4KO7A

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/w48f/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48F/V95I)
rcsb
source organism Pseudomonas aeruginosa
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ko7A00
1A3ZA 1BXUA 2XV0A 4FA7B 1CC3A 2GSMB 3NJFA 5F7BA 1SFHA 2HLEB 4JHVA 1VLXA 4YSAA 3G5WA 3NJMA 3BVDB 1ADWA 2FQFA 5B1AB 3WNIA 1AANA 8PAZA 1URIA 1M9WA 3FYEB 1TU2A 4YSRA 3V9CA 2H47C 3EH3B 1SJMA 2B3IA 4N8UA 1NIBA 2X88A 3S3DB 3FYIB 4M4RB 1KYAA 4E9QA 3NSYA 4BWWA 4X4KA 3ERXA 1OCRB 5D4IA 5I5IA 3NP4A 5B1BB 3FSZA 2I7SA 1TEGA 1NDTA 1ID2A 4PAZA 1JXGA 2EINB 2NRDA 4HZ1A 3NT0A 2XLLA 3RYMA 1KCBA 4NERA 2FT8A 3GYRA 2IDTA 4DPCX 1RCYA 2JKWA 5B7EA 2UXTA 2P80A 1J9QA 1L9TA 2BZ7A 7PAZA 3D12B 1L9RA 3NJNA 1NWOA 3X1FA 1JVOA 3GDCA 3NSDA 3ASNB 4E9SA 1JXDA 4UANA 2GBAA 3FS9A 4AZUA 1SHWA 1DYZA 1OV8A 2DWTA 3L45A 4DP6X 4A2DA 2YQBA 4G72B 5I6OA 2EIKB 2TSBA 2YAEA 5I6NA 3U25A 1BQ5A 4RH4A 1KV7A 1M57B 3QQXA 3QJVB 4ZK8A 1PCSA 5B1JC 1GSKA 2PP7A 3SQRA 1B3IA 2FT7A 2PLTA 1X9UA 4HALA 2EIJB 1BYPA 1KCWA 2WO3B 3UACA 3WNJA 1XB8A 4KO6A 3UGEA 2FT6A 2FNWA 3FU7B 3AG3B 2GI0A 3QJSB 3N2JA 3QJUB 2JXMA 3JT2A 4HCGA 1NINA 2VSKB 3KW8A 4Q89A 1JZHA 2J55A 5I28A 4KO5A 1NICA 4A2EA 3NJHA 1A65A 1GW0A 1OF0A 3OQRA 2XU9A 5PCYA 3OMIB 2W88A 1OOWA 2BW4A 2ZWNA 3FSVA 3WIAA 4AX3A 1WAEA 4A68A 2DYRB 4YSCA 1JZFA 2RACA 2HX7A 3FU8A 2LLNA 1TKWA 2UX7A 2BP0B 3H56A 4E9YA 2GC7C 5B1KA 1W6LA 2ZXWB 4E9RA 2R7EB 3EH5B 1N70A 2ZOOA 3CDZB 2XXFA 4G7QB 3OM3B 1MG2C 1ZDQA 1PNDA 2FQEA 3FT0A 3PAZA 1QHQA 3T71A 3FQ1A 1CYXA 6PCYA 4TXVB 3UAAA 3FSAA 1RZPA 4BDVA 5I6LA 2BP8B 1ETJA 3AG1B 3UADA 3X1NA 1FWXA 3MX0B 2CBPA 1CUOA 2YXWA 4YVNA 3EHBB 1NZRA 1E5ZA 2IDQA 1V54B 2XX1A 3ZDWA 1EHKB 3S8GB 2MTAA 2XX0A 2Y1AA 2CUAA 1KBVA 1SDDA 2CALA 2YAFA 2FQGA 1AS8A 3NSCA 2OCCB 1EZLA 3ASOB 3HB3B 3ABLB 1XB6A 2XVBA 1JERA 2W8CA 2AZUA 4UAHA 1ILUA 1A4BA 2XV2A 4N4YB 2HRGA 3FSWA 4YVUA 3AY2A 3SBQA 1E67A 5FC9A 4EF3A 4ENZA 1BYOA 4BXVA 1ASQA 2VW6A 1L9PA 2YAQA 3NJLA 4A66A 1GY2A 2HX9A 3CZUB 4JHUA 4WKXA 4QLWA 1AZNA 1A4CA 2I85A 1BQKA 2XXGA 1JXFA 1GR7A 4YSTA 2YAHA 1E30A 4FAAB 1NIAA 2IH9A 2YAMA 3NJKA 4HHGA 1XB3A 5IY5B 2PCFA 3WKPA 2QDVA 1A4AA 1MZZA 4G7RB 2QPDB 1NWPA 2PPFA 2YXVA 4MFHA 3C75A 1KGYE 4DP2X 9PCYA 2VM4A 2OJ1A 1ZPUA 2VW7A 7PCYA 4F2EA 3NJGA 2PPDA 2BWDA 3X2QB 2XYBA 4GP8B 4YSOA 3PXLA 1V55B 3N55A 4HAKA 2CJ3A 4KNUA 6PAZA 1ET7A 1HAUA 2IDFA 5D4HA 3TU6A 2J5WA 4NB7A 1QLEB 1J5CA 2UXFA 1J9TA 2FWLB 3IBOA 1PZCA 1PF3A 5B7MA 1JZEA 1MZYA 1NPNA 3EF4A 4AI7A 1OE3A 1AZRA 3PPSA 4PCYA 4KO7A 3MBWB 1BXAA 1A8ZA 5ANHA 2PP9A 3OD3A 2EIMB 3TBCA 5F7AA 2H3XC 4KNSA 5TK4A 4E9WA 5I6PA 2H5UA 2OV0A 2E86A 1F56A 2HZHA 3FQYA 4G71B 3TA4D 4DP8X 2PPCA 2YAPA 4YL4A 3T9WA 1XMEB 3GXUB 3H4FA 2HXAA 1ZDSA 2YARA 2IWEA 3TASA 3NSFA 4W9ZA 1PZAA 2AFNA 2Q5BA 2PP8A 1PNCA 1AACA 1KDJA 2DWSA 4KOCA 3UABA 2VN3A 1GYCA 5B1JA 1ET8A 1T5KA 1L9OA 1M56B 2BWIA 4M3HA 4YSEA 4GP5B 3ABGA 4CSZA 1NIDA 2IDSA 4DP1X 1AS6A 1AS7A 1JOIA 2BZCA 5PAZA 5I26A 1PZBA 5AFAA 3WI9A 1DZ0A 3S3CB 3ZX1A 1IKOP 4YSDA 2IDUA 1BQRA 2P80D 3QJTB 3IN2A 1AZBA 4GXFA 4BWTA 5E9NA 3QJRB 2QT6A 1NIEA 4G70B 1QNIA 2TSAA 5I6MA 2EILB 3T6ZA 2J57A 1HFUA 4DPAX 1BXVA 2AVFA 2ZONA 1IUZA 3T6XA 2MRYA 2B08A 1HAWA 4YSQA 2PPAA 1NIFA 1GS6X 1W6WA 1TEFA 1WA1X 1OE1A 4AKPA 1OE2A 3DIVA 5B7FA 2VW4A 3FPYA 3JTBA 1R1CA 4E9XA 1IC0A 4GY4A 2X87A 3S8FB 2Q9OA 4BK5C 2UXVA 2GIMA 1OCZB 1IBZA 3FU9A 1MDAA 1RKRA 5I5JA 1PLAA 1ZIAA 4G7SB 1AG0A 2WSDA 4A67A 4L0PB 2XV3A 1SFDA 1AAJA 4BXSV 2CAKA 3PAUA 3CG8A 3FPXA 2DV6A 3AG2B 4HCFA 4W1TA 3FU7A 4KO9A 1AZUA 3IEAA 1AQ8A 3WKQA 2WO2B 3X1EA 4AKQA 3BQVA 4WTQA 1ZV2A 4DPBX 1X9RA 1OCCB 4HIPA 5B3SB 1SHXA 1JZIA 5I6KA 1BAWA 2BO0A 4F2FA 1SF5A 1RZQA 4NAJA 1L9QA 3ABKB 3X1GA 1YLBB 