3JV6A

Crystal structure of the dimerization domains p52 and relb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
TSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription factor RelB
publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 101
sequence length 101
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv6A00
1JHLH 3BKMH 4ZO7A 4D2NA 4LDLB 2VXQH 2ZUWA 3VFMB 5FO8B 4P23A 3M8OL 4PJBE 3EYSH 5AUMB 1KCSH 3BH8B 3VWJC 5KSBB 2DQIL 3QZWG 2GJZB 4R3SA 3OX8B 1T0NA 4BSVB 15C8H 1IC7H 3MRBB 3QEGL 2HFGL 5C0IA 4L8DA 1ZA6A 2VLRA 5DC0A 4YGVB 1T7WA 4HZLB 3CSBA 3AY4C 3B83A 1JUFB 3DI2B 2BRRH 2D2OA 3RVVC 2BNRD 5E95B 3EYOA 1FYTA 3F7VB 4EIGB 4JO3H 5L8LB 1E6JL 4LGSB 1KG0B 4POYA 1UYWH 4DK3A 5A3IC 1KIPA 3WHE0 2VDOH 3E2HC 2A77L 5IBUB 1SBSL 3VMPA 1D5XA 1EX0A 3VXOB 1KIUA 4J6RL 1EUTA 5J11B 1JZ3A 1RULH 3SJVD 1G7HB 3OHXB 5C09D 3GI9H 3HR6A 3EO9H 4MLIA 4YPGB 4JM2B 1JMXA 4J2XA 2VSDA 4H25A 3VFSB 2A6DB 4R4FH 5CEYA 5AYUH 1FIEA 1NCDH 4AG4L 4EI5C 4NRXA 4Z0BH 4NDMA 5TGBB 1ZOXA 5JORB 4J4PC 1BQLH 1MPAH 2VOTA 2GSGA 3BP5B 1F02I 5DJXB 5F7EH 3V6FA 4JG0H 1EEYB 3WIHA 5C0EB 1WIUA 5FUOH 2R0ZH 1UCTA 2KZ1B 2VWEE 5GRVK 4CVWA 4G9FA 3QFJD 5I74C 4XPBH 3S3SA 2OK0L 5I8KH 3RWEB 3B2VH 1C5CH 4I0PC 3U7WH 4QXGL 3ZYOA 2NY1D 1R5VB 4MZ2A 1I3GL 1JWMA 3RGVD 4HG4J 2YA1A 4DVRH 4U0RB 1HXMB 3RQ3A 3DROA 4BA8A 5KVFH 1WWBX 1GC1L 2VDMH 2Z35B 3SDCD 4OI9A 1TLKA 4UDTA 2NY2D 5T3ZD 2J8UF 5B8CB 3UO1L 1JF1B 4WTZG 3NFSL 1PX3A 1DEEB 4MGXA 1A1OA 3FO9B 3O81A 5E6YA 1T21B 2YD9A 4TUJA 4L8BA 5DGRA 4KTEL 4GW5A 2MCPL 4ELKB 1FSKB 4JO1H 4RFNC 2DQHH 1OARH 1ZHNB 1IEBB 4LCUA 2B0SL 2B4CC 2EDXA 2FJHB 2C3XA 4G8EA 5E2UL 3FQWA 4B7IA 1JMZA 4YFLI 3UYPA 2BSTA 2PW2B 2XTJE 1I3UA 5F1NB 1IJ9A 1QNZH 3ISWA 1WUNT 3PWLB 4PJGE 4RFOH 1R3LA 5L2JB 1NL0L 4UOW0 2Q6WA 2ZOKA 1YA5A 5IWLC 3ZE1E 4MB4A 5HHVL 3KPLA 3EFFB 35C8L 4FXKA 5D9SB 2DWEB 3QR2A 4NQVA 5IG7B 4HULB 2R0KL 1PBYA 3IDXL 4OLYL 3U0TA 2EIZA 1NCAL 4FQLH 4PJ8B 5IEKA 3T3PE 4U2YA 2CKBL 3NA9L 4TOYH 4F2MA 1R0AL 1N7MH 5DSCB 4YO0B 1QFWM 4YHOL 2P5WA 2DIAA 1MHEB 2IAMC 4S2SA 1DBAL 5ILTL 1NMBL 3HC0A 5D6CA 5FYKL 1KN2L 3JVGC 4R9HA 4XNYL 2J5LC 5IFHH 3T0EC 1WAAF 5MENB 1CG9A 3MRFA 3NIGF 3S3PA 1GGIL 4I77H 3U0PB 2EO1A 3P3YA 3DGCR 3MZTA 5GGRA 4P2YA 4CVZA 4O9HL 5DQ9B 3N9GH 5HGDA 1FDLH 1A6WL 2PW1A 2RCSL 3GSXB 1MI5A 1BX2B 3CXDL 5F72S 3QCUL 2XT1B 3LKRB 2IANB 3DECA 1GOHA 1DZBA 4XVTH 4ODWA 1S7TB 5K59E 1RZIB 3RPIA 1NCWL 3DUUA 4M6NL 4KK8C 2AXGA 2Y1VA 1A47A 1AXTH 4NKQB 1EJOH 4F58L 1V05A 5FGBC 5C2UB 3Q5TA 4G8IB 3QB7C 5JIHA 2ICEA 5BVJB 3MV9D 1A7RL 3DRQA 4OCXL 1Q0YH 2HTKC 5GGTH 4ISVA 2VN4A 1JI1A 3ESVF 3FRUA 3MOAH 5F7DA 1DQJB 1AR2A 4XVUD 4MXQD 3EDFA 4S1QL 3NCBB 1U91B 1MIML 3M07A 5FCUH 1EAJA 4K23H 3GMNB 1LO2H 1BVKB 3GK8H 4RWYH 2XZZA 3WUWG 3ARRA 3NVQA 2YKLL 4UQ2B 3ZDZF 1CE1L 2VR4A 3QXUA 3VXSA 2O61B 1PQZA 3KHOA 3WJJC 4PGDB 5CJBA 1CD9B 4XP6L 5E4EB 3TFKC 3W11D 1GGCL 4JM2D 1YNKH 4HWBL 5EBMA 5IJVB 5EDXA 2WWKO 2NTSP 2IEPA 2IWGA 1U95B 3QQ9D 1HOCB 2VKXA 4E5XA 3Q3GB 1U8MB 2H1PH 4ODXB 3ORJA 3RY5A 4FQCL 4NN7C 5C0GA 1AO7B 2PR4L 1F58L 4EUPG 2VQTA 3D3VB 4QXWA 4AH2B 3P4OA 2CIKB 3VDAA 4HBCL 3IDJB 4PJHB 2FECI 5HJ3A 1B88A 1D5ZB 4P4RB 5D72H 1H3PL 4D8PA 3MO1B 1MJ7L 1YEGH 4X98A 5J3HC 3BEVB 2I25N 5FFLA 4NC1C 3STZB 3JWDH 1NAMB 3K3QA 3VXMD 3WS3B 1H8NA 5D7LA 1FNSL 1OT1A 2LVEA 1AXSA 4U1JB 1YY9D 2HFTA 1HI6A 3MCG1 1AE6H 4LHJB 3PL6A 5J6HA 4NT6A 2Q1EA 1U93B 4CRPA 3H2WA 5IR1A 5I75B 1QFWI 4FRWA 1G7JA 2AGJH 5E1HB 5C0AB 5C7XL 4XCEA 5DA0B 3RVUD 3CGTA 5BRZB 4WWKC 1Z2KA 1KTDB 2AI0H 3ZMRA 1RZKH 3WIHH 1ZA3B 2EDEA 3P9LB 4Y5YA 1LEGB 3VFVB 3HKFA 5F7KC 5ADOL 4NQEB 4G42A 2QHRL 2DAVA 1K6QH 3TBSB 4JFQB 4M7KL 4XNZC 1AH1A 1VFUA 4JJHA 1SYVB 5FOBA 1I1FB 5CD5D 5KSBF 4XVSL 2XWJA 3ARFD 3NCJH 3ELAT 4UV4H 1JZ7A 4YE4L 5TDOA 2W59A 1GC1C 1FFOB 5SWZB 3BPCA 4C4KT 1XGRB 1L0QA 2C1OA 3EYVA 5ESQA 3VFTA 3WXVH 4PG2A 2H2PC 4QTHB 5M94B 4LCIL 1T66D 4U7SA 4LPVA 4MD5B 3O8XC 1Q1JH 5A2JH 1S7RB 4N5EC 1DSFH 4O2CA 4HKXA 3HNSL 4QHKI 1DDHA 1G7QA 3HI6L 2GFBB 5HI3C 4M1DL 1ZGLP 3MROA 5IW1B 3RVTD 2X1WL 2FECL 4PJ8D 4V1DE 1SJHA 3WIFB 1KELL 3EO1B 4KTDH 4XP9H 5A16A 1JZ4A 2OJZL 4QXUH 3HNTL 3VG9B 1I7UA 4PGZA 1UACH 1VFBB 1G6VK 3FRPA 4RBPK 5H94B 1JZ5A 2ZKHH 5F21B 2VXUH 3ZL4L 5CKAA 1TZIA 4XXCC 1CXIA 3V5HB 4XNQB 3NFPB 4JM2F 2VDRL 2F8XC 1WZKA 4PJCB 2P5EE 2VZSA 2XACC 8CGTA 4R7DA 3DBXA 5IUSA 3L3GB 1TJGL 1UKSA 3U9UB 5E6IC 4JO4L 3BIKA 4R90H 4LMQE 3HLAA 5BCAA 2DLFL 5TPWH 1QFWL 1AHWB 1T2QL 3LN9A 4PP2B 2IAND 3LS5L 4DKEL 4QRQA 4KK6C 2UWEA 4PLOB 4JB9L 1XF1A 1QLFB 5GS1B 5ESAA 2F5BH 2GK0B 3FB7B 5EA0H 4DOHE 4RMQA 2YWZA 1WBYA 3KPMA 4RNRA 5GXBB 1BZ9A 5I8OL 4YGAB 3AY4A 3R06A 4ZMAT 4JFYB 3UBXB 4LSSH 5LXGL 2CDFA 4HUWA 3FOMA 4JJ5A 2XY2A 4H1LA 3QDJA 3EYUH 2E3VA 1KULA 5GRXG 3TYFB 1N64H 5J1AA 3BZEA 4R2GC 1NEZA 1LEIB 4MD0B 1EJ6A 3BGMA 5TDNB 2X4NA 4ODBD 5FM8A 4EIZC 1NGWA 3TVMA 2H8PA 3QT2A 3ILPA 1KLUA 2VQUA 1X5YA 2EDBA 4RCAA 2DQTH 5LVEA 1LK2A 3FJTA 2CGRL 5FHAH 1T1YA 2AQ3A 4JRWA 2ENYA 3G5YA 4HMEA 1DQMH 4KQ3H 4M9PA 1TENA 3F7RA 5CHNA 3QCTL 4WV1A 4X0KB 5A2LH 4DGIH 4M43L 4NKMB 5C2BL 1HIML 1X5KA 2F74B 5EBWB 