4KO7A

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/w48f/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
molecule tags Electron transport
source organism Pseudomonas aeruginosa
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48F/V95I)
rcsb
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ko7A00
2IDUA 3KW8A 1NIBA 1WAEA 1UATA 3JTBA 1SDDB 2PPEA 3T71A 1PZBA 1OE1A 3WG7B 1XMEB 5D4IA 2DWTA 3G5WA 2HX7A 2VSMB 2DWSA 5I28A 3ABGA 2XYBA 3FYEB 1WS7A 2FTAA 2AFNA 1ILUA 4Q8BA 1NDTA 3NSFA 3X2QB 3WKPA 1JERA 1PF3A 7PAZA 3NJNA 2PPCA 1PY0A 2BP0B 1AG6A 3QQXA 5I6NA 2FNWA 3CDZA 3WNJA 5B7MA 2XU9A 1JZGA 2GI0A 1CYXA 1V55B 5ANHA 4EF3A 2FQDA 3NP4A 3NP3A 2GSMB 2PPFA 2JXMA 1A4CA 3ABLB 3CVCA 3AY2A 1AZRA 1BQ5A 3AG3B 3FU7B 3IE9A 1WS8A 7PCYA 3S3CB 4DP5X 4DP0X 5B7FA 4TXVB 2Q9OA 2FWLB 2CJ3A 3PCYA 3OMNB 4DP7X 3SBRA 3T6WA 1AOZA 4G72B 4KNUA 4DP6X 2PPAA 2OV0A 1X9RA 1BYPA 5TK4A 2QPEB 2XX0A 3PAUA 1BXAA 3UAEA 2QPDB 4YSUA 1JVOA 3PXLA 3FQ1A 2YAFA 3GYRA 1J5DA 1RZPA 4M3HA 2XV2A 1PNDA 4GXFA 5B7EA 1ASOA 4KO6A 3S3BB 1N70A 4AX3A 1JXDA 1AZNA 2H47C 2EIKB 2PCFA 2UXFA 1CC3A 1L9TA 1KDJA 1PLBA 2B3IA 4NB7A 1AS8A 1PZCA 3D12B 4YVNA 3SQRA 1E30A 3AZUA 3WKQA 4MFHA 4BDVB 2CALA 2CBPA 1ASPA 2NRDA 1J9TA 1FWXA 4G7RB 1YLBB 1PNCA 2FT8A 2IDSA 3X1EA 3SBPA 3X1GA 4PAZA 4GY4A 1KCWA 3H56A 2IH9A 1AAJA 1GS6X 1ADWA 1BXVA 1JOIA 1GY2A 2VMJA 1PLAA 4WTQA 2W88A 3ZBMA 1BQKA 3EH5B 1JZFA 1L9RA 3QJSB 1AG0A 4UF7C 4AKOA 5LDUA 1JXGA 1JXFA 5E9NA 3MBWB 3QJRB 4AKPA 4BK5C 3AG4B 3IN2A 3NJIA 2R7EA 4DP8X 4DP9X 1L9QA 4M4RB 2VW6A 3C75A 1KBWA 2YAPA 3ERXA 3EF4A 3TBCA 2VW4A 4QKTA 2YXVA 2Q5BA 4DPAX 4G71B 3FSVA 3QJVB 4X4KA 1MG3C 1DZ0A 2LLNA 2E86A 1SFHA 1OCRB 1NINA 1IBZA 4FAAB 4YL4A 3JT2A 2UXTA 5F7AA 5I6OA 5I5MA 3FQYA 5AZUA 1SHWA 1ZDSA 4HAKA 4P5SA 4E9SA 1FFTB 3ZIYA 2I7SA 4ZK8A 2BW5A 1SJMA 2I85A 4RH4A 1E65A 4QLWA 3U25A 2BP8A 4N8UA 2QDWA 1N68A 2AANA 5I6KA 1IUZA 1AZBA 3AW5A 5AKRA 1PLCA 3NJGA 4AI7A 3CVBA 2VM3A 2AZAA 3DIVA 1MDAA 3IN0A 3NJFA 1OCOB 2YXWA 2IH8A 1L9PA 2PLTA 2XVBA 4YSQA 4JHVA 1JZJA 4KO7A 4L0PB 4NAJA 2I7OA 3FSWA 1NIDA 3ASNB 2VW7A 5B1JA 2GBAA 2AVFA 1AZUA 1NTDA 2XX1A 2AZUA 4GP5B 3PAZA 2EIMB 2GC7C 3OQRA 1BEXA 2VM4A 1TEGA 3ZDWA 3HEIB 3KW7A 2XV3A 1OCCB 2BZCA 1NWOA 4HHGA 4N4YB 4HCGA 2J5WA 4K9JA 3TA4D 1ZIBA 5EHFA 1BYOA 2ZWNA 2DYSB 5D4HA 1GS7A 2YAOA 4F2FA 2CCWA 4HHWA 1RKRA 4A67A 1M9WA 1XB3A 3S8FB 1SDDA 2HX8A 2DY2A 3S8GB 1J5CA 4YSTA 1I53A 1RZQA 3NSDA 1EZLA 2HRGA 3UADA 2QT6A 4KO9A 1MG2C 2HXAA 1CURA 4BXVA 2BWDA 2PCYA 2J57A 1SF3A 3QPKA 1ZPUA 2IWKA 3GXUB 1DYZA 2DYRB 2VSKB 3UACA 5PCYA 2EINB 4BXSV 1AIZA 3BQVA 2GC4C 2YAMA 1A4BA 5I5JA 4BWTA 2EILB 1EHKB 3CDZB 4CSZA 4KNTA 3QJTB 2OCCB 2TSAA 5I6PA 4F7KA 1L9SA 1VLXA 2ZOOA 1GS8A 1SNRA 2UXGA 4E9YA 3SBQA 2MTAA 5F7BA 3WNIA 4E9QA 2YAHA 3UABA 5B3SB 4G7QB 1HAWA 1NPNA 1X9UA 4UANA 4G70B 1QHQA 5I6MA 2DV6A 2Y1AA 2ZONA 2JKWA 4UAHA 4YSCA 3ASOB 3FQ2A 2CUAA 1PAZA 3TASA 2QDVA 1AANA 4GP4B 1ASQA 1AZCA 3TBBA 1BQRA 2YARA 1JVLA 3NJKA 3T6VA 1A65A 2FT6A 2EIJB 1GSKA 3PPSA 3X1NA 2X88A 4WKXA 2BZ7A 2BW4A 2BWIA 4HZ1A 2HLEB 4A2DA 3FU9A 2TSBA 2J56A 2PP7A 4YSDA 4HALA 1CYWA 2HX9A 3OMAB 1J9SA 1A8ZA 2UX6A 3NSYA 1SHXA 3MX0B 1NIEA 3QJUB 4G7SB 1IKOP 1NIFA 3WIAA 1OOWA 1ID2A 1WA2X 2WO2B 5TK2A 1PMYA 4YSOA 6PAZA 4A2FA 2H5UA 4E9XA 3UGEA 5FC9A 4HCFA 1PCSA 3L45A 4W9ZA 8PAZA 1GR7A 1TU2A 2YAQA 4A2HA 3NJLA 3EH3B 3EHBB 2FJSA 2PP9A 2FT7A 4E9VA 1F56A 2OJ1A 3N55A 2GB2A 1KV7A 1XB6A 5I26A 1ILSA 1URIA 2XXGA 1V10A 3ABKB 2XUWA 3NYKA 4A66A 1WA0X 1SF5A 1TKWA 1IC0A 2W8CA 1M57B 1B3IA 5A7EA 2IWFA 3NSCA 1NPJA 2HZHA 3H4HA 2XV0A 4AKQA 2VN3A 3N2JA 3OM3B 4YSEA 1OE3A 1RCYA 4YSRA 3V9CA 1TEFA 4DP4X 1HFUA 4A2GA 1NWPA 1PZAA 2RACA 4HIPA 4F2EA 1KBVA 1E5ZA 2XWZA 1JZIA 2WSDA 3CG8A 2IDFA 3NJJA 1NICA 3ABMB 3S3DB 1KGYE 5I5IA 4YVUA 1E5YA 1HAUA 1NZRA 1A3ZA 2CAKA 2FQFA 2J55A 3V9EA 4A2EA 3FU7A 1JZHA 3HB3B 4JHUA 3CVDA 3PLYA 1W8EA 1BXUA 4DPBX 1FA4A 4CSPA 9PCYA 2GIMA 1BAWA 2IAAC 4FA7B 2BHFA 2Y69B 2YQBA 1L9OA 2XLLA 5IY5B 1J9QA 2BP0A 2JFCA 4GP8B 3AG2B 3WI9A 3NT0A 1ZIAA 3OD3A 3FU8A 3UAAA 1CUOA 3H4FA 1ET8A 5B1BB 2XXFA 1QLEB 3PAVA 1AS6A 1GW0A 1ETJA 2FQEA 1ET5A 4W1TA 4PCYA 3T6XA 1MZYA 4BDVA 2IWEA 3FS9A 3IBOA 2IDQA 3X1BA 1OE2A 1XB8A 3AG1B 4DP1X 1ZV2A 3FYIB 2R7EB 1IBYA 1M56B 5PAZA 1OV8A 3FSZA 1A4AA 3DKHA 2X87A 4KOCA 3BVDB 1OF0A 3DTUB 4E9WA 3NJMA 5AFAA 2P80A 4DP2X 1T5KA 3CZUB 4NERA 1GYCA 1KCBA 3FPXA 3GDCA 2HRHA 2N0MA 2UXVA 4AZUA 4DPCX 1E67A 6PCYA 4KNSA 2UX7A 3FSAA 2P80D 1AR1B 3X1FA 2YAEA 3OMIB 4YSAA 5B1JC 1AQ8A 1SFDA 1V54B 1OCZB 2MRYA 3EH4B 4YSSA 4BWUA 1AACA 3T6ZA 3RYMA 4HCIA 4GYBA 4JKNA 1W6LA 4E9RA 2B08A 4Q89A 4ENZA 3FPYA 2PPDA 1NIAA 5D4JA 1WA1X 2GHZA 5B1AB 2BP8B 2IDTA 4KOBA 3QJQB 2FQGA 2ZXWB 4YSPA 1W6WA 2WO3B 3T9WA 1QNIA 1KYAA 3ZX1A 5B1KA 1MZZA 1R1CA 2H3XC 2PP8A 1AS7A 4BWWA 4E9TA 2BO0A 1JZEA 4KO5A 2A3TA 3FT0A 3IEAA 5I6LA 4P5RA 3NJHA 1GY1A 1ET7A 1KDIA 4A68A 1J9RA 3TU6A 1ZDQA
chains in the Genus database with same CATH superfamily