3PLYA 3X1BA 1E5YA 2DYSB 5AKRA 5I5MA 3T6VA 2BHFA 4UF7C 3ABMB 2FJSA 2HRHA 4BWUA 2BW5A 3PCYA 2CCWA 1NPJA 1NTDA 2XWZA 3S3BB 4HCIA 1SNRA 5D4JA 1GS7A 1ASPA 3NP3A 5A7EA 1AOZA 1PLBA 3KW7A 2BP0A 1KBWA 2GB2A 4DP4X 2FQDA 1J9RA 3NJIA 4BDVB 4YSUA 4P5SA 1SF3A 2R7EA 1ZIBA 2A3TA 3CVCA 4AKOA 3IN0A 3QJQB 3SBRA 3CVDA 3CDZA 4A2FA 1GS8A 3NJJA 4A2GA 1JZGA 3NYKA 2GHZA 1AIZA 3DTUB 4E9VA 1FA4A 1L9SA 3ZBMA 2N0MA 1SDDB 1CYWA 1PMYA 3V9EA 4KOBA 1BEXA 3AG4B 2YAOA 2GC4C 2BP8A 1I53A 4DP0X 2IAAC 4DP7X 2FTAA 2HX8A 2VM3A 1IBYA 1KDIA 2QDWA 1N68A 1WA0X 1JVLA 4DP5X 3DKHA 4P5RA 4K9JA 4YSSA 4KNTA 2VMJA 3TBBA 5TK2A 2AZAA 4Q8BA 2AANA 4YSPA 3PAVA 4CSPA 4F7KA 1J9SA 3CVBA 5LDUA 2I7OA 3AW5A 1V10A 3UAEA 4A2HA 1MG3C 2J56A 3AZUA 4GP4B 3T6WA 4HHWA 3EH4B 1JZJA 3OMNB 2UXGA 3FQ2A 4DP9X 4JKNA 2VSMB 1PY0A 1CURA 1J5DA 5AZUA 1ASOA 1AG6A 2UX6A 1OCOB 1FFTB 2XUWA 2IWFA 1ET5A 1PLCA 4GYBA 1AR1B 1UATA 2IWKA 3IE9A 3QPKA 3OMAB 3HEIB 2DY2A 2Y69B 2PCYA 1ILSA 1WS8A 2IH8A 1PAZA 2PPEA 2QPEB 4E9TA 1WS7A 3SBPA 1E65A 3ZIYA 4QKTA 3H4HA 5EHFA 3WG7B 1W8EA 1WA2X 1AZCA 1GY1A 2JFCA
chains in the Genus database with same CATH superfamily
3C5JB 2IMNA 4CDGC 1XQ4A 2OMZB 5INDB 1KTLA 3N44F 2FVNA 4L3EA 4TNVK 2YRPA 4JGJA 2J1YA 3LPPA 3FW6A 5J3HC 3NJMA 5IW6A 4XOBA 3PJSA 3FOMA 3EFDL 1ICTA 1DQJB 1JN6A 2CO4A 3SE3A 5JA9A 2OCJA 1RU9H 2APTA 5JZ7D 4YSRA 3T8XB 4WTWA 4WI9A 5H2BB 4K9EC 3QG6A 3EYSH 4XCFH 4NN5C 1JYXA 5C0BE 3K2UL 4IQHA 1LEIA 2FRGP 4ZOCA 5LJYH 1IQWL 2OMXB 1NMAL 2NUTB 1WCBA 3JSSA 1W0YT 5GRVK 1S9WA 3NP4A 3NTCL 1C1EL 2Y0SA 3FSZA 2DQTL 3EJRA 4LCCB 5AVSB 3NH7H 5GGTL 2VDOH 3EYVB 4YUEH 4M62L 1R5WB 4OLEA 4JPKH 4OLZL 3TJEL 2DI7A 2OQJB 5A16A 43CAB 1RPQA 4AEHL 2ZJSH 3BW9A 3TBSB 2QQNH 5HTSA 3S37X 3GQFA 1HJCA 3WTWA 4O2CB 2WQ8A 3AQZA 3WNKA 2M1KA 1KSRA 3GMOB 3QQ3B 2SODB 4OM0L 4WY7L 5EOTA 4QRAA 2XOTA 4S0TD 1NANI 1IGYA 1DQVA 4JM2B 4K5MA 4Z7OB 4OFYD 3P30H 2P5PA 4KJQD 1U8LB 2QVIA 4QIRA 1IQDB 3VH8B 4R9HA 3CQPA 3LIUA 4ZFFA 2OX5A 1XBRA 4S11A 5CEXA 3LZFH 2KC0A 2PO6A 3N04A 5F0PB 4LQFL 1U4FA 2E9JA 1Q0EA 3WE1A 1NKGA 1WO2A 4TYUA 2WO3B 4B3EA 5DK2A 5AYQA 2P49B 4P2OB 3V7AE 5FYJU 4O9HL 4JRWA 1JVKA 4HFWA 3O2VH 5C09B 3DRTB 3HLAA 4L4VB 5ECGA 2JK5A 4BFOA 4L29A 1KLUA 2JI3A 4P5TB 2ERJB 4KO5A 4P2OD 1TZ8A 4RLDA 1LK2A 2FX7H 2Z7ZA 1J0HA 8FABA 4XN8A 2EDWA 4N2MA 3RL2B 3C08H 1OF0A 5L7XL 5C09D 3TN0B 3ARBC 4FA8A 4L4VD 3F04A 1CBJA 1C08A 4G6AC 2HLAB 1OT1A 3BUIA 3MGTB 1PLGL 4P5TD 2WLIB 4FXKB 1HWWA 5HYJE 1FZKA 1KUMA 3FSVA 4WHTA 1U6AL 2O5NA 2DRUA 3FCSB 2AJVH 2BRQA 3TN0D 3QC6X 5JIKA 4OF0A 4N0YL 1U8QB 1JZFA 3BKYH 4D0DB 1E9PB 4JJ5A 4MMXB 2BP0B 3FMGL 5F89B 5FF6A 3KE0A 3PJNA 3N0AA 2HKHL 3SDCB 3QVAA 4JN2A 3HNSL 1RK1A 4P9HH 3C2AH 4ODUA 1D5RA 1ZPLA 2BSRA 2OMVA 1A14H 2J8OA 5AUMB 5SWQA 1RJYB 1TTRA 4HJEA 3WLBB 5JOFB 4G6ML 3C5SA 1MG2C 4Y4FC 3V6BR 3WLWC 4ZMNA 2V7HB 2VWEC 3SDCD 2R1WB 4FULA 3BWUC 1UXMA 5IB4B 2F53A 3INOA 4NNYB 1RU9L 1WAAA 5F21B 2BP8B 2B39A 3SGDI 5E4AA 4GO6B 3Q13A 1B6DA 3EYSL 1FIGH 1M05B 2W07B 3LS5H 3QI9C 4R7VA 4WNQA 4UBDC 2JKXA 3S98A 5D7KE 3EHBB 3VFRB 3GHEH 3SGEI 4AYMC 4RFOH 3UBXG 4F7MA 1DVTA 5FM8A 1YC7A 3ZE0B 4BE5A 3OB0H 2OI9C 2X4TA 1AS8A 4MNHA 1UXSA 5GRJH 3CVHA 3WMSA 3VSTA 3EHBD 4NRYB 3DC0A 1EH9A 3NH7L 1JGEA 2VDOL 4YUEL 1C7SA 1CU4H 1QSFA 1EXUA 4NBYB 3RUGA 4Y4FA 1BVNT 4YDLB 2XZQL 2ZJSL 3QS3A 4LO9A 2QQNL 1K6QH 5B1CA 5FDWA 3KPQA 4UQ3A 1T0NB 3ETBF 3DYPA 4ZOAA 2I85A 3NVQA 4A7TA 2I9TB 4QT5B 3QI9A 5GZND 1LM8V 2ZG2A 3G6AB 4P59H 2HJLB 5DZVA 1I3GH 4Y19A 1IVLA 3MV9E 5IFHH 3GTTA 4G9DB 4UYQA 4PJCB 3RDTC 1MZZA 5I17B 4POZC 2ITCA 4KV5F 3P30L 4JY6A 5D1XD 2VM4A 1OHQA 1BF8A 3DRQB 1U2YA 2PPDA 2XWBA 2M83A 2QZQA 4N2CA 4XWOD 4F2EA 2BVPB 3RBGA 2E7DA 3SPVB 1UA3A 5B39B 4P48A 1MFBH 3M1BA 3N55A 3LZFL 4LAJH 