NY6B 1JWMB 2D7MA 4MVBD 5EOQH 4DN3L 5IHUH 3K4DA 4R96B 4RGOH 1T5WA 4D9RD 3VXOB 3F8UB 3BKJH 4TRPL 4JRXA 5D2LE 4R90H 1TCRA 5F9DC 5JHLL 1EO8L 4FTVE 5EU6D 4Y2DB 4Z7NE 1MWAA 3IXAA 5C0EB 5IV2A 4KK8C 4X6EB 1IGTB 2IGFL 1ZK9A 3U0WL 1QFWH 3FT2B 3RI5F 3DVNA 3ZKXB 3DURA 3I02A 2NY0C 2DKMA 1EO5A 4A6YB 5EBLB 3H2WA 5CP3H 4CKVX 1LMKA 1YUHA 2DDQL 3BDYH 3MRBB 5L9DH 4QHLA 3L5WA 3LRHA 1MY5A 2D7NA 3H0TB 1QBLL 1TJIH 2XXCB 5DEFA 2AAVA 1KPVB 5MEOB 3GSOB 2AJXH 3QFJA 4ODUB 1JF5A 5I73C 1WFTA 3CLEH 4QYOA 4EKXA 2X89D 5C3LD 1TZHB 3T4AA 2V7HA 2VN7A 4X6FB 4DK6A 3FZUC 4H1LH 2O5ZL 2EE3A 3B5HA 2J88L 1MVFA 4QOKA 4Y4HB 2MQCA 4WNQA 3QIUA 3MGTA 1IE5A 1QZ1A 2XRAL 3M45A 3SDDB 1T6WA 4C56E 3O3EA 4Q9BA 1T5XB 3IDGA 4ZQKB 3UBXG 2Y7QA 5D7LB 4GW4B 3MACL 1MFEL 2R9HD 4Y4KD 3RUGE 2QSTA 3N85H 2W1NA 4JO1H 1INDH 2HMIC 3HZMA 3QZWB 4W6WB 3D18B 1F5WA 5TE6L 4TN9A 5GGRY 5I8OH 2LQRA 4NWUL 3LEVL 3ARDA 1HILA 3RGVC 1RIHL 2J5LB 4QGTA 1YYML 1ZVYA 4X98A 4OV5B 2ESVE 2HAZA 4U6HB 3D1MC 3OKKA 2UWEF 3T0XA 4WWKB 1WBXA 3BZFB 3ARBB 4CNIB 1JZ8A 4OLEA 5TGBB 5LCVH 32C2B 3OQ3B 4G9DB 1LE5A 5GRJL 3IETB 3UBXI 5C09B 4K9EH 4KMTL 4OZ4A 5E5MA 3EO1B 1EZVY 2JCCF 4PJHE 4QXUL 1YMME 5GGSA 4DKAA 3U9PL 5KAQG 1H8SA 4HULB 5J1AA 3TO4C 2NY4C 4GAYB 1KEGL 5TF1H 1MF2H 1BAFL 2MTPA 3OKOA 1P2CB 3ARGC 3VXMD 1QBAA 2QSCH 3ABZA 2K1MA 4XGZA 1YEKL 4HIEB 2F5BL 4X9BA 4BKLB 2V17H 4M00A 5FUOL 2IAMD 3QFDA 3TNNB 4HJGA 1VADA 3RWDA 5E56A 3IJHB 3L1OL 2OCFD 1PKQE 1VESA 2GSIA 4JQXC 5JW4M 1G7IB 3U0TB 1M6OB 3O4OB 4KZDL 4XAWH 3HE7D 4ZNEE 3MZTA 4QTHB 3GBMH 3DI2B 3IT8D 4OT1H 4AIZA 1AFVH 2VQ1A 2YC1B 1QYGL 4M61A 3ZTNL 5IF0B 1BJ1H 5I1JL 1RZJC 5E4EC 1MCPH 3AS2A 1MH5B 3BP4A 4ALAL 4YDVB 2X40A 4YZFF 4I8DA 2QHRL 4PD4J 1NMBH 4UBDD 3VFOB 1D3CA 3OKDA 4AT6B 5CHNB 5ICZB 5HYIA 1QUNA 5A2JH 5KVDH 3QR2A 1QBBA 4ZS7H 2JCCB 3WEXA 5F89B 5HI3D 1ZLSL 3WJLA 3DUUA 4YHZL 3VXRE 4F37K 4IS6B 2XXMB 4FABL 2AKRB 1ZKAA 2GSGB 4Y5VA 1BLNA 1U41A 4UILH 4OBRA 2XWTB 2X1OA 3PXHA 4M03A 3OX8A 1DVFD 3TPUA 1QQDB 1I8KB 1ZANL 2NLJA 3MRKA 4X6CF 3WO4B 4WUUE 5I8KL 1P1ZA 