3KW8A 1E8WA 4L3CB 2R39A 4NAMA 5D2NB 1QUNB 4I8DA 5C08B 2FE0A 5T3XD 1NAMH 4NN6B 4TNEA 4JR9L 3NPZB 3NTCH 4PJEE 3FMGL 4WSJA 1HHGA 1S9VB 4W9IC 5DK2A 1LM8V 4PJ9A 3N3EA 4OI9A 2OR9H 4NBYB 2CU9A 2XYBA 2FTAA 3FQTB 1RZFH 2G4EA 1T7WA 1JERA 5B3JE 1MCIA 3SYQA 2EVHA 4MNQD 3QUXD 1KG0A 5SX4H 2FX7H 2ADJA 2FEDC 4LF3A 3WNJA 4IBUA 3QHZL 1KYUA 2NXZD 2XU9A 1OGAA 1C12A 2C9AA 1YMME 4PJFB 1AD0A 3DXAA 1MVUB 1RZIB 1VIWA 1RU9H 3LDBB 4KXDA 4W9GC 1EJOL 3IFPA 1EIBA 1OARL 4U3XA 2PPFA 4PRBA 5ACLA 1MCNA 3CVCA 2K9UA 1GGCL 2CDEA 1S7WB 4AQ1C 1M9SA 3RWHA 4QRRA 2VUOA 3UJTH 4HCRL 3QO0A 4WI8A 3G6JE 3SGKC 4X9YA 4GSDH 4XO8A 4TNFA 1TITA 1X7SA 4XP6H 4QRFA 3GIVA 3O4OB 3B2DC 5A7BA 4FNRA 4BE5A 4FMVA 4M48L 2OV0A 5CLYA 5IMLA 4ZPTA 1EBPA 4A7GA 1P0SE 4MRCA 4TVPH 1IILE 2W9EH 1B0RB 3GMRA 3QDJE 4NCC1 2DD8H 4QD2E 4NC0B 3TONA 3APFA 1HH9A 1YEJH 4UQ3B 3OLGA 3VGBA 2DEXX 3ZT7A 3TS8A 2W5PA 1DJWA 2YAFA 1CFSB 3U7WH 3VGAB 3BZEB 2W80C 7FABH 2VDKL 3N42F 5E1AB 5B7EA 4DKDC 1VFUA 4Z3TA 5KVDH 1RLBA 4F58H 1XDTT 2R0WH 4X6CB 3Q2WA 1U8OA 4KX9A 3SKJL 4TKWA 1FH5H 4PVMA 3VRIA 4FJYA 5TE6L 4APXA 1VADB 3DK2A 3D85A 1S2EA 2Y5TB 4XOEA 3WKQA 1KCLA 2EDTA 3RZCC 2XWJA 3D48R 1XX9C 5BV7H 3SCMB 5DJZB 4ONGL 1XZ0B 3TO2B 1FH2A 4P5MB 3B8YA 1KFGA 4HJ0C 4I87A 4AYMC 2CO2A 1UB5B 3ROOB 3MNVA 4HD5A 3NK4A 2H4EA 2ZNWA 5LXGH 1GY2A 3Q3GB 4X7CC 4QNPE 1E8YA 4N1HB 3CFJA 1NKOA 5D7KD 5E5LA 3QJSB 1AG0A 3DUSA 1UCBL 4W4NA 3FUMA 4Y4KA 5DD5L 32C2A 1AQMA 1U95B 1OAQL 2NTFA 5JOFB 2YLHA 3D0AA 3QDJB 4BCYA 2AQ1A 3BUDA 2FEEL 3IPFA 2VXTH 4AKPA 4NFCA 1RZGB 3LIUA 3RY6C 5SWQB 1WFUA 5EC2A 4C56A 3QQ4B 1OSZB 1M3JA 1WT5A 4M4RB 4RNRA 4PRIA 4GAYA 3C75A 3SJVB 4ZMWA 2V0AA 4IBZA 4GXVL 4Q9QH 1WFNA 1MCBA 1CICA 1CLYL 4IMLA 3U7YL 2EUZA 4I0CC 3LS4H 4LASL 4HWBH 2DWDB 4K5LA 1MJJA 4NUJB 3LX9A 2DQGL 1SOQA 1PQZB 2ZXBA 5I1AA 1KPVA 3KL5A 1R9FA 1FYTE 4X6DB 4YUEH 2AJVH 5KBPA 2UXTA 1V8HA 2NQDA 2BOCB 3FO1B 1ZWIA 3D8MA 2DIEA 5KANI 5IB1B 1JPTH 3EFFB 3FOLA 1KCVH 5ICXA 4MJ6B 3S3SA 5IQ7L 3EFDL 2WLJA 4WU5B 4KZDH 4Z7WE 3RNKA 4JFEB 1DN0B 2XZAL 2AV1B 2AVGA 3AW5A 5E6IC 5H35B 4QRPB 5C0FB 3GXMA 4R5XA 2LLLA 4YH6A 1V7NH 1U8HA 4BKLA 2GAZB 1CDBA 2DBJA 1O6SA 5DXWA 4PCTA 2EZ0D 4LP8A 2F74B 2WBJB 3GXNA 3QUYB 5DR5H 2ZXCA 5KSUA 4Z3FA 4JFXB 5L7XH 4XXCA 2XTSA 3D85D 5IJBC 5FO9B 5ABZA 1AGEB 3HMXH 1JHLL 1AGCB 4CJ0A 5HHOE 3NIDF 4Y4FC 1PEZA 3F7QA 3KPNB 4QAWA 4ZDHB 5C1MB 4MCZB 5MENA 1CFVL 1G4RA 4YWGH 1S5IL 1WIPA 4J3TA 4HEPA 3HEIB 4ABVA 2PYED 1I8UA 4HXBH 2OMNA 2K8QA 2RB8A 3DDFA 3LHPL 4FP8H 4EPSA 4PJDA 3V9FA 3GUFA 1MAKA 2VOTA 3BLBA 3DIDA 4PJBB 4WGWB 2Z93B 1U2HA 4H1LH 2FR4B 2JVUA 3FO2A 3ZTJH 2CCWA 4JEGB 5GIRA 1Z5LB 4JO2H 4XB7A 5EU3A 5F7HA 4HGWA 2HKAA 1HHIA 5C08A 1GYUA 2KQNA 3B5GA 5G4MA 3GKWH 5DSCA 3UMNA 4F7PA 2F18A 5D1QD 3A24A 3OKEB 4KO9A 3RWHB 2HXAA 3BVNB 3BT0A 1Z2KA 4JANA 3GJEA 5IB2A 1ZLVK 1AYRA 5TDPA 3VXRD 2I9LA 4O58L 1FZOA 1ZHKB 4YC2B 1S9YB 4PJXF 5TDNA 1BX2B 4YS4A 2TRHA 1IL1A 4Q2ZA 5IK3B 1J0HA 3RL1B 4ZS7L 5I5JA 2ZOKB 1JPSL 1QYGH 5I6PA 5TH2A 2BP5M 1QSEE 2J8UB 2KHAA 1N0LB 1U30A 4BELD 2UXGA 1KIRA 1UEYA 3D69A 4FFYH 4YC2C 1MCDA 2QQLL 1BLNB 5IF0A 2MWCA 5ADOL 1DVFA 4MS8C 2C8NA 1UKQA 4UANA 3TJEL 3L5WA 1DCEA 4GIAA 2F53B 2GJ6B 2CUAA 1CTMA 4G8EB 5MEQB 1K6QH 1UB5A 1DFBL 1TJGH 3ZYJA 2YXMA 1U8PB 4HT1H 2Q8BH 2VR6A 3TFBA 3DI3B 3RE0A 4NP4H 4HVBA 3TEYA 1WC7A 3QORB 1A6UH 3TO2A 3W0WD 2WCGA 2C7FA 3EGDB 3IT8D 4BFNA 1SN0A 1G1OA 3NABH 3DYMA 5HDOA 3BN9D 3C08H 4IDJL 5C0ND 3I9AA 1DVYA 4A2DA 5C0JB 4YX2H 4XCFH 4PRPB 1QPPA 1SM3H 1I82A 3HLAA 3PWJA 3QJFA 3EOTL 5GGQH 2VLMD 1OTSD 4LLDB 5DD0H 4ABQA 1SHXA 3QJUB 1NIEA 3LZPA 4H25A 1SYSB 2OZ4L 1NIFA 3L2MA 4UT7H 3JWNH 4ZFZA 4OW6A 4IOFC 3K71A 1IMHC 3ARWA 1PMYA 5D6CB 1QRNA 2ROYA 3GRBA 4KKRA 5C2BL 4KDVA 3RZWA 1RZFL 2AEQL 3DYOA 4NI3A 4P5MA 4F27A 1LWJA 2JKTM 2LVEA 1P1ZB 4HJ0D 1MJJB 4NUJA 2EXTA 3VGFA 2FR4A 5KYXA 4A2HA 1VDGA 3P9MA 1P4IL 3CHSA 4TL5A 2BXYA 1CICB 2EXSA 1TR7A 4E9VA 4Y5YA 4QRBA 3VFMA 3ZGHA 1AGBB 5JHLH 3WIHH 1FNSL 5IVXA 5DD3H 2NNAB 1M7DA 5F9OH 3RL2B 3E8UH 4ZUWA 2WXFA 1LJMA 2HT3D 2GK0A 4PHXA 3U2IA 3E1ZA 3EH2A 4JW3A 4Y2OA 5GGSB 1N18A 1WA0X 1DDHB 1YEIL 3P0YH 5DD1H 5MI0C 1A1NA 2ITFA 3UBXA 1ULVA 1OWWA 1QEWB 2ZP9A 1H5BB 4H1LB 4BRVA 4YSEA 3RX9A 4P23A 1ZS2A 3QRBA 1TEFA 1YEHL 2R2HA 4P5TA 2D2OA 1UZ6F 3BAWA 4Y4KC 2VDNB 1K8IA 2HA1A 2R1WB 1QAWA 3DX9A 3QEGL 4B9JA 3IDYC 4IRZL 1NICA 5E6ID 4AY0A 1GAFL 2J2ZB 2WKGA 4OM0H 5HGAB 2BNRE 3RDTC 1WT5C 4OZ4B 3W81A 5F7UA 4KRLB 1TQWA 4ZTOH 3CVDA 4HXAH 2ENJA 2XN0A 3FQ4A 5SX4I 3NESA 3KPNA 4GKLA 3KWUA 4ELMB 3T1WA 3AT9A 2X7LB 2FEJA 1I7UA 3ULUD 2NY5L 3K74B 3QZMA 2O26U 5CIPA 4N2GA 3WFEL 1PG7L 4KAQH 2ZAHA 3U6RB 1VGEH 3N41F 3ZDZB 1UA7A 4JGUA 4L29A 1RIVL 4UQIM 1W8OA 1O6SB 1QLEB 1I1AA 1JP5A 2IH3B 5ANMB 4NNYB 5EOCJ 5FUZL 3W0WE 2BY0A 3P40A 2R0ZH 5SWZB 1LK3H 3JV4A 2MCAA 3VCLA 4AVIA 4WW2C 3JVFC 4KH9A 2J12B 5MEOB 2H8PB 2BDNH 4MVBC 2OL3A 2JJTC 2UVFA 2CHNA 3FSZA 1B4JH 5D6CA 3Q6FA 3QFJB 3Q7JA 4RGNB 1OIOA 3RHWF 2B59A 3B2VL 4AEFA 1P7QB 1RK0B 4BE6A 4M6ML 1YUHB 2YGOA 2GT9A 3GDCA 4GXUM 3KLHD 3CU1A 3GMOA 4ZBJA 3ZRCC 4QRTA 3S36H 5K9KA 3FSAA 3MLXH 1AR1B 2D3LA 4JM0A 3OMIB 4GW4B 2VZ3A 4G8GD 4C83B 2DAVA 4BBWA 1SFDA 2MRYA 4FCHA 3RPBA 1FVCA 5AOZA 4KC3B 3LH2H 2J8HA 4GKSB 1ZLUK 3TJPA 