5C0CD

1e6 tcr in complex with hla-a02 carrying rqfgpdwiva
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
200
structure length
200
Chain Sequence
KEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 200
sequence length 200
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0cD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0cD02
3S5LA 1YEHH 3QIWD 3QIWC 2A77L 5JW4M 3MGTA 4J3XA 3QUXA 4X5XA 4L3EB 2LVCA 4OF5A 2JIXD 2OCFD 1F42A 1GZPB 4P2YA 2UWEF 4U7MA 4XCYA 5IW6B 3H6JA 5GIRB 5CHNA 1RJYA 3DSNA 2EE3A 3N85H 35C8L 1TQCC 3GSNA 4KI5F 5C0RL 2GJ6E 5EWIH 5JIKA 1LDSA 3QUYB 5J57B 2J6EL 1MCCA 5DR5L 3JVGA 3H3KA 1I8MA 4ODUA 1LP9F 3S36X 2XZCL 1IAMA 3RWEA 1YECH 4F7TA 4LIQE 1KEML 1Z9OA 4QRUA 1MCOH 1AGBB 1LEIA 4UT9L 4AG4H 3VXQB 4O5LH 1OPGL 2YZ1A 4NBXB 3RZCB 4V1DA 4FNLL 1XR8A 4NHUB 2RQ8A 3OKMA 2DLFH 3R1GH 1JI1A 4QXTB 1KTLB 1JGVH 1XGPB 3L5WB 1A1MB 2P8MB 2E8YA 1HQ4A 1NCCL 5DEGB 3C5SA 3CH1B 3WS6C 1R24A 2UWEA 3SO3C 3FQTA 5BRZE 3RIAF 5KS9B 2Y6SD 3MRLB 5EZLB 2Y6SC 5FYJU 2ZNWA 4GUPB 2GUOB 3DBXA 3ZMRA 3VG0H 4NUGL 4P2RE 4ZTOL 1YEJH 4HG4K 1LP9A 1CDYA 4KK6C 3HRZB 1HWGB 3H3PH 5H2BA 1YYML 1L7IH 2IANE 4LSTH 1NSNL 3MACH 4OV5B 5INCB 3U7WH 5HGBB 5I8EA 1DBJH 3SN6N 4XNZB 4IMLA 3C6SB 4ELMB 3G5XB 5I1EL 4MAUL 4ZDHB 3MNVA 3BZEB 4XTRD 2HFTA 1H3GA 3ZE1E 1T04B 4XTRC 4D94A 4JFDE 1BBJA 1I1CA 4LLMA 3GJFH 1E28A 3UTTD 5HTSA 1IGFH 2BVTA 3IXTB 3V6ZA 4PY8I 3RP1A 1EAJA 4U1SA 4JLRA 4TVSa 3VFWB 1Z2KA 2VXTH 1JPTL 5D4QA 1OTTD 2OM5A 3FFDB 3SKNB 4ZPTB 1CD1B 3G6AA 4S1QL 5C3LD 3QDME 3TT1H 1I8IB 1LEGA 2AKRB 5BS0E 5C07D 4TN9A 2VDQL 2GK0A 1BF8A 3N50A 5E4EC 1I1AD 3NVQA 5K93A 1I1AC 3ZHDA 3MV7D 1KTKE 4WHDA 5DHVB 1LO0L 3M17A 5JW5B 1DFBH 1IM9A 2ZOKB 1IEAB 4GW5B 2JB6B 1ZVSA 3TBYB 4Q0XL 3PDOA 3OHXA 2JTDA 2VDPH 3H7BA 4FQXA 3O2WH 3QDJE 5FO8A 1GH7A 6FABL 2P5WA 4EOWL 1RZJL 4D0CA 4N1CA 5JW3H 2BSSB 4O00A 4WUUE 1V7ML 4PV8A 1HDMB 2DWEA 1BX2A 3VD3A 3MUGA 4XAKE 4RNRB 2DQJL 3OKYA 5K9OB 1QLFB 2VXSL 1CFQA 3LKRB 3SQBA 2GSGB 2NY3D 4EDXB 4GRMA 4NNYB 1YEHL 2NY3C 3U0TB 2G9HA 4NN7B 4P0DA 4Z0XA 1OSPH 5DJDB 3RJDA 3W9DB 3P40A 1FO0H 2BMKA 3O3AB 4NRZA 1Y6NR 5CKGA 1TTGA 4HK0B 4UNUA 2CKBH 2H6PA 4LVOB 5C09D 1K8IB 3CVHH 4DK6A 1E4JA 4MWFB 2IBBA 5DWUH 2JE8A 3N85L 3CVIL 5BO1L 2X4NB 2QTEA 1U8MB 3PE9A 3OSKA 2I9TA 4YQXH 1Y18B 5TH2B 5EWIL 4D8PA 1INEH 3ILPA 4JKKA 4M1DH 1B0RA 2GIYA 1YECL 1WT5C 1MCOL 4RAUB 4XVSH 4O5LL 2X4PA 1YPZF 1X5FA 4CVUA 4HUVA 1J05B 3QEHA 2C7UB 1UB5A 2DLFL 4UIKH 5MEOB 5KSBF 3VXRD 2EDYA 2Y9RT 4LSUL 1JGVL 4HCRH 1IBGH 2FDBP 4Z7UF 2AEQH 2B4CL 3SCMA 1JZ6A 3RVWC 1BJ1J 4L4VE 3B5TA 4KROB 2WWMD 5IVXF 4MNQB 3NABL 3SGJC 1ETZB 2WWMC 2HVKB 2IAMA 4N0RA 6CGTA 4WU7B 5DRZB 5C08A 1O0VA 1HQRA 5CJQL 4RGNB 3VG0L 3KPSB 4XBEL 3Q5YA 1XF2B 3PQYD 4DVRH 3CFCH 1CG9B 3H3PL 1L7IL 4Q74A 4LSTL 3MACL 2PETA 3U7WL 4ZOCA 1DBJL 4NQCE 1YPZA 2FD6H 2XN9A 1LE9B 4JN1H 5T1LD 4HAFA 3TPUB 4G9FD 5KSBA 5D7LB 2YN3A 3MUJA 1DQTA 3L3JB 4RMWA 5FK9A 3EYOB 1TVHA 3HS0A 2HN7A 3IB4A 4Z7UA 4DWHA 2DMBA 3EFFA 5F7EH 4MQ7B 1JZ2A 3HPLA 4P2OA 3IF1A 2CUIA 4JFEE 5CD3A 5IVXA 4PRBB 1S9VB 3RVVD 2GI7A 2UYLA 1RZ8B 2Z93B 3CJJA 1WISA 4JFPA 5FKAB 4ZNEA 2AI0H 5T33L 4I1NB 1FC2D 2N7BA 4FQCH 4NIKB 3F7VB 4C56B 3EO0B 2FR4B 4PRPD 1FVDB 2NTFA 2NXYD 3EO1A 4K3DH 2NXYC 5KTEL 2AAVA 2EDXA 3ILQD 2G2RA 5FM8A 3EZ8A 4XB8A 1DUZB 3ILQC 3HE7D 5LGHL 3KPLA 1MLBB 1F3RB 3HE7C 1UXSB 5DSCA 5F9JA 3DX7A 3V7MA 2BNQD 5ANMB 3F6IA 3JUZA 4MA3B 5F1NB 3DGCR 2YWYA 5EH1A 4Y4KD 2VDPL 3IDJB 4LHUB 4M7JH 5HHOA 1GC1H 3MNZA 3O2WL 4Y4KC 4KUZH 2RB8A 4EKXA 1DEEB 3QWRD 5E99H 1BJ8A 4G6AD 3UC0H 1XIWD 4G6AC 2HLFD 1YY8B 4ODSH 3DIFA 3WLBA 1XIWC 4BH7B 3SGDH 3OKOB 3Q5OA 2HT4C 4K3JH 2VXUH 2BRQA 2PYFA 1ZE3C 4O2CB 5CEXB 4QRRD 1OGAB 2WV3A 1RHHA 3VRJA 4TNVK 1JTPA 5I8OH 1KTDA 1FO0L 3TH2T 2D9CA 1AXIB 2A1WH 2K7QA 2CKBL 3CVHL 4LCIH 2HTLD 3K8KA 5GS0H 5I71C 4NM8H 2HTLC 3U79A 4I18B 3MFFB 5DWUL 5GGVY 1MHHB 1FGNH 3NCFB 3QXTA 1NDGA 4TUJB 4LLYB 4DFHA 3KJ4C 4YQXL 1CU4H 3ZE2E 1PG7X 1INEL 2NZ9D 3FOMB 5B3JF 5E03A 2XPGA 2NZ9C 4D0DB 4AENB 1U58A 2R69L 4UTBH 1UWEH 4WW1B 4GG6B 4XVSL 1K3IA 1FP5A 3KJ6H 4KQ4H 1KIUA 2FO4A 1DUYA 4HK3J 5FOJA 2HFFB 3C8HA 4L3EA 3OQ3B 5E9DB 2AJSH 4KMTL 1IBGL 1GZPA 2IALB 2JCCE 4ORZC 4OZFB 4U3XA 1WIPA 4Y5YC 5EOCJ 3K7UA 5GIRA 5KS9F 1F11B 2ADJA 3HFMH 5SX4I 3PWLB 5GGTA 3W5NA 4CJ1A 5T1KB 1YC8A 2FWOB 1BFTA 1WCQA 1QLRB 3Q3GA 4S0TD 1OD9A 4NO5B 3QEGH 1AGBA 4ODTH 1X5AA 3I2CH 4DVRL 3RZCA 3MZTA 5TQ2H 3CFCL 2Y23A 4ELMF 1XEDA 4NHUA 2DM7A 3D2UB 2F8XC 4QXTA 2M2DA 1XGPA 4QXWA 2FD6L 3L5WA 2DDQL 1FC1A 1A1MA 3MRGA 4QNPF 5DEGA 1AGFB 3CH1A 1O7VA 2Y07H 3ARSA 4KPHH 5F7EL 1HYSD 2DD8H 1D9KD 4Y0GA 1HYSC 1D9KC 2GUOA 4R7NB 1E27B 5CGYD 4RFOH 5CGYC 1X5IA 4L8SC 5BV7H 2AI0L 3P0VH 5F7LB 1N4XH 2BDNH 5D7KD 2V9RA 4FQCL 1LD9A 4OV5A 5HGBA 2FH8A 4LLQA 4F15C 1RIUH 3C6SA 5T1DH 3RX8A 2LVEA 5ERWB 3NFNB 4K3DL 4ELMA 4Z7VE 5ISZD 4K55A 5C0CD 5F89B 1ZWIB 3G5XA 5TQ0L 4M6ML 3BZEA 4X9HA 3X13A 4PJBF 4F37K 1U8PB 1HCVA 3OR7B 4NN5B 3TCXA 3ZL4H 2Q76B 1M7DB 1X4ZA 4RZCB 4OKVA 3IFOB 4GRWE 5EBWB 4L3AA 1VACA 3IXTA 3HZYB 4MVBD 3O2DH 4MVBC 3FAXA 1EDQA 4M7JL 1GC1L 