4N0FB 1TITA 1BVZA 2LU3A 4KDTC 2X9WA 2CK0H 4DGVH 3NABH 1A6AA 1F11B 2AP2A 1D6VH 3LSOB 4FFWD 1IGCL 3O8XA 2RGSA 3VXQB 4HIXH 2P5ED 3NFPA 5HYSA 1XMWA 2CO6B 3JV4A 3PHOA 4K55A 5C0CA 4K7PY 4ODSH 5ICYB 2KDGA 1X5IA 4LDEB 3KPTA 3V0VA 1JZ5A 1KJMB 1NMAH 5AZ2H 4U1NB 1NBQA 3AFLA 3MBEB 2X1QA 5K33A 1KEMH 3D2UD 4NNYB 1OF2A 1X5LA 1X44A 5EO9B 5K9JL 2JB6B 1NDMA 3EJZD 4DUWA 5FO9A 1CVSC 3ARSA 3BZ4A 5DQ9B 1F42A 1QBMH 2BNRE 5GGSY 1EDQA 1IC5L 2EDEA 1W72H 1V05A 1C5BL 3AM8A 1FO0B 1UJTA 1KENH 4HEME 2AJ3B 5C0IB 5JHDA 1MRFL 1UGNA 4JVUA 3TFKC 1JWUA 3T08A 4YBQD 4U1GB 5IIEB 3NZHL 1N5YL 4U6XB 1XGQB 1ZXQA 4JHWL 5E00B 4OCSH 1BZQK 3QPQC 2OSLA 3MPCA 1OAQL 3KYNA 1BZ9A 1NCCL 4YX2L 1NGWA 2X4PB 3FHQA 3NIDF 5FYJE 3C8KA 1ZHNA 4U7MA 4S1SL 2V9TA 4O9HH 1XGPB 1DQQA 1OAYL 1PW3A 4ZTPH 1QLEH 3CFJB 4UNTA 1JNHA 4X6CB 1I3GH 4QWWD 1K4DA 1VPOL 4PV9A 5IVNA 2C3VB 4PJGA 3AAZA 3QNYB 4OAWA 5J9PB 1IAOA 2IALB 2VLRD 1YZZA 3MRJB 4DEPC 3DVGA 4XHQA 4PRHB 3QHFL 1MPAL 2DBLH 1BZ7A 2FATH 3K8LA 1OLZA 3P30L 1JF1B 3J8F7 1KELL 4E41E 2PYEB 3NCFB 1XT5A 4G9FE 3ARWA 1QKZH 1G9EA 1AH1A 5F3BA 3O4LB 1OAKH 2EEAA 1A6TB 4NGHL 4U1LB 4NT6B 1RZKH 3V6FA 4L29B 3MV8E 2F74A 2BX5A 4JEGB 5CJQL 2GI7A 2ILLA 1D9KC 4WI9A 4H88H 5EUKB 3RAJH 3S35X 4LASL 5IB5B 1L4IA 2VAAB 1CQKA 3ILPA 1A2YA 3TO2B 4LPXA 2XKNB 3H3PL 4C58B 3BKYL 3TZVA 4IRJB 3CNKA 4OZHB 5IT2L 3GRWA 1X5FA 4Z5RB 3CXHK 1RUKL 5EB9A 3V4VH 2IPKA 4LHJB 4JY6A 4YK4B 3RVXD 1GH7A 3T1WA 4ZFFB 4U1MA 1S7SA 3PV7A 2ZSWA 3HNSL 3M8OL 2AJVH 5FYJL 4I77H 1AXTH 3LN5A 3MRRB 4E0RA 5B38G 4EI5D 1I3VA 4FFVD 1OAXL 1QR1A 3BZDA 3G6DL 4PRPE 1CFNB 1UJ3B 3QCVL 3ARPA 4Y16C 5DO2D 3H9ZA 4HK3N 3QXVA 3RNQB 1RURH 2GJ6D 3O2WH 1T0NA 4ODHH 3WNNA 4UQ2B 4P2QB 3BWUC 5BO1H 1BQHA 4P4KC 1R3JA 1M1SA 1EHLL 2PW1A 3JSSA 2ZUYA 3C09C 1A4KB 2ZPKL 1IEHA 3HCVA 2V2TB 4I3GA 3UROR 1LEKB 3PHSA 3RZCC 3IFNH 1CT8A 1NAML 2OXHA 5HYFA 3P9LA 4PJXF 5E2UL 2C3GA 2UUDK 1J1PL 1B6DA 3MO1B 1DZBA 1K2DB 4LLAA 2ESVD 1FLRL 5EBWA 3G5ZB 1JFQH 4FFYH 2AK1L 5I8EA 2PNDA 1KJ2H 1T20B 5C6WH 5TFSL 1A1NB 1C12B 4BELD 5EBMB 