2Z9TA 5HDLA 1KCRH 1GGUA 4EI5A 3B9VA 1A9EA 3VXSE 1HINH 2YEZA 3ZE0E 1NDGA 1CR9L 2ID5A 5KVDH 5H2BB 1LQSR 4L4JA 3TNNB 5IBTL 4XNXH 2NW2B 2YD4A 5F97E 4J4PA 2BVPA 3AVEA 4JHAL 1AO7D 1YEKH 5IM7B 4OLVH 4ETYA 5I1AB 1CGSH 3DARA 4Y8DC 1ITBB 1Q94B 3C6LB 2F5AL 4NGHL 1YDPB 3NAAL 3CMOL 5HHOE 4ZTPL 4KKLD 3NCEB 3QO0A 4X4XB 3WXWH 2X10A 5E8DL 2XI9A 3EO0A 3UTSD 2XNAB 3PIQB 1UM6H 3UTTA 3AROA 3SQOL 3ZKXC 4U6HB 2W65A 1WWAX 3LSOA 3E6HA 4OQ1A 1VENA 2EYTB 5DRNB 3EOAB 4OFPA 4R26L 1NCCH 2UZYB 3K1DA 5F8QC 4NWUL 4F7PA 4Y4KC 3MRPA 4N0YH 2Q76B 5D7JB 4JKKA 3FN3A 5LCVL 4Z7QF 2HLFD 1Q9LA 4DQOL 4RZCB 1N2RA 2YPLA 5HHMD 1UQSA 1MRDL 3TNMB 1RZ7H 4N1HB 5C0AD 5I1GH 2HN7A 3QWOA 1QG3A 3SDYH 4AJ0A 4NNPL 4L9LB 5C0DB 1IGYA 4OZGE 2ERJC 2DBLH 1CICB 4YZFE 4N8VB 2DRUA 4YQXL 4Z5RB 3LHPL 3B3IA 5INDA 1RUKL 2ZCLL 1U3JA 4WHTA 5J1SC 3ZKND 3EFDH 2FHCA 1OTSC 3C8KB 3K2UL 3T4YA 2PTTA 1NBVL 1DTUA 3ETBF 4WY7H 4OCRH 4KJWC 4HSQA 2VAAA 1HQ4B 4G9DA 2L0DA 1FL6A 4XZUA 4L1DA 5HGHA 5IWLA 5J13B 1UENA 1ZLSL 5GIRB 1CD8A 5C8JA 3TBVB 4MVBC 3PWJA 1RUMH 3OG6B 5EBLA 4ERSL 1N6QL 2OTUB 3FN0L 3S35H 1JFQH 4HH8A 4UNVA 1CQYA 4PRHE 4FQPA 1I8IA 1JRHI 5J6GB 3AMLA 5I8EA 3SE9L 2P44B 1P9MC 5IJKC 1S9VA 4PGJA 3DSFL 5GISH 3QNZA 3ECBB 1FV1A 3QULB 2VDKH 3JVGA 4L3EB 3UJTH 1U8OA 4ZPTA 5GGVY 3PGFH 3MV8B 2YRPA 3VD4A 5C0RH 4XCNA 3T0BA 1KENL 1ZT4B 5HXMA 5CAYB 4JHBA 3GSOA 1P4LA 1ZSDB 1S7XA 2P49B 4WTWA 1NAKH 4RDQG 3P11L 3NACL 3MRKB 4KRLB 3LV3B 3DPBA 5LWYH 5E5MA 1FNGB 1T04A 4GQ9L 4QRUA 3KYKH 5TE6L 3EDEA 5GS3A 2C1PA 2DBJA 3EOBB 5CJOL 1CFBA 3HE6A 4Q6YA 2XXCB 1N0LA 1KLGA 4WFHE 5HHXH 43CAA 1WEJH 5EN2B 3BDYH 1J5OH 1M7XA 5C6TH 1F00I 2F54E 4JDTH 4I48B 4NCC2 5D7KE 3P0GB 4XPAH 1IEHA 3TIEB 4OD2B 1BOGB 4WFEE 1RZJL 1XEDA 5DS8B 1QRNB 3GHBL 3HG1B 1TQCB 3S96B 3U2SA 4BSWA 2APXA 1KCLA 1WZMA 3VH8B 2R56H 4JZOA 4OD1L 3IU3B 1U42A 2A83A 2RR3A 3PV6B 4PV8A 1CIUA 4PJAA 3O11A 2D7MA 4FQIH 3FAWA 3LH2L 2WUBL 2XQYK 1W0YT 3NZHL 3QDAA 1MHHB 4MA7H 1C5DA 1MF2L 2ZCKH 5EU3B 1DANU 3QIBB 3PQYB 3QDJE 3FB5B 3RWGA 3P0YL 4JFDA 5BZDA 1Q9WB 2JJSA 4FFZH 5B38B 4OKDA 1JRHL 1IAOA 1UB5B 3MLUH 4PJEB 4QRPA 4L8SA 2ZJSH 3QQ4A 5KS9E 3G6AB 1HQRB 4YBLC 1RK1B 3WFHA 3WN5C 3GMRA 5D2LA 2JF1A 5FYLL 3CC5A 5GS0C 1INEH 4ZXBB 4NQSA 4XP5L 3DJ9A 2Z8VC 5C3LD 5E08H 3GI8L 1QBBA 5FAAA 5CUSH 3S6CA 4H1LH 5CJQL 1ETZA 4NP4L 2HFFB 3MBXH 3C6LD 5EWIL 3S37X 1G9NH 1H5BB 3VGDA 5CKGA 3MRIB 2M26A 1WFNA 2P8MB 1OAZL 3IFNL 1KIRB 5F7WC 2X4QA 1OQXA 4N90D 2O5XH 5DEGB 4WFFE 1IGMH 3DMMC 4PGEB 2R0WL 3HZMB 3PXJA 3U4AA 4ESKA 2P47B 5FO9A 4YK4B 3IJSB 2Y6SD 3LRSB 3EOTL 2YN3A 3JZ7A 4K2UL 4MA1B 1DBKL 3WFZA 1UM5L 4Z7NE 1T7ZA 5KSVB 2PYFA 2Z8RA 1MAML 1HHJB 3VGAB 2WNGA 4FG6C 4LU5L 4GUPA 1G9MH 3DVNB 4WWKA 1UWGL 3NIDF 4WNQA 3IDNB 2XRAH 3ZTJG 3SY0A 5K9OB 5EZJB 3MXVH 3ARQA 1GZPA 3EHBD 4HPYH 2YPLE 5IW3A 1EERB 1JJUA 4PJCF 4H20L 4R4NC 5EOQH 1WSST 2B1HL 3QCVH 5D1ZA 3HCVB 3OKOA 2NX5A 1M05A 3GZKA 1L6ZA 1BM3L 3NTCH 2BVYA 2WAHA 4QHLB 5T1DL 1C5BL 1D9KC 1JTOA 4LSUH 2IBGA 4PJBB 4MA3B 4HQQH 4PTUA 3HB3D 5T3XE 3QUYC 2BVOB 2UZIH 1YPZF 5F7LB 3L3KB 4ZAKB 4UNTA 1YN7B 2DI7A 1XF5B 3QNYB 4LL9A 2CRZA 3VRJA 2AKRB 3ALXA 4PJ9A 3RIFK 5JW5A 1NQBA 2XFXA 1KPVA 2FDBP 3BAEH 5CBAB 2A74A 4HH9A 1GL4B 3L95B 4HKJA 2FO4B 5D1QB 1IM3B 1GPOL 2H45A 4IOFD 3RGHA 5JQHC 5KW9H 1WCQA 3PP4L 3S4SG 4L3ED 4OZIA 3MUY1 4XXCA 4Z78B 3CPLB 5E6ZA 3FFDA 4TNWK 1LO4H 3BKCH 3I6KA 4KJQC 3CFIC 5EC2B 2X9XA 1BJ1H 4JN1L 3TPKA 3TYGH 4KC3B 2H41A 4HLJA 5E99H 5E6IA 5H35B 3T0EE 2NLJB 6FABL 1R3HB 4FFWC 3KPPB 2A73A 2WUCH 1F11B 5JPNA 1R3IL 1TNMA 4KJYA 4JZNB 4UBDC 2OR9L 1SVCP 1FG2B 2X05A 4WO4D 2AJYH 1XF4A 1FRGL 2R2HA 3OR7B 1JGVL 3MLSH 3V0AC 1W0WA 4LKXA 1KT2B 2VNCA 4TULL 2JB5L 1I1YA 4U1MB 5HHQA 3ULUL 1RU9L 3O6MH 3T1FB 2GJJA 4IIQB 4KMTH 1QRND 3W9EA 5EU4A 1LP9B 3G08B 5ICXB 3UPCA 4N0FA 1DQTA 4FZ8L 4U1LB 1IQDA 2YA0A 4D0BB 4F57H 3KLHD 1X6LA 1UCBH 3BN3B 3WE6B 3MYJB 1CU4L 2WLYA 1ZLVK 3QPQD 3VG0L 1SVZA 4WW2A 1KV3A 4KHTL 5FM5M 4JREC 5AWNH 4YXKH 1IAIH 4PJAE 3QIBD 4B41A 2LTQC 4HT1L 3MLRL 4ZQKA 1EO8H 1DFBH 4JFZL 4POZC 4Y1AA 1BF2A 5JOFB 5DGQA 4P2RD 5L2KA 1X4XA 2EH7H 1A4JA 4Q2ZB 2V7NB 3LN4B 5T1MA 1AP2B 4MWFA 4ZXBD 3WNNA 3CH1A 5E4IA 4NN5C 4KK5D 2Q86A 1KLFA 1AGDB 2HVJB 3RZCB 2OM5A 3M8OH 3TH4T 4OLXL 2YD6A 3I75B 4PRBB 4IRJD 5D2LE 2ZOLA 1LNUA 1S9XB 4CDGC 3GO1L 3MNWB 1KSRA 2PF6A 1HDMA 4J1UA 2DQIH 2XTJB 3WSQL 2Z92B 3LKPA 2JJWA 4ZODA 3S7GA 1IM9D 4PJGB 4DVBA 3IVKA 3HZKA 2HFGH 1CFTB 3O4OB 3QEGH 5JDSA 3LKSA 4NC1E 4CGTA 4RMRA 4D3CL 4Y4KA 1DP0A 2UZXB 3TO4B 2E8ZA 1L0YA 2B1AH 3CNKA 1CFQA 4PREA 1TIUA 4RGNB 3DVGA 2MWCA 1E6JH 4U6TA 2O93L 4P3DB 1QUNA 1ADQL 1AGFA 2N7AA 4YHPA 5IMMB 1FZMA 4DN3L 4M62L 4C83A 1SBSH 3FO2A 1CT8B 3EJYC 4HW6A 4I2XB 3HE7C 4X7SL 5DRXB 3SGKC 3KPOA 1KTLB 3VGGA 4D94A 1A7QL 2YSSA 4YDKL 4H26B 2L7JA 1AD9B 3K74B 4YDVB 4EEEA 2X89D 2DKUA 3BQUC 3FT2A 4HIEB 5D93B 3OKNA 3QZWA 2AEQL 1XZ0B 2D4DA 3MRMA 1HK6A 1UKQA 1GGTA 2EE9A 5JHDA 4MA8L 4HIXL 2NX5E 4NSKA 3BRDA 5DUML 1RI8A 3IFLL 3P4NA 4X6FB 1G6RA 4K94L 4GG6E 3BYTA 2QQKL 4FOMA 1IGTA 5HGBB 1P9MA 1J86A 4HC1L 3MZGB 3Q5OA 4R3SB 3V0WL 5D7IA 5E94A 4D0CA 5D1QD 3WO4B 5KAQG 1T0NB 