1RULH 1V8HA 3OX8B 4KUZL 3DJ9A 3MLYH 4ZNCD 2GJ6B 3NBNA 5E99L 3FFDA 3SKNA 4ETQB 3K3QA 1CD1A 4ZPTA 3EDEA 3UC0L 2O93L 1HHHB 4W4NA 1Q94B 4OGXH 1AR1D 4ODSL 1AR1C 1A21A 1I8IA 1ODAA 2VXUL 1KLFA 2A74B 1FFQA 3RY6C 3SDCC 5IG7A 5A2JH 4UTAH 2VTFA 1JL8A 1QFWH 4JO1H 1UJ3C 1F4XH 4YWGH 4R4BB 1WTGT 3DWTA 5JW5A 5I8OL 1KPRB 1QO3B 3WFHB 4PJBA 4GW5A 3ARFB 2JB6A 2W0LA 1IQDA 3MOBH 2A1WL 2VZUA 3JTTB 3TBYA 4AEFA 4LQFH 5GS0L 4NM8L 1ZSDA 5HI4D 3MJGX 4KMQA 2ADGA 5HI4C 1HXMB 3HMWH 3QZWG 4DKAA 3C09B 4NO0D 4P2RB 2A73B 4NKIL 1LE5A 3CC5B 4RNRA 5LAXB 1UWEL 2GSGA 4H5SB 3REVB 2IJ0C 4ZFFB 5E08L 4NNYA 2BC4B 1CD0A 3KJ6L 4KQ4L 1TJGH 5DJDA 1QEWB 4OM0L 1QSFE 4DJMA 3O3AA 4IS6B 2AJSL 5K9QI 4HK0A 1KLGB 3AGVA 3N1GC 4O58H 5E2JA 1T2JA 3VFOB 5LVEA 4J3UA 4MWFA 4QRPB 2YRPA 4P46B 4JG0H 3HFML 5I75B 5GPRA 5TH2A 2PW1B 4BFGA 5C0BA 4I77H 4JB9H 4ZFOB 4UV4L 5JPNB 3CUPA 1FFPB 2XG5A 3FOLB 4CU7A 3FRUA 3QEGL 5EU7E 4ODTL 3I2CL 1ZLSL 5F7YC 4FHBD 5TQ2L 1A3LH 4Y5XA 1IVLA 1I7UA 1C5CL 5FIEA 2HFGL 3U6RA 1OW0C 1F58H 3QDMB 3KLHD 3KLHC 5IFAH 3UO1H 3DXAE 4HMDA 4QTIL 5EU6A 1TITA 2IH1A 5CILH 4MNQA 2Y07L 1AQDB 4KPHL 2DD8L 1JZ5A 4WU7A 3B5HA 3VGAB 1K2DB 4NQEA 4FTVD 3BJLA 4MSWB 4PRAB 3QDJB 2VDLL 4RFOL 2LTQC 5DRNB 5BV7L 1K4DB 3ECBB 4U0RC 5TE4H 5KVDH 1MHCA 3HTLX 4WIQA 2EH8H 4UU9B 1N4XL 3TZVD 2BDNL 4WUUB 5DD3H 3S36L 3TZVC 4YAQA 2P7TB 3DO3A 2DQCH 1U8NB 1A6TB 1RIUL 5LCVH 5E8PB 5T1DL 1L0QA 4UT6L 3ZTJH 5DFWH 1S7QB 2Y7QB 3TPUA 5D7LA 3L3JA 3EYOA 5IW1B 1GCFA 1S8DA 4UDTA 4IOFD 4PRNB 4IOFC 3ZL4L 1XF3B 4E41E 1WBZA 1KB5H 4PRBA 3W11D 3FZUD 4F9PC 2PO6B 5CBAB 3W11C 3ARVA 1RZ8A 2Z93A 3FZUC 1OP9A 4G7YL 3RHWK 4HEME 5T3ZE 4YO0B 3MLYL 3DNKA 4PG2A 3LEVH 4LCWD 3W9EB 3F7VA 5IF0B 1P4LB 2CK0H 2FR4A 4PYGA 3GSUB 3LY6A 4U1HB 5EIVA 1U42A 4MMZC 3VGBA 1JNJA 1WZKA 5IB4B 2XKNB 3L3HB 3QO1B 4UTAL 3IDXH 4JPKH 4JFFB 5CSZA 1IAKA 1DUZA 4YWGL 3LDBC 4OLEA 2PXYB 2R23B 1MLBA 1MWAH 4JY4A 3I50H 3GJFA 1A4KB 2GTZB 4IIQC 3UPRB 5ANMA 1IRAY 3TLRA 4EI5B 5F1NA 3MOBL 1AP2B 1VSCA 5CWSA 4L4JA 3IDGA 3R06B 2FH6A 4LQFL 1GJIA 2VSDA 1DEEA 1AQKH 1WCBB 3HMWL 3HI1A 5IB3A 3O6LH 1MAML 5F7FA 1S9XA 2VDKL 4Y16B 4KZDH 4GG6F 1MIEH 4BH7A 3OKOA 4MYWB 3GKZA 2YRLA 1H8SA 2I27N 4HXAL 4XP6H 3KWWA 1CE6A 3QJFB 4O2CA 5CEXA 5J9PB 5HGAB 3ARRA 1OP5K 3VRLF 1IMHC 4QOKA 2Q8BH 3QCTH 1TJGL 1S7TA 5ALBH 5GGSB 2AJ3B 1DEDA 4PY7B 4K7PX 3TWCH 1X7QB 2DQTH 4NWUH 5I18H 4I18A 4Z95L 5EO0A 4JG0L 1MHHA 1X5YA 1NAKH 3O81A 3ZLQC 3KLAB 4MZ2A 1E4WH 1ZK9A 4I77L 4JFEB 3BRDA 1WLHA 1JN6B 4JB9L 3FOMA 3GIVB 2BVUA 3EOBB 4D0DA 4FFWC 2YPLE 3BPLC 4MXQD 1MH5A 2ADFH 4HIIA 4MXQC 4WJ5B 3VA6A 3CFDB 4NQTA 1ZA6A 1ZGLB 2F54E 5J06A 1A3LL 4LKCB 2ED9A 3GM8A 4CN6A 4KJYB 3CSPA 2HFFA 1F58L 1FO0A 2XICA 2F8VA 5E9DA 43C9B 4ZODA 3TBWA 2CKBA 5IFAL 3UO1L 2IALA 3CVHA 5C0GA 3UJIL 5J11B 3QFJA 4OZFA 4WWID 3SGKC 1BIIA 4FP8H 2ZCHH 3AB0B 5CILL 3VWKD 3J7HA 3TJEL 3VWKC 3B9KD 1FPTL 3B9KC 2BVPB 1DBMH 3NN8A 1EFXA 1CK0H 5D6DC 2K3TA 5MEPA 3MA9H 5TE4L 5KVDL 1LHZA 5ETUA 5ID1B 3U4EA 1PG7H 3GO1H 5HHVH 1JWSA 3CXHJ 5GRZA 4OCYH 2WIIB 1J86A 3D2UA 3KAAA 3UYOD 1JIBA 3HNVH 4HCRA 2ZSVA 5L6YH 1QBLH 5DMGD 5DMGC 1H5BB 3OXSB 3ULUD 4Y7MA 3ULUC 4NO3B 2R29L 4HIHB 2Z35B 3CX5K 4JKPH 4AH2A 3U1SH 1JHKH 2N1KA 3EAKA 4PJ5D 3BIAX 1KB5L 1ZLVH 1DBAH 4LLWA 3GI9L 2BSTB 4U6HB 2C1PB 3NPSB 4JGMA 4N1HB 1F97A 3JV6A 1CZ8H 2PNDA 4OAWA 1VGKB 4JM4H 3T0ED 3LEVL 5J13B 1PSKH 3X12A 5DXWA 3T0EC 1AO7B 1SMOA 1JRHH 1RIHL 3BAEH 5EZJB 2ORBH 1CDJA 1CDUA 5HD8D 5ERWA 2JJSA 2L7UA 1QSEE 2P5EE 5F89A 4IRSB 2OI9C 4R4FH 2NTSP 3ARGD 3IDXL 4JPKL 4K94C 2VAAA 5LXGH 3ARGC 4PJEE 4X4ME 1UG9A 4X6EB 3OR7A 5L2JB 2AK4D 3VXUE 5IQ7H 4NKMB 2P49B 1MWAL 1M7DA 2Q76A 3Q2CA 3IFOA 3VXPB 2XA8H 2KQMA 3QWOB 2OQJB 3D0LA 2CRYA 4GOSA 3VMPA 3OX8A 4NQSA 5EU4B 2H9GB 4KVNH 2Q20A 1ORQB 1LDPH 1AQKL 1ZTXL 2GJ6A 3NH7H 5JO5B 1HHHA 2F53E 3O6LL 1NGZA 1Q94A 4KZDL 3UJTH 1MIEL 2R4SH 1DN0B 2HJFA 2YKLL 2A74A 4XP6L 1JBJA 4NO2B 4PR5B 1EO8H 2Z8WC 4PJCE 5DJ6A 1GHFH 5EUOE 4R4BA 4LP5A 2Q8BL 3QCTL 3PG2A 5ALBL 1KPRA 3MV01 3WFHA 4JO3L 1FNSH 3ZE1F 4YGVB 4U1LB 4KRNA 3TWCL 4NWUL 5I18L 1QSVA 4QRQB 1FRGH 5BRZA 1HXMA 1NAKL 3HC4L 4J8RA 4ONGH 4D0BB 3FKUS 1GGYA 1E4WL 5IKCB 2BRRH 4YX2L 1NLDH 2A73A 4M03A 3UPAA 1U3HB 5LAXA 3JWDH 2ADFL 1A7OH 2R0WH 3CU1A 2D7TH 2ERJC 5EN2A 4H5SA 5T3ZH 1MF2L 4N8CL 1BZQK 1IKNC 3S4SB 5C8JB 3A6CH 2BC4A 2IANA 4XMLH 5MENB 1YA5A 1QEWA 3HR5A 1JZ7A 4JGUA 2BNRD 4M93C 3ZKQD 4Z7VB 1RZFH 3RDTB 1KLGA 1JYXA 5TF0A 3HG1D 3VFOA 3BH8B 4FP8L 1ZT1B 4OV6F 1NGYB 1RJZB 2ZCHL 1N8ZB 5EC2A 3VFNB 1CICA 2W9DH 4JFDA 1RPQA 2IPKA 4GRWB 4YBLC 1XF4A 3DO7B 4ZFOA 1BLNB 4K23H 5JPNA 2YD5A 4OCRH 3RAJH 3IXAB 3FOLA 5E8DH 1NC4A 4BFIA 1AHWC 5C71A 4Y19E 1E4XI 3P4MA 2UVFA 2BVOA 1NCBH 3DURB 4WHYH 4H0IA 3FN9A 3MA9L 4KVCH 1FSKC 3QFDB 3BGMB 2FEEI 3MLWH 1PG7L 3TO4B 3GO1L 4BQCA 3BPNC 5FEBA 1ZGLP 3KDMB 3HNVL 1R3IL 5L6YL 4MJID 1LO3L 1ZEAH 5BS0A 3FT2B 1AD9A 2V5MA 2VQTA 5JNYB 1U41A 1MUJB 3DI3B 1T2XA 5ADOH 2V2XB 4Z6AT 1R3KB 2GEEA 1M7IB 2BERA 2EYSB 2OYPA 3U1SL 1JHKL 4YDJA 2IWGA 1K2DA 3AS3A 4CVWA 3QJHA 1DBAL 3DHMA 4MSWA 1CD8A 3QDJA 1FE8H 3H9SD 5DRNA 4KWUA 4NZTH 2NLJA 5T3XD 