4KO7A

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/w48f/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48F/V95I)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ko7A00
2VM4A 2EIKB 1SNRA 1OE1A 1J9QA 1AZUA 3IBOA 1ZIBA 5I6LA 4KNTA 1URIA 2Y1AA 3X1GA 2ZONA 3V9CA 1PLBA 1WA1X 2BP0A 4W9ZA 2AZUA 2CCWA 3ZDWA 4YVNA 4F2EA 2JFCA 4FAAB 4AZUA 2XVBA 4PAZA 4YSQA 4P5RA 5ANHA 3FT0A 4NB7A 2VN3A 1FFTB 3UADA 2IDSA 4E9XA 1KCWA 1RZPA 3QPKA 1SHWA 3DKHA 1KDJA 3N55A 4YSPA 3EH4B 1VLXA 2IDFA 1AOZA 1PY0A 3D12B 2NRDA 4A2HA 3QQXA 3UACA 5I26A 2EINB 2QPEB 3JTBA 3NP4A 4KO5A 1ID2A 2PP7A 2IH9A 3PAUA 1BQKA 2GC7C 1IC0A 1RZQA 5PCYA 3FU9A 1A4AA 1PMYA 2CUAA 1L9QA 2DY2A 2XYBA 2FJSA 1ZV2A 1PZAA 2HZHA 1M56B 2UXGA 2GC4C 2MRYA 3V9EA 1A65A 3T71A 2HX9A 4DPAX 4GXFA 3WKPA 3UAEA 2CBPA 5B7EA 2IH8A 2PPAA 3CDZB 2HX7A 2X87A 2XLLA 2XWZA 3QJRB 1M9WA 2XXFA 2YAQA 4G7RB 2GSMB 1CYWA 1GS7A 3NJIA 3HEIB 5B1JA 5F7AA 2ZXWB 5I6NA 2H5UA 3FYIB 4DP8X 7PCYA 1W6LA 4N8UA 3ASNB 2N0MA 4GY4A 2FTAA 1NIAA 1E5YA 1UATA 2VMJA 4GP5B 1ASPA 8PAZA 3EH5B 1V55B 2HX8A 3C75A 1MG3C 3PLYA 1QNIA 4KNSA 3X2QB 2XX0A 2Q5BA 1ET7A 1ETJA 1A4CA 3NP3A 7PAZA 2QT6A 4TXVB 1NIBA 4A2GA 3BVDB 1SDDB 1NWPA 3JT2A 3IN2A 4YSCA 3OD3A 4L0PB 2BWIA 1ADWA 1ZDSA 2BW5A 2YAOA 4AX3A 1GS8A 4HCFA 3WI9A 1RKRA 2VW7A 2YAHA 1SF3A 1J9SA 2VW6A 3T9WA 1E67A 4F2FA 1N70A 1V54B 1V10A 5F7BA 4QKTA 2DYRB 1HAWA 3EF4A 3TA4D 4DPBX 3EH3B 4W1TA 3PAZA 5TK4A 1WA0X 3WKQA 4AKQA 1IKOP 5B1AB 4GYBA 1TU2A 4HCIA 3ZIYA 4M3HA 1AACA 2PPFA 3FYEB 3SBRA 3UABA 3CDZA 3L45A 3H56A 1JVLA 3NT0A 2CAKA 2IDUA 2WO3B 5EHFA 1JVOA 2XV2A 1W8EA 3TASA 1XB3A 1JXFA 2RACA 1F56A 5D4IA 1OCOB 5I28A 4UAHA 3FQ1A 1AR1B 2PPDA 2UX7A 3NJHA 4DP1X 2PP9A 3CVDA 2DV6A 1PF3A 1KGYE 1BXAA 3QJSB 2GB2A 5B7FA 4DP6X 2BZ7A 3AZUA 3CVCA 2PCFA 3ZX1A 1ET5A 3BQVA 4G71B 6PCYA 1ET8A 1PCSA 1X9UA 1ZPUA 1KDIA 2I85A 4PCYA 1SJMA 3KW8A 1BAWA 4BDVA 1IBZA 4KNUA 2EILB 3FSVA 3UGEA 4MFHA 2IWKA 1JXGA 2VSKB 2YQBA 1L9OA 1JZIA 3MX0B 5B7MA 4KOBA 3PCYA 5AZUA 1PNCA 4AI7A 3X1NA 3FU7A 5PAZA 4BXSV 1X9RA 4NERA 1M57B 2CJ3A 4YSUA 4NAJA 1SHXA 1OE3A 6PAZA 3IN0A 2GIMA 2FQEA 3CZUB 2OJ1A 3QJVB 3TBCA 1PLCA 2WSDA 3DIVA 2YAPA 1CURA 1KBWA 2GHZA 4BWUA 5AFAA 2CALA 3GDCA 1IBYA 2GI0A 4YSDA 1KYAA 1JZGA 4G70B 4DP7X 2YAFA 1BYPA 3FS9A 4YSAA 1AZRA 2FNWA 3ABMB 1AZBA 2PCYA 2B08A 3NSDA 3SBPA 2R7EA 2DYSB 2IDTA 1WAEA 1J9RA 4WTQA 5I5JA 5I6KA 3GXUB 1NPJA 3ABLB 4G7SB 5LDUA 3CG8A 3U25A 2PLTA 1AANA 1BEXA 3QJQB 1NDTA 4KOCA 1A4BA 4AKPA 2VSMB 3CVBA 3NJLA 2X88A 3S8GB 4BDVB 4HHWA 4ZK8A 1AQ8A 4YSSA 3FSWA 1E30A 4E9YA 1OV8A 2BWDA 3PAVA 3WNIA 3WNJA 3FQYA 5A7EA 1NIEA 3WIAA 9PCYA 2J57A 2FWLB 1AS7A 5FC9A 4KO6A 2E86A 2W88A 1IUZA 4YL4A 1ILSA 2HLEB 2IDQA 4BWWA 5D4HA 3NJGA 3AG1B 1MG2C 2YAEA 4E9VA 3QJUB 4GP4B 2WO2B 3FU8A 1OCZB 2XV3A 1NTDA 5B3SB 1GY2A 3NJNA 4DPCX 2EIMB 1JZEA 3MBWB 5D4JA 2B3IA 5I6OA 1PLAA 2FT6A 3FQ2A 4DP9X 1QHQA 2QPDB 4WKXA 2I7SA 3FPXA 3QJTB 4RH4A 4KO9A 2XU9A 2HRGA 3X1EA 1BXUA 1GS6X 4HALA 2XV0A 3AG2B 4A2EA 2Q9OA 4E9TA 2A3TA 2EIJB 4YVUA 4A68A 4CSPA 3TU6A 4K9JA 5I6MA 1L9SA 3X1FA 1MDAA 2FQDA 1TEFA 3ASOB 4E9SA 4KO7A 4A2FA 2BO0A 1AS8A 1EHKB 3EHBB 4EF3A 1OE2A 4UF7C 3IE9A 3IEAA 2P80D 2BHFA 2J55A 4F7KA 1E5ZA 1GSKA 4CSZA 1L9RA 1BQ5A 5TK2A 1JZFA 1XB6A 5I5IA 2QDVA 5I5MA 2UXFA 2OCCB 1AAJA 3SBQA 3OM3B 3PPSA 1GY1A 3T6VA 1AG6A 2BP8B 1NIDA 2DWSA 3G5WA 2H47C 2OV0A 2AZAA 3ABGA 2H3XC 2XX1A 5B1KA 1SF5A 4Q89A 1OCRB 3N2JA 1JZHA 1AZCA 2TSAA 1PAZA 3PXLA 5B1JC 3S8FB 4BWTA 3TBBA 2UX6A 3OMNB 1ASQA 1OOWA 1PNDA 1B3IA 2BP8A 4P5SA 2QDWA 1NPNA 3ZBMA 2LLNA 2HRHA 2BW4A 1HAUA 5E9NA 1GYCA 2PP8A 2GBAA 3WG7B 5AKRA 3T6WA 2PPEA 3FPYA 4QLWA 2Y69B 1EZLA 1TEGA 3FSZA 3NJFA 1NZRA 1FA4A 1ASOA 3NYKA 1QLEB 1WS8A 3DTUB 3KW7A 1CC3A 2W8CA 2UXTA 4UANA 3OMAB 2DWTA 2JXMA 2BZCA 4HIPA 1NICA 3T6ZA 5B1BB 4FA7B 1CUOA 2TSBA 2ZOOA 1DYZA 1GR7A 1KV7A 3NJMA 4HAKA 3FU7B 2AFNA 1KCBA 1JZJA 1AG0A 1AZNA 4X4KA 3H4FA 1W6WA 2FT7A 2J56A 2FQFA 4BXVA 4HHGA 1A8ZA 1SFDA 1YLBB 4JHVA 2IAAC 1NIFA 3NSFA 4BK5C 1SFHA 4YSTA 1RCYA 4G7QB 3X1BA 2FQGA 1DZ0A 1NWOA 2HXAA 1ZDQA 2FT8A 2I7OA 1PZCA 3H4HA 3HB3B 1FWXA 2ZWNA 3NSYA 3NSCA 2IWEA 3T6XA 2YXVA 1E65A 3RYMA 3OQRA 3S3DB 1TKWA 4AKOA 1MZYA 3SQRA 2AANA 2XXGA 2XUWA 2BP0B 4ENZA 2YARA 3AW5A 1OCCB 3FSAA 1AIZA 3ABKB 4JKNA 1ZIAA 4M4RB 3NJKA 1N68A 1JERA 5I6PA 1MZZA 3AY2A 4E9WA 1I53A 4Q8BA 1J5CA 1JOIA 1PZBA 3AG3B 4GP8B 2IWFA 1OF0A 4DP5X 5IY5B 1L9TA 2VM3A 2JKWA 1J5DA 1T5KA 2J5WA 2YXWA 1KBVA 4A67A 1CYXA 4DP4X 3GYRA 2YAMA 1NINA 1XB8A 4YSOA 1AS6A 3UAAA 1J9TA 3S3BB 2R7EB 4N4YB 4YSRA 1R1CA 4YSEA 3S3CB 4HCGA 4HZ1A 4DP2X 2VW4A 1BYOA 3OMIB 3NJJA 2MTAA 1XMEB 1GW0A 1BXVA 2P80A 4A66A 3ERXA 1L9PA 4DP0X 1JXDA 4G72B 4E9RA 1HFUA 4JHUA 4E9QA 1ILUA 1SDDA 1WS7A 3AG4B 1WA2X 2PPCA 2AVFA 4A2DA 1BQRA 2UXVA 1A3ZA
chains in the Genus database with same CATH superfamily