3BESR 4QXGH 3GNMH 1DN0A 4YPJA 1I3GH 3K80A 4JCLA 4L8DB 4MQTB 5JHLH 2VLRB 3ARBC 3KJ4C 5MHSE 1GC1H 2VIRA 3RU8L 2IQ9H 4Y4FC 3LZFL 1IEAA 1JPST 3WFDL 3LKQA 3UO1H 3EYOB 3NFSH 5EO0A 4OZIE 4PJEF 1YEJL 4OLWL 4TSBL 4EI6A 4FQJH 1KTRL 5F9WB 3TJHD 5EOTA 4KTEH 3WYRA 1CGYA 1YEEL 2MCPH 3GJFA 3QUKA 1CE6A 5JO5A 3V5DA 3SEPA 2LQRA 2B0SH 3TZVD 5HBBA 5E2UH 1OP9A 5E7BA 1DANT 2D0GA 5IFAL 1IAKA 2KL6A 2ITCA 4ZNEA 2JLLA 4R8WL 4H25B 1S7SA 1GHFL 3N1PC 5CEYB 5ESVA 4OM1L 1NL0H 4NRXB 1ES0B 4ZOCA 2IALA 1X5FA 3C8HA 1TETL 4NDMB 5I1LA 5HHVH 4P49A 4XC3L 35C8H 2BHYA 3C60B 2V5RA 3RIAF 3WFCL 3LIZL 2ADFL 4CJ0A 3UTOA 3V6FB 4WTZA 3V6OC 2R0KH 2GIYA 1KEMH 1B4JL 3PWPE 3IDXH 4OLYH 3WL9A 4CN1A 3L7EA 1NCAH 1MNUL 3H7BA 5BJTB 2CKBH 3P2TA 1WT5C 2VITA 5IROA 1R0AH 3WN5A 4YHOH 3Q6GL 5ILTH 1DBAH 1NMBH 5IB3B 1JWMB 3IDYC 5FYKH 1KN2H 3TPUA 4HXBL 4QWWD 4XNYH 3DROB 3H7LA 1FCCA 5EOCL 1FHGA 5DO2D 4UDTB 2AP2A 2JK5A 2ZUQB 4Y1AE 1GGIH 1NANI 4XCCL 5E9DD 4Q9BA 4C56A 3RZCD 5L2KE 4Y19E 1A1OB 4O9HH 2RCSH 1A6WH 3WHXA 4WEUD 2NXZC 3CXDH 1OT2A 2FBJL 4TUJB 4L8BB 3UP1A 4PJBF 4GW5B 1YJDL 4UINL 3BOVA 4Q9QL 2XTJD 1NCWH 1QKZL 4M6NH 1QSZA 4JQIH 2Q8AH 1T83A 5B3JE 5HHPA 1RJLB 1P84J 4JE4B 3LB6D 2R8SL 4LCUB 4OB5L 4X80L 2JB6A 12E8L 4G8EB 3GUTA 4K71C 1PEWA 4F58H 3FQWB 3OAUH 1XIWD 2BSTB 2QBWA 3PGCA 3ULVC 1OSPH 3TO4D 5I2IA 5BQ7A 4UT7L 1A7RH 4OCXH 5HVHC 1R3LB 1KB9K 5D5ME 4FXLA 5TDPB 2Q6WB 3K8MA 4ZUTA 4B7LA 1MIMH 3UXFA 3KPLB 4M3KB 4FXKB 1A3RL 3BPNB 2YKLH 2DOCA 3SQBA 3SKMA 4WUKL 4N0UA 3FB6A 2BOBA 1CE1H 1NPUA 1OY3B 3GIVA 4NQVB 4UQ3A 4APQC 1HILA 2NXYD 4XX1E 4XP6H 3U0TB 2EIZB 1QHOA 1GGCH 1GAFL 1NBQA 4TUKL 4F2MB 3RTQA 2R1YA 1OP5H 2PYEE 2DQGL 3L1OH 1NBYA 5EO1A 4S2SB 4X5XA 3HC0B 5D6CB 3QUYA 5C0CA 4JDZA 2B20A 4FQCH 4HD9A 5ALCL 3RL2B 1ZGLA 5EIQA 4JPVL 5FM5O 1CG9B 2DL2A 2PR4H 1F58H 3MRFB 3B5GA 4CU6A 5F9JA 3D0VA 4JN2A 5JHDE 5GGRB 4HBCH 3BH9A 5IMKA 4AIXA 4CVZB 5HGDB 2PW1B 3O9WD 1DLFL 5LBSH 4M7ZB 1LP9F 1VESA 1IC4L 1MJ7H 5J06A 2AJSL 2DMCA 3QXVA 5HI4D 4O2FA 3RPIB 3DUUB 4X6BA 2AXGB 2EH8L 2YRLA 3SDAC 1FNSH 3DVFA 1N5AB 4CVUA 4HGKC 4WTXA 3SDXA 4QOKD 4X7CC 5GGRY 2ICEB 1I1CA 3WFBL 4ZFFA 3CFCL 2VZVA 2AAVA 1P7QB 4ISVB 3FRUB 5F7DB 2WV3A 1ZVYA 2QSVA 1G6RH 4NHUA 5LGHL 4M93B 4PLJC 1MIEL 1MREL 1FIGL 4GW1A 3O3DA 1B4RA 3VXSB 1I7ZA 1PQZB 5GRJL 5JIPA 4Y88A 4F3FB 3N1MC 1MHCA 4MNQE 4M7KH 4PP1C 3AU1B 1MCFA 5EBMB 1A6VL 4M7LL 4OV6F 5IB4A 4G6JL 4NKOA 2VO5A 4NO0D 4XVSH 2UVEA 4LOUC 3GIZL 5AD0B 4WU7A 4YE4H 4E5XB 3MPCA 3MACL 3KYNA 1E4WH 4PJGF 5C0GB 4NHCL 4Z95L 3PV7A 4N0CD 4LCIH 5F70A 3TBWA 3P4OB 3C60D 4FQ2L 4KHXL 2X4RA 4X7TA 1L7TL 3HNSH 4F8TA 5ISZA 3HI6H 3VCLA 4D8PB 3JWOL 4U49A 2BSED 4NCC1 3GJFH 4XH2A 1Y6KR 5IVNA 3S98A 1F4HA 1T7XA 1KELH 1I85C 3MBED 5I1DA 1FZJA 3T3PF 2APVA 2OJZH 3HNTH 2CQVA 4HS3A 3RVWC 1YMMA 1QR4A 2ED8A 1AXSB 3HAEG 4J3XA 1GCFA 4I0CC 1HI6B 1KJVA 3W9DB 3PL6B 4MYWB 3ZL4H 4NT6B 3H3PL 3MTRA 4BFIA 2I27N 1UWXK 4PG9A 2VDRH 4OZGB 3GM0A 5GSRA 3OKMA 5JIIA 1G7JB 2CUHA 4FQXA 4DGYL 1N6VA 5FV2A 4XNUL 5A43C 1TJGH 4XCEB 1LEKB 4JO4H 3MNVA 5FM4A 3T3ME 2D7OA 2DLFH 4MSWA 1QFWH 1EAPA 1XH3A 3LS5H 1W72A 4X8XA 3ROLB 1A7OL 3JTSA 4JB9H 4C56E 3I3EA 4Y5YB 3ULSA 5K59F 1GOGA 2WBWB 4Z7OE 4G42B 5I8OH 1CLYL 5J11C 1OTTC 2B39A 2IBBA 4XBGA 3SGDH 2X41A 4LRNL 2QADC 5LXGH 1SEQH 3H3BC 5FOBB 2JIXD 2XWJB 5TDOB 4PRHB 3BPCB 2C1OB 5ESQB 1CTNA 3VFTB 4FQQA 2CKNA 3H0TA 2VTFA 1J05A 1OAXL 2NR6C 3HE7A 1OP5K 3SGKA 2BZDA 1FNHA 1LO3L 4V1DD 4KVNL 4O2CB 1G7QB 3O4LA 2CGRH 3C2AL 4IOSD 1JGUL 1EFQA 3MROB 3QXWA 4NYLA 4S0TD 3BT2H 1SJHB 1BQHB 4M43H 2D0FA 5C2BH 1HIMH 5A16B 4GG8A 5DD0H 5JA9A 1I7UB 4O02L 5D6DC 2P5ED 4XWGL 4HCRL 5IBTH 2ESVD 1UM4L 2Z91A 3VXUA 3BWAA 3QIUA 1TZIB 4U0RC 3DYOA 5DJYA 1UG9A 5FKPA 4MJ5A 5T33L 4R7DB 2QQNL 2X44D 3DBXB 2F5AH 3NAAH 5C0CE 3CMOH 4ZTPH 3BIKB 5DURB 3HLAB 5SWSA 2VL5A 1U3HA 3PHQB 3SPVA 5CJ5A 4X5LA 1OAKL 5DUPL 1J7VR 3VFWA 4MNGE 4LNVA 5E8DH 1CZ8L 5CSBA 4G6MH 3TA3A 5J7CC 1MJUL 5ESAB 3P9MB 3SQOH 2MKWA 1WBYB 3KPMB 4RNRB 1BZ9B 4LHUG 1VEMA 4Y5VC 3R06B 2QQLL 4Y4FA 3G5ZA 4TQEL 4R26H 5LCVH 1RIVH 3OL2A 2CDFB 4HUWB 2OBGA 4JJ5B 4DQOH 4H1LB 5BS0E 5IMOA 4U1KA 7FABL 4K9EL 1P7QD 4YC2C 3QDJB 4KVCL 4O4YL 3FN9A 1HKLL 3MRRA 5J1AB 1OTUC 4NNPH 3BZEB 3JXAA 1NEZB 5GS2H 3BGMB 2X4NB 1FLTX 4RGMC 4YQXH 1A22B 1NGWB 2DQFA 1N6UA 2EE3A 3TVMB 1AY1L 3LHPH 3E6FA 5LAXA 1U58A 4ZS7L 3KLSA 1RUKH 2YN5A 4BELD 2R2CA 1I9IL 2ZCLH 2WLZA 1LK2B 3BDBA 5DJCA 3K2UH 1T1YB 1I1AD 1T3FA 4LPUA 3G5YB 1NBVH 1T0PB 3U6RA 2W07A 2R9HC 3SOBL 4OI7A 5CHNB 2V17L 2W60A 4WV1B 3QIWC 1UJ3A 2WP3T 3RNQA 4LIQE 5SWQB 4EI5B 1A9EB 2YEZB 3GJFK 1NDGB 4JCMA 3OJVC 1A6TA 1ZLSH 2V5TA 2V9TA 2BVPB 3CLFL 5HHOD 1MEXL 1GGBH 4Z7WE 4ERSH 1N6QH 3FN0H 3KLAA 3RWHA 3V6OA 5CEZE 1FN4A 5ELIA 3SE4C 1QBML 3SE9H 3DSFH 3QO0B 4I0PB 3QUXC 5LGJA 4FTVD 1VERA 1XCQA 3IU4L 4OZHA 3PABA 1EVTC 3BP6A 3EO0B 3QQNA 2IH1A 5BVPL 2W65B 3LSOB 4ZS6C 1UVQB 1H3GA 3E6HB 2CXGA 5H37G 3W0WD 1YN6A 1YEHL 2DQDL 1KENH 3MRPB 4BZ2H 1BREA 1Q9LB 1N2RB 5CZKA 2YPLB 3CFEA 4RQQA 1UQSB 3RX5A 4B50A 1C12B 3P11H 3NACH 3I9GL 4XBPA 2HN7B 3QWOB 3OQ3B 2XQBL 4XCFL 3O3UN 1IGYB 5TE6H 4RFNB 4WDIA 2YXFA 3JWOC 