3QNZA 5I23A 4WFFE 3DX1A 3P54A 4K8RD 1T3FB 5EMYA 2EXYD 4M7LH 1PFCA 1NFDA 1OTTC 4J2XA 1T66C 3GZOA 1GZQA 2UVFA 2V4LA 2Y4SA 2UYLA 1JWUA 2Z34A 2VZ3A 1MW3A 1MIEH 3IBOA 5JQIB 4ZFOL 1N0LA 1PZCA 5C07B 3BRFA 4AQ8C 3I6LE 1OE3A 2WOBA 3PPSA 2Y2WA 5F8RC 1NFKA 5GJSH 2FX7L 3RDTA 1MRCH 3C08L 1DE4A 4M7JH 1ZTMA 4RGNE 5C07D 4NP9A 2B0SH 2XV6B 1JGUH 3I02A 2CIKB 3OJ2C 2VB5A 2E86A 5F6HJ 4Z18A 1H9DA 2VDOB 1NBQA 4PWIA 5HDRA 2Q86B 1LMKA 4O58H 4QO1B 2X42A 3BN9C 1XWVA 3HR5A 5KBKA 2AJVL 3KNBB 1ECZA 3QNXA 3B2DC 3DJZA 2YARA 3HNVH 1RSFA 5A6IA 1F6AA 3BKYL 5HYSA 3M86A 3P77B 1AOHA 3FQRB 5E08H 5KAQF 1TNMA 4U3XA 1ZK9A 5L0QC 4WWOA 1KJ2A 3NZ8A 4P9HL 4TQ8A 3C2AL 4YDVB 5JUEH 5JHBA 1JDAA 1A14L 2BRRH 4AQ8A 1SDAB 1LE5A 4BQBA 3BAWA 2G5BB 5I74B 4DQOH 1N18A 4ZRGA 2HRLA 4HMCA 2EVIA 2YQ2A 4GSDH 2P8MB 3UP6A 3S3CB 5H4YA 4IBYA 1X7SA 2VISB 4JRXE 4Y2LA 4EUPA 3BAJA 4YSDA 3CMOL 1ZT1A 3DUSA 3QJTB 1O75A 1FIGL 1G4MA 2ZWZA 3LS5L 4BV1A 2E75C 3IWVA 2QVMA 1ACYH 1N19A 1JF1A 2WYZA 1SVCP 4RFOL 1E4WH 3C6SA 2WXQA 1KIQA 1DDHB 2GJPA 2ZAGA 4BCZA 1B4TA 2J57A 4YHIA 1BXVA 3BYYA 2A83B 1UEMA 2VR8A 5GRJL 1FDLH 4MHHG 4X0NA 2CLRA 2OR8A 1P53A 3TBTB 1MHCA 3QRBA 1ORSB 1ZSDA 4ZFOB 3REWA 4MDIB 5C0BA 2Z92B 1GS6X 1ACZA 2CRMA 2WMPB 1CU4L 2ICWB 4ODSH 1YY9D 2AJZA 3G6JB 3E7JA 3DMMC 3EJYD 4Z9KB 3FPYA 1BZ9B 1XCTA 3IETB 3ZKXC 1K6QL 3FFDA 4N9GB 3ZHLA 2XWTB 3K4AA 2HG5A 4M29A 3EO9L 4HBCH 4L9LC 4NO0A 4KH2A 4KKRA 3OJVC 4P59L 1RKRA 1I3GL 1X6LA 1MFVA 2JI1A 1KJMB 3C9NB 5C7ZA 3GMLA 2CDEA 2P7TB 3ATBA 4F58L 5J12C 1RP8A 1GHFH 3FU7A 3H9HA 5DI8B 4ALAC 3BFOA 4IMKC 1QBLH 3DJ9A 4XGZB 4HHAB 3A6CH 3HCVA 5IW1B 2FJFA 1MFBL 4Z7OE 4YPGA 1KXQE 2MIZA 4XMUA 3ROOB 3D0LB 3DMMA 3V0JA 4GRMA 4M7LL 4NAJA 4BFJA 3BVNB 4GBXB 1SYSB 1NBCA 5M94B 1MY5A 1FVDA 4L1LA 4C4KT 4XMVA 2YPVH 1MIEL 1PDKA 3F5WB 5DXWA 3PU7A 2LHAA 4L9LA 4OCRH 4EXPX 5EZOH 4GBXD 4YBLB 4NZFA 4PRAB 4PJEE 5GJSL 1MRCL 4MB4A 1CFBA 4N8PA 5FHAH 5F6IC 1U8MB 4M7JL 5C09E 4FD0A 1SUJA 2B0SL 4IMKA 32C2A 1JGUL 1LWJA 1CICC 1MW0A 1SYVB 1T04B 1CIDA 1S7VA 4BINA 3ULVE 4WFED 4DZBB 1LGVA 5ITBH 5ACMA 1ZHBA 1TU2B 3T5WA 4EBQH 1I1CA 2DLFH 3VGDA 1J1XH 3HNVL 4Q4IA 2X4SA 3HJEA 5ITFA 4X4XA 5K9QG 1CVSC 3QYCA 1HYSC 5CU5A 5E08L 3V0FA 4NZJA 3I74A 3KLDA 5DRWB 1KN2H 5B4MD 2QDWA 3ZL1A 2NSQA 4DP5X 1Q9LB 4UOW0 5JUEL 1XGPA 2GSIB 4WU7A 4K9JA 2BRRL 4ZFZB 3U9PH 3O9WC 5DJ0A 4DQOL 4YSSA 3TJHC 1XHHA 4B9GA 1JGDB 4G6KH 3QBTB 1CDUA 2J2ZA 5E94B 4OZHB 4GSDL 2E27H 1J0JA 1P9MC 3RPIB 3GB7A 2YD6A 3CXFA 5JHLA 1UD5A 4J5VA 1SY6H 5HGBB 2DQEH 1PD1A 2C5DC 3M7OA 3NFNB 1BQSA 1RFDH 2IADA 1ACYL 4YNYB 1E4WL 3W0WB 5DUBB 4Y5YB 1EUUA 1R5IA 3OWEA 4JKNA 1GCYA 1OGSA 3IMBA 1FDLL 1FLTX 1NEZB 3CJJA 4FYSA 5F3FA 5AZUA 1SVZA 5E8OA 2VOTA 1AG6A 1BJMA 3W0WD 3ZE0E 1KZYA 2UUDH 2NPLX 4ODSL 2DM7A 5AW9B 3NESA 3QUYC 3SPGA 5C6TH 1TO4A 4GAGH 1TSRA 3P3RA 1P9MA 1CFQA 2WXIA 1KGCD 1JCVA 4HBCL 4JPQA 1BFOA 5FCUL 4BFKA 4YZFF 4E9TA 3NZUA 4D8OA 1LO5A 5CJXA 1WRFA 1ED3A 1JHLH 1KPUB 1SMOA 2IO5A 4HWUA 5CEYA 1A66A 3V4LA 3L9BA 4S1DC 4XPGH 1WZLA 1SEBA 1BXUA 1XF5B 1T22A 5F88A 1GHFL 3LRKA 5D1XE 1Q90A 4MMZB 1QBLL 4JHVA 5J6SA 3DHPA 1J5IA 3A6CL 3HR6A 2WNKA 3MV9A 2DM2A 2DD8H 1NAMA 5D70H 1AANA 4W6YB 3V9CA 1EEZA 3QUYA 5F1IB 1KB9J 4RGNC 3BZ4B 4XCEB 4Q6KA 3NIFB 3UZVB 4NWUH 4M4RB 1Q9OB 5EO0A 2YPVL 4LGPB 4BWWA 3APDA 5BOJA 4OCRL 1E5CA 3F84A 4LHJB 4A6YL 4RQQA 2EXTA 2ZICA 3GBDA 4QYOA 5EZOL 3VVWA 4I1NB 1S9VA 3UOAB 2R27A 1AR1C 2I7SA 5KW9H 2EDHA 2VUYA 2X09A 2VYRE 4JVWA 5DWUH 1R3IH 3F6IA 3MCG1 5FHAL 4Z77B 5C07E 1I3RA 2Z31B 3QO0A 1E2VA 3QYNA 2ZPKL 3QT2A 3VU2A 1RCYA 2UXTA 3IGAA 5ITBL 1IFRA 2RR3A 3VXPA 3PF2A 4EBQL 2DWEB 2DLFL 2EDQA 4ANVA 2BNRA 1J1XL 4ZNEA 4MD0B 3ALXA 5E9AA 2PETA 2XTLA 3I50H 2X6MA 5JZ7C 3RY4A 3BUBA 4HWNA 1UA6H 2FHBA 2E0PA 