4APQB 1DZBA 1I7RA 4PJHE 4WUUA 1PSKL 1H3VA 1L0YA 3CMOH 3L5JA 2VDML 1A9BB 2CKNA 3BAEL 5F7DA 5E1HB 5I1KH 1A5FH 1U8NA 2ORBL 1A6TA 2XACC 3RNQB 5E8PA 1B0GA 4FXGB 2XTLA 3D48R 1WWCA 1YJDC 5H37H 1AH1A 4R4FL 4Y2DA 1XGRB 3N9GH 3BGFB 1KN4H 5IW1A 4RX4D 3C9NA 5I6XB 5IJVB 2KZWA 1QSFB 4PRNA 3RFZC 2CR3A 5IQ7L 1XF3A 5C0ND 5GGUA 2EC8A 2XA8L 5C0NC 4X5LA 1FLTX 3QDAA 1KB9K 1AGDB 5C9KA 4CNIB 4KVNL 5EPMB 1MJJB 4JZOB 1LDPL 1NKRA 3PWPD 3RRQA 3NH7L 5E2UH 5IF0A 1SVZA 5F88B 3UJJL 2FB4H 3GSUA 2R0LH 4TRPH 4U1HA 3TA3B 2E7MA 3UJTL 4ZOEA 3CLFL 5I0ZA 4AQ1B 3QO1A 3SDXE 3PHOA 3NZ8B 1EO8L 4K8RH 5DEFB 4N8VB 4YXKH 1JGUH 1OLZA 1GHFL 3A0OA 3UPRA 3F12B 2CO6B 4PIRF 4EI5A 3NGBC 3NFPB 3DXAB 4J7RA 2DQUH 3KYOA 3O2DA 1AP2A 4MLSA 1NMBH 2VSCA 3VG9B 3R06A 5HGHA 4JPVH 4L4VA 2VC2H 2ESVB 4GG8A 2XFXA 5GGQH 1FRGL 3MV9E 1WCBA 2XKSA 5AZ2H 2DIJA 2IFFL 1H15B 4NPYB 4KKAC 5L0QC 4OCLC 1FZOA 2BRRL 4Y16A 3RWJB 4OZGE 3Q6FA 1A8JH 2EDLA 4X80L 2UUDH 5HY9A 4AJ0A 4GLRI 3JWDL 1P4IH 2DM3A 1A7OL 2R0WL 3QJFA 4X9BA 3SDAA 1P9MC 5T3ZL 2YEZA 3OR6A 5DJ0A 3A6CL 1FNGB 1XR9B 4NQCA 2P8PB 5GGSA 5FYKD 1DP0A 1RZFL 3D3VA 4PY7A 5FDWB 1X7QA 2GTWB 5GZOD 4PLKC 4PG9B 5GZOC 1F4HA 2W9DL 5HHPB 3SGEI 2YUVA 4FOMA 2MQ3A 4JFEA 3VXTB 5IVZB 4YDVA 1MSPA 3GMOB 4K23L 3GIVA 1IGCL 4OCRL 3L7FB 5HYFA 2R39A 5E8DL 3HLAA 4QY8A 4WJ5A 5EIIA 1FZMA 1NCBL 3CFDA 1ZGLA 3E3QE 5BVPH 1FNEA 1N59A 2BFVH 1JE6A 3MLWL 2KDGA 4KJYA 1I1FB 2VZ3A 4FXKB 4LSSH 4G9DA 4NT6B 3ARDB 3F62A 4CMMB 5A2FA 1A7BA 1T4KB 2A9NH 3I6KA 4GKSA 4G80B 3STLB 4LSVH 5ADOL 5FA4B 4XCFH 2PYEE 2EIEA 2R2EB 1IGYB 1MFCL 3MRDB 3LQMA 3U30B 3DX6B 5K9KB 4JM2D 4P5TA 5B38A 4FQQA 4FMFA 4JM2C 3ZE2F 4GBXB 3D9AH 4OCWH 1P7QA 3SDYH 5ID1A 1FZKA 3C60A 3DGGA 5JDJA 1D6VH 4WTZG 3CMOL 2WIIA 4LHUG 5I1KL 1A5FL 4HUXB 4WTWA 2Z9TA 4C83B 3MLRH 4RGOH 3BPCB 2Q86B 1H8OA 3DMMB 1EEZB 3N9GL 2X4OB 4HIHA 2Z35A 1JGEB 4MDIB 2JCCF 3OV6A 1OAYH 2XKUA 2RFXB 4A6YL 3QAZB 3DRQB 2V17H 3QIBC 1R6VA 4RFEB 3DV4B 4PJ9B 4BQ6A 2BSTA 4U6HA 4RBPH 5SWZE 4AEEA 2DQHL 3TGXA 4LU5H 2IH3B 4GW4B 4F3FB 2A2QT 3P9MB 5E2UL 4XCCH 4ZUVB 5HGDB 1NMAH 4GJTB 4K9EC 2R0LL 4TRPL 5JQ6L 4GRLD 2YPLB 4ZQKB 2PTTA 4IRJD 4GRLC 3VFGH 3JV0A 4IRJC 2ICES 4K8RL 4WW2C 4HWNA 1TCRA 3CK0H 1KEGH 5L2JA 4YXKL 1JGUL 2F5AH 3WMSA 2VISB 5I30L 3KPOB 1KCLA 1UEMA 3VXPA 3QG6B 5K9QG 4UIMB 1KB5A 2AJZA 2JCCA 2OQJA 2DQUL 5MERA 1ZHBA 1NMBL 3CFJB 4CN1A 4M5YH 4JPVL 3SOBH 5FYJE 3O2VH 3BIKA 2VC2L 1IC4H 5GGQL 3KPMB 1ORQA 2E9BA 2MSPA 5AZ2L 3K4AA 4G6JL 5HDLA 5JO5A 4QO1A 4RMUA 2CLVA 1PVHA 5IEKB 2GCYA 5IQ9B 3V5KB 1P4IL 2ICWI 1I9JH 2XXMB 4NO2A 1X3DA 3L3IB 2P43B 2AXJA 4JRXD 4Z7VF 4M3KB 1ZLWH 1CXIA 3LSOB 5EC1B 1MWAA 1BZ7A 4JPIA 5FOBB 3NA4A 4FQHB 1CXLA 5JDSB 2QQQA 4U1LA 2ZG2A 5F1IB 4M7ZB 1P6FA 3SDDD 4H8WH 4GRWF 1T7XA 4QRQA 3SDDC 5AZEH 4LVHB 3H0TB 3RVXD 1KNOB 4M9PA 3L3GB 5IKCA 2BZDA 3RVXC 4MX7B 1T6VN 4ZYKA 5E94A 4OBRA 1T03L 3O6FA 3LS4H 3MRNB 4LBEA 5HJ3B 1GOFA 2QKIA 3S4SA 5C8JA 3QCUL 2BFVL 2J5LC 3SJVD 2DWDB 5HHME 4BJLA 5HYJD 1QKZH 5CEYB 1AC0A 4Z7VA 4LSSL 4ZXBD 1QSEB 3RDTA 4URTB 2XTJD 3MJ9L 5DHXB 4ZXBC 5JOPE 2IQAB 2O5XH 2XTJC 3MV8D 4DQOH 3FQUA 5I17A 1ZT1A 2FBJL 4YHNB 1RJZA 2A9NL 3Q1SH 2XNAB 4PJEB 4LSVL 3VFNA 5BZDB 4LGPB 3VXUB 3PXHA 4XCFL 4L1DA 3OB0H 3MLUH 1AIFB 3JWOH 1BLNA 3IXAA 3GM0A 3V5HB 3QP3A 4WVRA 3DURA 3D9AL 4EN3B 4OCWL 3VWJD 3TO4A 3VWJC 3KPRD 2GFBB 3KDMA 3PP3H 4J4PA 4LLDB 4P48A 1G6RH 3MLRL 4ETYA 2CDFB 1S5IH 4RGOL 1SYSB 1JP5A 1PGRB 4POYA 3WXVL 5JNYA 4OD1H 2R1XB 1ES0B 1BEYH 2V2XA 1M6OB 3BSZH 3MRKA 1R3KA 4XXDA 4JRYB 3BISA 1M7IA 4WO4D 5SWQB 4WO4C 5AD0B 1EVTC 1Q0YH 2GK2A 3GJEA 5E2TL 1TZHB 3W0WB 1IAIH 2O5ZL 2WUCH 3HB3D 4LU5L 3HB3C 4APQA 4L8BB 1GOGA 1Z3GH 2IQ9H 1CXHA 1HHJB 2DN7A 1A9BA 5DK2A 1NMAL 3RNQA 4FXGA 1E4KC 2HTKD 3EHBD 2HTKC 3EHBC 3PDGA 3VFGL 5D1ZD 1FNHA 1WEJH 5D1ZC 2DM2A 4P3CH 1G9NC 2ZWLT 1KEGL 3CK0L 1K9TA 1AGCB 4H1LB 2F5AL 1QSFA 5CMAA 2EDFA 5FO7B 1K3ZA 4O51B 1I4FB 1CFSB 1UZ8B 2E7CA 4WI7A 5JHDD 4L9LC 5CD5D 3U36B 5D72L 3SY0A 4JQVA 4OM1L 1A4JB 4M5YL 3SOBL 5C07E 5CD5C 3O2VL 4PJGE 5EPMA 1MJJA 4DZ8B 4JZOA 4PJ7E 3MGOB 3VU2A 2PTUA 1AE6H 5J12B 1ZV5A 4B7LA 3SQOL 3WO3B 2DLGA 4YEFA 5LKNA 4Y19B 2HWZH 3QDGE 2CRMA 2G5BB 4I2XE 1I9JL 2VB5A 3NZ8A 3MLTB 3FO1A 4L29B 4XNYH 4N8VA 3T4YB 3A67H 3F6LA 2VNCA 3CDFA 5CINH 4MD5B 4AMKH 3DXAA 5K33A 3TIDA 1HINH 1HH6B 3GBLA 3V0AC 5AZEL 1AFVH 4U7SA 1QRND 4YR6B 2CJUH 1KUMA 4M6NH 4NPYA 1JTTA 3RWJA 2X7LB 4KFZC 4NJAH 3VFVB 3LS4L 2APWA 1UXWB 3FRPG 1N0LA 3QNXB 2D7QA 1T2QH 2GITB 2NY0D 4DUVA 3RUGE 4YHKH 3WNLA 1FNGA 2IC2A 5BVJB 2NY0C 4KK9D 1U6AL 4U1GC 4KK9C 1CQYA 3D69B 1WC7B 4R90L 4TNWF 2IBZX 2VWEE 3EDKA 3UEZA 2GTWA 2O5XL 1YC7A 4HJ0D 1D5ZB 3Q1SL 4HJ0C 2Y4SA 4FFVD 4NJ9H 3V8CA 1JPSH 4FFVC 3FFCE 4E41A 3JWOL 3VXTA 4MXVE 5J1AB 2QSTA 4YK4B 3L7FA 4ZUSA 1XT5A 3KPPB 3LKNA 3WUWB 5FYJH 1RFDH 2EEDA 2H32H 5DMIL 4NQDA 5F1KC 5E2WL 4UQ2A 4G8GB 2IFGA 2BP3A 4HWUA 4RGMC 1WBXB 3QQ9C 1SJHB 3STZB 3EDFA 5AYUL 4JG1H 1G6RL 1XZ0B 4QRSB 4FXKA 1X6NA 1JTOA 2QHLA 1S5IL 4NT6A 3ARDA 1XMWA 3SDXB 5IV2B 4OD1L 2H26B 4G80A 3STLA 1BEYL 4F9LC 1MIML 3K1KC 2ZCLH 3BH9B 3HZVA 3BSZL 2WBWB 1OOAA 3MV11 43CAA 