4OT1H

Structural basis for the recognition of human cytomegalovirus glycoprotein b by the neutralizing human antibody sm5-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
QVQLVQSGAEVRKPGASVKVSCKASGYSLKDHYMVWVRQAPGQGLEWMGWINPQSGGTGYGQKFQGRVTMTRDTSTNTAYMILSSLRSDDTAVYFCARDGAKTVSNSGLSLLYYHNRLDAWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein B
publication title Structural basis for the recognition of human cytomegalovirus glycoprotein B by a neutralizing human antibody.
pubmed doi rcsb
source organism Human cytomegalovirus
total genus 54
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ot1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ot1H01
5HYJB 3PWLA 1YNLH 2UYLA 1MFDL 4PGZA 3RDTD 3RIAF 2NY1B 3AC0A 1G6VK 2D7NA 4Y2DA 5HYFA 1KLGB 5HHNB 3PP4L 1XH3B 1I3RB 3QULA 5EU5B 2PYEB 2WBJA 1MSPA 2BERA 4XBGA 2A73A 1C7TA 5F1SA 4GAJL 4W6YB 1DLFL 1FIEA 5I6XB 1JZ8A 3U1SL 1A2YB 1T83A 1DQDH 4X5LA 1N6QH 3FO1B 5FM5M 4K7PH 4G8FB 4J3XA 1HQ4B 2OZ4A 2ADIB 2A38A 4L4VB 4P5MB 4FP8H 4WUKH 4YDLC 3CDFA 1TZGL 4IMLB 1PEWA 3I02A 3KYKH 2PXYD 1QYGL 2D0HA 2Q20A 4JPIB 4KJYB 3WSQH 4DGVL 1A14H 2FL5B 3NCYS 5IKCB 3L3GA 43C9B 1NH6A 1F58H 2F15A 3K2UL 4CN1A 3HG1D 5ENWA 5C0GA 1U58A 1U3JA 1I1FB 4NO2A 3FRUA 3TN0B 5LWYH 2X89A 4F33A 4LCWD 5EFIB 2NYYC 1Q9LA 3UO1L 4U3XA 1XIWC 1DEDA 1SYSB 3K8MA 4K7FB 1UACH 4Y5YB 3SY0B 3OJVC 4X4XB 2PW2A 5I9QC 5DK2B 3PJSA 1F4XL 2N56A 3VJ6A 1FZKB 1OAXH 2CLZA 4D3CH 2PN5A 4S1SL 5C6TH 4PLKD 4HT1L 3C60A 4XMPH 5L2KE 3H42L 1DQMH 4MXWL 4XAKD 4Z7VE 5F9WB 2CK2A 4FTVE 2X05A 2EYSB 1ZLVK 3ZDZF 2VABA 5MEND 3JTSB 3HLAB 2FHCA 3MODH 4OAWA 5D1ZD 4O00A 3CFBA 1A6UL 1VFUA 2MMXA 4JLRA 2X40A 4LSUH 1K2DA 4WV1B 5DMKB 3TBTB 4KWUA 1DE4B 2DTMH 1I1AD 3BAEL 3OPZH 1RZKH 3MRJA 4NC2B 3LEYL 3U4AA 2VC2L 3WHXA 2ID5A 1PG7X 1QLEH 1YEJL 3MNZA 5HGGS 4N8VG 1CG9A 4CU7A 1FVCB 4PJAA 2AERT 1U95A 4OZFG 1DUZB 3DRQB 4R90H 2AABH 4OFPA 4D9RD 4YHOH 3H7LA 4D9LL 1TTFA 3RZWA 3JXAA 1MJJA 4NPYA 1X5IA 2Y25A 4JRXA 4P5KB 4UT9H 3MCKB 5E2VH 3QG7H 4JKMA 5TFSL 2K1MA 4P2CG 1LGVA 3MJ8B 2AJXH 5FUOL 4MXVF 1FC1A 3GKZA 4KK8D 4YDKH 4JZJB 3WNNA 3SE8L 4Z7UB 5IFJB 4I18C 1P7KA 5IMKB 3NCYP 4P4RB 4KRPC 4OKVB 1F2QA 3ROOB 5JO5A 1C12A 2XKNB 5ANMA 4D0BA 1QNZL 3NABL 4M61A 1KTDA 1VPOH 4BM7A 5DZOA 3HMWL 4K71C 1IJ9A 1MREH 4XMKL 1U36A 2EXYD 3OKOA 4U7MA 2BSRA 3FT4B 4AEHL 4NYLB 2AEPH 3QXAA 4KUCD 5DJ8A 1YY8A 4A6YA 5BRZD 4X6BA 3U30B 2V2TA 4KKAC 5D1QC 4PGBA 4ZS6C 3ALWA 1LP9A 4PY8J 3W5NA 2YZ8A 3GSNL 3U0WH 2X1QA 1CDIA 1D9KC 3DRTB 3RTQD 3B6SB 2ZOKB 3D85B 3VXNB 4AG4L 3IXAB 2IANB 1CICD 5C07E 2EDHA 5LGJB 3HS0B 4PJDF 4W4NA 4Z7WA 3EO1A 2KH2B 3GDBA 2AXGB 5FYKD 4Y4KB 1MCWW 5TQ2H 3SPVB 5CKAA 2HFGH 4FTVD 4KJPC 2YXMA 2ORBH 4GQPH 1YMMD 1LO0L 4P59H 4PJCE 5FK9A 4PJHE 2Z8VC 1QFHA 1RJLB 4FQHB 2HFFA 4N1HB 3VRLF 4YZFE 1AGEA 3D5OF 3FQTB 2W9EH 4LSTH 4JY6B 1R5IB 3UBXB 3QUMH 1RZ8A 1FH5H 1CDHA 1JPGB 1Z3GH 4E9LA 1GGTA 5LQBH 4CVWA 4N8CH 2IAMA 5FGBC 3SDDD 1R3JB 3ULVE 3K1KC 4OF6A 3O3AB 1IM3A 4Q7DA 1KXQE 3OBAA 3FL7A 2OTUB 2BSTA 1IGCL 3FOMA 4POUB 3MGOB 3E1F1 1TFHA 3LKNA 1JGDB 4X80H 4LEXH 4QGYA 4K8RH 1KJVB 3MRLB 1JZ2A 3QXUA 4M8QA 4PRHB 2XWTB 5I15H 3IDNB 4RAUB 1BOGB 2L7UA 5GS1C 3CU1A 4YC2C 1EEZA 3ARDC 1JPFB 2QHRH 2X10A 3MYJA 4M7KL 4X6CB 2HTLD 2R0WL 1VFBB 1RJYB 4PJIE 3LPGA 1XT5A 1RIHL 3GJEA 2ARJB 2IBZX 5J6GA 1MRDH 3E6FA 2VO5A 3S36L 3VRJA 1A7RL 1P84J 3AY4C 3EYUL 5EOQH 1K5NA 3PWJA 4EOWH 5B8CB 3U36B 4FFVD 4HXBH 2R0KH 3L6FB 2DQUL 1ORSB 5FIEA 3VWJC 3DV6B 3P4OA 1MCDA 5BO1H 3SE3A 3T2PA 5LCVH 1OWRM 4HFUL 1VB9A 5HJ3A 4NQEA 4C59B 1ZVHA 2BVPA 4BQCA 3CVIH 4XH2A 1RJZB 5HYQA 1HZHH 3SKMA 3FFDA 5F7UA 5EBLA 2F53B 5DMJB 3UROR 5I17A 2VZVA 3D87B 3SDAD 2D03L 5K9QI 4LK4A 4EDXB 5C07D 1G0XA 1JNHA 4LLAA 5E8DH 1I8LC 4HS6A 4CRPA 1OTSD 3V52H 5DJYA 2P8PB 4U1SB 3KPMA 3VFWA 2JCCF 1GGCL 3X13A 4GW1B 1HDMB 3DBXB 1SYVB 4U6VH 3V6BR 3GI9L 4PJAE 5CZXD 3S4SB 4H8WC 2MQ0A 4NQVA 5D9SA 2NY6B 2CSPA 4JM2A 5INCB 1Q0YL 4FMKA 1I8KB 3KLSA 2NR6C 4RFNC 5KSAA 4QF1B 3ETBF 3WO4B 1NBYB 4FQIH 1LEGA 4YE4H 4JRXE 1S9KC 5GZOD 3KPPA 4R7NB 5ITFA 3QT2A 2YSSB 2VTFA 4HS8L 1DLHB 5D7JD 5D4QA 1C16A 2P43B 2BFVL 4Y1AE 2NX5B 4XGZA 5I2IA 3BQUC 5EOTB 3OGCB 2B0SH 1EVUA 3B9KA 5ALBL 2CPCA 4A2MA 2LE9A 5C9KA 3C2SA 1D5ZB 4P3CH 1GOFA 1L4IA 5TQ0L 4LVHB 4QOKE 2DBLL 3N1FC 2EE9A 1OSPH 3ARXA 5E6IA 5HYJD 1ROWA 4IMKC 1IT9L 4ODUA 2BDNH 3K80A 1FFQA 3RHWK 2ADJA 5FUZH 4QXTA 3WXWH 3MTRA 1KN4L 1F97A 4HKJB 5ETUA 5ADPH 2XA3A 3MROB 4S0SD 5D1XC 5BCAA 4JDTL 5C7XL 3OXRB 1T3FB 4DVBB 2JIXA 3CJJA 1XCQA 4M48H 4P2OD 4ONOA 2O61B 3HKFA 5FYKL 2QTEA 1AO7B 2BNQD 5A43C 1JPSH 1WFUA 2BJML 3T0EB 15C8L 4KHTH 4XWOD 3IU3B 3BDYH 4J3UA 2ICWA 1YNTB 3RGVA 2ZCKL 3CSBA 4FFZL 1UZ6E 3QEUB 2EDWA 4ZXBA 4K3DL 4APQA 3REVA 2CUIA 5D7LB 1J1XL 5DTFA 5FHAL 4OZGA 4I1NB 3HPLB 4OD1L 2CGRH 3FHQA 4WHCA 3ZT6A 3BKML 2ZG3A 1JNLH 3PP3K 1X7QB 4OI7A 2VYRE 3TYFA 4NZRH 1KTLB 1MQKH 2EH8L 1KUMA 4LKXA 2ATKB 1BD2A 5SWSE 4X7SL 3KLHC 3M8OH 2OMBA 2HJKB 4GAGL 5HVFB 3BP7A 1IBGH 4N1EA 4KUZL 4JO2H 3Q6GH 1QBML 1FZMB 2A0LC 2HLFD 4HUWA 4L4TA 1I3GL 1OAQH 4D8PA 3WFDL 4LMQE 2ARJQ 4HWNA 1RUAL 1BM3L 5H2BB 3WFHB 3NFSL 1A3QA 