3JV6A

Crystal structure of the dimerization domains p52 and relb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
TSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription factor RelB
total genus 16
structure length 101
sequence length 101
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv6A00
2AXGA 3GSWA 2AK4E 1NH6A 1ZS8B 1JGVL 5TPWL 4JO1H 3PP4L 2KUTA 4X9IA 1RZGA 5IMOB 1OGTA 1AGFA 3ULUD 4DGIL 3W11C 3EDKA 3U9PH 5BRZB 3VXPB 3FKUS 5BXFA 1WF5A 4YPGB 3S37H 1E0OB 1CD9B 1RZIB 4GLRH 4U6VL 4HPOL 1RFDH 3RZCB 2YD5A 1MFEL 4WRLA 4D9RD 1G7MA 5FB8A 4P5MA 3PQYB 3CSGA 5E08H 3TIDA 2BOBB 4S1SH 4YHZH 3VI4F 4I8DA 3C6LB 4X4MA 3BHBA 3I50L 3QYCA 5D71L 1V7MH 2Z8SA 2ZUWA 3O8XB 4F9PC 5IWLC 1FGNL 3RGHA 4MJ5A 3HI5H 5CILH 5C0FB 2J5LB 2ZUVA 4LRNL 4LFHD 4BQBA 5AG8A 4G3YH 4LSSH 2F54A 5KAQG 1YEJH 3I02A 5JHDA 1JNNL 3HZMA 2P8MB 3OXRB 3QFJA 3MCKA 2V2TA 3LKQA 4K7PY 2LFGA 3CVHL 1ZLSL 4WUUA 4NPYB 2ZUUA 5EOCJ 4R90H 5GGQL 5C07A 2VB5A 3MJ9H 5M7QA 1IT9H 1U8KB 2EDNA 5HHVH 1I7TA 5IB2B 4GKNA 3MGTA 4HLZH 3DRTA 4WEMB 1K3ZA 2O5YL 1R3JB 2VSCA 1YEHL 1H0DA 2FATL 4HHAA 3F65A 4GBXB 2OQJA 1FSKB 5JW3H 4GUPB 3DX6A 4XCYA 2WMPA 3HB3C 1UKQA 4OCWH 5BMFH 3QXDA 5D7JB 1GPOL 1WZMA 1FN4B 1UM4H 1HHIA 1R5VA 4FFYL 5HJ3A 4NHUA 1IC7L 1A14L 4L8SB 1T0PB 1IGFL 2XKNA 3ZLQC 2X9YA 5IQ7L 2FX8L 5K9KA 1F6LL 2VR5A 4QHKJ 4DGYL 2HN7B 2VZUA 4OM0H 4CVWA 4OZIE 4LVEA 3ESUF 1EIBA 5DJYA 1BQLH 3SDXA 2M1KA 4G6KH 3QEQB 3NIDF 1HWGB 3UAJC 3IDXL 3M1BA 3CGTA 2YSSB 5DD1H 1RPQA 4WWKC 5C92A 3KAAA 2RBLA 3EYFA 4XC1L 3O9WD 1BAFH 3H9SD 3PWNB 1EBAA 5T1DL 1GIGL 3MV9B 4IMKC 4OD2B 4F8QA 5IK3B 2BZDA 1CGSH 4MWFA 4K3JH 4XP6H 3SKJH 4PJ5E 5GGUA 1EK3A 4Z5RA 5L9DL 2ZPKL 4N8VA 2NR6D 1R0AL 4O58L 4BZYA 3CVHB 3CDCA 2AEPH 1EMTL 1YUHA 1DBML 3LPWA 3KPPB 1GYAA 1TTFA 1NBZB 5CJQH 5ENWA 1JF6A 4PJXB 3P4NA 3WS6C 3WEXA 2ERJB 3JBG7 2I07B 1S3KL 1PX3A 3VH8G 4POUB 1KN4H 2Q1EA 3NCBB 3KPOB 5SWSE 4NQEB 5C0RL 5JHDD 1S5IL 2CRMA 3HI6H 4NO3B 4PJHE 1OP3K 3KLHD 4J6RL 1OT1A 2P8LB 4UUJB 5I2IA 1KT2A 1Q0YL 4BK4A 2NY6C 2OQJB 1MCIA 3DX6B 4PGZA 3ZHKA 3IFLH 1X4YA 4L3CB 5SX5K 2VLJD 1J0ZA 3WIIL 6FABL 3MNWA 4PJ7A 1HQ4B 1JPTL 5HYJD 4HUKB 3NAAL 2X4UB 3L7EB 1I1CA 3TPUB 3VXSE 2VH5L 4XXCC 3IGAB 4J7RA 5F6HI 4YDLC 1U58A 2KL6A 1MQKH 3CFDB 2XXMB 3MA9H 3V5DB 8CGTA 4JCLA 4NP4L 5GZNC 3BSZL 1BD2A 4Y2OA 3FO9A 3PDOA 4FFVD 4NQCB 4Z7UB 5EFIB 2W60A 5F1NA 3CZJA 3WIHH 1OARL 3S4SG 3BH8B 1A3LH 1A21A 3RVWC 1X6NA 2VISA 5DFVC 2G5BA 1FSKC 2JB6B 4R2GC 2BY2A 1QP1A 4WI5A 5F9OL 3MV9A 3ARDD 3EOBB 3ZYJA 1OPGL 2DQHL 4X5XB 1Q8MA 2YXMA 5ADPL 1BECA 3O3BB 1RHHB 4AY0A 2XZCL 3BEVB 5MEND 1WFTA 4FXLA 2FD6L 4ZTOL 1BFOB 4GRLA 5AG9A 3RZCA 4YWGL 3RWIA 5KVFH 4M1GH 1CDIA 3HZYB 1Z9MA 4U1IA 1IGCH 1FC2D 2AEQL 2IF7A 3MOAL 5C0EA 2DYPD 4JR9L 5LGHH 4MQ7B 4NQDA 3WS3A 4G43B 3MJ8A 2ZUYA 4XB8A 1IKFH 5HYJA 1KJ2A 3WIFA 3I3BA 3BKYH 3BE1H 4Q6IA 3FFDB 5DXWA 3BXNA 3K80A 1DCLA 2EC8A 4BELD 4XP5H 3C08H 3KJ4B 3RJQB 4LLYA 3B4NA 3ARGB 3PWUA 2W0FB 1EXUB 1S78C 4GBXA 2APFA 2X2YA 1PEWA 3GMOB 5EU6A 1BD2D 4XP1L 3JV4A 5LGJA 4PD4J 1E4WL 4P2RE 5DUPH 1M4KA 3RVXC 3EHBD 1DN2A 1G6RH 3VFPB 4QHNB 1ERNA 2CDGB 3TO4B 5HYEA 4MVBC 3BPCB 4X6FB 1JE6A 5KN5A 2C1OA 4KH2A 3VXRB 1ZVYA 5HI5C 3EO0B 3ARBC 3BP5B 4KQ3L 1MFEH 1CDBA 2IQ9L 1ES0A 3SCMC 5I75B 1ETZA 1UKSA 4DQOL 4JGUA 2AJYH 1YY8A 1I9EA 4WU7B 4WUKH 2HKFH 1T6WA 4XCEA 1WSST 2VISB 3QDAA 3MUY1 3O6ML 3VMPA 1U8IB 4AEFA 5TE6H 1YEFL 4Q9BA 5SWZB 5SX4H 1NQBA 4FXKA 1QLRB 3JV6A 4X7SH 4D3CH 1MSPA 3AMLA 3WSQL 1D5ZA 2CJUH 2QKIB 2FJHB 1LGVA 5AD0B 1IMHC 1NFIB 1P9MA 5CCKH 2VDNH 4DUWA 4K9EH 5L0QB 2HTKC 4FQXB 2VLKD 1I7TB 5IB2A 1N64L 3RVVD 5DI8B 3NCEB 1KV3A 3FCTB 4XWOC 1JHKH 4EDXA 2HKHH 4PJGB 4JZNA 2N56A 3RGVA 3KG5A 2GTWA 2I07A 1PBYA 2M2DA 3GKWH 1K4CB 3FN0H 2CKBH 2V7NB 3N1PC 4NCDA 1QVOB 1T5WB 1MCJA 5JW3L 3DHMA 4JFEA 5E9DB 3BIBX 4OJFL 1YYLL 3BKML 3C6LD 3BPOB 1CICD 1JWSB 4LLWA 3A6BH 1KSRA 4WI7A 5KANG 3AREC 5EZJB 1QSZA 3EDJA 4XP4H 4BQCA 1NKRA 1J0KA 4O2CA 3LV3A 2DS4A 4PY7A 2VOTA 3T1FA 4WFGE 4ZNEA 5EULV 5JA9A 2XNAB 3DHJA 4JFEE 4K3EL 5I1HL 1FO0H 3EYVA 3VFRB 3EBAA 3VG0H 3QQ9C 2NYYD 1PDKA 4WV1C 4WFGD 5C0NC 4OCYL 4MNGA 4HHAB 4HCRL 2ZOKB 2E27H 4XC1H 5FK9B 3BP4B 3CMGA 1CFBA 3KDMA 5A2IH 3QXDB 5CJOH 3S6CA 5I74B 1KXQE 5D7JA 1D6EA 2ATPA 3WO3B 1G0DA 4PJXA 3B9KA 5ALBH 3TZVC 3D39A 1U8PA 3SDXF 1S7WB 2EDBA 1DN0A 4JFXA 4NFCA 3RTQD 4H8WC 4RAHA 4NC0B 3SDCB 1KTDA 1AHWB 1IGJA 4PJAE 5DS8B 3TJEL 2ERJC 1F3DJ 4PLKD 3O8XA 4NOFA 1L4IA 3KLSA 3EOYG 3QHFL 4XNYH 4KQ4L 1L6ZA 3VXUE 1UT9A 5HYQA 1JPFA 4X6DF 1ZA6A 4HIJA 1FZKA 4PS4L 3H7BB 3HAEA 4ELKB 1F02I 1YNKL 4JFED 2W9EH 4ZYKA 4UNTA 2NY7H 4E5XA 4PPTA 1L9NA 1IEAB 2OXGA 3RY6A 2B7DT 1GJIA 2EE3A 2LVEA 1BFSA 1C5DB 3X11B 1MFDL 4B7IA 4R4BA 2Z35A 2D7TL 1PKOA 5D7SH 3O9WB 4QHUB 5IGXH 4S11A 4QRQA 3UZEA 3WDHA 5I1AA 4P46C 4MXWL 4PJEE 3HI5L 1JWMA 4R7DA 5HVFB 4LBEA 2RIKA 5F3BA 2XN9E 1JF1B 4G42A 4ODWB 1DJSA 2ZUXA 1NCCH 2H1PL 1IBGL 3T0EA 5IVOA 4O2FB 4UNVA 3VRIA 1Y6KR 5HVWA 2QV2A 4ZUTB 5H8DA 3U30C 5IGXL 5HJ3B 2XTJC 4M7JH 4X6BA 4OFYA 2NY2B 1PEZA 3D3VA 2XICA 2R1WB 5EUKA 1RUKL 3VGBA 4UZGA 1HH6B 4YFLF 5FCUH 3Q2CA 