2R2EA 4N0YH 1IGYA 3MRDA 1Q0YL 2P48B 4GFTB 3MYZA 4PRIE 4YDIH 5K9KA 2VOTA 1JI2A 2BJMH 4WGWB 3VFTB 3MSPA 4GBXA 3MV9B 3ARBD 4HUKB 1Z3GL 3Q0HA 2IQ9L 2Q7YA 2VL4A 2AS5M 4OZGB 2EZ0D 4JFXB 1JJUA 1HHGB 4HUXA 4GXUM 2EZ0C 1VFAB 4LCYB 1A6PA 4P9HH 1HEZB 1UCTA 1DQQA 4IDLA 1VGEH 4NZRH 4LPTA 4YPGB 1WEJL 3L3KB 1HKLH 4P3CL 2XZQH 2C3VB 1F00I 2R0ZH 4MDIA 1MCBA 3BQUA 2OR7A 2RFXA 3IKCA 3DRQA 2F19H 5HPMB 3ZKXB 3R0MA 1CI5A 2IH3A 5KW9L 2YD1A 4OIIL 3O4OC 3KXFE 4GW4A 1UCBL 3D25A 3P9MA 5D1QB 1AE6L 2BNQE 4RWYH 1ZXQA 4J12A 3PGDB 5KJRH 1V3LA 2YPLA 3B2VH 2MMXA 2HWZL 5IROC 2KH2B 1F3JA 2F54A 4PFEA 4XNYL 2NY5C 2X1QA 5DJCA 3A67L 4W6XB 5CINL 2HVJB 3QG6A 3WHE0 1JPST 4AMKL 2VLLB 3CFJA 1CGYA 2XWJB 4LP4A 4W68A 3KPMA 2X1WL 1D3CA 3N1MC 1PG7W 2CJUL 3DROB 3V0WH 1PW3A 5AUMA 1RK1B 2ZUQB 4RAVA 3QUXD 5F6HI 5EUKA 4NJAL 3QUXC 3ZHKA 5D6CB 5IQ9A 3W81A 2C9AA 3AS0A 2FIKB 2YOCA 3BD5A 5C6TL 2ITDA 5DHYA 3IT8D 5FOBA 4K07A 4YHKL 1WITA 4LLVA 1FLRH 3MXVL 4YLQT 5C0AE 1YDPB 4BQBA 4PJEF 5JDSA 3EYFB 4G6MH 5I1GH 1IZKA 4RWHA 5DO2D 4JR9H 2CD0A 5DO2C 5T3XL 3JVGC 1K5NB 1U8IB 5JLZB 3ZT7A 4NJ9L 5DRXB 1U8OA 1JPSL 4QT5A 1X5KA 1KNOA 3L3GA 4IDJL 4V1DD 4FQ2H 1EHNA 3L5IA 3G5VB 4HZLB 4UQ3B 3EOYG 1QP1A 2FL5B 1NAMH 5AWNL 3U2SA 1RFDL 3MRNA 4OLVL 5HJ3A 2V2TB 4Q97A 2Q8AH 2NY2D 5EU3B 4F57H 4ZSOE 2NY2C 4JG1L 4PJCF 5CEYA 4JREB 1BWWA 4HPYH 3HC0A 3GJFK 1QSEA 2P5EA 5EUOF 5E7BA 1AGEB 3V95A 4KI5D 4YHNA 1T83C 3RY5A 4PJEA 4Z18A 4X4MA 2VE6A 2Z8SA 3LVEA 4KI5C 5BZDA 1J1OH 2ZCLL 4K9EH 3LKQB 4TVPD 3LD8C 4KI1A 1MJUH 2WK2A 1AIFA 4LK4A 4D9QD 4YDIL 1KTRL 2XG4A 2BJML 5IMKB 3V5HA 1RIVH 4OSUH 3TF7C 2W9LA 2VKXA 1ACYL 4EN3A 4NNXB 2Q1EA 3BYTA 1Q9KB 4ZUUB 1T1WB 1S7VA 2D7NA 1UM4H 4O2EB 5DC0A 3BJ91 1IJ9A 5J7CC 2F53A 5SV4A 1G7PB 4XC3H 4OCSH 5DK0B 2CDFA 2D0FA 4P9HL 1SYSA 3MJ6A 1VGEL 4NZRL 4PJCA 5GSVB 1HKLL 2IEPA 1OF2A 2DJSA 4PJXA 1M6OA 5EUOA 2R0ZL 3B83A 3FHAA 4ISVA 4OGAD 3RQ3A 3CSYB 1I3GH 4OGAC 4POZD 4PJFE 3P0YL 4XVJH 1KIRB 1MRFL 5TDOB 4EUPB 2WIMA 4HWZB 1VA9A 5CZXD 4POZC 4FFZH 1XF5A 2YD9A 5CZXC 1QFHA 5ISZE 2CDGB 1A7PL 5DQJA 4GMTH 1NGPL 4ODXA 4Q9BA 4UDUA 3MRIB 3QIWB 3UTPD 2R56H 2YMXH 4IOSD 2JIXB 4RWYL 4R0LB 5KJRL 1U92B 1EXUA 3B2VL 1IM9D 5I1LA 1FCCA 1IGIH 3DYOA 1I3VA 1R5VB 1TQCB 3WXWH 4G7VH 5JPMB 2DIBA 4FQXD 1AGCA 4WFEE 4FQXC 1TJHH 2P5WD 1GGIH 2PF6A 5HYSB 1JNHB 1F45A 3L6FB 3V4VH 1CFSA 4W6WB 2R1YA 5EO9A 5IVNA 1LO4H 4YNYA 3U36A 4S0SD 1A4JA 3JUYA 2R15A 1QVOA 3L3DB 2YR3A 1G84A 4HS6B 2QV2A 4DZ8A 3MGOA 1I85C 1A6VH 3V0WL 3EKCA 4HLJA 2XY1A 5A40E 2VN7A 4ZUTB 3AUVA 1T66D 2J8UE 1T66C 4PJHF 4Y19A 1ITBB 1QHOA 4ZAKA 3VFPB 3KPTA 1T1XB 3GK8L 4LSQL 3SO3B 4M00A 4OLUH 4L29A 3P4OB 2VKWA 3WFDH 2VYRE 2DLIA 4JHAH 5L8JB 4MD5A 1FLRL 1KT2B 3ZHLA 4G6ML 3MBEA 4JR9L 4QHKJ 1JUFA 1HH6A 5I1IH 5FAAA 3GSXA 4M43H 5DDHB 3MRPA 4M7LH 1FFNB 3T0BA 2EE9A 2IF7A 2ATPB 1S78D 1F02I 3TO2B 3GBNH 3MXWL 3U4BH 1S78C 3N06B 4FQ2L 1CL7I 4CMHB 2X7LA 1QYGH 1H0DB 1NAML 2R1WB 2X89A 1CS6A 3SCMD 4PJHA 3SCMC 1XGTB 2B5IC 2Z91B 2Q8AL 5IGXH 4F57L 3LHPH 4U33A 3SDXF 1OTUD 2IAMD 3EZJB 2ZG3A 4HPYL 5JUEH 1OTUC 4Y5VB 5HVHC 2IAMC 3D69A 3VDAA 5C08D 2Z31C 1GOHA 5GS2H 4JY6B 5F9OH 4N8PA 4K9EL 3MRHB 1MJUL 1CLYH 2VDOL 4KKLD 1MHPH 1G9NH 3BO8B 4KKLC 4Y2OA 3AM8A 5C07B 3U9UB 4PJGB 1G7HB 1RIVL 2XN9D 4OSUL 4XC1H 2MQ0A 4OZGF 3WCYA 1MI5E 4PJ7B 5HYQA 1UM4L 1I1AB 1OAXH 3RVTC 3MV7B 2CO7B 2NY6B 4HBQA 3STZA 3L3OB 1SY6A 1UVQB 4QWWD 4QRSA 4XC3L 4P2OD 4QWWC 4P2OC 3SDXA 1CDHA 3ORJA 4JDVB 1PBYA 2H26A 4NRYB 4XVUC 3BH9A 7FABH 2LV4A 1YEDB 3DTXB 4JZNB 1I3GL 1R3JA 4XVJL 2JF1A 1WIOA 2EKSB 5KSVB 4FFZL 1KN2H 1NEZB 2FSEB 4IMKA 5JMRA 1MELA 1RZKH 4GMTL 3EYQD 1F6AA 5CEZD 1FG9C 3MV9A 1S3KH 2NY3B 3V6OE 3EYQC 1JMZA 3RNKB 3MLPA 1C12B 1DLFH 3RX7A 2R56L 4OZGA 1G6RA 1HHGA 25C8H 2V5YA 5C09B 4R4ND 3V6BR 4Q6IC 4R4NC 4UI2A 1IGIL 3L9RA 1W0WB 4YPGA 3L3KA 4FXLA 2C3VA 3WXWL 4G7VL 4G8EA 1ULVA 2DL2A 3FB5B 5HHOD 3WNKA 3RUGB 3BWAB 1HIMH 1Z5LA 1TJHL 1GGIL 1UGNA 1A7QH 3V4VL 5LBSH 5D7IB 3EYUH 5HHQA 5HPMA 1LO4L 2FZ3A 1DVFB 3KYMB 1VADB 5D93C 3CXHK 3FFCB 3X3GH 3F7QA 7CGTA 1A6VL 5D1QA 4YHZH 2D03H 4MAYD 2OSLA 4MAYC 2IADA 4UOW0 1PDKA 1TJIH 3FT3A 1CDBA 2FO1A 4F8TA 2BVEA 1Y0LB 2WWKT 3C8KB 4PGDA 2NPLX 4OLUL 1NEUA 3RWCA 2W60A 5I9QC 1ONQA 5GZND 3WFDL 4LCCB 1ERNA 4JHAL 5GZNC 2HVJA 1NGXA 3I6GB 4R2GD 4BZYA 4ZFZB 3VFRA 4R2GC 1SBSH 3O6KL 5DURB 4U31A 1X9QA 1C8PA 1XGUB 1W0VB 1FNAA 4JJ5B 4PB0H 2BXZA 5I1IL 2XWJA 1D5MB 1FN4B 4M43L 3CDGA 3PQYB 5E6IA 2AJVL 3IU3B 4M7LL 2PYEA 1D5XB 3GBNL 1AJ7H 1H3XA 2NNAA 2IMMA 1RK1A 3K4DA 1FYHB 3GSWA 1QYGL 2V6HA 4TUKH 4AL8H 5E95B 4L3ED 5T1LB 5D6CA 4XPHH 3IDNB 1PZ5B 3U7YH 2VZVA 3LKSA 5IGXL 3WE6B 1EZVY 3AXLB 2HT3D 1YDPA 5JUEL 4LPWA 3ARWA 1U8IA 5F9OL 4Q9RH 1RZ7H 4FZ8H 4YPJA 1RV6X 4KJQD 1A7RH 1XAUA 3OKLA 1DQMH 3RZCD 1JNNL 4KJQC 1WVZA 4OUUB 1IEBB 5DGRA 1CLYL 3RTQC 3RZCC 5FECB 4R96B 4OQ1A 4HZLA 4XP9H 1MHPL 1G9NL 5SWZA 1TTFA 4NC1C 2JK5A 3DUHA 4XC1L 4QXUH 4DGVH 3HE7B 3CCHA 1OAXL 4GW1A 2DLHA 1UYWH 2C4FT 4L3CB 2BNQB 4NNPH 1INDH 2HFEB 1V3JA 4U6TA 5D1XA 4KJWD 4KJWC 4Y4KB 4EDWL 4F7PB 1PKQB 2AJYL 3BRGC 2D7PA 3LKQA 5EIQA 1C1EH 1KJVB 3K80A 3KR3H 