3JV6A

Crystal structure of the dimerization domains p52 and relb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
TSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription factor RelB
total genus 16
structure length 101
sequence length 101
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv6A00
3RWIB 2W9DL 1RUQL 2Y07H 3DUSA 3H9YA 1GC1L 2FX9H 4AL8H 1WAAA 2DMCA 4QTHB 5HGDA 1JN6B 3EJJX 4YDKH 5GGSY 5DD3H 5CJBA 1S7WB 4HMEA 2B4CL 1FC2D 3K46A 3O45A 1AQKH 1HHGB 1F45A 2EE3A 3ZE1E 1RK1B 1GOFA 2OJEB 1AQDA 3H9SA 4LFHD 5HYSA 3Q2CA 1J1XL 4YHPA 2O93L 5C2BH 1CDIA 1RZKC 4PREB 4MDJB 2Y6SD 4Z7WB 1DUZB 3NZHL 4XXCC 3E0GA 4L9DA 5D96C 3SQOL 3B8YA 4NQCD 3HC0A 2EDRA 3JVGA 3NH7H 5FYKD 4QEGA 3VFGL 4CRPA 1JF5A 1MLCA 1MRDH 1RZJL 3Q48A 5EN2B 4PRHB 1U36A 4JDVA 5C0EB 3NAAH 3V6FB 2CGRL 4KK5D 3O3UN 2AK4B 4WW1A 3U0WH 3RTQA 1YNLL 1JGEA 2EECA 5I18L 5DJ8B 3LY6A 4ODSL 4ODVH 1QUNA 2YA2A 3EO1B 4OQTH 2X4RB 3VFWA 4AENA 2A6JB 3IU4H 4UQ2A 1YDPA 32C2B 3LPWA 4OD2A 1A22B 4D2NA 3QHZH 4PJXE 1X5AA 5FYKH 3QJFA 5IHZB 1N0LA 4R4FL 3T3PE 5C0NC 3PF2A 2RB8A 2HT4C 3TYGL 4Z7UE 4TNVK 3GUTA 5IMKB 2VISB 3CAFA 5H35B 1XFPA 1E4KA 2RBLA 2E8ZA 4P2OB 1QSVA 4UV4L 2VLKB 4XBGB 4Z0BL 3GIVA 3UYRH 4KHTH 4JFOB 1A47A 3X3FL 3K4ZA 3QNZB 4WHTB 4NO5A 3HNVH 1X5HA 3CVHA 5FA3A 3WIHH 3BZDA 5EOQL 3O8XD 3H3BC 4P46A 5IVXA 4RMQA 1CFNB 2YHGA 3E6HA 4X0KA 1RK0A 2X1XR 4PBWD 2XA3A 4ZPVB 3ULVH 1IFHH 8FABA 5TE6L 1TETL 4U1SB 3MA9H 1PYWA 2F53E 4ZAKC 3GI8L 4OZHE 4U1MA 5F9WB 4NZUL 4QCIA 2VLKA 4POZC 5KSVB 3RTQB 3QUZB 3MRDA 1KELH 25C8L 4KKAD 1Q72L 4OKVA 4MCYB 5JNYA 3QUZD 3LRGA 4G7YL 3Q0HA 2BVUA 3GMPB 5E2JA 2R9HC 3WMSA 3HMXL 4FMKA 4CMHC 1NANI 1INEH 5LGHL 4TSAL 2R1WB 1NAML 1EHNA 4WFHD 4OF5A 5EUOA 1FNEA 1G9MC 3CLFL 3UJTH 3M1BA 1G7MB 2XZAL 3FQXB 3HE6B 4GLRH 2HVJA 2CDEA 4HKZB 4Y2OA 1DCLA 5CD5C 5ETUB 1TCMA 5DI8B 3K4AA 4RISH 5I66B 1F4XL 3W9DB 1LEGA 5KSAD 4XRCA 4ODTL 1AE6L 2FEDD 1GPOL 1S3KH 1H0DA 5GGSB 1X7QA 3JWNC 1MWAA 2HWZH 1YQ2A 1MY7A 3BRGC 4MVBD 4N5ED 2D4DA 5CEYB 4DAGH 2C3HA 1AD9B 3SGKA 5GS0H 1OQXA 4Q58C 1PQZB 3MC0A 3RUGB 3WKML 3HUJE 3QXAA 2IBZY 1CFQB 1I9IL 3D6GA 4NKQB 5JW4Q 3BP7B 3WFZA 1FG9C 3MLTB 3LKSA 3V5KA 4KKBD 3IFOB 4HJJL 3BEVB 4FN0A 4MJ5A 4O5LH 1IGFH 5DRNB 4QO1A 1MH5B 1QRNA 4XX1E 1YEGL 1F3DH 1R5IB 2BXZA 3I50H 4EVNA 2BMKA 1TXKA 2EIZA 2ILLA 4HJJH 2GJJA 1FIGH 4JJHA 3ULSA 3PWPE 3GMOB 4XC1L 1QRND 5JXEC 2I5YH 1HHJB 4KJPD 1AO7E 1MH5A 1QRNB 1FZJA 1T0NA 2ICWJ 1RUML 4OZ4A 4RFNC 2A6KA 4GKNA 5T5FH 5GZOD 5FGBC 3KLSA 1WZ1L 2YEZB 4NZJA 4S0TD 5I71B 4LLVB 2NY6B 1QBBA 2KH2B 3DX8A 4IMKC 2K1MA 4OKVB 1ZA6A 3KPRD 4UINL 4YFEA 3NN8B 3IYLW 4LDEB 1UJ3A 2VNCA 1X4XA 4X9HA 2P7TA 1GGBL 3WXVL 1WIPA 1D5IL 5DJYB 3HE7C 3SKUD 4QHUB 2JLLA 3ESVF 3QEUB 3QUYD 4IOFD 4JG0H 5JHLH 3TT1H 3GMMA 1OB1A 4NJAH 4LPVA 1PG7W 1ES0A 2KZ1B 2BVPA 4NN6C 5F1SA 4N1EA 3B3IA 3D0LA 1ETZB 1PVHA 1YZZA 3VWJC 5C0AD 3SY0A 3B5GA 3JV4A 4MNQE 2HKHL 4MQXD 2E8YA 4WNQB 4Y4HC 1FG2A 3BP5B 3MJGX 4X4XA 1R3JB 4KDVA 3B2VL 1MQKH 4P3DA 2VDKH 4FP8H 1AFVL 2ZG3A 3LS4H 4HWBH 4QGTA 4QT5A 3ULUF 5I17A 1FVCB 2EH7H 3TO2B 3V6ZB 1HHHA 1CDGA 4KAQL 5FO9B 3BN9C 3OAZK 5HVFB 1F6AA 2WWMC 4NQXA 1KG0B 4G7VL 3FRPA 3BPNC 3MLZL 4OLUH 3GI8H 3UYRL 5C08A 3QDMB 3O0RH 3TBSA 4JFFA 5I15L 4ZFZB 2R29L 2KL6A 5JLZB 5FM8A 1NBVH 1ZLVK 3IGAA 1S8DB 4OD1H 3ARGB 5AAWA 1FE8L 2H26B 4N8VB 2Y7QA 3KPLB 3BGMB 3EO0B 2VERN 2VDNH 3U4BL 1OGTA 4XVUD 1TQBC 4EBQH 2COQA 1M7IA 3RHWF 4KHXL 1S7RA 3ZDXE 1HYSC 4L9LA 3HFMH 5DR5H 3MBEB 5SWSD 3QXDB 5AUMA 5I0ZA 1DTUA 1U41A 2XTLA 2ADIB 3BJ91 3L95A 3QUXC 1ZVSA 4LLMB 1LD9A 4Y4FC 3TESA 4K94H 3S34L 2FR4A 3RWGB 3VJ6A 2VDOH 5F21B 4YHNB 3PHSA 3K74B 1VFAB 2GUOA 3O8XB 4X5XB 5IOPA 4Z78A 3L3IB 3ARDC 3VXPB 3BKYL 1QFOA 4M8VA 5MERA 4LSQL 4JDTH 2FIKB 4LLQA 5HYQB 2D03L 3MRPA 4TOYL 2X42A 4F2MB 1JF6A 1TTGA 4KKLD 4X6DE 2ZCKL 3OKKB 3QUXD 5ACMA 5HYJA 1IBGH 4ZOAA 2YPLE 3W0WD 4F9LC 4KJYB 3LHPL 1RJLA 4GG6A 1CK0L 1T0PB 4EIZC 2VZTA 5IIEA 2FYYB 2HJLB 3HAEA 3UTZB 4LSSH 5LXGL 2FSEB 5B21A 4XC3L 5FF6A 4LEXL 4NO0B 3OXRA 1YMHB 4APQC 3EOAA 3LEYL 4XNQB 3ETBF 1SJEB 3G6DL 3QIWD 4M7JL 1A6VH 4I4WA 5IVXF 2A6KB 3MLYH 3QDMA 4Q6IA 5BJTA 4V2CB 5C2UB 3HNTH 4ETQA 4DQOL 1D5BA 1ZHLB 1X5ZA 4UZGA 4UV7L 3WFEH 4U1JB 1WBYA 3VXSB 5DD6A 4GKOA 1KN4H 1FYTE 4K9EL 3B6SA 3U4AA 5E9DD 4WY7H 1JWSB 2J5LC 2WQRA 2AGJL 3MRHA 1SY6H 5JA9A 5KJRL 5FUCE 3LZFH 3D0LB 3QP3A 5DMGD 3ARZA 2VWEE 3QSKB 3VFUB 4XHJD 4U0QB 3F12A 5EZIL 1Y6MR 3CFKA 4LRIC 3G5XB 4HEPG 3RVXC 1VFOA 1T1WA 4LSUH 2H3NB 1HILA 2VQ1A 5CCKH 4U1JA 3Q3GB 4M6NH 3RZCA 3VDBA 4X6DB 4KK5C 2VDPL 1QKZL 4HKJA 4JFFE 3A6BH 4GQPH 3T8XB 5DTFB 4XWGL 2LU4A 2MKLC 2OM5A 1QO3A 4DUVA 5B4MD 4MXWL 1IC7H 1FO0A 2PTTB 2X4PB 5LQBL 3BRDA 1U8JB 3KAAA 3MLZH 3C60D 3LKRA 1WZMA 1IGMH 2ESVA 1C7SA 4V1DA 4ONGL 2IFFL 4O4YH 1QSFA 4PJAE 4FFWD 1VEMA 4PJAF 5HGGS 4J3OC 5JORB 3WO4C 2B1HH 2FZ3A 2R0LL 3GBLA 3FB8A 2ZUUA 5F72S 1E28A 3DETC 1LK2B 4JFQB 5D7JB 4WO4C 5C0FB 5D2NC 3TBYB 1S9WB 1Z9MA 4BZ2H 1KJ2H 3CFBB 3MV11 3RGVC 4HLJA 3VU2A 5BRZB 4ZMAT 4UQ3B 1XH3B 2ICWA 2VQUA 3CPLA 3QNZA 2ZSVA 3QZWB 4CMMB 3UJIL 1LE9B 3QIBC 2A9NH 5D2LF 5KTEL 5ESQA 