3DUSB 3PDDA 3GBLA 4YK4B 5DJYB 1I1FA 3OG6B 3NFSL 4FXKB 4Y0GA 4YFDB 5I1CH 2X4UA 1TCRB 5C08D 3PL6D 1JVKA 1RVFL 1JYNA 1JBJA 4Y16B 3KPSA 4H1LB 2VZ1A 1U9KA 4OD2A 2EIDA 2IANA 4KKAC 5MP6H 1G7PB 2FX8H 1RUKH 3MLXL 1EEYA 4QXTA 4M7JL 4ZFZB 2G2RA 1U8QB 3MRBB 2WIMA 3UDWA 1OM3H 1U95A 3BE1L 1EERB 3SDDC 1DLFL 2DLFL 5E6YA 3TC9A 5C71A 3QEHA 2ADJB 2HTLC 2BC4A 3WBDA 2X4QB 2LVCA 4NDMA 1JHLH 1ZK9A 4LASH 1LK2A 1NAKL 4QHNA 4MB3A 4TSBL 3E6FA 3QUZC 3GRWL 1CFQB 5F1IA 4MJ6A 4Q9RL 1B2WL 4Z7UF 1MAKA 4AYFA 4JRYA 1AY1L 3BP5A 3SGEI 1HDMB 4HUUB 3UTTE 3W81A 5FECB 2CXGA 1BJ1H 4WUUE 5C07E 3V95A 2WBJB 4HWNA 4KXZI 2V9TA 1FFNA 3O6LL 4X4ZA 2XQYK 3CFKB 1BIHA 3BKJH 3MRQA 3S5LB 2IH3B 1XH3A 4JHWL 4RNRA 4Q9CA 4G6FD 3ARDA 2GW5A 5DEGA 3VRIB 2APBA 2R23A 2PETA 1BVLA 4UQ2B 2VLJE 3Q1SH 4LCCC 5HXMA 5BQ7A 3FRUA 1CL7L 4GKOA 5F7KC 4BFEA 1RJYA 5JTWA 3U9UA 3CLFL 2XG4A 1VGKA 5I0ZA 2WUCH 5E6ZA 4UMGA 2ARJQ 5GGVH 5C9JB 4RMVA 5F7FA 2VABA 1RJLA 1I4FA 1ED3A 2HLAA 5E2WH 3ZYZA 1UJTA 4PRDB 3CSBA 5DJXA 4QRSA 4PJXF 5JNYA 1A0QH 3NACH 4X6DA 3LQMA 3PGFL 3OKOA 1JK8A 5CLWA 4YLQT 4KTYA 4OLVL 1EH9A 1Y18B 5F72S 2ESVD 4JAMA 4M7ZB 2AQ1A 4WEBH 3VDAA 3HE6C 4GBXD 3V9FA 1F97A 2A6KB 1R5WB 3AB0B 5IB4B 3BUTA 4KVCL 1MI5E 4PLJD 1KCKA 3ZTNH 2O26U 4NBZB 4PJ5D 1Q9WA 1RJZB 5DD5H 4TN9A 1YNLH 1DN0B 5DUBA 4RAVA 1KCLA 1DFBH 4IJ3B 4RFNC 2V17L 2DQEH 3F7YA 3W5MA 3PNWA 4XWGH 3WNNA 2PXYC 3REVB 4Z95L 1P84J 2IFFL 1XZ0A 4L8BA 3H7BA 4ELKA 1MWAL 3RFZC 3MODH 4WY7H 1AQDB 5T1DH 5D1XB 4A2LA 2P5EE 2P42B 3OKLB 5LCVH 2QL1A 4I2XB 4BJLA 1O0VA 5IVZB 2MKLC 1T2XA 2LAAA 4JRYE 3DIFA 3B9KD 1H8OA 1T20B 2FIRT 3MLTB 3PWVB 2Z93A 4X4YB 1GCFA 3MRIB 3AAZB 3SGKC 4I77L 5J6GB 1UB6B 1XEDA 2A73B 1XAUA 5EU3B 4J8RA 4XVTL 2WUBH 3CU1A 4ZAKC 4YGAB 3W11D 2PN5A 1A6WL 5GGRY 4O2CB 4HKXB 3LVEA 1X5IA 4P4KC 4KKLD 3IKCA 4WFFD 2VDRL 3SCMA 1A6UH 1B0GA 2EIZA 1FZMB 4HXAL 2I5YL 3T8XA 1B4JH 1J8HA 2HT2C 5DLMH 5L88H 3VA2C 1OGTB 2EC9U 1A9EA 1KUMA 3BPNC 4Y2DB 2B4CL 3LEYH 2PO6A 1JTOA 4JFZH 3RUGE 4OKDA 3BJLA 3IT8D 4YHLL 1U42A 3FO0H 4QF1B 5ISZA 3CFJB 2A1WL 2QQNH 2MTPA 3S37X 5DD3L 3FONA 2VLKE 4G6MH 5DJDB 2BNRD 1FYTD 3FTGA 1K5NA 3GMMA 2IALA 1QYGL 3T4YB 4KK9D 5IQ9A 1S7XB 3OF6A 3SGDI 1FVCA 3WHE0 4LHUD 1BFVL 5TE6L 2QSVA 2FX7L 4LEXL 4OM1L 2XZQH 4WW2B 3SKNA 5JXAH 4OF6A 3QEQE 3TVMB 4HKZA 1QO3B 1XF1A 4FQHA 1MIMH 3EYOA 4RQQB 1T0NA 2ZG2A 4NKMB 1ZHLA 2FX9L 1ZA6B 3HUJF 4M3KB 5C0BD 4CMMA 4EUPB 3UCRA 2F74B 1N64H 5CSGA 3RPIB 4KMLB 4TTDD 5E8OA 1QACA 5EUOA 5BS0E 4WUUB 5C07B 3RX8A 1UA6H 3PGDA 1VEOA 1YJDH 4LLMB 5D1QD 5IEKA 4XCNA 2ZSWB 2C7UA 3CXHK 3X17A 3CFCL 3GMRA 1FP5A 4EQ2A 4NQXB 4AMKL 3UJIH 1U2CA 1EEZA 1P7QB 2PYFA 3HE7B 1S8DA 4GRMB 4OLZH 1S7RB 1SJEA 3RDTC 2DYPB 4RWYL 5BS0A 3I2CL 1YQVL 3OG4B 2XA3A 1PAMA 2VUYA 2FDBP 3M1BB 1IGMH 4RFEB 1RZKH 2VLRA 3BN9D 5DZNA 3ARTA 1OW0A 2ADJA 1TJIL 3UXFA 4WI3A 1MAJA 3F6LA 4R4FH 2YA1A 4J12A 4MCYB 2MOVA 3KJ6H 1QLEH 4XNMA 3SDAD 2F9BT 4R7NA 1TPXB 1FRGH 4JAMB 2XKNB 5JHLL 3ARGD 4MD4A 5AUMB 2X4NB 1RV6X 4RWYH 4X6CF 1VESA 5HGDA 3HTLX 2NY5H 3O6KL 4HDIA 4Y5XB 5D5ME 2ADIA 1E4XL 1RURH 1BJ1J 3Q5OA 2J2ZA 1MJ7L 1I4FB 3HPLB 2OTPA 5IB3A 1G7MB 2LU7A 3LCYA 4P9HL 4LLUA 4C56A 4MNQA 3VXNB 2EEBA 4P49A 1ULVA 2F5BL 1MAML 3TFKC 1H5BC 1F11B 3WLWD 5CIPH 3BKCH 3LSOB 1B0RA 3CSPA 3W82A 1ZV5A 2G9HA 2NNAB 5C08B 3P30H 4MX7B 2WZPD 2DTMH 3S34L 4ONGL 2R1YA 2BVYA 4ONOA 1LP9F 5LQBL 1D5IL 4CVZA 1F4AA 5MENB 3UYRH 3QPQC 3QEHB 1VSCA 3LKNB 4AH2B 2D9QB 4Y5VC 1HI6B 5AZEH 1FO0L 5SWSA 4N8PA 4X4YA 3MUHL 5F1IB 4YAQA 4JRXE 4FZEH 5KOVC 5HYJE 2NXZB 3N1QC 1SEBA 4KRMB 1U36A 3IJHB 5C0EB 4JQXA 3PHQA 3FT4A 1S8DB 4NSKB 4HWUA 2JJSC 1SQ2N 1INDH 2PTVA 2EECA 4S1RH 3DJ9A 3TJHC 4R97C 2X4OA 4HH9A 2IMMA 4U31A 4JGJA 4KDTC 2A6KA 1I3VA 4JFZL 1LEKA 2ITDB 3GHEL 1T20A 3MLTA 4DWHA 2A6DA 2R29H 4K94C 1JZ2A 2JCCA 2NLJA 5D71H 5JW4Q 3VXOA 2C4XA 4R2GD 1U3HC 4POZC 3MLSH 4JREC 5E2VH 1I1YA 1T2QL 1UVQA 2H2PD 5CBAB 2AV7B 4PJDF 1PG7W 3AMKA 5TPWH 2G2RB 3RL1A 3MX0A 2E7HA 2X4TB 4R90L 1NBVH 1OAYL 1MCRA 5FUOH 5JNYB 2PUQT 4YHIA 1U8NB 3VG9B 1NDGB 4L9LB 2BVTA 4S0TD 2XV6B 5BV7H 2IG2L 4HIEA 4HPYL 1DQDL 4HJGA 3LMJL 3WIFB 2NNAA 5C08A 1MCKA 5I30H 2WWKO 4XX1G 1CXEA 1ZKAA 4ZOBA 4P4RA 5L7XL 1H8NA 1LO3L 4MXWH 2FWOB 1QA9B 3HC4H 3CVHA 3ILQC 1R5WA 2LV4A 1XGRB 2O5YH 4Z7QE 3VW3L 3GSQA 3MRFB 4OCXL 1DSFL 3RY5A 4MDJB 4YHZL 4V2CB 1IGYA 1HN1A 3LRGA 5GRZA 2VDQL 1TXKA 3WUWG 2C3VA 4JO2H 1E4KC 3UTSE 4Y88A 2OZ4L 1MJJB 2YKLH 4LIQL 5HVGB 3V0VB 1BZQK 5GRJH 4Z7NF 2FIKB 4G3YL 1G6RA 4CDHA 4AK1A 4XP9L 5DJ6A 4D8PB 2EDWA 5IMKB 3B5HA 5HHOD 1N3NB 5KG9A 5FYKL 3QAZB 1AGDB 1BQLL 4OBSA 5GRYA 3ULUL 3FRUB 4QOKB 2BNRB 4IOFC 5ID0B 5FFLA 5HY9A 1WVZA 3QQ4A 2VLRB 3O6FD 1IAOA 3QA3B 1Q1JH 4RWHA 5GGRA 4KRLB 4NGHL 1MVFA 2BP3A 4K3JL 4HK0B 1ED3B 2HLAB 2EE2A 5JOFB 1AJ7L 4ZO9A 5IESL 4NYLA 2Y06H 2HJLA 4G8EB 4RDQF 1A1MB 5AUMA 4UTBH 4P9HH 4M93B 3ZE1E 1LO4H 1ZEAL 2M8XA 1DL7H 5JDSB 4YZFE 3L3JA 3NBNA 3RWEA 3DTXA 4P2QA 1PLGL 3W0WA 3FFCD 2BSRA 1R24A 2VLLB 3RKDC 3SY0A 4XWOD 3P11H 1TVHA 1QNZH 3QQNA 2F74A 1HYSD 1D6VH 3FOLB 1BHGA 2YRPA 3DX8A 2AI0H 4YDKL 2AV1B 4N1CA 4FMFA 2MCPH 3U30B 4GG6B 3EYSH 3GMQB 4J4PC 4XI5C 