1QSFB 4GB9A 4HV8B 1NCBH 4RQQB 1U6AL 4KTEH 4XC1H 3E9UA 1NGYB 1JF6A 2XKSA 3QYCA 4Q89A 2V33A 5D4JA 2YPLA 1UWFA 2OULB 4JFFE 2VLJA 3ML9A 1EWHA 4P23D 2OQJB 3T9WA 2APVA 2YPVL 5L9DL 4QTHB 4XNDA 4AIZB 2O6CA 2PP8A 1XH2A 6FABH 1FFOB 4CA4A 1PYWA 4KH2A 2A3TA 2H9GB 2C3GA 2YSTA 5GRYA 1T7ZA 1RJLA 4HJSA 4WFFD 4D7PA 1ODUA 1IRAY 2J20A 4PWHA 2Z31B 3TU6A 5FO7B 1Z9NA 1OTSC 1KY7A 4M7KL 3OJ2C 2PPEA 1NCAL 4RDBA 5IV2B 2MPAH 3CXDL 4GOSA 5HXMA 4A38A 4M1GL 2X4NB 4F7MB 4ELMF 2R4RH 1JGVL 4FYQA 2E7CA 3H9SB 1SMDA 1ILUA 4BA8A 4EXKA 2WXKA 4N9GA 5I8KH 2K7QA 3QEQD 4OUUA 4R7VA 3VFGH 5ICUA 1YEIH 3BDYH 3P0YL 3DX7B 4NWTH 3LN9A 3DTXA 1YEEL 3BD3A 4H0IA 1TU2B 4WUUE 3VFUB 2G5RA 4AG4L 2FD6H 1PY4A 1MCSA 2HLAA 4P2QB 2BK8A 1AKJB 2VDNL 4L4VE 4OJFL 4WWKD 5IHWA 5E1IA 4RMRA 3JV4B 2YOCA 5AOIA 4H8WH 4X6FB 4OLVH 5DMKA 4R0LB 3DJTA 3AACA 5KYYB 1H8SA 3VSVA 4BZ1A 2WXPA 3UYPA 5T1LA 5DJAB 3B2UC 2DQTL 3SKOA 1FDLL 4XPFL 3SBRA 2N1KA 1AOZA 3TBWA 4PJ9B 1WQVT 4Y5VA 4WLCA 3ULVH 1P9MA 2Z4QB 1NLDL 4XI5C 5EOTA 4L3AA 1INEH 4U3HA 4KKPA 3LEVL 4JANB 3ZDYF 4NDMA 1MHCB 4X9BA 3PGFL 3MTRA 4TQEL 4HUWB 1BIHA 4L8DB 4YBHA 3OJMB 3CBRA 2QPDB 4YSUA 1SXBA 4B7LA 5TPWH 3I9IA 1BM3L 2DRUA 3GYRA 1KB5H 3HZVA 4XP9H 4Y9CA 2PW1B 5CKAA 1N70A 1ZPLA 2XWEA 3T4AB 3CZFB 3W0WB 4M43L 3CHPA 1R17A 2EIKB 1RJYA 3WXVL 3HAEH 1QSZA 4GIOA 3C5ZD 3T65A 2TRYA 1D3CA 2NNAA 3RBSA 5JHDD 5KBDA 4Q9CA 3SQRA 2H3NB 5I0DA 3VFRB 1C1EL 2VQUA 4ZNEA 4BH7A 2DLHA 3CVHH 4W70A 4Y1AB 4AT6B 3ZL4H 2BVQA 2XQYK 1DJHA 3QFDB 3UO1L 3VQLA 2WBWB 3CPLA 2QGBA 5AYTA 2SEBA 2AW2A 3K5SA 4LSRH 4NQVB 2PYEE 1F6AA 3BPCB 3HFML 4PP2A 3MA9H 3MRDB 1V5JA 2ZJSL 1AZVA 2FH8A 3HZMA 4KJWD 4F3FB 2BIIA 4CSTA 1TJHL 4OGYL 1H3UA 4W9JC 1JOIA 4ZODA 4HZAA 1JTTA 3QUKA 5KS9A 1U58A 2OJEA 2AQ3A 2CIKB 3I6LD 1MFNA 1L9RA 2N56A 4HPYL 5C0BD 1DLFL 4EMZA 3NABL 4N68A 4CN4A 2WW8A 2O5YH 3GSNA 4N6RA 3U6XA 3CFNA 1U8MB 4E2OA 4NJAH 3ILQD 2EDXA 1A21A 2Q6WA 3O3DA 1D5MA 1GGBH 4UOZA 5HHMB 2HTKD 4EBQH 1TIUA 3MGTA 4DUXA 3TJEH 4Y16C 5ALBL 4QKTA 2BY1A 3EJSA 4E42A 1NFAA 4QYOA 3V4VA 4ZO7A 4N2IA 3FSVA 3QJVB 4YZFF 4P2QA 3C09C 3GKWL 3ILDA 4NCDA 4UB0L 3WUWG 5J13B 1HVXA 2MHAA 4RAVB 4U1NA 3P0VL 4GRLB 3R8QA 3X11B 3EOAA 1WHOA 4JFQB 4K9EC 3VD9A 3ZKND 4HWBA 4M7KH 2AHIA 2ATKA 1L5GB 4BZYA 3O3BB 2XBDA 4X5WB 3ZL2A 2FSEA 4PWKA 2DIAA 4QR7A 1J5OL 3SDCB 5CF3A 3QIBB 2H6PB 4PJ5A 4L3EA 1A7QH 2Q7AA 5CD3B 4DQAA 3PABB 2J6EA 3FTZA 5C0GA 4ZUUA 5K59F 5HI5C 1WBXB 1C9SA 3RGVC 3VGEA 2YKLH 2YPVH 1E4HA 1UCTA 1KTLA 1XF3B 4DN3L 4KRPC 2E27L 1BA9A 3IJEA 3QNZA 5AKRA 4MXWL 2HH0H 5CCKL 3WN5A 3EJTA 3HMXL 3IN0A 1BQLL 2B4CL 1T1YB 3ZKSD 3FQRA 1EGJH 4EAEA 1Q0YL 4K7PL 3F8UB 1LYQA 4KROC 3OKEA 2X4PB 4JY4B 2DH2A 4JY5L 3S5YA 1B2WL 3VFOA 4F5CE 2BSCA 5JIPA 3FQUA 4N2MA 2EKJA 1A7BA 3QARA 1XSJA 4FF9A 3HC3H 3KG5A 5IMMB 5DC0A 2WHVA 2Q2EB 4M6MH 4PLNC 4KZDL 4GI8A 4UOJA 1EUTA 2VZ1A 1ZK5A 3O6FA 5LNEA 4OAWB 4TLKA 3UGUA 5IWLC 4KKAD 4C56D 4HCGA 4QXTB 3T1FB 2AK4D 3NRPA 2AXHA 3SN6N 1MEXH 3QFJD 3TA4D 4Z7NB 5E6RB 2A9BA 1JYXA 4KXCA 3VXPA 3TA3C 4XWGH 5A16B 1KULA 1CLCA 1KXVA 3IVKA 1KC5H 5C6PB 1UWXH 3LKRB 2BSRB 2R0ZL 3C8KB 1N4XH 3NDZE 4OD2A 1FAKT 1OZTG 1HEZA 1XR9A 1HEZB 1XR9B 1HILB 4LLWB 3TURA 1I53A 1VACA 3W82A 4JPWH 4EVNA 4K5NA 2YFOA 3ECBA 3IDMB 1D5RA 3KPPB 5I75C 5KVEL 3VD0A 4PJHF 3TWYA 1C16B 1QSFD 1OP5H 3MUGA 4TLSA 2FZ3B 5E8OA 2Q7NA 1BIIA 2DI8A 3CFCH 3LPPA 3PREA 1G87A 3OAWA 2VXQL 3ZPDA 1IV8A 4XGZA 1MAJA 3WTXA 4Y5VB 4NQCD 4D0BA 4QY8A 1OAQH 3MOQA 5EWIL 1DZBA 4OM0L 3HE7A 3GEFA 4WHYG 2OSXA 5F7BA 3GLAA 3S2CA 2MEJB 4TRPL 4O9HL 4M6OH 4FZEH 4HP5A 1HAWA 1V3LA 4QHLB 2PABA 5C6WH 2B1OA 4HJGA 5AKVA 2ZONA 3MVSA 4IGBC 4BZ1H 3DMMA 5DU7A 5F1IA 1GHFL 1FZMB 3TBTB 2IQ9H 4LLAA 4DIXA 2OXGB 5JHMA 4OZFG 3QXUA 4JFDB 3MNWB 2CHZA 3HBQA 4PJAE 2L4OA 4KXZH 4YXLL 4GAYB 3BPNC 3MLTB 4IMKC 4XHJC 2BZ7A 3O45B 1U2YA 4X0KA 2HLEB 3BD4A 1Z9PA 4X2UA 4MD4A 3FUKA 5DHVA 4MMZC 3UBFA 1E5CA 1EEQA 2VN5A 2WWOA 3DHUA 2A1WH 4IKKA 4TOYL 3AQYA 1RP9A 3KBHE 2B3RA 2IGLA 2JIXA 3U7WL 4ZW5A 3O9WD 4G6AC 1X7TA 1AP2B 1LO2H 2ARJB 2ZSVA 3QT2A 2VXVH 2NW3B 4G7SB 1SEQL 5DJ0A 2EQDA 1JPFA 5ILTH 1T4WA 4I9WE 1JZ8A 3HAEA 1PVHA 4PJGF 2H45A 3BUPA 4BZ2L 3TYGL 1G0DA 2IDCA 4ODXA 4QLRA 3MLVH 4W9DC 3EADA 3U4AA 4AIZA 1EJ8A 4NZUH 4XX5A 5CU9A 3O3DB 4JCMA 4PTTA 1J5OH 4W9ZA 5JXED 4DZBA 3QVAA 1CLOL 1JSYA 4Y4HD 3L3DA 5F6HI 4FQ2H 2VDKB 1FNAA 4JLRB 4UDTB 4CNIB 3B1UA 4XBPA 4XXWC 3KPSB 2FT7A 3CE1A 2EC9T 1BP3B 1WK0A 1S9KC 4UYPA 3BWAB 3SDCA 2CIKA 5I26A 2AK1H 1WZMA 2C5DC 4L3FA 3MRMB 5FW7A 3DURB 1P53A 2XUWA 3GBEA 2P42B 1CF1A 1L5GA 1WO2A 2GTWB 3NYKA 4PUBH 3N1PC 2NDFA 1XR8A 2MNUA 2XZCH 4DZ8B 1D5BA 4L1LA 1Z9OA 4IOSD 4H25B 3VI3E 3BDXA 3F85A 2Z1KA 3MBEC 1A66A 5C9KA 5I1DB 5HDBF 3FFOA 5LO7A 3P30H 1KLGA 3TPKA 3D06A 3SGKA 4BCXA 3H6JA 1HFUA 2PETA 2J7LA 3EIFA 4RGMC 4ALAC 2FIRT 1RK1A 4PGJA 1E5ZA 3X3GL 2GFBA 4HLJA 5FKAA 2ICWA 5JW5B 3WY4A 2EO7A 3GIZH 3S4SA 3H3KA 1M71B 3SCMC 5I5IA 4TNVF 3TVMD 3ARED 3S5ZA 3A5VA 2J55A 4DK6A 1UYWH 2XKNB 4YGVB 5A2JH 4ZS7H 1D5IL 1P7QA 1RK0A 2HT3C 3G9VA 1O9VA 3OF6A 4JFPA 3ZUCA 4MJID 4Y5XC 3QUYC 3WS3A 5ICZA 1U3HD 3RKDD 2DQJH 1NCDL 5L2KD 1WUZA 4OV6F 