4ONOA 5CZKA 2N56A 2BHZA 1KN2L 3SHSA 3ARPA 5IMKA 5LQBH 3WNOA 1RZKL 3ULUE 3MCG1 1RUML 1S3KL 3E8UH 4NNXA 3TVMC 1J0IA 4ZUUA 1Q9KA 1T1WA 4QRRB 4XH2A 5J1TC 1WZMA 2HRPL 4F2MA 1JF6A 3I02B 25C8L 4M48L 1DLHA 5C0DA 3O4LE 1G7PA 4DKEH 3BXNB 2EE6A 5GSVA 5E2VH 4UOJA 2DIAA 2ICEA 1HIML 4KAQH 3MUHL 3QNYA 4NGHH 3UPCA 5C0AB 5I74B 3LPFA 1T3FA 1A7QL 5LBSL 2DJ4A 3FQRB 3EYUL 4P2QE 3STBA 4XB7A 2X4UB 3GDBA 5D71H 4NSKA 1VERA 2E5EA 4G3YH 1VFMA 5LWYH 1KC5H 3MRIA 2FJGB 3GSNH 3WHE1 1GGBH 3AU1A 5F97E 2AK4E 1P5UA 1XGQB 4YHZL 2D03L 3K8LA 4R0LA 2ZCKH 1U92A 3O3DA 4Y5YB 1HK6A 1U95B 3DX9B 1TJIL 4TSCH 2NW2B 4PJIB 1R5VA 1A1OB 4W4OC 5JPMA 3MCLH 5J6HA 2R0KH 3CX2A 4ZSOB 2ZKHH 1KCVL 4YFLF 3L7EB 3L6FA 1SBSL 5JXEA 1BZ9A 1UWGH 3GI8H 2C3WA 2X9YA 4PB0L 3MLZH 2VIRA 5IM7B 4NQVB 4HS6A 1KF9B 3ZT6A 3ZKMD 2D2OA 5IBLD 2YBRB 3ZKMC 5IBLC 2I24N 2YK1L 1AJ7L 2AEWA 3VXSE 4AT6B 4ZUTA 1IC7H 4NN7C 5H94B 4TUKL 4AL8L 2E7LA 5C0JB 2QL1A 3VFPA 3T0AA 1T1XA 5F3HB 4TVPH 4M8VA 5IP4A 5DJZB 2I5YH 5C3TA 1CDCA 3NCCB 3U7YL 1D9KB 1FL5A 3OJ2C 1RZJC 4U2YA 1KT2A 1NCAH 5C0BD 5HDOA 3UTSE 5J0BA 5EZIL 5T5NG 3RA7L 4L8SB 5FGCE 3DYMA 4HJGA 1T1YB 2J7LA 1RZ7L 4FZ8L 5ESVB 3E2HB 1FFNA 2X09A 2ATPA 1A7RL 1DQML 4PJFB 4PJGF 2EDBA 2P44B 2BOCA 4Y5XC 5IHZB 3O9WB 4PJ7F 4ENED 5ISZB 3D5OF 4ENEC 2R1WA 3HG1E 4FQ1L 4HKJB 3MA7B 5I1DB 1X5XA 3MBXL 1MEXH 4JFOB 4QXUL 3BEWB 5EU6D 4DGVL 1DTUA 2VABB 1XGTA 1B6DA 2MCG1 1LNUB 1UYWL 4NC0B 4OCMC 4MNQD 4JO2H 3OWEA 4XP4L 4XPAL 2H2PD 2WINB 5H35A 4RIRB 4Y5VA 2H2PC 1YY9D 4OQTH 1KGCD 1YY9C 5J3HD 3TCLA 2VH5L 4EI6A 4NQED 4P57B 4ZO6A 3CPLA 5ACMA 1CDGA 3BT2H 2A83B 1C1EL 4LDOB 1WTLA 1JF1B 4HAGA 4TTDD 1B4JH 5DMKA 3BO8A 3SDCB 4H1LG 4TQEH 3VGFA 4PJGA 1UJ3B 3E8UL 4PJ7A 5F7KC 3SKMB 4BH8B 1G7QB 1BQHG 2CDEB 3H42H 1I1AA 4RQQB 3I6LD 1JWMB 2VDNL 3L3OA 5FB8B 2BY3A 2UY6A 2J8UB 3WN5C 3QDGA 4I2XA 3RUGF 4DKEL 3ZT5A 4WI2A 4JDVA 5E2VL 5ID0A 2F58L 4NRYA 3OAYH 5KSAA 3PIQB 5KS9E 4JZNA 4NGHL 4YJZL 4PG2C 5KSVA 2ITCB 4RA0C 3ZSSA 5TF1H 3SE4A 3MNWB 5E8OA 4JPWH 5GS1C 5E24E 1JPFB 4G3YL 5LWYL 1KC5L 1Y6KR 1R5IB 3RNKA 3GSNL 4X9IA 1C12A 3S37H 1GGBL 3Q6GH 1CTNA 4U6YB 4JKLA 3QCVH 2ZCKL 1KENH 5MP6H 1NPUA 5I1AB 4UNTA 4U1IB 1W0WA 2NMSA 1YNTB 2HMIC 3RUGA 3BWAA 2R0KL 3QO0B 4Z76A 1IQWL 4QNPE 4ZS7H 3VXOB 3QT2A 2B1HL 2APTA 3DVGA 3VFUB 3GI8L 1SJEA 1DVFA 3MLZL 2HJKB 1YEFL 2QQLH 4OJFH 4CVZB 5JOFB 3LPGA 3D1MC 4LPCA 5JOEA 3DPBA 5HDBE 3FFCA 3KYKH 1WFNA 4MXWH 4PGEA 1G0XA 3NCBB 4QOKD 5C0IB 5FUOH 4XNQB 1IC7L 5IT2L 2DYPB 4PTUB 5C6WH 1F5WA 1GPOH 1VEPA 4U1KB 1V5JA 5DUBB 3TT3L 5ENWA 3ESUF 3MJ8B 4TVPL 3C8KA 2J4WL 1T7WA 2CLRB 1S7XB 5KZCD 2I5YL 2E6PA 3PUCA 1WFUA 4LCCA 1TNMA 4I18C 3WUWG 4NDMB 1DANT 3I6GA 5DQDH 1NCAL 2AEPH 4ZFZA 4DCQB 3QZWB 3ROLB 1XGUA 1W0VA 4JJ5A 3D0VA 1PZUB 1D5MA 5KVEL 3LMJH 1NH6A 5F93C 1D5XA 2WQRA 3LQZB 2OS7A 3BEVA 4JDTH 2P1YA 3TN0C 1OL0A 4PRIA 1FQ9C 4RFNC 1EAPB 1U8JB 1J12A 4CDHA 5E9DD 1A47A 3QA3B 1KCSH 3LEYH 3IDNA 3QFJD 3HNTH 1RSFA 1MEXL 1VCAA 4HUWB 2XA3A 1PZ5A 3LV3B 1A6ZB 4JO2L 1X5GA 1RJLB 4OQTL 1S7RA 2ARWA 1ZLVK 4YFEA 1MY7A 4I4WB 1EFXD 4PJAB 4OF3A 2L7JA 1CIUA 1X5HA 3EYVA 3BT2L 4YE4H 5GJTH 1IEBA 3GRWH 5FECA 4R96A 4X7CC 1B4JL 5D5MB 2B39A 4HV8B 4HUNB 3WSQL 2QR0A 2FEDD 3D2UD 3TM6A 1ZHNA 2X42A 2FEDC 5DMYA 1VEMA 4JCLA 3LDBB 3NPZB 3T2NH 5L8LB 4LNRA 3KXFA 4NC2B 3H42L 4XWOD 1M71B 1WIUA 4IIQB 1MJ8L 4XWOC 3T2PA 1F13A 3RL1B 3SE9H 1GYAA 3RGVB 2HFEA 4C4KT 5CCKH 1DL7H 1NGQL 3DX8A 3O45B 2D4FA 4F7PA 1J1XL 1B0WA 3T0WA 1Z9MA 5ICXB 3QULA 2X4RB 1KJVA 1R3HB 3ET9F 3T4AB 2C3XA 3GSRB 4RGNE 5TF1L 3SE3A 1NFIB 3KPSE 4HULB 4OZHE 4WV1B 3OJDB 2JJSC 4J1UB 1JGDA 3H9ZA 2EICA 4HK3N 3Q6GL 4ALAH 3AREB 3QCVL 3I02A 4HF5H 1KENL 5MP6L 4HMEA 3WHXB 2AJUL 1NCDH 3BXNA 1OHQA 3VXNB 2KQNA 5FGRA 1AXSA 2FECI 3BW9B 5FF6A 5BZWB 5C0AA 1TIUA 4UOW1 2GJ6D 5AYQA 4PJDE 3FQRA 3BPLB 4P5MB 4MS8D 1JYNA 4YHYC 2PCPB 4MS8C 2X4UA 5FV1L 4OI9A 5FM5M 2QQLL 4OJFL 5GGTH 3KYKL 1IGTB 4K3EH 3L1OH 4MXWL 1IL1B 4C56E 1XGQA 5C7XH 1FAIH 5FUOL 5JW4N 3DX9A 4QF1B 1GPOL 2RCSL 1OT2A 1FBIH 2DKUA 3PL6C 3BN9D 2Z8RA 3W82A 2FGWH 3BN9C 1A1OA 3VWKB 5F7NC 4P5KB 4GS7C 3B9KB 1GC1C 4ZSOA 5BRZD 3L7EA 4LCUB 2SEBA 2V9QA 5DQDL 1G9MH 2AEPL 4NCC1 2VQ1B 3C09C 4ESKA 5FHBH 4P9MH 4PJFF 5IM7A 1LVEA 3LMJL 4NQVA 4X7SH 2YBRA 3KPNB 3LRSB 4KK5D 2IAND 4AT6A 4JDTL 3PV6B 2RIKA 4JHZA 4KK5C 4MA7H 5HI5D 4JHWL 3ZDZE 3OXRB 5HI5C 3LEYL 5F3HA 3I85A 4N90E 3G04A 3HNTL 5GS0D 3OKEB 1RJCA 2H1PH 2YSSB 5GS0C 1OGAE 4XPBL 4MLIA 5DK3A 1CICD 4JFDD 1J1PH 4PJ5B 1CICC 5DJ2B 1CT8A 1OSZA 2AV1B 4WTXA 5FCUH 4L8SA 5I0DA 2DQIH 3GMNA 1NC4D 5ESVA 4QTHB 1S9YB 1IZJA 4YE4L 3QG7H 4LPVA 1KJ2B 1JFQH 3IFNL 5GRVL 5GJTL 4PJFA 1FH5H 4WENB 3O9WA 3UMTA 2OI9B 1MQKH 3FMGH 1UEYA 4HKJA 5BS0D 1E0OB 5E8NB 5EBLB 5FM5O 4CL7A 4GG6E 5DUML 4JFOA 2J8UF 4EUPG 2VLME 2VABA 3ME0A 2VLRE 1JK8A 1LNUA 1GRWA 1CYGA 1YMME 2AK4B 5I2IA 2WW8A 4WI9A 3SE9L 2WINA 3P4NB 1HSBB 4RIRA 5CCKL 1RU9H 1TZIB 1DL7L 5GS3A 4HQQL 1AY1H 2MTPA 2XV6B 4WDIB 1BOGB 1J8HE 4ODVL 5IIEB 1SJVA 1BAFH 2A83A 4ODWB 4OFDA 5DD0H 5HSFA 5DHVH 1JF1A 4KXZI 4WWKC 4WUUD 4X4ZA 4WFHE 3T3PE 4BKLB 2VITA 5CJXC 1EO5A 3G5ZB 4J3VA 1RUPH 1SYVB 