5DD5L 3B3IB 5INDB 1NLDL 2I5YL 4WHTB 4OZFG 5B39B 4LGPB 2NNAA 4X6CA 3HI5L 3D25A 3T4YB 2PTTB 4K55A 3RPKA 3S5LG 4KK9D 1FO0L 1AQDB 3GHBH 4G9DB 2HJLB 1FL6B 4FABL 1EEZB 1NC2A 4XZUB 2EXWC 2ED7A 3C9NA 4OD1H 5JW3L 4CKVX 5IVXA 5BO1L 4PRHD 4QLRA 5IV2A 5C8JB 4MB5A 3ZZ1A 3LH2H 3PWJB 5FYLE 5EBLB 2WUBH 4JFEE 3CZFA 3C87A 3NZHH 4X6EA 4APQA 5HYSG 1MF2H 2YOCA 1PG7X 1I8IB 5BZWB 4UILL 4X9HA 3CVHL 5I8EB 1QLRA 3QJFA 1T89C 1AGBA 3GMMA 3P0YH 1W72H 4YDIL 5HD8D 1S9VB 1RUQL 3VFPA 5ACZA 5FHBH 3WV0A 4KDVA 2OX5A 4LCCC 3QNZB 1JRHH 5FYJU 4FFVD 1FV1B 1DUYA 4Y2OA 1U8OB 2J5LB 4NZJA 3SKUD 3T0EB 2PXYD 4ZPTB 3X12A 1K4CB 1XR8A 5EUOA 5FYLH 2BCKA 3ZE0F 4XP5H 1ERNA 1MWAL 3GI8H 4XCNB 3ZT5A 1QTYT 3H8NA 1ADQA 2WSKA 2QKIA 3GSOB 1P4LB 1U2HA 4J3TA 1S7XB 5CJQH 4F9PC 4NP4H 4IOIA 5EWIH 2X09A 3ZHKA 3VWJD 3VXUE 5E5MB 5FCSH 1OAZH 4QXTA 1T04B 3IFNH 1MFCH 4QRUB 2UUDH 3IRPX 2F54D 5D7KD 2C1PB 4JY6A 4WFED 4ZYKB 5JXEC 3HE6B 4AEIH 1CFSA 1Q0XL 2R0WH 5I17A 4R7NA 4RA0C 1QLEL 43CAB 4RIRA 3EOTH 5DT1L 5KANI 3RX7A 2CLVA 4K2UH 3TCXA 1JPFA 1UM5H 2GHWB 3BD4A 4Y16C 3C5SA 3RVVD 5DFTA 3U2SB 2BC4A 4BSWB 2ZSVA 5E00A 2GK2A 3T65B 3QPXL 2A83B 4PV8B 5ID1A 1PVHA 1Y18A 4PJAB 3RZWA 3O11B 1J1XL 1GSMA 1UWGH 3DWTA 4DUXA 3QHFL 4ORZC 1RIUL 4OZGF 1WFUA 4H20H 4YZFF 3MC0A 4GRWE 3RWGB 2B1HH 2XY1A 1MUJA 2XV6B 2ZUYA 1MLBA 4JFDB 3FB8A 5BZDB 2VXTL 4DKFL 4E41D 1IAOB 4OLUL 1BM3H 4MXVF 4QRPB 3QQ4B 4AYFA 4EI5D 4NN7B 3WFHB 3FQUA 1G0XA 3GMRB 1A1MA 5D2LB 4RMUA 3CC5B 4NQSB 4S11A 1IL1A 1JIBA 5DHVA 4Y0GA 4F37K 1ETZB 4XGZA 4D9QE 4N1EA 2CRIA 2VDNL 1V7NL 1M7IA 2WBJA 4WFFD 4KMLB 1G9EA 3RIFF 4XPTL 3EUUA 3FZUC 3VD3A 4QY8A 1N3NA 2ORBH 3OG4B 2X4QB 4X6DA 4I0PD 4PJ5A 3U7YL 3V6OE 3WNMA 1KBGL 3GRWL 5MP6L 1TVBA 3PP4H 3DLQR 4OF8A 4TNVK 2FX7L 5FO9B 1AGCB 2OJEA 3FCTA 4TNWF 5A2KH 2KZWA 4OZHE 3QDMA 2PYFB 4HGMA 4HZAA 3ULUE 4JRXE 6FABH 2O5ZL 2R15A 2CLZA 1R3IH 4GUPB 4X99A 1S7VA 3CFKA 3CFJA 4WWKB 3RWDA 2NY3C 4WNQB 1K9TA 3OKYA 2OR9H 3SY0B 5ACLA 3BGAA 5GRZA 3QEQA 1GZPB 3DX6A 1YUHA 4FQHA 3OXSA 1FRGH 3CSGA 2CMRL 2DI8A 1JGVH 2VLLA 4LSDA 5D1ZB 4XNZB 3OKOB 2NX5B 1HYSD 3C6SA 4J3UA 4TULH 5DJZA 4BFGA 2JB5H 4KY1L 1M05B 4PY7A 1T5WA 3R1GL 3ULUH 4FNLL 5T3XD 2GEEA 2VLKA 1RU9H 2HH0L 3LPFA 2G60L 4CW1A 1H8OA 5B4MC 4GG6B 4ENEC 2BY3A 4Y8AA 1ZEAL 1JPSL 4FZ8H 2R4SL 1UXSA 2VH5L 4IM8A 3MQIA 3ULVE 3S36X 2R2EA 3UJJL 5IIEB 3O8XB 5ALBL 4MQXD 2D0HA 3DVIA 4I13B 1CU4H 3P4MA 4HPOL 3VG0H 4WI9A 2HRLA 4KHTH 5IVXE 3DX9A 4IS6A 3VRJB 4KRPC 3OR6A 4PJ9B 5JW5B 4HT1H 5L7XL 2XFXB 1KPVB 3MLRH 4MZ3A 5I1JL 2A74B 4HH9B 4HKJB 4O2EA 4JFZH 1KB5L 5D6DA 3DXAE 2IAMD 2DN7A 3RFZC 4HWUA 4OZIB 2UUDK 1Y6NR 3T0ED 1HEZA 3FFDB 4XNMA 2CUMA 1A5FL 5MERA 3I6KB 3SGJA 3OKKA 3FHQA 3BKJL 3WNKA 4CN4A 2YD7A 1X7QA 5E6IB 4OLXH 1FVDA 5D7JC 2LAAA 1CGUA 3QBTB 2A73B 5D96C 5F6IC 3T4AB 4KJYB 3R8BB 1A2YB 3GO1H 1BJ1J 3ARWA 1VSCA 1AKJD 4NN6C 3MODH 4KK8D 2JELL 3WSQH 2FIKA 4IMKC 3L3DA 4JPWL 1XF4B 5GGUA 2L7UA 4Y5VA 2R2HB 2VLJA 2G75B 3L9RB 4LKXB 2W92A 5E2WH 4D3CH 2F8OA 5IBUG 3HRZA 1I1YB 2IPTL 3B8YA 1K85A 1RZGA 4OKVA 1HKFA 2HTKD 3W9EB 3ZHLA 3OJ2C 4Z7NF 1F97A 1IC5L 2KPNA 4N0FB 3HFMH 1VGKA 4M00A 4R2GB 4HWEL 1IQDB 3PWPB 1ADQH 4HUUA 5DHXB 2OL3A 4DN3H 3A6BL 3EYQD 4XMPL 2YR3A 1V3LA 3OPZL 5I18L 1NKOA 3K4ZA 4X7SH 4M7JL 1A7QH 4YDKH 1QA9A 5GGQL 1UH4A 3TFKD 5IQ9A 2F53A 2WINA 3QIWA 3ALPA 4ZQKB 1I75A 4HK0A 1TITA 1J8KA 2AEQH 2FIRT 3RI5K 4HUVA 4Y1AB 2BJML 3H9YA 5F88B 4MA8H 4AIOA 1PY4A 5L2KB 4HIXH 3OZ9L 1T1ZB 1A4JB 2J6EL 4NZDA 5T1MB 1CTOA 5CIPB 2WIMA 2Y36L 4LP4A 4MWFB 3UJIL 1J18A 5DUMH 3EAKA 1FLRL 3CH1B 3IFLH 2Q86B 3N85L 4G8GE 5B3NA 4QHMA 2QQKH 2ILLA 3IDMA 1JNHA 2BNQA 2ZOLB 1LNUB 3QUXA 3UTPE 5J3HD 2FEEI 3G5VA 3K4AA 5LJYH 1HDMB 4J1UB 3B43A 3V0WH 3O2DL 3LKPB 2IBZX 3ZKXB 2N7BA 4LPCA 3I2CH 4DVBB 3IVKB 2CR3A 1LGVA 3HZKB 5JDSB 5E8OA 3LKSB 4WI7A 2MQCA 3IS1X 2YK1L 4Y4KB 2VXVL 4LLVA 1NJ9A 3HHRB 4X6DE 3RU8H 1Z9LA 2AEPL 3LZFH 1D5BA 5D8JL 5BXFA 1ZWIA 3WFDH 1V7ML 4PREB 3MV7D 3I3BA 3HR5A 3DVGB 4LLDA 1YEJH 4M4PA 4M1GL 4OLWH 4TSBH 3WEXA 5ICYA 5DHVH 3NCYS 4YHPB 1FZMB 4C83B 3QDME 5JXAL 1YEEH 4P5TA 3FO2B 4JFXA 4QT5A 2IG2L 4UOJA 2AXHA 3KPOB 2YSSB 5L0QC 2PYEB 3K8LA 1NUDA 1LDPH 4YNYA 3ZTJH 1XAUA 5DRWA 2PCPA 3DSNA 4FS0A 3FT2B 1N26A 2ICWI 4YXHL 4K3DL 3OKNB 3QZWB 5IFAH 4HX1A 3MRMB 3X14A 1ND0A 4R8WH 5ICZA 1UJTA 1GHFH 4L4TD 5IEHA 5JHDB 3MJ6A 5FB8A 3K2MC 4OM1H 5EZLA 1BD2D 4ZUWA 2H2PD 2AS5M 4NSKB 3OSKA 1TETH 4WVRA 1K2DA 4Z77A 2LAGB 2VLKE 3O8XD 4XC3H 4U1SA 3I85A 3P4NB 4N5ED 1G6RB 3WFCH 3LIZH 2ADFH 2X4SB 3O41A 1IGTB 3QAZC 5HI3D 3G6JA 1ZLWK 5I66A 5J89A 1B4JH 4ODVL 3LVEA 3TCLB 3ZYIA 4G7VH 4LCCA 3QRFM 4PJAF 4JR9L 4QHNA 5MHSD 5D7IB 5E94B 4D0CB 4MXWL 3RRQA 3KPTA 2FEEL 3SDDA 5T3ZL 2DI9A 1DQDL 1RHFA 4HXBH 5IMLA 3RDTA 5AAMA 1KNOA 25C8L 3L3JA 5BOZG 4OSUH 4PJ7A 1IEAB 1XF3B 4ZPVB 3LKQB 4XCCH 5EO0B 3QUML 5E6ID 3S37L 3OB0H 3VGAC 4EI6B 2FBJH 3VXRA 5LQBL 5EOTB 5D2LF 4KK6D 4LVOB 2ADJA 1YJDH 4HIHA 4UINH 3GJFB 3QUKB 1CE6B 1QKZH 5JO5B 3DRTA 2XZAL 2R8SH 1WC7A 3HMXL 4OB5H 1T7YA 3Q1SL 4X80H 3SCMA 4Y16A 5JUEL 4HCRA 1AGEA 1IAKB 4LSRL 3RL1A 5FEBA 1AD0A 3AB0C 4I18A 1RHHA 4GXVL 4UT7H 2MMXA 5ESVB 