4FA7B 2ICWI 2XZCL 1TZIA 4HLZG 4WHYH 5CGMA 1MW0A 2X44D 2D3VA 3OPUA 4NQVA 2JFCA 5HD8C 2P8PB 2JJSC 1GZPB 4U1SB 4OJCA 3RUGB 1XD1A 2VC2L 2XHNA 1ET8A 3E38A 2PW2B 4GBXC 2PW2A 2BIMA 5F6HJ 5D1ZC 4A39A 4Q6IB 2UWEA 4CADA 1TMQA 1I8KA 4X6FA 5TPWL 5DMKB 4XNYH 1HI6A 5MI0B 3DOSA 1I1RA 3CCHB 4W93A 1QLFB 1MIEL 4MYWB 3AM8A 2BOBA 4NS0A 2FYYA 4HDIB 5PAZA 3RKDC 3LEVH 4X83A 2NX5D 3BPOB 5GGVH 2P8LB 1XCQA 3BVDB 1TQCB 3DTUB 3LQAL 1IAIH 4IRJA 2P80A 4MCMA 4UQEA 4BZ1L 3EO0B 1S5HA 5J3HD 1GYCA 2ICEA 1HEJC 2N0MA 3ECUA 1IGFL 1BZOA 1MHCA 3FCTA 3BAKA 1NCOA 2OTPA 5FYJU 3MV7B 3UBGA 4F7EA 1ZVYA 3QPQC 4FCAA 5D55A 3FCSA 2FD6L 2MKWA 1X7QB 1X5FA 1WUNT 1MFCH 3VD7A 4X42A 1CLVA 3J7HA 2ZT9C 3JSSA 4QKXB 3VI3F 4EKXA 3I02A 2ZG1A 4URTB 4Z76A 3ZMNA 3MODL 3OKLA 5JYMA 3FRPB 2Y1YA 4A6YB 4PGEA 3D3VA 5GRWA 2L8AA 2I60H 4Z0XB 1F3JB 1DBML 2KQMA 4ZMNA 5E9DB 3NJVA 4IU3A 1YJDC 2HG0A 3EDEA 3EFDH 3KYNB 5DFAA 4RZCB 2XNAA 3S9DB 1NOLA 2B15A 2JSFA 3MUHL 3US9A 4N90E 5KVEH 3O3AB 3IMWA 4UDUB 1QP1A 4M1GH 4LKCB 4TF4A 3MOBH 4OFPA 1NAMA 4RBPH 3MUUA 4ZW6A 4F33A 5CD5D 5KS9E 4AV4A 3V6FB 1UATA 3SGJA 4DF9A 1T1YA 1YQ2A 3KWTA 3FFCB 1WWAX 3IDIB 4X0NA 4ZTPL 4PGBA 1IBGH 2ARJQ 5C9JB 4NI6A 4UWQB 5E0FA 2BSEA 1ZSDB 4FQIH 2NR6A 3UEZA 4LL9A 3MRNB 4LVNB 4WI5A 4LNVA 2AFNA 4B9FA 1G7PA 4N8VA 1JN6B 5EIIB 4RSVA 3NSFA 1GGIL 3MXWH 2VDRL 3CFCL 4HIJB 2WNWA 3V7AG 2V5MA 3A67L 1SYSA 3IFLH 2AQNA 3FULA 3MOAH 2YHGA 1N7ML 1CXKA 4XMXA 4KZ0A 1LE9A 5DLML 1KIPA 1T83A 2G30A 2DIBA 3ZO9A 3ATEA 4IBLT 4OZFH 4P2CG 1WLHA 4KTDL 1F00I 4Z3GA 3G6DH 4GXUN 4OZIF 2WLMA 1IEHA 2X1XR 4X5RA 5F9DC 4EF3A 1ACYH 3IETA 2D4DA 4WUUD 4LMQE 3BGFC 5HSFA 2HKFL 3UTTA 1AO7E 4NO0A 3MKKA 5C09D 1H8NA 3V4VL 5BRPA 2B4CH 2VQTA 3MLXL 4JG1H 4HUMB 3H2QA 2AJUH 4NHUA 1YC8A 5JDSB 2ENPA 2HMIC 4DP0X 1YVLA 3GINA 1KXTB 2Q9OA 3D39B 4K5OA 5IM7A 3ILPA 5AUMB 1G7HA 3GSRA 5F9WB 4FJZA 3KH4A 43C9A 3JUZA 1BJ8A 1UVQB 1MI5A 4HUUB 3DJRA 2ORBL 3KWVA 4R96B 1XCTA 5DUPH 2XX0A 2BDNL 2JLLA 1UOWA 4OTXL 3A0OA 1QLEL 3LXAA 4KKAC 1VA9A 1GGUA 4LEXH 4P2RD 2DWEB 2R4SL 2YD9A 4PY8J 4C8XA 2V17L 4N0YL 4PLKC 3RGVA 4F58L 1A7PH 4URKA 1X7QA 1QSEB 1BMZA 2J8UE 4X6EA 1E27B 3MYZA 1E27A 3X17A 4CN6A 3VG9B 3ILEA 3SE3C 1E4KC 1PZCA 3VCLB 3D12B 1IGYB 2VNCA 3B1TA 3AZUA 1A1OB 1IM3A 4TS6A 4DQOH 1MKFA 4U7KA 4U1HB 1GOFA 1SBSH 4MVBD 2J73A 2FZ3A 2K6ZA 4M3KB 4NKMB 5E8OB 5GJSL 4I4WB 1X5MA 4CAGA 4FZ8H 5EV7A 5AG9A 3AQXA 5JIKA 2EYTB 3ROLA 1XGPA 3MRKB 2Z92B 4JAMB 3S5LA 2WYZA 4GSDL 5JA8B 2AEIT 3OPZL 4MA7H 4WFHD 3X1GA 2CGRL 1K72A 5EEXA 2JELH 2VDOH 5EU6D 3BD5A 3MRCA 1KCWA 5E8DH 4XOCA 3FB8A 3ME0A 4JCLA 2I5YH 1DVZA 4M62L 4NO3A 3O3UN 1QNZH 4IGBA 2ZCLL 5F97E 4YDZA 3F7PC 1MCPH 4LE8A 3V0EA 4JPKL 5HGAA 2BH0A 5LDUA 2CJUH 2W0KA 4P5TC 1NPUA 1MFAH 2X42A 4NNXA 4NNXB 4PJ8A 4PJ8B 1VENA 2VIRA 5I66B 1DQMH 2VABA 4JZNA 3GGWB 5T5NF 5C3TA 1QUPA 2MQCA 4Y19E 4DP9X 3OSVA 5G2NA 1BIIB 4I89A 1CFTB 1PSKL 1UD5A 5I30H 4XPGL 1MCEA 2IAMC 3N43F 4DPAX 4U6XA 2YBRA 4S1QL 4U1IB 3MCKB 1AO7B 2J3SA 1IQDA 5HHXL 4G7VL 1QX1A 4FABH 3IU3B 5HDLA 4M9OA 4HC1H 5AZEL 1Q9LB 1BG9A 1BW8A 2Y7NA 2NY6D 3GMPB 4V1DE 5FOJA 3LXBA 3U9UB 5IREA 4LAQL 1TJXA 1BHGA 2NCMA 4TVSa 2EC9U 2PN5A 1A6WL 5CZXC 1SJMA 2VDMB 3TVMB 2XPGA 3IGFA 4JVUA 5KVEE 3T1FA 2HWZH 4RA3A 5GSRA 4PRHD 3CC5B 3UO1H 3WFHA 4Z7WB 1VZHA 3VRLE 1FAIH 1KB5B 1PZ5A 1DQML 1MNNA 1SRDA 2EEBA 3SDCC 5I0VA 5E2JA 5HPMB 3HB3C 5HPMA 3FZUC 3DIVA 4IOIB 5D2LA 2E5EA 4M7LT 5DHMC 1MCPL 5FGRA 2JJTA 2BNUA 2YD0A 1WFMA 2IH8A 3HS0A 3AM8C 4OLVL 2WAHA 3ZMEA 4YSQA 3L2NA 3MBXH 4JHVA 5FO7A 5BO0D 3WJJA 5DQJA 3O81A 4IIQA 2W91A 2I7OA 2VLKB 4FFZA 1NIDA 1MCJA 3LN4A 5B1JA 3J8F7 1A6TA 2BIHA 4NP4L 5IQMA 5L8LB 5D7IE 3EF7A 2Z91B 1K2DA 2LABA 1U8NB 1D6EB 1CDUA 4NWTL 4NQEE 2FO8A 2DN7A 5FB8A 1JF1B 2HFFB 3HBGA 3IJSB 1TQBB 1NWOA 3EFOA 4HMEA 5F0MB 3EOBA 3OHMB 4WWKA 4HUNB 3ZKQD 2L0DA 4W4OC 3L4ZA 3QCTL 4KK5D 3VTMA 3AY4C 4AQ8C 1LO3H 4RGNC 3MREA 5J6HA 4W9LC 3FH5A 1FJ1A 1SDDA 3WEOA 2XFXB 1F58H 2DY2A 2FB4H 5DHYA 4CDGC 5IROA 5ESVA 2QSCL 2R59A 3BE1H 6CGTA 4NQCA 4RMBA 1BBDH 4Q6IA 1DQJA 1EZLA 3L6FA 1R46A 2YPLB 3MR9A 1HQ4B 1NCUA 3DGGA 5E6IB 2PYEB 3DPBB 1JPST 1JDDA 3K8KA 1Q1JL 4HKXA 1ZEAH 3MNWA 3U0PA 4HAGA 4Y1AA 5FLUA 1BBJB 2AXGB 3FB5B 5PCYA 3TCLB 5CCJA 2CPCA 1EUUA 3FHAA 3CN4A 3PGCB 1ACCA 1W91A 3CXDH 3QJTB 1FYTB 4X6DE 3BCFA 3ETSA 2NUTA 1CBVL 2UWEE 1KBBA 4GG8A 4ZFOL 5F3BA 5E2WH 4RRPA 3BH8B 3RA7L 2NMSA 1WEJL 3QUMB 3UC2A 4ZG1A 4MASA 2EVJA 1E6OL 3GM0A 1A4KA 1E4XI 3GNML 3SQBB 2A9NL 5C0CD 1GMEA 2WQRA 4HDIA 3UZEA 5LWYH 4FQ1L 4ENEC 5E5UB 5DEFB 1H15B 3K6SA 1ZLWK 4N24A 5CCGE 2YA2A 1UURA 1BGXL 1EVTC 1GGTA 4OI8A 1ZTXE 1EHAA 2OMVA 2AI0H 3HBZA 3TZVC 4IK6A 3S98A 2EIJB 2H7WA 1GSKA 1LNUB 3PPSA 1N5AB 5IQ9A 1AQKL 4YHKL 1U6AH 4KTEL 1DVTA 2J8UF 3IFPB 4KVPA 4IGBB 4LDCA 1S9VA 1VZGA 1UH3A 5DK2B 4NO0D 3ZDXB 4OCWH 1SJEA 1TLKA 4B9GA 4PJ5D 4L4TA 5FUZH 4M1CD 3MV9B 4OZHB 4PU2A 3WDJA 4AQEA 2X38A 2CBMA 5AKSA 3BSGA 1AGCA 5GISL 5HY9B 5IVNA 1RJCA 3OSKA 4H5SA 3TN0A 1FO0A 3QEUB 5C0IA 3L3KA 2UZIH 1CT8B 2ZKHL 3VXOB 1JRHL 2YJLA 3B3IA 2BOBB 4J6RH 2WJ5A 3FTGB 5TK2A 4GAJL 4QHMA 1V3MA 2P24A 3NEEA 3TFKC 6PAZA 4LEOB 4Q9RH 