4MNGA 1KN2L 3LNGA 5E00A 4TLUA 2H0PA 1T2QL 4X98A 3CN0A 3IJHA 3U9PL 1TDQA 1WP6A 3MCKA 4OR1A 3GO1H 5DVMA 4XC1H 2FHFA 2G3XA 5DD3L 3EADA 4DHLA 3ATDA 2E27L 1KV7A 4JGUA 3MTRA 4K3EH 1ETZB 2VRAA 5CD5D 1JDCA 1GSKA 3BZDA 4ZAKA 2HFEA 4K4KA 1SY6L 3VD5A 2DQEL 3P9WB 5CP3H 4RNRA 5L4FA 2QHLA 1X5FA 1JXKA 1HQ4A 4LCCC 1EAPB 4YHYB 1E40A 2WN2A 5FB8B 1QFOA 1NINA 2JJWA 3O11B 2IFFH 4JRXA 5HJBA 2YIHA 5DMKB 3CFDB 3VE0A 2XG4B 2OMZA 3IMRA 2C3XA 3ZK0A 5FYJE 4A6YB 5B21A 1MN4A 4D9LH 3PDOA 2XU9A 3UTQB 1M1SA 4FQHA 4XE0A 2WKOF 4FG6D 2R51A 2W88A 3T8XA 3T0VA 5C6TL 3ZTJG 4WRLA 1MKFA 1ZWIA 2X5PA 4KJQC 5JMOC 2XBZA 4GAGL 5K59F 2AS5M 3IKCA 3CHRA 4B95C 2QEJA 4L8SA 3FNKA 1WAEA 2ZTBA 2X1XR 1RIHH 5ICXB 1A6TB 2NUTA 2BHZA 4XN2A 1JHLL 2JCCE 5KUKA 2BC4A 2IBZY 4RAVB 2AQNA 4U3HA 4XPGL 2Y23A 3DJSA 4X4ME 1DJHA 2ZOOA 5BO1H 5AAMC 2ZSVA 2OQJA 4PUBH 43CAA 4FZEH 4ZMQA 1PNDA 4HWEH 3GLEA 2GY7B 2GJRA 1VGKB 2CDGA 1BVKB 4L8DB 4CL7A 4GKOA 1AJ7H 4XR8C 1TIUA 2DD8L 2ZYIA 2WXMA 4P2OC 1UASA 5D70L 3UAAA 3FSAA 1URZA 4CVXA 3S88H 5CWSA 4YXKH 4MQSB 5DJ8A 4YDMA 3WFDH 5DS2A 2X0WA 2XNAB 3HG2A 3EFFA 3QQ3A 1NZRA 4NWUL 4P5TC 2ERJC 3KBFA 1EFXB 1I7TB 4PRNB 1AGCB 3TN0C 1JS4A 1NCCH 4XCNB 1GAFH 1KXQA 4HSCX 4L3FA 3WU1A 4FXKC 5KW9L 5DWUL 1R3IL 3FSWA 5AAMA 2HJKB 2Y2YA 4HD5A 5FC9A 3H8NA 1BYOA 1MAJA 3NJLA 2YAQA 5DZLA 3KWVA 5CBEB 2C3WA 4OCSH 4OU3A 2VXSH 4WFEE 4MMXC 3BH9A 4P2OA 4PJEA 5TD4A 1CDCA 4JHUA 2L04A 1K9TA 4WKXA 3SDCC 3OWRA 4OJEH 3KLHD 3QH3A 4JS7A 5C09A 1I9RH 4JGMA 2IH9A 4DQAA 1TMQA 1UA6L 1FG2A 2QSVA 4P5TA 1JZ2A 1X5GA 3ESUF 3IMSA 1SN2A 2Y5TA 2M2DA 4D0BB 1XGRB 3CN2A 5C0RH 5C8JB 4WI7A 3CZLA 3TN0A 2A9BA 4Y4HA 1OAYH 3NFPB 2HLAA 3WO4B 3GO1L 5GGTA 4FXKA 4XC1L 1ZE3C 3GIZH 2YUWA 1G7HB 2VXUH 4K3EL 3EHBC 1Z7JA 4KNUA 3FCSA 5FUZH 4YHKH 5DJ2A 5KYNA 1OKEA 5C86A 1OLLA 2BOCA 3E3QE 2J5WA 5FM5M 2DJUA 2AXWA 3R1GH 5EFIA 1E9PA 3MJ9H 4MMXA 2G3NA 2QKIA 1MCFA 3I6SA 4OZHE 4X6DF 5F89A 3ZGIA 3EJCA 5LVEA 3DK2A 3P4MB 3H53A 2Q20A 2V7NB 5DA4A 4WGKA 5ETUA 2IFFL 3O81A 4KUZH 2FSDA 4QRQA 3WLBA 2WIMA 1CE1H 2N3JA 3K6FA 3QZWA 1ROCA 2RH0A 1BXAA 4YDLC 2PTVA 2ADGB 2PP9A 2R1WA 2CHXA 1BWWA 3JTTB 3MKGA 2GTWB 2OP4H 3B83A 3R0NA 1AQHA 4OGYH 3UG5A 2I9LA 2UY6B 2YK1H 2ADIB 3IFPB 3WDJA 4ZODA 4HD9A 3VX0A 5D1XC 2GFBA 3UZEA 3VFRA 4DP8X 2C8NA 4XWOC 2L7UA 1ZXKA 1KGCE 2H8PB 3SHSA 3H4FA 1ZDSA 2FJHB 3GBNH 3N42F 5BPPA 4R7XA 4FXGC 2OMYB 4K8RC 1QUNB 2EXYC 4UOZA 2V5RA 1AACA 1OWWA 3B43A 4J3VA 1QNZH 5DFVD 5BO1L 4ZMPA 4YSEA 3JZ7A 2Z8VC 4J1UB 4PUBL 4QHUB 5C0IA 2YEZA 4FZEL 5GZNA 2A7BA 1QYGL 1AJ7L 1NUFA 4IKIA 3AMKA 5BUPA 1SQ2N 3DARA 3S88L 4YXKL 2IJ0C 3WFDL 2IDUA 1QTSA 5EOCH 5AYUH 1GMEA 1AZBA 5D1XA 4HLZH 1CGWA 1P7QB 2GI7A 2QT6A 2LR4A 3APFA 3WEXA 1F41A 1ZD6A 4G2AA 2HG0A 4KTGA 2VQTA 2P42B 1RJLA 4F27A 4KHXH 4KK5D 5H94B 5IROA 4LB8A 1WWAX 4FXGA 2QFPA 1F13A 1GGYA 1NCCL 4GRLA 4JZJB 1PD0A 2YA0A 1P7QD 4XCFL 5EC2A 1HIMH 1NUNB 4D8PB 4WF7A 2A1WH 3KGUA 2P24A 5DJZB 3L1EA 4OKVB 3MNWB 4JO1H 3TP4A 4R96A 1HQRB 1T3FA 2B1AH 3X12A 1CDJA 3WJJA 2JSFA 5A43C 4P8QA 3VFPB 2VXSL 4GAYA 3PWNA 1GXEA 1RK0A 5C0FB 1IBZA 5C07A 1I9RL 2WQAA 4M7ZB 5DMGD 3B5GA 1WFIA 3JXAA 5AB9A 5DJAB 5I74C 2K3TA 3HAEH 1AAJA 1JD7A 2W81C 2LE9A 1OAYL 3HZKB 2WK2A 4LCUA 1ITCA 1XF2B 3CZKA 3GIZL 3LKQA 1FIEA 2UWEB 2VXUL 2XXCB 5K93A 5JW4R 5FUZL 4KQ0A 4YHKL 4WHYG 3VG9B 2DIAA 2DEXX 4KXZH 1DQQA 2W0FB 1YLBB 5BQ7A 5CFHA 4EE2A 3OX8B 2D2CC 3P77A 3R1GL 1YY9C 3EJTA 3MJ9L 4PBWD 1KXTB 3EJYC 1NGZA 3FQUB 3HMXA 3A3YB 3OKKB 1N8OE 4IOSA 4BFEA 5LGJB 1EVUA 3BP4B 1GSMA 5I76A 1T0OA 4HS3A 2V3DA 5A7EA 1CE1L 3MOBL 2Q1EA 3DVGA 4MJ5A 5IQNA 2GB2A 2KUTA 4APQA 5BZDB 3NJIA 3SPIA 2RAMA 4U1JA 2OP4L 4P5SA 4NO5B 4BBWA 1WBZB 4YHPB 5DC4B 4YK4B 4M02A 3O6FA 3QJQB 4OGYL 4WJKB 1N6QH 2YK1L 4GW5A 1KIRB 