4LARL 5LCVH 5KAQG 5MI0C 1J8HA 4GKZB 1WAAF 5IUSA 2ERJC 3O41A 3VJ6B 3S5LB 3VFNA 2XTJB 2C1OA 4QOKE 2BP0A 3CFCH 1EO5A 3G6AA 2IVFC 3VRLE 5B3JE 4NS0A 1Y0LB 3FB7B 4ZQKB 1AD9A 2Y07H 5EOCH 3TYFB 2AQNA 4JRXD 3RDTA 4O5LH 3MX0A 1MW0A 4U4IA 5E6IC 1KV3A 5D2LB 1MHPL 2R4SL 3MROA 4HGMA 1TPXB 2ZUSA 3JWDC 3MUUA 1CGXA 2VN3A 1KJMB 3H54A 4GRLD 4PJEA 4YHPA 5CGYD 5JQ6L 1RUQH 5EULV 3O2VH 4WGKA 3H3PL 1K72A 4XCCH 2G2RB 2VR8A 4LQ1A 3SJVD 1EZUA 1IAIH 4GS7C 2WB1A 5EF0A 5DUML 5BS0E 3TT1H 2E9GA 3NABL 1KIUB 2A74B 1UT2A 1XCWA 1YSOA 1QEXA 1OM3L 3UTTB 1I8UA 4ZO8A 4EI5C 1MFDH 3LD8B 3ZSTA 1K4DA 3DNKA 1RZQA 3MLVL 5EN3A 1EEQA 3L5XL 4LKXB 1L9QA 3VI4E 3PJSA 5EWIH 5EBLA 2BSEA 3DURA 3N9GH 4Y4HD 1BFSA 1CTOA 5CGYC 3V4PB 1KPUB 2NZ1A 3T65B 3H9ZA 1EO7A 3KPMA 5IZ7A 3RA7H 3WKPA 5AYTA 1CZ8H 2VDRB 4ZMQA 3HC2A 4G82A 2WMPB 1TYJA 2ZWSA 3MJ9L 3K6NA 1A6TB 2QQNH 4MAYC 1A14L 2RQ8A 3GGWA 4N6RA 1NCDL 3SPVA 5C2UB 2OP4H 2EC9T 5DUMH 3V4UL 3MLSH 2EKSB 2EICA 5GRXG 2F8VA 1UYWH 1CYWA 4NO2A 2PXYA 4KVNH 5DZLA 4BH8B 4PBWD 4Y4HC 3T1FA 2A9CA 4K73A 2KT6A 2VDOL 5KSAB 5I6NA 5L9DL 1A6WL 5JPNA 1KENH 1S3KL 3SGKA 1HOEA 5JHLH 3DOSB 3RPIB 4AG4L 2NLJA 1IC5H 3L5IA 1OAQH 3W0WA 3D4ZA 4I0CC 3P0YH 2HX8A 2W9DL 4K9EH 4UT7L 1BD2A 3PLYA 4NFCA 3WDJA 3VFSA 3BPCB 1QA9B 2PYED 3L48A 3UTQB 2WK2A 3UO1L 1KSRA 1ZK9A 2NW2B 2CDFB 5ID0A 1PPIA 2OMXA 2XIBA 3ZRSA 4OZGA 1UGKA 4KKRA 4NUPA 3V52H 4Y9BA 4PRNB 3FQXA 2FECI 5I1LB 4N8PA 4NFDA 5C6TL 1NCBH 2MJWA 4XRCB 3T9WA 4M9OA 2NY3D 1L7TH 5DK2A 3K6FA 4HX1B 4AUYA 3VXNB 2OP4L 1DJHA 3IGAB 4MZIA 4ORZC 3VVWA 1EEUA 5E51A 2RALA 5TK4A 5EEYA 1T04B 4NQDA 5CEZD 1LO0L 1X5YA 5FUOH 4P06A 4G8GE 4ODXB 4D0BB 2Y5EA 2BC4A 3BOVA 3ZZ1A 1YMHB 1Q0XL 1ZHNB 3FOMB 4H4NA 2WCPA 4N5UA 3APDA 1UXSB 4OGAD 3X3GL 3IPBA 3A6CH 4D3CL 1JVLA 1LGVA 3QC5X 3BYTA 3GS4A 4UOQA 4XHJC 2MCAA 2IDUA 4AIXA 1KOAA 4FQIH 4M4RA 5CU5A 3ZQ9A 4TSAL 4OCXL 4GW5A 5DC0A 1PIGA 4MNGA 1X7QB 1ND0B 1MVUB 3BDXA 3EGDB 4KK5C 3HUJF 3NIGF 4OLYL 5GZNA 5AL0A 3VI3E 4CNIB 2OMVA 1WGOA 2XFXA 4H2AA 4AV5A 3QDJE 4YDMA 5TDOA 5DQJA 5JPMB 1IFGA 3N44B 3WAJA 4Y0GA 1MWAA 1CMOA 5HYJA 3D0LA 3WEXA 3KYNB 1JTTA 4FG2A 5JIHA 1L3WA 3F04A 3F84A 3P4NB 4UT6H 3CC5A 4N9OB 1NM9A 4FQCL 4PCYA 2D2CC 3BRGC 4CKVX 1SBSL 2VIRB 2Y2WA 3REVA 3H9HA 3W0WE 1IKNA 4HEME 4BFBD 4KQ3L 2VR5A 1JXKA 1JGVL 1H3PH 2IWKA 4S1DC 3SOBH 4DGYH 5EFIB 1BFTA 1MFUA 4TV3A 3VXTA 4IQHA 1PFCA 1N6VA 1PW3A 4Y89A 3QEHA 4V1DB 3WFBL 4AI7A 3AU1A 1IGTB 1NUGA 1BA9A 3CMOL 3SDAA 4CMHB 3ZDYB 1CICB 4BSJA 4P2RA 3QUYD 4NM8H 2MHAA 3A4FA 2CWRA 3F7VA 3CFDB 2BS71 5JHDE 2VC2L 4FQLH 4YGVB 4XMZA 4CAGA 2EAEA 3BLKA 1U3YA 2BSCA 4Q9QH 1BECA 5DHVA 4UMSA 3RI5K 4PTTB 3B9KA 3KJ4C 4J39A 3D4GA 1F2XK 2ESVD 4P3DA 3QYMA 1SXSA 3VXUB 3AADB 3KPNB 5FCSH 2X09A 1JI2A 1MQKL 5HHNA 2WAQA 4PJIA 1GPOH 4LLMA 3SGDI 4LFHD 1AZBA 4JZNA 4OD3H 3O6LL 4X7SH 1EPFA 5IHZB 2IMNA 3V6FA 3OX8A 3QWOA 4BZ2A 5J13B 5AVSB 4PW3A 1JK8B 3CN2A 1KLGB 2FYVA 3KXFE 4F57L 5C9JB 4JG1L 4XP6L 3UBXB 2IPUK 4ZW3A 3AT9A 5GS1A 4JM2C 4OLZH 3VFPA 4UWQB 1INEL 2X10A 2YJLA 2A9MH 3O8XA 2MFNA 4OFDA 2QKIC 4NENB 3IK2A 2FSEA 3BDYL 2HFGH 3EJYC 3MV7E 1K3IA 3D69B 4HKZA 2J57A 4IOIA 1JVKA 1CFTA 2NZIA 5AVXB 3SYOA 3I75B 4AEHH 4MJHA 4MNQB 4S0HA 1IUZA 4W6XB 1S7UB 4UM9B 4PV1C 3HUJE 3EYUL 4PD4J 1NMAL 1YY8B 3P3YA 2CK0L 5FX3A 4MNQA 3FRUA 1BF2A 2WXJA 1CDGA 4EDWH 1I8MA 4JM2D 2VDKL 1H15B 3QJUB 4G6KL 4MQ7B 1W72A 2WWOA 4DN4H 4KKZA 4P5TD 3HBQA 2EDEA 2X6UA 1T5WA 1SMAA 4NZUL 4OLEA 2ZCKH 1JZ7A 3MRMA 1PLAA 3LQMA 3DTDA 2WYIA 4RH4A 1KIPB 4ZOBA 1FZMB 1QX1A 2H32H 1E2ZA 2ARJQ 1PDKB 1WRFA 3BP7B 4HQQL 4NP4L 5C09A 5KAQF 3X1EA 1NC2A 1GS6X 1FBIL 1YMMD 4IRJA 3OLEA 4HU8A 4HIHB 5C0FB 3FCUB 3QWOB 2VAAB 4P2QB 4MA7L 5IBLC 3DVIA 2PR9A 5ISZD 3TIDB 2L7QA 4CVUA 1Z0NA 3T04D 3N40P 4K9JA 3SEPA 5JLZA 3UTZA 4XPHL 4XWGL 2IADB 4L18A 3SKOB 1OQXA 3KPNA 1UC6A 3S36L 2BO0A 4O51B 4NLAA 4U0QB 4K0OA 4IJ3C 5DHVB 1GOHA 2ZKMX 3EYUH 1J1PH 1U4FA 4JM0A 5FWRA 2ICWA 1KGWA 4RGND 4QIRA 5DR5L 5CD3A 3E38A 4JO3H 3MREB 3IVKB 3I9AA 2HKHL 2YMOA 2VDMH 5BRZA 4ODHH 1QSFE 2OV0A 2Q2LA 3TEWA 5E94B 2XHNA 5HJGA 4WTZG 5J6SA 4YQXL 5I23A 2BIOA 1CT8A 4Y5VB 4FZEL 1OOWA 2AK4D 2D7QA 2EIBA 2F7PA 4FQXB 4TTDD 3R7QA 2BW4A 4ZRGA 4Q2ZB 1T4KB 4N2BA 3WG7B 3T0DA 3QEUB 4QRRA 1NA8A 3T6WA 4WUUE 1CK0L 1TG8A 3K5SA 5C07E 1UA7A 4LVHC 1FC1A 5D5MA 1UJ3B 5L4MA 4BZ1H 2WZ5A 3KW7A 1GJWA 1UJ3C 2X6MA 4TVPH 3C60C 4A63A 3BFQG 4W81A 1HSBB 1UD2A 3P4OB 3GM0A 4G8FB 1H3WM 1KBKA 4ZUVB 1SOXA 2XYCA 5KS9E 4OI8A 1PX8A 3MBED 3O3EA 1ADQH 2ZJSL 4K15A 2FIKB 2XG5B 3MJ8A 4P5TA 1ZGLP 5E4EC 4UTAL 5I1IH 4XNUH 2DQCL 2HH0L 1FG2B 2CDEB 5D1XA 2ZX9A 3BAEH 1AG0A 1CPUA 2AQ1A 4BKLA 5ITBH 1WFMA 4X4KA 3ECVA 1IBFA 2O5XL 3CU7A 1S9KC 4JR9L 1AD0A 3WXVL 2ZKHL 1ZANH 4NZJA 1U8OA 3QQDB 1IC4L 4N0RA 5T1KA 3GSNB 3NFNA 1WFIA 1NMBL 4L3AA 3CMOH 2EDYA 4FG6D 4BK5C 1UXSA 2ATPB 7FABL 4FDWA 3TT1L 4I0PB 1MCRA 4Y9CA 4ZS7H 3HG3A 3H4HA 4AM0Q 4PWEA 5DWUH 1A3LH 5C0RH 3HMXA 2BIHA 1Q72L 3KPQA 1E8YA 1FZOA 1YUHB 4U7SA 3SDYL 4MZRA 4X7TA 4PJEE 4NSKB 1S7WA 1L7IL 3CZEA 4S1RL 3HZ3A 3FBQA 2NUTA 5HGBA 3DPBB 3HNSH 4XRCA 4OZFB 4PGEA 5JW4R 2AJSL 1QTYT 2G9HB 2NNFA 3LH2L 4ZAKC 3OHXA 3WGVB 4GAGL 3T1WA 4GO8A 3Q1SH 3FQTB 3PV6B 4UIKL 3WSQH 2JQZA 2B16A 1EJOL 2ZCHL 2VH5H 1XF4A 1XIWB 3DMMC 5JHDD 2IOMA 1UB6A 1MF2L 4J3VA 4DP5X 2QBWA 4BFKA 4NGHH 4G8AC 5FM5M 2BVUA 3RY6C 2MCPH 2NY5L 3HOGA 1HINL 