1OP5K 3K7UA 3A6OA 2IFFL 1AGBA 4FQXB 4X4MA 2Q8BH 2FSEA 2Z0BA 3N1QC 3OAYH 3G04B 2Q7NA 5D7IB 3LHPH 2X4RA 3FT3A 1P7QA 1PSKH 3RIAK 3EHBD 1IL1A 1GPOH 1FO0L 1NGYA 2CIIB 2YBRA 2GJJA 3CPLA 4GXVH 5GIRB 1QKZL 5FDWA 3KPSE 3QIBC 2DN7A 5CBEB 3HE7B 3MRCB 3M1BB 5EUOA 4EBQH 2AI0L 3BPNC 4AENA 1PG7W 4Y1AD 4MNQA 3WN5B 2VZUA 1QA9B 4YUEL 4ODSL 3VG9C 3MLPA 1EFXB 3UAJD 4F8QA 4NWUL 3HN3A 2FO4A 3MRRA 2ICEB 3VI3E 3D3VB 3RWEA 1XGUB 1A6AA 3QQ4A 5HHQA 1S7XB 3G6DH 4LP5A 3VFOA 4O58L 4JFPB 1N59A 1AR1D 4QOKD 4NJAL 2B1AH 4QRTB 5KVEH 5HVHC 1MLCA 4QO1A 1P6AB 2C3HA 2LV4A 5IW3A 1CXKA 4I3GA 2DQTL 4WU7B 1T21B 4H25B 2W91A 4YAQB 3VXMA 3CMGA 4OCNC 1RMFL 4OCXL 3HZVB 4LIQH 5DUBA 4LVOB 5C9JB 3JZ7A 1MIML 3GUTB 3VFMA 2H8PA 1FE8H 2VDNH 25C8H 3B3IB 1FC2D 3O4LE 4BUGA 1A1NB 5D70L 3ZDZE 4I5BB 2ZKHL 2MKLC 2OL3A 5E8PA 2VQUA 2B1HH 4YX2L 2NY3C 4NRZB 3I50H 3QFJB 3GMNA 1JWSB 5TE6L 2J5LC 1KBGL 1JTPA 1QFWM 4LGPB 2QQNL 3MUHL 4KH2A 3IETA 1MAMH 4FG6D 3CLFH 2VLKA 1I9RL 4WY7H 1U91B 4DVRL 4PJBF 4N0UB 1WWAX 4R4BA 5I73C 3CFCH 1K8IA 5I71C 3CC5A 4N5EC 1BGXL 4I3RH 2E3VA 3GBNL 3OZ9H 5HHME 3D48R 1N5AB 2XTJB 2JJTC 2CKBL 3EZJB 4TSCL 5SWSD 4YHZH 4Y5XA 4Y4FC 1XF3A 3BKCH 2CK0H 3GMOB 3OKYA 4HIJB 3QH3B 1IC5L 4HCRH 5IT2L 1B9ZA 2FDBP 3MPCA 3CVHB 2W92A 4PRDB 3UX9B 4DOHB 1X5ZA 1AGDB 2BRRL 2Q86A 4WO4D 2AJ3B 3FQNB 3U6RA 1S9WA 4MCZA 4S1QH 2XZQH 1LILA 4I0PC 3QHZL 4HQQH 5C0AA 5L2JA 4JRYB 1EH9A 4Y4KD 2EDJA 3VFTB 4HPOL 4PJ9B 2P24B 2E8YA 3F12A 2CRYA 2B8OT 2NY2B 4DKFL 5DHVB 4PJXA 3DTXB 3QEHB 4QXUL 2FR4B 3KPSD 1FFNA 2HJFA 1B6DA 3I3BA 1FYTD 3VCLB 3B2VL 2F5BL 3K4DA 2VXQH 3ORJA 4ORZC 3BPCA 2X5PA 3ARQA 1O5DT 2KQNA 3WMSA 2BX5A 2FATL 2V5YA 1LO4H 4ZDHB 3LQAL 5F7LB 1K3IA 1BX2A 3BWAB 3GEWB 2VITB 2HKHL 5DJ2A 4Y4HD 3WLWD 1SBBA 3D2UB 3V5HB 2PCPA 3LB6D 4X7EC 5HI3D 4XCFL 4BQ9A 4OZGE 4QT5B 4X9BA 3ZTNH 1OPGH 1FBIL 3QIUB 1WEJL 1CGXA 3MA7A 1QLRB 3O4LD 1NCTA 5ALCH 2A74B 1KGCE 3NMEA 1CL7I 3F58H 4P5TC 4JFDD 2IFGA 2EKJA 1C5BL 4ZFZB 5DJZB 4HXAL 4OF0A 1BD2E 4NM4H 4QXWA 2VL4A 5JIHA 4LSQH 3VRLE 3MRGB 4DN3L 2NY0C 1NUGA 3JWOH 3NIGE 1RHHA 4LDLB 3FO2A 4L4TE 4Z7OE 4V1DE 3QUZA 4JGMA 4D0DB 1XF4A 3MOBL 3CK0H 3SCMC 5JHDB 2OR9H 4XWGH 2M8XA 1TZIB 4HKBB 5I30L 2FJHA 2ZPKL 5E94A 4ZUSB 4X4ME 3N9GL 1DVFC 1F45A 4F57H 1T1ZB 4M03A 2EZ0D 4UU9B 3V0AC 3H9SA 2A6KA 2V7NB 2XN9B 4OV6F 1KCUL 3NPZB 4YHNA 3SDYH 3RBGA 4U1MB 4L9LB 4OM1L 2F53D 4Z7QE 4JB9H 5HGDB 2HJLA 1NGPL 4Y5VB 5EUOE 3BUYA 4OLUH 2D2OA 1KENH 1XGRA 1KLFA 1K4DA 4PYHA 3NCBB 3ARFB 1WBZA 3JV4A 4ZUUB 4ZOAA 5ICXA 1MCOL 3O41B 3SKOA 1PG7H 4QWWC 5CINL 3T2NH 1GGUA 4G42B 2A6IB 2BNRA 2R4RH 4B50A 1WC7A 4XNZB 3KPRD 4JANA 4DK6A 5ID0A 4L8CA 1TVHB 3IDYB 1F4WL 3PV6B 2OM5A 2EICA 2D0GA 4UOW1 4ELMB 3VXSE 5C0EB 5IEKA 3VXME 1JK8A 5EZLB 3DHMA 1T6WA 1CR9L 1RFDH 2RGSA 1YEFL 4H1LH 3TO4C 1A5FL 3CXHJ 2Z8SA 4PG9A 1FL3A 4N0RA 3T1FA 1FGNH 1NMCB 1UFUA 3QRFM 3I6LE 2HLAA 2ICWJ 2JB6A 3GIZL 4KTDH 3TBVB 1H15A 2R56H 5J56B 4LQ1A 3C5ZC 3UZQA 4S11A 3MLWL 4QRPB 2WZPD 1CQKA 4OT1H 4HKXA 4ZUWB 3EOAB 2MNUA 4I9WE 4GRLA 3CZFA 1T1WB 1UVQA 2DQIH 2JCCE 1RUKL 5I1LB 5SX4H 1HIML 4HIHB 1FNLA 4Q9QL 4OCMC 1XF2A 4HG4J 4RMTA 5AD0B 4RISH 1M6OA 1RU9H 2AJZB 4NP4H 1WICA 2Z31D 3ARGB 2OQJB 2B20A 3QIWB 2DQDH 3QDMD 5A2JH 3OJDA 4JFFA 1UWGH 4GXUM 2QR0A 4ODVL 4V1DD 3DHJA 1HINL 3V8CA 4KKCC 1G9NL 5C0AE 4R2GB 4G9FB 5J3HC 5C92A 1V05A 1AGFA 3ARSA 5I1JL 1Y18B 5C0JB 4NKIH 5JHLL 5CP7B 4P48A 1R24B 4MD0B 3FO0H 2HVKB 1JMZA 1YNLL 3FOLB 4BFIB 3IKCA 2R39A 3H0TA 1D6EB 1S7WB 4NN6B 4PTUA 3VXRE 3CMOH 2AVGA 4Z76A 5F6IC 3V6OC 2XV6B 3ZKSD 5JOFA 2GITA 4S1DD 2VUYA 5DGQA 3GNMH 1NGXB 5F1NA 3IGAB 1DQDL 4U1JB 3V7MA 1EEYB 1N6QL 1OB1A 4K7PL 2YD3A 1KNOA 4KV5F 5E00B 1A7PH 3IXTA 3ZKXC 4WUKL 4GJTB 3KYKL 5CEZE 2YWYA 3F7VA 4BYHA 2G2RA 3WSQL 3VXSD 1A14L 1XGTA 4NUJA 1ZEAH 1M7IA 1F58L 1CTOA 1M71B 2QADD 4J4PC 1CL7L 1RK1B 4K8RD 1SY6H 4P9HC 4ZPVA 2GSGB 2BVOB 4L3ED 2WP3O 2W0KA 1CGSH 3EGSA 4WW2F 1T22B 3QNXB 4HUNB 4RWYH 2NY7H 4TVPH 1NBVH 1OLZA 1UACL 3OJMB 3NCMA 4OV5B 3SDCB 3NVQA 1OARH 2LABA 2PNDA 3ARBB 3BMWA 2DKUA 2R2EB 5TDPB 4I9WD 1NBZA 1OAXL 4D3CL 3FO9B 3QQNA 3TA3B 5L2KB 5C6TL 2IBGA 1DQML 4TUJA 3O3BB 2Q8AL 5B39G 5C0NC 2NY1C 5HVGB 5FEBA 4NO3B 2W0FA 2N4IA 1I1YB 2KBGA 1VHPA 4F9PA 5JXED 3DV4B 4Q6IB 3MBEB 3MODL 1CDBA 2FIKB 1F3JA 1NKRA 2VQ1A 4LHQB 2Y1VA 1P1ZA 4G80B 4LSUL 2OYPA 4JFOA 4E0RB 1UKTA 3V0WH 2DTML 2BVQA 2H6PB 1HHIA 3OPZL 3BT2L 4WUUA 1MHPH 4ZTPH 5ID1A 4J2XA 3MLXH 1U0QA 2DM4A 3QCTH 3GMLB 3QDJB 4GMSH 1MRFH 4OGXL 4LSRL 2BMKB 5D2NA 4WJ5A 3G6JF 5JUEL 2BNRE 3AS1A 5AWNH 3IS0X 4CU8A 1U3HA 1ITCA 1VACA 2B5IB 2H32A 5E8OA 4R90L 1O0VA 3PDGA 2DTSA 1HKFA 3VXRD 1SEBB 1UJ3C 4YHOL 3BKYH 3T65B 3C6LC 4OF5A 5L8KB 4HZLA 4UT9L 3U9PL 4NZTH 5E2VL 1XAUA 3QG7L 5CEXB 1PD6A 3B9VA 3D0LB 4I18A 2AJXL 4YDKL 3FQWA 4O5LH 1XZ0A 4PJFA 3DX6A 2X1XR 2APTA 1ZE3C 3EYFA 1JNJA 1WCBB 3BDXA 5DD0H 1MH5A 5F9JB 5K9OB 2CR3A 3TZVC 5IQ9A 4RGNC 2A2QT 3WL9B 1ZHKA 1VPOL 3CUPA 1T20B 1MREL 2NY2D 3BZEB 4XXCA 3WS3B 3MRNB 4D0CA 4N9OB 1YDPA 2AEPL 3MR9B 4U2ZA 3QXDA 1U8LA 4LCUB 3MRDB 1BMGA 1J5OH 4GG8B 3S88H 3SO3C 2ZUYA 4QTHB 4RFOL 3ZTJH 3O9WC 2L0DA 1UB6A 4GBXC 4UDUB 1GC1H 3PXJA 3UTSB 4YHPA 4NO0B 