1ORSB 1M7DA 2OJZH 1T0MB 5INDB 3IVKA 4LARH 4ZODA 4F58H 5CMAB 3KYMA 4K23H 2YZ8A 3O2DL 3GSOA 3GK8L 4Q6IC 3BD5A 1NUDA 2VDOL 1UH4A 2Z91A 1GGIL 2BOBA 3MACH 4L4VB 4V2BA 3MUZ1 3QQ9D 1I9EA 1P4IH 4FS0A 4U1LB 5ADPL 3HCVB 3B2UC 2JELH 2WBJB 1FNSL 4DWHA 5IROA 3CFJA 4YH6A 1RFDH 1J5OH 2MOVA 3ARBB 4AIZB 3DO7B 4QY8B 4M61A 1ZSDB 5MI0C 1BQSA 1KV3A 3SCMD 4BFIA 2WP3T 4NQVB 2R2HA 1FPTL 4JKPH 3MOAH 1S7VA 3RJDA 3O3BA 2VB5A 2ZUTA 3OJMB 2CJUL 2GW5A 3QEQA 1WVZA 3VXRA 4Z77A 2DI9A 3MRIB 5KVFH 3ULUL 1JRHL 3VFRA 1Z6JT 3EOBB 5IVXE 2VITB 1KIQB 3AVEA 3U7AA 2X70B 3U0PB 3WJLA 3FRUA 3O6MH 2NY7H 1VGEH 3IETB 4KTEH 3EJZD 3O3BB 1WJ3A 4D0BA 2LFGA 4U7SA 4ZAKD 3HNVL 2VXTL 4YHOH 2BVQB 1VKXB 3GBNL 1ZSDA 1SYVA 5DSCA 1VADA 4X6CA 1F02I 1RK0B 1KLUB 4U7KA 1TDQA 3WD5L 4RGMB 5JW3H 3CFJB 5CIPA 1UWXK 5HHOA 1ACZA 1DLFL 5DHYA 3RVTD 1WIOA 5GGVH 5IJVA 2AQ1A 5JIIA 1MFAH 4Q2ZB 3MLPA 4KWUA 4OLXH 4OCYL 4P5KA 2HRPL 3SDAB 1KYOJ 2ADJA 3HNSL 4X6DF 2RAMA 1V5JA 4OQ1A 1CL7L 3S37H 3TJHC 3U48A 4Y4HA 5E5MA 3FO0H 5ESQB 2VE6A 3IDGA 5IROC 4JO2H 1AKJB 3H42H 4U3HA 1MJJA 3CZFB 3O3AB 3GHEL 1E6OH 2PR4L 3N9GL 1ZGLA 2P4AB 1NAMH 1HQRB 4Z6AT 3ARXA 4Q9QH 2OS7A 4Q9RL 4K9EH 3X12A 1H5BA 1JHLH 4WY7L 4C56D 4GT7A 2OP4H 4QOKD 3H7BB 1W0VB 5I1DB 3CIQA 4RZCA 4QRSA 4PGCA 5SWSE 1I4FA 1YECH 4OLEA 4ZFOA 3QIUA 1FFRA 3B9KD 3L3KA 4R2GC 2WIMA 4I8DA 1EA9C 5EC2A 2G2RB 5EN2A 5D5MF 5IQ7L 1RJZB 2EH8H 4LL9A 4G8GD 1EEZA 4CBPA 3EZ8A 5LAXA 1N4XL 1SEBA 1LDSA 4WGWB 1YYLL 1KCVL 4PJEA 2DQIH 1NBZB 4DZ8A 3VG0L 4LNVA 5TDPB 4W4NA 4ZNCD 4TTDC 3F5WB 4FQCH 4FTVA 2GY7B 2VR9A 5DVLA 5D4QA 1AQDB 3SJVA 4M7LL 3TF7C 1OAQL 4O5LL 2E7BA 1UXSB 1D6EB 4S1SH 4ESKA 3ARBD 1VERA 1IGML 4MSWA 1KXTB 4PRHE 2GJZB 1MFDH 2ZCHH 3OKMA 3KYKH 5AZEL 4L8SB 3NCBB 2ZJSH 2DMKA 4KK9C 4DCQB 5ITFB 1J05A 1KEMH 2H6PB 4PJIB 3ZT5A 2CLRA 3BH8A 1MCOL 3WFBL 3L3OB 3IU4L 1XR9A 2R23A 4G8GA 4D9QD 5JHDA 5DD5L 4FA8A 3MV9E 1V05A 4YIQA 4Y19A 2CQVA 3T0VA 1QSED 5J1AA 2AV7B 1OSPH 5J8OA 2G5BA 2VDLH 5DMJB 1TPXC 4IMKA 1B90A 3P9WB 2A6DB 3NFNA 4AM0A 2DQFA 5GQBA 4UIMA 5GS1B 2VUYA 3SE4A 3ARQA 5JHDD 3E6FA 4YHMH 3WFCH 2ADFL 4F7TA 4X99A 1X6LA 5FOJA 2CLZB 3EYSL 2L7JA 2FBJL 3FZUD 5JUEL 4IM8A 3O9WC 3D0VA 4C57C 2VXVL 3K1KC 4LMQE 4P2QD 4LLUB 2QKIA 3IDJA 3ZL4L 2F8XC 3O6LL 1MIEH 1F58H 2IQ9H 1QBAA 4NSKB 3H7LA 4GG6B 3OX8B 1CIUA 4J23A 1TETH 3LRHA 3OJDA 1NLBH 4NCC1 2DWDA 4N0UE 2BHYA 5CJXA 3TFKC 2X5PA 3QUMH 1KNOA 1QD0A 5I2IA 1G84A 3BO8A 2ICEA 4HPYH 5HHQA 3EYOA 4LIQE 4O2EA 3U36A 3MREA 2GUOB 3O8XA 4Y4HB 5E5MB 4YPGA 3VXPA 4ONHA 5EOQH 1V7NH 3EYOB 4O2EB 5D2LA 3EDKA 1MREL 3SGKC 3T0EA 3BIBX 1E4XL 4NN6B 1MCRA 3U2SB 4JQIH 1WFUA 4MA8L 4B41A 1FFQA 4XPTH 5CINL 4JO2L 4HUXB 4QNPE 4RWYL 2DI7A 1NAMA 2GSGB 4FNLH 1YEKL 2AQ2A 2E9IA 3BKJL 5FO8A 3B43A 4PRDA 1P84K 5KOMC 1ITBB 1MFAL 4TVPE 2BFVL 4G5ZL 1YEHH 3NCYP 4JFED 3EFFB 3RVUD 1ZT1A 1VEOA 4CVXA 3REWA 1KCKA 2HRLA 4JQVC 2GSGA 4XBEH 4PB9H 5DLMH 3X17A 4OCNC 1UA6H 4NRXA 5L0QC 3MCKB 3GMQA 2R0WH 3PL6C 3PIQA 4RMSA 2YPLB 2YPKB 5E8EB 4NZTH 1S7XB 3FTGA 4Y2DC 2D9QB 3PGCA 2G5BB 2XKSA 4FFZL 1A2YB 4P2RB 4PB9L 3T0AA 4JRXD 3GSWA 1F4HA 2ZCKH 3IXAB 3BPLC 5DEGB 4OZHF 3DWTA 4MNQB 4MAYA 4LGRB 5A40E 5CEXB 3SDDA 5IHUL 2Q6WB 4W6WB 3B9KB 3ZDZF 4L8SA 3HMWL 4QRUA 5I1LA 4FQ1L 4W81A 1BWMA 5F8QC 1UYWL 1RUQH 2Y07L 1C8PA 2CIIA 2ZUWA 3NABL 4LKXA 2VJXA 2GK0B 1S5IL 3NH7L 2FWOB 3RZWA 3FAWA 4YDKL 1FSKB 2DLIA 2ORBL 4GAGH 5E7BA 3S96B 1UJ3B 1R3LB 1P2CB 1SEQH 3BAEH 2P8LB 5D7LE 1MCCA 3FB6A 1J18A 3BQUC 4JM2B 4U1IA 2NW3B 1A6TB 4U6HB 2R9HD 3FZUC 1UEYA 1PKOA 4QRQB 5ACZA 1AO7B 2QADC 3EGSB 4R2GB 4XPBL 2MSPA 4LEOA 1OGAD 4G3YL 4OZIB 3RY4A 4NBZB 5FAAA 5J12B 3CUPA 4HF5L 1OAZH 2YXFA 3S3SA 4PYGA 1VACA 3RIFK 1F97A 4OV5B 1SMOA 4EI5C 4PJXF 1FJ1B 3W2DH 2FZ3B 4UB0L 3SDYL 2P45B 5C1MB 2RFXB 3GMNA 3DPBA 2B5IB 2QQKL 4V1DB 3U9PL 5KSUB 2XQBL 5MHSE 4I18B 3GSQA 3DXAB 3FQNB 3QXTA 3MLUL 4Z7VA 1JL8A 2DQUL 2E9WA 4HUNB 1BJ8A 1IAMA 1JTPA 3S36X 4EI5D 4P3WA 3QUZC 2CRIA 2KUTA 5CSZB 1UM4L 4CL7A 3LSOB 5TFSH 2OLDA 5K59E 4ZAKB 1PY4A 5E1AA 1FN4B 3TO4A 3LEXA 4HKJB 3KPSE 3OKOA 2L4OA 1DVFA 2DI8A 3VMNA 3VRJB 3BZEA 2FRGP 5I6XC 1RHHA 4R4NC 1BFSA 2IH3A 1U6AH 5D5MA 2VLMD 3S8WA 1YN6B 3KYNB 3TNMA 3WFHB 4KXZH 1A7OH 3QDHA 2OX5A 4XGZB 4RX4A 3OAYH 3L3JA 3KYNA 5CP7A 3RWDA 3TH4T 5INCB 3UO1L 4GJTB 5DUPH 1J86A 3TLRA 1U58B 4HT1L 5C08D 5IF0A 3FOLA 5E8PA 1A21A 4DKDC 4BA8A 5LJYH 1DDHA 3HMXH 4GMSH 2IF7A 3TT3H 3WE6A 2AK4D 4PJ7A 4I77L 3DJ9A 3RL1A 3SO3B 5C8JA 3DYPA 2D7TH 3SDXB 5F9AC 5T3ZH 4PB0H 4MNGA 4ENEC 1XCQB 5DQJA 5GISH 2P5EA 2NZ9D 5FK9B 5T1KD 1T2QH 4GS7C 5KVMC 5FIEA 3MBXH 2B0SH 4U6YA 2ZSWA 4I3SL 1Q9WB 3U4BH 2NR6C 4XNQA 4N68A 3OF6D 4QHKI 3BDBA 3MROA 2IMMA 1JNLH 1J8HA 1JGDA 1KYOK 1UWXH 2B0SL 1HINH 4OAWB 2J8HA 3I3DA 3T0ED 3K2MC 3TNNB 3L1OL 3QEGH 4PG9A 4H1LH 1QLEH 4X4ME 1XGQB 5DJZA 3MNVB 4Z7NF 4E0RA 1G7PA 3ARDA 4Y19E 3O41B 2CR6A 3ULVC 2R2BA 4NKIH 3FT3A 3OGCA 1KLUA 5EOTB 5JHDE 4APQA 2IPKB 2VRAA 2DQJH 3QCVH 4JM2F 3MLSL 4Q7DA 3HS0B 4PV8A 5L6YH 4N9GB 4GS7B 1CGYA 4RDQF 3RGVD 4XP1H 1L0XA 3IJYA 4P2OA 3UAJD 3MFFB 5T1DH 5BVPH 1EUTA 3MODL 3GUTB 4HWEH 4HDIB 1BZ9A 3GKWH 4KK6C 5HI4D 3EO9L 2JJUA 