1L0PA 1AD9B 2GHZA 5DZAA 3LDBB 4MMYB 2WO4A 3WE6B 3QCVH 2VZSA 4U1SA 2O6DA 3CPLA 3GBNL 4URTB 4F37K 3S5LB 2IAAC 1L3NA 5DJXB 5D55A 1GL4B 1QBAA 2ALWA 5KN5A 3TBTA 1F00I 3W1ZA 4ZFOA 1TITA 1TZHA 4EDWH 4P9HC 3VMOA 4KMTL 2WTPA 1QNZL 3BHBA 1MIMH 2F74B 4GAAA 2K8QA 3KPOB 4HOZA 3EXJA 1FFOB 1MELA 5KBMA 4KNTA 1IAKA 1BZ9A 4GBXC 4GXUN 4N9GA 2JCCA 2ZKHH 2B7DT 3L08A 4PY8J 5C71A 4Q8BA 1W0VA 3UYRL 1M3IA 3MRMB 4X4MA 4KGJA 1TTGA 5EOCL 5AYUL 1J9SA 4ZUSA 1EZVX 4YBLC 1AH1A 1H3XA 1X7TA 4FEMA 1MG3C 1E5AA 2DMCA 2WQUA 3IU3A 4HXAH 1P0SE 1KJMA 3C9NA 3ESNA 4KHXL 1WHOA 4JO3H 4N0UB 5DI8A 4HF5H 3RY5A 1G6RH 5FOJA 1HIML 3NQKA 4FQIL 3J2PA 4ETYA 4HHAA 4I0PB 2A1WL 1XH2A 5SX5K 2E7LA 4PJHF 2XUWA 4JO1L 2YBGA 5B4MC 4DZ8B 2B1AL 4J4PA 3D0LA 3CZEA 3PYCA 3WUWB 2AABH 5C0CB 3BVNA 2XPGB 1RUMH 4I0PD 3F6JA 4JHZA 4I7ZC 1T20A 4YXHH 2WXGA 5FFGA 4LSQH 2FYYA 2NY6B 4OIIH 4U0QB 1MPAH 3OKOB 4TQHA 3DROB 5C0CD 1S9XA 3RNQA 5C0ND 1YHPA 3E3QC 1XF4B 2XXMB 4XN5A 5FECB 4IOFD 4OGQC 1FBIH 1C16A 2NY6D 4R4FH 4ZXBA 2K78A 2ODHA 1U8MA 2VSDA 3ZZSA 5H37A 2HSIA 4P2CG 1FVEA 2F18A 3W11D 2FATH 3QWOA 1T04A 4MQ7B 3N3EA 1ADWA 4TVUA 3GMNB 4U7MA 3LXCA 3WNIA 4DZBA 3BSGA 3F7KA 4P3DB 3U6RA 4WEMB 1TU2A 3RPKA 4Y5YC 3U36A 1FL6B 2KPWA 4JDVB 2EUXA 3FYIB 2EIEA 2NR6D 3GMQB 1KYAA 5DVLA 4FTVA 5DRWA 4ECNA 3LY6A 1Q9LA 5JXED 4ZPTA 2OSWA 5SWSE 5T8IA 5ERWB 5DR5L 3UBFA 4ZFZA 1PYWA 1QX1A 2QZ5A 3DOSB 1JGDA 4JCWA 3IK2A 4GT7A 4HEPA 1A4KB 1MW1A 1QWHA 3AM8C 3FQXB 1CZ8H 1N59B 3RPIA 3GSWB 4C59B 1N6QL 4PJFF 3MRBB 1SJVA 2BZ7A 1OIOA 3QCVL 3NJNA 3OVUB 3O41A 5DZNA 3U79A 3UYOD 4EN3A 2X4NA 1JXDA 3DPBA 4NFBA 1FZJB 2EEXA 4AZUA 4MMZC 4PWEA 1NEZA 5SV4A 2ARJA 2FBJH 3H2WA 3K6SB 3LRHA 4EDWL 6FABH 3ARRA 1DBBH 4CVWA 1MIML 2AQPA 1JNHB 3DX7B 3KPMB 4JFZH 1KOAA 4J3WA 5DT1H 3HAEB 3CFCH 4NO2B 1OL0A 2BINA 2CR0A 5ISZE 2QV2A 4P04A 2FL5A 2ZKHL 2EECA 3DX8B 1DZBA 1Z66A 1UC6A 3PE9A 2JQZA 2ZX8A 3DPDA 1CD8A 4GT0A 2J8UF 3V6FB 4JDZB 3S4SG 4HU2A 4JGNA 5T33H 4AMWA 1BVZA 3MBXH 5MENE 4Y8AA 2D4FA 4JO3L 1KYFA 1YYCA 1O7SA 2QSCH 5E2VH 4F20A 2CNZA 4HF5L 1CXIA 1G6RL 1N5YH 4IK7A 4AWJC 3TBWB 4GW4B 1U8JB 1BCIA 1XAKA 4ABVA 1OB1B 5GJTH 3RI5F 4XOAA 4AXWB 2ZKYA 3AUWB 3T3PF 3EDFA 2Y7SA 2AABL 3NCCB 1U3JA 1RUML 3UZVA 4YXHL 1Q9OA 3SE8H 2HYMA 4LSQL 5CJOH 4OIIL 1MPAL 2K0RA 2R56L 5MEPA 1JL8A 5CD5C 2CA4A 2GC7C 1X5KA 1EHLH 5LXGH 1EX0A 5JW3L 3G5ZB 4AQZA 1FBIL 3VCLA 4NNPH 4GI6A 2VCOA 3FO1B 4FFVD 2GTQA 3PHSA 4OZFG 2FATL 4YE4H 4G7QB 1LEKB 2F68X 1ZK5A 4Z7UB 1WFOA 1MRFL 3DYMA 4PN6A 1CK0H 4HKJA 3RVWD 4KRPB 5EU6B 2HRPH 3AG1B 5INCB 5IKCB 1UWFA 3UADA 1TG8A 4YHYC 4NRZB 5DJDA 3HMWH 4I0KA 5GRWA 4FG6C 2IDQA 3ZDWA 1D6EB 4HPYH 4J28A 4KRPD 5EU6D 1MNUH 2V9UA 1IGTB 1O7VA 1SDDA 4PJAB 1E9OB 2MCPL 2XKUA 2ZWSA 3ARXA 4P2QB 3GUTB 4XNUH 4PVMA 1EAJA 1U2HA 3ZQXA 3NJVA 3ASOB 3A24A 5DJCA 2R23B 5D9SB 1JERA 3ATFA 5GS3A 4HGWA 1PEZA 3VD4A 4P5KA 1G6RB 4D9QD 5TPWH 1CZ8L 4WJ5B 3QPQD 3MPCA 4P2QD 3O45B 4ATTA 1HHGA 1B4JH 3KL0A 2VKWA 5DRZB 3D8MA 4DN4H 1XSJA 2IEPA 3MTXA 1A4CA 1A9BB 1JXFA 4KJYB 5FB8A 3IXTB 1ZMYA 1A6AA 5E1GA 3A0OA 5DMKA 3CFDA 2XFGB 2H32A 4D7BA 2QDVA 2FBJL 4FDWA 4A6YA 3QCTH 6FABL 2J71A 1VAHA 4Z95H 4FTDA 2Y1YA 1DBBL 3DDFA 5BXFB 3GBMH 3O8XB 1GVIA 3WXVH 4Z7VB 4JFZL 5DT1L 2BWDA 4F7PB 3I6KB 5CKAA 5KS9E 4PRPB 5T1MA 2GYSA 2XVGA 5DS8B 4E42B 3FFCE 1F3DJ 4IBZA 4M03A 3KD4A 2UZPA 3O8XD 1FL5A 3WV0A 2FEEI 3ARYA 5ICXA 3TU6A 4PRPD 4NB7A 3VXRE 4CC1A 3T1WA 1JGIA 3RVTD 3NEOA 2UXFA 4DVRH 5I6XB 1II4E 4HX1B 4HOXA 1QPXA 3HKFA 5T33L 3ARGB 3MV7B 3MBXL 5HDLA 1D2PA 1PW3A 1SN0A 3AUVA 4FJYA 3D7PA 5D7IE 2QSCL 1GJUA 4Z3JA 3P4OA 2DIEA 3D25B 3DTXA 3ZIMA 1N5YL 3KLHC 4JREB 1TZIB 1HL9A 5CUSH 1CQKA 3ARGD 3MV7D 4L8DA 3MUGA 4Y0GA 4GNKB 5AW1B 5TK4A 4F2ME 3H3PH 4DT2A 4R97B 3PJLA 1NGXA 4N0UE 