5I15L 4F80A 2CDEA 1JP5A 1NKRA 2C4XA 4HUMB 1QPXA 4ZSOA 4AENA 2CK2A 5I1LB 3PWPD 3KWWA 4J3SA 2FB4L 4ZUSA 1L9NA 1A3RH 2WZPD 4GRLC 3FKUS 4WUKH 2MHAA 1WF5A 4ZAKC 3T2OA 4GBXA 4GLRI 3WL9B 3L7EB 4GKZA 3H7BB 5EFIA 3OJMB 1GAFH 3P4LA 3F5WA 3INUH 4TUKH 2VITB 2FCBA 4YBLB 1U2CA 3WN5B 1KJMB 2DDQL 1CDIA 2EYSA 3S88H 4YHLL 5C08A 1E28B 4QNPE 3L5WA 4X7FC 1IC1A 5E5UB 5L2KD 1CYGA 2F53E 4Y19D 3TPUB 4JPVH 4LP5A 4P5KB 3GJEA 3DV6A 1BF8A 1S9KC 2JK5B 2C3VA 2FEDC 1IBGL 3VU2A 4UIMA 4C56B 4NQCA 5I1IL 3FT4A 5AG9A 4I9WE 5BMFL 2OL3H 3WHXB 2N4IA 2EDYA 5IQ7L 4GG6F 4FN0A 1IC4H 2CDGA 5MENE 2AJSH 1NANH 4R0LA 3T2PA 5HHPB 2EH8H 5CCKL 2V7HA 4OFYA 2BNQE 2JB6B 1QFOA 3CX2A 3GUTB 3MA9L 4Y4KD 3PGCB 3WFBH 1JTTA 5I2IB 3P0VL 3CFCH 4P4KA 5DQDL 1F6LL 3O3AA 4MNHA 1JF5A 4ZUTB 4IBLT 1ZANL 4OZIF 1GRWA 3P30H 1MVFA 3CSYA 2BX5A 1YYML 5J57B 5B22A 3I6GA 1MREH 1FIGH 1L0XA 2XG4A 3SKMB 2PTVA 1OTSD 3FB6B 2BOBB 4IDJH 4N0UB 2VR9A 1T1XA 3GIVB 2PYED 4UQ3B 5GRJH 4TSAL 1HILB 4BKLB 2A9MH 3K8KA 4KJWD 3TH2T 2YHGA 4P2QA 3U9PL 3VGFA 1A6VH 4M7LH 5I0ZA 4HS6A 1D9KB 3RTQB 2R1YB 4DJMA 2X70A 1NBYB 5EO1B 1KPUA 2VC2L 5JHDD 4X5XB 4LLMB 3QUYB 5F9DC 5C0CB 4JDZB 3MACH 4M1CC 4NJ9L 1CGWA 2YA2A 1V3KA 4MVBD 1N59A 4NHCH 5CINL 5F9JB 3D0VB 4JN2B 4FQ2H 2EC8A 4KHXH 1I8KA 1L7TH 3BH9B 5IMKB 1ACYL 1KFAL 1WIOA 1YQVL 3JWOH 4MJ6A 1X5LA 3VFOA 3HMWL 1UB6A 5TQ2L 2IPKA 3O6FA 1DUZA 1KJ2L 1EFXD 2V5YA 4PJHE 4UZGA 4X6BB 1F45A 4P46A 4NKIL 3G6JE 1S9YA 2GSIA 4ZOBA 3SDXB 2A6JA 4K3HA 4L4VA 2FWOA 3U36A 2GJ6A 3H3PH 3MUJA 2XA8L 3AM8C 3HC4L 2Y5TA 3VGBA 3C5JA 1GZQA 1MCIA 3NCYP 3C8DA 3U46A 3QUZC 4DGYH 3QWRA 5DA4A 1I9RL 4XNUH 4PD4J 3KPRA 4RGNC 1MJ8L 3OGCA 5EUKA 3F7YA 3CVHA 4WEBL 4PJ7E 4MNQD 5IP4A 4YFLF 1A7OH 1YC7A 2P8LA 3KDMA 4GW1B 3O3DB 3VFRB 4D9RE 5MEPA 1I7ZB 3RGVC 4CU8A 3VXRE 1EV2E 1FL5A 2IF7A 5B3JF 4W4OC 4GAGL 1MHCB 4P99A 2NY4C 1W2KT 4LRNH 4Z7WB 3FO0L 5IB4B 4NKOB 1E4JA 1MWAA 2X5PA 5D93C 4XCYA 4WU7B 4NQEE 5I19L 1TQBB 3GBML 3QJHA 3V4UH 1A7PL 3KYNB 4FFYL 4PJDA 1C08A 1MSPA 2J88L 1KYOK 2DJUA 1OAXH 2R0LL 3JV6B 1JYWA 2HWZL 3EJZD 4JREB 1ONQA 1LO3H 2DJ4A 2X4RB 3IJYA 4KVNH 2VDLL 5ISZB 1J0ZA 4P23C 3G5XA 3C2AH 4ZSOE 4OCSL 1JGUH 1JN6A 4ONHB 1INQA 2Z4QA 3F6IA 6CGTA 4FQ1L 1U8KA 3BYYA 4O5LL 5I1DB 1BGXL 2D31B 5TJWK 4AEFA 3STLA 4O02H 5ETUA 4UDUA 4HS3B 4XWGH 4HCRH 5GS0D 1UM4H 1NSNL 5KN5A 1KJVB 4NN5B 3DHJA 3QG6A 4BFIB 5HTSA 2EO9A 4PG9B 5GSRB 4UB0H 4Y5XC 3OKMB 5C08E 3QP3A 5T33H 2QQNH 3DUSA 4FQXB 5D4QA 4C56D 4OGYL 4X9BA 4RMTA 3MNVB 3I02B 2VYRE 5GHWL 4MSWB 1LDSA 1V3MA 1NGYA 1XH3B 1OAKH 1OWWA 1W72B 5DUPH 5CP3A 3DMMD 3JTSB 1CZ8H 1K5NA 4RX4D 3ULSB 3PF2A 1MJUH 3ES6A 1GOFA 1MHPL 2CPCA 1OLLA 4KAQL 3WIIL 3TP4A 1O7SA 5ANME 2QQLH 4XBGB 1K3ZA 3NIFF 1IAMA 4TQEH 5ENWA 3REVA 3QQ3A 4N8VG 3DO7A 4KKAD 5DMGC 5F89A 5T5FH 3W5NA 4JFEB 1LWRA 4FG6D 2ZSWA 1PW3A 3P9WB 1N5YL 3MV01 4XWOD 7FABH 4GH7B 4K9EH 2GY5A 1BMGA 4XAKE 1BFOA 4O4YH 3SE8H 5DR5L 4FQQB 1HKLH 1QSEA 3H0TB 1J05B 5IKCA 3HE7B 5LKNA 1AY1H 1VADA 5GPRA 4ZS7H 1FPTL 1I9IH 3O4LB 2AQ1A 3BQUB 3HPLA 4Q97A 3SOBH 3DGGA 2V17H 2W9DH 3KS0H 4JVPA 1D9KD 1T0MA 2OS7A 3F8UB 4GG8B 1F5WA 4NKDA 4OUOA 2FX9L 5DJ6A 3THML 2ZWLT 4GKSA 2FLBT 4LPTA 3DX7A 4KWUA 5DVMA 4XVUC 2Z91B 3QUYD 3VXUB 4LHUA 3BWAB 3QIUB 4XVJL 5FUZH 5DJYB 4KQ4L 5FKPB 4MJ5B 3T0AA 2ZUQC 3UTZA 5GS2D 2EDDA 3V4VL 1YY8A 2ZG3A 2CR6A 1YC8A 1QBMH 4BH7A 3WMSA 5MEQB 1TJIL 2VL5B 1U3HB 3O6KL 3SPVB 5IB1A 3IU4H 3GGWA 3KLDA 3VFWB 3FQNA 1J0HA 5JOEA 1BHGA 2EIBA 2MFNA 1OWRM 1F90H 3KJ4B 5BVPH 5BS0D 5E1AB 4Y4FB 3G5ZB 1IAIM 1MQKL 1S9WA 2CUIA 1YEHH 4JPKL 4ODSL 3C5ZD 3L7FA 4D9LL 1OF2A 4NO3A 5H8DA 2G2RA 1C16A 1OAYL 1RVFL 5IMOB 4UBDD 3GMLA 3I9GH 4WI3A 4L4VE 3MRRB 2GJ6E 1JK8A 1F6FB 2XQBH 4XCFH 3B9KA 1BWWA 5EORL 3IKCB 3Q6FB 5FV1L 3MRLB 5DD5H 3MGAA 2YUWA 2DQFB 4Y2DD 2J4WL 5LAXB 3E6FB 1U58B 1NLDH 2I5YH 1KB5A 3BPNC 5I1EH 5DJCB 3HI5H 1T3FB 3H3KA 3WO3B 3U6RB 3BJLA 1K8IA 5D2NA 2P46B 2W60B 3GMQB 1UJ3B 3OTTA 4HJGA 2CK0L 3KYMA 3RNQB 5I9QB 4P2OC 5JW3H 5CEZD 2VXSL 1A6TB 1CDGA 4ODUA 3PJSA 5BO1H 2ARWA 3FHAA 3MGTA 1E6OL 1I9JL 3OV6A 4GRLA 3DTXA 3KLAB 3RWHB 2COQA 5JA8B 4YFDB 1L4IA 5DF0A 1FN4B 4QRRE 5EO9A 4UILH 3CDFA 3W2DL 3CVHH 3EIFA 4DUWA 2DYPA 4PJDE 1QVOB 3VFNB 3BX7C 3MFGB 1F4YL 4YJZL 1FORL 2P24A 1RUQH 3CFDA 3MJ9L 2HT3C 2DQUL 4POZD 5LGJB 4E0RA 3D85B 4OZHB 5D71L 3PABB 1NGXA 4KDTA 1LE9A 3T2QA 3BP6B 3VI3E 1NGPL 5DUBA 4Q0XL 2HKFL 2XXMB 3BEWA 4OZFA 4JFHE 5DMYA 3PHOA 4YEFA 4PGCA 1YN6B 5F9AC 1MWAH 4LSQL 1LMKA 3VMOA 4LCWA 5CP7A 4YXLL 3G6DL 4S1RH 3CFEB 4RQQB 3VFUA 3EGSA 4XXDA 4XBPB 2AJUL 2XZCL 1NC4A 3P73A 3V0VA 4QO1A 3QDGD 4WDIB 1OM3L 1DL7H 1Q0XH 3FOLA 1NUFA 4K71B 4YLQT 5FYJE 5HYSA 1QLEH 5IGXL 2NNAB 3D25B 4JY4B 4ZO8A 5CJ8A 4M3JA 5DT1H 1G0YR 3BZFA 2KQMA 2J6EA 1AC6A 4M6OL 5EU5A 3PP3K 1NC2B 1JE6A 1RZ8A 4JFED 5D1XC 3C9NB 4MAYC 3BIBX 4HKBA 1UA6L 5IVXB 5F3BA 1DJSA 5IV2B 4K7FA 1EHNA 4NJAL 1S7UB 1MJJA 2PO6C 4PJXA 3SDXF 4OCNC 3CZFB 3EJYD 4HJ0C 4X6EB 1A6PA 3QHFH 5EZOL 1OGAA 4APQB 2H2SC 3IXTA 1RIUH 2DWDA 4RGOL 3O2DA 1KPRA 4M61A 4X4ZA 1QLRB 3QJFB 4PY8I 1AGBB 3GMMB 4K7PL 3BQUD 1QSEE 2NZ9C 5CP3H 3VFPB 5ACZB 2VXTH 5ITBL 4DKFH 1JNJA 4OCYL 2LVCA 