2XPYA 3MLXL 4BFFA 4ZUTA 1XXDC 2JMRA 2VO8A 4WSKA 2L7UA 2YLKA 3E6HA 1JFQL 2K6WA 4M6AA 2F5BL 4XP1H 1AS6A 1KB5L 1TDQA 2KKQA 3WV0A 2KZWA 1XR8A 2R7EB 3TBVB 5JPNB 4ZAKD 3STLB 4KHTH 5D2NC 5IB5B 3PXJA 3HNSL 3WYRA 3ROLB 2OR8A 1IM9A 3K7UA 1PJ9A 3N40F 3TVMD 5DRZB 2ZNWA 3RKDD 1XEDA 3MOBH 1KCVL 4H1LG 1AQHA 2GI7A 2P80A 2QPSA 4KAQL 4C58B 4CVWA 2FWOB 4FS0A 3U2SB 1YNLL 2UY6A 1SEQH 3MV8B 1MFEL 4JHUA 1N6QL 1FVEB 2ZG3A 1WA2X 2I9LB 3S34L 4FTVD 1SQMA 2UXVA 3H2PA 4HXAL 4LCWA 2C26A 5GZOC 1I4FA 1NH6A 1SNRA 2DIAA 1MY7A 2OL3L 1BMGA 4LRIA 3M07A 1IQDB 3MR9A 4KUZH 1TQCB 3BAKA 3X1GA 1CGYA 3C6LD 5BNXD 1WA1X 1H19A 3ZTNH 4U6TA 3BVXA 4PY8J 1JNJA 2GHWB 1HK6A 1AR1D 1CE6A 1NGQL 3A6BH 3TN0C 4ODUA 2FJHA 5DJ8A 4JG5A 1O7VA 4P5RA 1DVFD 3RJQB 3CQPA 1UEYA 3CCHB 2WLLB 4YEEA 3RWEB 2IDSA 1C8QA 1RZPA 1IEHA 4QJ3B 1GGBL 5GZOD 4Q9BA 3T0EA 2NY1C 5EZIL 3RGVB 3WMSA 1G7QA 4MRBA 1FE8L 1Z7JA 2IQAA 3U4EA 3JSSA 4Y2DA 3UACA 2X3AA 5GXBB 2P5EB 3R4RA 4RBPK 4IGBB 1JGEB 2BSTB 1NCJA 1FV1A 4ZX6A 2HJKB 5E2TH 1IEBA 3BEVA 3PPEA 1OALA 1VPOH 4GMSH 4CC4C 1M42A 3MRBA 5IV2B 3NA4A 1QR1A 3I84A 4XVSH 1NBVL 5CEZE 3PWUB 3TA3B 4NQDD 4OD3L 3MRBB 4G9DB 4P2CG 2FIKA 2XG5A 4B3VA 4EUPG 4EE2A 1AXSA 3AREB 3QRGH 4JRXE 4JDVB 5DI8A 4QO1A 1J8HB 2ED9A 4PLNC 2BNQA 3CIAA 2YD5A 3I6GA 1Z3RA 4Y2DB 1TNMA 4HFUH 3GZQA 1ZLVK 4JN1H 2P5ED 4MAUH 1GJUA 3GSNH 4YNYB 4YH6A 3H55A 3RWEA 4MZ2A 2Q87A 5IB2A 2E7LC 3FFOA 5F7DA 5AW2B 2CHZA 4GXVL 3TA3D 3CZNA 3TO4A 2HUHA 2V9TA 1UM4L 4X7EC 4YX2H 1E6OH 3FYIB 4PY7A 1WZ1L 4LSSH 1ZLSL 4JO8A 4XXWC 1NIAA 2YJQA 3KDMA 5AOLA 5AW7B 1FAIL 3ME0B 3ML8A 2FJFB 4FCHA 4X4XB 2HRLA 4UDTA 4XZUB 1HN1A 2Q76A 4HH8A 5FO7A 1V55B 3CZLA 3UAJC 1F5WA 1O6TA 1XCQA 4DGVH 4P23B 4O2CB 2KZ1B 3QG7L 3LYRA 3OVUB 4LSVL 1CGWA 4P23C 2R0WL 4XNUL 5BZDB 4F7MA 1PU0A 3BGFB 3UPAA 4LEBA 1N59A 4QTHA 3ZDYF 5FW7A 4I1NB 2B1AL 2AQSA 3OSVA 5CWSA 5I16A 3PWNA 3IFLH 1RH8A 1ADWA 4ZXBC 3GPSA 4BQ6A 2ADGA 4HC1L 3IJEA 5D7KD 4LEXH 4WY7L 1JK9B 4R0LB 3S3SA 5LQBL 2KDYA 4BD4A 1OTSC 2A7BA 3UG5A 4P2QA 2DTMH 2JKSA 3PDDA 4DPBX 3SJVE 2APSA 2VLLB 3QK0A 3GO1H 3QULB 4Y2OB 1AGDA 3F5WB 2DLHA 4MB1A 1J12A 1DO6A 4YHIA 7CGTA 1NC2B 3U0WH 2QMJA 1JCVA 2FLRT 2ZWKA 5IHWA 2A9NH 1DSFH 4FFYH 3L7EB 3FH5A 4ZXBD 1DCEA 3WNKA 5KSVB 2HTKD 4IS6A 4CVXB 5HHME 2BVPB 3E8UL 5FA3B 2E0PA 3DV6B 4AENB 3NIGB 1H15A 5F9WB 1OTSD 2B8OT 3OHXB 4Z0XA 2PF6A 4WHDA 1KTJA 2QVKA 5EU4A 1E8XA 5CXPA 3IFOA 5J06A 2GTZB 4NIYE 1S7WB 2WVVA 3K74B 1QG3A 3L4YA 5LNGA 4ZPVB 2F7RA 5AVWB 3QAZB 4OFYD 3FN0L 1OF2A 1XTLA 5CLZA 4DP6X 1MXDA 4L4TE 3U9WA 4MKMA 3L2MA 4EOWH 1IC7H 3AJ7A 3GMLA 3MNVA 4KKCD 4KX8A 5KEZA 5AW0B 3AWGA 1XO8A 4MFHA 5CLTA 3FO2B 1PLGH 2W80C 3DX7A 4D0CB 4FG4A 4KROC 2WIIB 1KYOJ 4LPTA 3DGDA 3LX9A 1U4EA 4KOBA 5IK3A 1MFCL 4EPSA 2NY0B 1PNCA 1RVFH 4PJCB 1A1MB 4BUQA 3O45A 3FU7A 4PBVC 5D1XB 5EEWA 4OZHA 5DO2D 4BXSV 5JUEL 4L4TD 2OZ4L 3MJ8B 3MRLB 2AEWA 4PJGE 4G8GB 4GKNB 4QGYA 3CVHB 5I19L 1CXKA 2GUOA 3V6OA 1LP9F 4WUUD 3WO4C 1U8NB 5EC2A 1PX3A 2FQEA 3VD9A 4FQXD 5E56A 4N0FB 3B56A 5IWLC 2ARJA 2X7LB 4PJ7F 1LE9B 2VKWA 4OGXH 5TDNA 1DUZB 1I1AA 4NRXA 1DE4A 1TTGA 5EORH 2PETA 3NN8B 4QY8A 5T33H 1HHGB 1M6UA 2IAMD 1JZGA 3M7OA 5JXEA 2BRQA 2AAAA 5EZOL 3BP4A 3P1VA 4WGWB 3SDDA 1VPOL 4GMSL 3FK3A 5HGGS 4Y4KC 3J2PA 4N90D 5AL8A 2Z93B 2XZQL 2Y23A 4GRWE 1WAEA 4GSRA 4V1DA 2ENJA 5CUSL 1X5KA 5BOZG 2CGRL 4DO4A 1DBAH 1CR9L 4P9ML 3MREA 1TFPA 5E2UH 1U3ZA 3MUGB 4JRXB 4M7LH 3CVBA 3SGJC 5B38B 5CD3B 5JOFA 5C09D 4E68A 3BDBA 1A9EA 1EIBA 3WKYA 3ARBA 2CKNA 3VI3A 1PJWA 5AYUL 5FGBA 5FO9B 5MEOB 3FQYA 1BQSA 1NJ9B 3Q3GB 4P5KB 4ISVA 1AGBA 4MBOA 3MRNA 5HVHB 1N8ZA 3ARXA 1AZVA 1N8ZB 3B2PA 2IDQA 3C9NB 4GG6E 5J3HD 3B9EA 2VAAA 3BSZA 2WZ6A 4BBWA 2ZTBA 3CHSA 5H35A 4H20L 1YN7B 1CR9H 2VLJA 2WKOF 1YNTF 1KT2A 1X7QA 4I48B 1BCIA 4P2OB 1MY5A 3ARGB 1LXMA 1E0OB 5FO9A 5MEOA 3U4BL 4ZFQA 1BIHA 3WEOA 2AKRB 3VI4B 2B3IA 1Z1WA 4LXFA 5D2LF 5HHXH 1PZ5B 1S7SB 2GEEA 3BW9A 4UINL 4F37K 3ZHDA 3FUNA 3QO0B 4JFDA 1EGJL 2P5EE 4ODXA 3DUUA 3QCVH 2HRGA 5F72S 2P45B 2A6KA 4K9EL 5BRQA 1T04A 4HUXB 4NQDB 2DYPD 4HKXB 5C07A 3CK0L 3CAFA 3WHE0 3P30L 1OB0A 3KLSA 3NDYE 3X11B 2FAUA 2X1PA 3N42B 2EIZA 2V3DA 4U49A 1FRGL 4XPAH 2NY5H 3TONA 3WS6A 4LGPB 2GPZA 5DS2A 1UQSA 4E9SA 2F53D 1HKLL 5CN2A 1JDAA 4HJIA 1MI5B 1G4MA 2WWMC 3HPJB 4A39A 1BYNA 5TDNB 3EJJX 3IE9A 4NNPL 2FSEB 2YD9A 3HC3L 4GSUA 5LAXB 3IWVA 4J5VA 4W9IC 2MWCA 2FH8A 4PJ9D 4WI8A 5CCKL 1C08A 1E5UI 5IMLA 3EOAA 4LPVA 4GBXC 3OM3B 5DJAA 1BLIA 1CLYH 5FWQA 1AIFA 4G8EB 1SVCP 3QCTL 3W0WB 5DMGC 4J3WA 5AOKA 3QYCA 4R5VA 5F93C 1OT1A 1AZCA 3V6FB 4AWJC 5EWIL 3Q8BA 2UZXA 5DJXB 1FRGH 3OSKA 1ERNA 1GHFH 3T1FB 2NNXA 4K3JL 4GSDH 1NPNA 2DMCA 3FN0H 4X8JB 1HAUA 5A6LA 1JL8A 2LVCA 4JDEA 5DD3H 5FGCE 4HJEA 4J6RH 4IDLA 2V8LA 3RRQA 1HJCA 2D7PA 2IGFL 3DLQR 4BKSC 3IDIA 2XWXA 3GMLB 4I87A 2BSRA 5BOPA 4PSRA 5FLVA 1T6VN 4LNRB 4WWPA 2AQ3A 1C8PA 3C2SA 3QI9C 5JOPD 2YKLL 1RURL 4GKLA 2XN0A 3TTYA 3SY6A 1FHNA 1NCIA 4IKKA 2D7NA 1KPUA 3KL0A 4N2NA 5B1BB 5HI5D 5IGXL 3G3LA 4MA8H 1DFBL 3PJSB 3IJ9A 5DO8A 4WQOA 2WQUA 4YWGH 3RL2A 1G7MA 4GQRA 3EZJB 5T5NG 2ITCB 4GQZA 2A4ZA 1NL0H 3OPZH 