3ZDXE 5JPNB 5FYKD 3TEUA 1JNNH 4UT6L 3HE7D 2HH0H 1DEEB 4P5TA 4XMKH 5KSBA 3VXUA 1QKZL 2GJ6D 3C6LC 5ITFB 3U4AA 4YR6A 1ACZA 3NZHL 3ES6A 2GTWB 4DFIA 3OKMB 3JTTA 5CGYC 1QFPA 2Y07H 5GZOD 2PNDA 1ORQA 4IDLA 2V2WB 4WIQA 2DQIL 3MLUL 1GAFH 4HWZA 4GJTB 1AO7A 3HMXH 4FTVE 1XR9A 1BVKB 1PYWA 3BIKB 4RMWA 3WFDH 1UKTA 3T0WA 1KJ2H 4FZ8H 4JFEB 5DJZA 3WN5A 4XPAH 4NQUA 1YPZA 1RQ5A 1MHHA 2AJ3A 4BZ2L 3BT2L 1DFBL 3V4VL 4HW6A 4W6YB 4DK3A 5E99L 4NSKA 2UWEF 5CUSH 4O4YL 3VD3A 1AC0A 5FK9A 4UV4H 3V7MA 3C60A 2DI9A 4XHJD 5EBMB 3KVQA 4P3CH 1DBBL 4LKCB 1N59B 1MCQA 5E9DE 4Q9RH 3M07A 4XRCA 3LKSB 1B0GB 4H20L 5CMAB 1U8HB 4I18C 3CD4A 5CWSB 5IFJA 3HR5A 3INUL 4PJ8B 3VXOB 4XCNB 2O61A 4OZFA 5DHXB 1GC1H 4F33A 4LNRB 4JVPA 3CFIC 4IRJC 3BRGC 3OX8A 5EO0B 1HKLL 2J8UE 3P9MA 2AV7A 5GQBA 1WZLA 3IFPA 1TITA 5D1QB 2NXYC 4JN1H 5IFAH 4I3SL 4V1DB 3DI2B 1BIIB 4GRWB 1MCDA 1JF1A 1TMCB 2B0SL 1Z2KA 3OAYK 3QIUB 4OD3L 3S35H 1VPOL 5LXGH 3BESR 4MX7A 1LO0H 4IEFB 3QUXA 1YEGL 5FYJL 4XVJL 4KUCF 3ULSA 4G9FE 5F9WC 2AJXH 1WUNT 1EAPA 1KIQA 2O5ZH 2ORBH 5DK3A 2NPLX 4U6HA 4GH7B 1NGPH 2F53D 3VMOA 1OGAD 5DQDL 4Y4KD 1GC1L 1CTOA 2FJHA 1F4HA 4A2MA 2NY4C 2BVQA 5DGQA 2IANE 4R4BB 3SKOA 3T09A 3CC5A 4GMSL 4NBXB 3FB8B 2P5WA 5LBSL 5LGKA 1TZHA 1KB5H 4QRRB 1ZLWK 1QFWH 4PLNC 3ZDZF 4JFHE 3ZHLA 3BD5A 2X4PB 3WXWL 4JDZB 4XVJH 3WMSA 4OKVB 4EUPA 1NDGA 4L9LA 5I17A 2C3WA 1DQQA 3KYAA 4U1JB 3WS6A 4PYHA 1NGWB 3L3OA 1DLFH 2A6DB 5I16A 5M95B 4DTGL 1FORH 4MD5A 1XGUB 4OZGF 3QRGH 1S7VB 5EH1A 4C83A 1TFHA 1ZHKA 3BGFC 3IDNB 4G6JH 3KWWA 3DARA 3UMTA 4XBGA 1V5JA 1MLBB 1I1YB 4NM8L 4Z7VF 4KRPC 3JZ7A 3UTZB 2VC2H 4JHAH 1RULL 3ARVA 4QLRA 2C3XA 4JFDA 4NM4L 4JM4L 5L8JB 2A9MH 4H8WL 1I1FB 4M7LL 2V17H 3RRQA 4LCUA 3MLPA 3FN9A 3P73B 4JFFA 1N7ML 3L3IA 2VL5A 3VFRA 1MCHA 1IM3B 4PGCA 4YGVB 3IU3A 1JZ7A 1UACL 4ELME 4YBLB 2FL5B 1S7SA 2V2XB 1JP5A 3FHQA 3DX7B 3Q0HA 4QXGL 1KC5H 1JGEA 3GSOB 1A3LL 4MA1C 4Q9QL 4HUMB 2FR4A 3TZVA 5KVGL 1CZ8L 5I8EA 1KLGB 3BGFB 1ZANL 5HGDB 2VNCA 1WWCA 3MLYL 4LAQL 4NWUL 1WJ3A 5GHWL 1MHPL 5EZIH 4LDOB 3QWQB 4JANB 1NGZA 5MEPA 4C58B 1KC5L 3DVGB 4MDJA 5I15H 5C0IB 5F7EH 3GKWL 1R3KA 2VDPL 3EGSA 4KQ3H 3U9UB 3QDME 3AXLA 5IHUH 2D0GA 5K9KB 2OL3L 5GJTL 3V7AG 1ZWIA 3OXSA 5I1JL 5I75C 1J0IA 1J5OL 1C12B 1G6RB 4RA0C 3STLA 3HMXL 2ZZUT 1NANI 5E1HB 2Z31B 1TVHB 1UCTA 3AC0A 4U1NA 4JFQB 4LSPH 2R1XA 1QBAA 1MHPH 3OKMA 2VMFA 3P4OB 1ZT4B 4P59H 3EOTL 5CIPB 4FQXD 1NCAH 4ZUUA 1K6QL 4LCCB 2R2BB 2XTJE 1X3DA 3O3UN 2BMKB 2DQCL 5GIRB 43C9A 3G6DH 1YPZF 3KPRD 2VZVA 3KXFB 1XF4B 3H3KA 1BX2A 1G0YR 4QRQB 2GY5A 4PRPE 2DJSA 3ZSTA 1WITA 1R0AH 3LPGA 2KBGA 5DJAA 4HJJH 4F7EB 1IC4H 1VFBB 5DDHB 3QUXC 1U93B 4G6AC 5T3ZL 2CRYA 5J3HC 3EYUL 3JV5A 2VL5B 4ODHL 5CJOL 5EORL 3O2DL 1NC4B 3KPQB 4PRAA 2QSCH 3Q5TA 1M7DB 2VXVL 1F3DH 1FDLH 4JFDD 1J0YA 3L6FA 4FQ1L 3X3FL 2YEZB 2BVOA 3B43A 3QHFH 5JXEC 4EJ1C 1OAKL 4V1DA 3AM8C 5D7JD 4QWWD 3KXFD 1SM3L 3V4UH 3W9EA 4MXQC 5A16B 1K8DB 5CJXC 1ZGLB 2VSDA 5C86A 1IM9D 1QFWL 4MS8D 4OZFB 4F33B 2CRZA 3VXSD 2J8UB 5T1KB 2XWBB 4WTZG 5IVXE 4J3VA 5HHME 1T6VN 5ALCL 2N7BA 2PCPA 5HDOA 1P5VA 2N1KA 2EYSA 1X5XA 5H2BB 1TJGH 1MHEA 1OOAA 4Y2DD 4LAJH 5FGSA 3W39A 1P6FA 1U95B 3NMEA 3MGOB 1GRWA 3C8DA 3LD8C 1OD9A 2EZ0D 3S97C 2PO6B 4M5YL 1TQCB 5H37H 2EXWC 1TJHL 5KTEL 1GZQA 3OGCA 1CG9B 4HFUL 5LG1A 4PV9B 4XNUL 3B9KC 5EO1B 4ZUVB 3EW3B 5I30L 3WJJC 1NCTA 3MGTB 5FGBA 4BH7B 4MD0A 3VWJD 4P2RA 5KSBB 1PGRB 2BSSB 4HUVB 4YR6B 4TULL 2EYRA 3EJZD 1H3TA 1AQDA 5L7XH 5ESAB 1U93A 4K7PL 1I9RL 1U8MA 2H26B 4JM2C 5D7SL 4LPWA 4QYOA 3BXNB 5DWUH 1EAPB 1CD1A 3BQUA 3MRGA 5CZVH 5ICYA 5AAMA 3WL9A 2OTUB 2J3SA 1A4KA 3QI9D 1HIML 2VDOL 1WIUA 2GITA 3MZTA 2C1PA 4PJBE 3FB8A 3T2QA 1HEZA 5K93A 2WLZA 3TYFB 2OI9B 4XNQB 1I9RH 3BD3A 4RFOH 1B6UA 4RGMC 4LLMA 2Q20A 3U0TB 1Y0LA 4I0CC 5CMAA 1WCBB 5GRUH 2GCYA 4AZ8A 4OZIB 5T3ZD 1OP5H 2MQCA 4OCSL 1M6OB 1M7IA 1Q94A 2HFGH 4F9LA 4KK9C 2EYTB 4N1EA 4PJBA 1BFTA 3BHBB 1D5XA 4UTAH 5HSFA 1RU9H 3H3BC 3C5ZB 4YO0A 4K07A 4KJWC 5IB4A 4YHNB 3MV8A 2P4AB 1D9KB 1LVEA 2CR6A 1UZ6E 3EOBA 3TWCH 2IADB 3OJMB 3IXAB 5EZOL 3W2DL 4CKVX 5FOJA 2OK0L 3BDYH 4ODSH 3KPOA 5F7LB 6CGTA 3QWRD 1UH3A 5C0BA 2NY2C 3B9DA 5INDB 3K2MC 1NC2B 4FQHB 4KDWA 2C3HA 4LVOB 5DR5L 9CGTA 4QRRA 5TE7H 1U3JA 4F7CB 4YIQB 1MAMH 5DA4A 1DDHA 3NIGF 3QJFB 4DOHE 3TIEB 4LLUB 4HIXH 1MELA 1R3JA 1J05A 4RMQA 4F37F 4UQ3B 4X6CA 1QBBA 4JJHA 5ICZB 4HT1H 5E6ID 1PZ5A 2P1YA 2AXHA 2YD4A 1I3UA 4I2XA 4U1JA 3KXFE 3T04D 2YWYA 1S5IH 3IDIA 4MJID 3BQUB 1TNNA 3MRGB 2BVPB 2YOCA 3DURB 3MRJB 3DV6A 1CGWA 3ISWA 1L9MA 3ARYA 3RHWK 2IBGA 1BX2B 3LZFH 4BFGA 3FN0L 5JO5B 3SDYL 3IDXH 2VWEC 1YYMH 3U7AA 3ZE2E 5E95B 2CDFB 3P9MB 1V7NH 5KSAC 5DDHA 2R8SL 2GEEA 2JLLA 1CXIA 3EZ8A 3ABZA 3BPCA 4X6FA 3WYRA 2VZSA 3WD5L 3QUXB 5GS0L 4F3FA 3C5ZC 5I1GH 2DI8A 4Y5VB 4MXVE 4X4XA 5EC2B 3L5XL 2FEDC 2GUOB 1F3JA 4KFZC 4R26L 3VE0B 3RP1A 8FABB 4WGWB 4K23L 3LZFL 5L2KE 1H8SA 2IAMB 3MO1B 1G9NH 5HYSB 3PWPE 5GGVL 3KS0J 5EO9A 3VWKD 3C5ZA 4YO0B 3AREA 3KDMB 4HH9B 4MCZB 1SY6L 4XXCA 3CLEH 4MYWB 3JWOL 4Z5RB 2H9GB 5HI3D 5KTEH 1WFUA 3UTTD 3RVUC 1U92A 4CADA 5C0RH 4Y4FA 2J4WL 1FG2A 3S34H 3HNSL 1X44A 4PG9B 