3FTWA 2VDQB 3V5DB 1G9HA 3HE6C 3WO4B 5I1GL 2X4QB 1OANA 1LDSA 4QRRD 3B37A 3CC1A 3LRSB 3S34L 2JKJA 1PX3A 3WDHA 4LLQB 4IRSC 2VDLH 1O5DT 4IRZH 1WDAA 3LZOA 1XB6A 3SE9H 1UD8A 1AGFB 1AKPA 5IB1A 5I74C 1PY9A 1WZ1L 1TNMA 3L6FB 4JPIA 4GW5A 1U0QA 1SDAB 4A66A 5MERA 4IRSB 5FFLA 3CFUA 3FQNA 1N67A 4AIXA 4NQXB 5I16A 3TIDA 1CIUA 3NSCA 2OTUB 2R23B 1G7HB 1JTOA 4GIPD 4HEMA 5GGVL 4AKQA 1B90A 2X2UA 4E41D 1EA9C 3ZKMC 2DKMA 3N44B 3BO8A 5FWQA 5DJDB 5AVXB 1PDKA 2K0RA 4LLVB 3IDUA 4BQ9A 1QTPA 1T2QL 5KBNC 1MW1A 3CG8A 4APXB 2QVTA 5C86A 5DZ9A 5EO1B 2Y2YA 3QWQB 5AW6B 4M3JA 1OSPL 1Z3RA 1LO5B 3DRQB 4ODVL 4A2EA 1KOAA 4FQXC 4CN1A 3OAUH 3ARFC 4FNLL 4M6AA 1JCVA 3UDWC 5E8NB 3RTQC 2DQCL 3BAEH 3FC8A 5C07B 5KSBE 1ES0A 2C4FT 4WUKL 3VFTA 4Z7UB 4OLZL 5T33L 4RLDA 2JCCA 1OF2B 4JG9A 5KW9H 5EG6C 4P2AA 4ELKB 2OYKA 3E6HB 1L9OA 5BJTA 3DX3A 1Z5YD 4P07A 4NRXB 2WVVB 3IJSA 3ZZ1A 5AEAA 3TFKD 5JHLL 1FNGB 3ARZA 4TM9A 3HNTH 1UJ3A 2BC4B 3HS9A 2FQEA 3L9BA 4Z77A 1F0LA 2OL3H 4HS3A 5E7BA 4RFOH 1MRFH 5GS3A 4QHNA 1SXSA 3OAZK 2IWEA 1QBMH 1MJUH 1F4XH 4OD2B 3R1GH 3X1BA 2AJZA 4U4BA 3T0BA 3FUDA 5DJYA 3SDYL 1RULL 1TTAA 1D9KA 1UEMA 3ZKNC 4QHLA 4ZUVA 4M48H 5J12C 1P7HL 2NY6B 2WQXA 5D7LE 5DRWB 3TO4A 1MN4A 3QXAA 3M46A 1WCBB 4OLXH 5D7KE 5JO5B 4TL4A 1PW3A 3GMRB 2YFNA 3MNMA 4HS8H 3ARGD 5HYQB 1G1KA 1HX0A 2V7NA 5B1JC 1TZIB 3AXIA 4EZJA 1OCZB 2KDGA 4YSSA 4WQOA 3RYMA 3RGVB 2JB6B 4ZMLA 3VSQA 1DJYA 5L4IA 4WEBH 4UM9B 1R5VB 1QASA 3D18A 1G7MA 2QMJA 3FPYA 2PPDA 4WTZG 5AW3B 2GHZA 5MERB 5C2UB 2CDFB 4HT1L 1I3RA 2CR0A 3K8LA 8CGTA 5HHQB 2FQGA 4G83A 5ISZD 2EE0A 2F7QA 2H3XC 4RFEA 5KBKA 1NGWA 3ARGC 2BO0A 1EXUA 2VN7A 4U1GB 3WJMB 4U6HA 3EXJA 3CK0H 4YAQA 4YDIH 4PJ9C 5IVOA 4A68A 1NDGB 4QGTA 5A1AA 2GBUA 1OSPH 4JFXA 4PJGB 4JFTA 2X4OB 4XO4A 3CXHJ 5AG8A 3IGAB 3VFMB 3SYPA 3QWRD 5JIQA 2XA3A 3VQMA 1O5PA 2M1KA 3SY0A 5D4IA 2V9UA 3SY0B 4EUPH 4N5EC 4XPBL 2HX7A 2NY3B 5ACZA 5BS0B 5BZDA 3ABGA 3KE0A 4Q52A 4A1RA 3GSQA 4UQ9A 1ES0B 1KJMA 4LRNL 4Q8BA 3T4AC 3SQBA 5JIHA 1N6QL 4H5SB 3TN0B 3X2QB 4BZ2H 2YSSB 1N6UA 3MACH 3IS1X 3O8XA 1QEWA 3ZTJG 4XN4A 5DUML 3VTTA 5F89A 4PBWD 3S97C 2WP3T 1CK0L 3L5IA 4O02H 1RUAL 2R83A 2BNQA 3F7LA 1IQWH 2OI9C 2QMKA 3KYOA 4WDIB 5GS1A 4NYLA 4O9HH 5E4EC 3AFLA 2Q3AA 4O00A 3LEYL 3BAJA 4MAUH 2VDLL 4FEMA 4FJ6A 5EZJB 1A1OA 5K93A 3IF1A 1WS8A 2GI7A 4L0ZA 2DQHL 4GS7B 4J7RA 2A0LC 3EFFA 5E5RB 1I3GL 1LO4H 1XF1A 5EO9B 3E9TA 2WB7A 4WEUD 4MA8L 5CN3A 4UU9A 2W92A 5JZ7D 5L6YH 3C5SB 2DYPD 2ID5A 4DZ8A 3PJSA 1BYPA 3KR3L 1TPXC 4ILDA 2FYVA 2DTML 5H8DA 4LGRB 3B34A 2B5IC 2XA8L 3S37H 1Z0MA 5L88H 4J3OD 5CP3A 1EO7A 2Q2LA 5C0EB 4P46C 1TTGA 4BSVB 2XV2A 4CMHB 2Z6FA 4U1LA 5L7XL 4XNUH 2PTTB 1H3XA 1UZ8A 3AGWA 5EZIH 1BVKB 3B2XA 3QAQA 1YN7A 4N5UA 5D5ME 3WFDH 3LS4L 3RWFA 2B3IA 1SXCA 2VT0A 2CNZA 3LN5B 4RGMB 4YFLF 4EOWL 4KDTA 4BDVB 5F9JB 3BRDA 5D72H 4A7UA 3E6HA 1O7VA 4PWEA 3D0VA 4JQXA 1PTZA 2GT9B 5KSBB 2H9GA 2UZIL 4Z7NF 1J1PL 3Q6GH 1CR9L 2MHAB 1EFXB 4RAVA 4JGNA 1CFQA 5G4NA 3X1EA 1B2WH 3MNVB 2GSGA 1DQIA 3TF4A 1OPOA 3F7VA 3NA9H 1TSHA 2EE6A 4NQDA 2PF6A 4WTQA 1U3NA 4K7PH 5GIRB 3RY6A 5FOBB 5CEYA 3EUUA 2HPOA 5LXGL 4QPEA 4UF7C 1H6TA 3IDXH 5EF3A 5F3FA 2YZ8A 2CLRB 2CJSA 1JXFA 1O6TA 3GSNL 4OFQA 2AQSA 1E9QA 4OD1H 5JW3L 4NO5A 4NBXB 2HG5A 2BCMA 5ETUA 2X89A 1D7BA 5IVZB 1TTRA 2VW6A 1DJSA 2A9NH 1E9PA 1FL5A 1HINL 1JZ3A 5KVMC 4FNQA 1UXMA 5SWSE 1INQB 2Y2TA 3RP1A 4V2CB 4FQXB 3P2DA 4FADA 3PG2A 3Q2CA 1M71A 5K1VA 1E5BA 3I75B 4NN5B 2EO9A 5K39A 4BV1A 2X4TB 3B43A 5AWNH 1LQBC 1ED3B 2XG4B 1EHLH 5AW4B 3N06B 1GC1H 4K3GA 1U93A 2WYTA 2C7UB 1FFTB 4FXGC 3D2UD 3VX0A 3UZVA 2X3AA 3V7AE 3C60A 3FOMB 4Z5RA 4MXQC 9CGTA 4U6HB 4JVPA 1BQHG 2YA1A 2YMXH 4D3CH 3VXSE 1IUZA 1NDGA 1PLCA 3C9NA 3NJGA 4X5LA 3UYRH 3HUJF 3ZE1E 3H9SE 2EH8L 1NGWB 3EDJA 1Q1PA 1XH3A 4RVBA 4ZFGH 3TF7C 3IKCA 3HPJB 5D1ZI 2XG5B 5ID0B 2G0LA 2XG5A 2XVBA 4X98B 4BK5A 1S78C 1UM4L 3SDAA 3FRUB 4G1MB 5D71H 3FSWA 3IWVA 1BFVH 3ASNB 5DWUH 4JO3L 4RMTA 4AYFB 2CLVB 3D85B 2ATAA 1AC0A 1AJ7H 3QHZH 4UUJA 4S1DC 4TVUA 4MJ5B 4F9LA 2IFGA 4EBQL 4FA6A 5LHDA 4AV5A 3U0WH 1NDMA 2HMID 1ZGLB 1A2YB 3BYYA 4ABUA 2EIZB 1HXYA 2HWZL 5K69A 4EZKA 2K6WA 3KGTA 4Z0BH 5JTWA 1OCCB 3CVHL 2ZCKH 1KT2B 5KYUB 4PS7A 1H3WM 2PCPA 2XV6B 2CPUA 3VYOA 5D4HA 4DOHB 5J11B 2XVGA 3DSNB 3IPEA 5GZOC 4G6KL 2EH7L 2MMXA 3BPOC 5EF1A 5J12B 4R5VA 2C1OB 1EJOH 2IC2A 2FJGA 4NP9A 4B9ZA 1NEZB 2HX8A 3DYPA 4KVCH 3S8GB 5HP5A 2G9HB 5I1EH 4YGAB 3H3BC 3BIBX 2WGNB 3NSJA 4WTWA 4I5BB 4TQEH 2BVOA 1PFCA 1WPCA 3NIGF 3RIFK 4NQSA 5JDSA 1KPUA 2IWKA 3PP4L 3GRWL 2WB1A 1M05A 3B5HA 2NSXA 3HS8A 1DYZA 4PV9B 4FA8A 2EINB 1RZJL 4QTFA 5LBSH 3QWOA 2C9QA 4EN3C 2R0KH 4GUQA 5L4MA 1VLXA 4K8RL 2ZCLH 1NAML 4KK5C 1T6VN 3FF7A 5AW7B 2MTAA 25C8L 4IBVA 1M6UA 4DH2A 3CBKB 3VFRA 4S1RH 4XPGH 4Z9KB 3SQOH 1LO5A 1QZ1A 3DRQA 4M5TA 5E9AA 1Y07A 4H26A 3WTVA 3WXWL 5JIMA 3G08A 5DYFA 5D7IF 4FZ8L 2HKHH 3OG4B 1XIWD 4KQ3H 4ES8A 3WN6A 5JXAL 2QDVA 3SDDA 3FCTB 4LSVH 1Y6MR 3VXUB 1OGPA 3EO1A 3T6VA 3C6SA 4KVNH 4PS3A 2GJ6D 3E3QE 4LOEA 4N2BA 4UMSA 3G6JB 1A0QH 4JO3H 3POHA 1FVDA 3I6GB 3VD3A 4LGPB 2RD0A 1GYVA 4HKBA 1G9NL 1QNZL 3FU9A 4I3SH 4BSVA 4A04A 