4H13C 5GJTL 3QJXA 5G5DB 2ZX9A 2XNAA 1RSYA 2CCVA 2SEBB 3L3OA 2WYIA 3CDYA 5D2LB 4XC3H 3SE8L 3T1FA 3JVFC 3TZVA 4QNPF 5CJOL 3RILA 1K8IB 2EDKA 4G8EA 1I7TA 2F58H 4U6TA 5JW5A 3D51A 5C0CE 3ULSA 4XCNA 4YDZA 1CPUA 1EHLL 2RFXA 1PNCA 4KJWD 3WO4C 2XWJA 3GS7A 5LXGL 1SOXA 5G4NA 3RHWF 4NNPL 1OO2A 1K8DA 2IANB 1AC6A 2DB8A 2WCGA 4K5PA 4YE4L 3C2SA 4PIRF 4Y9GA 4CSZA 3CU7A 4Z7WE 2H41A 4NAMA 3MUHL 5PAZA 1PZBA 5E1HB 2IAND 4XXWC 2HRPL 3PNRB 4GXFA 4FFZA 4BWTA 5B3JF 3HMWL 4QRRB 4DGVH 1P5VA 1BAFH 4HPYL 4OZ4B 1GMIA 1QQDA 5AALA 1MNUL 2MJWA 3NFSH 4D0BA 3D3VB 1C9SA 1UGKA 4F9LC 1WFUA 4QF1B 4EI5B 2DWYA 4XNUL 4C47A 4QRRD 3ZMRA 3QRFM 1HAWA 3U9UA 2MMXA 3B2MA 4FABH 4I89A 1F90H 3D3VD 5TPWL 4HK0B 4YAQB 4AY0A 4J3TA 3IPEA 4EI5D 3OF6A 4X5PA 4Y2OB 5EF1A 1AKPA 4DN4L 3M88A 3QIWA 4IBQA 3JTBA 5SWSA 3UZQA 5DFVC 2VKXA 3K8LA 4GY4A 5EU5B 5J6GB 4Y9BA 1XV8A 1RZJL 5AWNH 5F1OB 4G8GE 2PWGA 2XN9B 3L1OH 1BOYA 4HC1H 3P4MA 1ZA6B 2V7NA 1R3JB 2A6KB 4MA8H 5GGRA 2FBOJ 4BHUA 5I1AB 2EDXA 2VXTH 2P8LB 4BFRA 2XN9D 4LRNH 4LASH 2ADGA 2W65B 3MLRH 3PP3H 1AMXA 3JTTA 3LQMA 4Z95L 2GTWA 3SKMA 5ESQA 4F9LA 3GBML 4AYBA 4OF6A 3WXVL 2R69A 4YQXH 4ZX6A 4KK5C 4AKQA 3IFPA 4WTQA 1T1ZB 1OGAA 4QHMB 1KGXA 2VDPH 2RA1A 2H8PA 5DLMH 2HUEA 2Q7YA 2HPTA 1TKWB 3PHAA 2FJHA 3MBEA 3KHOA 2OMYA 4M6AA 4JZJC 2K7QA 2FO8A 5BOPA 2EUZA 5GGSY 1QUNA 4DVRL 3VVVA 5ISZA 2Y07H 2BW5A 2A73A 3NA4A 4J7RA 1M2VB 2I07B 4NQDA 3HG5A 4HCIA 1PAMA 4TQEH 3AGVA 3NP3A 1GGBH 2NZ1A 4J1UA 3RI5K 4KTDH 4MWFA 5DMGC 2CUHA 3B2VH 4G82A 3BZFB 2R7EA 3S48A 5A7BA 3HS0B 3H3PL 1XX9C 3N44B 3W39B 5EEZA 5EU3B 5MENA 1YYLH 3DJRA 1JTOA 3RB5A 1UH3A 4NKMB 1QPKA 4A2GA 1ONQA 4M7ZC 3VI3B 4Q9CA 4Z0XB 4L1TA 4XC3L 4XAWH 3BVXA 3FU0A 4ZW7A 3TO4B 4KVNH 4LF3B 2F58L 1H6UA 2Q0ZX 1CLYH 2X44D 3I9GH 1A1MA 3L7EA 4E9LA 3PV6A 4XMKH 4D8PA 4C57C 5BS0A 2PYFB 3RIAK 3TO4D 3SOTA 2EYSB 4J27A 4XB3A 4AYDC 3JWNH 1O6VA 2X6CA 1KENH 1DTUA 4MDJA 1MCJA 3VG9C 1P1ZB 1R46A 2D7MA 1P4IH 3ALWA 3VI4A 2CO6B 3VFPA 1I8MA 5E4IA 2AANA 2EUVA 1R5VA 12E8H 5AG8A 3VH8G 3ZU8A 5C0FA 3KLSA 4FQCH 4Z7UE 1HSAB 1CFTA 4GKSB 1BAFL 4ZUUA 2MNWA 1IRAY 3TJPA 3EO1A 3NFSL 5D7JD 5EU6E 2L7EA 3EGSA 1ZHNA 5TE4H 4DP9X 3FTYA 1OAXH 2A9NL 2H45A 3SY6A 5I1DA 3NCXA 1NGPH 4YK4C 3HZKA 1CE6B 3KPRB 2VZVA 3RVXD 4TVSa 3CH1A 1ASOA 1OCOB 3APNA 4FABL 2BS71 4TSAH 1F90L 4D9QE 1UZ6F 3KVDD 4P2QE 4F7CB 4J6RH 3AS2A 3VTTA 3KPRD 4WEBH 4W93A 4XMLH 3HEIB 3MRQB 5AWNL 2PTUA 3LQZA 4KXZI 1ZLUK 3L1OL 3BFWA 4HC1L 4NN7C 1MVFA 1PAZA 3V6OE 4LESA 1R4XA 2WLLB 2DIJA 3KPNA 5DHXB 5LGJA 4GQZA 3RQ3A 3MV8A 1ZHKA 3SSGA 4OJCA 5IB5A 1CT8A 3HZMB 3DURB 4QGYA 2VXTL 3EGDA 4DFHA 4LRNL 1WA2X 1AZCA 4LASL 3MLRL 2J12B 1NFAA 2JFCA 3QNFA 1WAAF 3L9RB 1DO5A 5CZRA 4LHUB 1WBZA 2E9BA 1CC3A 2GSMB 2WWOA 4JL2A 2WN3A 3GTVA 4WO4B 1AI1L 5FKAB 2DMGA 1VLXA 5DD6B 4YQXL 2X4QB 1G7LB 2VDPL 4H2AA 2K8MA 3PWJA 4EI6A 4I88A 2GBTA 1N26A 4MMYA 5T1LB 2Y7OA 1M7IA 4LHUD 4WTZG 5DLML 2UZIH 4WO4D 4UT9A 4CRPA 4Z7VE 5I8CB 3IRZA 4G59C 1L0QA 2XPYA 4NQXA 5EF3A 4PRPE 4NKIH 2EEDA 5DJXA 5KS9A 2Y07L 4KK9D 5BRQA 3TNMB 1IC1A 1NBZA 1X4YA 3B5TA 4I0PC 3LEXB 3FFCA 3W3BA 2LFEA 5MEOB 4TQEL 3RUGF 1GGBL 1FFOA 3OG6B 4KTDL 4LIQH 5ESVA 4UV4H 3TCLB 2LTQB 3VXRA 5HI3D 5C0NC 3MV7E 4ZYKA 3B2VL 2GTZB 4HZ1A 4XVOA 3ZTEA 5DTFB 2QR0A 3SE9H 4IOFC 2YFNA 2NY6C 3H55A 2W60B 4JJOA 4I2XB 1YYLL 5D7IA 5ANMB 4N22A 3RU8H 3W11C 1FPTH 3LNIA 4OLXH 5FM4A 5LN4A 3UJJL 3LD8B 4KVNL 5I1KL 4P05A 2MCAA 4PGDB 4F2MA 5DEGA 4BCXA 1CLYL 1BM7A 3BH8A 4N0UA 4WW2A 3I9GL 1SBBA 4KX7A 3QYMA 3N1GC 1JV5A 4XMKL 4OF3A 1R3KB 3BWAB 3F12A 1FG9C 4I0PA 2NR6C 2Q10A 5HJ3A 3M17A 2VN7A 3HBZA 4PV9B 3GSXA 1ORQB 1KENL 1NFDF 4RBPK 1P4IL 5JXEC 3CSPA 5GRZA 3OLIA 4MXVE 2VT0A 1UVQA 2KDGA 2IANE 1PG7W 3QJHB 4ZMZA 1THCA 12E8L 2Y7MA 5C3LD 