5DJDA 4WCYL 5IG7A 5BV7B 2WQRA 4FFYH 4P57A 4MNQE 4PJ9D 1HI6A 5F21B 3VFWA 5DRNA 4BSVB 2YPVL 4WNQA 1NCWH 3GMLA 4UAOC 3O3EA 2C4FU 4KHXH 5SWSB 3SGDH 4CMHB 3MACL 3QUYC 2OX5A 3ARFC 2BHYA 3K46A 2EKJA 4ZPTA 4F7CA 5C9KA 4C4KT 1EHXA 1UM5H 4NKIH 3TNNB 2ICWA 2WQ8A 3WNPA 5IT2L 4PJEA 3H2WA 3HS0A 4ETQA 1AXIB 4DW2L 2Z4QA 4G7YH 5I1DA 4B41A 4GSDL 3SDDB 5F93C 2X40A 1T2JA 3Q1SL 4CN6A 1NCDL 4QYOB 1CL7I 1R5IA 2AVGA 3K4ZA 2EO9A 1H9VA 2GQHA 5HDBE 5KSUA 2J12B 3CSYA 5DMYA 1NCUA 3VXQA 4DTGH 3BPLB 2EH8L 1YA5A 3VXRA 4O2EA 1JCKA 4KXZH 4F8TA 3SE9L 5I66B 1VCAA 4WTWA 2BSSA 5CD3B 1YEGH 1KN2L 1XGPA 2COQA 3EKCA 3MA7B 1MJ8L 3FN3A 5LXGL 4RGNE 1MCSA 4YHLH 3RNQB 4L8DA 4YX2H 3OKYA 2GFBB 2EDKA 2DI7A 4LK4A 2L7UA 5SWZE 1Q72L 4IMLB 2FGWH 3OKDB 4OUUB 4NM8H 1UQSB 3BI9X 2C26A 1ROWA 2NLJB 1NC4A 2YXFA 2WLYA 1FYHB 4M5ZH 4YHIB 4ZNCD 8FABA 1QLRA 1I7UA 3CXHJ 3O8XC 3QFDA 4JE4B 2HRPH 5IVNA 3RI5K 2XN9D 2JF1A 1LDPL 1FYTA 3RWCB 2GK0A 3ULVC 1RJCA 4KI5F 4BH7A 1OAQH 5K9OA 2Z9TA 1FFPA 3OZ9L 3MTRA 4RISH 1R5VB 3LN5A 2CKBA 4Y16A 2UV3A 3SJVE 5T1LB 5BZDB 5D9SA 2P7TA 1T03L 1M05B 4DJMA 3QISA 5DRXA 3UO1H 4AL8H 1G1CA 2GY7B 5FF6B 5KOMC 3V6FB 5IR1A 1VB9A 4ZPTB 4MHHI 5IJVB 1GC1C 3UBXG 1KB5A 3MOBH 5IMKA 4JRXB 4LHUG 2VQ1B 2BXYA 3DRQB 2JCCF 2IBBA 2O5ZL 2ORBL 4JRYD 1WBZB 3D6GA 1FZJA 5IBTH 1IILE 1YQVH 2HLFD 5L9DH 4QHLA 1MFCL 3E8UH 5ID0A 4IOSD 2VDKL 3UTSB 4PP2A 4RGNB 4NZUL 5GS0C 4N8VB 5F7HA 5C0BB 4M48H 4YBHA 3KPNB 2R0LH 1NC2A 4P3WA 1RMFH 3STBA 3VGFA 1Q94B 1WZ1L 1RIVH 3I6KA 4P99A 5GHWH 2VQUA 3W5NA 5DJCB 2NX5A 2NZ9C 3H9HA 4DKFL 4PJFB 1IC4L 2X4RA 4M7KH 1HCVA 4RNRB 4ODWA 2A74A 3OR7B 1NFDB 3IRZA 3AY4A 5IIEA 2G60H 4KRPB 3UAJD 2DIBA 2IAND 4WENB 4CRPA 3U36A 4G7VH 3V52L 1KT2B 1ZT1B 4HD9A 3JXAA 5C2UB 1MQ8A 3D39B 5E7FA 2OL3H 3O6LH 2YN3A 5EU6E 4OIAA 4QHMA 2AV1A 15C8H 3Q6GH 4DN3L 4H1LH 3GMQA 3BDBA 4HS6B 4B7LA 1RI8A 3SDCA 3FQXB 1CXHA 4JQVC 2BSTB 5KSAA 1CE6B 2RJMA 3RWGB 2FRGP 4FQLH 1I7ZA 3LEVL 4APQA 3MRPB 4LSPL 2B1AL 3FCTA 1MIEL 5C0JB 4NQTA 1VERA 2G60L 3L7FB 3DVIA 5T3XE 4GFTB 1YEDA 1F3JB 3NCYS 3S35L 3OAZK 4NUJB 5F9JA 4N0CC 3RIFF 4NN5C 2IANB 1G7HA 1OP9A 4R0LC 4LF3A 4OGZA 5F96L 2AJXL 3IFNL 2KQMA 4CVXA 5TH2A 5FHAL 5L2KB 3THMH 3DV6B 1IEHA 1DTUA 3KLHC 4QHUA 1FJ1B 1CXKA 3PF2A 2X1OA 4PV8A 5HHXH 4H26B 1YMHB 1FL3B 4PS4H 4ZD3L 4PTTA 2B1AH 5C0AE 5EORH 5KS9E 3WEXB 3OXRA 3QFJB 4XBPA 4UIMB 1DLHA 1YEKH 1MCBA 3GSNH 5HI4D 5CSBA 5D7IE 3GJFA 2B5IB 5EU4B 5ESAA 4DK6A 2RB8A 2XTLA 3CC5B 5BOZG 1NMAH 2VAAB 3U7WH 1J5OH 2WBJC 4L8CB 4HUXA 4KJPD 5DFTA 4NQDD 4PFEA 3V5HB 1AE6H 4X4XB 5EC2A 2QHLA 4MLIA 4JFDE 1NL0L 4UAOB 1KLUB 4KV5F 2PW1A 5GRWA 4CNIA 5I1DB 1W8NA 1Q9LB 1VENA 5DGRA 2FSEA 1F58H 1DBAL 1I75A 5GISH 1OWWA 3WIHL 4LIQE 5D1ZB 4I3SH 3GSNL 3EAKA 3GHBH 1MJUL 4JG0H 4LSRH 3S96A 2H6PB 3VRJA 3CDGA 1P4IL 3CSYB 1BZ7B 1RUAH 4HXBL 1GOGA 2PTUA 3D69B 1R3LA 4U2YA 4I0PA 4PRIE 4P57B 3QZWG 5LGJB 4K3GA 4HKXA 5DMGD 3UTZA 4NQCA 3QCTH 1KBGL 1MCWW 3RX7A 1N7MH 1TZHB 1BMGA 3DX9B 1KOAA 3N1MC 1TZIA 2W9EL 3PWLA 1TETH 1FVEB 4NQCD 4M6MH 2I60H 5JQ6L 1P7KA 1W0VA 3IS1X 3GSVA 5K9QI 4ZMAT 3DPBA 3CFBA 5DUML 3MR9A 2J6EH 1SEQH 3N85H 3D18B 2PXYA 5IEHB 2B1HL 4MDIB 4DAGL 1YEFH 4XGZA 3LEXB 3RWDA 1Z3GL 3DV4B 4NKDB 1NANH 4C83B 4WJ5A 4HFWA 1NGXB 4U1SA 4EVNA 1PKQA 5IBUB 1D5IH 4M6OL 1H3PL 5ITFA 3NOIA 2MHAB 5T33L 4KTDL 5FECA 4JKLA 3QXVA 4BA8A 2QKIA 3L95B 3KYOB 5EU4A 2B2XH 1ZAGA 5DJ8B 5FM8A 3UTTB 1KJ2B 4XPGH 1CK0H 4OUUA 3GIZL 2HFFA 2IPTH 4OAWB 2CUIA 4IRSB 1HINH 1DL7L 4Y1AB 3T0EC 4LU5L 2CQVA 2E7MA 4JZJB 3GGWA 2Q8AL 2WAHA 1JNJA 1LILA 2PR4L 4WUKL 4NO0B 3K1KC 1NFDA 1GL4B 4OFIA 1BWMA 5F44A 5HYIA 1DE4A 5GRJL 4JLRB 1QR1B 2GIYA 4PJ9A 5B8CC 5F88B 4MQXC 2AJZB 4Y19E 4QHMB 2WBWB 1RZ8B 3V6OE 5ANMA 1JGEB 3IDUA 4PJHF 5IR1B 2R0KL 1A3RL 3P0VH 1MRFH 4YE4L 4LASL 1IAIM 5C0CD 1P4LB 3VGDA 1A6AA 1GOFA 1F90H 2IFGA 1WQVT 4XXDB 3RUGB 3EDDA 3LY6A 1UWXH 4OUOA 4WFFE 1NGZB 1ZHBA 4ONGH 4LNVA 4HK3J 3MV01 3I6LE 5C0DA 3T3MF 2DM4A 3D18A 3BPLC 1RY7B 3WHE1 2Z8RA 3D3VE 5HGAB 3MRLA 5F1SA 1LO2L 1I1RA 3G9AB 4NO2B 4OIBA 3D5OF 1CICC 3IYLW 5D2LB 2F8XC 4CW1B 2VLKB 3VU2A 4BH8B 1AHWC 2P5WD 4K8RC 4S1DD 4XBPB 5CS7A 3LN5B 1K5NB 5CLTA 2HMIC 3JWOH 1B90A 4PJEB 4HQQL 4RCAA 1NCBH 4Z77A 1FIGL 3NN8B 1JNLH 2VAAA 2W0LA 1BZ9B 3S36H 4RGOL 4X7EC 5HGHA 4ODTH 4GRWH 3ZDYF 1QOKA 3O4LA 2BNQA 3EYSL 43C9B 2JJVA 1AP2B 3OTTA 2EDOA 2E9BA 3FT3A 1DBMH 1DZBA 1ZHKB 1BOGB 3QHZH 3BRDA 4P4KB 5ID1B 3SEPA 1KJVA 3L5WB 4XC3H 4E9LA 2CDGA 4HCRH 4PRHB 1DQML 1WBYA 5E70A 3WFHA 4G7YL 1L0XA 4IMLA 5AWNL 2YZ8A 1ZLUH 4Q74A 4L8SC 3LKOB 5IHLB 5DHYB 1M7DA 1P6AB 4UTBL 4HBQA 1XGQB 4YHYB 1A6ZA 3TBVB 5JIKA 1GZPB 3TCXA 1MWAA 5CJ5A 3GUTB 2LU3A 3BJ91 2W65A 3GM0A 4YBLC 2EO1A 1KLGA 1GGBL 2XOTA 5C09E 1KENL 2CK2A 5FA3B 4GRWE 1MNUL 2DLEA 1N4XL 5D70H 4GAFB 5T3XL 2JTDA 4X5WB 4CBPA 4JDTL 3DGGA 5C08E 3UPCA 2DWDB 2XWBA 4OT1L 2CGRL 5C0IA 3G6JA 5HGAA 4S0SD 4DZ8B 4F9LC 2CK0L 4P2CG 5KVMC 4HLJA 3IAQA 1KYOK 1N4XH 1KLUA 4G6ML 4JJ5B 3VWJC 2YK1L 2UYLA 1ADQL 1U8NA 4HX1B 5GGSY 2DQHH 1RU9L 1U8MB 1NCDH 4ODVH 4ZS6C 3VFUA 2DMKA 1QVOA 3GNML 4MGXA 3VRJB 2GTZB 5FOBB 5DC0A 1WEJL 1Z6JT 1I9IL 4Q58C 1S9WA 5DF0A 