4XB7A 5JOFA 1QQDB 2VDMH 2AERT 1LO0L 4AEIL 3GKZA 5C0RH 2P8PA 4HPOH 5DHVH 3NGBC 1EJOL 4PR5B 1EO8L 2APWA 2LABA 1BP3B 3BSZH 4L1DA 2NY3C 1UWGL 4D3CL 1JMXA 3BVNB 5F88A 5KS9F 1LHZA 2X6MA 1CLCA 5F93C 1HQ4A 3G9AB 5KVEL 3MYJA 1MELA 4NQCA 4CJ0A 2I9TB 3FRUB 3NFSL 4A6YA 2IG2L 5INCA 1SBSL 4IRSD 5HTSA 3WL9A 5IBUG 2Q76A 1UWGH 5DFWH 4D3CH 1OSPL 3HCVA 3RIAF 3WS3A 3WNOA 4D8PB 3QR2A 1KLFA 3IDXH 3F62A 4L8CA 2HLFC 1KF9B 4JFYA 5C8JB 2Q8BH 2HP4A 3ULUD 2AV7A 5IM7A 2NXZC 5D72L 5FYLE 3MXWH 4R9HA 4JFXB 4K71C 2G60H 5TFSL 4YO0B 4AQOA 5C3LD 3ARTA 4JAMA 4ZUSA 1T1WB 2ZSVB 4PJGE 4CMMA 4Y4FA 4RMRA 2EO1A 1MCBA 2CLRB 3CH1B 3V4PH 5A2IH 3WXVH 1KIUA 3AY4A 4XGZA 5GRUH 3OR7A 5JDSA 1LK2A 2XTJC 5EDXA 5GHWH 1HSBB 2DQUH 4GAYB 2AJ3B 5IFJB 2BSSB 5DHVB 3VDAA 4F9LA 3BWAA 3CK0L 4QHUA 4QWWC 4XCCL 1S9YA 5L7XH 4X6EB 4M4PA 3H3KA 4LGPB 3W0WB 2YRLA 2ITDB 5FDWB 5D9SB 3CDGA 1NBZA 4EUPA 5JTWA 1NDMB 5FOBA 4JM2C 1U9KA 3IKCA 3MPCA 3T2OA 1LQSR 4LPYA 5J7CC 4G6ML 4WW2A 1QFUH 1ZWIA 1H3VA 4LIQH 5L2KE 4OJFH 4M7KH 4OGAD 3RKDC 4NPYA 1KTLB 3U30B 1G6RA 1AI1L 2ITDA 2EIBA 2GTWB 3L9RB 2I60H 4JREC 3ZE0F 2R4RH 5F89A 3PG2A 4TSAH 3O3EB 3QDJD 4LIQL 1UJTA 3B9KC 3KG5A 4NYLA 1G6RB 3A6OA 4PGCB 1QPPA 3L3OA 2CLZA 3RI5F 2AEPH 4NKDA 4P23D 1I75A 3VXRE 2OXHA 4PJAB 1YYML 1A4KB 1H5BB 2YZ1A 3BPLB 2GJ6E 3P30H 3BKCL 4K7PY 2D03H 3VFMB 4KUZH 1TZGH 3PDOB 4Y4FB 3BQUD 3MOQA 3GSXA 1R3HA 1CFQA 4TNWK 2VWEC 4LLDB 4HS6A 1A8JH 3GSXB 3LQZA 5ANMB 2HG5A 4XPFH 2XWJA 3QIBD 5D7IE 1CQKA 1RFDL 4N0YL 3QCTH 4UOJA 4KUCD 2XFXB 4GW1A 5HHOB 2BX5A 1K8DA 1T1YB 5EZOL 3I02A 3REWB 2ERJB 5IBLD 5LWYH 4OCSL 5T1LA 4LAJH 3G6JE 4MWFA 3BIKA 4AEIH 3TM6A 4A2LA 4MQ7A 1N5AA 5C0BB 5KVFL 1I4FB 5TF0A 3REVA 2CD0A 3VGGA 1NSNL 4HXBH 1FYTB 1DLHA 2NPLX 2GITA 4LVHC 1JK8B 3G6AA 5C07A 4Y89A 3O6FC 2FO4B 4R3SA 3IU3A 5DS8B 4NIKB 4OIIH 2DS4A 4Q9CA 5JNYB 2AS5M 1AR1D 2AGJH 4EZMA 1D5XA 2QSVA 2M1KA 4R4BA 5CBAB 3BWUC 3ZMRA 5FF6B 5CGYC 1A6VL 4YPGB 5IB1B 4CGTA 3NIGF 4RBPK 4NQDA 2AXGA 5T3ZE 4OM1H 1EJOH 3QWRD 3RWGA 3KDMB 3BSZL 1DL7L 4JO4L 1MAJA 1D9KC 2DWDB 1P53A 1UKTA 3HE7B 3MLUH 5IVOA 4RMVA 4NP4H 5C0CE 3MRRA 2QSTA 4NM8L 4IDJL 4XNZB 2F5BL 4L4TA 5GGRA 4WFFD 2EDHA 3VW3H 5EFIB 3CDFA 5DGRA 4P2RA 1QFPA 1I3GH 3HZMA 3TWCL 5CBAA 1RI8A 3RY6A 3DX6A 3OWEA 4RFNB 3HN3A 4OLYL 2CRZA 2FX8L 5FYJL 1OLLA 4U49A 2NR6D 5EWIH 4L3AA 2VC2H 2O5XH 5EU3B 4Q0XH 3L5WB 3VD7A 3P73A 2IAND 2NY5H 3EYFB 2DLFH 1JHKH 3HG1D 1OPGH 4P5TC 5EUOF 5C08B 3X14A 2EEDA 1ZVYA 4RNRB 5E00B 3ALWA 4NUGH 4BYHA 1OAQH 3M07A 4M1DH 4G9DB 1M71B 4FXKB 5IW6B 3F58L 4TUJA 5DJ2B 5KVDL 4MXWH 3V6ZA 4JVWA 1G7IB 2H1PH 5FYJD 1KCUL 3UPRA 3DSFL 2CRMA 2Z4QB 2JJSC 3DRTA 1TCRB 4OSUL 3KWWB 1NMAL 5IFAL 5FKAB 5EA0H 1WV7T 5CSBA 4XP6L 2H1PL 4HKXB 1TMCB 1AGBB 1MIML 4OCMC 1B0GB 1T7VA 2NW2B 2VLME 4QXGL 3D18A 2P49B 5I30L 3DGGA 2IBGA 3D3VA 5HHVL 2EIDA 35C8L 3VWJA 2VAAA 3WNLA 5AYUL 3MRGB 3OAYK 4PG2A 1A9BA 4QXUL 1J8HE 1JIBA 4XXDA 1HINL 2YMXH 3QFJB 5FB8B 5E4EB 1OCWL 1AE6H 4TPRH 1ADQH 2A77H 1BF2A 4AZ8A 3HC3H 3MNWA 1HXMB 2OYPA 3ZSSA 1EERB 4JPKH 3FQNA 4WV1A 4BZ1H 3T1WA 1G7HB 1HWGB 2J8UA 4P2QA 3LQAC 4H1LA 2AABL 4HGMA 4CMHB 2LVEA 3VRJA 3ZLQC 5ISZD 3STBA 4TPRL 5E8DL 1HH6B 1MJ7H 3DRQA 1NFDF 3BZ4B 4X8JB 3RNKB 1QBLH 2IANE 1UXWB 1Q9WA 5DQ9A 4J3VA 2WAHA 1SHMA 3NPSB 3GGWB 1KJVB 4LEOB 1O7VA 3VCLA 3BZFA 4K71B 2OK0H 1OTSD 1JZ3A 2NXZB 1MJ7L 5C6TH 4G6KH 3LN5B 2R2EA 4ELKB 3D85A 1IAOA 3G08B 3AY4C 3RNKA 2OSLA 1AXSA 4QTIL 1S7SA 1BIIB 1NKOA 4IBLT 5J1SC 2Z8VC 2X09A 5DD0L 5KSBF 2OL3L 5JO5A 1CICA 2VDRH 2VLJD 4PJEF 3SGDH 4ORGB 5I1LB 1FNHA 3EGSA 1IZJA 4FXGB 5FYJU 4HFUL 2IG2H 4HUUB 1LWRA 5DTFA 2AJYL 5BOPA 5GJSL 5FB8A 4HIJB 2NW3A 5GRXG 4A6YH 2EZ0C 1DQDL 1XIWA 2V5TA 4WI8A 3MYZA 5DEGA 1N64H 3EOYG 3RQ3A 5DZLA 5FGCE 1W72B 4XNMA 4XAWH 3L3IA 4YR6A 2H3NA 1WK0A 3D18B 1WBYB 4BKLB 3EAKA 4LLMA 3M8OL 4XMKH 1KTDB 4L8CB 1A3LL 3RUGE 3WV0A 4OZIE 2Q86A 3JV6B 1Z0MA 5B8CA 4KVCH 1E4KC 3CFCH 4NFCA 3QXDA 1CF8L 1YEHL 4EI6A 4MD5B 3BHBA 1U8KB 5E95B 2I07B 3V5HB 5BRZD 5HHPB 4NM8H 1GGTA 1NCUA 4JFEA 2H2PD 4NM4L 4KZEL 3CK0H 4KRMB 2MFNA 4DW2H 2P8MA 3QEHA 3TBWB 2E7CA 1FRGL 3VGAB 4I9WE 3QRFM 4YFLF 1U8NB 4X80H 1L6XA 4ZFZA 2UZYB 4U3CA 1MLCB 1MJ8H 1PG7X 4PY8J 1KLGA 2Z0BA 3MR9B 1PKQA 5F1IA 1NFIA 3MV8B 3QEQB 1FP5A 1E6JH 3FO1B 3K7UA 5L9DL 3MGTA 3FB5B 4WW2F 3MSPA 5A3IC 4OSUH 1BAFL 3GB7A 4JPWL 5FHBL 5DJ0A 3NIDF 2XN9A 3T77A 3H8NA 3P2TA 4XCNB 2APBA 5K9OA 3SGJA 5F9JA 3ALPA 4NN7B 2R2BB 4ZFFA 5BRZA 1AKJD 4YJZL 2DOCA 5B39G 4ZUTA 1MJUL 4PG9B 1AIFA 1ULVA 1PZ5A 5KZCB 4M8QA 3HAEH 3IRZA 3MMEB 1DEDA 4ZUUB 5AWNH 2D7OA 3A67H 1FZMB 4JB9L 4NO5B 4P59H 1ADQA 4X6CB 1NFDB 5F9JB 3ARFC 4MJ2A 1HK6A 1S7QA 2AKRA 4JFOA 1MCIA 3HR5B 3KYAA 4PJCA 3MROB 5C6WH 3MJ9H 5T5FL 3JXAA 2XG4A 4X7CC 1ERNA 4I0KA 2UWEA 4I48A 3VI3F 3RWCB 5ELIA 2W9LA 2X44D 1IILE 3GJEB 4EI5A 2X7LB 4NQUA 1IQDB 5HGHB 4UV4H 3VGEA 3GNML 4F7MA 4U2YA 4WO4D 4Z77B 5DQJB 2CJUH 2W60A 3EKCA 4DZBB 4QHKJ 2XQBH 5ID0A 5F97E 1EEUA 5IGXH 1TZIA 1ZA3A 1TVBB 3ZYOA 3TT1L 1F6FB 1IGTB 3O11A 5FO7A 3DX9B 3GMLB 4LHJB 4DGVL 2EYSB 2OK0L 2A77L 4NJAL 1SY6A 4WO4A 4RFEB 2DBLH 1PAMA 3HZYA 3VXOA 4OCSH 4Q97A 1U8HB 