2H2SD 2GSGB 2J56A 3FT3B 2J25A 3P0YL 2Q7YA 1OP9A 2DL2A 1OD9A 2DPKA 2V9QA 3NCFB 5FYLD 5ANME 4CVXA 2K8QA 3REVB 4RETB 4RAVA 4Y19D 4KMTH 3KYKH 4JY4A 1FORH 5AZEH 3QA3B 3SDXB 1A4KB 1PVHA 1RCYA 2OMTB 4Y16D 5FV1L 1G9MH 3WY2A 2XSKA 1U8PB 1YN7A 4AJYV 3QQ9D 1I8IA 1UWXK 2D4FA 5DJ0A 4HULB 1PTZA 1RULH 1SYVA 1PL3A 1AD9B 1KELL 1HEJC 5SX4H 1MLCB 1D7BA 5C0IB 1CYGA 1ETA1 4JO1L 1OCCB 3HTLX 3L4ZA 3ABKB 3ARDC 1LE5A 4MS8C 3DK2A 3ETBF 3ARDB 5I6PA 1KXQE 5HVFB 1DFBH 3GMQA 4F15C 3W9DB 4XN8A 2HH0H 1OF0A 1TJGH 5D1QB 1L9TA 1RUPH 4YZWA 5DVNA 5DMYA 5DGRA 4D2NA 1IARB 2QPFA 5TDPB 4X9GA 4ZD3H 1NINA 4UDTB 5EU6A 1QLRB 3NCYS 4AL8C 4BINA 1RIUL 1RJZA 3BKYL 3LRMA 3VXNA 5F9JB 4MXVE 4WUUB 3RTQC 2YMXL 2NNCA 4FXKC 4HZ1A 1PYWA 1JHTA 5DD5L 2D9QB 4QRPB 3RVXD 4AK2A 3GPEA 1WLHA 1MHPH 1HQ4B 4Z7UB 2Y36H 5E5MB 4A66A 3NUKA 3V8OA 1I1AB 5CBEA 4CMMB 5D1QD 5LG1A 2JI2A 4NKMB 2HWZL 1QPXA 5BUAA 2PPCA 1AQKL 1PD0A 4G7YL 3K6IA 1QSEA 3VFSB 3BPNC 1U8NA 4P2QE 4YDJB 4YL9A 2VDRL 5I8CA 4JGNA 4B5EA 3S3JA 5IW6B 3F83A 2FX7H 3RTQD 3O11B 1T3FA 4RSVA 1J0ZA 5E6UB 4JFWA 5GIRB 3WJJC 5HYSA 2ZONA 3MCKB 1PLBA 4KPHL 3RX5A 2C9UA 3S48A 2CCWA 1QTPA 4JZOB 5C08D 3VRLF 5B3JF 3T08A 4NXKA 4R5XA 2EXWC 2DQIH 2QHLA 4JY6B 2XVBA 1JGEA 4D0CA 1HHKB 4UOZA 1PG7W 5DJZB 1WDAA 4AUUA 2AMUA 1WVZA 3E6FB 2VJ0A 2OMUB 5DJ6A 4MA3B 3PQYA 3RBSA 3WIFA 3IF1B 3N55A 5E00A 4QYAA 4U3CA 3T0EB 1YEWA 4ELME 3FTGB 3U7AA 1FNFA 3P3TA 2G3ZA 1LM8V 3QFJD 2OMZA 4RCAA 3FUEA 2P49B 3F58H 3O3UN 2X4TA 2YGOA 2VCOA 2PP7A 3BD3A 5FYJL 1HQRB 5PCYA 4ZMZA 1A9BB 3SE3C 2IBBA 4MMXC 3EO0A 3HN5A 4N2KA 2F54D 4Z5RB 2OMZB 4GSDL 2MRYA 5T3XL 5LNDA 4Z7UF 4E0RA 2ZOTA 3LMJH 5HJBA 1MEXH 1WH0A 3FTGA 1WEJH 3WUWA 5DSCA 3EUDA 4HUWA 1G7HA 2AJXH 1RV6X 1Z9LA 3GUTA 1NBCA 4Z7VE 4QRQA 1N19A 3EHBD 3U2SA 2HTLD 2OMUA 3NSJA 1T7WA 5DJ6B 2CGZA 3QFJB 1PZSA 2XV6B 4P2YA 4XP5L 5FGRA 3LKRA 1JCKA 4YHYB 4Q9RH 4NPKA 2QSTA 1AQMA 1N5YL 1FIGL 5IESH 5IQ7H 1CD1B 3H3KA 3ROLA 2PW1A 2V9RA 4IIQB 1MCWM 3MMEA 3CVIH 1JAEA 4Z7VA 4TLTA 3ZT7A 2NY7H 5KVFL 1MI5D 1B0GB 4YXKH 5MP6L 1S7TB 3L3HB 4FFWC 2NXYB 4M1GL 3VX0A 5E8DH 2YPVL 1D5RA 2XX0A 2V33A 3SDDD 4XMXA 1TJIL 3JV5A 43CAB 5LLIC 2UUDH 1KGCE 3WTXA 5BZDA 5JXED 2AITA 2NPLX 3JT2A 3FRPB 3P3RA 4GG8A 3B2VH 4GSQA 3PV6A 2BWIA 3QIWA 5DMIL 1XCQB 3D08A 3ZL1A 4C59B 1ZDSA 1FBIH 2FJFA 4XZUA 4WHTA 2YK1H 2G9HA 1MJ8H 5GISL 1LHZA 3W57A 3KDMB 4R7NA 3MRDA 1BPLB 3GINA 4PY7B 1H8OA 3HLAB 3QEGH 4NQCD 3C5JB 3GLEA 4FQJL 3EF4A 3MBEB 1YJDL 3HNTL 4KBPA 4TNVF 3CQFA 1ECZA 4YK4B 4JFQB 5LGJB 4PJAE 2EZ0C 3Q5OA 2I26N 4YNYA 4DN3H 5IJVA 2LU5A 2AW2A 2P8MB 3UC0H 3RB7A 3BZDA 3CHRA 4W4OA 1I9RL 3CBJB 3VXMA 1AI1H 3Q43A 3PWLA 2Q6WA 3B1TA 2BHZA 5HHOE 1NEZA 1WZ1H 4LSSL 1SGKA 1R33A 4GRLC 3HR6A 3GMQB 3ZHLA 2CLVB 1T1YA 4UYQA 5C0CD 2B7DT 3ARBD 3GMRB 4KUCF 5CNHA 1I7ZB 3VYNA 3LQAC 3MRFB 4NAMA 3ALWA 43C9B 1YZZA 3GKWL 2LLGA 1FG2A 2CDEA 3QWRD 4ZO9A 5DUJA 1EFXB 5EZJB 4V1DD 2HJFA 1OCWL 4TQ8A 2X9WA 4CVZA 1AE6L 4FX5A 4IDJL 3AU0A 3N85L 4X99A 3TBYB 3VMPA 3VXRE 5K9KA 1L6XA 3W11C 2R2BB 4FP8H 1DVQA 2BVEA 2VMFA 5I71C 4AZ8A 2OMTA 1I7UA 3QNZB 4TSBL 1T21B 3LKQB 1OQOA 3EYVB 3S37X 2VDLB 1C1EH 3CLFL 1VA9A 3KW8A 4FNTA 1BAWA 4KMLB 3IDJB 2Q3AA 5GGRB 5ITBL 1ZVSA 4HSQA 1IAII 3H2WA 1A2YA 35C8H 4FQXA 1GOFA 5DJ8B 4LEOB 5AKTA 3S6CA 3VWKA 1CDUA 3RDJA 3SY0A 3T3MF 1NC4A 3RL2B 4JG0H 4YHNA 3W11D 2R0LH 2W0FB 3KE0A 3DC0A 1FAKT 1OP4A 4N2FA 5TPWL 1MCPH 4PJFA 4U31A 2Y3AA 5B8CC 2ISDA 1RHHB 1LO3L 4AEIL 3ZMEA 4P4RB 5B8CB 1B6DA 1Z3GL 2XA8H 1MWAH 4FN0A 1KF9B 1T83C 1UD4A 1I3RA 4EN3C 3FFCB 5I9QB 2NY6B 3ENEA 2ADIA 5DLMH 2IG2L 1K8DA 2DZEA 3MACH 3BT2H 3AQYA 3MV8A 3DIVA 1KTDB 1LK2B 1UXWA 4MCMA 3C12A 4BFRA 3I3DA 2PYFA 5A2JH 4HH9B 3IDYC 4YBQC 4KDVA 2K7PA 5I1HL 2Y9RT 8CGTA 3MXVL 4GPVA 1CLYL 3V52L 2EH8L 3DRTA 4R7DA 1AZRA 1NQBA 1E50A 3D4YA 4WUKL 3UTZB 1MFCH 3QG7H 2Q7NA 2B08A 2LAGB 3ISYA 3UO1H 5EZIH 4Y1AE 3KPLB 4ZMLA 4P46C 3ABLB 4KTDH 1YG9A 5LDUA 1E6JH 3U25A 3UZQB 4B7IA 3GF8A 1WTLA 3BP7A 4TQEH 1BP3B 2X4NB 1KWKA 1P6WA 1YNTB 3R8BB 1OAYH 3E2HC 4JZJB 4JHAH 3F8UB 4YBQD 5CJQL 2D03L 4QXVA 4HMCA 2IGTA 5LWYL 1V3KA 2ZP9A 4E9YA 1T5WB 3OKLA 3ZYIA 4PW9A 1RPKA 1OD7A 2FL5B 2VDNH 3C5SA 3FQTA 4MX7A 2O6FA 1XSKA 3PL6A 4QWWD 4F7EB 4UIMA 1IFHH 2VABA 3UOAB 5KWYC 5CZVL 5MEQA 4WJG3 4EI5B 5J1AA 3GXTA 5DZAA 2ZSWA 2W91A 2YD2A 4P46D 3K46A 1S9XB 1UGNA 4LAJH 1GGIH 1KCRH 1SY6A 3D2TA 3TP4A 4FXGC 1YNKH 3RZCD 3NJGA 5JIQA 4Z7OE 1KMGA 4ZMAT 1IGJB 4CN1A 4Y8DC 4CC1A 3GXDA 1OCZB 3B5GA 2F7IA 3P9MA 5I5RA 3S8WA 3KYOB 2H32B 1Y07A 1T66D 3N44F 3QCUH 3HB3D 5I6OA 1IGFH 4NKIL 2QV4A 4ZBJA 1Z5YD 3SD2A 5FECA 1BLNB 5GJSL 5C1MB 2AJUL 3NFNB 2WZAA 5JOPE 2V17L 1A5FL 3MU3A 3B2UC 4KQ3H 3SOBL 5IG7B 2XU9A 3IMUA 2PO6A 2F1AA 2OQJA 2K45A 4Y4HB 2EVIA 1E7UA 2ZPKH 3NVQA 3EH1A 2YUVA 1K5WA 4R84A 2IBGA 3TU6A 1X5LA 3MRNB 4L37A 4X8GA 3Q2NA 4UBDD 4ODSH 3ASOB 4P5KA 1VJSA 1CQKA 3SQOL 1NJ9A 5GRJH 1XAKA 1BBJB 1OE2A 4Y2NA 4UF7C 1FVDA 3B2UD 4JPWH 1ZTMA 2AJVL 4WTZA 3DROB 4HF5L 2ZYHA 5BS0D 4ZMYA 1COBA 1SXCA 4MNQE 4PJ7E 1XCTB 3IS1X 4TVPD 1EEYB 1AG6A 5K59F 4GW4B 4L4VD 5IM7A 3D2UB 5I75B 2Y5TB 3L4CA 4TUUA 3BO8B 2WQAA 