1ZGLP 4YX2L 3BYYA 1G0XA 1A5FH 1IZKA 2F8VA 3LMJH 2E8ZA 3ZTNL 4I2XE 2GT9A 5BV7L 2OK0H 1FL3A 4RMRA 1JPTH 3BFOA 5KSVB 5ETUB 1EO7A 1JTPA 2VDRH 3ECBB 3E6FB 4P5TD 1WBYB 2XRAH 3TPKA 1L7IL 1U8KA 4U7SA 4ODVL 3OB8A 5IBTL 5HD8D 3LB6D 5FDWB 5BJTA 5B3NA 5CGMA 3MJ9L 1XGYL 1L6XA 4HKBB 2VLJB 1NLBL 4JQVA 1A4KB 3JWDC 4AMKH 3B3IB 5JIHA 2FJGB 4DW2H 2X41A 4ALAL 3QIUC 5J12C 4XGZB 5E8PB 3GJEB 3QBTB 1DUZB 1YC7A 4LPUA 5CP7A 3QQ4B 5B39G 4HS6A 1S9XB 3QG6A 4HAGA 4LKXB 5FYJU 4XCCH 1NCAL 3IXTA 3LS5H 4MSWB 2NY1C 1JRHL 1XGYH 3ARWA 2QHRL 3FFCA 3U4BH 1BFVH 1VADA 2HTLD 4U6XA 5IB1A 3REWA 1S7WA 5BW7A 1U8PB 5F9DC 4XMLH 5C0JA 1WFNA 3D1MC 2F58H 4PRBB 1OD7A 2BVEA 2DQGH 1YQ2A 3QUZD 5D6CB 1AI1L 1RZIA 4IBLT 4PRID 1AKJA 1SJHA 3MOAH 1T1YB 3F7RA 3LKPA 5TJWK 3C5JB 3IJSB 2GAZB 3TIDB 2X4QA 3PGCB 4G6KL 5B21A 3WNOA 5BRZE 1J87A 2IADA 3N9GL 4KMQA 1A7RH 4L4VA 5FAAA 1N5YH 4OLUL 4LGSB 1QEWA 4NRZB 4HGKC 1S9KC 4PV9A 3O2DH 1U6AH 3HZVA 4XBEH 4P4RB 5INDA 3IFNH 3WXVH 1KF9B 4XP6L 3SKJL 5D1XD 1CGSL 1T0MA 3V5HA 5KSVA 3I6LD 1IGML 4AQ1B 5D93B 4UDTA 2XQYG 4UQ3A 3ULVH 2P47B 3KYOA 2Y1VA 3N1FC 4JM4H 4OLUH 2OSLA 5FO9B 3BSZH 2VXSH 2NW2A 1DANU 1J1OH 4R4NC 3MMEB 4OZ4A 2ITDA 3BRFA 4UT9H 3MRMB 4L4TE 3BVNA 3MSPA 4RFEA 2OP4H 1LWRA 5CZXC 2OTUA 5CP3H 4ZUTA 4OLEA 4TUKH 1ND0B 4ORZC 5E8PA 1MI5D 4JFOA 3RZCC 4QTIL 4L3CA 3LKQB 4MD4B 3JWOC 3VWKC 4GBXC 1IFHL 4PRNA 4HZAA 3X13B 5IW6B 2YPLA 4PJ7E 4XNQA 4LVNC 4ACPA 3DMMC 5FO7A 3VD9A 2VXQH 3RVUD 3NIFE 1XF5A 1SVCP 5HVHC 4J3SA 4FP8H 5MEQA 4GQ9H 4H88H 4LP5A 3F5WB 3G5VB 1MFAH 1T4KA 4FQ1H 2XZAH 1CQKA 4QRPB 4YDIH 5DLML 4LCIH 5DK2A 4E42A 1QFOA 3HCVA 3OJDB 4BZ1H 5B38G 3ARFD 1C08A 5JMOC 4NCC1 1TJIH 2OJEA 3QCTL 1MI5B 2AEPL 1P53A 1BOGA 1T89A 2ZOLB 4I3RH 1CLOH 4YXHH 4I48A 4KZDL 3QH3B 4PB9H 4D2NA 5F7DB 5L6YH 3WDJA 5J57B 3MRDA 3G6DL 4RX4D 2E8YA 1P2CA 1P84K 3OF6D 1NAML 2NTFA 3FMGL 3QNXB 3FO2B 5KVEL 2HWZH 3A6OA 3AS3A 3QDJA 4NUGL 1DDHB 4CW1A 3GSNB 1JGVH 5F70A 3MJ7B 1UXWB 4CL7A 1MRDH 3KR3H 5DVLA 1TJHH 1MEXL 4FABH 4LMQE 3RGVC 4WV1B 1OF2A 5M94B 3VFVB 3DIFB 3VXME 4O9HH 3TA3A 4PB9L 1BZ9A 1TTUA 1A02N 1WWWX 5MEOA 1J12A 4NKMA 4JLRA 4OV5B 2ICWJ 2WP3O 1CTNA 1HHIB 1U0QA 3GMOA 2VQ1A 4PP1D 2FO4A 3RWFB 3D2UA 4KK6C 3TT3L 4RGND 4LQFL 4PTUA 4OQTA 4HPOH 4NWTL 4XMPH 1BBJB 3V79C 3QXTA 4KTEH 1VGKB 5SV4A 1HINL 1ORSA 4F7TB 3E6HA 5F71A 1DUYA 1YDPA 2R2HB 3SJVD 5DMIL 2CMRL 1SEQL 1Y6NR 5F9AC 3T8XB 3GO1L 3TPUA 1CXLA 1OTSD 1FL6B 3QDMA 3LKOA 5HTSA 5IKCA 4K3HA 4M43H 4GMTH 3EJYC 4PIRF 4NWTH 3E0GA 1C5BL 2YK1H 2VN7A 5F6HJ 1CICA 1INEH 3W9DA 5HHMD 5EBGA 4W68A 4TRPH 3ROLA 4MCZA 3JUZA 3KYMB 3D9AL 2Y6SC 1A1OB 2DKUA 4JFYB 4YE4H 1DEEA 4P2OC 4P5TB 1A7PH 4RAUB 2UZYB 1QSEB 1TCMA 3JV6B 15C8L 4DN3H 2O5XH 2CKBB 5TDOA 4RGMB 2AJSL 4JKKA 2QSTA 1XCTA 4KJYA 4JN2B 1YEHH 4P2RD 4TTDC 3N50A 5EDXA 1UM6H 3MV7D 4YDVA 5DUBB 5EOQL 5TFSL 5I8CB 5IHBA 2R69H 1AGCA 4HJJL 4PJXE 3NTCH 1UEMA 4M00A 1PG7L 3HNTH 3I9GL 4BUHA 3ULUF 4M48L 4D0CB 2ZCHH 4YXKH 5IP4A 3U0PA 3RWIB 2AEIT 4TRPL 1WWBX 3AU1A 5GJTH 4D9RE 2XYCA 1GPOH 3HI1A 3HRZB 5FO8B 4GAGH 1UXWA 4ZPVA 3O9WC 4LCCA 4PJFA 4HX1A 1LE5B 5D7IA 4OLZL 3MLUH 4W6WB 5C09D 1NCBL 3NTCL 5C0AA 3RDTD 3U0WH 4Y19B 4R3SA 5TFSH 1BQHA 3QQ3B 1DQJB 5MEOB 4BQ9A 4XPAL 4S2SA 1FGNH 4ZXBA 2NR6C 2XTJB 3VH8A 1N5AB 4UOJA 3SQBA 3L1OH 4JEGB 3KS0H 1QTYT 2MQ3A 3GSXB 4JY4B 4LNRA 2AK4D 5D96C 4AENA 3SDAC 2ENYA 1UFUA 3A6CL 3UJTH 2DRUA 3NCJH 1JYWA 4CJ1A 4NQDB 3VDCA 2M26A 4ZTPH 1SJHB 4OI9A 3OR7A 3LS4L 4N0YH 5DD6B 2KDGA 1E6OH 4GW4B 2KQNA 5DMKA 3MCG1 4ZNEE 3QDMB 3TV3H 3L9RB 4PGDA 3QXUA 1VACB 1YN7B 4P23B 1AC6A 3NCFB 5GS1C 3A6CH 1HKLH 3EYQD 3PXJA 3GHBL 4LSRL 4FG6C 4Y1AD 3O0RL 3NZHH 5J1AA 2BCKA 5I1KL 4XT1C 3QIWD 1CLYH 5JUEH 5A16A 5GGUB 1FH5H 1X7QB 5E4IA 3X13A 2D7TH 1MCEA 4OFKA 1A0QL 3NACL 5E08L 1U8IA 5A2FA 5IF0A 5J13C 3RIAF 4F7PA 1RIHL 1XCTB 4I48B 3ES6B 1A2YB 2C3GA 3NCMA 2XPGB 1YEDB 3V4UL 5IESH 3ZT7A 3C6SB 4LEOA 5CKGA 4QHKI 1NMCC 3V6FA 5FF6A 3RVWD 4OFYD 1BVKA 1PYWB 4NO3A 1UYWH 4KJQD 4YHKH 3H0TB 4UI2A 4UUJA 3PG2A 5JHDE 2J6EA 5F1KC 3QFJE 4MJIE 4LVNB 1ZT4A 4XNYL 4GOSA 2F54E 1SYSA 1NGQL 5JW4M 1YEEL 1QSEE 4QCIB 3V0WH 5FGCB 4M7LT 2BNQE 2FLRT 2OCFD 4OQTL 1GZQB 3CXDL 4XTRC 1NBQA 2R9HD 3C60B 2D7NA 2Q87A 4S1RL 3GMNA 1YMMA 3CPLB 4KROD 4NRZA 3VW3H 5T33H 3VFMB 3KPNA 3EO0A 3TO4D 3V6ZB 4HGWB 2VDQH 3OAZH 3HZMB 3IU3B 3V8CA 4TOYL 4L5FH 5F1OB 5GS2D 4DVRH 3VXRD 3MLVH 2VR4A 2FZ3B 4I9WD 5LCVL 5BS0B 4JQIL 1OVZA 1ONQA 3ZKND 4ELMB 4AEIH 4GW4A 4FFZL 5DMKB 2CGRH 4K8RH 1LHZA 4WI4A 1RZGB 3U36B 4RISL 5D70L 5T3XH 2ZUSA 2DLFH 3FHAA 4ESKA 4S10A 3LAFA 4UNUA 1A7PL 3CFEA 2XFXB 1FG9C 2VZ3A 3KLDA 4MAYC 5ANME 4DVBA 4XCYB 5GGSB 3X14B 2A6JA 3O11B 4GKSB 4BFBD 3C09C 1KACB 4D0DB 4JFOB 3MV8E 4HDIB 4KDVA 1YNLL 4IDJL 4OZHB 2EDQA 1U8LA 1BQUA 2D2OA 3ILQD 4M5ZL 4LCYB 5CAYB 5HI5D 4AIXA 1FL6A 4N9GA 1UXSA 2ATKB 3O45A 1K8IA 2VJXA 3P4MB 3TCLB 1MY7A 3PGCA 3CCHA 1X4ZA 1WIOA 5EZLA 5HHPA 1HQRB 3ZKMC 4PJ5B 3QWOB 1B88A 2C5DC 3MFFB 5JR1H 5HDLA 5F8RC 3ILPB 4NNXA 3H8NA 3U0PB 4BSWA 3L3OB 4RMUA 3HPJA 2B0SH 4OD3H 2HG5B 4PY8J 4NRXA 2ZP0T 4QRRE 1U3YA 3RWFA 4ONHA 3T0ED 4J2XA 5D5MF 4WFHD 3DVFA 1MLBA 