5FM8A 2YEZB 1M7XA 4IRSD 3BRDA 4LIQE 2CDFA 2X1WL 2PKDA 2R0LH 3QCVH 2FJFB 1MHHA 4J3WA 5TQ2L 4DUWA 2QQKH 3WJJC 2HFGL 1WV7T 2ORBL 2IMMA 5AEAA 2CO6B 1EEQA 1NC2D 1JZ3A 1FNAA 5E2UL 1RUMH 3PWLB 1I75A 2UYLB 1KCVL 4MA1B 2WINA 2D7MA 5FO8A 4Y2DB 4ZAKA 3BPOC 2IBBA 3QG6A 3IRZA 2GYSA 3I75A 2XY2A 3QULB 4JDVA 3QQ9C 2WBJB 2W9EL 4LSTL 1PKOA 3MMEA 1ND0A 4K3HA 4XBGB 2V9RA 5FGBA 3QUML 4UI2A 4IHOA 2A73B 4JZJC 1FH5L 4EUPH 1VKXA 5LQBL 2CO7B 5J06A 4N8CL 3W11C 5L6YL 1QUNA 1AKJA 3S35X 1FL6A 5ECJE 4P46D 5E7FA 2R2CA 1MFEH 2F74A 5DYOA 2Q7YA 1X6LA 2VWEE 4X80L 4J6RH 4LEXL 4UB0L 5DI8A 3AUVA 3I02B 4K8RL 5MHSE 3ARDA 4BH7A 4RIRA 1K8DA 1O7SA 4IDJH 3L3GB 3RWJA 2IADA 3NFPA 2DOCA 2QHRL 4LEOA 5ENWB 5IB5B 5C0GB 3QUKA 1U58B 4DWHA 1YEIH 1EHLH 3RUGF 4HULB 4NO2B 1UM6H 3FRUB 3KG5A 3PL6D 1KC5H 4PGEA 4MJIE 4NQCA 4F33B 4Q97A 1Q9LB 2DJUA 1MRDL 2YD4A 2WBWB 1E4KC 2LFGA 1SHMA 4PGCA 5EOQL 3RY5A 4WTZA 4EOWL 5I1DA 1IZJA 5EZIH 2A83A 3DURA 4M6MH 2YMXH 4BKLA 1VCAA 4MS8C 2PW2B 3PJSB 2R0KL 2VISA 3TGXA 2IQAA 1J1PH 3N50A 4RBPK 2CLZB 3VJ6B 2VE6A 3HPJA 3MO1A 4XPFH 5BO1L 3C60B 2J8UA 5LCVL 4J8RA 3TVMD 3FMGH 2OK0H 3CVIL 2VABB 2WNGA 2WLYA 3EDEA 4U7SA 4RWHA 1HZHL 1IC4H 5GJTH 1EGJH 1J7VR 4OAWB 3GIVA 2VH5H 3CFBB 3ESUF 3PGCA 3BGFC 2GTWA 4JLRB 4PRPE 1K2DB 1IAKA 2XT1B 2HFTA 3HAEG 3DIFA 3QZWG 2AJUH 5FHBH 3MRJB 1C5DA 3WHXB 1KJ3H 4WUUE 1MJ7H 2DI8A 5JA9A 4K3EL 3V52L 1CT8A 1BF8A 1DP0A 3MNZB 5IB4A 2AS5M 5D2NE 2Q3AA 1CG9B 3AREA 4U6VL 4PJAB 5DMGD 1HEZA 1U95B 1NUDA 2I5YL 3VGAB 3DMMD 3I2CH 3B8YA 3P4MA 1BJ8A 1MJJB 4NPYB 4JRXB 4FQIL 4YE4L 4M1DL 2Y36H 1QOKA 4JQXC 1NLDL 3ZDXF 3QAZB 3BQUA 4H88H 1TVDA 2RJMA 1LO3H 4PJFE 1P7KB 4Y7MA 2NY4C 4U31A 3MV8E 1H3VA 2B0SL 4P2QE 5JO5B 4Q9RL 5HPMA 4P2RE 1C12B 3SBWC 2C1PA 4P3CL 5ANMB 4D0BB 3TJHC 4JN2A 4M61B 1KTDB 3W0WE 1SVCP 4LCCC 4D2NA 4EN3D 3GZKA 5K9QG 5K59F 5HI4C 3OKOB 2ZNWA 2BSRB 5IJKC 5GPRA 2BDNL 2G5BA 4TTDD 5FUZL 3WXWL 4MJID 3QXAB 5DJ8B 1YY8B 2HT3D 4A6YB 4X6BB 2V2TB 1A7QH 2M26A 1OQXA 3MLUL 4PGBB 3MA9H 4H0GA 1LP9B 4HJ0D 1P7HL 4M48L 8CGTA 5JW4N 3SDXA 2HA1A 3GGWA 4XCNA 3FFCA 3JVGC 4ODXA 1JPSL 1T66D 3C9NA 4WU5A 4F7TA 4YJZL 3WFZA 4UT7H 4KHTL 4Z7WB 3BDYL 3R8BB 3EO1B 2XTLA 4G43A 4U7KA 1XGYH 1MCKA 4PB9H 3PE9A 3VG0H 4PJ5A 2NY6C 4WHYH 5FK9B 4GH7B 3WO4C 2CGRL 5EZOH 2HFFB 2UWEA 4O51A 1JNLL 1FJ1A 3F7QA 1AGEB 4PRPD 1E4JA 1WTLA 5CSZA 3S37L 1TDQA 3T2OA 4NZRL 1MQKL 3B43A 4DQOH 1YEDA 1DR9A 5I1CH 3MNWA 1RZ8B 1F6FB 3QNZA 4M9OA 1RPQA 3LPFA 4PJ8A 3M8OL 5AG8A 4KY1H 2IAMB 1IBGL 4LBEA 4AM0A 3VFSA 1P84K 2DQCL 4JO2L 1IM3B 1DQJA 2Y5TA 1QBLL 3SDCD 2BSTB 4RZCA 1MUJA 1OAQL 3FOMB 4OFYD 5TJWK 2P5WA 1UGNA 4UUJA 3LKNB 4FOMA 1PGRB 4M8QB 2FX8H 2NLJA 5JDSA 4DFHA 4KK6C 2UZYB 1FRGH 2Q8BL 3ILQC 2NW2A 3Q1SH 1BJ1H 1EEZB 1YY9D 2IH3A 5CBAA 1ODAA 3MYJB 3LHPL 5FM4A 5HI5D 5AAMA 4JAMA 1PSKL 2W59A 2XIDA 3LMJL 4GXVL 5CEYA 3BIBX 4NQCE 1DCLA 4XPTH 3GJEB 1I85C 5J6GB 2R1YA 4EBQL 1WWCA 3E6FB 1A6TA 3VRJB 1QSFE 2WWMD 5D7KE 5DFVC 1WBYA 1K5NB 3T0EC 1SM3H 4KROB 3MV8D 3PWJB 4R8WL 2ZCLH 4HAGA 4P2QD 4UBDC 5F6HJ 3WFBH 5F70A 3A6CH 4P2RD 5I8EA 4XT1C 3G6DL 3W0WD 1IMHC 2BSED 1MCIA 4EUPA 5IQ7H 2DIJA 3VGDA 3P4OB 1KELH 5KVEL 2BHYA 2VZTA 3I6KA 4K9EH 4G8GA 5HJ3B 4NQEB 5GSRA 1CU4L 4JCMA 2BVPB 2LAGB 3O4OB 4XH2B 4QRRE 5HYQB 3SKMB 3FFDB 4XC1H 4LIQL 1MHEA 3WFEH 1LE9A 1VADA 4KJQC 5EBLB 2VDNL 5I17B 25C8L 1FAKT 4PP2A 5C09A 1JNHB 2B1HL 3B9EA 3C09B 1BQLH 4JFYA 4HS6B 4JQIH 4UT6H 3KXFA 5DJYB 3KPMB 3VFWB 3VFNA 3HR6A 3X13B 2JELH 1IEAA 1MAML 1OTUD 1KF9B 2EEBA 3CLFL 5DSCA 4FQXC 1EBAA 3SJVE 3HNVL 4WY7L 4U0RC 4TVPE 2PTUA 4NQVB 5D9SB 3CFCL 4JM2B 2PTVA 1MI5D 1T5XA 4I3RL 5KSAB 3PWNA 3OZ9L 5SX4I 1LEGB 3HE7C 3RZCD 4Q74A 3E6HA 4ZOEA 2XNAA 3KPPB 5ITFB 3WN5C 3BKCL 3LCYA 1JRHH 2CK0L 1U9KA 5I19L 4HCRL 4I0PA 2BSSA 1C16B 4XGZB 4S1QL 2XZQL 5I2IB 4R4FH 4HQQL 3M45A 4Q0XH 4PLJC 3B9KB 3NIDF 4XVSH 4JFXA 3RKPA 3UYPA 4LF3A 4YPGA 3FN0H 1K85A 4NC1E 3EYVA 1KCSL 3B5TA 4U05A 1FDLH 4JQVC 5E6IB 5SWZA 2VDQL 2NXYD 4ODUB 4XTRD 4HJJH 2ADJB 4QXTB 3V2AR 5ETUB 4MQXC 3WJLC 1QSFD 2V2XA 5D7KD 2JIXB 5E99H 1XCQB 4BQ6A 2VOTA 2VXQL 4OSUH 4FXLA 1CE1H 1J0YA 1II4E 2RFXA 3BRFA 1LO4L 4G6KH 2P44B 2K3TA 4GT7A 3DOSA 2ICWB 1IFHH 3RGVB 2R2BA 4EDWH 2DQHH 4ZXBB 1YEGL 1I4FA 4APQB 3REVB 2NCMA 5DTFB 3O8XA 5D7SH 3FJTA 2VDRL 4NUGH 1T6VN 4P5TA 1OPGL 2W0PA 1QFWH 2XTJC 4OIAA 2J6EH 5H8DA 3TYFB 2C4FT 4G8IA 3OKKA 4TUKH 3ES6A 1BP3B 5ALCL 5I1KH 4OQTA 4LKXB 4QHLA 1BD2B 3E8UL 4NM4L 4LSQL 4HEPG 3BP7B 1A21A 5GRUH 5KJRH 3JWOL 3ZYOA 4L4TB 4HUWB 4TUOA 1WITA 3ABZA 4D8PB 4OI8A 1IAMA 4OFKA 1R5WA 4XNMA 3ZO0A 4IRJD 4PJ9C 3CK0L 3SJVD 3MXVH 2OR9L 4XWGL 4TVPD 4CVXA 1DVFA 1B6UA 4XPGH 1KXVC 1AGBB 3EYSH 4MCYA 4NNXA 4JZOA 3QWOA 2FSEB 2EEDA 3AS2A 5IVXF 1HHKA 1RQ5A 2X4RB 3WYRA 1P7QB 1IL1B 3OX8A 1NGYB 2YBRB 3CPLB 5F71A 2XOTA 1OL0A 2ENSA 3SDYL 5D96C 5FDWB 4W81A 4M6AA 4DFIA 3KDMA 1Q9OA 1C7SA 4JB9L 5DJXA 2NPLX 5EUOB 3RFZC 5J89A 4AENB 4MJ2A 4OLUL 4MNQB 4HFWA 1KENL 1A9BA 1WT5A 3RVXD 3EKCA 4POYA 1ZTXH 2FO4B 3G9VA 3MRRB 3H9YA 3V6ZA 3RWEB 1A6AB 1PG7L 3QQ4B 3T2NL 5HHQB 3VFOB 5C0CD 1N59B 2R4RL 5F7NC 1KPVA 4MX7A 3V9FA 1MFBL 1MLCB 2LU4A 1WFOA 1UA6H 5EUKA 5LBSH 3CH8A 2JJSA 2UY7A 