2J5LB 3CMOL 2GSIB 2VXTH 4KK9D 6CGTA 1G1YA 5EORL 4I18C 1XGRB 1TIUA 3QO0A 1SM3L 2CKBA 3T08A 4G8IA 4FQPA 4PLNC 1QBLL 4KI5F 5D1QC 2VZOA 1NPUA 4MB4A 4KC3B 5ANMA 2M2DA 4PREA 1KPUB 5C86A 1OD9A 1PSKL 3L6FB 3DSNA 3GHBL 4OB5H 1NLBL 4TTDD 3VI4F 5F96H 2QADB 5GRJL 1EGJH 1QA9A 4PBXA 5TDPA 4HD9A 5KANI 4YPJA 4R0LA 5I1EH 4DCQA 3PJSA 5ICXB 2Z8RA 1QG3A 4DVBB 2Y1VA 4JQXA 2F54A 2W0KA 2BY3A 3RWHB 2X4TA 2H9GA 3V8OA 3OF6A 1UM6H 3FB8B 4R26H 1RHFA 4OI9A 4AT6B 2H2SC 3VXOB 5T3ZL 4R90H 5JIHA 5HGAB 2BJML 3SE9H 4XP5L 3ESUF 2Z93B 2EYTA 4ZOCA 3CMGA 5K9QG 1I8KB 3ZKMD 2F54D 2R0WL 4P46D 1N2RA 5GJTH 4RQQA 3DURB 4RGNC 1R5IA 4IEFB 3N1MC 1HH9B 4DZBA 4HIHB 5IW1B 2H9GB 4PJIE 4FFVD 3O4LB 3PV6A 4WW2B 1MWAL 2RCSH 3BKML 4N1CA 2FX8H 3F6LA 3KLDA 2BNQD 3ZYZA 1I3VA 4HFWA 3TCLA 2DD8H 4PLOB 4WI3A 3W0WE 3ARRA 1WTLA 2AJVH 4Y4KC 4UDUA 3QUZA 5KSVA 5L0QB 4JZJC 1MCWW 5E99L 1EZVX 2FIRT 2QL1A 5H37H 2YKLL 1KCRL 1RULH 1PBYA 3AC0A 1F3DJ 4ZSOB 4JANA 5IFJA 5BXFA 1F13A 1NCAL 1NL0L 1J05B 1L7IH 1BJ1H 1LDPL 3OR7B 1ODAA 2NY1B 5JDSB 3RDTB 1CZ8L 1TQBB 3WUWB 3KPRE 5DHYB 2GJZA 4JRWA 1XGRA 3QO0B 5FHAL 3SE8L 3T0DA 4MGXA 2VLKD 5I1HL 5EO0B 4JM2D 2W9DH 2VZSA 5C3TA 5D1XB 1OL0A 2KQMA 4JZOA 2HMIC 2K7PA 2EKSA 3QIWA 5I66A 3Q1SH 2B7DT 3NPSC 1MHPL 5ENWA 2BSRA 2YD8A 5IM7B 3HE6A 1A3RH 4Y4FD 4UB0H 2ITCA 2X1OA 3PDGA 1QR4A 3FO9B 4YDLC 1WWAX 2DYPA 3KPPB 2XPGA 1CICC 1D5IH 3PNWA 4P23B 5F70A 5IB2A 2EXYC 2PO6B 1CGTA 2QSCH 3MGOB 3N50A 4XMLH 3FN9A 5E4EC 4Q9BA 5ETUA 2NXYB 4KTYA 2CDFA 2E9JA 1IGIH 1IC5H 5BMFH 2JJSA 4LCWD 3FQXA 4K8RL 4OZFB 3DROB 4X7FC 1VCAA 4MZ3A 1I9RH 1IEBB 4M03A 4JVPA 3LD8C 4CU8A 5CBEB 3I85A 3Q6FB 1TNMA 3SDXE 1I7TB 3BPCB 3SKJH 1CXEA 3RVWC 3MXWL 3FL7A 3VXMD 3V52H 3IFPA 4HWUA 4GW4B 3IDNA 4ODUA 1J7VR 4E5XB 1KTRL 1JGVL 1Q38A 4HIIA 1H3PL 4LPTA 4YC2C 3GSVB 3U36B 4AEHL 3NN8A 2AI0H 1ZMYA 5B39A 5D1XA 1FV1B 2BRRH 3MJ8A 4X9GA 2X4SB 3JWOL 3RDTA 3OXSA 5SWQA 4OTXH 5A16A 3D39A 1U3YA 5J6HA 5DVMA 3OZ9H 2ED9A 4JANB 1PJ9A 5FGBA 2AJYH 3CFEA 1EH9A 1MHEA 4ZO8A 4PJDE 4YDJB 2BNQB 2QKIB 4P5TA 1NJ9A 4YHLH 3CXDH 4R26L 5E08H 1TVHB 3V4VL 5IT2L 3RX5A 1OWRM 4MA7L 3P4LA 4GKZA 2UZXB 2I24N 2YEZA 4R3SB 1W0YT 5I8CB 4U3XA 2ZCLH 1EGJL 1IKNA 3E6FB 3BZFB 3M8OH 2V2WB 5J56B 4KQ4H 1DQLL 4R6UA 5GJTL 2I60L 4J2XA 1FZJB 1T0NB 1XZ0B 3UTSB 3BX7C 4Y5VB 4ZQKA 4XNZC 4LSVL 3P4OB 1UH2A 1JNNL 3MV8D 5DLML 2EE2A 1LK3H 1T2QL 3MV7E 4PJCF 2P5ED 5DD1H 5CWSB 2Q3AA 1RVFL 2JK5B 2CIKA 1B3JA 4OGAC 5SWZA 3RRQA 3S97C 5L8KB 4JGJA 4HS8L 5E2WL 3IDUA 1NEZA 3OKYA 2X4OB 3ZDYE 4XVTH 3PNWB 1BFOA 5K9KB 4KZDL 3MUHL 3NBNA 1MCEA 2FGZA 3JV4B 1C5DB 1IC4L 1C5BH 3QWOA 2NXYC 4JHAH 4WVRA 3WUWA 4MMXC 3EYUL 5EU5B 4M43H 1OAYH 4L3EB 4RRPA 4TVPH 1YEEH 3WFHA 3OKNA 3D2UB 5J0BA 1M6OB 3NCCB 2W91A 1CICB 4P2QE 4YX2L 1A1OB 5DC9B 3NACL 1PG7L 3EDFA 4KGJA 4YZFE 3DGGB 1YEJL 5HDQL 1NGYA 3KPSB 2YD5A 5DYOA 2P44B 2ZWLT 1JUFB 3DV6A 4JM4H 3RI5K 1UB6B 5IQ9B 2WUBL 2BY2A 2P48B 4L3EA 4PGZA 4ZAKA 5C6TL 5T1LD 4EDWL 2ERJC 1SEQL 4FXGA 4OZ4B 3UTSE 1C5DA 3KJ4C 5FKPB 5I8CA 1WAAF 5FA4B 3UBXB 1BIHA 2Y72A 4Y1AE 3HI1B 3NVQA 4OZFG 5BVPL 4XVJH 3LKPA 4O58L 4PRPE 3VFVA 4C83B 5CLWA 5IVNA 3DXAE 2NY1C 5AWNL 2AP2A 1SY6L 5EIVA 3VXTA 5HYJD 3ARFD 3ISWA 4U6XB 2E3VA 2DTMH 3TA3B 4C4KO 2BXYA 4IS6A 1J10A 3EZJB 2VZUA 3MO1A 1AGFA 3LN5A 1EO7A 1YJDL 5J6HB 1MNUH 4PJ5B 1CIDA 5IP4A 4KJYA 1C5CH 1VEPA 2GAZA 5IR1B 4Y4KB 2DLEA 5CZVL 2D7QA 4Y5YB 2XZQL 3V6OC 4JG0L 1KCSL 1A9BB 3K2UL 2P8LA 1A6ZB 5DXWA 4D0DA 1UM4H 1LNUB 5IMMB 1XF2A 2HLAB 1WWCA 1WSST 4YHNA 2DLFL 2FR4B 4J6RL 1B0GA 2YS4A 3K2UH 5E8NB 4DOHE 3OKNB 3TN0B 1OP5H 3RP1A 3UP1A 4JREB 5ISZB 3G04B 1FVDB 4LP5A 4AEHH 1J87A 5D1ZD 4L9LB 3N1FC 1WZKA 3OKKA 4KKNA 3LV3A 5GS2D 4MAYB 3IDIA 3QHZL 5KBNC 5FYKE 4HJGB 4M1GL 4YGVB 3ARBC 1FNAA 2XI9A 2CKBH 2NZIA 4X6BB 1ORQA 4MXQC 4QF1B 3V52L 3VXUB 2XN9B 1JJUA 4YAQB 4XB8A 3LQAH 1JWUB 3SJVD 4XNYH 5BZWB 5E24E 3FB5A 3U0PA 4HT1H 1DBBH 4H20H 3FHAA 2C4FU 2D0HA 2ZUQB 2RQ8A 4YHIB 3ALXA 4Q6IB 4C4KT 1I1AA 2DQDL 3D87B 3OKEB 4I77H 3VG0H 3LH2H 1JF1A 1NAKL 2AI0L 4OI7A 2MQ3A 4LU5L 3AS2A 3QIBB 1G9NL 2BRRL 4J3TA 3P0VH 3TGXA 4N90D 1MCNA 5F7YC 1IGJB 2DN7A 3GRWL 3K8KA 4JFPB 3RGVB 4BFIB 3WIFB 1B2WL 1IGTA 3O11B 5CILL 1S7QB 2AKRB 3BGMA 4NNPH 4X6BA 4M5ZH 1YUHA 2R8SH 3ARBA 4AIZA 2A83B 4NO2B 4PJBE 3IFNL 2J4WH 5F1NB 5C0EA 4FMFA 3OJVC 4U1LA 5HGHA 3C5ZA 5HDBF 3G04A 4UMGA 4G8EB 4Z8FL 3FMGL 2P42B 3VXNA 3O2WH 4KROD 4LHUB 1UA6L 4DKEL 1FGVL 3EYVA 5F44A 4HBCH 4PRAA 5DEFB 4CN4A 2FJGB 4WI5A 3ZZ1A 1UT9A 4JFHD 5IMLA 1I8IB 4YX2H 1XR8B 4Y7MA 1DR9A 4B50A 2EXWC 4LRIA 3RWJB 1VGEL 3CFBA 1R3IL 1FGVH 4GOSA 1AIFB 3ARFB 2MMXA 1IM9B 1A5FL 1RQ5A 1FAKT 2XOTA 4HHAA 4OCWH 4I5BA 5IESL 2H41A 4LHQB 2CR3A 3PP3K 4JRXE 3C87A 3U7YH 1T6VN 3VXTB 1OAYL 1NCDH 3CSPA 1I1CA 5EZJA 4IRJC 3HG1E 1A7QL 3BHBB 1VGKB 1I3RB 1F8TH 1OAKH 1F4WH 2HH0L 1T1XB 3HUJB 3BAEL 5C71A 4XC1H 1I9IH 1P9MC 5BW7A 5SX4I 4MJ6A 2HT2C 2DJSA 4GLRI 1RZJH 3MA7B 2YC1B 3QXAB 4O02L 2E6QA 1AC0A 4MQ7B 4PJFE 1AY1L 5B38A 5AEAA 5HYSB 2ZUQC 4UT9L 5I1CH 2I07A 3V5HA 1NFKA 4XI5C 1YNLH 4LSTH 2R56L 2MHAB 2P24A 4PS4H 1KACB 1OD7A 1W8NA 4IMLB 1FFPA 3LOWA 3FQWB 4UT9H 4S2SA 5E94B 