4NM4H 4OZGA 5D2NB 1DVFA 2J7LA 2P45B 4H25A 4GRLD 1J8HD 3QHTC 1XF2A 1WAAE 2VXTL 1S7UA 4JRYB 3U2SB 3RVVC 2HKFL 3T3PE 5KN5B 5LAXB 4LCUB 3BEWA 4PJHA 3FO2A 4MQXD 1HNFA 3ORJA 3ZE0E 3MRHA 4L1DA 4YBQD 2KPNA 1IKFL 1PZ5B 3LKRA 4NJAL 4OGXL 5ADOH 4EN3A 5DEFB 5HY9B 2H26A 1A1OA 1JGLL 1NSNL 1RZJC 3X3GL 1CGYA 1X9QA 2F58L 3MBED 2YPLB 4GW1A 5T3XD 1U3HB 4WI9A 3FO0L 1AP2A 2JJSA 5IJKA 3KLAB 4JANA 2OR7A 5MEPB 5FYKE 2HJLB 4G8EA 5I1EH 5ERWB 1C16B 4JHBA 5DRZA 1BAFL 4PJIF 4YPGA 4EQ3A 1JI2A 3OZ9H 5EBMA 3NVQA 4J4PD 4XI5D 3SKMB 4PREB 2AQ3A 5FHAH 1QQDA 1S9YA 1OAZH 5FB8B 4UINH 5DO2D 2P24B 3RVTC 1EMTH 1W0VB 2NYYC 3TCLA 4S1DC 2XKUA 1U6AL 4P23A 4E5XB 5DSCB 3BAEL 2CLZB 3WN5C 3NN8A 1CGTA 5JPMB 1NAMA 5KAQF 1IJ9A 3QI9A 1D9KD 4MJ5B 5L2JB 3PWJA 5D7KE 5ACZA 3VI3F 1MCFA 2VXSL 1JWSA 1I9JH 1D9KA 2BK8A 2WANA 1MCOH 5ESQB 4FQQA 1U8JB 1X5JA 1P4BH 3JTSA 4ZTOH 1NJ9B 3G6JB 2VL4A 4XHJC 2Y5TB 3GMNB 4QNPF 3WFHB 1VFBA 2DTML 4JCMA 4PLKC 5HGHB 3WN5B 4N90D 3P30L 1MJJA 1WC7B 2H8PB 1CD1B 4OAWA 4OF5A 3U46B 4RIRB 3U79A 3MA9L 4OCMC 4IRJD 3HI1B 3OKNA 4BSJA 5FKAA 4HZLA 3DYMA 4JPIA 5AZEL 3DROA 1M71B 4JRWA 5JZ7D 1FNSL 1JHTA 4DN4H 4TUJA 1KCRH 2H2SC 1F4WL 1AFVL 1YMMB 3J7HA 4U6YB 3I6GA 5CJQL 3OWEA 1MWAH 4F7PB 3LN4A 1QR1A 1E4XI 2UVFA 5ALCH 5DK0B 1INDL 2XPGA 4Z7WB 4CDGC 5KJRH 4Y4KC 4DUVA 2EH7L 4Z7NE 2NY4D 2LQRA 2VE6A 3QIUA 1AHWA 3WO4C 1T66D 5E00A 3T65B 2W59A 2UVEA 2BSRB 3SY0B 1Q0XL 5I8OL 4P2QB 3W0WB 5B22A 3KYMA 1JYVA 4M6NL 3VI4E 3TGXA 3VFGH 2Z8VC 5IM7A 3ELAT 3S5LG 3SJVA 2I5YH 4UT7L 1P4IH 4RA3A 1S9VA 2FGWL 1T5XB 5KZCB 2QADB 1J1PH 4YEFA 3F7QA 4ZS6D 2FR4B 5C3LD 2DD8H 1LEIA 4NNPL 3MV9E 5A43C 3SGJC 2IPTL 3KNBB 1X7QA 4R0LA 3ZE1F 2RR3A 5ALBL 5ENWB 4MLSA 1WWAX 1NBZA 4HS8L 2VLKA 3GMMB 4YIQA 2OR8A 1ZA3A 4GAYA 3CK0L 3U82B 1FVCB 2FBJH 5IBLC 1ZT7B 3ARRA 1K8IB 2D7OA 3P4MA 2LAGB 1OARH 5I71C 1XR8B 3F12A 5HYJB 5D6DA 3BDYL 4ODSL 2V2WA 4WI8A 4KKAD 5DUPL 2XRAL 1CQYA 3D0VB 4F57H 3F58L 4HWZB 4JVWA 4M61B 5EOQH 2NY6B 4FTVB 1VGEL 4HLZG 2R23B 2F5AH 3HPJB 5L8KB 4N90E 1JI1A 1OCWH 3IFOB 3SDDD 3ZL4L 3KWWB 2FECI 3CFEB 2FO1A 1I7RB 4GAJH 2FBJL 1H15B 1CDYA 4JO1L 4JO2L 4YH6A 3PP3H 2Y7QB 3BW9A 4C54A 3UTSA 3N06B 4RAVB 4A6YB 2C1PB 4ODUB 2R1WA 4L9DA 3HC0A 2X9WA 4M5YH 3PWVA 4MSWA 1GGUA 1CU4L 2B5IC 3LIZL 1IGCL 3L7EA 3GMRB 4JFHD 5JIIA 3RIAK 2IJ0C 3MLXH 1WAAA 5ERWA 1N26A 3VD7A 4NO0D 1WCBA 4UINL 1EEZB 2DJUA 4LHQB 5F1NB 1RK1B 1PY4A 1X6LA 3CFCH 4I0PC 4AQOA 3IRPX 3BP6B 3P0YH 3OQ3B 4Y5YC 5LKNA 3VG9C 3ALPA 4LQ1A 2J6EL 4ZUSB 4ONHB 2G5BB 4C57C 1A7OH 4Q6IC 1KIQB 2PO6C 4QT5A 5T5NG 4KDTA 3LOWA 5I6XB 1QLFA 2BRRH 1T1XA 4K94H 5JDJA 5MERA 4J8RB 4LSSL 3KPRE 1FLRL 1FNEB 3TA3C 1FIGH 2BFVH 1NKOA 1FO0A 4NHCH 1F90L 4LEOB 3NFNB 1A9BB 5E94B 2ZCKH 3MRPA 4FMKA 3P0VL 1AQKH 4KKCD 4IS6B 4N0UE 5ESQA 4WHDA 3LKPB 4JFQA 4HKJB 4Z8FH 4Q2ZA 5JHLH 1ZXQA 2UYLB 3MFGB 1LNUB 4OD1L 2V7NA 4UV7L 3SGKA 3SDDA 4NUJA 5F9JB 1SYSB 3F8UB 1TDQA 1FAIH 3MMEA 1HXYA 4L29B 1MREL 4G80B 1QO3A 4U6VH 2ZPKH 5BOPA 3DYPA 3MFFA 1HNGA 4UT6H 1S9WB 2FGZA 1T7ZA 4O5LL 3MROA 2W0FA 5E8EA 1JFQH 4N8VG 4KC3B 2A77H 1X5FA 5E2WL 1Z0MA 3U9PL 1FZJB 3FTGB 5L0QC 3S88H 4F7EA 2H1PH 2IALB 3T4YA 3RZCD 1LD9B 3S37L 4EXKA 4MAYB 4MXQD 5EZOH 3FB7B 3T0EE 3W2DH 3DUHA 1P9MC 4HUXB 1YEKL 3KPQA 5FYLH 2W9DH 3QNZA 2P24A 3DMMD 4KI5D 3HNVL 5MEQB 5JLZA 4U3HA 5DSCA 1IM3A 3QUMA 3SDCC 3O6FB 3CH1A 5FHBH 4DEPC 2AS5M 3QEQD 1H3XA 3GSNA 3VGAB 1JK8B 4L5FL 4MQTB 3FB6A 2NX5B 1N6QL 1CLZL 1IC5L 3OJDA 4NCC2 3FQTB 4PRPD 3UYOD 2FH8A 3MV9D 5EUOB 3Q6FA 3WHXA 3G5YB 1FYTE 1EVTC 5HGBA 2R56L 4QT5B 5DVOA 3D25B 5LVEA 4GG8B 5FGRA 4WI6A 3L3HA 2J8UA 3R1GL 3EFDH 5F7DA 3G5VA 3EDFA 5DMIH 5EUKB 1JPGA 1MJUH 4DGIH 1MVUA 2EXWD 1C7TA 2ZKHH 3QO1A 2IC2A 3FOMB 5FYJH 4ELMF 3PDOB 1TPXC 2DYPA 1IT9L 3LS4H 1LO0L 1BEYL 1EO8L 3STLB 3DO7A 1NGPL 5MP6L 2Z31A 2HT2D 3ULVE 1RFDL 4U3CA 4F80A 2VXUH 1T21B 3KPRA 3IDJB 2IPKB 2PW2B 3QDMD 1XGTA 5FKPA 1MHCB 4PJIB 4OLXL 5D1XA 2WUBL 4R7NB 3MPCA 4TTGA 5D2NA 4H0HB 4K7PH 3FQNA 4CUCA 1AY1H 3DBXA 5DUMH 1PSKL 2EDXA 3IAPA 3VGGA 2VITA 5GPRA 2R1YB 4P2RB 5KSUB 4PV8B 2FEEI 2B1HH 3T1WA 4PTUB 1T0MB 3VXMB 1DQLH 2VDOH 1Z0NA 1TVBB 3WIIH 5E5RB 4F15B 2DBLH 3E3QC 3IXAA 2RFXB 1XGPB 2C3VB 4PGBA 1H3PH 5DMJB 1B9ZA 1F42A 3UX9B 1AKJD 5GS1B 2A38A 3LSOA 1MFBL 4EOWL 4B5EA 2DQEL 4P48A 4F15C 3UZQA 3RTQB 2BDNH 1ZT1A 2IPUK 2FO4B 5DJ0A 3U46A 2OTWB 1A9EB 1SJXA 4PY8I 2DBLL 4NNYB 3W9DB 1OTTC 1ND0A 1YPZE 1IAIL 3AB0C 3PV6B 2X4NA 4TUOA 3BGMB 3L3KA 2NY1B 3ARDB 5TDPB 5D96B 3DLQR 2ZSVB 2FB4H 1FLTX 2GK0B 1LO2H 1Y0LB 1QRNB 3QXAA 1UACH 4FXGB 2DJ4A 5IMOA 1QSFB 2WIIB 4QY8A 1NLBH 3I6GB 4J3TA 5JXEA 3NCJL 4LLAA 1HSAA 1VKXA 1I1AB 1PVHA 3WE6B 2BNQD 5BZDA 2GI7A 1AGCB 5IQ9B 1BPVA 2HFEA 2ESVE 3O4OC 2NY0D 2P43B 3HMWL 2EEAA 2JK5A 4Z7VA 1U2HA 3K8KA 4OCRH 5DK2B 3DO7B 4LCWA 1CZ8H 5D2LF 5DD0L 4YHML 2Q3AA 4ZUSA 3Q48A 3INUH 4OZHF 5EWIL 1IC1A 2ZOLA 5KW9H 1CDHA 2R0LL 3WUZA 3H42L 5DQ9B 4JKWA 3PUCA 3MO1A 1DLHB 5E6IC 4NZUH 5IB5A 1KXTB 2UUDK 1I1AC 4WU5A 5C0FA 1S7TB 5E5MA 4ZAKB 4HWBH 3GBNL 3RWHB 1P2CB 1J18A 4LHJB 3QDHA 1NCWL 4YDKH 4TSCL 3MCKB 2V2TB 1F2XK 2WK2A 3K8MA 4WW2F 3QUYB 1LMKA 2JELH 5EWIH 1A7NL 