2HJFA 1DUYB 2YS4A 3BXNA 2KH2B 5TE7L 1WQVT 2OI9C 2HJKB 4LRIC 5FGCB 1MCEA 3X12B 1XR8B 5HDQL 2BCKB 3VXUD 1C7SA 2QR0A 3PL6C 4F7MA 5DVKA 1WAAA 4Z7WF 1V7NH 4IOIB 3REWA 2EEBA 5FDWA 3GB7A 4XPTH 4H5SA 4QXTB 1DR9A 4OFVA 3TT3L 2GYSA 1JYXA 1PZUB 1J12A 5EPMA 3DIFA 2D03L 3C09C 4MDJA 1KBGH 3SDAB 1CFSB 5MP6H 3CH8A 5I17B 4PRPA 4TNVF 5I16A 4DZBB 5IVOA 2FX7H 4NUGL 4Y5YC 1HHGB 3ARBD 1IARB 4BM7A 4RIRB 2CLVB 3A6OA 1S7QB 1JPFB 1KF9B 5C0JA 5CJXC 3C5SB 3QUZA 1RSFA 2BC4B 5E00B 5CGYC 4LLYA 2K9UA 5EIIA 1MCWM 1XGQA 5SX4I 5ID1B 3CCHA 1Y18B 3QFJA 2DD8L 4GOSA 1QBLL 2V2WA 3ZT6A 2SEBA 1T4KA 1TDQA 3SKNA 4PG2C 5F1IA 1ZS8A 4PPTA 3RGVA 1X4ZA 3R0NA 4W4OA 5IHBA 4YFEA 2CMRH 3SDCA 1MUJB 1MRFL 1MLBB 1H15A 3FB8B 4KY1H 4OGAC 1Q72L 1I3RB 2OCFD 1QQDA 3R1GH 4FNLH 3L5IA 2HH0H 3H9SE 1ORSA 2G60H 4PS4L 4X8JB 4G8GB 3MRNA 3O6LL 3FQUB 4D9QD 1ZEAH 3MRCA 5C0BD 1A1MB 2P42B 5EIVA 4ETQA 2VH5H 4XP4L 5IW6A 3QUMA 5ALBH 1IL1B 4U3CA 1DQLL 2E7HA 4HAFA 5DHVB 4HPOH 3D39D 4XGZB 1JNLL 3MOBL 3NPZB 5KSAC 2A38A 4PRID 3DURA 1M7IB 1S7WA 2Q8BL 4EXPX 4KGJA 1PLGL 1ZMYA 5JPMA 1PAMA 5L7XH 3HMXA 1N3NB 4TSCH 5I1JH 2X1PA 5E24E 1T80A 4JKMA 1GGYA 1UZ6E 1YZZA 3KXFA 3PWNA 4X6DB 3WKNA 5J4MA 1KB5H 4WI4A 1D3CA 3D85D 3AGVA 1DBJL 1TVBB 2W0KA 1MCLA 1LHZA 4JRXD 2OJEB 1N4XL 3FCTB 1E27B 1G7PB 4QCIA 4Y5XA 2E9BA 2ICWA 1H3VA 3BD3A 2EDFA 1OQOA 3QDMB 5FIEA 4H88L 2NQCA 3BKJH 3H42L 5F1KC 2QHLA 1SJXA 5H37H 1T5XA 2NXZD 3H9ZA 4P48A 4X99B 3V5KB 1S7VB 3CFKB 3CFJB 4CUCA 2DB8A 5IHUL 4IEFB 5DD3L 3QEQB 2JELH 1G9NC 1P2CA 2BERA 4JPWH 1BFSA 1YUHB 4ZUUA 4FQHB 3TVMC 2VLLB 4Z18A 4LQFL 2QADB 3C6SB 5DJZB 5C92A 2A9NH 1EDQA 4HGWA 3ULVD 1CVSC 2QL1A 4G6FB 1C8PA 2VLKB 5AAWA 1PKOA 4OZFH 4CW1B 4WV1C 5JMOC 1NC2D 5DYOA 5F44A 1IC5H 4JFOA 5IBLC 4ONFL 1UXSB 4HWEH 2R2EB 1JVKA 2RB8A 1Z9MA 4XMPH 4HF5L 1HH6A 4BSVA 4ONGH 1F3DJ 1BVLA 1VDGA 3OPZH 3P4MB 4HHAA 1UC6A 5I18H 3Q48A 1LP9E 5KVGL 4M7JH 1G9MC 4APQD 3LRHA 1WBZB 4KTYA 3EDJA 3DXAD 3DX9B 4IS6B 3OR6B 3SKJH 5GGQH 3RUGA 4YGVA 4GKOA 4UTAL 4HZLA 4PJXE 5DK0A 3MV9A 4GRWF 1S3KL 4O2EB 3RI5F 1HHKA 3TGXA 1OGAE 3BKYL 2BJMH 4PB9L 2P4AB 1FH5L 1JNNL 4P5MA 3OZ9H 5F1OB 2J6EH 1U8QA 5K9JL 1HEZB 1Z0NA 4XNMB 3GSQB 1TZHA 5MERB 1R5IA 5FUCC 3UJIH 3OKKB 1FLRH 5ACMA 1C7TA 4LEXL 2GUOA 3N85H 2DL9A 1X7QB 3LS4L 3QSKB 1FVDB 4K8RC 1OGTA 3M45A 2VZ3A 5FYKU 3VWKD 1B0WA 3J7HA 4GS7C 1CS6A 1QBAA 5HYEA 4Q58C 1LO0L 3UDWC 3BISA 1A14L 4YIQA 2FIKB 3O2DH 2XOTA 2ZUVA 3L3DB 3U82B 5CMAA 3LDBC 5GGUB 3SDAD 4Y5VB 3DETC 2VLJB 5C07D 3JV4B 3NA4A 4KZEL 2DLGA 4CNIA 2YK1H 2VXVH 2IPUK 3HRZB 2R2BA 1RZGB 2AEPH 4OKVB 5D8JH 1BAFL 1F13A 1V7MH 1VEPA 4PRPE 4OZHF 4UU9A 4YC2B 4AT6A 3L5XL 3L5HA 4M1GH 1VGKB 3ULUF 4HUUB 2ZZUT 2OL3B 4RGMB 4PLJD 3VXMA 5JXAH 4I8DA 2WMPA 1Z9OA 2A0LC 4I3SL 3RIAK 4PRDA 4RGNE 1KJ2A 1ZXQA 1QA9B 1FJ1A 4PP1D 4XPFL 5IQ9B 2F53B 2WINB 3QIWB 5DI8A 2UVFA 3F62A 5HPOA 4NZUH 4YXHH 4K3DH 4HK0B 3W39A 2E7LC 5B8CA 4I2XE 4P2OA 4LOUD 1A7NL 4HUVB 4EN3C 4PYGA 1JGLL 4G8GD 3FFCA 1BJ8A 4ELMA 2UYLA 4XBEL 2VDOL 1KCUL 5FF6A 3MREA 1PY9A 2CRMA 1FAKT 2C7UB 3ULVF 2YXMA 1EHXA 2GI7A 3UPAA 4QHMB 4JFFE 1PG7L 3IDMB 1JNHB 2BNQB 3IXAA 3QUXB 4ODVH 4LFHD 5IVXF 5HVGB 3KPNA 3ARFA 3LMJH 4JR9H 3PWLA 2AV7A 4P9ML 2R39A 5AYUL 1B0GB 3RVWD 3HE6C 3LY6A 5T3ZH 4OFDA 1DQDH 5E8OB 1YECH 4XTRC 1FVCA 4LLVB 4PB0L 1NJ9B 4F7CA 4YAQA 3KXFE 2KUTA 3B9AA 1D5BB 3QDMD 5BXFB 1ZWIB 1A4KA 1X5ZA 2R0ZL 3QUMH 4YX2L 4LLDB 3S37H 1W8OA 5FGRA 2VLRE 4BQ6A 5E56A 4XPBL 5ICYB 1CXLA 3VD9A 5K33A 3VXTA 3ZTNL 4P5TB 4QT5B 1FYTE 2B8OT 2XZAH 3O2VL 3HMXH 3Q1SH 2WANA 4YNYB 1OTTD 4OLZL 5DRWB 2PCPB 2PN5A 2VDML 5JUEH 3K81A 3F6LA 4Q9RL 3CIQA 2DM2A 5D1XA 1OP3H 1F2QA 3ZSSA 4MAYA 4G6FD 4LSRH 3X14B 1ND0B 2MKLC 2VLKD 4GXVH 2JJSC 2C4FT 5IEHB 1BX2A 5FB8B 2Y06L 2DF3A 5EZLB 5I15H 4L8SC 1Q38A 2EKJA 2PO6A 4G6AC 1L6XA 3OAYH 4ZUWB 2IANA 4W68A 1MOEA 3ILQD 1O7VA 1K2DB 4OF7A 4Z77B 2FB4H 4HV8A 2NY0B 4ZFGL 4QYOA 2O26U 2DQHL 4PRNA 3O41B 1FC1A 4BJLA 3ZO0A 4MLSA 4HEME 3NCMA 3G6JB 1NMAL 5I66B 1ZGLM 5F7YC 4LCCB 2Y07L 3LPWA 1EHAA 4QHNB 2DDQH 4W70A 1UGNA 4LRIA 1P84K 3TC9A 4ZOEA 4YHLH 2L4OA 4ACPA 4U33A 3SDDB 2DQCL 5EH1A 4GXUM 4HWZA 5IMLB 4G9FE 5DD6B 3IETA 3WKML 3L3JB 4M5YL 4PJ7B 4GFTB 4TVPL 2XICA 3AAZA 1TTGA 2EDQA 3K7UA 2XKSA 2O61A 5I1IH 2X6MA 4AL8H 2XQYG 2X4OA 5BMFH 1U8IA 5IQ7H 2FX8L 4TTDC 3VXRB 1IKNA 5J0BA 1JCKA 4TOYL 2BVQB 2ADJB 4HJJH 3CXHJ 3WJLA 3GM8A 1G0DA 4HIHB 1IGIL 1CLCA 3DRTB 4FXGA 4C57C 1WC7B 5CCKH 3P77A 3SCMB 5HYJA 4M48L 4UMGA 2V2XA 3QO1A 4OJFH 4Y16B 1CDJA 5CJXA 3SBWA 3MA9H 5D1ZC 3RX8A 4AK1A 1B2WL 3P0VH 1AD0B 4I18B 4U05A 1RHHB 4WU5A 5DQDH 4X6DF 1TFHA 3V8CA 4LKCA 3X13A 1TMCB 2J1KA 2CDEB 1F4AA 3T77B 4ZSOB 1OTUD 1ZANH 3PHSA 1QHPA 3HNVL 1RMFL 3UTSA 4ZUSB 1YYMH 1VACB 3T0VA 2FYYA 4Q6IA 3V7AE 1EZVX 1SYSA 4PR5A 1ZK9A 2MHAB 4CBPA 2VJXA 3CFBA 1DVFC 4TSAH 4PRAA 2R9HD 4GBXB 2HT4C 2F53D 3QIWD 4LNRA 4RWHA 4PJ9C 5EFIB 3U9PH 3F5WB 4F9LC 5GGTL 3MCKB 1TVDA 3MOAL 2EYSB 5C08B 3FONA 3L5WB 1RUAL 4GLRH 2GCYA 5EU6A 4NJ9H 4I9WD 3S36L 3GJEB 1UH3A 1YMHA 1KYOJ 5CINH 1LO2L 3DV6B 5MEND 1CD1A 1OCWL 5KSAA 2C3VB 4OF6A 4XPGL 1LEGA 2P5WE 2FGZA 4UIMB 3F58L 1ACYH 1KFAH 3FT4B 