4C54A 3E8UH 5I1CL 3IJHA 1CLZH 2DJ4A 2BY1A 3Q6GL 2DRUA 3LQZB 4GUPB 5DURD 3HR6A 4FTVB 3L6FA 1M05B 3TN0C 3LRSA 2NX5B 4GKSA 1N4XH 1G9NC 4DZ8B 4Z7QE 4MJ6B 2X4NB 3K4DA 1NDGA 1OTSC 3GMPA 5KVDH 1ZT7B 2E27L 1I3GL 1T1XA 4WI4A 3TWCH 1MHHB 4XPAH 1U8HA 1W0WB 4RQQB 1VGKA 4YDIH 2V5SA 3QUYB 5EU4A 2YD2A 4WHDA 3VFOB 1EAPB 2EYTB 3T04D 2JJVA 1YPZE 3Q5OA 2ZCHL 5AZEH 4DFHA 2GTWA 3L9RA 5D6DA 2R0KL 5BVJB 2I9LA 3WKNA 4LRNL 4LSRH 4AQ1B 2HAZA 1P7KB 3VWKD 1JWMB 3QA3A 3X12B 3ZTNL 2DQCL 2ATPB 4PY8I 2DF3A 4AK1A 5EBMB 1IM3B 1GZQB 1NMCC 5I73B 1QNZH 1A0QH 3L5IA 1V7MH 3KPRA 3IAGC 1TVHA 1EHLH 4KQ4L 3IDGB 5ALBL 1KJ2A 3ELAT 4IRZH 1PYWB 4FHBD 4JFXA 5E6ZA 3R4DA 3N1GC 3GSUA 3E6HB 4JFYB 3JWDC 1OW0C 4X0KB 4MCZA 5FDYA 4P5TD 2XKNA 5C0ND 4LGSB 1X7QB 3T4YB 2FB4L 1J0ZA 5TGBA 4F8TA 1IC4H 5K9QI 1LEGB 5J12C 3QCTL 4A6YB 2J2ZA 5IEKB 3AREB 2NYYD 3IJSB 4U1GC 5HY9B 4LVOC 2YMXL 4XTRC 5C0GA 3CMOH 2CDEB 4HKZA 3OKLA 1LGVA 1MI5E 3DECA 1IKNC 2ARWA 1RJCA 2WP3O 4K07A 5HDQH 1XZ0A 3R8BB 2XTJD 3T65B 4UTAH 1IL1A 1FAIH 4WENB 4ODWB 3Q6FA 3NA4A 5ILTL 4ZO6A 4BH8B 1JK8A 3VFPB 3W39A 3T65A 3BMWA 4LMQI 5EU3A 32C2A 4OD2B 5C0DA 1RIHL 3GKWL 1ND0A 3NTCH 1Q94A 1F6AB 1MIEL 1N0XH 3U46B 4WTZA 5DEZA 2HFGH 5HD8D 1DLFH 4FQJH 3EOTH 5IK3A 5I1IH 4X6FA 1WT5C 5LCVH 3NCJL 4FXKA 1RV6X 1MPAH 2BNRD 1UADC 1P7QB 3CGTA 1K8DB 2R4SH 4OZGA 3MRRB 1OAXH 4L5FH 4BQ8A 5GGVY 4PGDB 3HPLA 5JQ6L 5FM4A 2QR0B 1RMFL 1CVRA 1MVFA 3PWVB 4PIRF 2HG5B 5H37G 5CZVH 4P4KA 1GC1C 3V4VH 5TPWH 4E42A 4HIIB 1YMMA 3FFCA 1XAUA 2P7TB 1P6FA 4JZOB 3WLWD 1RZ8B 2IBZX 4OGYL 5I8KH 2ICEB 1MUJA 2OZ4A 4HK0A 4CN1A 1X5KA 2ZG1A 2PW2B 3U4EA 2X41A 3AAZA 2V5MA 4H26A 1FORH 1OTUD 4YBQC 4F7PB 1UACL 1R5WB 4CUCA 5EZLA 2J6EA 2V2TA 1HHJA 1XCTB 2XYCA 4H25B 3DXAA 4P3CL 4NFDA 3REVB 3TA3A 1LP9B 3QNYB 3IRPX 1F3JA 4X80L 5F6HJ 4JKWA 4KTDH 4XCYA 1HDMB 1EAPA 4MWFB 4XP9L 4CJ1A 2PYED 3Q5TA 1YYLH 4HBQA 4IHOB 2GCYB 2IMNA 1P4LB 1JP5A 1U8PB 2IALB 2XZZA 4Z18A 5EG6C 1AGDB 4XP4L 1IM9D 4M02A 1OP9A 5DT1L 4GW1B 4OLZH 4UU9B 4N0CC 5JPMA 2GIYA 4FABH 1BQHA 2JTDA 2P46B 2YRZA 3LKSB 1X5YA 3QDGA 1S9XA 4DGYL 3ZKQD 2PXYD 1YY9C 1CXLA 4X4YB 1I7ZA 4FQ2H 1LO3L 1M4KA 1UFUA 5D1ZA 1ONQA 4BZ2L 2NTSP 4LVHB 3WHXA 3UJJL 4KJWD 4FRWA 4M6OL 1T22B 4PJHB 3C5JB 3UTTD 4Z76A 4FFYL 4E41B 3LEXB 5HI5C 3OB0H 4ZXBB 5EU5A 1K2DA 4AYFA 5HSFA 1S5IH 2OMNA 4M6OH 4ZDHB 4XXDB 2QQKH 3RIAK 4YEFA 3PWJA 4TULL 5D1XC 2I27N 1BFOB 4U33A 2VIRB 4F37F 2ZKHH 2VAAB 3GIZH 2ADGA 4F37K 3S5LA 3SKNB 5D7KE 1T7ZA 5DI8A 5BS0E 5A2KH 4Z8FH 3BZEB 3HE7D 4ZPTA 2VL5B 1TPXB 3EDJA 2VLJB 4NC2B 2MNUA 1INQB 3O3DB 1AR1C 4WFFE 3IDXL 3OAZH 4JZJB 3SOBL 3MNZB 4HUWA 3THMH 2NY4C 5BQ7B 2GFBB 2XWTB 3F7PC 2CH8A 4Z7VB 1Z9SA 1YJDC 3UPRB 5DJ6A 2QJDA 1P2CA 1G9MH 1G1CA 1SM3H 1FNSH 3MJ6A 1N3NA 4XCYB 2B2XL 1CXKA 5T5NG 3V7AE 1JGLL 1DSFL 1FJ1A 4GXUM 4KTEL 5CZXC 3KPTA 4DFIA 4HHAB 1U3ZA 3MNWB 4N9OB 4POUB 1Z0NA 2YD3A 1QSFD 3QQ4A 1PW3A 1QR1B 2HFFA 3MRPB 1CDHA 1YQVL 4I13B 1X5XA 5C9JB 4FQHB 3BUYB 4OF0A 1U2CA 4NQDB 1RMFH 3QFJD 2CUIA 4RWYH 4OLUL 3G5ZB 3H2WA 1P9MA 4QLRA 2XQYK 4TVPD 4OTXL 4EQ3A 4LDLB 1VPOL 4OM1L 3MCKA 3SE9L 2NNAA 1N26A 1RZFH 1JNNH 1CR9H 3NCJH 1I8LA 2IPTL 5J9PB 4ISVA 3IFLL 4YGAB 4PTUA 2PR4H 4PS4L 1U8LB 2XTJB 2I9TA 1KELL 25C8H 4WUKL 4MLSA 3IB4A 3WHE0 5EBWB 4Q9RH 1VADB 3RPIB 3UMTA 4IDJH 5BOZG 1JGDB 5CHNA 4L29A 3VGFA 4HUMB 5LGJB 1OGAE 3C9NA 1S5HB 3GSNB 2APVA 4ZTPL 3G6JB 1BQLH 1CU4L 1MFBL 1CL7H 4IRJB 5DQDL 2PO6D 3MV8A 3ILQD 4FFZH 4N0UB 5D1QD 3R1GL 4U6YB 2PYFA 3V4UH 1DBAH 2XA8L 1U8NA 5DJAB 3JV6A 3MRIA 2UWEB 1CFTB 3GMRB 1XCQA 4OGXL 3WXWL 4RBPH 4NQCB 2F58L 3BJLA 3WE6B 4YAQA 2FH8A 3AB0C 4RX4D 5FHAH 3SE8H 5ESVB 4JPVL 3BUYA 4PY7B 4JQXC 4YGVA 4QRRA 1KUMA 3V7AG 1GZPB 2WBJD 3U7WH 4XPGH 4OFPA 4M8QB 4LK4A 3D69B 3O45B 3MNVA 2NY3B 2IQAB 3NIFE 4JO3H 4QYOA 1YEJH 5HGDB 3TNMB 1I1YA 3MRCB 5KSAB 3GEWB 5EOCL 3U7WL 3GSOB 1BBJA 3NFSH 2VLJE 1JV5A 4PPTA 1LP9F 4X7EC 4C56B 3KLHC 1WIUA 4HGWB 4G3YH 5BS0B 4M6ML 5EOTA 2IAMB 1BAFH 1C1EH 2HFFB 4IIQC 4KMTH 5FUOL 1Q8MA 1R24B 4LKCB 4HGKC 3U0TB 4Y4HD 4HAFA 1E27B 3KJ6H 4HIXH 1GGIH 1FIGL 5IW1A 1KGCE 3QG7L 3O4LD 4MD0A 4CVUA 1KN4L 3CDGB 2IADB 2I9LB 4OCRL 5CZXD 4HUVB 1QSFB 2BOCB 1EVUA 5EO1B 5E5UB 1CCZA 1KEML 5JZ7D 1C5CL 4BH7B 2MCPH 3QWRA 1CFSA 5KSBA 4ZFOB 3WJLC 4R96B 3VH8A 1MRFH 3IAQA 5TF1H 1JPTH 4ELME 3C5SA 4NP4L 5F7FA 2ZOLA 5DD5H 3OMZA 4HWZA 1A14H 1Q0YH 5IW3A 4NWUL 3WS6C 2MCPL 3U0TA 5L2JB 2DKMA 1QACA 4OQTL 4EUPB 4L9LC 5HPOA 3IDMB 1ZT4B 4PJ7B 2XZCL 1UCBH 3V0AC 3QNXA 4PRBA 3FOLB 3PWUB 4NZDA 4G6MH 4NNXA 3DI2B 5I8EA 4OCXL 4PLJC 4FQJL 3UO1H 2NLJA 15C8L 1YQVH 2N1KA 1BECA 5E9DA 1FNGB 1QEWB 1FE8H 3TIEB 1W72H 3FQWA 3BD3A 1FFPB 2WBWB 5D93C 4JN1L 4UT6L 4HC1L 1HHIB 1VFBB 3W9EB 4Z7VF 4HAGA 3GBML 3NCYS 4PLJD 1KB5B 4JAMB 4LASL 3QULA 4WWKC 4G80B 3QIUB 5BV7H 3VG9B 1JHTB 4XWOC 1KTLA 1G7MA 4H8WL 3ROOB 4QHNA 1NBVL 1KBGH 4JFDD 1W0VA 3H7BA 4XP5H 2A74A 3HMXA 4M4RA 4GG6F 5DD1L 4MD4A 3KR3L 4DKEH 1V7NL 3I9GH 1RJZA 1ZS8A 1HEZB 4HDIA 5ACLA 2OZ4H 4OZHB 3UBXG 3FT4A 5C0CB 1QLRA 1Q9KA 4MJIA 2YBRA 5LBSL 4NQSA 4KKCD 4LF3A 2GYSA 1FZMA 3V8CA 2ADJB 1MQ8A 5IVXB 2B5IC 1NAMB 1PG7H 1KPVA 1OF2B 