3C6SA 3UO1L 4U33A 3F7VA 3QR2A 4IOIB 1K6QH 5FYLE 2ZJSL 1G9ML 1JZ6A 3K81A 3M17A 3O4LB 2A74B 1JJUA 1T04A 1YN7A 1JN6B 3BUYA 3HS0B 5EIIA 2XQBH 5BXFB 5EZJA 3OKLA 4QOKE 5FA4A 2CDFA 4WO4D 3ZKXC 4R2GB 5IV2A 5BCAA 5CD5C 2DWEB 3LEVH 3TP4A 1D3CA 1AXTH 3DUSA 1EZVX 1YDPB 2R2HA 3CLEL 2IQAB 4L3EE 5HI3C 1P7HL 1IARB 1PD6A 1IQDB 2XN9B 4Z7WF 2CLRB 4J1UB 1VACA 5BS0D 2AKRB 3PV7A 4TVPH 4EN3D 1UJ3C 1DBBH 2DQUL 4OD1H 4EUPH 4OGAD 5L6YL 5T5FL 1ONQB 4H1LG 2IEPA 1UZ8A 2NW3B 5CEYA 4X6DE 2YD6A 2H9GA 3HZKA 2PYEE 3P9WB 4PJBF 3GB7B 4R4FL 2F15A 4KJQC 1OGAA 2BC4B 4ZFOL 3WKMH 3ZO0A 5DQ9A 1RUQL 3BGAA 4PTTB 1G7IA 4PR5B 4LRIC 4MA7L 4XBEL 2Z31D 1U3HD 4POZD 3STZA 3U83A 2H2PC 2QTEA 1H3GA 4MJ6B 4TVPL 1IGJB 5DS8A 3RWHA 2VITB 3G6JF 2GHWB 4NJ9H 4YAQB 5C7XL 4JM2F 5C3TA 1KCRL 4J23A 2WBJA 4OM1H 2R2EA 2IMNA 5B3JF 1J05B 4NFDA 4I3RL 1CT8A 3HG1A 1XGTB 5FKPB 2R0ZL 1WFOA 5IHZA 3CCHB 3H9SA 3MLWH 2GTZA 5I73B 1UZ6F 1JHKL 3V2AR 3HHRB 4GG8A 3CH8A 3RY6C 5F7MC 3RPKA 4NHUB 2ADGB 4BKLB 1OAXH 2UWEB 4PJCB 4Y5YA 4LSVH 4NNYA 3O8XD 2OJZH 3QJHB 3LQAL 4PRHD 4P4KA 3LN9A 1A7QL 3SE8H 4YDJA 4ODXA 2D7PA 3QNYB 4GAJL 1DVFB 4OI7A 3G6AB 3BMVA 2CLVB 3C08L 2D31A 3L3JB 5AZ2H 3RIFK 1J10A 1UCBL 2A83A 2ZNWA 4FXGA 1MFAL 3DX9A 4XP1H 1ZS8A 1FCGA 3QEUA 3HR5B 4FA8A 4WEUD 5H35B 3OKKA 5IK3A 1ZHNB 3PXHA 1YNTB 3FRPG 3C6LA 2P5ED 4G8GB 4DVBB 3CFBB 1JGLH 1NSNH 2B8OT 3QCVH 5LWYL 4N5ED 2R69L 2CR3A 5ISZB 4Z7VB 2MSPA 4I4WA 3GI8L 5IIEB 5F89A 2ZCLH 3ZE2F 3D87B 3FONB 4LOUD 5I1CL 5IFJB 5CBEB 2XI9A 1EHNA 3UYPA 2BNUA 2OZ4H 2RFXA 1S5HA 2X7LA 3MRNA 4JM2B 1ORQB 2EEDA 3ZYIA 2OMNA 3ZTJG 5A3IC 5T1LD 3R0NA 4I3GA 2MPAH 4DZ8A 3QCVL 5GS0D 2EDHA 2G75A 2X1XR 4AEEA 4LGRB 3O81A 3KPMA 1HK6A 1YJDL 2Q76A 4F7MA 2QADC 5JA8B 2BXZA 4P0DA 4IRSA 5CIPA 5EOCH 1SJVA 3ARPA 3DSFL 4ETYA 2OI9C 2YMXH 4LCWE 2MCG1 4APQC 1T21A 1NLDL 1C7SA 1G6RL 2Q3ZA 1LEGB 1XIWD 2EIBA 5H94A 4HPYH 1TNMA 3UTPE 4YQXH 5TH2B 4ZOAA 1LO3H 4LQFH 4WU5B 3C8KB 4AM0A 2JJUA 1F2QA 3VFMA 4O5LH 2X70B 3E2HB 3LDBC 2AJVL 1NFDF 1AO7D 3MREA 4U6TA 4YDJB 2YMXL 1SMOA 4PJFF 1A6ZB 3TBVA 4PJ8D 4ZUWA 5CGYD 1BQSA 3VFPA 1Q9OB 2MMXA 3ECBA 3A67L 3BP7B 1MCLA 2V9QA 4KK5D 3TN0B 4HWEL 4L8CA 4CU8A 1UQSA 2BERA 1V3KA 3OHXA 1YZZA 4WHTB 3Q6FB 3WHXB 1KPVA 2AJVH 5GS3A 1MJ7H 2NY6D 1GGTA 3MNVB 1IEBB 1S7SB 3RVTD 2GJ6A 3CX2A 1I7UB 3AS0A 5IW3A 2W07A 1CBVL 2BVQB 3WJJA 1M71A 3NFPB 5D1ZA 1LEKB 2ZUQC 4PRNB 1A47A 1MVUB 2EDEA 1ITCA 4X9HA 2Y9RT 1PJ9A 2C1OB 1C8PA 1H5BB 5HHNB 1OTUC 1IAKA 4JM2A 4J1UA 4MQ7A 1QHPA 4QRRD 3HAEH 2YUWA 2FL5A 1ETZB 5GZND 1B0RB 2GK2A 2ICES 4RGOH 3OXSB 1IKNA 3JWDL 1HQRA 1Y18A 5EZLB 4X6EB 5HHPB 1BD2B 1CFSA 3TVMA 43CAA 1MHEB 4ODBD 2WBKA 4FZEL 2Q76B 1VFAA 2X4SB 3MNZB 3QO0A 2I24N 1CDGA 4Z7OE 1GGIL 2JJTA 4X8JA 3UBXB 4CVZB 4JQIH 1F8TH 5DD1L 2Y23A 4CMMB 1FV1A 1NGYA 5EC1B 1F13A 4GG6F 2LE9A 4DVRL 3VXMA 1AD9B 2NXZD 3P4NB 4OLWH 3DMMA 5GGTH 2RAMA 3RWJA 4ZO7A 4L4TB 4YEEA 5JZ7C 3U6RB 3RVXD 3DOSA 3IETB 4Q97A 4KWUA 3PHSA 4OCXH 4MVBD 2X09A 1A1NB 1NEUA 3PIQA 4JFFB 5E8NA 5FHBL 5ESVA 5ABDE 4R0LB 4PGCB 3QDJB 2MHAA 5EU5A 1MFNA 4UU9A 3IVKA 2YD9A 5GGTL 1P7QA 5IT2H 4B53A 4D0BB 4LGPB 1XR8A 4M9PA 3LRSA 4HMDA 4HULB 5TQ2L 4LSTL 1CF8L 4EDWH 3BGMA 3QEUB 4KUZL 4XNXH 3VXRE 3MNWB 3HG1E 4JDTH 1RK0A 4HUWA 4NQSA 3OR6A 3OB0K 4ONFH 4Z76B 4WEBL 1C1EL 1FFOB 5IQ7H 4G8GA 1CN4A 5HHOE 2X9XA 2A73A 3GGWB 1A6WH 1HH9A 1YC8A 2PKDA 2Z0BA 1KIPA 3QHZL 4JPWL 3HNSH 4DGVL 3EHBC 3TYGH 2OR9H 2VE6B 4EUPG 4YHYC 3UDWC 4OB5H 1GIGH 2HTKD 5CEXA 3DXAA 3LHPL 3M8OH 5KSAB 1FNHA 5DD5L 2YBRB 4WW2C 1LO5A 1Z3GH 3HLAB 5L88L 1RZ7L 1I9IH 4QRPD 5C6TL 4PGEA 3PP4H 5D8JL 3WFBL 3LQZA 3QUZA 4JDVA 5EOCL 4KPHH 1KELH 4ENED 3HR6A 43CAB 5IUSA 3BP6A 4Q6IB 1HZHL 3JSSA 1UZ8B 2NW3A 1BOYA 5L2JA 5L2KA 3NPSC 5E4EB 1XF4A 4E0RB 4S1QH 5J6HB 1ZHBB 3MLSL 5E2VL 5CBEA 1KB9K 2GT9B 3ARED 3V7AE 2F19L 1J1XH 4TULH 1ZT7A 5BMFL 1NJ9A 5JR1L 4AIOA 5CZKA 4J6RH 1EJOH 5ESVB 1TIUA 4I5BA 4OZFG 1AO7E 4FTVA 4PJGF 1NEZA 1HILA 5K59F 1KG0A 3BWAA 2A0LC 2YD1A 1WC7A 3ARXA 3QNXA 1JPSH 3TV3L 4PUBH 2PW1B 2BVOB 5KSBF 1LNUA 7FABL 4OLVH 1I3RA 5D7IB 3U7YH 3EIFA 4G42B 2WWMD 3N0PB 3BW9B 4I0PD 3TN0A 2D0HA 5DR5H 3H9SB 4WV1A 2XA8H 2DM2A 1ZGLA 4WGVB 1G9MH 4QEGA 1MRFL 5D7IF 4EKXA 1XCQB 5IW1A 3VRLE 3TZVD 3MUGB 1TQCC 3FFCB 1DANT 5DK0A 1UVQB 4G9FD 4F2MA 1FNEA 4JO4L 5D4QA 3KPSE 3ARQA 1OW0C 3QZWB 3PJSA 3QCUL 1NDMB 5J4MA 3KYKH 3VXSB 1N6UA 4KV5E 1YY8B 1R24B 2VLLA 4WU7A 2CUHA 5E2JA 5DD0H 5J3HD 3OPZH 3GBML 1INQA 4L4VD 2WP3T 2PF6A 2HJKB 5F9OH 2XA8L 4FNLL 3QQ9D 1UADC 4W81A 2D4DA 4NZDA 3MNVA 3OX8B 5C0ND 3V52H 1N6QH 5E1AB 3IJSA 5ICXB 3PHOB 1CGUA 2IAMA 5HYSA 4WHCA 4ZUUB 1HCFX 4GG6A 5D72H 5D7JC 2PXYB 5DHVB 3LEXA 3O2DA 4HQQH 3QPXH 4MDIA 4J3OC 3OGCB 4QWWC 3ULSB 4HJ0C 1JUFA 1LP9E 5IMLA 3G5YA 1XT5A 2FB4L 4WDIB 1YY9C 1E28A 3R1GH 2P5EB 2Q86A 1QSEA 5TE4H 4GMSH 3MCLH 4HKJA 3GSQB 3MRFA 4MJIA 4O4YH 4MS8C 2CD0A 3FJTA 4NT6A 5E99H 2VLRD 25C8L 1ZOXA 4GAYB 4HIHB 5I1JH 3SO3B 3BYTA 2P5WB 2DQTL 1ZLSH 2EYTA 4WI2A 4QTHA 2FBOJ 3I75B 3TLRA 2Q7YA 4M61A 4AT6A 5FYJE 1V8HA 4Y2DC 5B4MC 1RIHH 1BF8A 3FT2A 5C7XH 2MCPL 1WV7T 3SDCD 2PTTB 2P8PA 4ISVA 4D9LL 1AXSA 1B0WA 4X6CB 