3IDNB 3E2HC 3ECQA 5DFVC 4LEXL 4PCSA 3MRGB 2MOQA 1KGCE 2ZTBA 3QUXC 3ZHFA 4XCYA 4ZOBA 3S36X 4MB5A 4PR5A 4M5ZL 1SZNA 2OL3B 3K1DA 2H32H 4L2YA 2WO2B 3BRFA 1FO0H 1UJ3C 2CMRH 4M7JH 3KYAA 4JFUA 2ADGA 4WZ9A 4YSOA 4C59B 1LD9A 4WI2A 1KELL 5JQIB 2CRMA 1L7TH 5DEGA 2YLKA 4ERSH 4DQOL 3GMLA 5LG6A 3WFHB 4WVRA 3AXLA 5DI8A 1E4KA 4G80A 4MS6A 1JGVH 4EI5D 5BS0E 3LKSB 5I1LA 3Q1EA 2MKLC 3V4VH 1CLZH 4K5PA 3WE6B 3OKNB 3OR7A 1RPQA 3OVUB 3T4AA 5LAXB 3EOYG 2OJ1A 3WAJA 4OCWL 1S6NA 4KHTL 4QI3A 2D4FA 2M26A 3GMMB 1CXIA 5DQDH 1CICD 2RFXB 1DJXA 4OB5L 1GOGA 3GI9H 4ALAL 1I3UA 3CSFA 3K2UL 3P54A 4AQAA 4R97C 1O9ZA 5GGSA 2F8IA 1TEYA 1SF5A 2HT4C 4LK4A 4OZIB 1IIKA 2XY1A 5L9DH 2XY2A 1M1SA 2XWTA 2JQMA 5KJ7E 1Z9SB 3REWA 3C60B 2VDRH 4AH2B 1H3PH 4XWOC 1NM9A 2XWXA 4JM2A 5LBVA 4QY8B 1EANA 1OE3A 5JOPE 1BQSA 1KN4H 4H8QA 4LSPL 4R2GD 1MCOL 4E36A 1C5CL 1PZAA 4HIPA 5B38G 1KGJA 2VERN 4R4FL 4N0UA 4XVJH 3UTSE 3L9EA 3L3HB 1KGYE 3IRZA 4J28A 4J8QA 2FQFA 2KZKA 4EZLA 2WXOA 4EVNB 4AE1A 3P77B 1I8AA 3OBAA 2NUPA 2XIIA 5DLMH 5CUSH 2UY7B 3NZ8A 4HKJA 4PWJA 1YY8B 2IFFH 1BXUA 4F15C 3KZ8A 4KQ0A 4CSPA 3JQOB 5F1IB 2X4RA 1GYWA 5BZWB 4C58B 2WZPD 1IVLA 2IAAC 2BOLA 2CKBB 1F4AA 1NCWL 5I16B 2WQUA 4G11A 4NN5C 3T5WA 4QJ5B 3PDDA 5TQ2L 1MFVA 3P2BA 2JB6A 1VPOL 2YUWA 3GXIA 5C08E 3F01A 3RNQA 1ETJA 5I1CL 4KX7A 1X5YA 1NH6A 4PCYA 2QVIA 5DVLA 5C0DB 5L88L 2KDYA 3LZLA 5C0AA 5FWRA 3T6XA 2VLRD 1IBBA 4JPVH 2IAMB 4I9XA 4U1MB 3AVEA 2WIIB 3BPLC 4L8SB 2XKNA 4YGVA 2EDLA 1WV7T 2YXFA 4XGZB 1NBZB 1GJUA 4AW7A 2AJ3A 1FO0L 3QC6X 3K0YA 4M7JL 5F8QC 3E80A 1AY1L 4YHIB 4CVXB 2DI9A 1WWWX 4DT2A 4XVSH 2G60H 5C07E 2APSA 3R0NA 1EGJA 4OBSA 5LQBH 2OSYA 4PPTA 3ZQWA 1WAPA 5DO2D 1I1YA 5F3HB 4QTIL 2YQ2A 1BBJA 2YAEA 2P5EE 3CSBA 3PXHA 5ESAA 3PXJA 4OV5A 2ESVB 1EV2E 2EYRB 4BD4A 1V54B 1QO3B 1XAUA 2QQNL 3FONB 4TUJB 3TA3D 4L1HA 4YLCA 4M1DL 3MLRH 2AJXL 2E59A 2WM0A 1R0AH 4PMFA 2ICCA 5INDA 3QIBA 2FUTA 4BSWA 2DQFB 1A3LH 2WUBH 1IAOB 3IMUA 2PYFA 5ID1A 2CUMA 5HGHA 1JWUB 2Q76B 3Q2NA 1I31A 4ZOAA 5HDQH 4CC4C 3AY4A 1L3NA 3N6YA 2OFQA 5E08H 3V5HA 5HJBA 5I8CA 2ZXWB 2C3HA 5I8CB 1DBAL 1CE1H 1QNIA 2WO3B 3NSXA 2HKHL 4OAWA 3TEUA 4Y2LA 2HSIA 4B60A 3MXVL 2HLFC 1AMYA 1UASA 3HRZC 5TQ0H 1RZKL 3ZOAA 3QO1B 3OXSB 1M2OA 5T5NG 3HI1A 5DJXA 1E4XH 1EDYA 1E8ZA 1VEMA 3NA4A 3K8MA 3HLKA 4YX2L 1Z5HA 1P6FA 5GGTH 3T71A 3VH8A 4ZUSA 5HHXH 4MKTA 4WO4C 3X3GH 2I9TA 4YEFA 3U9PH 4LHUD 2EYSA 4Z3IA 1I9IL 3PV6B 3KPRB 1HKFA 4NRYB 4X6BB 1XF2B 1XF2A 3T08A 2VAAA 3DSFH 4HZLB 4YHMH 4JFPB 3S0PA 1E9QB 3RB7A 2MNJB 5DRXB 1GH7A 4XMWA 5ALCH 7PAZA 2L7UA 5BVPL 3EJUA 3SOBH 4HIIA 2WYIA 3L3GA 4DKFH 3JWDC 2PPCA 4DKTA 3MV8E 4PRIB 5E9DA 5EUOF 5KZCD 4MAYB 3EO1B 5FGCE 3SOTA 5I6NA 4QIRA 4ZX5A 5KYXB 3FH8A 1OAZL 3DJ9A 4Z7IA 4DW2H 2FWOA 1UM5L 4X4XA 3SPCA 5KAQG 2A9ML 3FTXA 2GI0A 1CYXA 1MJ7L 3CDCA 3LKPA 1CL7I 5JW4M 4FN0A 4ZS6D 2BPBA 1CE6A 1KBKA 2EDEA 5I5RA 1OHQA 4K55A 4HS8L 3WBDA 1A6UL 3UYPB 4OQTH 2OSLB 2FGWL 4OZIA 3EHBC 2CJ3A 2N7AA 1MFBH 2Y5QA 4MLSA 4NQUA 5EBMA 4ZDHA 4G72B 1A1NB 3UBXB 3ZKXB 5GQBA 2VL5A 1BQHA 3OKOA 3PWLB 5IROC 1X9RA 5HI4C 5IOKA 4DCQB 2H2PC 1HCZA 2YSSA 1F4XL 4LIQE 1I7ZA 1OK0A 4KI5C 3RWJA 3K72A 4IS6B 4V1DB 5D71L 3KPRE 3V0AC 1UM4H 2LU4A 1ADQA 1SEBB 5H4YA 4GKSA 5E7FA 2WK2A 3IFOB 4FXKA 2H47C 4P4RB 5A3ID 4XX1E 4YLQT 5F8RC 3OTTA 4HHAA 1JWUA 2Q76A 2Z65C 1AS8A 3OZKA 4K23L 1T7VA 3VB8A 3QDMD 2EDRA 2JJUA 3HG1E 4AITA 3A23A 4NZTH 2YMTA 3P3UA 3B9KC 5CS7A 4HFUH 1GC1C 1SLXA 3CPLB 3QHTC 4R83A 3BSZL 1XSKA 3K2IA 3GSOB 1RJLB 1YJDH 3BKJL 4GRWE 2R29L 3D09A 2C9RA 2J8OA 3SBPA 4R96A 3MV9E 4OZHE 1SJXA 1FVEB 2ODIA 1FPTL 2C4FU 2NXZB 3BO8B 3WGVB 1A9BB 3IDIA 3O6LH 3D4CA 1FNHA 3T8VA 2OMUA 3OXRB 4UOW0 4GG6B 4IHOB 4K7FB 4EI5B 3K4DA 2HVJA 3UCQA 1ETA1 2DL2A 3MMEB 5H2BA 1LO0H 5CEXB 1N3NA 1QFWI 2GBTA 1CMOA 2Z64C 4U0RC 1JGDA 2ED9A 4PSPA 4F57H 1N10A 3P02A 3AS3A 3QDJA 2HVBA 3FQNB 5C0AB 5GZOA 1RAMA 5GGRB 4XXDA 1MCHA 1VADA 5BCAA 3IN2A 4IU3B 1GTNA 2CO6A 1CFVH 4PRDB 3BP5A 4I77H 1NCTA 2BCKB 3Q05A 2WXJA 3Q1SL 3IDXL 2IJ0C 1F3RB 3OKYA 4WKZA 4LNRB 5FO2A 2Z7ZA 4JRXE 3M86A 4L8CB 2QEJA 2J8UA 1X5HA 2ITDA 4PVNA 1ANUA 5I5MA 2W9LA 1VFAB 3U0TB 3B3IB 4OZHF 1IGCH 5I1KL 4OLWH 2XA8H 3S37L 1HE8A 2H41A 4NQQA 3UC0L 3REVA 4HV8A 4QHMB 4BYHA 4Q9QL 1VFMA 4PJ5B 5EEVA 2Y3AA 4RDQF 3GM8A 2VWEE 3OKOB 3PWLA 2H1XA 1QW8A 4APQC 1ECYA 5B8CC 1JYWA 4PCKA 2R2EA 4NSKA 3T2NH 2X4SA 2CR6A 2EDOA 2G2RA 3TTYA 4XRCB 3NFPA 4XCCL 2J21A 4WJKB 5GS0H 2PKDA 4LT7A 1FFNA 2L7JA 1UWXK 2FX8H 5GZND 3T0EE 3BAYA 3L3OC 1JWSA 5IV2A 3GTVA 4ONHA 1OP3K 3WCYA 4OCYL 2FUQA 4DK5A 3QGVA 1KTRL 3RWEA 1UENA 4JDEA 3MZGB 4K0OA 3T0VA 5FGCB 1KCRL 5K39B 3T2LA 4ONFL 4L4VA 5CEZE 1MWAL 1JE6A 4PJBE 2BOCA 5GPRA 4DN3H 1I9JH 4JREC 1HOCA 4K15A 4NQEB 4NIYE 4TSAH 3VX1A 2ILLA 1TEGA 1XGZA 3EDKA 1IFHH 1MI5B 2AERT 3KW7A 4P5TD 1XFPA 4ES9A 4LRNH 4PV8B 4HUKB 2FCBA 3X14B 2QHLA 1IGTB 1J12A 2ZWNA 1EMTH 1KWGA 3ZE2E 2AV7A 4G80B 3SJVD 3KPOA 1T3FB 1EZSA 1OSEA 3P3TA 5CSGA 1RKRA 4XBPB 3N0AA 5E2WL 2DLFL 1LMKA 2EDJA 1AD0B 1R47A 3DXAB 2E4TA 2M2DA 4YDJA 1IBFA 4UB0H 1IAMA 3HC0A 4LKXA 1EEZA 4FMKA 4K71B 4LVEA 3UADA 5EBLB 5D9SA 1PLGL 1GSMA 1KF9B 