5CD5C 3NIFF 3U48A 3MV9D 2R1XA 1RZJH 2R29H 3VXMB 1CIUA 5EU7C 4RAVA 5DK0B 2FEDD 1OD7A 2X9YA 5DUBB 5DA0B 3FZUD 3VFMB 2H8PB 2M1KA 1RFDL 1D6VH 4ETQA 2B4CH 4LAQH 2OL3B 5E8PB 2AXHA 1FGNL 3C5ZA 2D7OA 2W9DL 3GMNB 4KTDL 2HT4C 4TRPL 4M7LH 2R56L 3KXFE 4B7LA 3RWHA 1TZHA 1BOYA 3IETB 4HV8A 3RIFK 2AGJH 4OT1L 2A77H 2VLKB 1F3DH 3H7BA 4AQ1B 4P57A 4R4BB 1K8IB 1LD9A 2DQIL 3CC5B 3RA7H 1JHTA 2ZUSA 3HB3D 4ORGA 4RISL 4Y5VC 1RU9L 4JG0H 3B5GA 4NP4L 1XF3B 5JDJA 5EA0H 4HC1A 2DQDL 2BVYA 3L3KA 4NO5A 3ARFC 3IJHA 1UWGL 5C08D 4F15B 2Q86B 3W39A 3U6RB 2C4XA 1S9WB 4MCZB 5FUCE 4CJ0A 5C0AB 4NHUA 5L2JB 5FYLH 4XNZC 4ERSH 4RA3A 5IROA 3ZDXE 2K7QA 3K8LA 3PF2A 3HE6C 4XXDA 3IDYC 2ZCHH 4NKIL 5GS0D 3F12B 3N1PC 3O6FA 3ZE2E 1T03H 4PJXB 5F96L 5SWZE 1KB5A 5GHWH 3V6OA 1FFNB 2F58L 1IEBA 4F37K 2HJFB 3CMOL 3AAZA 3S96A 5K59E 5AZ2H 4OZFA 4O02H 4FQJL 2W65A 2WIIA 4L8DA 4JVPA 3BPCB 2BNUA 1J86A 3UTTD 3GNML 1P53A 4M9PA 1TPXB 2V5RA 2EDNA 3S35H 1BX2B 1QRND 1JWUA 4W6XB 1NAKH 4ODTH 1A7PL 2AQ2A 2VB5A 3C5SA 2YA1A 1WIPA 3DX8A 1V3KA 1IM9D 4B0MM 5DJ2B 5IBLC 2R0ZH 3QSKB 2PCPB 4J4PA 4LLDA 3NCCB 3L9RA 4DZBA 1N0XH 1ZEAL 5JXAH 1AQKH 1AE6H 3MA7B 3RVTC 1SY6L 3R8QA 1CVRA 1MY7A 4U6HA 3GK8H 3QIWC 5M95B 1CGSL 4PJGF 4RWYL 1S7QA 2Z35A 5IHBA 2NY7L 2CRIA 1FSKC 4TVPL 1NBVL 2HFEA 1T0PB 1RHHB 4P4KD 3FO2B 4Z9KB 1MAJA 4PJEF 3OAZH 3QUZB 5ELIA 2NTSP 5JOPE 1OARL 3L3HA 3TT1H 1CFSA 1XF4B 5L0QB 4CGTA 3EW3B 3HI6H 4ODBD 3DX7A 3U46A 1W0VA 5I66A 1KT2A 1P6FA 4XHJD 4P49A 2FJHB 5E94B 4NQED 1F02I 2DDQH 2FBJH 4NN6C 2P45B 3H9SB 4LU5H 2A6KB 1L0YA 3SKJH 1BLNA 3STZA 4YHNB 4FQLL 5E5RB 3D69A 2HJLB 3BUYB 4KK8C 3V0WL 4G8EA 2HRLA 5T3XH 4ENED 1EFQA 3VGEA 1UM5L 1XGRB 4YBQD 1K4DB 1SQ2N 1MHPL 4ZTPL 2EC8A 2C7UA 3MLXL 5DVOA 3QCTL 1WBZB 3JV4B 5A3ID 4O2CA 5FCUH 5ICXB 4GMSL 4MHHG 3SKOB 1MRFL 4WWID 3ZSTA 2BNRB 1XCTA 1WC7B 4GG6A 2ILLA 3BPLB 4FQQA 4DN4H 1A4KA 4PJ7A 4JANB 5T1LD 5ID0B 1UJ3A 5AWNL 3DX9A 2E7LA 3QUYD 4L8CB 2EXYC 4M5YH 2EDTA 5DHXB 5BV7H 3BKYL 1UXSA 1MFAH 5ITBH 3QP3A 3PQYA 1TVBA 1JK8B 1ZVSA 5EWIH 3MRKA 4HG4K 4CW1A 4BSJA 4NZTL 4HWBH 3NA4A 4PG9B 3RTQC 5KVGH 3OB0H 3T1FB 1HI6A 1G6RL 4XNUL 4KDVA 2HLAB 4O5LL 2JB6B 1NMAL 1FL5A 1H15B 5KSBA 3ARBC 5DRWA 5IJVA 2PO6D 3TZVA 3PHSA 1U2HA 5D6CA 5C2UB 3TA3C 5DD0L 3X3GH 1R5VA 4HKXB 4LSVL 5BZWA 1JVKA 1IC7H 4HLZG 3RVVC 4GRLB 4Y19A 3CZFB 2GY5A 1UVQB 2JB5H 2EC9U 3BISA 1XF2B 1X44A 4HEME 4IOSD 1M6OB 5GRVL 5HVWA 3J8F7 3O9WA 4GBXA 5DT1H 2P5EE 1J5OL 2CD0A 3B9DA 3S88L 5HHOA 3LKRA 3OJDB 2CUMA 4JFFB 3IU4H 3TF7C 3SDDC 1GC1L 1TNMA 2QR0B 4GRWF 1ACYH 2YPLE 2XICA 1NANI 1TJHH 5HBBA 2R0LL 3QCVL 4XI5D 2YS4A 1AGFB 5I1GL 5KZCB 2QQKL 1A6ZA 1X4ZA 1Q0XH 2VN4A 3L3DA 3NIDE 5D5ME 1GRWA 1NEUA 3IKCB 3JV0A 1PZ5A 1MIEH 3H0TB 4PTUB 5KG9A 3QPQD 4Z76B 4CMHC 1EDQA 2W07A 5EB9A 5JOFB 5KS9F 2GITB 4OF8A 3U4BH 4UNTA 3KS0J 5F1NB 1JBJA 2X2YA 1OB1B 4XPAH 3Q0HA 1CN4A 1KNOB 4S2SA 4NHCH 3LRSA 4LOUC 2E9IA 1MFEL 3IXTB 4J6RL 2J88H 3UTOA 3F7VB 1NLBH 2G2RB 3IFLH 1XGTB 4IDJL 4NUJB 4JCLA 1M7IB 2H2PD 4LLMA 5ISZA 4OZIF 1YEIL 1EHLL 3OF6D 3IDXH 1UM6L 4NKQB 1MWAA 1KC5L 4GKNA 3PNWA 1BJ1J 3K74B 4I4WA 2I9LA 4YDVA 3ZKND 1HQRA 4L8SA 3EGSB 4CU6A 3WS6A 2V5MA 4JFZH 5IB1A 2UUDH 1LO5A 5E2JA 5I9QB 5EZIL 5CHNA 1OTSC 1WWBX 4KRLB 2YMXL 4M6ML 3WHE1 1J1PL 1MHCA 4AZ8A 1NBZB 4XPFL 1DJSA 3PP4H 2X4UA 3DO3A 4OCYL 4MA1C 4TUJB 1RY7B 4Y2DC 2W0FB 4PGJA 3FAWA 3FMGL 2OK0L 3DETD 4BZ1H 3MUJA 3NFNA 3QNYA 4KKLD 1DANT 1E6JH 5GJTL 1IC4L 1EGJL 3RNQA 2P5ED 1F3JB 2VQ1B 3A6BH 2DICA 4JFOB 5IVXE 4Z7NE 1RVFH 3ULVC 4M43L 2AJYH 2YPLD 4G9DA 2BVQB 2HMID 3B2UD 1HHIB 1B4RA 2QSQA 1PLGL 2AJUL 1AIFA 5FHBL 4WUUB 2I26N 1KJ3L 5ID1B 2HG5A 1MJ7L 1QYGH 4PR5A 4ZFOA 2EE3A 4DGVH 4J3TA 2J8UF 3UTQA 5D2NB 4WJ5B 5BS0A 4R7DA 5LKNA 1G9MH 1NCCH 3AB0B 1RURH 4CDHA 1NDMA 4PJ7E 3UTPE 1U3HB 1VACB 2H32B 4ZQKA 5E8OB 3I2CL 5IW6A 4PREA 5JTWA 3UO1H 4Z77A 3K4AA 4X6DA 1Y6MR 4HZLB 3ULUH 3H8NA 5DJ6A 3HTLX 2Y36L 4XVUD 3NIFE 2FX7H 3IRPX 1NEZG 4P2OC 2DLFH 1NFDA 1DEEA 4I18B 5E4IA 2D3VA 2YC1A 4TVSa 1VDGA 2XWJA 1JRHI 4H88L 3FQWB 4PJFB 1XZ0B 1JHLH 3EYQC 1LO3L 4S1SH 5MI0C 1NUNB 5T1MA 3UMTA 4XWOC 3EYFB 1ZLUK 1GAFH 4LCCA 1NCNA 1I9JH 2DKSA 1MH5B 5IBTH 3C60C 2FECL 5EPMA 5IQ9B 1ZHKB 5IJKA 1H0DA 4MQSB 3T0BA 3TWCH 3CUPB 2NMSA 1DUYA 5JW4Q 1LNUA 4OM0H 4D0CB 1YDPB 3BAEH 1Z0NA 3QXDB 1A7QL 2A1WL 1U8LB 2DI7A 3MA9L 3OKEA 3ULUF 4GQ9H 3JVGA 5FKAA 2YWZA 3BVNA 1UB6B 2C3VA 4LHUA 4C55A 4YHPB 4Y88A 3R1GH 4UT7L 2CDFB 1J8HE 2NZ9C 3RPIA 3HMXH 1MHHB 1UM4H 3VGFA 3TJEH 1XGYL 2HT2C 4D9LH 2WW8A 4PB9L 3VG0L 1QVOA 1UZ8A 2X09A 5TFSH 2WINB 3VWKD 5FO8B 4ZAKB 1R3HA 5EZOL 4TNWF 4AH2A 3EHBC 3QG6B 3HR5A 3I75B 4DEPB 4JDVB 3TFKC 2APXA 5I8CA 1QFWI 2E6PA 2EDKA 2VXTH 1ND0B 3MMEB 4DQOL 5I1CL 4A2LA 4KHXH 4U1GB 4IHOB 4QHKJ 1VKXB 4KY1L 1IKNA 1AKJB 5E9DA 1L0XA 3HRPA 1G7JA 1A0QL 1FL6B 3CSPA 4HMCA 3PWPA 4KGJA 1RUQH 4QRUA 4XMKH 2F74B 5DYOB 2Q7YB 4ZPTA 1D5BA 5DI8B 3ARDB 3VI4F 5CJXC 4BH7B 5DD3H 4RIRB 4M4RA 2MFNA 1K8DB 2HVJA 1LE5A 3RWJB 2IADB 3Q1SL 4ZSOE 5F7EL 3RVWD 3NFPB 1UWXK 4LEOB 3QO1A 5A2IH 3QUKB 3H9SD 4JKWA 4E41A 5ISZE 4UMGA 5FYLE 5EC2A 4B7IA 4TSAL 2XRAH 3JWDL 4PGEB 5HDLA 4NQCB 5EIVA 3WEXA 1R3IH 4XPTL 4XP9H 4P23D 