1QFUH 3H42H 1M7XA 3SO5A 4B50A 4LEXH 3PL6B 2XY1A 3L3DA 4NC1C 4FQIL 3QXWA 4KZEL 2CLVA 3LKSA 1S7VA 1K8DA 2AK4B 3QNZB 3MOQA 4LLVA 2DF3A 1RAMA 5F88A 1G9MC 5H35A 3PL6C 1DBAH 5GSVB 5BZWB 4K71B 1EJ6A 1YJDC 3CZFA 4LLDA 3TIEA 3QB7C 1AR1D 1BIIA 1MIEH 3D0LB 4TPRH 2GJJA 1FCCA 4CVUA 2IGFH 1KELL 4BZ2H 2JKXA 2X4OB 4MMZC 3C5SA 1IRAY 1KPUB 2AJUH 1JPFB 4F3FB 5BVPL 4Q9QH 4FQIH 3LD8B 3VXTB 1KPVB 1WK0A 1JV5B 2YA2A 5JMRA 3IDJA 2IPKA 3DGGB 3GIVA 1NAMH 3IJYB 1YN6A 3VE0A 1LK2B 3TN0D 2I26N 3VXPA 5AYUH 2A6JB 3O11A 4GKSA 1DUZA 1QRND 3X11A 2PYEA 5BVJA 3DBXB 4HV8B 1KTDB 3ALWA 4XP5L 3AGVA 4UIKH 2DICA 2EDDA 3VXUB 4N8CH 5IFAL 1P7QD 4X4ME 1SBSL 3RL1B 5IB1B 3ETBF 5I1AB 1EAJA 4XVSH 3PQYA 4P2OB 5JORA 1MCPL 3G08A 1T3FB 2V5MA 4UOW1 1F00I 2HFEB 3MGAA 2NQCA 4LVOC 4IRJA 4NBYB 4JZJC 5DEGB 1RULH 3UJJL 4XMPL 1E27A 5EOTA 4ZOCA 3C2AL 4Y8AA 3LB6C 4KGLA 4LSVL 3QUKA 3SE3C 1XZ0B 1WT5A 4GXVH 5HYSG 1G7LB 3D48R 5ID1A 3GSXA 4UIKL 3QIUD 3BZEB 2P8MA 1KN2H 3B9AA 3CK0H 1OTTD 4H25B 1FBIL 2XWTB 4I9WE 3O3EB 3T77B 1FGVL 3QXAB 4ZODA 4FQCH 3GRWA 4GMTL 5CWSA 3UJJH 1KG0B 4LVHC 5KVEH 3KPSD 2X6MA 3DX7A 4R96A 5J11C 1DBKH 1C5CH 4HG4J 3BOVA 4EI5A 2VXTH 4D9QE 1A4JB 4X6BB 2W0KA 3AREB 2I60L 3SQOH 4QXTB 4ELMA 2IG2H 1CGVA 5HDQL 1S7QA 5J1TC 2GKIA 1QRNA 4ZSOE 4X9GA 2EDTA 1FAIL 2Y5EA 5A2LH 2P49B 1CDJA 4X98A 4M1CC 1FN4A 1M1SA 4M7LH 4POYA 3I9GH 1OLLA 4YJZL 3BEVA 3P0YL 3X14A 3MA7A 4KQ4H 5J0BA 1KTRL 4I5BB 3P9LB 3GHEH 2D7QA 3GMPA 1EZVY 5KBNC 5BRZD 3C5JA 3SGJA 3VG0L 1YEIL 5I17B 4HIIB 4JVUA 1WGOA 3S88L 3KPRB 3QUML 2R0WH 3CU7A 3MBEA 3FOLA 3MRQB 4NHCL 3UEZA 3ROOB 3M17B 1LE5A 2BFVL 3UJTL 4G8GD 4M62H 5D6DC 4IM8A 1FNLA 3CPLA 2HH0L 3IU4H 1L7TL 4KZEH 1UB6A 1KJMB 2OJEB 2OP4L 3VH8B 4N9OB 5MI0C 1H3UA 3RPIA 1OHQA 4B0MM 5J6HA 1T7VA 5JO5A 5DJAB 1ZLVH 1W0YT 4OLYH 1NAKH 1TZGL 4C55A 1CU4H 3HC3L 1DQDH 3I75A 1Q9KB 4HKZB 2C7UB 1QRKA 2PXYD 3RAJL 4J3WA 3DO3A 2GYSA 2IPUG 1AGEB 4K7PX 3EOAA 1RK0B 1WTLA 4PJCF 2VXQL 1DSFH 1G84A 1FRGL 1NMAL 5IROA 4HIXL 1ZVHA 1QUNA 5E4EC 1D5MA 1F4XL 1HXMB 5E8OB 5CEYB 3P11L 4XCEB 3L3KB 5DEFA 5AYUL 1JUFB 2AXFA 2SEBB 2FJFA 1X5AA 4M8QB 3VGAC 2MKWA 4XVUD 1JV5A 5DHVH 3QSKB 2ZSWA 4YHPB 1EX0A 1XF3B 2R15A 2QQKH 2X44D 4KTEL 1NEZG 3TVMD 2DN7A 1BD2E 2YD3A 3EFFB 4K3EH 3IDYB 3PDGA 1NFIA 3V5DA 5FYKH 4WW2A 5EO0A 4JDVB 4KKLC 2BRQA 4NQCE 4JQXC 3TYGL 4BSVA 4HC1L 3HCVB 4DGVH 4D94A 1Q1JL 3RNKB 5KJRL 4XPHL 4EDXB 3C9NA 4GXUN 4Y4HC 3QT2A 2AQ2A 2EDJA 4LCWB 4OZIA 4OQ1A 1YECL 3CDFA 3DRQA 2E27L 5SWQB 4NQVA 2JB6A 3ARFB 2NY3B 1T5XA 4MNHB 1F11A 4L4VB 5GRVK 1II4E 4QO1A 4KKNA 4OZGE 1Q0YH 2X89A 4YNYA 3O3BA 1BLNB 2EKSA 2H3NB 3VCLB 3MXVL 1IQWH 5FCUL 2ADIB 3P40A 2A77L 3AAZA 1ZVSA 2WINB 5D1QC 3RWGA 1QG3A 4WDIA 3IFLL 2OYPA 4PP1C 4HUVA 5DVNA 3O3AB 5FUCC 1LK3L 5IB3B 4RGNC 3HZYA 4JN2A 4WCYH 1R3IH 4P2OA 2A9NL 5TGBA 4UDUA 1ODAA 2AI0L 2YPVH 2W9DL 3CVHH 1G7HB 1YYML 1CFVL 1EJOL 2YD7A 2VLRE 4HSQA 5J12B 4PRAB 3KPMB 4MD5B 3BN9C 5KVDL 1QNZL 1LK3H 2R8SH 2BNRE 1NLDH 1CVSC 3FT4B 1S3KH 4LMQI 3EJYD 2GITB 4TNWK 3VXUD 1HXMA 2E9IA 3ARGC 2Y25A 5GS0H 1RZ7H 2Q8BH 3KJ4C 4M1DL 4K7FA 4FQ2L 3HRPA 1NDMA 4M6AA 3VGHA 3KHQA 2I9TA 2JCCB 3WV0A 4R26H 4U6YA 3PGFH 1NBVL 1OAYH 1BBDH 4DGYH 2AXJA 5FYLD 4R96B 3IGAA 1J9CT 5DT1H 3PHQB 2AEQH 3O45B 4XPFL 1X5LA 4OSUL 4P2QD 3W0WD 4ZQKA 4FQ2H 3WLWC 1UM4L 1JNLL 1CFTA 3SOBL 2EYSB 3UTPD 4QF1A 1A6UL 4XNXL 4XCCL 4AEIL 3GNMH 2QADD 1ZEAH 1BZ7A 2VH5H 1UWGH 1U8JA 3OKEA 5DT1L 4O02L 5EPMB 3DSFH 5J13B 5I1IH 4APQD 2D0FA 1LDPH 4Z78B 3MRLB 1BBDL 4LL9A 1A7OL 2EKSB 4RMTA 4Y16C 1LEIB 2VTFA 4I1NB 2D3VA 4AIZB 2WV3A 1RSFA 4PB0L 1L7IH 5FUZL 3T2NH 3EYOB 2YPKB 4UILL 4NJAH 4ZPVB 3I6KB 1ZA3B 5ECJE 3HI6L 3MLZL 1FPTH 1UWGL 4Y8DC 4XH2B 4OCWL 5DVMA 1G7JB 2QBWA 3D2UD 1OF2B 4GW5B 5JOEA 5ADPH 2FX7H 4X6EA 3PL6A 2YS4A 1T1WA 1K4DA 4ALAH 1FC1A 4HEPG 4P46A 4HWEH 4IHOA 3MLRL 5I1EL 4AM0B 5ICYB 3LN4B 3WD5H 3KXFA 2OBGA 2UWEA 3QPQD 2GJZA 3V4PL 4H5SB 4FG6D 2X89D 2MJWA 1D5MB 3NFPA 4G5ZH 3T2OA 3BZEA 3U4BL 2SEBA 4PJEF 2QR0A 1O7VA 4ODUA 1JYXA 4U2ZA 3EZJB 5HHOA 3WSQH 2WBJD 3C09B 4M02A 4JY5H 1ITBB 1A5FL 2VXVH 5K33A 3MJGX 4XPBL 1OTUD 5CGTA 3B6SB 4JKPL 1QBLH 5IKCB 4MQSB 3GIVB 3ARBA 5EBLA 1CICB 1MQKL 3EDEA 2GSGB 4N0UA 4P59L 4K9EC 3B8YA 3TJHD 1OQXA 1RZKL 2DQFA 3G04A 4U1GB 4JFYA 1D7FA 1P1ZB 3P4LA 4K71C 4M62L 1AXTL 3RBSA 1V7NL 3FB5B 3B9KB 3CLFH 3VFTA 5E8DL 1D6EB 2ATPB 2X42A 3P0GB 1A2YA 4JO3H 1MPAH 4E41E 1A1MA 2NXZC 3JTSB 4LCIL 2J8HA 1WT5C 3MRNB 2XZAL 1OAUH 3K0WA 3G5XB 5ITBL 5BW7C 4OLYL 2PCPB 3P3YA 3LQAH 4KROC 1WIPA 4GO6B 4EI5D 2YSSA 2DM3A 5KVDH 1EGJL 1QSVA 3GJFH 4NN7B 4E41A 3MYJA 3OKNB 4WWKB 1UA6L 2FSEB 3VJ6B 3FQUA 1CVRA 3GEWB 3U6RA 2GSIA 3ZKNC 3BIKA 5EUOF 4RSVA 1BQHB 5IHUL 4LSDA 4N5UA 3T4AA 3X3FH 3WJLA 2H32B 4LSQH 1AGBA 3GKZA 1QFWM 3O9WA 4Z7UE 4FFWD 5CD3A 3JVGA 3DWTA 4MAYD 3ZSSA 2A2QT 2V7HA 3UYRL 4AENB 1HWHB 4W4OA 4ZO6A 1ACYH 1UWEL 1P4BL 1J8KA 4NKOB 2HYMA 4EI5B 1OLZA 5DTFB 5T5NF 1FZOA 1HHHA 3K4AA 3CIQA 5MI0B 1U8HA 2ZCLL 3HLAA 4U1HB 1DVFC 1KNOA 1YPZB 1FGVH 3U48A 4QRSB 2ARJA 4HH8A 2L7JA 3ARFA 3HMXA 4WWKD 3DRTB 4OGXH 5ADOL 5C2BL 2DMCA 4PRPB 3DX8B 5J56B 4TNWF 5KW9L 1S9VB 4NNPH 1HH9B