4NKDB 2EIZB 3SDCA 3BUYB 1YMHA 4XAKD 3U0WL 3JZ7A 3WEXA 5HYSG 2CDEA 3HA0A 4Y2DD 5BXFA 4RQQA 4Y2DC 1I1YB 4KHXH 1WUNT 3VXSB 4ALAL 3IJHB 4HIJB 2J8UA 3IDIA 4HF5L 4JQIL 1C7TA 4PS4H 2M1KA 3ETBF 2VLJA 2X4SA 4HUUB 3HI5H 4EQ3A 2EDRA 4CGTA 2H45A 4WEBH 4ACPA 4N0FA 5HXMA 4OGYH 1TVDA 5BV7C 1CGXA 3M45A 4KU1A 1AXTH 1YEGH 3UDWA 2CRZA 3OGCB 5FYLE 4BSVB 3MRFA 4BK4A 2ERJB 2UUDK 2VZOA 4AQOA 1JPFA 3FTGB 4BUGA 5GGTL 5DJYB 2H8PA 4K3EL 3L1OL 4U6YA 5FGBC 2V2WB 5C7XL 1ORSB 3U0PB 1J0HA 3HG1B 4NRXB 4EI5D 1FBIL 3FCTA 4EI5C 3VMOA 3VE0A 2FRGP 2FGWL 3AAZB 1BQSA 5IW3A 4L4VD 1T1ZB 2DOCA 4YHOL 3O41B 2BVQB 5I15H 4HS8L 3BDYL 3VXOA 3QHZH 1MNUH 1AHWB 2YHGA 4Y16D 3QUZB 2YD6A 3MREB 3VFUA 4Y16C 3S88H 3ULVE 1FSKB 5FHBL 2HJKA 1ZHKB 4P9ML 5JOFA 3H9YA 4X7SL 3BPNB 3RWFB 3SDAD 4P4RA 3GMPB 1LK2B 4OT1H 3SDAC 1YZZA 4CAGA 3K8MA 4XNQA 3IDMB 2DYPA 4MA7L 5ALCH 4PTUA 4NQCD 4U1KA 2N7AA 5DUBA 2ARJB 3D3VD 1MI5A 3X17A 4HKBB 2WNGA 2H1PL 5CIPB 1DQJB 1X5LA 2NX5E 4MNHB 4N1EA 4ZD3H 4JFED 3HC3H 4BSWB 4DCQA 3QZWA 2MFNA 4KKCD 5FCUL 4I0PB 4KKCC 2DQIL 3H9SB 3WIFB 4R3SB 4Z5RB 4OF7A 4PTTB 3B9EA 1VESA 3QG7L 1JFQL 3LQZA 3K2MC 1FH5L 4NZUL 4X7FC 1PX4A 5T1MB 1U8JA 4RCAA 1MQKL 1T22B 1BFSA 3V6OA 2COQA 1VHPA 1MCNA 2YD4A 4WNQA 3CFEB 3LV3A 1A6ZA 1QA9A 1CF8H 2X4QB 4Z77B 1NEZG 2Q3AA 4PD4J 3MMEB 4QRTA 1J10A 5EBMB 4OGZA 4F9PA 2KBGA 1RMFH 1V7NH 1RU9L 2AXFB 5GGRB 4MCYB 1AY1L 3T1FB 4I4WA 4QRPE 4RBPK 1S7WB 4P5TD 4RDQG 4LQ1A 3PHQB 4P5TC 3C08H 1BAFL 2EDJA 5DD0L 4NM4H 4X8JA 4U6VH 1P7QD 2CPCA 3EYSH 3C60D 4EVNB 1FIGH 1U8LA 3VRIB 12E8L 1KCKA 3C60C 4HV8A 1ND0B 2R4RH 4X4XA 1U91B 1RUPL 3SKJH 3FB6A 4HX1A 2NY7H 1I8KA 1YN7B 1FGVH 3RKDD 4CDGC 3RKDC 4Y4HB 1M71A 5GRUL 1BM3H 1OTTC 2DKSA 3CZFB 5JXAL 3QUMB 4U0QB 5LG1A 3J8F7 3NGBB 3RL1A 5JORB 1ZT7B 1Q72L 4K3GA 3RGVA 1ZANH 5KSUB 4OQTA 3PABB 3P9LB 3D18B 4PS4L 3QB7C 3HI5L 4EXKA 1J7VR 4WEBL 4HGKC 4OGYL 2X1PA 1I3UA 5EOCL 1RZIA 4K2UH 4PY8J 3T4AA 1AXTL 3D85A 5DFTA 2A0LD 4PP2B 2IGFH 2EDWA 2I9LB 1C7SA 2A0LC 1NFIA 1GZQA 4WV1A 4OCNC 5TDPB 1L7TH 5IR1B 3RGHA 3T8XB 3CNKA 3B6SA 4KMLB 1ZLWK 3GSVB 3ZO0A 2VUOA 3AREA 1K85A 2XQBH 4ODHH 2A9MH 3LZFH 1W72B 1WJ3A 3VXNA 5E5RB 5JW4R 3EOTH 4HD9A 3MRRA 2L4OA 3F7PC 3BW9A 4OZ4A 2VDRH 4QLRA 4JANB 5BZWA 5I15L 1WICA 1RY7B 4KUCD 1BJMA 1W0YT 1SHMA 3QHZL 1MNUL 3TBVA 4OZFH 2PCPA 5IB5B 3K81A 2W0FB 3RX5A 2EYRB 5SX5K 4DK3A 1JWUB 1LGVA 2MOVA 4MA1C 1IGTA 4OT1L 4GAYB 2F74A 1IL1A 4GKNB 3ULUF 2OZ4A 5B39G 2JB5H 5ALCL 3W39B 3QSKB 1UFUA 3SKOB 2X1XR 3OPZH 2EDEA 1FZJB 3B2UD 1T0NA 1CFVH 3IGAB 4AG4L 3OB8A 3B2UC 2YA0A 4JFFE 3BESR 1NCWH 4P5KA 3TIEB 2A6DA 3R1GL 3OZ9H 4PLJD 4LCUA 3RPKA 4PLJC 3OB0K 4HH8A 3N0PB 4ONHA 4ZD3L 2MPAH 1MVFA 2VQ1A 4LOUD 1UH2A 4N5UA 4LOUC 3BPOC 5KAQG 3O6FD 3QQ4B 4PRHE 1TTUA 2O61A 3O6FC 3GMQB 4FFYH 2I07B 3KPNA 1XCQB 5E5MB 2Q3ZA 3PV6A 2JJTA 1NCUA 3DRTB 3OXRA 5FYLH 2FBOJ 1X44A 3PP3K 4H88H 4OZHB 5FXCH 1CFNA 1A3QA 3E6HA 1YEJL 2P8LB 5C0FA 3RDTD 3FQXB 4HIXH 3RDTC 2OR9H 3BUTA 4N0CD 2YSSA 4N0CC 1S9WB 4WHCA 2E9JA 4FG6D 3QIBB 1CF8L 1HI6B 4I5BA 3UXFA 4JAMB 3MO1B 3O4LA 2CLZA 4KC3B 1V7NL 1NUGA 5IJKA 1MCHA 3WD5H 4LRIA 2A6JB 3KGRA 3GSOB 4Z7WB 1PYWA 1S9YA 3C08L 4NM4L 4MD4A 4U6VL 4PJDB 3EYSL 4XCEB 3TO4D 1FIGL 1IGFL 2EH7H 5F9AC 5CBEB 1BMGA 1NKOA 4P2QA 3TO4C 3MLVH 1RURH 2EXYD 3SKJL 4U49A 1FFOB 4IRJB 4J4PD 3WLWD 2EXYC 2ZPKH 3RVVC 3ULVH 4J4PC 3WLWC 4WW2B 5E8NA 4LLAA 5EBLA 4BSJA 2VXTL 1JZ8A 1UQSB 4OIBA 2EKJA 2P4AB 3O3EB 5ITBH 2WQ8A 4MQSB 1ZANL 4XBGB 3TT1L 2VLKD 4IHOB 4LGRB 1TZIA 4LIQH 5FO9B 3NFSH 3IAQA 1J8KA 3CSBA 5D7JA 1T20A 1BOGA 5E00A 4KDTA 1SJXA 4PBXA 4APQD 3GRWA 4K2UL 4QCIB 1DFBL 3GMLA 2X9XA 1BQLH 4G8IA 4APQC 4BKLA 4AZ8A 2IGFL 4HIEA 3G5ZA 5B8CA 1SYVA 5GJSH 4NKDA 3BUYA 1F6FB 3MJ7A 1L7TL 3BP5B 2NXZD 4JFQA 2NXZC 4JRXB 3DARA 5JW3L 1I1YA 4DN4H 3VXSA 3HPJB 4HIJA 4XXCA 2XQBL 4WHTB 5DEZA 4ODHL 1QSFD 2BSRB 2HLFC 1IAOB 2A9ML 2MKWA 3LZFL 1Q9LB 3SDDB 1OTSD 2HA1A 1OTSC 5ILTH 3GHEH 3PGFH 3EOTL 2Y5TB 5KN5B 4GH7B 2VN4A 1JPGB 4JQVC 1OSPL 2BSED 2VDRL 4P23B 3UTSA 3OGCA 1FL6B 4BSVA 4LF3A 5DJAA 3G5YA 2NR6D 4L8CB 1OY3B 3DETD 2NR6C 4HJJH 4BUHA 3S35H 2DBLH 3FTGA 3RL2B 4J23A 3BD3A 2J5LB 5DJYA 5EU7C 2A6IA 5IHUH 2V2WA 1AO7E 3PWVA 5HYJB 1Q1JH 1U8KB 1YN6B 3ZDYE 4M1DL 4ZXBB 3FO0H 4Y88A 3BFOA 2XTJB 3OPZL 5C2BH 3DXAD 3AAZA 1KXQE 5SWSE 1CXEA 4UILH 1NCWL 1T1ZA 2WMPA 2VLRB 1YMMB 3VG9C 3O41A 2BVQA 3P9WB 3RWGB 4UIKL 3OZ9L 4YDLB 1VPOH 2UZYB 5IMMB 4NYLB 4HCRL 1K8DB 2AEQL 2MPAL 5IW6A 3QUZA 4Y4FD 5JMOC 3MREA 3PP4H 4YH6A 4Y4FC 1J8HB 1BPVA 5F71A 2NQCA 4RRPG 4FFYL 2OL3B 3QUYA 2I25N 3LAFA 1U8HB 2IMNA 2M26A 3IDMA 5FYLL 2OMNA 4H88L 3HAEB 2ARJA 5DJXB 3VXQA 4HIXL 4XI5D 3LRGA 3O0RH 4XI5C 4O2FB 4QHMB 1BWMA 2AP2A 3MR9B 1KTLA 1J18A 3TNNB 4MNHA 4E41D 3QEQE 5HHNB 4JN1L 1CVSC 2P8MA 2EIBA 3MRBB 4I0PA 1P53A 1LO5B 3OKDB 4KHTH 4WRLA 4R3SA 4DZBB 3AS2A 3JWDC 4Z5RA 4PTTA 5T3ZD 5KS9A 4NQDD 4NN6C 3MRLA 1IT9H 4Z7NE 1N0XH 3LQAC 3S3PA 2ID5A 5EZLA 4Y8DC 4GUPA 1AI1H 4N9OB 1A2YB 2EH7L 3MLVL 5HDBF 1RURL 3HZMB 1YQ2A 2ZPKL 4X9GA 5D1ZB 2MNUA 2JJUA 3M1BB 1UJTA 3ARDD 1PLGH 3HRZA 1MCIA 3ARDC 3CFEA 1ADQA 5ITBL 2X4QA 5INCA 5MENE 1WAAE 