2VDPB 3OKOA 4PRIA 1DVXA 4U1HB 5B39G 4FQCL 1S9KC 2GK0B 5JYLA 1HNFA 3PHOA 5GGVY 2ZSWA 4Z7WA 2FT6A 1Z9PA 3CXHJ 1G7MB 3QJSB 2XTSA 5TE4L 1IAIH 1JPEA 1OAXL 4A37A 3IGLA 1NGPL 3ELQA 3CFKA 4N2BA 4M6ML 4QRRE 4MAZA 3W82A 2EICA 4O2EB 3O2DH 3CQFA 4BFGA 4GSUA 1XIWA 4PWKA 2DL9A 4HUWB 3GMNA 4TSAL 4LP8A 1H8LA 4P3DA 4J6RL 3RURA 3M1CA 4WEBL 4XMLL 5CGBA 3VTAA 4Z3IA 2YD2A 4FLHA 4LSPH 2ZX6A 2ZYSA 1XL4A 2L0DA 4W9HC 3OXRA 4YHZH 4IHOA 4A7SA 4N90D 3ECQA 5FYKU 1TVHA 3QK0A 2UX7A 5ERWA 1BG9A 2A9DA 1XF3B 2AGJH 3L6FB 3BAEH 5D7SH 3QDGB 1T5WB 3B2UD 2XN9E 3DOSA 4WWID 3JVGA 5FXCH 1KCVH 1HK6A 4G8GA 3B8YA 5HGHA 3FQWA 5DHVA 4ODXA 4UT7H 4MGXA 5HHVH 3UXFA 4EIBA 2GY5A 1WGVA 3IXAB 4TXVB 4PB0H 3D85B 3GGWB 2WNXA 1ZGLA 1A0QH 4RISH 4HBQA 5LAXB 5BNXD 2YXWA 4NKIL 3EDEA 1J0KA 4QRUB 2G3MA 3D85D 2B14A 2AJUH 2B15A 3K6SA 3AITA 1L4IA 2ZG3A 3QHTC 5KSAB 4IEFB 4N25A 3DX7A 4CN1A 3BMVA 3KPMA 4LIQL 2ZUQB 2G3ZA 4UV4L 5GGQH 1CG9A 2E6JA 1R9FA 3AQYA 3SE9L 3GS4A 4RA0C 5KSAD 4C83B 1HZKA 5CGYD 3C8KA 4BKTC 1ASQA 2VW6A 1YN6A 2QGCA 3V52H 4AM0B 2R1YB 4FFVC 1PU0A 1EO8H 3NBNA 5IIEB 4AMKH 4WK2B 2EE2A 4JX0A 3RU8L 1FPTL 1QABA 2A4ZA 4YLBA 4OLXL 2DM3A 1FYTE 1USQA 5KJ4A 3MMEA 3QA3A 3V6FA 3GM8A 1OQXA 4U1NB 4Y88A 1E30A 3RVWC 1JPFB 3VI3E 1XB3A 3MRGA 3UEQA 2OTPA 5AENA 1U33A 3P4LA 1BD2B 4X7FC 5FW8A 1I82A 2QPDB 4JQIH 3VXTB 4ODVL 1QFWM 5AAWC 2VABB 1MY7A 2F1EA 4KRPC 2EVGA 4PREB 4Z5RB 4G83A 1MVUB 1QSEB 1BD2D 4GP8B 2AK4B 1MFAH 4KU1A 1HU8A 2L8AA 3TH3T 1TQBB 4UQEA 1XD0A 4TQPA 2IDFA 2MOGA 3DO7B 3GSNH 1QSED 2R0KH 3QPQC 2AK4D 1ZVSA 2D0FA 4D9LL 5MERA 3BP5B 1XR8B 3S96B 1B6UA 3UTZA 2AP2A 2OMBA 3EJUA 1IAIL 3FO1A 3OJDB 3SDDB 4AI7A 3GMPB 4K73A 3V6OC 1FH2A 3D52A 3APMA 1FZMB 2BLFA 4H0GA 3K6OA 1A2YA 3MBWB 3O2DL 1A8ZA 4Z7UA 1T2JA 1CGUA 2OXHA 1PJWA 3K0WA 4IRSB 1JGVL 5I6PA 4M1DH 3SDDD 4F3FA 5AAWA 2FBRA 2YUZA 5EU7E 5HGAB 3X13B 5E8NB 3KHQA 4P4KB 4QD2E 3KPRE 1A7PH 4NRZA 4GOSA 3TA4D 5HHOB 5GGVH 2BIPA 2YAPA 4IRSD 4KZEH 1BLIA 1IGTA 1MCIA 4LLWB 5GGSB 4YHZL 2AITA 5IWLA 4P4KD 1M6OB 4OGXH 4P2QA 3O8XC 3GUTA 2X9XA 2AFNA 1S7WB 1SXSA 2Q5BA 5HHOD 2AGJL 4DIXA 3BAEL 5D7SL 3RVTC 3F7VB 2C3VA 4TOYL 2C1OB 4G43A 2BWIA 4MZ2A 5HHVL 3V6OA 3E1F1 1A3RH 5HGDB 2BVYA 4Q74A 4PGCB 4PB0L 1DZ0A 5I6XC 5IQOA 5A6MA 1A0QL 5J6HB 2FECI 1A9BA 4P0DA 4RISL 3ARGC 5DD1H 1S78D 3K80A 1G87A 3D4ZA 3IXTA 4PJ7A 1SEQH 1PL3A 2AJSH 4NGHH 4ZFGH 2DMKA 4JREC 2O6EA 1CF8H 2AJUL 2TSAA 1Y6KR 3EBIA 2WJ5A 3GIVB 4N2HA 4S0SD 1OD9A 3FT2B 5BXFA 2ZONA 3O8XA 4R97C 3JT0A 2QV4A 1QBBA 1O5PA 4QRSA 2WAHA 2I27N 5DC0A 2ZF9A 3G3LA 4MB3A 4PMFA 4PRPA 5GGQL 2D9CA 4KPHH 4S1RH 4LU5H 4KJWC 1U93A 4JW3A 3ZDXF 1HH6A 1SJXA 1AC0A 5D1ZB 1XH1A 3SE4C 3V52L 2BMKB 1EO8L 1Q9WB 4AMKL 3SGJC 1DEEA 2D2OA 4G1EB 1JRHI 4X0KA 1QFWH 4HX1A 3MOQA 3MV7A 5D1ZD 3VD3A 5LDSA 3GXTA 4I2XE 5HHNA 3QDJB 1KACB 4H8VA 1NCUA 4YFLI 2J7LA 1GZPB 4KITB 4F92B 3HZ3A 1F11B 5K5YA 3HHRB 3GXFA 3B1UA 4JQIL 3FPXA 4X83A 2Q3XA 2V5SA 2N7BA 5KVFH 3QDJD 3LRSB 1OOAA 4JPIA 3DXAB 2CHZA 3VFSB 1E4HA 5KZCB 2ZYRA 5G5DA 5CD3B 2WYHA 4MYPA 3E2HB 1MFAL 4M93B 3V4PA 2ZCHH 1MH5A 4ELKB 3LKOB 1QI5A 1YNTF 2LABA 5F3BA 5IJCC 4IOIB 3DXAD 2Y3NA 5KZCD 1B9KA 4EAEA 2R0KL 4I1PA 1OP4A 2Y36H 4I9WE 4P07A 4EI5C 4Z8FH 5IEKA 3SYAA 4UZGA 2XIDA 2X28A 5CSBA 5IF0B 1TYEB 2IANA 3S3BB 1HHJB 5D4JA 1UQSA 2BCKA 1U8OA 4HKXB 4K55A 4XZUB 1UM5H 3EDDA 3F01A 4NKQB 3QHFH 4F58H 5J8OA 4M1DL 5E5MB 4W4OC 2CK2A 2ILLA 2GJ6A 2KMWA 5EIIB 2UY7B 1PSKH 4HWBA 4E9VA 4QRRA 5GGVL 3QARA 4PY7A 1WJ3A 2W0PA 2A74A 4UDTB 5GSRB 3GF8A 1WFJA 4KZEL 2Z35B 5E2WH 1HILB 2WLYA 4MXQD 4Q9RH 3E38A 1J86A 1KGUA 2EYTA 2HX8A 4NC2B 4QF1A 4URKA 1L5GB 3HZYA 1KDIA 2XQYA 4F7EA 1MJJB 4LEOA 4IU2B 2JB5H 4JPSA 4MRBA 2HFTA 4Y89A 5E8EA 1QR1B 2X9YA 3IF1A 1J8HA 3VWJB 2XG5B 3GXNA 4LKXA 