3FFCE 4EDXA 1HHIB 1YQVH 4ELME 4G3YL 2BNQD 2CDGB 3HMWH 3QUXD 5ANMB 5TQ2H 1P6FA 1I1FA 2OQJA 3BPOC 1KJ2H 5HY9A 5IF0A 1PFCA 4J3WA 3EBAA 1ZVHA 4KXZI 1RUPL 4NKIH 2V7HB 1MI5E 4ZS6D 1VB9A 4ZNCD 5DEFA 3DV4A 1A0QL 3ME0A 4L3CA 2JE8A 5INCB 2XA8H 3HC4H 4P4KB 1BVZA 3O3AB 4MNHB 2NY3B 3K1KC 1I9RH 3PG2A 1MJ8H 4JG1L 5DRZA 1A9BA 3JWDL 4WEBH 1JPGA 3CSYB 3MJ9A 4OGXH 3I6GB 1H9VA 3LKOA 1QFPA 5H94A 1DQQB 4U6XA 4WW2C 3MA7A 4H8WL 4GAGH 3V5HA 5HDBE 4Z0XA 2CJUL 4P2QB 4HS6B 3FO0H 3PE9A 4GO6B 1JF6A 2X70B 3U9UA 1KPUB 2E9IA 2RQ8A 5I19H 3GBMH 4JGUA 1A7PH 3KNBA 4FFYH 4ALAH 1AHWA 4PLNC 1BQHG 1N59B 2J88H 5FDYA 1TTFA 1RZKL 3FQXB 4JHWH 4PTTA 2R0LH 5I76A 2HWZH 5GS1A 3D3VD 1IFHL 4KRPB 3FRPG 1I8KB 2VDLH 1CXEA 3TZVC 2XKNB 4MJ6B 1YPZA 4LMQI 3VFOB 5FA3B 4OCSH 4PBWD 1RY7B 2WWKT 2Z8SA 1UB6B 2IPKB 3O6FB 1DUZB 3EKCA 3D18A 4WHDA 4FQ1H 3QEUA 4O5LH 4P46B 1BGXH 1RK0A 1TPXC 1I8MA 3TV3L 1S9YB 3RVXC 2GSIB 3Q0HA 2GTZA 1MCKA 5E0QA 3U4BL 1NSNH 1ZHLB 4NBYB 4QNPF 2QSCL 2A6JB 1LEIA 4B53A 4NCDA 4L4VB 2FWOB 1OAQL 2H26A 3U36B 2GJ6B 5MI0B 3AS2A 2NPLX 5AZEL 2Y5TB 2CXKA 5F6IB 5D96B 3C5JB 3C08L 1GZQB 4Y7MA 4Y4HC 5D7LE 3QHZL 3U46B 4QF1A 5K9KA 1EUUA 5KBNC 4EQ3A 4D9RD 1FFPA 3KPRB 4OGYH 3BMWA 1KGCE 4NN6B 3UDWA 3OGCB 5GHWH 3F7YB 3CVHB 3MOQA 4NKMA 5JXED 4XP9L 5BRZD 4DEPC 5EBWA 3TBTB 3KR3L 3PDGA 2P8LB 3KDMB 1UACL 1YEDA 2QV2A 5MEPB 3TNNA 2GTWA 1MHPH 1CL7H 4KAQH 3MFFA 4KUCF 1FL5B 3WIIH 4NQED 1Q9KA 2OSLA 4XB8A 5IHZB 3LEXA 4MXVE 1T22A 3O0RL 4L8CA 2OZ4A 5I1AA 3HZVA 2PNDA 2APWA 1DBMH 1FCGA 1XMWA 5HPMA 4PJFA 4A6YL 4XCYB 4QRRB 1OD9A 4WHYH 1N5YH 5HYJE 4RISL 3QJHB 2XIDA 2Y7QA 5SWZD 4G80A 4PJDB 5DR5H 4NQXA 1C08B 4OTXL 1XGPB 3ZKMC 2EYRA 3GSWA 1ONQB 3IJYB 3ET9F 4CN6A 2IFFL 3ARXA 1FPTH 3N1QC 3RWIB 2NY7L 1P5VA 3G5XB 3MRQB 1JGDA 1TZGL 1JN6B 2E7LA 1INQB 2Z4QB 4EN3A 2Q76A 1RJZA 1U8KB 3PGDA 4JGJA 2FX9H 3THMH 3STLB 4U1HA 1PZ5A 4UDUB 5C08D 3GSNL 1N64L 4L9LA 5KN5B 1BLNB 2ZG1A 1OB1A 1MCPL 2HYMA 4XVJH 3UYOD 1UFUA 3QG6B 4Z5RA 4LAQH 1NFIA 4KQ4H 4PYHA 1J0YA 5F1SA 4U6YA 1J10A 5CSZA 2PUQT 1I4FA 3DUSB 5I30L 2BMKA 2MOVA 3IDIB 5EU6E 3V4VH 5KAQF 3VD7A 2DICA 4PFEA 2NXYC 1TJIH 2XKUA 4UT6L 1HQ4A 3O6KH 1NGYB 4P2CG 2DQEL 2V9RA 4XC1L 4LVOC 3GMPA 3KPQA 4K3EL 3ES6B 3MUGA 5GIRA 4XNXL 4HKZA 4PJHF 4OFYD 1S78C 4NM4L 1X9QA 3G6JF 5ENWB 3REVB 3QQ3B 4ZUVA 1MQKH 4ODSH 2UWEE 4JPKH 5F89B 4D9LH 4YDLB 3CLEH 4MX7A 5B39G 5JW4R 4KPHL 5EG6C 5ERWA 5DJ0A 1OAYH 2ZSWB 4X9GA 3IB4A 1Q9OA 3O9WC 2NY3D 1BFOB 1QSEB 3E8UL 5IKCB 5L0QB 5EORH 3W82A 4L3EA 5JW4M 2J4WH 4XPHL 1VADB 4PJ7F 5I6XC 2ADGB 3D69A 3T09A 1MCSA 1NCCL 3HPLB 2E27H 1ZT7A 1JZ2A 2CD0A 3RWFA 2W1NA 3QHTC 2CK0H 5B4MD 4QRSA 4ENED 4LF3A 1T0MB 4NKDB 5GZND 1U92A 3ZDYE 5IROC 4GKSB 5CEXA 2VXSH 1FNGA 4BFEA 3FMGL 1RURL 3DX7B 1KIQA 3S8WA 3SDYL 3KS0J 1E6OH 3UTQA 3R8QA 2DBLL 4PGBA 2Q7NA 3VE0A 4WO4A 3QAZB 1HH9A 4QTIL 3NH7L 2BY2A 4RRPA 5JLZA 4KRPD 1R3KA 1YY8B 4JEGB 3W2DH 2I60H 4JKPL 2OYPA 4OD2A 1BOGA 4BH7B 1F4YH 3MJ9H 1OSZB 4E42A 2DQUH 1QRNA 1I7TA 5IB1B 1AIFB 3GGWB 5D71H 4KI5C 1NCBH 1L7IH 1NGPH 4Q0XH 1T83C 1JFQL 4ODHL 1S9WB 1MHHA 4L4VD 4OCWL 3L7FB 1OF2B 3CUPB 4UIKL 5D7JD 1C16B 3UTTE 3FB5A 4ZDHA 2MQ0A 5FUCE 3V2AR 2AJUH 2XZCH 4LVHC 1JK8B 4IDLA 3B9KB 4LPWA 3OF6D 3B6SA 4P2RA 4QHUA 3QXAA 3UJTL 1YNTA 3FL7A 3H9SB 1CICD 3LD8C 1QSFA 2A6IA 1SY6L 1CDUA 3BZDA 3JV5A 1HN1A 5C0RL 2I07B 1IE5A 5D2NB 1URLA 3AB0B 3MXWL 4HJGB 5BW7A 2I9TA 4IRJA 2ZCHL 1XCTA 1H5BA 4GAJL 3RTQC 2XPGA 2P8MA 1UA6H 3PJSB 4ODUB 3ARDC 4QRRD 4YH6A 2LU3A 3MGTB 3VDBA 4K8RH 1MCOL 5DEGA 3RWJB 4GRLB 3DTXB 1T20A 4EQ2A 1IM9A 4PGEA 1IQWH 2AV1A 3HZMA 5EZOH 1DVFA 3O45A 5EO9B 2H32A 4RGOH 2W9EL 4XPAL 4K7PH 4N90E 2P24B 1HXYA 3CFDB 4F9LA 5ITBH 4YHYC 4E0RB 4OCYH 1LE9B 4AM0A 3QA3A 1B3JA 5DUBB 2UV3A 3DVNA 3BEWB 4OZFB 3V6ZA 2OZ4H 4FQIL 3PHOB 5HDQH 3MV8D 2C3WA 4PGCB 1BECA 4GSDL 3PXHA 1ZTXH 4GMSL 2ZCKL 4LCWB 5CP7B 5DQJA 4J12A 2X89A 3VFUB 3EGSB 4XXDB 4L9DA 5FYJD 3RNKB 1NC4B 3V0VB 1MFAL 1ZT1A 3TT3H 3T2NL 4MB3A 2D03H 3TO2A 1OPGL 4K07A 1RFDL 1MCHA 3FOLB 1N8ZA 5ADPL 2CKBA 3ARPA 4NUGH 1JBJA 1MY5A 1INEL 1MAJA 3BZFB 4F7TA 1BZQK 2VABA 4WW1A 2DTML 3BO8A 1CF8H 1YN7A 1XF5A 3HG1D 1MLCB 1RZ8B 3UC0L 4N8CL 2WIIB 4HKBB 4ORGA 5F3BB 2DD8H 4K7FB 1QBLH 2R1WA 5DMKA 1TQBC 5KSUB 4K3JH 1MJJB 4NBXB 4PJXB 3ZYJA 4KJPC 4LLWA 1R3JA 3M17A 1OGAB 2HTLC 4XP1L 2DWDB 1KPRB 3DYPA 4M61B 4OF3A 2WQ8A 3PQYD 1MRFH 3JUZA 1BBJB 4GW4A 1FGVH 2EICA 1Q72H 3LPGA 1XGYH 1NCTA 3V95A 3FO1A 3X17A 2HJFB 4HUNB 4PS4H 3VFGL 3BXNB 4H0GA 4TTGA 4Q7DA 3O6LH 1RZJC 2X40A 4JFDE 2IADB 4XP4H 4MJIA 3MXVL 3QYCA 3HN3A 2FGWL 4WRLA 2QR0B 4QRPE 3TZVA 1CIDA 1F3JA 3VRIA 1JNLH 3MOBH 5EOQL 1A21A 2VE6A 3QCVL 2Q8BH 2BY1A 5SV3A 5FDWB 4BUHA 1PLGH 3GB7B 4FQXC 5J1TC 4H5SB 4U1MA 3VXNA 5TFSL 4EZMA 4LVNC 2APBA 1F8TL 3DIFB 5EPMB 1P7HL 2A6KA 4PJDF 2LU7A 3U4EA 4GKNB 4MDJB 3G08A 1PJ9A 3IJHA 4HWBA 1DBJH 4PRPB 2ZUUA 1N4XH 4U2ZA 3VI3F 4CMHC 4D0BA 2R1XB 3MLYL 4NO5A 4Y4HA 5C0JB 4NNXA 4H88H 3QUZB 1VGEL 2H9GA 4OLEA 5I8CA 2IJ0C 1TVHA 4LLYB 4S1DC 3BZ4B 5EIIB 3KGRA 1XGTA 1QFUL 1XGQB 4JRYA 4U1GC 5F7HA 3QFJB 4POUB 2B4CL 2V2WB 4XHJC 1KCVL 4F15B 1HSAA 2SEBB 5IHUH 1T4KB 5DD3H 