3ALXA 4HFUL 3WEBA 4HIEA 1C5CH 5E94A 3GQFA 2FUQA 3CZGA 4CMHC 4YHZL 2C3GA 2LTQB 1EEYA 4QHUA 4U1LB 1TVBA 1ZT1B 1KN2H 4LGRB 1T0MA 2I5YH 4PG9B 4QLWA 3L81A 1OEZW 3HC0A 3EG9B 5ADPL 4LVHB 4ONOA 2W8CA 3T0BA 4ACPA 1KEMH 3HE7B 5E2VH 2BZCA 1Q8MA 2AXGB 3K71B 1HCVA 4H40A 3F05A 2TSBA 4TQHA 1GR7A 5J4MA 3SGDH 4LCWE 4OZHB 4OIAA 5H8DA 5I6XC 1WIUA 2C34A 4NQQA 2JJWA 4JPVL 5DD0H 3RWDA 3RY5A 4XVTL 1FLRH 5I1DA 1Q94B 1MHEA 3C6LA 1A8ZA 3PWPD 4K3DL 3QIUB 1V05A 1RXLA 4Z6AT 1NBQA 1F4XL 2VLRA 2N0KA 3QO1B 2FZ3B 4M6OH 2R0LL 5E1AB 1P84K 1TYEB 5E6YA 2GJZA 5IQNA 1I3GL 2BC4B 3UEQA 2FQGA 3SDCB 4AGLA 3CFTA 4FNSA 1IGJA 4ZX3A 5GHWL 3SDCC 4W9JC 5HYFA 4JFHD 1MIMH 3FRUB 4F8PA 1FL6A 2Y7SA 3S3DB 5JNYA 4AKOA 2QVMA 3NCJL 2AANA 3TNMB 1ZXQA 1RFDH 5DK2B 3AWEA 4NRZB 1KACB 2XCMC 1MCOH 1ZPLA 5JW3H 3I75A 1KJ2A 5TFSH 1FL5A 2NY2D 1AR2A 2D3NA 3TVMB 2IC2A 3C5SB 1GPOL 2BVTA 5CIPH 1YNLH 4OT1L 2CDFA 1N68A 3DGGB 4F9LA 2WQWA 4IJTA 3AB0C 3LIZH 5JZ7D 4NLHA 3ZTDC 2Y22A 3HPLB 5JHDA 1BD2B 5I74C 4B7LA 2AQPA 1HZHL 1IAKB 1VAHA 4OV6F 1DN2A 2NLJB 1DP0A 4HGKC 4DT2A 1YYLL 3D18A 5IKCA 3IBEA 1EUUA 1U58A 4N25A 2WSPA 4N85A 5JW3L 3DX9B 2FATL 3QUKB 1CLOH 4FQPA 1FLTX 2UZYB 3FFCD 1QYGH 4WFFE 4WK4B 2Y7OA 5H37G 1ITCA 1HEHC 2DLGA 4M1GH 3BUBA 5DS8B 2Z9TA 2PYFB 1TNNA 3Q8FA 1DVFB 5BQ7B 5GGUB 3SPVB 1S7VB 2WXNA 4DKEL 4OW6A 3DSFL 3F7RA 3GGWB 5AEAA 3QZWA 4E9QA 4F7MB 1QSZA 4OCMC 1QRND 3PE9A 5KN5B 1QWNA 1BQRA 1PEZA 4WFFD 1I3RB 5DHXB 5ICYA 5FYKU 1RZ7H 2G75B 2G3MA 5IP4A 1UWGH 3AY4A 1MPAL 1S5IL 4C56B 2W0FA 2JB5L 2YN5A 3MRRB 1YEIL 3TEZA 3MBXH 3KGRA 3QH3B 1YC7A 4OI9A 3EYFA 3S35L 1DQKA 4QXGL 4F2MB 2K70A 4FQ2L 2BCKA 4JR9H 4DOHE 5DFVC 3FT0A 1GYUA 4NB7A 2CQVA 4C4UA 3UTPD 4Z7WF 4OF0A 3H9HB 3VSTA 1CZ8L 1FPTL 1XF1A 2BX5A 2AP2A 1Z5LA 2QQLH 1G7JA 1DTUA 4FQQA 3AROA 3P4NA 1LJMA 3WEMA 2E7CA 2HYMA 3JWOC 3RGVC 3D0LB 3QDGB 3WEXB 3I9GL 1UZGA 4DCQA 5K9KB 4D9QE 2WIMA 4GXVH 4NRYB 2AQTA 3OGCA 4RVBA 3BVNB 1OWWA 4XMKL 3TM6A 3N91A 2DLFL 4G9DA 3NEXA 5EZJA 4R4FH 1T7XA 1PMYA 1OAKL 4JUSA 4KDWA 3WMQA 2AK4A 2VXVL 3DVGA 1R5IA 1AE6H 4JFXA 3MRFA 1XGQA 1DBKH 5DU7A 4XNAA 4KXDA 2FUTA 5EU5A 3K2UH 3O3DB 4AV0A 3ZJAA 4TVUA 5ALBH 1QD0A 2CBPA 3BN3B 4M1CC 3RGVD 3U4EB 1G7QB 4FMFA 2LVEA 4GEJA 1C12B 3NH7H 2V5RA 2XG4A 1ZXKA 3NBNA 3KVQA 3DGCR 4U6XA 3EOYG 4PJ5B 3WFCL 4U1GB 3PGDA 3TWCL 4I0PC 1FJ1A 4Q97A 4Z18A 2OSXA 3GSXB 5HI4D 4M5YL 1ZHBB 1Q1PA 2UWEA 3DUSB 5HD8D 4DP8X 4HX1A 4LCCA 4N8UA 4JO4L 2DMHA 1CO1A 3CX5K 3DO3A 2DQUH 4GY4A 4R7NB 4RFEB 4FXKB 3BJLA 3H3BC 4TNVK 5KOVC 1UATA 1NGXA 5BW7C 4X83A 3QIBA 2X9YA 2Z8SA 1YMMA 2CSPA 3CK0H 1X5ZA 1EMTL 4OAWB 3L3KA 3STBA 4MA7H 4QI3A 3WFZA 4A2GA 3AXHA 1FVEA 4A37A 1NWPA 4JW3A 43CAA 3V4UH 4WFEE 2X4SA 4XWOD 5D7IA 3OD3A 5M7QA 5FCUH 2VXUL 5KVEE 4PGDA 5K9JL 1SJEB 4IHBA 4LRNL 1HXMA 5IJKC 4WUKH 4LLVB 3L3OC 2M83A 2FGWH 3HG1A 5IT2L 1J9SA 2VW6A 5ANMA 1D5IH 2F8OA 4F58L 3MMEB 4FXLA 1F1AA 4CL7A 3E7JA 5ESAA 1ES0B 5IB5A 3FOLB 4NCDA 3ZYZA 1B4JL 3ZE1B 3ARFC 2PXYB 1AOHA 3ILPA 5CIPA 4EDXB 1IKOP 4QPEA 4UT7H 1FH5H 1KZQA 2HLAB 1BQHA 4G59C 4WEEA 2NSXA 2QGBA 4ODHL 2ZXEB 4JNXA 1OLLA 2PR4L 3FYEB 2MNWA 1LEKA 4NP9A 5AB2A 2JKRM 3MPCA 4ERSL 4R97C 4LLAA 4WWKC 3QDJB 4PJBE 4ZDHB 3CUPB 5DTFB 1BQUA 1FNHA 2ITDA 1G7PA 2UZIH 4JE0A 4N0YL 3VDBA 2DI9A 4BIKA 1JXFA 1L6PA 5AW4B 3THMH 2X2YA 3WXWH 2ZUXA 3MHZA 1WBXA 1HYSC 4OZFA 1RVFL 4RMVA 3SCMD 3TL5A 3CVDA 4PYHA 3IU4H 2DV6A 3FFDA 2NX5B 3LNFA 1FZOB 1YUHA 2JJUA 1BXAA 2OS7A 4OIIL 4OV5A 1B90A 2GB2A 3MVSA 3AZUA 3BX7C 3MGTA 4WWKD 2C9RA 3GT6A 4YEFA 2IV9A 3H53A 1LO2L 2E8ZA 4S2SA 3LRHA 3EO9L 1N2RA 2FEEI 4KX9A 2ESVA 3M17A 2DQCH 2V3EA 3K6DA 2DYPB 3B7TA 1IBZA 4EJ1C 4PJEB 1VZHA 1PZUB 3K6OA 3QQDA 1S9VB 1BAFH 4Y2LA 3GDBA 2QVIA 3O4LD 3CV5A 3SCMC 3WXWL 1AD0B 3ZHFA 2J5LB 3CFKB 3MX0B 1WWAX 3ZTJG 3OZKA 1W15A 3OBAA 4GFXA 3BIKB 4JKPL 5HVGB 1I31A 3QJHA 4M7LT 3X1NA 4XN7A 2ADFH 1GZPA 25C8H 2K6YA 4OLVH 1S4IA 2VDPH 3PGFL 3G9AB 1FVCB 4CA4A 3AREC 4Z7OF 2OMYA 2XIDA 1MKFA 3ZE1E 3JWNE 5KW9L 3KPSE 1X7TA 1NANI 2C7UA 3FTVA 5F0LB 2XWBB 3KWXA 4L1SA 3RU8H 3K0WA 3EGSB 3RWCB 2NY7L 3CLFH 3PY9A 5CEXA 2QVFB 5E08L 1JWSB 4LPUA 2IPKA 5D93B 5KS9B 4LFHG 4WO4B 4R4NC 3QORC 3HZYB 3Q5TA 1OM3H 1BYPA 3WFBH 3HJEA 3V8CA 1P7KB 4EI6B 2OKMA 1JI1A 1RLBA 2CLZA 2EKJA 1ZE3C 4PB0L 4WCYH 4WI0A 1H0DA 3MO1A 3B2VL 5JIMA 5CFAA 4IMLA 4AQEB 3GXUB 4PS4H 2XN9D 3IFLL 2BFGA 2O5ZL 1NAML 4HK3N 4KKLC 4KRMB 4XBPB 5TDPA 3SPGA 4OGQC 3HNVH 2HG5B 4UU9A 5INCA 1WBZB 4Y9EA 5A2FA 1ZV9A 4YHML 1JPST 3EYOB 4TSCL 1ZA3A 1OAKH 1AJ7H 5C0GA 3QORD 4PG2C 4BFJA 3BWAB 3MRIB 4NM4H 4L2YA 5DLLA 3PAVA 3TPUB 4N8VA 5F1NA 5A7EA 1KNOB 3D3VE 2ZUQC 4ALAH 3T5WA 4ZXBB 1X4XA 2HSIA 2ZG2A 2NY4D 4PHXA 2QQNL 1ZLUK 4NUGH 3MJ9H 5IVXB 5D96C 2HLEB 1MFEH 5FF6A 4HIIB 4UOW1 4J1UA 4H8UA 1ROWA 1NOLA 5C0FA 4M5SA 2P4AB 4UI2A 4IRJB 2XVKA 5CN1A 5GGTL 1R3JA 4KKPA 4AL8H 1WZKA 4ZTPH 4X5XB 1LWRA 4HISA 5SWSA 5B3SB 3FF8A 1WZMA 1H9DA 4KQ4H 4GSXA 2XVLA 1P2CB 3L2NA 1NFDB 2FT6A 4DP9X 2PCPA 3FQRB 4OZ4A 4X9BA 5SWSD 4FJYA 1OT2A 3DJ9A 2MMXA 1HXYA 3FPXA 2DMGA 4FLRA 3HE6A 4D7PA 1E9OB 1A64A 5HDRA 1IBDA 4L3FA 1CIUA 2M2DA 2VT0A 3PFQA 1QPPA 