2I69A 1SF3A 2J57A 4MQXD 4JQIA 1ZVSB 2DQEH 2YGNA 4HFUL 2A77L 1RLWA 4MJ5A 4FQQB 4ADIA 1DVFC 1J8HB 1HYRC 1TVHA 2X3CA 3I3DA 2F54D 4NEHB 5ABAA 3R8BB 4HG4J 3L7EB 2EDKA 5KANG 2Y24A 1LVEA 1K4DB 2WLKA 4AK1A 4IEFA 4OM1H 1D9KC 3K46A 4RFNB 1YPZB 5IMOB 3O6FC 1KIRB 3VWJA 1G94A 3S96A 2B7DT 5L4JA 3OAYK 1T1ZB 2D31B 1W72A 4CUCA 1EAOA 4GSRA 1A1MB 3QR1A 3OKDA 3OKDB 4OLYH 3WKML 1Q9OB 5DEGB 3ULVD 4OFDA 1MF2H 4JCWA 3SGEI 4DVRL 3DO3A 4RWYL 3WFZA 4RESB 3VXSA 1THAA 2AJ3B 3HNVL 4NN6C 2K9FB 3LQAC 1BQRA 1N8ZB 1SPDA 3K1KC 5JLZA 5F88A 2BNRA 1WC7B 3QORA 4OQTL 4PUBL 1Z3GL 5D2LB 3QEQB 3T3PB 5LKNA 1QBML 2X88A 4WKXA 1Y0LA 1G9ML 2IOMA 2LAGB 2BWIA 2I07A 3I84A 4WEBL 5F9AC 3GS4A 4CC4A 1JPGA 1XEDA 2DLIA 3NACH 2VYRE 4JY4A 2XN9E 3CQPA 1N3NB 4LEBA 2A9AA 3HHMA 3SE4C 2ZJSH 4P2QD 4MHHI 5DZLA 4WWID 1E4WL 2NY7H 3RGVD 1N64H 3D87B 3D4ZA 4I18B 2O5XH 3MLVL 3QDGB 5E4EB 1INEL 1NL0L 3ZHDA 2XWJB 1U8CA 2GTZB 4A2FA 2CG9X 2Z7WA 3TOPA 1OT4A 3DSFL 1NCIA 4N0FB 3SBWA 3ZDYE 3QXWA 4PTTB 5I73B 3VXRB 2RCSL 1NCCH 3ULUH 3OAUL 3Q2LA 1XGUA 2VMCA 5EU4B 5FYKU 1JL8A 4ZTEA 4WGKA 3TCXA 5FHAL 4IHBA 1JZ5A 4H8WL 5CGYD 4P9HH 3VTAA 5IEHB 3AGVA 4X5WA 1AGBA 3VFVA 1KGWA 2QQNH 4GKNA 2WZ0A 5F7DB 4AG4H 4HC1A 3UG3A 1ZJAA 4MD0B 3CDGB 2R0LH 3ISRA 2Z35B 2OMXA 3WUWA 3VRLF 3MXVH 1U93B 4M29A 3P3SA 1PKQB 5T33H 5CO1A 4EJ1C 4HCRA 1WGOA 3H4HA 1W0WB 3QDMB 1HTYA 4Y2DC 2R51A 2W94A 3HG1A 5D7JC 3MFFB 1QQDB 5AB1A 1XSOA 3E3QC 4R97B 1KJ2L 2AP2A 2F58H 2JLPA 4NPYB 4GG8B 5F3BB 2MPAL 3NFPB 1OT1A 5CXPA 5GS2H 5EUOA 3V6FA 4PJCF 2IDFA 1PFOA 2AJZB 5DK0A 2DW5A 3MJ9H 3OKNA 1QR4A 3OR7B 4XN2A 4HPOL 3CZEA 3S34H 5AUMA 4FFZH 1F11A 4M9PA 3KWWB 1A6PA 1J05A 3PLYA 3L2LA 5EB9A 2OJZH 2VZTA 4H8WC 4U1KB 4K3EL 3EGXB 3GXPA 4GBXB 1RZ7H 2RQEA 4HIXL 9PCYA 4TQHA 2CRYA 3AB0C 2XZZA 1RMFL 1J9QA 4FTVB 1INQA 2LU5A 3EJRA 1IM9D 1W0VB 1D7DA 4JKPH 1UWEL 1E3ZA 2DQFA 4OZGF 3PAVA 2LOEA 5GRUL 4R4FH 4XVJL 1OTTD 4YHZL 3JWOH 3L9RA 1L6XA 1Q9WB 4X4MA 3SGEH 1N0LA 1UKTA 1S7XA 1RIHL 1VGKB 5CFAA 3C8KA 4BDVA 1R33A 4G8IB 4QHUA 3KGRA 3MV8A 3LRHA 4OCNC 4JO5A 1TZGL 3KEHA 2UUDK 3RU8H 4OZ4A 3B7RL 1XCQB 3B9AA 4KJQC 2OKMA 3D5OF 1ZT4B 2NY3C 3D34A 4HJ1A 1P69B 3OXSA 1P5VA 5K59E 3KM2A 2NY1C 3BUYA 3LKQB 4OCRH 4MJ4A 5HBBA 4AM0A 5DT1L 4ETYA 5MEQA 1D6VH 2FHFA 3APDA 4XCNA 3WD5L 4HF5H 3A6CH 1JD7A 4P57B 4PJHA 5GS2D 5ESQB 1Q72H 4PB0H 2ZF8A 1RZ8A 4PYHA 5H4ZA 3VFVB 2Y7QA 1AACA 1ZA6B 5EU3B 5F71A 3CMOL 4I1PA 3PWPD 2YQGA 1Q94A 4M93B 4WW2F 2B08A 2C9SA 5JPMC 1XF4A 3WIFB 1XCWA 3CC5A 3VXSB 5JW4N 1QFPA 1KENL 5AKTA 1PIFA 1JVKA 4N3UA 5DHEA 3O6KH 1AXTH 5D1ZA 5KSAD 3SGJC 4O2FB 5CJOL 4DKAA 3W9EB 4ZX6A 5AW1B 4L9DA 5K9JL 3O4LD 1R3JA 3S5LG 4EN3D 1FZOB 4J23A 1A7QL 3NJHA 4FXGA 4WO4D 2CXGA 5D7LD 3MLUL 4HIQA 5E1GA 3DUUB 1NEUA 4HETA 2E74C 4PGZA 3CN3A 1HSAB 1XXFC 2AJYH 4LSUH 3FT4B 3C6LB 4MA3A 5ESVB 1RUML 2DICA 2ESVE 4F7PB 4YJZL 5BW7A 1JUFA 2ZWZA 4PBVC 4BZ2A 5DUBB 4I13B 1XCXA 4X80L 5L2KB 1DUZA 4NRZA 4YFDB 2ZKMX 4XNZB 4G8FB 1TO4A 3OJDB 4LLDA 4LSQH 1XV8A 5HGHB 3SPVB 3CJJA 3EFOB 1Q1JH 4AC4A 3CQQA 2X4QA 2PXYC 2NCEA 3WMSA 1XGUB 4WTZA 1RUQH 5EU4A 4EDWL 2HVKA 2I26N 2ADFL 4AH2A 5IFHL 4LESA 1GZPA 4U1SA 4XP1H 4XC3L 1F41A 1DJIA 2K1MA 4MQTB 2HLAB 1UJ3B 1AR1D 1JDAA 1WAAF 3SDAB 5BZXA 4JLRA 3UTTB 5E2UH 4L3CA 3U7AA 3QE5A 4A7SA 5LAXA 5J4MA 2V9RA 3QISA 3T0EB 1BF5A 1NCCL 1ORSB 1NJ9A 4JDVA 3JT0A 3M8OH 4XZUA 5GHWL 3VI3A 5ACZB 4JQIL 5C2BH 5HHNA 4J4PA 2Z4QA 4KMLB 4MWFA 5EOTB 1NMBH 2O6EA 3PGCA 2WQ8A 5FPIA 2JB5L 3GMLB 5J1TC 1KBGL 2B0SL 2NR6C 4J2QA 1Z9SA 4MNQA 5MHSE 1W0WA 3QDMA 3VU1A 3PXLA 3LS5L 3ALPA 4I0PC 2DTSA 3T0WA 4YFEA 3V0WH 2XWDA 3EO9L 5EUKA 1HWGB 5TGBB 5AVRB 2ZUVA 2EH7H 1WTLA 1G9MH 1HHJA 1KDJA 1TDQA 4POUB 2IO5A 2RCSH 4F7TB 5J13C 3KGUA 5ICZB 2ZUQB 4MFHA 3WHE0 1BZDA 2YUVA 4ZUTA 2NUPB 1OB1A 4F37K 1F3DJ 1WIOA 2FGZA 3WLWD 2OZ4H 3PNWA 4Y4HC 2VZOA 4OQTA 4L4TE 5CFHA 4ZXBA 2EUWA 5LN8A 3IDJB 3UBHA 2Y7SA 5M94B 2ITDB 3RDTD 3F7YA 4FI7A 5ADOH 1NC4D 1GS6X 5F3HA 3V4LA 4AYEC 3ZE2F 3SDDC 1JNLH 4PBDA 2W88A 3TYFB 3M17A 5IHLB 2QV2A 4LLUB 2XRAH 3STBA 4NQTA 4Y4HB 1IC4H 5E8DL 2KUTA 1ZY9A 3KXFB 3ZYIA 3GT6A 3WY2A 1ZT1A 1TPXB 1WP6A 1WFIA 1OP9A 1TJGL 3TEWA 2Y72A 4KROB 3L95A 1A7OH 1RFDH 4LPVA 5FDYA 4HS6B 2QZ5A 2ICEB 3NJIA 3MJWA 1VZIA 3NN8B 4HJEA 3ARFB 1U8LB 2C4XA 2VLJB 3KHQA 3II3A 4OLYL 3CFDA 3H9HA 4WI0B 5C7ZA 3WKMH 1DBKH 1C08B 3NAAL 4G71B 3FN3A 4X4KA 1QA9B 1BD2D 4HMCA 1SJEB 4PJ7E 5D93C 2QR0B 2XDHA 3CH8A 2VITB 5T1MA 3K2KA 5T1MB 4ANWA 3WEXA 1SLUA 4DHLA 1AP2A 2ARJA 2ZSVB 4RWHA 4E5XG 3C8DA 4JHBA 1OAUH 4NQDD 1QFUH 1U95A 1MH5B 5F6IB 5EA0H 2LAAA 1MHHB 7TAAA 4GAGL 1B0GA 2DQIH 5C0AE 4IIQC 4XXDB 2VXVL 4JN2B 5DGQA 3GSNH 3V95A 4JKLA 1HHHB 2AZAA 1MPAL 2WLLB 4UMGA 3PGDB 1DDTA 4E9LA 1HSAA 2LQRA 3OC5A 5AWNL 3O45A 5DJ2B 2IPTH 2CO7B 2PLTA 4JO2L 3DMMC 5DR5L 1YNTB 4JZJA 3T3PF 1ACYL 3MRQB 1MFDL 5D2LF 3D2UB 3FUFA 1S8DB 2FBRA 3TA3A 5JA9A 4XO9A 1S9XA 4CVUA 4Z6AT 3V4UH 4HF5L 1X5XA 3UPAA 2EDWA 3QEUA 5I17A 1GHFH 1UFUA 1YMMA 4K3DH 3WV0A 4FL4C 4N2HA 3BGAA 4KRNA 1U42A 4HHGA 3SE4A 2EVFA 3DUHA 5E8PA 1OP3H 1T6BX 3P9LA 1BYOA 2WBJD 1PYWB 2BSTB 2WN2A 1XO8A 3BZEA 1VFBB 5D1QA 4MZRA 