1JHTA 2AXFA 4JHZA 1ZS8B 2A77H 4KKBC 5SX4H 3RGVB 3DNKA 2W91A 3H9SD 4J6RH 5FO7A 5T3XL 3B9DA 1VPOL 2WW8A 5JR1L 1HHHA 3SDCB 2NY4B 4LQFH 1HSBB 1EGJL 1H15B 3U48A 2FR4A 5E9DA 3RZCA 4P2RE 1RD6A 1QQDB 1JTPA 3V79C 1ORSB 2N1KA 2X4TA 1QSFE 2KBGA 2WUCL 4LEOB 1MVUB 3MRNB 1QOKA 1A6UL 3HC3L 4AG4H 4JFFB 3MRCB 4ETQB 3MJ7B 3QUMB 5IW6B 2EZ0C 2Z92A 1MCQA 3QIUC 4P23B 5KVGH 1MCWW 3DURB 3HS0A 1S7WB 3MLSL 4ZAKD 5C9JA 1XIWA 4NOBA 2DQJL 5JPMB 4U1IA 2UY6A 1IGJA 5GZOC 1CWVA 4KMTL 1S3KH 3KXFB 3PWNB 2OK0H 3BKYH 1U3HC 4PB9H 1N0XL 1FH5H 4LSVL 3RP1A 3TA3C 5C0IB 5K9JH 3ZDXE 3GFUA 1ZA6B 1PG7W 1UCBL 4QCIB 4Y5XB 2ICWB 2FEDD 4HIJA 4YWGL 5TE4L 4LEXH 5E2TL 1E4XI 1X5HA 1U8PA 4WCYL 1AD9A 3SN6N 2RJMA 1FYTB 1T5XB 3LQZA 4WUUA 2DMBA 4OAWA 1FVEA 1NC4D 1KIPB 1FZOA 4QGTA 5BV7L 1G7LA 3D5OF 1LO0H 5MEOA 4ZFOL 2H32H 1P2CB 1D5XB 1ZVSA 4ZUUB 5F7FA 3VRLE 1Z5LA 2PXYC 4XX1G 2JJUA 4KZEH 4HDIA 3CVIL 2CRYA 4HGWB 4X6FA 4BQBA 1BOYA 3RKDC 1BAFH 5HGBA 2C3HA 3O9WA 4L29A 1E4KA 1UJ3C 4DGVL 5DYOB 3L5XH 4OIIL 4OM0L 4JFOB 4LAJH 2RBLA 5I9QC 5TF1L 4NFCA 5FYKE 2IMNA 3NGBC 1HH6B 1BVLB 4HHAB 4I3SH 2GSGB 1QACA 1OGAD 4BYHA 3E1F1 4I3RL 3QI9C 2DMKA 4QOKA 3RUGB 1BPVA 4XPFH 3TT1L 2EDWA 4G9FB 4U6VL 5DK0B 3MV9B 2B1AL 1NUGA 3NA9H 1HHKB 1TJHL 1A7NH 4DZ8A 4P5MB 1JGLH 2E9JA 4HK3N 4M1CD 1B9ZA 1U8QB 2I24N 3ULUC 3MMEA 1TZHB 4XBEH 1KCUH 1R5IB 2YMXL 2GUOB 2GITA 2ATPA 2DLHA 4JDVA 1OGTB 1PG7H 3G9AB 4MJIE 3QCUH 1E4XL 4NO0A 3GEWB 3B9EA 2OP4L 4LHQB 4P9MH 4YIQB 1WZLA 4TRPL 5CMAB 1UZ6F 1IGFL 1ES0A 4EKXA 1LILA 4PRPD 4CNIB 1O0VA 2VDPL 4V2BA 2FZ3A 5JNYA 2OTPA 5DJAA 4GAFB 4PB0H 3C60A 3V9FA 2R2BB 4KKCC 1I8LC 3QUZD 4UU9B 4AT6B 4YX2H 2M2DA 3PUCA 4RGND 4AMKL 2ZOKB 4XRCA 1FNLA 4S1QH 5F6HJ 1FFNA 5BJTA 1QD0A 2FH6A 3MBEA 3VXMB 3ZTNH 1PX4A 4NO2A 3WLWD 3GNML 4PRDB 2KQNA 5IB3A 1O5DT 1KJ2B 4GMTL 1JWSA 3O2VH 4JRYE 5JHLL 1GJIA 5EZIL 1FJ1B 4OLZH 4O51A 5DI8B 2IQ9L 3BHBA 2NY4D 4Q9RH 5IEKB 2EDLA 1T2XA 4HWBH 4PBVC 3W39B 4P2OB 2D7PA 5DTFA 2HKHL 4JZJA 3WLBA 3ARDA 2P5WB 2Y06H 4FQJL 3FFCB 3TWCL 1KCKA 4ELMB 4JFFD 2UYLB 4C4KO 4ODTL 5FF6B 5E9DE 3MREB 1UXWA 4ZFGH 3WFEL 1RJLA 1BBDL 4P23D 4TVPE 2APFA 3MLZL 4OBRA 4DW2L 1CDCA 1H3PH 1MI5B 1NMAH 2MJWA 3IXAB 1ACZA 1HYSC 2DKSA 2JIXA 2VQ1A 3KPNB 4JQXC 2Y07H 3ARFB 4XI5C 4ODWB 2AV7B 3KXFD 4NC2B 4YHZL 4PJXF 3WUWA 4LBEA 2CO7B 3NIFE 5TDPA 2DQCH 1GYAA 1SQ2N 4MAUL 1YEFL 2YC1A 4A6YA 2ZP0T 2QTEA 4XMKL 1FVCB 4F7CB 2VLRD 1DBBL 1NGZA 4V1DA 2FJGA 4YAQB 3WKMH 4M5YH 3MRJA 4MQXC 5D7IE 5C86A 1T03L 4PJIA 4TVPH 5FOJA 4M5ZL 3DRQB 1A4KB 1KEML 2EXYC 1FYTD 5C7XH 4RAUA 3UZQA 2FX8H 3F12A 3AS3A 4K94C 3VXTB 4EUPA 3T04D 5HSFA 4MQ7A 5J9PA 2P5EA 1IGIH 5DJ8A 2ESVA 4WUUE 3RL2A 5ADOH 4NPYA 2QHRH 4M48H 4R97C 4K7PX 5DMGD 2AVGA 3GSNA 4MQSB 5D1XB 4MAYB 4M9OA 3T8XA 1B2WH 1TXKA 1D6EA 1UH2A 5EC1A 2PKDA 4RAHA 2PO6B 3AMKA 3V8OA 3MGOA 2DJSA 4RBPH 3HNVH 1RMFH 4MD4A 3LQAL 4HV8B 4JQIL 2Q8AL 4QYOB 4ZNEE 5DJ2A 4PRNB 4JKLA 2ICWJ 5HJ3B 3IYLW 1A6ZA 1N5AA 5J8OA 4TUOA 3OAUL 5BV7C 2R4RL 4M1DH 2HMIC 2WBJC 4X98B 3JTTA 4EDWL 5DC4B 1MFDL 1OSPL 1EBAA 2K3TA 4G9FD 2WWMC 2FBOJ 8FABA 1JL8A 1P7QA 2OI9B 4JM4L 1JZ8A 5D7LB 1RUAH 4QOKE 2YZ8A 4NFBA 4DTGL 5LG1A 5I1KL 4HWZB 3STBA 3S36H 3IETB 1BZ7A 5J6HB 3EYQC 1FL3A 3SE3C 1OCWH 5IR1B 4HUXA 1PDKA 3AAZB 1KACB 4XPGH 1WWWX 4ZD3L 2JKXA 1I1AA 3F58H 1J11A 2X4OB 4F3FA 3OXRA 2ATKA 1U8IB 4G3YH 4DCQA 3AU1A 2A1WL 3C09B 4KI1A 3IAGC 4MS8C 1T7VA 1T2QH 4DKEH 1IMHC 5GRWA 1H3UA 4IHOA 5AD0A 3L1OL 3MCLL 4FXGB 1RUPH 3EDDA 5HHOA 3P77B 2RGSA 4QRTA 4JFPA 1OOAA 5HYJB 2V2XB 3QO1B 4KI5E 1A0QH 3LCYA 2W0FA 3HI1A 4JGMA 4WU5B 5LBSL 4LKCB 3X13B 4FTVA 3AREC 3EYVB 1VEOA 4JG1H 2G5BA 3UTSB 1FFQA 1AFVL 2FYYB 4Q6IB 5SX5H 2Q3ZA 5CZXD 4HKXB 1DDHB 1SYSB 4PR5B 1LE5A 5FECA 4EOWL 3CFBB 3W0WA 5DVOA 1YJDC 3W9DA 4PRAB 4H8WH 4UV7L 4GAYA 2CJUH 4LNRB 3QCTH 3MUZ1 4OZGA 2X7LA 1PEZA 4Z9KB 2XYCA 1IZKA 5HHMB 1CFVL 4P2OD 4N0UE 4Z6AT 3FONB 4JANA 5GGSA 2GCYB 1LEKA 1CR9H 2P5WD 5EU6B 1G6RL 2NYYC 3FFCD 3IF1A 1WTLA 3ROLA 1YMHB 5I71C 5E70A 1IGCL 3AXLA 1Z3GL 1CD1B 4JHAH 3SGDI 3ZYZA 4PV9A 5KSAB 1LD9A 3SGJC 1UZ8A 1IFHH 2YBRA 3UZVB 4NGHH 1UWEL 2Z93A 4ZFZA 4EDXB 4PD4K 1OHQA 1MI5D 2HT3D 1SY6A 4TYUA 1DLHA 2OQJB 4QRQB 5HY9B 2UWEB 3MV11 5IF0B 2NCMA 1U36A 4G43A 5BOPA 5TH2A 4PRHA 4BUGA 1F4WL 2M8XA 1AI1L 3TV3H 1E4WL 2R23A 4OUUA 5I1CL 1UT9A 4Z8FL 3U4BH 5DEFB 2QSCH 3X3FL 3DV4B 1U8JA 1OAQH 4L3CB 3V52L 2B5IB 2DIJA 3RUGF 1CLOL 4KXZH 4NWUH 5AZEH 1XF2A 2XA3A 3C08H 3FOMB 3QHZH 1MRDH 3MX0A 3SDXE 1IKFL 4NNYA 5DRZB 1QZ1A 1A9BB 1I7RA 1INDL 1BQHA 1JPGB 3OKLA 4PJIE 2E6QA 1AC0A 3EZ8A 4WWID 5F9OL 2H6PA 2PXYA 2H8PB 1QO3A 3KR3H 3ILPB 1KLUB 3LKOB 4P59L 1FE8L 4U6XB 1CVRA 3VXSD 5M7QA 3MA7B 2AJXL 5EBGA 4Z0XB 3O0RH 1MCRA 2OXGA 5CS7A 5D1XD 2ESVE 4MAYD 3NABL 1C1EL 4NQDA 2NY5L 3VWJA 3IDUA 4A6YH 2HG5A 5KTEL 1JYNA 2W9LA 3IKKA 3UCRA 4N9OB 4BK4A 4RISH 2F54A 2PO6D 3PHQA 3KNBB 3QXDA 4OTXH 5IVZA 2DIBA 4HJ0D 4PTTB 5I76B 2H2SD 3P9MA 3QI9A 4HK3J 2IFFH 3SGEI 2NY7H 5FK9A 3GBNL 1YPZB 2NZ9D 4EUPH 43C9A 1TZGH 4FA8A 1SEQL 5GS0L 3D18B 5K9QG 4NUJA 3H6JA 3GDBA 3QEUB 3EZJB 5ISZE 1RK0B 1I8MB 3UTTB 5JQ6L 5D7LD 3GSNH 2GTZB 1P7KA 4WI2A 1AXIB