1VFOA 2K0RA 3HRZC 2HFTA 4OF6A 3H42H 1M1XB 1P4LA 3QR0A 4QXTA 5FFOA 2XN1A 1HHIB 1THAA 1UADC 1NFDE 3UJJL 2DEYX 5I6MA 3X1FA 1G0XA 4OIBA 4HJ0C 1TEFA 4ANKA 3MLZL 3ZTJH 1TZOA 2ITFA 4KXCA 4A2FA 4IU3A 3D69A 4MRCA 1DBML 5GGSA 3OKNA 3FMGH 3FZUD 3RIFK 4PJ5D 4JFSA 3WE6A 2J55A 3OJVC 3NRQA 5DFTA 5I0ZA 5ID1A 3OXSA 4POUB 1CXIA 4B9PA 4K3EL 4RMTA 4XP9L 3SODB 4X6DE 1OY3B 4M03A 4E42B 3AFLA 4NN5B 2XKSA 3WL9B 1KXQA 1P69B 3G5WA 2A6DA 3P40A 1JPSH 2ZNXA 3CJJA 2IAMC 3QS3A 4PYGA 3TH2T 2OW7A 2TSAA 4MSWB 5IHZA 4WO4D 4JZNB 2AAVA 3VGEA 3MLSL 1JG9A 1HT6A 2ARWA 5TF0A 1HIMH 2Y6SD 4FFVD 1Y1DA 2KZBA 3TZVD 5IQMA 4Q7DA 3QDMA 4MCYB 4U1IB 3EOAB 1IM3D 2VZ3A 2Y69B 2Q3XA 2XFGB 2OTUA 1WS8A 4A7SA 4KVCH 4K4KA 3KLDA 1JPTL 1MFBH 2AS5M 4I5BB 1TZIA 5TQ2L 3VFGH 5AAMA 4Z78A 4NBYB 2IXQB 1WC7A 2E7MA 3H6JA 1LMKA 3GMOB 5LUMA 1I1FB 1DVUA 1TYRA 3L4WA 3VXSE 1CICA 1S78D 1DYZA 1I7TA 2Y6SC 4FFVC 2BOLA 1SBSH 1D3CA 5EUKA 3TZVC 5JXAL 4GAAA 1XSJA 4FYQA 4MMYB 1T03H 5IFJA 2W0PA 4F8TA 3O2DL 4WHYH 2XNAB 4N1EA 3SJVB 4YDNA 3GXNA 1IAOB 3UTSA 5KZCD 1K8IB 4W6WB 4OFPA 3MQIA 3VMNA 4M8UA 3CQQA 3ZDYE 3MRHA 3L5WA 1CS6A 3KXFD 3QZNA 5TQ2H 4XPBH 2B5IC 5EO0B 4F8LA 1YEGL 2YBGA 2G5RA 2ZT9C 1CVRA 1NGZB 1NBZA 2B5IB 1IAIM 1U3HC 2R59A 2Y36L 3NSCA 4MDIA 1AI1L 3RX7A 4ZMNA 1OB1A 3RE0A 3IMVA 4GRMA 2HMID 1E3FA 5DS1A 3B9AA 5FYJU 4EZJA 1X4ZA 4PLKC 3ZQWA 3PFUA 1X5IA 5EG6C 4XPGH 5EORL 4YDKH 3TBTA 1RZFL 4OQTL 4N8VG 2ZXAA 4NN7C 3Q3GA 4MNGB 5BCAA 4I9XA 2R8SH 4M7KL 5IQ9B 4JKNA 5AKVA 2WN3A 2HFFA 5DK0B 5F8RC 3N0AA 1A6UL 2EEFA 3NPSB 1CTNA 2Y0SA 3O4LB 3AG3B 4GP8B 5ESVA 3CPLA 4PVBA 2LR4A 1J10A 5C0EA 2EDRA 3FOMA 5JOFB 2AGJL 4AQ1A 4XAKE 2F5AH 5K69A 5D7JB 3NCCB 4GAYA 4TOYL 2CM5A 1DANU 4GQ9H 1QUNB 5F96H 4NQEB 1J18A 3TESA 4OCSH 3FB5B 3FO9A 4PLKD 5TD4A 1INEH 3F7PC 1WUZA 3OAWA 2R2CA 2GVYA 4DNLA 1E5CA 1Z5HA 2WQ8A 2VW4A 1N64L 2CK2A 4R2GD 2IH3B 2Z8WC 3GTVA 4GUCA 5FUCC 4GMTH 2VDKH 3D87B 3NN8A 2OA9A 2BIMA 1JGDA 4FFYA 3VD7A 1DJYA 3VQLA 1L9PA 1WCBA 1EMTH 2WWKO 3FO1B 3LKNB 4K07A 2ENYA 4MCZB 3SB3A 3MJ6A 2G3NA 2F18A 1MCHA 8FABA 5C6WH 1ESOA 5LN4A 5DK0A 3VRJA 4IRZL 2F1BA 3QDJD 5ERWA 4ODTH 3IAGC 3MRPB 4NEHB 5I6LA 1DSWA 4KNTA 4ZOCA 4ZNCD 2Y1AA 4RGMC 1G7LB 2XN9B 1EJFA 4TQIA 2DQDH 1FYTE 5EUOB 1IGFL 1A1MA 2VQ1B 4A55A 2WYHA 1AQDB 4HEMA 3D50A 3V6ZA 2XOTA 5DUBA 5DJYA 3WS3B 4P2OC 1OGTA 5DRXA 1FGVH 3QXAA 2V7HB 3ZKXC 1KCWA 4UT9H 4KAQH 1VGKB 3V0EA 3B2DC 5FDYA 1MHHA 3KCPA 1KDJA 2VJXA 4GH7B 1M7XA 3HMWH 2NT1A 5E9DB 2WKLA 3D12B 1K4CA 4XPAL 5FGSA 5HDBE 4IYKA 5T1DL 4OSUL 1IC1A 2QPEB 3QUZA 4JGUA 4XPHH 4XWGH 4WO0A 2BSBA 1VCBC 3G7TA 1CLVA 3AXIA 4F33A 5I17A 4P2OD 4LKXA 1UHVA 4GUPB 4LL4A 4J4PC 2JLPA 5EOCJ 4ZW5A 5KVDE 4RAUB 2UXGA 3IYLW 3CBKB 2BOBA 1J1OL 4LBAA 3HS0B 4B0MB 5K9QG 5FA3A 2HX9A 3I02A 4LVOB 4Y1TA 4C83A 5FM8A 2P8LA 1EAOA 4AM0A 3OKOB 3L7EA 2EDXA 2YXFA 4M5ZH 1K5NB 5F44A 1MAML 4YQXH 1LEIB 1S7RB 1M9WA 1SUHA 3UDWC 4EDWL 2FK9A 2R29H 3NAAL 2ITEA 2YXMA 3F5WA 5INDB 2X5PA 1HOCA 4LT7A 4M93C 3W39B 3NJIA 4J4PD 5FYLE 1ZHKB 1WJ3A 4PJHF 4R7VA 4BEIA 4EIZC 5KANG 4EIBA 1W6LA 3QUHA 2WLIB 5GGRY 3ASNB 1WV7T 4FTVE 3GSQA 1P1ZA 2W9LA 3LN5B 1IGCL 5CWSB 2ED7A 4ADIA 1ZANL 2I25N 4K8RC 5FYKH 2V2WA 5B39A 1JGUH 4GUOA 4HLZG 2FJGB 3B7SA 5F3HA 5GGVL 2A38A 4OBSA 1JPGB 3EGXB 4O2CA 4M56A 5D1QC 5JW5B 4U05A 4RMRA 4N2EA 4NNYB 2Y3NA 4R4BB 3QCVL 4BK8A 1J5HA 4UQ3A 5HGAB 1YEGH 5E6RB 5C0CB 4HDIA 3VTMA 2BRRH 4XHJD 5AUMB 3VFWB 1F8TH 3L5JA 1WAAE 5I2IB 4JJHA 3ZHKA 3WTSA 3ARSA 3RGBA 4HPYL 1HL4A 5KSBE 1F6AA 4ZO6A 4KK5D 4N0UB 4Y5VC 2DYRB 5I15L 3L3GB 1WA0X 4W9KC 1M6OA 1GZQB 4BRJA 4FP8L 4N22A 1G9HA 5EPMA 1VHPA 2R8SL 2DQTL 1PAMA 1R19A 4QHLB 1RULL 1VZIA 4QYOB 2NX5E 3C09C 3SIKA 4S1RH 4WU5B 2R0ZH 1WAPA 1SMOA 4I7ZC 1UENA 4XX1E 2NY1B 4Y16A 3C5ZB 3MLRL 1CDJA 4GRLB 1N0LA 4YR6A 2XV2A 1W8EA 1J0KA 4LP4A 5DD6A 1FDLL 4P4KD 3ZZQA 4JDVA 2OMWA 5DI8B 2Y5QA 5L6YL 5FDWB 2Z31D 1AFVL 4G80B 2ERJB 4QOKD 3PWUA 1ZE3H 3TA3A 4APQA 1AR1B 2H9GB 3VYPA 1NGYA 4PRBA 4JM2F 5JA9A 3UJIL 1TCRA 3D0VB 5IW1B 4FEIA 3A6OA 1QO3B 4W4NA 4FADA 1X5FA 1T1XA 2BZ7A 4H1LB 3BH8B 2JJSA 4NXSA 1UACH 3GBML 4AITA 2RIKA 3O4OC 1D5MB 3QUYC 2CHWA 4RZKA 3MRIA 1OZUA 1GRWA 4JCLA 3RWIB 1U36A 3G5YA 3OKYA 1AHWC 3REWB 5CD5D 4LSPL 4R6UA 4XH2A 2OYLA 5BVJB 2Z31C 3OL2A 4JPQA 2Y4SA 4LL9A 3KH3A 2HG5A 2UZIL 4UU9B 1OPGL 4MJIA 3PCYA 3QXWA 2F2HA 2JCCE 5AW3B 1SXBA 1A14H 3IXTB 4FMKA 1H3XA 1VRSA 1H0DB 3MO1B 4XCEA 1QFUL 3R8QA 2VR4A 3W5NA 2D7MA 4FQHA 4XXCA 5AYQA 4K7FA 2Q7AA 1S8DA 1NCWL 4RMSA 5EF2A 5DEFA 1NANH 4LLWB 1JGLL 1MHCA 1OE3A 2BSSB 3P0VL 1OAXH 1X5JA 2BM3A 4QTFA 1FFNB 4BE6A 4ETQB 1JYXA 4YPGB 1OARL 4X6BA 1OGAD 2HVKA 1OTUC 2KHAA 4KRPB 5E6SB 3RIKA 3TBCA 4NQXA 4Z7NB 1RFDL 3MXWH 2X44D 2GHZA 1TUPA 5J9PA 3KPTA 2VLKE 2FWOA 4YDVA 2YGPA 2VDNL 4JO3L 3GBNL 5DYOB 4TS6A 5FW8A 5FA4A 4JUTA 4PR5A 3RUGB 1NUDA 1DHKA 2YAFA 1WZLA 4HLZH 1G6VK 4HS6B 6FABL 1FVCA 4JKWA 4PJ5E 2PCYA 2XWJB 2H0JA 1A7RL 4AY0A 3GMPA 4U6VL 4KK9C 4LDCA 3U9PH 5I6KA 3ZR6A 2FNBA 2WXOA 3CG8A 3FT9A 4HK0A 1PQZB 3CFKA 4JQVA 1BEXA 3VFRB 1MJJB 3HVDA 4ZUUB 1SUJA 3ZSSA 3QDHA 1E4XI 2DLFH 2QJDA 1UB6B 3E2HB 5FAAA 5IB3A 