1X4ZA 4XP1H 1KCRH 3RKDD 4DUXA 4GH7B 5BV7C 2XQYG 4PJ8D 1BJ1J 4HZLA 4DAGH 3A6CL 3ZMRA 1D6EA 2W9EH 2Q6WB 1KCUH 1Y6NR 1UQSB 1QPPA 3BIAX 4OLVH 4ZFZA 3MODH 5E6IB 4ZUUB 5FCUL 4LSSL 4UOJA 3TESA 4L4VE 4OGXL 3M07A 1QSVA 3ZL4L 2ZUWA 2D9QB 2YPLA 3LKRB 4JFDA 4MA3A 4O51A 5EC2A 1RIUH 4F33B 1CD9B 2FZ3A 3GGWB 3KWWA 3NZ8B 3QQNA 4KZEL 5CZVH 5ALCL 3V6ZA 5E9DB 2X05A 2VC2L 5H8DA 3UYRL 4AMKH 3QXAB 4NZUL 1CICA 3OJVC 2CKBB 4EN3C 2H1PH 2PXYD 4Z7UE 2Y5EA 43CAA 3UDWA 5CBAA 4JG1H 2Z9TA 5DK2B 5I17B 4PJXB 4G6MH 3GSWB 1IGFL 3WDHA 2Q7YA 2W92A 2EKSB 4OIAA 4UV4H 3C2AL 1CL7H 4XWOC 2OZ4A 4I13B 3VD5A 2C9AA 4O2FB 2JB5L 4PGZA 1WAAE 1KIPA 4DKFH 3GBNL 3KLHC 4F7PA 3BPOB 4N8VB 2BVTA 5I0DA 1XIWA 2OL3L 5EZJB 1T7WA 2ZKHL 4ONHA 1A22B 1AQDA 1WFNA 4FZ8L 3OKMB 1Q72H 2NCMA 4U1HA 3IVKA 5KS9F 1Q9OB 2IH1A 1IQWH 3CC5B 2HJKB 3QPXH 2H8PA 2Q86B 2VYRE 3D69B 3IDNB 4UIMA 3CVHL 2ZG1A 3FO9B 1FNSL 4M7KL 4KKAC 4Z95H 2I9TB 3FONA 4MD4A 5LAXB 5DC9B 1ADQL 5T3XE 2H26B 1N2RA 4YPJA 5JQ6H 5FECB 3QUMB 1R3IL 3FFCD 5I1CL 1Q0XH 3FB8A 4QRQB 5I19L 3GEWB 3T77B 2EYRB 3P11H 1QFHA 2A6DA 1F4WH 3LKOA 5KVFH 4F7CA 4RAUA 5F9OH 1DTUA 4MDIA 3EJYD 9CGTA 2GJ6A 3QI9A 4HV8A 1A8JH 3U1SH 5KSVB 5JNYB 1EA9C 5IJKA 5JIIA 1LD9B 1AY1L 5EG6C 2X4UB 1L6ZA 3QIWD 4JN2B 1KF9B 3MCKB 3E2HB 1Q94A 5FOBA 5I1IL 3CFEB 3HLAA 4RMSA 4N5ED 4ZYKB 3L7EA 1IEAA 2V2XA 3BKML 1RHHA 3GHBL 4HKXB 5CIPB 1V7NL 3SHSA 3MCG1 4GRWH 5ILTL 3AUVA 3ARYA 3LV3B 1MOEA 3C5SB 2VIRA 1BIHA 1CG9A 4XCYB 1IM9D 5GRUL 5GZND 4ZTOL 1M7DA 4NO5A 4YNYB 2FWOB 2NR6D 4AEFA 4OCWH 3X12B 4F80A 2DBJA 4FRWA 3V8OA 1Q9WB 4YDIH 4JG0H 4IBLT 4G8EB 1J8KA 3SDAA 3F7VB 3DRQB 1A6WL 4NCDA 2PTUA 2XNAA 2VDOL 4BFEA 1A0QL 5E8PB 3LKPB 4I18B 3T1FA 2Y06L 5DJDB 5E8EA 3KPOA 4U1SB 1E4XL 5T3XL 2ZUTA 4RDQG 3OAUL 1JK8B 4LFHD 3WKML 3C6LC 2HFGH 5DJYA 5FDWA 3BDXA 2H2PC 4LLQA 1MHHB 3EJJX 1VA9A 5I75B 3V5KB 4WI5A 4GG6F 3CH8A 5D2NB 1F3JB 3RWHA 1CDHA 1CFSB 1LO5A 1XF3A 5LWYH 5EBGA 5SWSD 3VWJB 4M7JL 5AEAA 3VFNA 3WS6C 4ZXBA 3VFWB 5HPMB 4HT1H 3E1F1 4M43L 4S1RH 1KB9J 4WUKL 3G5YA 2J8UE 3LB6C 4FHB