1X5IA 3MRKB 3PP4H 4L8BB 4TTGA 4O2CB 3D9AH 3EHBC 1BZ9B 4HBCL 2F9BT 3CH1A 2BOBB 2AXFB 3CZFA 3O3AA 3KDMA 3LMJL 4GRWB 3FCTA 4Z95H 1EEYA 4JQVA 5DA4A 2ATKA 4BK4A 5E5RB 5IB1A 2BVQA 3WDHA 4UI2A 2P47B 1QLRB 3BXNB 5GIRB 5C0RL 2B39A 2P5WB 1UJ3C 3TO4C 3RGHA 2F53D 4PJXB 4KI1A 1U8IA 5IHZA 4Z7UB 2XRAH 5DUML 3RU8H 43C9B 1Z9LA 1P7KA 3A6CH 5FFLA 1P7QA 4AENB 3P9MB 2H45A 5C09A 5T1DL 4OZFA 4ZO7A 3WFDH 5IB3A 1VKXA 4Z0XB 5IEHA 1JGEB 3X13A 5T3XD 2CDFB 2CGRH 4B7LA 5GS3A 3ARGD 1JZ8A 5JOPE 2BVYA 4KDTA 1NBQA 4G6AC 1H8SA 3RL2A 1T20A 3RVVD 4BJLA 12E8L 4Y2DB 3QDJE 2J12B 5TF1L 4KY1H 4I3RL 1FLRL 1ZGLP 1LO5A 4K8RC 4HCRL 5A1AA 3P40A 4OFKA 4YZFF 3MBEC 1J12A 1PKQE 2O5ZL 3I02B 1NCNA 4GUPA 3IJSA 5SX5H 5IEKA 4GAJL 4OCRH 1CF8H 1U3HD 3VWKA 4M1DL 4YC2B 2XT1B 3ZE2F 3BP6B 3VW3L 5D7LD 1CD9B 3MUY1 3H0TB 2UV3A 1WICA 5CCKL 1EJ6A 4MCZB 3HKFA 4X7SH 1KXQE 4DN3L 5D2LB 3K8LA 1RZ7L 3RKPA 2NX5E 1U92B 4GSDH 2O5XL 3NFPB 5FM5O 3ZTNH 3LD8B 4NQCE 1ONQB 4UTBL 1NGXA 5EU4B 2SEBB 2B1AH 3P4NB 3CX5J 1SVZA 1IC7L 1KNOB 3QWQB 4P9ML 4S11A 1NLDL 4K3DH 4LLVA 4KGLA 5EUKB 2EH7L 3P4MA 1D5MA 4IRSC 1LO3H 2GI7A 3INUL 1OHQA 4U6HA 1FYTA 4P2RD 43CAA 1BQHG 4P23C 4MA8H 3QUMB 4QHMB 1TJIL 4QOKA 4WWID 5DC0A 3P9LB 1WQVT 2R2CA 2SEBA 1JZ4A 4PRIE 4YDLB 5KG9A 4PJDF 2WUCL 4GRLC 1AR2A 1QVOB 1IQWH 4KUCF 4WJ5A 1WC7B 5K9JL 1KTKE 2Z92B 4MZ2A 1A0QL 3HPJA 2VIRA 4J4PC 43CAB 2HKFH 4QRTB 4PP1D 3A67L 3S88H 1JPST 4MXVE 1OARH 3MV01 4C55A 4GRWF 5DJXA 5DO2D 5EUKA 4MJ5B 1FFOA 4U6VL 5ICYB 4LCWE 4K7PX 3O9WB 3DIFA 2A1WL 2J4WL 1NGXB 1P1ZB 3T0EC 2UY7A 2FHFA 5B3JE 2AEQL 1PQZA 3J7HA 1A1OA 4OCWL 3CFKB 4KUZL 3FB7B 2DQJL 2YPLA 5E8EA 2MKWA 5HI3D 3SPVA 3GMRA 5DRZB 3SDXF 2CLVA 5LAXB 5FKAA 5B4MC 1Q0XL 1JTTA 4JR9L 1U8MB 2Q6WA 3V0WH 3VXME 4X98A 2Z4QA 1INDH 1BLNB 2HVKA 3BEWB 5KS9B 3MUGB 4L3CA 1NEZB 3QUKB 4QRRB 3JZ7A 1B4JH 1H5BC 4WW2C 4L5FL 1YY9D 3FQTA 1HCFX 2F8OA 2HJLA 1LP9A 2YPKA 1A6AB 2FJHA 2EEBA 1CFTA 3X14B 1EX0A 3NTCL 1DP0A 2AVGA 1N6QH 4ZUVA 3U30C 5HI5D 3U4EB 5KW9L 1YNKL 4YHIA 3RNQA 1S7UB 1ZEAH 2RJMA 1S5HA 4NQXB 4X8XA 3DX6B 4U31A 1NUNB 3NOIA 4EDXA 4ONHB 3S3JA 1F4YH 2BNQA 3TBVB 5EFIA 5IOPB 5CJ5A 5DJDA 3QPXL 5D70H 1MY5A 5CINH 1KB5L 5HHQB 2F5AH 4M93B 2OP4L 1K4CB 1H3GA 3T09A 3NMEA 1YECL 3BP6A 5HI3C 5I74C 5HYJB 3TNNA 1OP3H 5ISZA 4OLYH 4HWBA 2Q1EA 3U6RA 1Q0YL 2R56H 1M7IB 5FGCB 4KDTC 4LLQB 5HYQA 5DEFA 1TFHA 3BMVA 3GSWB 2AJUL 4XCNA 2NY3D 5IWLA 1VFAA 3ARDD 2VR5A 3CFCL 2IH1A 2VMFA 3VXNB 3MGTB 1PLGL 2UY6A 4H5SA 2DDQH 1J8HD 3O41A 3WNNA 2NMSA 2ZOKB 4MVBC 5BQ7A 1GH7A 1ZLWK 4PJIF 1R3KB 3KPSD 3MBEA 4PJDB 5EC1A 1E28B 4XZUA 4NO3A 1PDKA 3SDAC 1AGFB 1GOHA 1T6WA 2X4RA 3VFWB 4LCWB 5D71H 5C0IB 3ILPB 4JGMA 4AIOA 2DQCH 5CHNB 3CSBA 5F8RC 4RGMC 1L7IL 1ORQB 4RAUB 3STLB 2CRYA 1MSPA 2O61B 5LQBH 1CZ8H 4MD5A 3ULVD 1BLNA 2HVKB 5KS9A 3SBWC 1HHIA 4AEFA 3LV3B 3L3DA 3FRPG 1FO0B 2PTTA 2X4PA 4TUKL 4Y0GA 4H8WH 4ISVB 5J1TC 3FQUB 5I1JL 5AYQA 4P2OC 5JMOC 3PHOA 3UDWC 5IFHH 4P9MH 2NQCA 3S4SB 2VDQL 2PETA 4F9PC 5D5MB 1CBVL 3P77A 2V7NA 3W11C 1MHPH 3IJYB 1JHTA 4QXUH 5E8NA 2HYMA 2YRPA 3IS1X 4KKLC 3HI6L 2XIDA 3J8F7 3O2DA 5FGSA 4P5MA 4PRPB 3GJFH 3SKNA 4MXQD 5HPMB 1G9NH 4NN7C 4CU7A 4MHHG 4LP4A 1MCJA 2YD1A 5E6ID 2CKNA 3QFJE 4HIJA 2R4RL 3QO1B 4HS8H 4UUJA 2JB5H 2C26A 1FVDA 4Y4KA 4PLKD 4HWZB 4L4VA 1U3JA 3I6KB 1HZHL 4NKMA 4RAVB 3L5HA 4N0YH 2WBJC 2X1QA 4N0RA 4UBDD 3E2HC 5I75C 5CMAA 3VMOA 2VDLL 4IOFC 5JORA 3PUCA 1G7JB 3VGAC 4QXTA 3VXMA 4P48A 1TZGL 1CK0H 2FCBA 3HC3L 4JZNB 3MLSH 3CC5B 1YY8A 5GXBB 2BVOA 1U91A 5KVGL 5E8OB 3QJHA 1FGNL 5C7XL 1E0OB 1KJVA 1J0YA 1JWMA 2XZCH 5DK0B 2X9WA 2VABB 4FOMA 2R4SL 4JKKA 3QDJB 1F2QA 4JZNA 2NX5A 3VGDA 4JR9H 1R3LA 4J8RB 3UXFA 4UNUA 1AKJA 4HGWA 5EO1A 3PGDA 4N0FB 5JQ6H 4L4VD 1UKSA 4F15B 2DKSA 3SO3C 1RIHH 2VLLA 1D5ZB 3RWEB 4OF3A 3WO4B 4O00A 4I5BB 1MHHA 4WTZG 1YEKH 2ZPKH 4UDTA 4DVBA 5DUPL 4FQXC 2YD6A 5LCVL 1MNUL 1PSKH 3OR6B 5IBUB 4WEMB 4R0LB 1CTNA 1MOEA 4M7ZC 4JO4H 4MJIE 5CKGA 5IMLB 4XVUC 3F7RA 2F19L 1E4XH 2VE6B 1C7TA 3NIDE 4KY1L 2VLRD 4KKCC 4D0BB 4KRLB 5DDHB 3UC0L 4R97B 5EUOB 1DQDH 1Z5LB 4M9PA 4N5EC 5I6XB 2VITA 3CCHB 4U1HA 1VFUA 2R39A 1U3HC 1YEFL 1ZHNA 4N8PA 3CLFH 4CVZA 4Z5RA 4X5WA 4M62H 3H42L 1J9CT 2YUXA 3MRJB 1EMTH 4W70A 1RULL 3GRWA 4L3ED 4DN4H 3I75A 1HYRC 2VUOA 1MFNA 3SE3A 1LO4L 1FDLH 2ARJQ 4Z0XA 5IHUH 2HVJB 5IEHB 5CJQH 2KKQA 3C6SB 1A7PL 1TZIB 1DBAL 2YWZA 2X05A 4QRRD 3VD4A 1NMBL 2AK4A 1KENL 3W81A 4OFVA 3P0GB 5L88H 1HE7A 5CEZD 1NGWB 4M43L 3MXVH 3VFRB 3QPQD 3W39B 1A4JB 4PJGA 2CUMA 4OZIF 1QQDA 3KNBB 3ARFA 2OCFD 4UAOC 1NLDH 2DAVA 4Y16A 2XKNB 3GJEA 4X9BA 5D1ZC 3V0VA 4EI5B 1ZGLB 4XWOD 4AJ0A 4JPVH 3UZEA 2DQDH 3ABZA 1Y6NR 3HI5H 2WZPD 1WGOA 1K6QH 4J7RA 4TNWF 5INDA 3JUYA 1KJ2B 3GFUA 2AK4E 4APQB 2EKSB 1KCVH 4XPHH 3MRMA 4FTVE 2HMID 4P59L 1PGRB 1T5WA 1ACYH 4P9HH 1X5FA 2BY0A 1N6UA 1FSKC 4HPOL 4G9FA 4NGHH 4PJEE 1L9MA 1JPFA 4GBXD 9CGTA 3PQYE 1IVLA 5KSBE 5EIQA 3U2SA 3ZT6A 3HLAA 4P9HL 4OF7A 1G6VK 4Z7WE 2YBRB 3TZVC 5CUSL 3DUHA 2KZWA 1XGUA 3D25A 1IE5A 3RKDD 2PYEE 4UDUB 1XGPA 3IDNB 1QRKA 12E8H 4LSQH 4ZFGH 4KRPD 5GSVA 3O8XC 3BH9A 1U8QA 2ARJB 2ATPA 1NDGB 2B2XH 1A4JA 4N8CL 4PJ7E 2NY2D 