3RAJL 5J06A 2J2ZA 4FQJH 1WH0A 3JWOL 4JRYD 4IU2B 3LYRA 4GT7A 4RIRB 1TQBC 3A21A 4M00A 3THMH 1LEGB 1SEBA 1AKJA 4MAYC 2JJWA 2ENSA 5LGKA 2YPKA 3GMQA 4G42B 4IKIA 2VXSH 4M8QB 3Q1SH 3KPPA 3DX1A 4UNUA 4ZW8A 4PM1A 3ZE1B 1W16A 4RMSA 4BXVA 1F90H 4MB3A 1NOFA 3U1PA 4NQXA 5G5DB 1CL7H 1NLBL 2W9DH 4AMWA 4LB8A 3NRFA 1FL5B 1AMXA 1BVLA 4NQEA 4JFFB 3ELQA 4JFFA 2PWDA 1W80A 2AGJL 3GD1C 3FT9A 3NOIA 1UD3A 4U3SB 1S9WB 3WFDL 1JNJA 1MVYA 4IM8A 3QQ3A 2AJVL 3STLB 4NCC2 4ZTPH 4OKDA 2HJLA 1XH1A 2RH0A 4P2QE 3MFGB 5AZ2H 3AS0A 5KVFH 4LASH 1UD4A 1IGIL 2UV3A 3HNSH 4XBGB 2F19H 2P5WD 4IMKA 1TETH 1JXJA 1DR9A 3TZVA 3PAYA 4LPYA 4P4RA 5JUEL 3S8WA 3PWNB 3PIQB 1AD9A 4OFIA 4XZUB 3VI3B 4B3EA 4JO1H 3TBBA 1EFXA 2YARA 1N2RB 2BSBA 3G5YA 1E9PB 3D52A 4KQ4L 4OCXL 5FA3A 3MODH 5ABDE 1EEYA 2O5NA 3KJ6L 5D2NA 1ZLVH 1BJMA 1MVUA 4ZFOA 2BW4A 5DD5H 5TE6H 4HFWA 4Y1TA 4F20A 5A2FA 3MKGA 5C0RH 2LT9A 4DAGH 1Q0YH 2IPTL 4UV7H 3EH1A 1EHNA 1X5ZA 4G9FA 4RAUA 4PG2C 2EDDA 4YK4B 5EEYA 2UWEB 1S9XB 4CADB 1T2JA 1C8PA 5C0NC 1OVZA 3VXME 5AW8B 1IKOP 5DF0A 1OOWA 1ID2A 3F6JA 5EZOL 3HAEB 2KPWA 1SLWA 4KK9C 2H6PA 2E76C 2P8MB 3BESR 4KUCD 4L05A 5T5FH 3ZYOA 1FE8H 4JFEA 5CP3H 4O2FA 4I0PA 1JS4A 3UTPE 2V2TA 5ITBH 3BI9X 5HHVH 1TCRA 2XNAB 2IPKA 1AXIB 3I9PA 3M6DA 2X5PA 5B39G 1G1CA 1FH5L 3D4YA 3W39B 1EXHA 3UZEC 3EHBB 2OYMA 2BNRB 5F88B 2RGSA 4XNAA 4PD4J 3UCRA 1L6ZA 2CUHA 2O4EA 3MNZA 1EZUA 4TVPE 4DOHE 4AIOA 4OGQC 3RWFB 3W57A 4OZGA 4HHAB 3MLWH 3F7KA 1VEPA 1V10A 1DQQB 1BSIA 5HGDA 1JFQH 1DP0A 2HN7A 3DX8A 4IBYA 5I1JH 2QL1A 3U0PB 2IQAB 5CD3A 3NEOA 2OTWB 3OR6A 4GUPB 4MJ2A 3OM3B 4NJAL 1HJBC 2EAEA 3ZE0B 3KAAA 3ARBC 3CFDB 4HCRH 2AJSH 4WI0A 4KKBC 2OR9L 4A2GA 1XH0A 2PXYD 3EUDA 3QUYA 5IBLD 2ZUQC 2JXMB 3RTQA 1I8MA 5C0DA 3BLKA 3Q06A 1OARH 4APQB 1B0WA 4HGWB 3LMJL 5C7XH 4AENB 1KB9K 4YZFE 1RUPH 2KLRA 2V5RA 1AQDA 5F7FA 3V9EA 3V5KB 2H3KA 1ZT7A 3VXTA 3FU7A 4R3SB 4TUOA 4G9DB 1F97A 4G9DA 4QO1A 1U92A 4QO1B 5EEUA 1RIUH 3QK0A 1IX2A 4UQDA 1NKRA 4PBXA 4DCQA 1SJVA 4GRMB 3AC0A 5FYJE 3M88A 1CGXA 1S9YA 2DBLL 4M4PA 5K9QG 3JYCA 5ESAB 4OV5B 3C5JA 3QXTA 3HZVB 5EPMA 4DEPB 2IBZY 2AK1L 3AG2B 3MLWL 3NT0A 3DK0A 3Q0HA 4U1JA 5F44A 5F96H 5EZLB 1MCKA 3O3BA 2ICEC 4DAGL 5SWSB 4I0PD 3LKOA 2OMYB 1HI6B 5LGJA 1GL4B 3O8XC 1HHJB 4IW4C 3GSUB 3WTYA 3FS9A 2NX5A 3DX6B 2CWRA 3HZYA 4JRXD 5F0LB 3AWGA 4MS8D 5DVNA 2E7LC 3LHPH 4FP8L 4GFTB 4ZOCA 5KW9L 4OLUH 3VGDA 1QEXA 4E9WA 4P3CL 5BQDA 2BNQD 4UIKL 4UM8A 1KJVA 3TNNB 4DPCX 4PGCB 5JO5A 2HTLC 2OW6A 2YUXA 1E67A 3QQ3B 1OLLA 1OTUC 4PQXA 4AVHA 1T1WA 2H0JA 3I75A 5ENWA 1LEKA 2CKBA 5BNXD 3IAPA 3MV7A 4NENB 4EQ2A 2FBJL 2A1WL 1T3FA 1XSIA 2AJXH 4HLEA 1B9ZA 3B83A 2V9TA 3WTUA 2D7TL 5B8CB 2BX5A 4MB4A 4ZO6A 4GYBA 1R5VA 4Z7QB 4BKSC 4O4YH 1YPZE 4U31A 3HI5L 4XP5H 4ENZA 3AT8A 4GO8A 1RUQL 2YC1A 3LXUX 1P7QD 1VB9A 2YN5A 4L5FL 1YDPB 1KJ2A 1AY1H 2NTSP 3MX0A 2Y22A 2VXQH 1CL7L 2XIDA 2YUZA 3H3PH 4JZNB 5AVTB 4ESKA 4QRPA 4WWNA 5C0FA 1OW0A 1I1AC 5HD8D 4BKLB 2F8OA 2D7OA 4PJBA 2VXUL 3DJZA 1M42A 1BDYA 2XPZA 4WKZB 3VFPA 1TYEB 1WZ1H 3KLHC 5KSAC 4GRLA 2NX5E 4R0LA 3UP1A 3D25A 1NIBA 3K81A 3RY4A 1NGQL 4LLWA 3HMXA 4HBCL 4UQCA 3ALWA 1KC5L 2FAUA 3L08A 1D5ZA 2IAND 1ZANH 4DGIH 3GTTA 3FYEB 1OD9A 3CFIC 4PY7B 3UAFA 4QRPD 5J7CC 3P73B 4XPAL 5BUGA 5BPPA 3ZU8A 2I9LB 3FAXA 4XNQA 4X5QA 3U48A 2A74A 5ECJE 3GXTA 4L3ED 3SEPA 2LHAA 2YN3A 1XIWC 5I1LB 4YO0B 2A2QT 2MNWA 5B7MA 2XN1A 4LPUA 2WLLA 3KYOB 3QHFH 4PI0A 4WDIA 3IJHA 5TDOA 2V3EA 3ARDA 1U3JA 1BZ8A 3THML 3B2UD 1MUJB 2NYYD 3RA7H 3SSGA 2BRRH 3UAJC 5E2VL 4AL8L 1EGJL 1BQ5A 3AY2A 4JRXA 4GW5B 3RWIB 1T89A 3TT3L 1SN2A 4XX1G 2D7MA 3MAWA 5D1XD 4DP5X 3NCFB 5CBAA 5I0WA 2EABA 2YPKB 2ZX7A 3VI4A 4UYQA 1SHSA 1XD0A 1HNFA 5GSRB 2G5UA 3HW7A 1DTUA 1QFUL 4JFDA 2PO6C 2J1YA 3L1OH 3HG3A 4MQ7B 4NZFA 2A9DA 4YFLI 3UERA 3QS3A 3EOBB 4WWKB 5A43C 1IC7H 4H2CA 1JVOA 2NSMA 2J44A 1KB9J 3O4OC 4XNMA 5IB5A 4M3HA 2JKNA 3L3DB 3SKJH 3VE0A 1I1AD 4YXKL 3FU0A 3IKCB 4WSKA 4LCWD 3BP6A 4D0DB 1AZNA 1BJ1H 3ECBB 1VGEL 3KS0J 1U8OB 2HB0A 2AITA 5E4OA 1G43A 4R26H 1I3VA 3QG6B 2DLGA 3ILQC 2VTFA 4JKMA 2HH0L 5DVMA 1I3RB 4MXWH 3VFTB 2P47B 2P4AB 5AW0B 5AAMA 1K85A 2NLJB 5FHBH 4G8EA 1Q0EA 4X7FC 4HU2A 4XOAA 1RZ7L 2H0PA 5A6LA 5KJRH 2MOVA 2PO6D 3KMDA 2W65B 5INCA 2EIZA 1LEIB 3LNFA 4JN1H 3AAZA 3BYTA 3MROA 1L3WA 4IBSA 5F70A 1D2OA 1B4TA 2NXYC 5GSVA 5A40E 3CH1B 2BS8A 2FT8A 4H8UA 4DO6A 4PAZA 5L8KB 1J8HD 1F5WA 2IH9A 2DMHA 3TBYB 1PLAA 5FK9A 3P0VH 2EEAA 4GG6E 4QOKB 4PLJC 4UILL 4Z7AA 5FCUL 1NCJA 5JMRA 3U2SA 1QBLL 1T03L 1J8KA 5EZLA 3K71B 1EO8L 1BF2A 4JFWA 4DUWA 4Y2OB 4HZLA 5J6SA 3BKCL 1DBKL 5I9QB 1OGAD 3CFKA 3MBWB 1HOEA 3MBWA 4LQFL 4QCIB 4QCIA 4P46A 5CGYC 1X9LA 2APWA 3P4NA 2G3ZA 1I8LA 4PRAB 4PRAA 2X4SB 4KQ3L 3TH2T 5JXAH 1YEFH 3IJYB 2R7EA 4ADJA 1OSZA 4Z0XA 1ZV5A 5FYLD 3HJ0A 2AXGA 5CGBA 3OHXA 4Y5YB 2LE9A 3BQUB 4KRMB 1A7NH 1NGXB 3KBEA 3LKPB 3QG7L 4MYPA 3BVTA 1NBVL 4EEEA 1CI5A 3F58H 3KS0H 4UIMB 4W9EC 4Y9BA 4MD4B 5DHVB 1JGEA 1JNLL 3EO9H 1P4IH 1S7RB 3O9WC 4G6AD 1F4YH 2X9ZA 1NBVH 1DUYB 1KIUA 2NT1A 5C0AD 5A6IA 2VUKA 4YDKH 1Y1DA 5AALA 3CZNA 3JV0A 5AVUB 1MSPA 2E9IA 3DETD 2BSDA 3IDGA 5ERWB 4G43A 1GYAA 3DWTA