1IGJA 4OUUA 5F7MC 1U8QA 2ITDA 3EYOA 4PGCB 5I1DB 2A83B 3DURB 2ZCLL 3SGJC 4UDTA 4BKLB 3WFBL 3HNSH 1R6VA 3QWRA 4WI2A 2XXCB 3A6CL 2VISB 5IGXH 2IQAB 3MGAA 3D9AH 4XRCA 3D39A 1B0GA 2VE6B 3HPJB 3MO1B 5C0BA 5IQ7L 1VGKA 1KELL 2J8UB 4G5ZH 4K9EL 4NQDD 4NZDA 4J8RB 1T7YA 3QXVA 5BQ7A 5T3ZH 5JZ7D 1B2WH 5L9DH 5JQHC 1BHGA 5FB8A 5EO1A 1LK3H 3GIVB 1T7XA 4U6XA 4WNQA 2V5TA 4XC1L 3WFEL 3PGCB 2GTWB 1WAAA 4GKSA 1IGCH 1IAKB 2IAMC 4CVZA 3DIFB 3SHSA 1GOGA 4WO4C 1C5DB 2GJ6A 3IJSA 1AHWA 1BQLL 1J8HD 4JQIL 4Z18A 3WIHH 3BJLA 4UT6L 4KVCH 1G7QA 2ATPA 3AMKA 5IB4B 3UEZA 3TH2T 3H3PH 4OD2A 4XP1H 1O7VA 3AREB 1HEZB 4UV7H 4RFNB 3OJ2C 3K8KA 4X8XA 3RPKA 2DLEA 1RIHH 5D2LF 1NAML 3P4MB 1Z2KA 4NKMA 2QSTA 4MAUL 1WF5A 3RX8A 1FP5A 1JRHL 5FAAA 4KROC 1OVZA 4JFFD 3BQUB 3GMRA 1RHFA 2DI9A 4XCYA 4R4FL 1J87A 4Q0XL 1TQCC 5HPMB 2CMRH 3VMNA 2C1PB 4JN2B 1QSEE 4S1RL 5T3XE 3FN0L 4OZHA 4CUCA 1FDLL 1HILB 2AKRA 1OGAD 5FYLD 3LIZH 3QUXC 4HJJL 4MNGA 3WJLA 2G5BB 4FXKA 5J57B 1I3UA 3ET9F 3S8WA 4YBLC 5E99L 5EOCH 1ORQA 3SDXB 2NXZB 3LKOA 4OSUL 5H94A 4MDIA 3GGWB 4XCNB 5J7CC 3FFCB 3H9ZA 4ODXB 4YPJA 1MCRA 3C9NB 4WU5B 4F7TB 4G6KL 5CWSA 1H3TA 1OAZH 3CAFA 3LKSA 1W72L 1IFHL 1Q0YH 5CIPH 4EDWL 2DQHL 4G43B 4RX4A 1FG2B 1PY4A 1ED3A 4PJ5B 5CD3A 4WFFE 4M8VA 5D7SL 4UAOB 1JZ6A 3MLSH 5KSAC 3WDIA 2UWEB 4O51B 2FGWH 1FJ1B 3P73A 1PYWA 4Y16A 1QFWL 3INUH 3ESVF 2J6EL 5CSZB 4TUKL 5HHPA 5I1KL 4QNPF 1XIWD 1YEDB 2YRPA 4F7CA 3MNWB 2OJEA 5GGTH 5I18L 3W2DH 4NFBA 5MEQA 5ALBH 2FLBT 3QEQE 4PJ8B 4OKDA 5DHYA 1ZLVH 1QFUL 2P8LA 4LBEB 5GRUL 4AM0B 5KJRL 1T2QL 4MAYD 2VRAA 3B9KC 2DBLH 3IVKA 2Y5TB 3AXLA 4RZCB 1MUJB 3PWPE 2P5WB 4UUJB 3TO2A 4B41A 3MXVL 1RZKC 2E5EA 2V9QA 1GXEA 1JN6A 2NLJB 5JDSB 2FH6A 2OTPA 4XPGL 5F7KC 1B3JA 2F54E 3EYSL 1TXKA 2NW2B 3N85H 5CLWA 4UILH 2IH3B 4M3KB 5CBAB 4MQ7A 1A1OA 4KFZC 4JAMB 5HDOA 2DYPA 5FYKH 2MSPA 3BPNB 5CEYB 4U1NA 2OR8A 3BRGC 4X9GA 3DNKA 2R1YB 1CFTA 2VZ3A 1A6TB 3VXUD 3QXTA 5DC9B 1WBYB 4FFZH 4M5ZH 4JY5H 3RGVC 1UC6A 2R23A 4ZXBC 5I8EB 2Z8WC 1QSED 1HCVA 5T3XD 4EUPB 3D39E 1I8MA 3DXAD 1ZSDA 1WFNA 4GSDH 3I6KB 1UA6L 2EE6A 4G8GB 4P3DA 2YOCA 3ISWA 1NC4A 2EH8H 5GSRB 3ZHLA 3IDGA 2WUBH 1RZJL 5KBNC 2R29L 1QR1A 2MJWA 5I74B 4LSPH 1OCWH 1MHEB 1HOCA 1LE9B 1VADB 1XMWA 2YPKA 5K93A 2Z31C 5INDA 1CLYH 5C0FA 2ZUTA 2NY3B 2YR3A 5C1MB 32C2A 4AIZA 2FO1A 1D6VL 3PDDA 2B4CL 4LAQL 3HAEH 2J5LB 4KRPD 4PP2B 3CLEH 5C09B 3HUJA 3GSNA 4JFYB 3DROA 1OWWA 2AP2A 2Q6WA 2VSDA 4ESKA 4M7LL 3KXFB 5EU6A 2X6MA 1HWHB 1ZK9A 3VXTA 3VFNB 4F7EA 4OI9A 3FQXB 1IEAB 3MV7E 2AGJL 2BHZA 2IPTH 3RDTA 5DSCB 2A77L 5I73B 4WFFD 2JJWA 1ZLSH 4MMXC 5F9DC 1F00I 2AI0H 1WLHA 4FS0A 1T5XB 4KKAD 3RA7L 4EQ3A 3PWNB 5D1QD 4ZS6D 4JKLA 4YUEH 5LGHH 3E6HB 1DBBH 2XNAB 4JG0L 1D9KD 3E3QC 4ZFFA 3QEQD 3ARWA 5B39A 3MREA 4NCDA 5EA0L 3LVEA 3MLZH 1RSFA 1FVDA 4I0PB 1MRCL 1FNFA 5DVKA 4L1HA 4U1LA 4ZNEA 2BSSB 4NJAH 1HN1A 5IG7A 1E0OB 2AQ3A 2JE8A 3HE6A 1AJ7H 2PXYA 4KJPD 5FYLL 1XF1A 3SQBA 4ERSL 4JFXB 4LF3B 4YPGB 1XGQA 2F54D 2MKWA 3EYVB 3HG1A 4JGJA 2ZCHL 4U1KA 3TYGH 5EBGA 4XNYH 1T03L 5SWZB 1WSST 4WWKD 2ED9A 1DBKL 3OG4B 2YUZA 3MCG1 4LCWA 5F3BA 2C3WA 4K8RC 1FZJA 4HUKB 1Z0MA 4YX2H 2CLRA 3FHAA 3ZHDA 1LDSA 2IWGA 3HI1A 4F58H 5AZ2L 2V2XB 4O02L 1WZMA 5MEPA 2QQNH 4KKBC 1FAIH 6FABL 3ZKQD 2RFXB 3NGBB 2XZAL 4NC0B 4BUHA 4GLRH 5JORA 3ULUE 1FFRA 3EAKA 1NAKL 2R2BB 3F5WA 4ODTL 1ZHBA 4HK0A 1QD0A 2J2ZA 5GISH 1MQ8A 2IG2H 5MENA 1I4FB 4KI1A 2D0FA 5D1ZA 2CKBH 1FNEA 1N0XL 4YO0A 3MFGB 5JXAL 1AQKL 4P5TB 3ZTJG 2RAMA 4Y5XC 1BFVL 2D7TH 2Y6SD 1I1AA 1NCBH 3OKKB 2GQHA 3ES6B 3GK8L 4G8IB 3UC0H 4QHLB 2NY0B 1EUUA 5HGBA 2WUCH 1PY9A 1TETL 1F13A 4TUOB 4KK9D 3VWJD 3MV7D 1GYAA 4XNMB 4IJ3B 1R5WB 3TT1L 1AH1A 5ACLA 1QHPA 2PETA 3HI6L 3ARTA 2M2DA 1T7ZA 3RAJH 3ZT5A 4CVXB 1DVFB 4MCYB 4NNXB 4JZOB 3QWOB 2DDQL 4U49A 2FBJL 8FABA 1HHKB 3B2VH 1LWRA 1T80A 4LU5L 4MD5A 3SKJL 3OX8B 4TNWK 4IS6A 4ALAH 1EO8L 2FATH 3JBG7 3KDMB 1Q9OB 5DJXB 5A2KH 3RY4A 4D94A 2APBA 2HN7A 3O45A 5T3XL 5DJAA 3DJ9A 1RZGA 1YZZA 4HFWB 1A9BB 3VGGA 1ETZA 1TPXC 1LEIB 2YA2A 3BP5A 4UTBH 1AFVH 1RJCA 5FCUL 3V6ZB 1JNNH 5CILL 5FGCE 3RWFA 4KTYA 4GMTH 4DN4L 1KPVB 4MX7B 3S37X 4N5UA 3RBSA 5SX5K 1OGTA 5EUKB 2NR6D 4M5YL 5BRZA 3MC0A 2R1XB 5BV7L 4UTAH 1TJGH 1G7PA 1MFAL 4RAVB 5ITBL 5FGSA 3N0PB 3QHFH 1P4LA 4JG1H 5KVMC 3MLYL 1NJ9A 5EWIL 4XP5H 3RTQA 2ESVE 3D0VA 3DI3B 1CICA 4MVBC 4HWBL 4FN0A 4ETQB 3HCVA 5BJTA 1ZXQA 5KVGL 3C5ZB 1U8HA 3QUZC 3ULUD 3HUJE 4IRSC 4ONFH 4Z7VA 4GG6F 2VMFA 3P40A 4FTVA 4X6EA 5EU6E 1YMMA 3BX7C 4K2UH 3N9GH 3RWHB 1TZHB 3NZHH 4HV8B 5EG6C 1IC7L 1U8IA 3WNLA 3V7AG 5ERWA 3H7BB 2Q3ZA 4P57B 2JB5L 1UB5A 1LD9B 5D1XD 3Q48A 1JHTB 3WFCH 1U8MA 2AK4D 4ORGB 1IARB 2FYYA 2DLGA 1BREA 5DT1L 4JREB 3SDDA 1MVUB 2ERJC 2X42A 5KSBF 3L3KB 5T3ZE 4NO5B 2JLLA 3IJHB 3IU4L 1XEDA 1UQSA 4ZNEE 1ACYL 5CJBA 3W39B 3PP3H 2ZUUA 3QRGH 1TJHL 2I27N 1W0WA 1KJ2L 3BPLC 2X9XA 4NHUB 2DIBA 4XHQA 3RHWF 2YUWA 3BE1H 1UCTA 3VXOA 2OXHA 3WE6A 4XXDB 5CJQH 1Q0XL 1X5FA 5EU3A 3O6FB 3RRQA 1S7VA 1PW3A 4FQ1H 1KB5B 1MIEL 4LCWE 1IEBB 2BZDA 4OTXH 3S96B 3AAZB 1YECH 3GIZH 1EERB 3KLHD 3O2WH 1FO0A 4OZFB 4CNIA 1VFMA 4HIIA 5FYJH 2W65B 3LV3A 1OP5H 2WIIB 3GBLA 4KDTC 4L8DB 2A0LD 3F6LA 3ARRA 