5EBMA 1HSAB 1CGVA 1F4AA 4KJPD 4M1CD 3WJLA 4L9LB 5JHDB 4KJPC 4LIQL 1UH4A 3GMRB 3PWUB 4M1CC 2AXFA 1H3PH 2DICA 4HZAA 3T1FA 5L8KB 1G0DA 1V3KA 4ZDHA 3T04D 4FQJH 3TBTB 1T04A 4GBXD 4CJ0A 5GSRB 2X41A 1KPVB 2OJEB 3GEWB 1BQLL 3VRIA 3B8YA 4JFHE 5DT1H 1M4KA 4I9WE 1U91A 4F37F 5GJSL 2QQNH 2YPKB 3RBSA 4WI8A 1YN7A 1U8QB 3VFWA 1LK3H 2BNUB 5ACLA 4Y4HA 2EE2A 4M5ZH 4DN4L 3QUMA 2C4FU 3BQUD 3UROR 5KSUA 5IEHB 3RWIB 3BQUC 2AKRA 3ALPA 3PABA 3D18A 3P9LA 4K3JL 4OTXH 1WWAX 3GIZH 3GKWH 1QFWM 5ILTL 3GHEL 1X4YA 3GSQB 3PGFL 3HRPA 4XPGH 1B4RA 4GXVH 3QUKB 3TYFB 2NX5B 5DHVA 2ZOKA 1IEAA 3IVKB 1IE5A 2JJWA 1T80A 1Q38A 4G5ZH 1NFDE 4LCIL 3B5GA 5TDPA 3FB7B 2YPLD 3SPVB 5F44A 5IR1A 1HH9B 1FGNL 2BSSA 3T8XA 2F54D 2NY0B 1IEHA 1RZGB 2BOBB 5IHUL 1HDMA 1CU4L 4OD2B 3IFLH 1Q1JL 4ZFOL 1XF1A 1CXFA 4H25B 3FO0L 4JZJB 1W72A 5K9OA 2YRZA 1QLFA 3SE8H 3C2AH 4YC2C 5B22A 3LKRA 4UTBL 4QGYA 3MZGB 1U36A 4RMVA 4EDXA 1ZGLM 3U0TA 5CKAA 4UILL 1SEQH 4DW2H 3W9DA 5C2UB 4DEPC 1VPOL 1EHLH 1FL3B 1K8IA 4H0HB 3G6JB 3PP4L 5DD6B 5FCSH 2EYRA 1UB6B 1JWUA 2ILLA 2X4NA 4RGMB 1U8MA 3FO9B 2CMRH 2MJWA 1E4XH 1Y18A 4K8RD 4OZHF 1M05B 4DKDC 4O02H 3DUSB 4GKNA 2YD2A 4K8RC 3W39A 1EUUA 1YQVH 1I75A 3ABZA 4RAUA 5F3BB 1I8LA 2DQGH 2EYTB 3O11B 3O0RL 3TIEA 4XBPB 1J05A 2C7UA 3T0VA 5MEOA 1HE7A 3OKKB 1I7ZB 1DDHB 4CKVX 1N6UA 4KY1H 3DV6B 3GBMH 4PJDF 2ESVE 1J88A 4KHTL 1ETZA 3GMQA 2HVKA 1G7MB 4N9GB 4XNUH 1IT9L 1N0XL 1S5HB 3EUUA 5DRZA 4LKXB 4ODBD 4WGVB 1AI1L 1N2RB 1B2WH 5BOPA 3DRTA 3KPSA 3ZYJA 4OZHA 3FHQA 4KRPD 1XF2A 4MA8H 1QSED 3FQXA 3P77B 2P5ED 4KRPC 1QNZH 3A6BH 3P0VL 1PLGL 5IBUG 1CG9A 4V2BA 3HZKB 1S9WA 4RSVA 3QIBA 1HI6A 3VFSB 5DTFB 4UAOB 1TZGH 3MO1A 4D2NA 4LLUB 2HG5B 1MFNA 5A1AA 1J0ZA 1FG2B 1LE9A 3VD9A 4NC1E 1SM3H 1EVUA 1H3PL 3D39E 4ZPVB 3UP1A 1LEKB 2A6JA 1P1ZB 4FQJL 3O4OB 3T65B 3T09A 3VDCA 2F5BH 4MQ7A 4EN3D 1OCWH 4PJDA 1MQ8A 4XCEA 4PV9B 5CBEA 2F53D 4DKFH 5DT1L 1S9VA 1A6UH 3O2DL 2QQNL 1FFOA 3P73B 4NZJA 5FKAA 4HFUH 1RULL 4O4YH 1LK3L 2WP3T 1EEYB 3O3BB 3ZDZF 2X1OA 5K59E 3O3EA 3CSGA 3ARUA 3FN0H 4C56A 3EO0A 5HYEA 3BZFB 3K46A 5H8DA 4OGXL 5L2KE 1FVDA 1ZLUH 4J3WA 3RHWF 1ZT4B 4IHOA 5FO9A 1WZLA 3GIZL 3NIFE 3GKWL 3WNMA 1QFWL 4JO1L 3S96B 1F4XL 4XPGL 1G7LB 4GXVL 5D2LE 1UXSA 3TC9A 4QCIA 4MA3A 3HHRB 3MGTB 2X44D 4G5ZL 4WTZA 5F70A 2X40A 3IDJA 4LHUA 4XCYB 3TV3H 4PRHB 2GY7B 4GLRH 1U0QA 1G7JB 4X6BB 2VR5A 4OLWH 3NCYS 3HPJA 1YY8A 4WHTA 2MKLC 2BSRA 4JFZH 3F7YB 1IAOA 5F7UA 4LL9A 1Z0NA 1Q9LA 1I8MB 1OQOA 3SE8L 3C2AL 3RWEB 5EB9A 3L95B 1OGAA 5KN5A 1SEQL 4DW2L 1JPGA 3BD4A 4P23A 4J3OC 1EFQA 3JV5A 2J2ZA 1XR8B 3SGEH 5BW7A 4F80A 2KPNA 1OAUH 4O58L 3BX7C 2UZXB 4D9RE 4M7KH 2FX7H 3P11H 4F58H 3MFFA 4X99B 4Y19D 4ZAKD 3T3PF 3RL2A 4ZS6D 4ZAKC 4TUJA 4LLYA 2CMRL 4WEUD 1E4XL 4ZS6C 4X7DC 2NY2B 4GRWH 1R24B 5F8RC 3FQTB 2D7MA 4Q9QH 3PXJA 4ZXBA 4AENA 3M8OH 1H3UA 3DBXB 4X5WB 1S7SB 4UB0H 3A6OA 3MBED 4OD3H 4WW1A 4GG6A 3S34H 2DQGL 3MBEC 5GRXG 2X6MA 2QEJA 2VLRA 1YMMA 3LD8B 4RMRA 4TTGA 4UZGA 5I1JH 4U6XB 4NYLA 4XMPH 3WIHA 5I8EB 2FJFB 2OTWB 4KY1L 1F11A 3GBML 2P24B 1J8HA 4HWBA 2ATKB 3PWLA 2X89D 3GMMB 1KXTB 2DB8A 5T1KA 3LOWA 2FWOA 4XNUL 2YUXA 1BVLB 2DQFB 5FV2A 1BBJB 1QLRA 4I3RH 5GRWA 4LLMB 4NO5A 5C0BE 1E28B 3V6FB 2ED7A 3VDBA 2PW2B 3G9AB 4MA8L 1QNZL 4PP1D 3A6BL 3T3ME 4U1SB 4JLRB 4PP1C 2EH8L 5FFLA 4H8WC 4O2FA 4XPTH 4YHPB 5DD3L 1HCFX 3MR9A 3I84A 1TZGL 2DAVA 2DQCL 1MJ7H 5LCVL 3TNNA 3G6AB 5E0QA 1DANU 1SMAA 3O6MH 1AGFA 2NY4D 4X7EC 1BECA 4OFYA 4DZBA 2NY4C 5E70A 3AM8C 2F5BL 1X6LA 1OCWL 2AABH 3ULVF 4R7NA 5I19H 1E27A 1A6UL 3M17B 5J1SC 3T08A 3HZMA 2LABA 3QXUA 4HFUL 2Y1VA 4O4YL 2HKHH 3PDOB 4GKZB 3OHXB 3VD4A 3H7BB 1TETH 1TFHA 4FQXB 5GXBB 2P5WB 2CK0L 5IFJB 2E8ZA 1U3ZA 2RHEA 1HSAA 5MI0B 1JMXA 3NFNA 4PV8B 1NBYB 5HD8C 2DWEB 1ZWIA 3QQNA 3JWOC 1I1RA 4M8QB 3MUGB 5SWSB 1EEQA 3BIBX 1U8PA 3IS0X 4AEIH 3MV9D 4QYOB 3IU4H 3I50L 4GRMB 4RZCA 2YC1B 3ALWA 5EBWA 2OJEA 1F2QA 3HZYA 4MNGE 1BJ1H 2YPKA 4X6CE 3TV3L 5IFHH 1B90A 1IC5H 1U8QA 2BNUA 5DQ9B 5FUZH 1W2KT 4ETQA 3DHJA 4D3CH 1FIEA 2I9TB 4HFWB 4C54A 4IJ3B 3ILPB 2Y5EA 3GSQA 3K74B 1UKTA 3QUKA 5B21A 4JRYE 2NX5A 1QO3A 2A77H 3V2AR 3QEQB 3ARFA 3QEHB 4HUVB 3JTTA 1BD2E 4S10A 1OAUL 3JXAA 5D1QD 4B50A 1G6VK 5F96H 3W0WE 5D1QC 2DQTL 4MB5A 2FX7L 3P11L 3FB7A 4F58L 4WFGE 3SCMB 4HS3B 4TSAH 2B5IB 1CIDA 1R5WB 1RZGA 2FYYB 35C8H 4G42B 1EIBA 3E3QC 4OD2A 3T2QA 5HVHB 5C0RH 4Q9QL 3GUTB 4H25A 4P2RA 2Z31B 2YA1A 5DR5H 4JZJA 3M8OL 1QQDB 3CC5A 1HQRB 3RKPA 4WFFE 3B43A 2XZCH 4U1MB 4UB0L 3REVA 3K0WA 3LQAH 4OD3L 4ZFFA 3S34L 4PGZA 4E0RB 5E6ID 3U48A 2XT1B 4IS6A 5E6IC 2PYED 4GKOA 4FNLH 4XMPL 1FL3A 5IBTH 1II4E 3S3JA 1YPZB 3QI9B 4QRPA 5DD6A 5F7MC 2XN9B 4P46A 1UB6A 2WANA 2PW1A 1AC6A 3HS0B 1DBML 3EFFB 3WJJC 4I3RL 3THMH 1FFPA 3ZYOA 3ES6B 1CK0L 3IF1B 4R8WH 5IVXB 5CD3B 5HVGB 4F9LA 2NCMA 2UYLB 2EYTA 1RK0B 3WNNA 4G6FB 4XBPA 1A14H 4XPTL 5HHVL 3HN3A 4OCYL 3QDMA 3OKKA 1I7ZA 1DDHA 1QBLL 2D31B 1VB9A 2NTFB 1C16B 3EO1B 3O6ML 5SWZD 5HI3D 3QFJE 1AQDA 5HI3C 4S11A 4JKPL 1G7MA 4I3SH 1E6JH 1DN2A 1S5HA 2AABL 3KPLB 4LKXA 1PQZB 5DSCB 5I19L 5DA0B 3DX7B 1NFDB 4PRAA 4Q6IB 5FM4A 5D1XD 3P77A 4PJ8B 4GT7A 1CZ8L 