1T89C 1XIWA 3HG0A 4HFWB 1G6RL 1SBBA 4OCRH 4AT6A 1M7DA 4G9FD 4ZYKA 4HQQH 4NP4H 3BZ5A 4XVOA 1L0XA 1GGTA 2MNJB 1OW0C 2FWLB 3GSVA 3BEWA 5IGXH 3C2AH 4YLQT 4KK9D 4F9PC 5T3XE 4KK6C 3DPBA 4ZS6D 1E27A 1V7MH 3ZKMC 4X7TB 4OLXH 4ABWA 5BMFH 4JN1L 2H26A 5H94B 2CHNA 4QDGA 1PD6A 3AQXA 5JDJA 4L8DB 1F86A 4PJDB 2WC7A 3BXNB 1Q1JH 3QUMH 1T2XA 5GGQH 3WE1A 4DVBA 1M7DB 2AJ3A 3AQZA 3T8XA 1KTRL 2GTWB 2E7DA 5CEZH 4XC1L 3MA7B 3MRKB 1BZ7B 3A6BL 3NRFA 2FECL 1XF3A 4WKXA 5C0DB 3T3PF 1U8OB 1PIFA 1VFAB 2F6AA 5T5FH 4L1DA 4TUOA 4ZS6C 2A99A 3BUPA 4U6HB 3ZKMD 4ALAL 4ELMB 4MQTB 4EDXA 3AG2B 1R5WB 3D9AH 1BW8A 2G2NA 1W91A 4JRYB 3DJSA 4X7FC 3LH2H 1Z9MA 3HG1B 2XBDA 3LKPB 4ZFOL 4RESB 1QQDA 1E28A 1HL9A 4G6KH 4KO7A 3ZL4L 1EHKB 2OSLA 4L1HA 1VFBB 2UZPA 3UIZA 1J0YA 1FYTA 1PG7H 3N06B 4CADA 5F7EL 4NQXB 4H44C 3RPKA 1I1AD 4J3OG 5E5LA 1PD1A 1ZT4B 2MH4A 3FQUB 5KSAD 1AAJA 2JIXD 1MHCB 3RVTD 5LVEA 4Y7MA 5CP7A 4JFFD 4LO9A 2XN2A 2H47C 4XMKH 3IDXH 1YPZA 5AD0B 3EYQC 2H3XC 1A1OA 3E3QE 1SF5A 1PSKH 5A3IC 2P8PA 2K3HA 5IVZA 3EYSH 5T5FL 1ZHBA 4KK8C 2IPTH 4QXWA 2J8UA 4DEUA 2LLNA 5KYXB 3JWOH 4NQVA 5E9NA 2CHXA 4PJ6A 1FNLA 2WJ7A 2R1XB 3RA7L 2YRLA 2DH2A 4X6CB 3U30C 5LG6A 2P7TB 3DXAA 4H8HA 5FO8B 2B0SH 5FB8B 3RWIA 2X4QB 4F8NA 2CKBB 4D9RE 1D5MA 5G4MA 2JE8A 3RILA 2O4EA 1OAZH 1SOKA 3D2UD 4FG6C 3ATBA 3WKNA 1Q72H 3ILDA 1NICA 3R1GH 3NPZB 5EZLB 3CVHH 3QNFA 1O6VA 2W07B 1P5UC 3IGFA 2AK4B 1UD3A 2KPNA 1WT5C 2VL4A 4R0LC 5EF1A 4LIQE 1KCBA 4HIHA 2EDTA 2JIXA 2YQGA 4XP9H 2WVUA 5DD1H 3RL1B 1G1CA 1XR9B 5TFSL 3V5HB 3M45A 4AW7A 1TZHB 4LSQL 2VB5A 3G6JA 3QQNA 5DXWA 2GFBA 5G5DA 4OD1H 1N0LB 2OZNA 5DVPA 3V0JA 4D9LL 3BQUA 4V2BA 1G7JB 3Q6FB 3NJXA 4IU2B 3MLWL 3S36X 1TQUA 2MQ3A 1DQML 5K59E 3VH8G 4U4BA 3GI8L 3MUY1 1XL6A 1T6BX 2J7LA 1FWXA 5JHBA 5JW4Q 4KHXH 4FG0A 4F2MA 3L1EA 2HJLB 5K39A 4HKBB 3A6CL 1F6AB 2ZPKL 3UG4A 5GSRB 3TYGH 2F9BT 3PABA 3PWPB 1ZY9A 2WTPA 4IEFB 4MXQD 1VIWA 2UWEF 1LO4L 3DXAD 4W9CC 5ICYB 1I9RH 5JW5A 5CMAA 3TVMC 1MZZA 3ZRCC 1X6NA 1J5CA 2VXSL 5IY5B 2CGYA 2WLNA 1OP5K 1RZIB 2YXWA 3ARVA 2ZOKB 1MFAL 2K9UA 4ZNEA 3UBXA 3WN5C 3T2NH 2VDQL 4J3UA 4ZSOE 4TF4A 5GRVK 2W38A 3LPWA 3VW3L 1R3KA 3QZMA 2ZUTA 3RVWD 2YPKB 2XRAL 2WLIA 3PDOB 2V0AA 2DEWX 3S3CB 3OR7A 2LGNA 3MRGB 2RAMA 1G6RH 4QXGH 2WP3T 1ZHKA 4LLDB 5BUGA 2YPKA 4L4VB 4PLJD 1JGVH 1H3PL 3I50H 1TJMA 4G9FA 3V95A 3C5XA 1XF5A 4DGYL 5TE4L 3JV6A 3MOAH 5JQ6H 3BISA 4M7KH 4HOWA 1JXDA 4JHZA 4UT6L 5FEBA 2RBLA 5M95B 1TIUA 5L2JA 2B1OA 3QR1A 5D70H 3AG4B 4JFEA 3BWZA 1G5GA 2AJYH 3K3QA 4TVSa 5KBMA 2C3VA 2D7TH 1CD8A 1FNGA 1MJUL 1OE1A 2JJTC 4NN6C 4OFIA 4A6YH 4BH7B 3INOA 4AE0A 3C08H 5E6ZA 3QCUL 1DN0B 2W0KA 5GSRA 3SDAB 5F3FA 4APXB 2V7NB 1RZJC 2O30A 3QEHB 4W9LC 4F2EA 2W65A 3HI1B 1F4YH 3CSFA 4XAKD 4XMPL 4HCRH 4XNDA 5DD5H 1JF6A 5I1HH 1ED3A 5EFIA 1MWAL 5I8EB 1DUYB 1VACA 1AO7D 2VUKA 1IFRA 3BT2L 2YKKA 3U79A 1CLZL 1J88A 1MNUH 1YEHL 4JDTH 4EAEA 1S7QA 4L05A 2IDFA 4LZKA 4Y2DD 2B4CC 4LSTL 3WAKA 1PY0A 5I1GL 5JXAH 1L4IA 1D2PA 4YIQA 3Q2VA 5CBAB 1YECH 3QXAB 3JTBA 4V2CB 4J8QA 5K33A 4ONHA 5DC2A 5DUBB 3IDMB 3MOQA 5AOJA 3V5HA 2QQQA 5AW8B 2CG9X 4EVNB 1O5PA 4YOKA 3RWDB 4MMZC 3ASWA 1NFIA 1I1YB 1PG7L 4HAFA 2VYRE 3FU6A 1XSIA 4MMZB 3WJMA 4O58H 3ZT6A 3NK4A 3BRDA 3IGKA 1AHMA 1QZ1A 2DI7A 3U4AA 1MCOL 4L8SA 5AVYB 2HZHA 2WUCL 1P9MA 2FEEL 3EXLA 1V8HA 2AXGA 2GC4C 3HC4L 3HW7A 3ZHNA 4QT5B 4AQ8C 1JWMA 3C8DA 3HE7A 4NC1E 5ICXB 5BPPA 3QUXB 3OJDB 2KBGA 2NY2C 1J8SA 5FB8A 4NFBA 4ODBD 4WV1C 3FO1A 4H8PA 5D9SB 3DA0A 2YAQA 4GT0A 4RMWA 3CU1A 1A66A 3GMNB 4U1GC 3GZPA 3HEIB 4AJVA 2ZSVB 5IMKB 2YZ8A 3CN0A 4PJGF 3RFZA 2FRGP 3K80A 4LSTH 2N0MA 3N41B 4P48A 4H26A 1I75A 2NSMA 2LTQC 3CWGA 4GP5B 4Z7WE 1ASPA 3C8HA 5CP7B 5T3XH 4PREB 4F8OA 1MG3C 1KTCA 1QNIA 1CDCA 1XCTA 2EH7L 2PR4H 5GJTH 5BRZE 3ZXAC 4PJGB 1QA9A 4CGUB 1QLEH 3O9WD 3MV7D 4OCWH 5J6GB 3VXUE 2APFA 3WNNA 1XD0A 2BW5A 3TBTB 4QRSB 2YAHA 1INDH 4XCYA 4QXUL 3UYOD 4MJID 4LLDA 5CGBA 2H8PA 3KGUA 1C9SA 5GS0C 4JRYA 5SX5H 5D6DA 4B9YA 3VWJA 3IU4L 2F54E 4N28A 4G3YH 3ESOA 1E3XA 4LCYA 4A1RA 4L3EB 3ARFB 4MAZA 2FEDC 2J43A 4U6YB 4F37F 3QE5A 1AACA 5IHHA 1OAYL 2PPFA 2ZOKA 5F0JB 1QFOA 1QZNA 3SDYH 1RUQL 2Z7UA 3PUUA 1WFOA 4JO1H 3PWVA 3ZDZF 2CCLA 4J3OF 1R9FA 3UYPA 4KKCC 5FKPB 1RJYB 3MDJA 2AVGA 1S9WA 4LSUH 1FFQA 3VI3F 4L8DA 4WAFA 4WF7A 2EUZA 2BY0A 5IEHB 3NJHA 1HL8A 3TJEH 3RNQA 2PP9A 1YYML 4P4KA 4KKNA 3GMOA 1PF3A 3EFFA 5HPOA 2Z6FA 2GY7B 3Q0HA 1KGYE 1Z6JT 5DO2C 1E4XH 3W37A 1DLHA 4OB5H 2SODB 4LVOC 2QTEA 4PJAB 3V7AE 1PKQE 2DH3A 4FJ6A 2G2RA 1EZSA 1DZBA 1E5BA 1EQWA 2ZAHA 1R5VA 2VXQH 4NO5B 2X12A 2PWFA 4X7SL 3UAFA 2N59A 4L48A 4BDVA 1X3DA 5J12B 4X50A 1A6VL 1XGPA 4IBQA 1JXGA 3MROB 1MJJA 2YQBA 5DVMA 5DEGA 1CL7I 3D51A 1D9KD 3ULUH 4K7PH 4JY5L 3KPLA 3OXRB 2P48B 3UP6A 4MSWA 3VG9B 3D3VD 3A21A 3FTXA 4OR1A 1JNLH 2Z7YA 4JMNA 3MV11 4NERA 2GJ6E 3S5LA 4R7DB 4S11A 3RUGA 4E42A 2BVYA 3CSYB 4HT1H 3BZ4A 2GIMA 5F7MC 1HI6B 3IU3A 2W5PA 5J1TC 1KTDA 1LK2A 1HHJB 1UXWB 5DYFA 4FRWA 1FUNA 4WDIB 3NCYP 5DF0A 5ENWB 4Y8AA 3M7FB 2ODIA 2JVUA 3MJ7B 2FHCA 3ELQA 3PWJB 4NWUL 1Q9WB 3DX8A 3JWDH 4YSAA 1AKJD 3L08A 4PRIB 4PJFB 2CJUL 2EE0A 