4RGOH 3U4BL 1N4XH 1S9VA 5HDBF 2VLJE 4FQCH 4XBPA 3SEPA 2GHWB 4XPAL 1A02N 4NHCL 1JWUB 3DUUA 4XAKE 3TIDA 1GGYA 4C83A 3C5SB 4GRLC 4Q9QH 1GIGL 2C1OA 1X4YA 3DX8B 2J88L 5MENE 5E0QA 1NLBL 3WLBA 1MCFA 4LLDB 3L9RB 3IFLL 4DZBB 4Z7UF 2N7BA 2VZSA 3QIBD 3SDAA 3IDXL 4JFED 4U6HB 5C07A 5F1IA 1C1EL 5C0RH 1AQDA 2IQ9L 1FIGH 4LLUA 1S7QB 2Z35B 4JFZL 1ZGLP 2FZ3A 3PGFL 2KZ1B 1CS6A 3GSVB 2HFEB 3CGTA 5DVLA 4PJCA 1MCJA 2DL9A 4PJHA 4WHYG 4QEGA 3L3HB 1CFSB 4TPRH 1UJTA 4C56E 4D9RE 3DX7B 5DMGC 3U46B 1W0VB 5I66B 4ZUVA 1KT2B 3NOIA 4RMQA 3H9HA 1NCDH 2YD5A 3DMMC 4JPVH 4K7PY 4WEMB 4BZ1L 4ZFGH 1E6JL 1JYNA 5I1IH 1JF1A 1H9VA 3A67H 5KOMC 1BLNB 3STZB 5D7JA 3A6BL 5K9JL 4ISVA 3D69B 2NY3D 5T3ZD 1RVFL 2CKBA 4G8EB 4RDQF 4M6NH 2AJYL 3QDGE 1G0YR 5JW5A 5C09D 2XYCA 3SGEH 1CIDA 4IEFB 2C7UB 5KTEH 4GW4A 2VWEC 3IJYA 4O2CB 5EBWA 2GCYA 1IQWH 4OUOA 4OZ4A 4CADA 1XCTB 3CSGA 3W9DA 4GG6B 4FQQB 2Y06L 4MNHA 5DA4A 1G9ML 1A4KB 1NCCL 1CL7H 4PJ7B 4EN3C 1RURL 1JZ4A 2ZUWA 1UJ3B 3DX9B 4N5ED 3SOBH 4PJIA 3EOBA 2DMCA 3VXPA 2P47B 3C6LB 5BRZE 2VDPH 4UINH 1UXSB 2E9BA 2HT3C 4P2OA 2VLMD 2ICES 1TVBB 1TIUA 3PQYB 4Y4FD 1ERNA 1ZVSB 3ULUL 3MRKB 1G0DA 4CW1B 2F8XC 4WCYH 2FX7L 2BNQA 2DLFL 1NGZA 2VLJD 3BGAA 1F8TL 1HI6B 1JHLL 2ADIA 4KVNH 1FL5B 1BQHG 5KSBB 5DRWB 5FYKE 5IJVB 1XR8A 1URLA 2ED7A 4X6CF 3TZVB 2Q8AH 4BFGA 4EI5D 1DSFH 5D6CB 4RGNB 1GAFL 4PRNA 1YMME 1I9JL 5IBTL 3QO0A 1R5VB 2CR6A 1HHHA 5BZWB 43C9A 1ZVYA 4UOJA 4HJGA 4HS3A 4Y19B 3TWCL 1OT1A 1H3WM 43CAA 4F9PC 4DKAA 5MEOA 4OM0L 2L7JA 3GRWH 1UCBH 3T0VA 2O5ZH 5KSVA 3ME0A 3BT2H 1FNGA 2R2HA 3E0GA 3SO3B 3O9WB 4ZOBA 4GBXB 1YPZA 2V2WA 2P7TA 4GQ9L 3TNMA 4PIRF 2DQEH 4OGXH 5HHOB 4LSRH 3LKRB 2QQLH 3JSSA 3T0AA 5JUEH 3C8KA 2QSVA 1ULVA 3BEWA 3R1GL 5D2NC 5T1KD 4XMLH 4C56D 2GK0A 3AB0C 3J7HA 3HMXL 3N1GC 1UM4L 4PRAA 1U3HC 3TJEL 3JWOC 5HGAA 2W60A 3QCUH 1A6ZB 3L3DB 3BPOB 3U9PH 4QCIA 1YY9C 1IZKA 1N5YH 4RFEA 3LN5A 3EO9L 4M93C 4NOBA 1PZ5B 4HMDA 5KG9B 5FYKU 1TCRA 5IMOA 1N6VA 1RUPH 4Y1AA 1OF2A 1AXIB 2Z92A 2VXTL 3AFLA 3G5VA 3QDGD 4KHXL 1T89C 1Y6KR 1QR4A 3TEUA 3WD5H 2ENYA 5JW4R 2FNBA 1NSNL 2ZUQC 3P0YH 4IOIA 1FVEA 4QOKA 4XBEL 3SCMD 3FB8A 2R9HC 4NSKA 3KPOA 1RUQL 4S2SB 3LRSB 1J0KA 3BGMA 5F89A 3TBSA 5JW3L 5CJXA 4PD4J 4PRIE 3NCFB 4LPTA 4XXCC 4N9GA 5DD3L 3KYOA 3M17A 3ULSA 1CF8H 4LLMB 4OQ1A 5CSGA 5ISZB 4RFOH 5DS8A 1PQZA 5F9OH 1MWAB 4GKNB 2XRAL 2X4OA 3PNWB 4I4WB 4YDVB 2I9LB 2Z4QA 1HQRB 1U41A 4L8SB 1R3IL 3B5HA 1U6AH 4XP9L 5F1KC 3SGJA 3ZE1F 5IB1B 3MRMA 4HW6A 1LO5B 2BCKA 3GJFA 4QWWD 5CHNB 4R4ND 2YD7A 3HNSL 4M1GH 3P9MA 5E2UH 1IKFH 1ADQH 5IGXL 1KCVH 3D9AL 1MHCB 4KRMB 1NDGA 2X4UB 4G5ZL 4ZAKC 5T3ZL 1B2WL 5L9DL 4DEPC 5F44A 3NFNB 3QNYB 5SWSA 2PF6A 1BVLA 3BGFB 3OXSA 2J8OA 1LK3L 4TN9A 3RZCC 3TO4D 3RNQB 1U42A 4U1GC 5L6YH 1OM3H 3S6CA 2RCSL 4WO4A 2X70A 4RMVA 3KPLA 2E9JA 4Y8DC 1JYWA 4G9DB 1CLOH 1AIFB 4UB0H 1GVIA 2Y4SA 4EVNA 2UZXB 4KJWC 2ZG1A 4Y4KA 2R4SH 2HG5B 1J12A 3WIHL 3OKMA 1AP2A 1EV2E 4KVCL 4PR5B 4ZFOB 3T0DA 1YQ2A 3UTQB 3CDGA 3H3PL 5BS0B 4R7DB 3KAAA 1NPUA 2Y5EA 4XP1L 5HYJE 1NDMB 3TBWA 4UV7L 4ZQKB 3KPSA 2YN5A 1WUNT 4X4ZA 5IW6B 4PREB 1T5WA 5IW1A 4OLZH 1FYTA 1NL0H 4Z77B 3X11A 1F11A 4NDMA 4X6DB 1LEKA 3T0WA 5DJ6B 1WFTA 4JHWL 4FXGA 2J7LA 2R15A 2BNQE 3L5HA 1NFDB 1DEEB 5FECA 2YC1B 1REIA 2NY4B 5J1AA 3U0TA 2XWJB 5HGHA 4WW2C 3RJQB 1FPTH 5D7IF 2G9HA 2YN3A 5T1MB 4L4VE 3MJ7A 4YQXH 4Y4HA 4PRID 5E8NB 1J05A 4JKPH 4LCCB 1EUTA 2CMRL 3MLTA 3QB7C 4KPHH 4PTTA 5EPMB 3EDKA 4DUVA 2VAAA 2YD1A 3P30H 4EEEA 4HLZH 2EIDA 1H0DB 3QUXA 2D9QB 1UG9A 1NFIA 1DUYB 3O4LA 1LNUB 4LFHG 4JFDA 3LIZL 4ZTOH 1CDUA 4OLEA 3PIQA 1ZANH 3HNTH 1KLUA 1L0QA 2GUOA 3TH3T 4K3EH 3OKEB 5LGKA 1OTTD 1YPZE 3NPSB 5B8CA 5EOCL 5FKAB 3GSQA 3BVNB 3CFEA 1GGBH 2C3VB 1DN2A 4LHUB 4ZD3L 4G6FD 3MZTA 3P9LA 1EK3A 2I5YH 1OAZL 1F4AA 4IRJC 3RPIB 5C2BL 3AREC 2C4FU 4GLRI 2VLRD 5EZJA 4BH8A 3S5LA 2H45A 4DK3A 3CVHH 1QVOB 2DM7A 3LQMA 1UZ8B 1Q1JH 4M1DH 3MLSL 2BVTA 2IPUK 2F53A 1R3HB 4AH2B 1NLDH 1A7OH 2EDLA 2FGWL 3HR5B 2W9LA 1ZGLA 3INUL 5I0DA 3NA9L 2PW1A 5I8CB 3OKLA 4WVRA 4U1HA 3PWUA 5ESAA 5GGTL 3KHOA 1INDH 4NOFA 5DURB 3W2DL 5DHVH 4Q9RH 4PRBA 5E1AA 5E9DB 1G7JB 2CRZA 1EAPA 1T1XA 3PWPB 4MSWA 3KPRA 4Z8FH 4QRUB 5D6DC 4YHYB 1U3YA 4WW1A 1OAYH 4NC1C 1MFNA 4AY0A 3U9UA 5HDBE 4ZPTB 5C0ND 2NY1D 1D5BB 3RX7A 3VE0A 1ZKAA 4GS7B 2PYED 3R0MA 2HVJB 3MLUH 3N85L 1LE5B 4UILL 3QO1B 2FEDC 4E41B 4NRYA 5EC2B 3FZUC 2FHBA 5JIKA 4OBRA 2NXZC 3WEXB 1YN7A 4Z7UE 4AEEA 1IGJB 1JCKA 4OUUB 1Z6JT 5I1HH 1U8QB 2ITDB 4L4VD 2X41A 1HH6A 3EYOB 1DQTA 4M5ZL 1CCZA 2FWOA 4UDTB 4PJDA 3O81A 4JY5L 2JKXA 3THMH 3W5MA 3GHEH 1ACZA 4XRCB 3D39B 2D7PA 5FYJE 1B0GB 5C0BB 1VGKB 4UAOC 4GSDL 4LRIA 3TN0D 3TPUA 4Q9CA 3S37H 2EDBA 5BQ7B 4HKJA 5EULV 1NFKA 3C6LD 2WUBL 1YYLH 4POZC 2Z31A 4F7PA 1SJHA 5FB8B 5EO1B 4WEBH 4LSPL 4WNQB 4U6XB 3QDMA 1JF6A 1OCWL 3I6GA 3WDJA 2DQCH 1CLYL 4ZUTA 3LD8B 4PJ8C 4V1DA 4GKSB 1QBLH 1G9EA 4L3AA 4E5XA 4CVZB 3CLEL 3VGHA 3IJSB 2GJ6B 1MFCH 1AHWB 2HH0H 3SKUD 1TTUA 1T2XA 4K94H 3ZL4H 1G7QB 2ATPB 2CXKA 4NBXB 4U0RB 1HYSD 1GC1C 4OD2B 1FN4A 2IPTL 1NBQA 1RZ7H 3LMJH 4X8JA 1ZLSL 1UEYA 1W8OA 2VSCA 4I2XA 3I85A 1ZT1A 1FYTE 5I1EH 2LU7A 4NKMB 2HKFH 4AJ0A 1QQDA 2AJSH 