1K4DA 3ECBA 2HKHL 4XWGH 2J88H 5D1XC 1P6AB 3NCMA 4UU9A 4JM4L 5C70A 1TETL 5HHOB 1FNFA 2AQ3A 3MNZB 3IKKA 3VFSA 4AIZB 1JPTH 1JRHL 2P7TA 2HG5A 3DECA 3NA9H 3UBXG 5ESAB 1S7QA 1M7XA 2Y7QA 4ZPVA 2EEAA 4NFBA 5D93B 5LXGL 2QLVB 1P1ZA 5FYJD 2PYFB 2VDQH 4Y1AE 3QIUB 3IU4L 3S8WA 4MAYB 1RHHB 4PV9A 3VRJB 5E6YA 1LO0H 2PO6A 1KTDB 1OAZH 5CBAA 3P73A 3VGGA 2X2YA 5IFHL 4OF8A 4YO0A 5FUZL 3O3BA 1UZ6E 4G8GE 3W9EA 1PX3A 6FABH 1P4LA 4UINH 4D3CL 2OTUB 4R2GB 1V7MH 2R4SL 1NANI 5IB4A 2XKNA 1FYTE 2OTPA 3L3HA 1P2CB 4JFFA 4L4TD 1U58B 5F1OB 2PXYA 2R23A 4NUJB 1A4KA 2GTZA 5FA3B 1UADC 1MAKA 2FO4B 1FNSL 1DUYB 4MDJB 1DR9A 5LGJB 5F96L 5JIHA 1R3LB 4R0LC 3LRHA 1VDGA 4PRHA 5CS7A 1ZMYA 4P9HC 4ONGL 4TSAL 2ICWB 4XP5H 1G7JA 2OMBA 2ADJB 4X6BA 1N6QH 3CVIH 5BO1H 1TQBC 3V79C 5HHMD 5I8CB 1NLDL 5DVKA 3F7YA 3CU7A 3Q3GB 2D7TL 5JOPD 5C0EB 5J9PA 4LEXH 3LQAL 5JXED 3L95A 1P7HL 5HGAA 5JXEC 3EDJA 5MHSE 5IUSA 4XMLL 1TDQA 3RTQB 1A7NH 4X98B 1WF5A 2DM4A 2AJ3A 2BY0A 5IBTL 2EC9U 3D39B 4LSUH 5DGQA 1L9MA 3RIAK 4PB9H 4X99A 2B4CH 5IHBA 3MRGB 1OM3H 2E7LC 4XX1G 3S6CA 3CD4A 1MY5A 3QHFH 1UACH 3KLAA 3PDDA 1C5DB 3NABH 2IG2H 3B9AA 1JN6A 2CIIB 5LGKA 3EOBA 3DI2B 3RAJL 3THML 2BHUA 4R8WL 5CJQH 1T83A 2W38A 5HVFB 4X5WA 1S7SA 4KVCL 4XBEH 4GAFB 2QQKH 5J8OA 4LKCA 3LB6D 5CFHA 1A14L 4KK6D 3LB6C 4RA3A 5L2KB 4U6XA 4MD0B 3QXVA 5ITFB 4XCNB 1RUQH 43C9A 2CGRH 1EGJH 4ZO8A 1LD9B 4G43B 1ZEAL 4LLQB 2FJFA 2OTWA 4CMHC 2P24A 3TVMB 3TBSB 2ATKA 3GMMA 5D2LB 2IPTH 4I3SL 1E6JL 2BVPA 3X13B 5ICZB 1BVLA 2DQFA 2APBA 1LILA 2QSCH 1D5IH 4OKVB 3I3BA 1VACB 3FQWB 1J0JA 3H2WA 3V6FA 1FE8L 2PW2A 3IFPB 4Y5VC 4XWGL 2J88L 3ZDYF 4NZTL 1NMCC 3TYGH 3OAYK 4YHPA 5T33H 1NUNB 1KCUH 3NA9L 5FUCE 1H5BA 3OXSA 1BF2A 2XY2A 3WBDA 1KN4L 4NO3A 5KTEH 3BDXA 1HXYB 2FIRT 5IG7B 4H1LH 4C59B 4MGXA 2JELH 5LGHH 5GGVH 2NY6D 1HKFA 1OAZL 2AGJH 2NY6C 2C1PA 3TH4T 4PJBB 5I73B 2LE9A 1IQDB 4P4KB 3QDGD 4GKZA 1MCJA 1VGKA 1N3NB 1ZSDB 3LIZH 5FYKU 2ADGB 1AO7A 4UINL 5KSAD 5IFJA 5EZJA 2FB4L 5KSAC 3ZKND 4RISH 1NBYA 3ZKNC 2P46B 1URLA 3MGAA 4IRSA 4DOHE 3O8XB 4M8QA 5SWSA 1LE5B 4X6EA 3SE4C 1I85A 1F4WH 1CCZA 2DJUA 4QYOA 4NKMA 2VMFA 1JVKA 2YC1A 3QWOA 2ZZUT 4Z7NF 4HLZG 3G08B 5D2NE 3CIQA 5EU4A 2H9GA 3ULSB 5DQ9A 4PD4K 4XP5L 1N6QL 1HNGA 1Z9LA 1WWBX 3VXME 4HFWA 2B2XH 5C0BB 1DN0A 3LN5B 5IK3B 3VH8G 1WAAF 3CUPB 3G9VA 4PR5A 4LEXL 3FRUB 2VWEC 2R69H 1DVFD 3ZE0E 3HI6H 1DVFC 2ARJQ 1OWWA 1JV5B 3HAEG 4Y5XB 1A7NL 1I7UB 3FFCD 3HE6B 3QEQA 3U6RB 4YGVA 5C1MB 1P69B 4KMTH 4AIXA 3EW3B 4PB9L 4YFDB 2DLEA 3RVWD 1OM3L 5EU6B 4HS3A 4D0BA 3MX0A 2IH1B 3QHFL 1R5WA 1UACL 2FYYA 4G42A 5TFSH 2IG2L 3QBTB 4I0KA 1PEZA 3GUTA 1BGXH 5DI8B 2ICWJ 2UZIH 2Z31A 4LCCC 1U3HA 1QQDA 4NQEB 5DURD 4U1MA 2QQKL 5BVPL 1QFOA 4WY7H 4E0RA 5MENA 1WAAA 1MHCB 4DFIA 1RUQL 1SY6H 2CGRL 1ZAGA 5GRVK 1EGJL 3C5ZB 4YAQB 2QBWA 3BH8A 3QI9A 4PRID 1T5WB 1NGYA 1N8ZA 2DDQH 4LGSB 1CR9H 3E6FB 2WBJB 3D3VE 1OGTB 2IPTL 1NFDF 4B0MM 3BHBB 1S8DB 3EFDH 4UDTB 3DO7A 1NC2B 3WN5B 5JA9A 2QSCL 1D5IL 4MNGB 3ES6A 1WBZB 4X6CB 1RK0A 3QFDA 2XWTB 3BGMA 3SDYL 4LDLB 4LASH 3VA2C 3TYGL 1D6VL 1V3MA 2GY5A 2QHRH 3F8UB 1KCUL 4G6KH 1MCPH 4KDVA 5CJOH 1WQVT 2J1KA 2D31A 3FT2A 3OAZH 3V52H 3TP4A 4CUCA 1C16A 5GS1B 1MUJA 2CUHA 1YNLH 5TQ0H 1H3TA 1OAYL 4M6MH 1IAKB 4RMTA 2EYSA 5CSZB 3KXFD 2JELL 2V17L 5INDB 8CGTA 1PQZA 2FX9H 1BD2B 3BMWA 5GGVL 1NFDA 4JY4B 3GJFB 1HYRC 1A9EB 1IAIM 4Q6IA 2AGJL 1HZHH 1NBVH 4GXUN 5E7FA 32C2B 4PJ8A 5CWSB 4DN3H 3IDGB 5F9WB 5GS2D 3LIZL 4K7PY 2VR4A 1QACA 4E42B 4AIZA 3DSFH 5JZ7D 4XCCL 1XH3B 3PJSB 5JZ7C 3HI1B 3UTTE 5ICYB 4RISL 4JFYB 5IB3B 5ESAA 1S9XB 4GQ9H 4K71C 1LMKA 2HT4D 1XGRA 4U2ZA 3V7AG 1F3DH 3SE3C 5L9DH 3KWWB 1CE6B 3DVIA 1F4WL 5IJVA 3QIUA 5IMOB 4HKZB 4LMQE 2C4XA 4MAYA 4QOKB 1BQHB 5A43C 1FAKT 1AKJB 1S7TB 2FATH 1AGDA 2X5PA 1EHAA 1IC4L 4CNIA 3P4LA 2R2CA 3AFLA 2X05A 5KZCB 5EO0B 1HOCB 2OTUA 5F88A 3MV7E 3LKOB 4M4PA 2CUMA 1CBVH 3TA3A 2B2XL 4W81A 5JA8B 5C0AD 4EJ1C 5I74C 1P2CA 3NCYP 4NKIH 1HWHB 5DEFA 1MH5B 4HIIB 4NUJA 1RZKC 2EDOA 3HI6L 1ZA6B 4NCC2 5E08H 2FX8H 3F12A 5FA3A 3TN0B 3NFPA 4RFNB 4MDJA 4OM0H 5JQHC 1FO0B 5LGJA 4H8WL 1CL7H 1R3LA 3TBWB 2CKBB 2ESVA 3CVHB 5C0GB 3QFJB 5J89A 2XWBB 1BIIB 2O5YH 2ICWA 1F2XK 1HILB 1H15A 5TFSL 2OP4H 5M94B 5I8CA 1BGXL 1HHKB 1NCTA 2UZIL 5K59F 5IWLA 1Q9WB 5C09E 4UV4H 3NN8B 2WSKA 1EFXB 5C0EA 1MFDH 3D6GA 1CLOH 5MEPB 4WY7L 1ZLSH 1ZVHA 3RTQA 5F6IC 1XR9A 5ETUB 3NIFF 4ZOBA 1C5CH 1QKZL 2P8PA 2HFGH 1P5VA 4X98A 1JWSB 4YHMH 3U4EB 2VZ1A 1SY6L 4C55A 3CDYA 3D39A 5D2LF 5D7IE 5FDWA 2Q6WB 3U46B 3Q48A 4DQOL 2ZSVB 5HBBA 1WGOA 4PG9A 1CR9L 4QTIH 3V0VB 5F7WC 4Y1AB 5HHPA 4R6UA 4S1DD 1C5DA 3EFDL 1ED3B 4C57C 2PN5A 3MLUL 4HC1H 4LSRH 4S1DC 5IVZA 2CIIA 3GMOA 4AH2B 2E7HA 3VXRE 5CP7B 2J6EA 2I26N 2WUBH 4LLWB 2VDLH 4LASL 3JV6B 1I1FA 4OAWB 1B3JA 3BE1H 5L2KA 2QHRL 4MD0A 5ITFA 3BGAA 1MCPL 4G6KL 3E2HC 4JKMA 4XCNA 5CJOL 3C6LB 3S36H 3X12B 3OBAA 4G43A 5D96B 4QXGH 3V52L 1FYTB 3IAPA 1I3RB 3ISWA 4CMMA 2E9WA 3O9WD 1T4KA 4UT6H 3TVMA 2KUTA 4MB3A 1QRKA 4N0UE 4P99A 5GRYA 3O9WC 5ELIA 3TBSA 1YNLL 3PQYE 4AK1A 4TUOB 5D2LA 5BMFH 5IB2B 5FA4A 2VAAB 3F65A 1GGUA 5ICZA 3ZZ1A 2FX9L 4EUPH 5ECJE