3O4LA 5GSRA 1HKFA 1Q0XH 4GFTB 1U2HA 3P0YH 2EEAA 5IUSA 3VFOA 3BIKB 1HHHB 5GS0D 5T1LB 3CH8A 1KB5A 3SKMB 4W68A 1XR9B 2R23B 3QIWB 2EYRB 5CIPH 4YXHH 4BQ9A 5T3XL 3BEWA 5ERWB 3RWHA 4PJIA 2XPGB 4JRXB 2DYPB 4KV5F 3SCMB 1LILA 3O81A 4G6FD 2W0FA 2XFXA 4HMCA 3O4LE 5EBLA 2DBJA 2XWJB 1TJGL 3GMMB 2DWEA 1YA5A 3ZKSD 1CGXA 3QH3A 4G8FB 3KLHD 1OW0A 2Z9TA 3OPZH 1D9KB 4M1CD 1DBBL 3C5ZD 4S1DD 1FVCA 3TO2A 3V2AR 3F5WA 3BPNB 4OT1L 2HA1A 1INEL 1R3JA 4CADB 2ZP0T 1JZ2A 4HPYL 3CZJA 3ULVL 2FGWH 1TJIH 4NC1E 3B9AA 1EGJA 4UOW0 4PJBB 1NQBA 4P99A 4RISL 2Z92A 1JGUH 3MJ7B 4KVCL 1YMHA 3QHFH 4ERSH 3I6LD 1NC4A 2FGWL 1JHLL 2W0LA 1QVOA 1FIEA 3PGFL 5DJ6B 3NCFB 3WLBB 4YQXL 3S88L 2EIZB 5EU6D 3P4OA 3QQNA 3G5VB 3OB8A 4RGOL 4LPUA 2PXYC 4TRPL 1NC4D 3B83A 2BNRE 3UROR 1D5MB 1LK3L 4U2ZA 3PV6B 2DQFB 1V3KA 2WV3A 4YQXH 1U8OB 5BV7B 2NY6C 3MXVL 3MO1B 5DF0A 2PF6A 2UWEE 1PFCA 1GGCH 5GS1C 3MRQA 1YMMB 3FFCB 2W0PA 3TYFB 4Z78B 1NC4B 4DGYH 2QBWA 2AAVA 4PBVC 4EVNB 2R0ZL 3OQ3B 4TVSa 5EZLB 2AJVL 3F7VA 3W82A 1XIWD 2O26U 4HK3N 5SWQB 3QQ9C 3S3PA 4XVJL 2VR4A 1DANU 3OKMB 5EZOH 4PGDA 2VKXA 4DOHB 3VXUD 3AFLA 2Y36H 4UNVA 1BGXH 2JJWA 2DIAA 4XNUL 2VN7A 3SQOH 5M95B 4F57L 3NIGE 5EA0L 3AGVA 4L8SC 3RUGA 4XP6H 5ADOL 4E42B 1ROWA 3VXSA 1S78C 1BFTA 3CDYA 1F4WL 3RA7H 3UEZA 3NAAL 4NHUB 4JHZA 3X3GL 3LPFA 4EN3C 3MUJA 1ND0B 4ETQB 4LAQH 2Z31A 2R1WA 1UQSA 3TH2T 4JHBA 4FQCL 5DK3A 4RIRA 1PY9A 3O2DH 4DEPC 2R1YA 1U8QB 2AJSL 2ARJA 3KWWA 5IHBA 4GW5B 5CBEA 1MEXL 3RIFF 3IDYC 5HHXL 4POYA 3X11B 1MHCB 3NZHH 3X3GH 5EC2B 5E56A 3IAPA 4WFGD 3EFFA 3QT2A 1SJXA 3QQ3A 2H32H 4POZD 5SWZB 1R5VA 4MA1B 5DJ2A 2A6IA 1H3UA 1T5XA 1JI2A 1N7ML 3QQ3B 2DTSA 3SN6N 1Q1JL 2H26A 2V2TB 5I16B 4G9DA 3U1SH 3X11A 3SDDD 3SGEI 5CUSH 4LCUB 3MMEA 3VRLF 2AQ3A 3RVTC 2ICES 5MENB 5D7IF 2Q86B 2AXJA 3ZKXC 5B8CB 3AS1A 3DBXA 1U95B 4WU7B 3TIDA 1JYWA 3L3HB 2VDPH 5MERB 3V4PL 3V7MA 2BC4B 1MHEB 1FL5B 4ZS7L 3ULVE 5D7JD 4QT5B 3R06B 2JKXA 4QTIH 5HVWA 4HV8B 3RTQC 1IFHL 3GSRB 5HYFA 3OKDA 5F9WC 4WNQA 1NCWL 1CD0A 3MA9L 1Y18B 4JFHE 3ZL4H 4OT1H 3NA9L 1MAML 4KK8D 4P4RB 1KGCD 2OTUB 3L7EA 3DYMA 2Q7NA 1BOGB 2VLLB 4G7VH 4NRZB 4LPCA 5HD8C 1DFBH 1M7DB 2G75B 3L3HA 5KANG 4WTWA 3QUML 3VFVB 1P6AB 4JY4B 5IB5A 3QHFL 2R2EB 3DNKA 2IJ0C 2VO5A 3TC9A 1FO0L 2ZSWB 3MLVL 4LASH 1TVDA 3CSYB 1Q9OA 4MQSB 4LCUA 4FTVD 3L3GA 4JN2A 3UJIH 2P5EB 1BQLL 1CU4H 1MFBH 3HC0B 5ALBH 5T1MA 4M5ZL 2BVOB 5C0BD 4NQEE 1JUFA 1N8ZB 3ZYIA 4JFFD 5CKAA 3N1QC 4XH2A 4WDIB 5BCAA 4NZTL 4WV1B 5DHXB 1WLHA 1FZOB 1FG2B 3BP5A 3UBXA 1KJ3H 4LOUD 2HT3D 4KH2A 2LVCA 1H3WM 3O6FD 5MI0B 4JJ5B 3PGFH 1QO3B 1T7WA 2YKLH 2VZVA 3RTQD 5MEQB 1XF4A 3VXSE 1KT2A 4PJGF 3IS0X 2OR9H 4P57A 3MFGB 4KKBC 4MNQD 3RWEA 1DVFD 4HJ0D 4RMTA 1RHHB 4Z7WA 3V4UL 5JIPA 3E1F1 3QISA 1T0MA 4ZD3H 2DMBA 3EYUH 2XRAL 3MLYL 2DD8L 4D0DB 1ZT4A 4OV6F 3G5XA 2Z35A 4TVPL 4JPWH 3G08A 4YDVB 5KW9H 3CFDA 1GGCL 1XMWA 1RAMA 5L2JA 4HQQL 5ADOH 1G7LB 3MLWH 5HHNA 1GGYA 1B4JL 2GT9A 2ZOLB 4G8GE 1MFDL 3LKOB 1U91B 2CXKA 3CVIL 3O2VH 4PTTA 1FQ9C 4WFED 5KS9E 5DD3L 3KJ6L 1RUMH 3VXMB 1MCQA 3JWOC 4D9RD 5KJRH 5F9OH 5FO7B 4HZLB 4C83A 5MEND 5DFVD 2H32A 3D85B 3E8UL 5TE7H 2BNQE 1OM3L 4OIIL 4KVNL 2OTUA 5BJTB 4DKFL 4A6YL 4PJDA 4R8WH 2NZ9C 3QDAA 4QRQA 4KRPC 5ACZB 4QOKE 1L9NA 1MRFL 4EOWH 2WANA 2ZOKA 5E8OA 3SOBH 1E4JA 1A6UH 4JY4A 4LQFL 1XGPB 4ZO9A 4LSTL 3TVMC 5EZJB 5F71A 4XPBH 4JY6A 4QXTB 5ABDE 4XMKL 3C08L 1MCKA 4JDZB 2AW2A 3FO2A 1P5VA 4XBGA 4LHUA 4Q9QL 1Y0LB 1P7HL 1BD2B 4P57B 2A0LD 2X4TB 4Z7NE 3QUXA 3RVXD 4F7CA 4G8EA 1CFNA 1KXVC 2BRQA 5A43C 1IM9A 4M9OA 5J4MA 5D72H 3O4OC 4BUGA 2CKBB 3QCUH 3RWJA 4GH7B 4Z7OF 4Y5XA 4AG4H 1GZPA 4ZFFB 3R8QA 2EYRA 2A6JA 2HTKD 3DROA 1NMBH 3ECBB 2AJZA 2YSSA 4ZS6D 3WS6A 4TUKH 2R1XA 3DX9A 4RDQG 4JFPA 3RGVA 1N5YH 3BGFC 3K3QA 2DQTL 3MA7A 4Q6YA 4BSVA 1A6WH 1CT8B 1QNZL 4XPAL 3U9UB 5ID0B 2PTVA 5E6IA 1AJ7L 3O6KL 5GSRB 4MYWB 4PRPD 1YEIH 5HHMD 1XF3B 5L9DH 4QHLA 3STZB 1GAFL 5C07E 4ALAL 2CXGA 3QEHB 3TBWA 3SGDI 2BNRB 1LO2H 2D9CA 1SYSA 3DMMA 2ZNWA 4LSRL 4LRNH 1CE6B 5EULV 1SQ2N 2R2HB 2VXUL 2EYSA 3JUZA 3OKLB 3HR5A 4U6TA 3SKOB 4XBPB 2EDKA 3LH2L 1DQQA 2AJZB 2YSSB 3C6LD 3DMMB 1CD1B 3M45A 3BQUB 4LSVH 2FB4H 2DICA 2AK1L 4M7KL 3TPKA 1JPSH 3H6JA 2L7UA 4I0PC 5A16B 8CGTA 4U1KB 5FYLD 4CVZB 5KTEH 5ITBH 4NNPL 2ITCB 4GMTL 4IRZL 5L2KA 1AHWB 5F7NC 2R8SL 4DUXA 1FZKB 1Z5LA 1FPTH 4O9HH 4LQ1A 1TQCC 2AEPL 4ZSOA 1AGCA 1C5BL 5AYUH 3BXNA 5GIRA 2B4CC 2DYPD 2PUQT 4Y4KD 3HS0A 4PV8B 4ZSOE 4RA0C 3P30L 2ATKB 3PE9A 1AP2A 1AGCB 1EEYB 3BDYH 1NCBL 4G9FE 2YOCA 5K59F 1W2KT 1HZHH 5IMKA 1AHWA 5L2KB 5TDNA 1IM3A 1NFIB 3D48R 1T03H 2FO4A 1CGUA 2JE8A 5JDJA 3ARWA 2QEJA 3QXUA 5B22A 1KPVB 1OF2A 1PEWA 2GJ6A 4C59B 5F1KC 3QA3B 1OB1B 1DLHB 3PL6B 2N56A 5CFHA 2FH6A 1FC1A 2DBLL 3EO9H 2AXGB 5JXAH 3IDJB 5I76A 3VE0B 5I9QC 3WFDL 1F00I 2D0FA 2HRPH 1DQJA 4O58H 4LPWA 4G6JH 4GQ9H 4K2UL 3QRGH 5FEBA 1IAII 4X98B 2X4QB 4OFIA 3DO3A 5EOCJ 1WEJH 2DM2A 3FO9A 4MD4B 5FUOH 1VDGA 4MAUH 3VRIB 1NGWA 5T3XE 3SO5A 2EDNA 1RU9L 4BSVB 1F8TL 5FDWA 3VXRD 3V95A 4XCFL 1WZ1H 4YHPB 1EFXD 5A2FA 2FD6L 1T2JA 5AG9A 5GJSH 1T1ZB 3W9EA 4OLVH 4XMPL 2F5BH 1HSBA 3FN0H 4OM0L 4EEEA 3ZDZE 