2IMNA 3QYCA 1X5KA 1FCCA 4R8WH 3P4NA 5LGHL 2CQVA 1DBBL 5CZKA 2GJZA 5FYJU 4ONGH 3DUSA 3MLZL 3OB8A 2JJUA 2RBLA 3DPBA 3DVIA 5HHOD 3QUMA 4X9IA 3UXFA 3GMRB 4MJ5A 1T04A 1Q94A 4OGAD 5DRZA 4XCYB 4I77H 1AJ7L 4QHNA 1CU4H 3ECBA 4PRHE 1BQUA 1I7RA 1ZA3A 3VXSA 4RA0C 3AU1A 4LCIH 2XWBA 4OZHB 3RQ3A 4X6CE 3TYGL 1BIIA 1BF2A 4URTB 1IGMH 2P8MA 2AKRB 2YHGA 4XNYL 5I74C 3QQ9D 4QHUA 2H26A 4L3EA 3LPWA 5A16A 1RIVH 2YRZA 4JFDE 4MNGB 4FXKB 3V0VA 3LS4H 3DWTA 3KWWA 1AC0A 3IFPA 4F58L 5KN5A 4U0QB 1ORQB 3O3DA 3CCHA 3LKOB 5H94B 1EAJA 3MACH 1ZHNA 4MDIB 4D9QD 1FAIL 1AY1H 3O2VH 1ZHLA 3HNVH 2FX9H 4ELMF 5CWSB 4I13B 3FB7A 5FYJD 1F42A 4EXPX 2JCCA 3V5DA 1YQVH 3LKSB 3AM8C 4M7ZB 2EXWD 5GISL 1N64H 2IG2L 2OTWA 1ED3B 5CD3B 3KR3H 5JXEA 1DL7H 3GMPA 4UIMA 3OAZK 1DQQA 1WVZA 5J12C 1JMXA 3TNNA 1F6AA 2F53E 4OB5L 5I19H 2QKIA 1G7HA 3P73B 1PYWB 4Y16B 4JO1H 1KB9J 4UNVA 2QLVB 3D85D 2D7TL 4KRNA 5LAXA 2IAND 1NCBL 4RBPH 5HHPB 4O2EA 3UC0L 5IM7A 5GRZA 4F7CB 3U79A 2OJEB 2OI9C 5F9AC 1BZQK 4ENEC 5HYSA 2Y7QA 3FCTA 1A1MA 4MXVE 2GTZA 5DHYB 5MEQB 5FUCC 2WUCL 1R3KA 4MS8D 2P8LB 2R69H 1KCSH 5A3IC 4YR6A 3IVKB 1VENA 3AXLB 1KOAA 5DO2C 3KPRE 2VDQH 3TO2B 3UBXI 4JDZA 3VXRA 3RAJL 1I7UA 1JN6B 3QUYC 4UOW0 3UJJH 4KAQH 4YXKH 4GW5A 3K2MC 1GSMA 1V7NH 2GKIA 2D31A 2PR4L 4MQ7B 1N26A 2X9WA 1H3PH 5D96B 2WAHA 3O6KL 1A1OB 2DYPB 2KDGA 1Q72H 3QH3A 1ZT7A 3BIAX 4ALAL 4U1NB 3KJ4B 4J7RA 1CFQA 2A9MH 1CFTB 5B21A 5IMLA 2NX5E 4QGTA 2MCG1 3I3DA 3NGBC 2RQ8A 5BXFA 1C08A 4Y2OA 4AEIL 1YEGH 4F9LC 5GGRA 2PO6C 4PRHD 2OX5A 4UTBL 3SGEI 1AFVL 4PJDE 3BYYA 2R23B 2VDRH 1JNNL 3ZE1E 3U4EA 1QLFA 1U8KA 1IAII 2BXYA 3O8XC 4GMTL 1I8MB 1ZSDB 5DHVA 4HDIA 3VFPA 4KK5D 5BZDA 4X5XA 4WTZG 2QEJA 4P3DB 3DECA 4CMMA 1NC4B 1JI1A 3IDGB 3E8UH 4O4YH 5T5FH 4KZEH 3CH1A 4UTAL 1QR1B 1TJGL 3QHFL 4JG1L 4X7CC 1HOCB 3QDME 4XP5L 5INDB 1FFOA 2YPKB 2NW3A 5C0FB 2DS4A 3PV7A 32C2B 4AIZB 1AO7E 1RZIA 3MCLH 5IVZA 4IRSA 5E56A 3G6AA 4RNRA 3CU7A 3HUJB 3LKPA 3RKDD 3GSNB 3DROB 4IJ3C 4ONFL 2Q6WB 5JW4M 3STLA 1MAKA 1PKQB 5EU6B 2EEAA 5T5NG 3VXTB 2PUQT 4F7EB 1VSCA 2QJDA 3MRIA 4K2UL 1NC2A 3NZHL 2LTQC 3RDTB 4FNLH 3RU8H 2I9TA 4EIZC 3KGRA 4Z5RA 4I2XE 3WFCL 4LQFL 1FGVH 3QBTB 1V5JA 3OKNA 2XFXA 9CGTA 3OQ3B 4ZFFB 1H3XA 3IFNH 5B39B 1L7IH 3MREB 1WT5C 1A9EA 3FB6A 1HH9A 1FVDB 4P46A 4JR9H 4P9ML 4U1LB 1QZ1A 5IG7B 1MFBH 3RI5K 2VR5A 3QRGL 3HE6B 2PXYB 5A2LH 2VDLH 5B4MD 3BE1L 2NY6D 3O3UN 1XGQB 5GSVA 2JJSC 4MGXA 4JKKA 5D7IE 5CJQL 3HG1B 3BYTA 3T3MF 4U1KB 4LNVA 3PL6A 2H2PC 1CD1A 3OR6A 4FQ1L 4LCWB 4L3EE 5F3BB 4LRNL 1FZJB 2Y07H 4LSSH 2CLRB 4OTXL 4KDTA 1YECL 3ZKNC 2W9DH 3HI1B 4TRPH 2NX5D 3O2WL 3HC3L 5FYJL 4AMKH 5MEPB 1QTYT 4RGOL 1N4XL 5IBUG 5DLMH 3GB7A 2F5AH 1ES0B 4FQCL 4H26A 5GRJH 5JORB 2L4OA 5B38A 2PYFA 1NEZA 3DARA 3F5WB 4WDIA 1ZHBB 4HK0B 1YJDH 3TVMA 3L3IA 3P11L 3ILQD 4X7TA 5F7YC 1MVFA 5MENB 4MZ3A 5JPMB 5GS2H 4NZJA 4PJBA 1JF5A 5D1ZB 4ODWA 3DETC 4EIGB 2RR3A 5GGVY 4YO0B 5CLTA 5CCKH 3MSPA 4N90D 3I3EA 4JREC 1I1AB 1X4XA 1AO7D 4HGWA 1FSKB 2ZSWA 3X14A 5C0RL 5DFVD 1CE6A 2ADGA 3JTTA 5DXWA 3T0ED 1FIGL 3QFJE 3NH7H 1FLRH 4TSBH 3EFDH 5HGBB 2NTFA 3B2UC 3LH2H 2W0LA 4HMEA 2WQ8A 1S7UA 3DLQR 5IROC 5D7LD 4IOFC 4XNQA 2XY1A 3MLRH 4TPRL 2XXMB 5F96H 1JPTH 4YGAB 3DMMA 4N0UE 4RMUA 3O6FC 4N0CD 3ELAT 2F58H 1X5YA 3C87A 4QYOA 3ULVH 5C3LD 1NCDL 4JPVL 3V8OA 4FQJH 8FABB 5DC4B 4EI6A 3BEVA 4ZFGL 2OZ4H 4KJQD 4MD5B 1YMHA 4G7YH 2VIRA 5DQDH 5I1IL 4IS6B 3A67L 3WBDA 1WWWX 4P0DA 2LU3A 3QI9C 4XVUC 1Z5LB 2MOVA 2VXUH 4DOHE 1J0ZA 4KQ3H 2HN7B 3O45B 2G75A 3BUTA 4PJCF 4M6NL 5F72S 5DJAB 3CXDH 1RZGB 3V6FA 1ETZB 1CDGA 3DYOA 3BP5B 4HCRA 1Z9MA 1DFBH 5KTEL 5SV3A 4FQXD 4EN3A 3RWFB 1IQWL 4MHHI 2IBZY 3KLDA 1OP3K 5DDHA 1MCQA 1OGTB 3SOBL 5EO0A 4HKZA 4MJIA 3EJZC 3PWVA 5CGMA 4KQ4H 5IHZA 2VDPL 3HE7D 1BJMA 3ULVF 5E1HB 4UINL 3DSFH 1G7PB 1P4LB 1FORH 1NJ9B 5B3NA 2UZIL 1EFXD 3RTQB 1U8OA 1RIUH 3D0VB 5E70A 2OXGA 5JLZA 5IK3A 4WCYL 1CICB 3D3VD 5BJTB 3HCVB 4HGKC 1U8HB 4Y89A 4X98A 4PLJD 4KVNL 4Z0XA 4Z7VB 3TCLA 4FTVB 3P0VH 4FFWC 4X6EB 4NKDA 1DSFL 4KI5F 1YMMB 3BFOA 1UXWA 2N1KA 1DQLH 1K4CA 4PJIF 5EO9A 3ZDYF 1Q9WA 1U8IB 4RRPG 4DGYL 5ERWB 4OLXH 1BBJA 1VERA 4FQLH 3WUWG 4PRPA 1UB5B 5KVDH 2LVEA 3GHBH 2XPGA 3BHBA 4FQ2H 3E2HB 3GRWL 1UCBL 1R3LA 1UM5H 1U8MB 1IILE 4AT6A 5HD8C 2O5ZL 1MCSA 4G6MH 3G5ZA 3ZYJA 5IFAH 2FYYB 3QFJD 1WZ1H 1TQBB 4YEFA 3SDDB 1ZT4A 2DQEL 5JA8B 2QQLL 3FQUA 4OFYA 4YHML 3BH9A 3B8SA 1UQSB 5HY9A 1S7SB 4JY4A 5TDPA 2BHUA 4MD4A 3LY6A 2A6DA 3QDHA 4XMLL 1W0WB 1KYOJ 3LRGA 1G7IA 3EJYC 3VXOB 2E7LC 1KSRA 3WE6B 4E42A 3BN3B 3QCUL 1J88A 1E28A 4MB3A 1TJIL 2XQBH 5DEGA 5EU3B 2XTJD 1S7VB 3RVWC 2XN9E 4LDEB 1N5YL 3EUUA 4CMHB 2LVCA 4MDJA 1CGUA 1G6RH 1T89A 4HGMA 4XNUH 1GZQA 1RUPL 1NMAH 1OSZA 1FQ9C 5F7FA 1FO0B 2G60H 3H3KA 5GRWA 2X44D 3MV8A 4CNIB 4HIIB 4P23C 6CGTA 4P2QA 4MLIA 5TGBA 3S9DB 3LV3B 1KEGH 4PJAF 3LRHA 3LSOA 3WD5L 1S9VB 4YIQA 4P2RA 5ESQA 4JRYD 3H6JA 4LPVA 4LSVH 3W0WA 4QLRA 3P0YL 3DI2B 4PJ9D 4XBPB 4XX1G 4AEFA 4NFDA 5L7XH 3DUUB 3TIDB 4C83B 5D8JH 2C1OB 1PAMA 2I25N 3O3EA 3C6SA 4ELME 1S8DA 3RP1A 2FEEI 3WLBB 4PJBE 1EHNA 3VH8A 1CF8L 3L3JA 5E5MA 2GFBA 3SDAB 3O6LH 5C07B 5F1IB 5F9OL 4Q6YA 4EJ1C 1AQDB 4X9FA 5GS0H 4YDIH 