3U7YH 2GIXA 4LIQL 4E5XB 4FULA 3IGLA 1KXVC 2P8PB 3X3FL 2W9EL 4YHNB 4ODWA 1LD9B 2GJPA 3U9UA 4G42B 1IAMA 1BIIA 3QJFA 5FGCB 1XX9C 1E9OA 5F9OL 3V4VB 1ZT7A 4FTVB 1Q0EA 4WU7A 5C2BL 1ZT4A 3FQUA 3FUFA 2WXKA 3CLEH 4L3ED 1UKSA 3D52A 3G5YB 5C0JB 1AZZC 3KS0J 3LQZB 1AQ8A 3C5ZC 3FSWA 4Z3GA 4I3SH 4HZLB 3HAEG 4I18C 2KH2B 5KYWB 5E2VL 4WNQA 2OSLB 3FB6B 3BVWA 3WIAA 1BM3L 4IHOB 5KJ7E 3R1GL 3LKPA 5IHUH 3FQWB 2E86A 3IXAB 2X28A 3EJSA 3POCA 1TCRB 1J86A 4GUQA 1EFXA 3UPCA 5C0ND 1J1XL 2X6CA 1HYSD 1MG2C 2I60H 3U36B 2P28B 3JQOB 2A77L 2N3JA 3KXFB 5D7EA 2XV3A 3TPUA 5CS7A 3KLHD 2X6BA 4X5QA 4HZLA 1RZKL 4KPHH 4PFEA 4F15B 2CH8A 5C0DA 1VERA 5CLYA 2H0EA 3BVTA 3LPFA 3ARQA 2QPUA 3ZTNL 4YXKL 5MP6H 5KVFH 3ECQA 4X4YB 1O0VA 4LOVA 3O8XD 4QHLA 4NNXA 4DVBB 2A74C 4LHQB 4JM4H 3U9UB 3MCLL 4MA1C 1M6OB 4UB0H 2I32A 2BNQE 4L9LB 4ODWB 4A2EA 4MA1B 1VZGA 1O9WA 2ATKB 3RY4A 1F02I 1E27B 5KVFE 1YEKL 2LAAA 2R51A 3K2IA 3ATEA 1JMZA 3A47A 3Q48A 5I2IA 3CXDH 5E0FA 4F5CA 2RD0A 1IX2A 2JXMB 1H8SA 5EO9A 1JWSA 4ELKB 1NCGA 5J5EA 2R69A 3NG5A 1LP9E 4BA8A 5HDBF 5BV7B 4N8CL 2OJZL 3KBEA 2XWBA 2YPLB 2W81C 1FQ9C 1JZFA 3PU7A 5CHNB 4ELDA 3SKUD 2OCCB 1LO5B 1NBYB 2NSQA 1AMXA 2BCMA 4JM4L 1DJIA 4OCXH 4D8PB 1AXIB 3S0PA 1SQ2N 4MXVF 3GSRB 3WTTA 5ES4B 1XGTA 2NMSA 3N2JA 3MV8E 4YFEA 1XGTB 3MLYL 2EDDA 1L0QA 2RFXB 5B1JC 4QKXB 2XXCB 5HI5C 4EKJA 4LLUA 2X9ZA 4N2AA 1B3IA 2BP8A 5IR1A 1OGAB 2O5NA 5E5RB 4PR5B 1F90L 2HRPL 5INDA 1U92A 1FL3B 5E4IA 1EHLL 1LO5A 1NBYA 3GRWL 1XGPB 5DYOA 1P4BL 2DMBA 5CHNA 3US0A 4KKLD 4JZJC 2ZXDA 4AXWA 2PPEA 3FPYA 4UTBL 5TTRA 3GWJA 3ABZA 5CJXA 1A3RH 3TIEA 4X7CC 2B2XH 1NOAA 3OKOA 3T2LA 1G7HB 4B60A 2X1XR 2P8LB 1NGWA 4GJTB 2CLRA 3PIQB 5KS9F 3AABA 4HIPA 4ZODA 2YC1B 2NX5A 5DEFB 3QORB 1RZJH 2DQJH 4FC3E 1TETH 4MCNA 4RAUA 3U0TA 4FA7B 5C92A 4BHUI 3HG4A 4YN3A 3P4LA 1KJVA 4X98A 3OB8A 3S4SG 2Y07L 4KI1A 4Y4KB 1C1EL 4DEPB 1HQRA 4FJZA 2XICA 3ZUCA 4O9HL 4PJDF 2R4SH 1DQVA 5GZND 1GYWA 2BNRB 5DHEA 1RJLA 2BY2A 3EFOA 3O0RH 5GGTA 3HR5A 4IMKA 5LKNA 1A7BA 1JE6A 1BVKB 1F3JB 1T0PB 2AV1B 3GHPA 3QEGL 4IKLA 3WJLA 3ZE2E 5F7LB 2ZWYA 4YSTA 1CB4A 4L29B 4A6YA 3V7AG 3E6FA 4AMWA 3U36A 1OAZL 4KXZH 1DJGA 1MCLA 4BKTC 1MEXL 5FYJE 4X5RA 2IG2H 4XC1H 1MZYA 3Q06A 3APFA 4JZOA 4OKVA 1GL4B 5F7FA 2H9GA 3P0GB 3MKKA 2DMKA 5KJRH 1R3IL 1PKQB 3EJUA 4YUEH 1UURA 1IM3A 3MUZ1 3S35X 3FC8A 4Q14A 2X4SB 1R0AL 1D5XA 1HSAA 2LFEA 3KVPA 4XE0A 1U41A 3F00A 1AGFB 4G1MA 3CVIL 3G5VB 2X3BA 2XTLA 4WU5A 1E9QB 2EDWA 1RLWA 4M3JA 4DIXA 5C6PB 1D6VL 2RH0A 1U6AH 1R3LA 5GHWH 1PZDA 4C47A 3CXHJ 3FN3A 4XAWL 2WYZA 3BSGA 5CCGE 3V0VA 3GZOA 3A3YB 3L6FA 4JHAL 5F7EH 5C9KA 3RFZB 4MNHA 3FUIA 4K3EH 4NT6B 1RJZB 5I15H 1WWCA 3BN9C 2J8HA 3PWJA 4LCUB 4KI5C 2YEZB 4P2AA 2BMKA 4UQ3B 5IQOA 5D9SA 3N1GC 5EEVA 3IKCA 3KWTA 1D5ZA 2O1AA 3CPLB 1RUAL 4X2UA 4NPYB 2AVFA 3NA9H 3A4EA 4CU8A 4QT5A 3QJZA 4PJ8B 3Q8EA 2EUWA 3JVGC 4PJ8C 3QUMB 4LVNB 2L04A 3CFNA 3MYZA 2J4WH 4NI3A 4QRRE 1B0IA 5HDBB 1YQVH 1JZ2A 4LVNC 2NYKA 3P11L 4GAJL 2AZUA 2LV4A 1P4UA 1P5UB 4KI5D 3N43B 1BOGA 4MJ5B 1SYVB 1A7OL 3V0GA 3OGCB 1S78C 1T1ZB 4JL2A 4QRBA 4ONHB 4XN5A 3G5ZB 3N1FC 3VM7A 3VQMA 2YO3A 2G9KA 4OCYH 1FFTB 4I3RH 3F6JA 1CFSA 2JWYA 2Z0BA 3ILQC 1S7RA 3AUWB 3DKHA 4POZC 4U2ZA 5EUOE 3KS0H 3G6DH 4FL4C 2JH2A 4YPJA 1AOZA 3H8NA 1XGYH 2EYRB 2Y06H 4FNUA 4PJ8D 4A2HA 5B4MC 1TQTA 4LU5L 5E1QA 1NEUA 4C83B 1JDCA 4DZ8B 1J5OH 1ZLVH 4X6DF 4EI0A 3O3AA 2GSGA 3K4DA 1LEGB 3SE4C 3DVNB 4B9CA 3DSFH 5C0AE 4EMZA 2R0WH 2JQAA 2WGXA 2XYBA 5AAWC 2PWGA 1TO5A 3WFHB 5CUSH 1I1FA 3O3AB 4BH7A 1A65A 1RIVH 1QW8A 5IVNA 3DDFA 4OQTA 4UUJB 5SV4A 4LCVA 5AZ2L 5B4MD 3MZTA 1FSKB 3BKJH 4I77L 3DX4A 3MLPA 3CDZB 4AYDC 4Y5YC 2RCSL 3LKOB 3V4PL 2XWZA 1DVFA 4L23A 4LU5H 2XXFA 4LPWA 5AOMA 4NO3A 5I1JH 1XBDA 4P05A 1EX0A 1JTPA 3TC9A 1BGXH 1U91B 2V7HA 3MZGB 1MCEA 4TLSA 2OYKA 4WEUD 2H5UA 2C8NA 1X5HA 5IKCB 4ZMXA 5TPWH 3S3PA 1N64H 1P53A 4DGUA 2VMJA 2O5XH 2PNDA 3QNXB 1IB5A 3OKMA 2O6CA 3Q1EA 4HK3J 3HC4H 3O0LA 2JCCA 3FCTB 4CJ0A 3WU1A 1SMDA 3HPLA 3UBXG 4N2DA 1G0YR 2C1PA 2VAJA 2RB8A 4QNPF 4KFZC 4FFYL 4XE5B 3O6FC 2R15A 1DSFL 1RK7A 3CZJA 5ADOL 7PAZA 2GIYA 4PJGA 2FBOJ 4PJHB 5JORB 2EEDA 3N9GL 1TSRA 3E8VA 2YSTA 3GB7B 4YSCA 4UQAA 4I13B 4PJCE 3DHMA 3QWNA 3CLWA 3QT2A 1JGDB 2WBJA 2YAOA 2YEZA 2QHRL 1UQSB 2G5UA 2K6ZA 3LS5H 5H2BB 1RKRA 1NLBH 4IBYA 3P4MA 2CRYA 4M6OL 1E67A 5LB1A 1R24A 4CN6A 1E3ZA 2W1NA 3CX2A 2J8OA 4FXGB 4QXTB 3GKZA 3V4PH 2AK1H 4QKTA 4AVIA 4KZCA 4QEGA 1N7ML 3WKQA 4B9ZA 2X6AA 5IROC 3MNZB 1XH0A 4TQEL 2DQHL 2C9SA 3ULUF 1HX0A 4IU2A 4L4VE 4LSVH 3P9LA 3NCJH 2DJMA 1P6FA 3K4ZA 2FZ3A 2DW5A 5FYLH 1GGIL 1KCRL 3QUXA 1P2CA 4U3SA 4L8BB 2ICWI 2VZSA 4Q52A 3PHQB 1PLGL 4Y5XA 4OTXH 4F20A 3OQ3B 3L9RA 4EKXA 3AM8C 3CTTA 5IJVB 3RAJL 4RWYL 4M43H 4JAMB 2PPDA 2GSIA 3SHSA 4DKFL 2FDBP 1GAFH 3UG3A 2XZCL 5E4EB 4PVNA 5AVQB 1JDDA 5IOPB 2B59B 1NEPA 4HS3A 1W72L 3GO1L 1CFQB 3K71A 5FHAH 1RL1A 1AGBB 1J1OH 2JB6B 5CJ8A 2AEPL 3MN8A 5HVWA 4BM7A 2IOIA 1WEJL 3IFPB 3OF6A 2X0UA 1YJDC 1SJHB 2F54B 1W8NA 3VI3B 3OZLA 2P7TA 3DXAB 1R46A 3POHA 4Y4FC 1AHWB 1MFBL 2BP3A 1VACB 4XMVA 3UGEA 2F1EA 1RJLB 3EFOB 3P73B 3CSGA 5I8E