5FKPA 4FNLL 5GPRA 4PJBA 2W0FB 2FBOJ 1BFVH 1A4KA 2BVPB 4PJAA 4JHWH 4EXPX 4ACPA 1A7NL 4QRTA 1PLGH 4CADA 4DKFH 4EXKA 1WC7A 4C58B 3AS3A 4LCCB 3BDXA 3SJVB 5I8OH 1A3LH 3WHXB 1BFVL 1H3TA 5KG9B 3TJHD 1FNEB 3LS4L 5GRVK 1U8OA 2X89D 3BN3B 3VFMA 1YC7A 2QQLL 1FH5H 2G9HB 1MWAB 5FV2A 5DMKA 3S4SG 3QAZB 4Z9KB 4IOIB 3P4MB 1GRWA 1G6RH 1NCWH 4XRCB 1I1FA 4KQ3L 3VE0A 5I71C 3SDDC 3GSQB 3L3KB 4XWGH 1QFUL 3D25B 4QCIB 1QFWL 4PJ8D 2CPCA 3LKPB 4H25A 4EQ2A 3LN4A 2ZUXA 3P9MA 3PL6A 3UTSA 4QNPF 1RZKL 2ZUSA 4YHLL 4GRLA 7CGTA 2F54B 3P11L 2DIJA 3KPNB 3BEVA 1CVSC 4ELMA 1I7RB 5GISL 5GSVB 1WT5A 5BZDB 2NY5C 3WSQL 2Y4SA 6FABH 4L4TD 3P4NA 4JM2A 4CNIB 2FIKA 4UIKH 5F7HA 1H8OA 3GSVA 1NAKH 3CD4A 2VXQL 5T1KB 4FG6D 4EIGB 4GW4A 4KROB 2EDDA 1U95A 4WU7A 1KIPB 1MIMH 4I3GA 2A73A 3WFBH 4KROC 5FGRA 1I7TA 5J6GA 3BDYL 3B9KA 4LOUC 4EBQL 4OZFH 1QLFA 5ERWA 5E2TH 1JPSL 2OI9C 2VXQH 5B39B 3RY6C 4UTAL 1YYMH 4M7LT 2BVTA 3L5JA 5F7DA 1GSMA 2A6IB 4GMTH 2PN5A 1MCPL 5CP3A 5IG7A 1I9JL 4JGUA 2VN4A 4LCWA 1ZTXH 1B9ZA 3PGCB 4G6KL 2Q3ZA 3DBXB 3D2UD 1S8DA 3K81A 5LXGH 4L3EE 2D4FA 3BPCA 4GXUN 4P4KC 1X9QA 4RAHA 3TBSB 4F7EA 1TCRA 3AUVA 1QSEA 4DUWA 5I1GH 1CWVA 4NRYB 5IB5B 3GSNA 3C8DA 2UUDK 4TSCH 1DUYB 4XI5D 3BRFA 1I3UA 4BKLA 4NOFA 5I1EL 1SJHA 3DOSA 5IW6A 3QAZC 5F7EH 1IAKB 3TPUB 1B0RA 4G43B 1XIWB 2CUHA 3L7EB 1FBIL 3NZ8B 3MUGA 4KI5D 2ICCA 1AY1H 1I85C 3KPPA 1IEAA 4N0CD 2P5EE 4WUKH 2V2XA 2R1YB 5J9PA 4TNVF 3CX2A 3L5WA 5F6HI 4CVWA 5TQ0H 4P2RE 4OLVL 2Z31B 3UC0H 3MRLB 4P2CG 1QFWM 1OAKL 4WEBL 4CAGA 3SE4C 3DVIA 4O51A 2IH1B 2KPNA 3LEVH 5HDOA 4ZTOH 4YEEA 1Q72H 1RUPL 1E4WH 4BSWB 3C8KB 1LNUA 4JHWL 2QV2A 4HFUH 2BCKA 4LQFH 4NJ9L 1NGZA 2FECL 2OSLB 4H88L 2FDBP 4BQBA 1LE9A 4UV7H 3WFEL 3GI9L 4W6YB 1DQLH 3RNQB 3DV4A 1D6VH 1SBBA 5D5ME 4M6NL 2FD6H 4YHKH 1P69B 1JNLL 1RSFA 3DUUA 1TZHB 1CGWA 2ENSA 4ONFL 4OM0H 2IAMD 3HPJB 5LBSH 1TLKA 4PJ5D 1MVUA 3QCUL 3WLWC 1HH6A 3DRQB 4IJ3C 1CDJA 2KBGA 2IANB 4Y1AA 4KPHH 1ZAGA 2ID5A 4ZFOL 3QDJA 4BM7A 2V7HA 4J3XA 3V6FA 3LKOA 5IJKA 4P3CH 4FQIH 2XWTA 4XNUH 4O4YL 3TZVA 2ZUYA 1D7FA 1U8MA 1ZANH 5HHNB 1D9KD 1G9EA 5GS0L 4DK6A 4PGEA 3QO1A 1HSAA 3QJHB 1A6AA 3D85D 4YDVA 3W5MA 4X8JA 4LLAA 3PDDA 4E41D 2M8XA 5SX5K 5HPMA 5E6IC 1QP1A 4M3KB 4WEUD 5C9KA 4YFLI 1WISA 5D1QA 4K94C 5GRWA 4EUPG 4H1LB 3W5NA 1NEUA 5D96B 3ZTJH 2GK0A 5SWZD 1FFNB 3MLWL 4BELD 4NN5C 1BREA 4HG4J 1HXMA 2AJXH 2AV1B 3FFDB 3ULUC 1QSZA 1YEGH 5DJXB 3U0WL 4HS3B 1A9EA 4Z7OE 4ORGA 2BSTB 1NH6A 2ORBH 1UVQB 1FZOA 3PXJA 4LBEB 2NLJB 3QG6A 1DBML 5D2NB 1RIUL 4PY7A 4WO4B 5KSUA 4XH2B 5D7JC 5ESVA 4EJ1C 4LPXA 3T0EE 1MFCH 4S1QH 2YC1A 4D9LH 1A14L 3DTXB 3GMNB 1CBVH 4LVEA 1BM3L 1T89A 1D5BB 1ZHLA 2DQHL 3GJFB 1M71A 5HGBA 1DVFC 4HJ0C 4NO3B 3S4SA 1B4RA 4ORZC 3L3GB 5CSZA 1KCSH 4F7MB 2FL5A 3DETD 3TBTA 1WF5A 1BJ1J 3VCLB 3FQUA 3HUJA 3S9DB 5DO2C 3QFDA 4YWGL 4N0UA 1KN2H 3DURA 2LTQB 5HXMA 1F58L 2IQ9L 5GGUB 4MCYA 1HYSD 3T2PA 1JBJA 4QGYA 3H9HA 1I9RL 1NC2A 3C9NB 2JB5L 5IKCB 5EORH 4JVUA 4GBXB 3BVNA 5F88B 4ODHL 3GNMH 4NRZA 3RPIA 5MEPA 2Q7YA 3QI9A 1HOCB 1DBKH 3U6RB 4P9HC 4PR5A 4RAVA 1TZHA 5IBTH 4S0SD 5TQ2H 1XT5A 5SWZE 2XNAA 2V17H 3RAJH 5E2UL 1X3DA 1I8IA 1CS6A 4H5SB 5LKNA 2EXWD 2FLBT 5CEZH 4QWWD 5K9OB 4PJCB 3S36L 1L4IA 4UBDC 5D2LE 5HVGB 1ZEAL 3C8KA 3BWAB 3MCLH 2QSQA 3GB7B 1BBJB 2E6JA 4HX1B 4UILL 5AG8A 3BE1L 1ZLUK 2V7NB 1FZKA 4HC1H 3INUH 2YPVH 1UKQA 3HB3D 1AXTL 1RUPH 3V0VB 1A7RH 5BS0D 2RGSA 4E0RB 3OPZL 3U82B 4YK4B 3ARSA 1CFBA 4F8QA 4BSJA 4F33B 1CE1H 3DYOA 5JR1H 1BX2B 5HYSG 4RFEA 3QI9B 2Q7YB 3R1GH 1HXYB 1RZFL 2RR3A 5HYIA 5HHPA 2XA8H 3I75B 1QLEL 3LDBC 3KPQB 2PCPB 2QADD 1KIQA 4Y16B 3PQYB 3VXQB 3WS3B 1A7PH 2X7LA 3TBTB 3PQYA 4CU6A 4NZRH 4AM0B 1S9VA 2AEQH 4XP4H 3GJFA 5HGBB 4HX1A 3SBWA 2J7LA 5IVZA 5JXED 4RSVA 4YNYB 5FYLL 1E6JL 1RD6A 2HJFA 5MP6L 3RBSA 4ZUUA 4BZYA 1IEHA 1BHGA 1OOAA 1G7PB 3ARDB 2NY2B 2R0LH 4HKBA 3V6OE 4M7LH 3RX7A 4ZUWB 3TIEA 3QUXB 1QEWA 5MP6H 1EPFA 4F7CB 4YXLH 4DVRH 1JE6A 4PP1C 1J0KA 3RWIA 2F8VA 2PYEB 2R15A 5I8EB 1RY7B 4N9GA 4JDZA 3N0PB 3TYFA 1NGPL 4NQSB 1HHKA 4N0FA 3ULVF 4M1CC 1MCOH 3HZVB 3FT4B 4LHUD 1NBYA 3PDOA 5DUMH 3V6OA 3WO3B 4DVRL 4QOKB 3KVQA 3SHSA 1FLRH 5BO1H 1K6QL 3SEPA 1BQHB 1HEZA 1IC1A 3E3QC 1H15B 1FL6B 4S1RL 4D9LL 2E7HA 1CFVL 3QPQC 3G6AB 4EN3A 5F1OB 4PJ9A 3ARGC 4XPHL 3NCMA 1JNHB 5GGQH 3VRLE 3GSNL 1NDMA 4Y8AA 5FOBB 4ZFGL 3MLXH 5KVEH 1P4IL 1C1EL 4KMTL 2NY0B 2IPUG 4XVSL 2C3VA 5D7SH 3LN9A 5T33L 5F89B 5DRWB 1QZ1A 1L7TH 1EZVY 3C60B 2X1WL 2BSSA 3GO1H 4NPYB 5DHVA 1CG9A 2AABH 1YPZA 4K8RD 4QHMA 4NCDA 5I1DA 3SDYH 1MQKL 3FN3A 3KPMA 5IV2B 3PWJB 3UZQA 5CP3H 1ZHNB 1DE4B 5F9DC 3RJQB 3U9PH 5L7XL 1XF5A 2G60L 3KYOA 1I85A 5DVKA 1MUJB 3VWJB 4CKVX 4Y8DC 5CJOL 1BBDL 4OD3H 3W0WA 5L8JB 1M05A 2ESVE 1BD2E 4ODXA 4FZEL 1AD9A 1TJGH 5FECA 3OSKA 1M6OA 3L5XH 1MF2H 2EE6A 4MAYD 3PWVA 3UTOA 1BBDH 1XIWC 3NPZB 4OD3L 5J57B 1AFVH 3FHQA 3MRFB 4HWBL 5I1AA 4K7FB 2MJWA 3ZDXF 4JRXA 2DQEL 2C3XA 1P84J 5IWLC 4PGBB 3TH3T 4XNYL 1DQMH 2GCYA 1A6WL 1ED3B 1MI5B 4WFGE 2CIKB 4OCYH 3TEUA 3JTTA 2Y9RT 3QDGD 3MQIA 4JFZL 5DK2A 4QRSB 3QDGB 2UWEF 1CDCA 5I1KL 3SDCB 4NRXB 5ALCL 2XXMB 2FJFA 2MPAH 4YUEH 5CGMA 1CN4A 2Y06H