1U8PA 1U6AL 1RZJC 4LLUB 3PUCA 3IDMA 2C9AA 4H1LA 4CN4A 2FZ3B 1PX3A 3S3PA 5I1GH 4QRPE 1T4KA 1H5BA 4PJCB 4PJHB 3D2UD 1T7WA 4M1GL 2B4CC 1IKFL 1ADQL 4JFQA 1HYRC 5JQ6H 5L8LB 1N2RA 4NM8H 2IJ0C 5CD5D 2EDXA 1MI5A 1NMBH 2WWKT 4ZUVB 3JV6A 2ADFH 1LP9F 3QIUD 3H9HB 3WS3A 4KGLA 5M7QA 5KAQF 3RZCA 1H8OA 1DBAH 1DBMH 5DGRA 1JF1B 1BWMA 4P3WA 4Z7WF 1AD0A 3C2AH 5D7JB 2OR7A 1OM3L 4ISVB 1UZ6F 3BN9C 2CKBB 1B0RA 2EE2A 3IF1A 3ZMRA 3KYMA 5JW5B 1CLOL 3GM8A 5JHDD 1CD8A 1M4KA 3AS3A 4G9FE 4L1DA 1VEMA 2R4SL 4GW4B 2APFA 3IJYB 5EBWB 4G6JL 2GCYB 4GKZA 1ITBB 3FN9A 4OZ4B 4CADB 3W9DB 4MNHB 2XN9D 4PJIB 2CXGA 3EOBB 2FHFA 4RMWA 4V2CB 3VXPB 4IIQC 3RNKA 5I76A 4JHZA 5HXMA 2D9CA 4OLZL 3TPKA 1NL0L 1QSFA 4MZ2A 4QRSA 4P2OB 2HP4A 1UH3A 4L8SC 2VXVH 3WS6C 5HDQL 3ARFD 2BNQB 2F19H 4WW2A 5IB2A 4YHKH 1NGZB 5MI0B 4BSWA 1UENA 3RIFF 5CAYB 4XAWL 2E7CA 2R1WA 4LCYA 1FPTL 2X4TA 4OCYH 1XR8B 1SJEA 3UDWA 4YQXL 2EYRA 3HHRB 3HE6D 4TNVK 4M02A 1GJIA 4PRNB 4X4YA 4JKPL 3ARVA 3BH8A 3QO0B 4QRRA 4KPHL 3VD3A 1HHHB 3P30L 5IB5A 1BFSA 3FT2A 4HJGB 4HS3B 4OFDA 2DRUA 5IF0A 43CAB 4HD9A 3TC9A 5MEOB 4WI6A 4M43H 3VI3F 4ZTOL 4OIBA 3TM6A 5KSVB 1PLGH 1ZANL 1FNGB 2R2HB 3HNTL 4MXQC 4PB0H 1YUHA 3PGDA 1SY6A 4BELD 5CJOH 5EIQA 1YPZB 3MYZA 4MWFA 1X9QA 2P7TB 2V2WB 3TNMB 5E4EB 4QRPD 1B4JL 2BOBA 1GGBL 3C8KB 1IGTA 4IRJA 4MAYC 3SJVA 3BEWB 1IAOA 1EEUA 4AIOA 2GK0B 3O2DL 1S78C 2CJUH 5IBLD 3G6JA 4PRAB 2V17H 3C08H 4F37F 5HGAB 4XC3H 2W60B 5BVPL 4PD4K 3CVHL 1EZVY 3NTCL 2CLVA 1WGOA 1KACB 1Q1JL 4QCIB 5JIPA 2YD6A 3RVTD 1JZ7A 4RFEB 1VFAA 3LN5B 2DBJA 3ARGD 3ARPA 2XG4A 4ONHA 5IP4A 4F7MA 3QIWD 1A7OL 4LLWA 4OCWH 2UV3A 4LDOB 1TCRB 5IMOB 3T3ME 4Y1AB 4JVUA 1OF2B 2Z92B 3G5VB 5TE7H 3ZZ1A 4NZUH 1INDL 4R2GD 4G9FD 3QDJE 1S9XA 4W70A 1P9MC 5D6DA 3L5WA 5C0CA 3R06A 4IOIB 1FVEB 4JM2F 4QOKB 3FB8B 4NFCA 4NSKB 3KPOB 4PP1C 2EIEA 4WI3A 1K9TA 4X0KA 4Z8FL 1HCFX 4UIKH 3BGMB 4LSDA 5F89B 1L9MA 1OAYL 3TBSB 4F80A 2XI9A 3BZ4A 2VN7A 4LPCA 3MV9A 2FEEL 1WBXA 2O5XL 4N9GB 2A1WH 3BKJH 3KYOB 3M17B 3ULSB 3MJ9L 1BAFH 2APVA 4G3YL 1NANH 4R3SA 5DS8B 1PQZB 3HC0A 2X4OB 3NPSC 2Z4QB 2ZWLT 5KSUA 1VESA 5BV7C 2EDFA 3MQIA 1GL4B 5I1HL 2VQTA 3MRMB 2BCKB 3GJFB 4XZUA 1G6RA 3B9AA 4JPKH 1KFAH 5A40E 3B83A 3THML 4W68A 1A3RH 3GHEL 3P9MB 2ZJSL 3U82B 3VRIA 3GSWA 2AK1H 4XVJH 3U0PA 1PEZA 1I7TA 1NDGB 2BXZA 4JN1H 1MI5E 1MCPH 2BC4A 3L7EA 1N7MH 4PY8I 4HH9A 1NUFA 5SWSB 1YYLL 1SBSH 1BVLB 3IAPA 1A6WL 3OXSB 4WEBL 3KYAA 5DRNA 4HX1A 2YKLL 1MLBA 5C08A 2EC9T 1A0QH 5JMRA 2ZSVA 4WO4B 4ZYKA 2X70B 1E6OH 3KPLB 5LG1A 3UTSE 3QFDA 3RWGA 3RJDA 1IKNC 1CXLA 3ARBD 4ZO8A 1Y0LA 1P4IH 2R8SH 4OZGF 1MFCL 3EDJA 4EVNB 4YHYC 4I8DA 3TA3D 5L2KD 3KPTA 2HH0L 3OKMB 1AP2B 4K94L 1U93A 3ZL4L 1KPRA 4KV5E 4LASH 2KKQA 3RVVD 5F7EH 3CDGB 3KLAA 4GS7C 5ESVA 4B53A 3T3PF 4LNRA 4M62H 1QG3A 4G6AC 3MBED 1RZ7L 2XZZA 3S3SA 3TBWB 4TSAH 3KPSB 3JWDH 4WWKC 1T5WB 5IW1B 4YXHL 3NIGF 1FYTB 4Z7OF 4WTXA 5I1EL 3RUGA 1G1YA 1F11B 2HKFL 4NDMB 1PBYA 3X11B 1LEKB 2AJSL 2VXSL 2AEQH 3UTTA 4FXGB 3QDJD 4ONGL 5FECB 5CZVH 3U0TB 5DJ0A 1WZLA 5J1AB 1QRNA 4WGWB 5HGHB 2IPUG 4LGSB 4G7VH 1TQCB 2G9HB 3MJ7B 2IF7A 1IM9A 4Y4HB 4I77L 1J05B 4MLSA 4Z7QF 3MLTB 1MPAH 4PTTB 1RAMA 2E7MA 2OL3H 2VAAB 3NN8A 5GGUA 4LCIL 1EHXA 5EUOF 3RWIA 3QUXB 3N1MC 1NFIB 1JGEA 4NT6A 4KI5E 3O4LB 5DD5H 1IGML 2WBKA 4JFDB 4M7JH 1RIVL 3ZDYE 4YFDB 3LS4L 3PIQB 2Y6SC 3LD8C 4YBLB 1G84A 3GMQA 1KLUB 2GUOB 4J3VA 4P4KA 1AHWC 3GSQB 3S98A 3MACL 3CFEB 5DWUH 4P2YA 1AY1L 3OHXA 3P9LB 3AM8A 3O2VL 4KK9C 1LVEA 4LOUD 2AW2A 2FX9L 3F6IA 3WXVL 4QTIH 4PV9A 3OKDA 1YQVL 4X5WA 4NWTH 5IHLB 3G6JE 5EZJB 1MF2L 3LEXA 1NAMH 5HHMB 3S5LB 4BH8B 1N64L 5E95B 4HSQA 3KR3L 3EZ8A 1DL7L 3CD4A 4MAUH 1QFOA 3L95A 1JE6A 2VL5A 1ZGLB 4JO1L 2DM3A 2PW1B 2NY5H 3OKLB 5GS2D 1EGJA 3UTSD 1NCUA 3MBXH 4NO0D 4U1HB 3PWUB 5J0BA 5ESAB 4I48A 1MJ8H 4KC3B 1GH7A 4PRBB 5JMOC 4S1RH 2R69L 5E1AB 4LVEA 2IEPA 5C0CE 1EAPB 1T1XB 2CH8A 3QR2A 5DUPH 4MSWB 3KPRB 5T1LA 4WW1B 1A22B 3QUYA 3IDUA 5EBMA 3U9UB 3CFKA 3VW3H 4Y2DD 3VE0B 4R97B 2E6JA 3MV9E 1CXHA 3UJJL 3UYOD 1TENA 4KAQL 2WBJD 4YXKL 1NCWH 1V7NL 1JGVH 1H3PL 3M07A 1G9MC 4NRYB 3MXWH 2OLDA 1Q72L 2HTKD 3ULVD 5CEZH 1JIBA 2EYTA 1YN7B 2A9ML 4NNPH 4F9LA 2PO6A 3MGTA 3OWEA 1W72H 1HH6B 3ULUC 1HSAA 4XP4L 4YXLL 5EDXA 2FWOB 5I75C 1KTKE 2EDDA 4PJXF 5GZNC 4PJDB 5ANME 4M7ZC 4L4JA 4OZGB 3BESR 4LLVA 4X99A 5DFTA 1YYMH 4KI5D 1OW0C 35C8H 3TPUB 2CKNA 3PG2A 5DMYA 4JJ5A 4RDQG 2X89D 4Y16C 4PGDA 2X4QA 4O4YL 5T5FL 2Z31B 5I18H 4KZEL 4F7PB 1SJHB 4DGIH 3QXWA 5DVMA 1ZLUH 1LP9E 3T4YA 1QFUH 3QDMB 4LLQA 3I6GB 1L6XA 1T2QH 4ZUTB 3FTGA 5C08E 1S3KH 4V1DB 5FO7A 3EYQD 2XACC 3MCLL 3QEGL 1ZLWK 3UBXG 4E5XB 5ICZA 4TQEH 3MRBA 4WFHE 5TDNA 1K6QH 4Z7WE 1JHKH 3BP4A 4ZS7H 3C60D 3PABA 2VDOH 5FXCH 4CVUA 5BMFH 3G5XA 4W6WB 1A3LH 1FN4B 2DF3A 3FT3B 4FNLL 3RU8L 4ZOCA 3U2SA 4X8JB 1E4WH 2GIYA 2OBGA 1MELA 3T4AA 2CDEA 4I2XB 4FQPA 3C5JA 1ZT1B 3SGKA 3HFMH 2Z93A 3KJ4C 3RUGE 1QQDB 1FGVL 3FQRA 4AQOA 3P4NB 1L6ZA 5D71H 2GJZB 3IFNL 3UTTE 5C86A 5EU4A 1L7IL 4OCSH 3DUSB 3TCXA 3GJFK 4JR9L 3QUMB 1QRNE 4MJ5B 2NZ9D 2DLHA 1T04B 1Q94B 5DRZB 2ZNXA 5DQ9A 2HT2D 5I8KH 1JI2A 4QHNB 1HHGA 3ECBB 2VDLL 1S9YA 1I7RB 5B22A 1ZA3B 4BZ2H 3VXSB