1QZ1A 4JFHE 1A3RL 1PY9A 2VE6A 3WOVA 4QTHB 2WZPA 3VJ6B 5IZ7A 2NY2B 4I5BA 1BZOA 4P9MH 1E3XA 2AZAA 3D0VB 4HGKC 4WI0A 3VWJD 1MXDA 1RY7B 2AV7B 4W4OA 1ZA6A 3D09A 5DD1L 3GJEB 3IWUA 5DQJA 4CA4A 4FQXA 1R3JA 5LXVA 3PWLB 3FRPB 1SEQL 4RRPG 5I1AA 1MCWM 1LO0H 2AJSL 4NGHL 4ZFGL 1CF8L 4WUUB 4FI8A 1EDHA 2GCYA 4UV7H 2EYRA 5A2JH 3AB0B 2PWEA 2WP3O 3HS0C 2WQSA 1QEWB 4P49A 4JUSA 5EG6C 4EQ3A 4QHMA 5IBLD 3INUH 4WUUD 4N6QA 1ZS2A 1B0WA 2FZ3B 4KPHL 4S1RL 5A2AA 1EFQA 2D0HA 2WOYA 3SKNB 5B3NA 2V2TB 1ET5A 3L2NA 1Y0LB 3TO4C 4KTEL 2WNWA 3Q2WA 4MTMA 1NDMB 3KJ6H 3V9FA 2CHDA 1RZJC 2ICEA 2NW3B 4MA3A 4LL4A 4G7YH 3HVNA 1TENA 4NM4H 4XNAA 1EANA 3OJMB 3KPSA 1S9YA 3LVTA 1CDBA 3V0GA 5FWQA 4R90H 1F86A 2OYMA 3OPUA 1A21A 3ZZ1A 4U1LB 2PN5A 5GS1A 1FYTA 5KVFL 2ICWJ 4FQQB 3P3UA 1SFHA 3CDFA 2IH1B 2FLRT 2GT9B 1JGLH 5D7JC 4NKOA 5TDOB 4ELDA 1IZJA 3GXDA 4M56A 4XO4A 1BD2E 4ZZKA 4FMKA 3VI3A 2ZCHL 3ZYOA 2PW1B 3NDYE 4HIEB 4Y5VB 1M9WA 1FORH 1WWBX 5HI5D 3TVMA 4CU7A 5EB9A 3RVXC 2ZZUT 3TA3A 4HIIB 4N8UA 1NFIB 1W72A 1QSEE 1J5OH 2Y36L 3FTXA 2AK4E 3EG9B 3KYNB 3NPSB 5EU7C 4Z8FL 2J1WA 4JQXC 1KEMH 3BP6B 4CKQA 1EJ8A 4RFEB 1AO7A 2EYSA 3B3IA 2FE0A 2HJFA 1TCRB 4EJ1C 4HFUH 3G08A 4YGAB 2G5UA 1UT9A 1G7IA 4A55A 2ED8A 3OKLB 1UM5L 4LLQA 3QHFL 4PJEF 1XEDA 2EINB 3MVSA 4NQQA 1MAMH 1NBVL 2JIXA 4LCYB 5D7JA 3RYMA 3SKOA 1OAQH 4FMVA 1PSKL 4JG9A 5BUAA 1HSAA 1WHPA 2IBZX 1D2OA 4AW4A 3QR2A 3U4EB 3X1FA 4DEUA 5E2WL 3ULVF 4QRFA 1HDMB 4LT7A 2IFGA 2P5WE 5JDSB 1TQSA 4BA0A 3QXAA 2XPZA 4B60A 2MQ3A 4WO4C 3L4TA 1KCSH 1D5IH 2G4GA 2Q2EB 4JQXA 4EZKA 7TAAA 3KPRA 3RWGA 2JB5L 1J8SA 5EUOF 4IYKA 2YC1B 4KK9C 1CJYA 2EIKB 1KJVB 3RWHA 3WJMA 2VJ0A 1JK8B 1KXHA 4KDTA 2JWYA 3DO3A 3LN4A 3MRKA 3WN6A 4HPHA 5DJYB 2QVKA 4K23L 4ZO6A 5HI3C 5E6IB 2X7LB 4PJ8A 3QJZA 1KCWA 4M8QB 5IG7A 3BAXA 3UACA 2GK2A 1LO0L 3B7YA 1SXAA 2XHNA 1I1YA 2LTQC 5L88H 3FH8A 4HUMB 2QJDA 1Z9NA 2BIOA 4KKLD 5E6ID 4UV7L 5CFAA 3MRLA 4G5AA 4WO4A 1LMIA 4D7PA 4JANB 5H4ZA 4JKWA 4NFDA 1EUTA 4KK8D 1G7LA 3MO1A 1HX0A 2G5RA 1OSZA 1FRGH 3MODH 4OCNC 5F1NB 3GSQA 1CD0A 3ZTNH 1WBXB 1SLVA 3LD8C 5TH2A 5I8CA 3KJ6L 4LKCB 3IAGC 3DGDA 2XJKA 4ZG1A 2VDRH 4NZUH 3FF8A 5IBUB 5IM7B 2OTWB 4NM4L 2IH3B 2CSPA 4A68A 5KVDH 4NUMA 3DSNB 3LEXA 4ZMTA 4X6DB 3H56A 4X6BA 4R90L 2C7FA 1QW8A 1W6LA 1XMWA 2R2HA 4OLVH 2J72A 4DGUA 3A4DA 3A21A 2D31B 5M7QA 2OMUB 2Y2TA 3EH5B 2VLLA 1OCWH 1J0ZA 3DVFA 3QDJE 3FZUD 4RDQG 4QDGA 5ALBH 1ADQH 2W60A 3TEYA 5DWPA 2IPUG 1CYXA 3ETSA 4N86A 3HI1A 1RZPA 5F7DA 4MSWA 1MWOA 1AR2A 2PXYB 4GXUM 3DXAE 1D5XA 4XB7A 1CUOA 1R3HB 1OF2A 2FB4H 4HZLA 2P28B 1FNAA 4DAGH 1G0YR 3T04D 4QOKB 2ZUYA 4UINH 1FNSH 1V7MH 3N42B 2PXYD 2IQ9H 3CHOA 1J48A 3DGGA 5CSZB 3WY4A 2YAFA 4HFUL 2APWA 5CJQH 3IGKA 4GSXA 5DHDA 1MFEH 1WZKA 2BM3A 3FFOA 1TVBB 2EXWD 3DX0A 4QOKD 4YZFE 1ZJBA 2P3YA 1F1GA 3H1ZA 3V5HB 2EE3A 2HRGA 3PP4L 1I8KA 1MAML 4IKJA 3B2UC 1MFDH 4LFHD 4BZ1A 1BZ7A 1OAQL 5CP7B 3X11B 4PJXF 5L2JB 4KHTH 3DVNB 3MRCB 3MFFA 1XD1A 2HPOA 3W2DH 1G7MA 1I85A 1C8QA 2G2RA 4JFUA 2QMJA 3WIFA 4GUQA 1OB0A 1KCSL 1D5IL 5D7EA 1NPUA 3HZVB 4KDVA 1CTOA 1IAII 4JBSA 5I30H 2JQAA 5KVMC 1IL1A 5EN2B 3VXNA 2BP3A 1F18A 4N2EA 2WWKO 5D1ZI 2KZKA 1KYOJ 3MXWH 4YE0A 1OPGH 2A6JB 3HC0A 4NYLA 4YSOA 1LVEA 4NQTA 2GAZA 1CXLA 2CJ3A 2VQ1B 5D1QE 3TPUA 5F8QC 2RIKA 5F9JB 2CBMA 3VFTB 5KSAC 3TIEA 5CGYC 3OC5A 4DSYA 1CL7I 5ECJE 2ZUQC 4KMLB 3WEOA 2V8LA 5L88L 3RZCB 2XA8H 1YA5A 1BVOA 1X7QB 2VZ1A 2ZYHA 2IAMB 2Z1PA 4GUPA 1BAGA 3KEDA 4MCYA 3CWGA 4JFXA 2BP5M 4QY8B 4WUUE 2EIMB 3RX9A 3RZCD 2ZCLH 1FRGL 3MODL 1M7DA 2E4FA 4PG9B 5L8JB 4LVOB 3ZTNL 1LJMA 1ZT4B 1HEZB 2AXGA 3I9AA 2C7UB 2IAMD 4MAUH 4M6OH 1F42A 3KEHA 3QNYA 4CU6A 4YIQA 5JNYA 1RD6A 3SIKA 2VDRL 5I1IH 1BMGA 3OKEB 4UQDA 3GZPA 4UILL 4IBUA 5KVDL 2Z93B 3PUUA 3II3A 2X3BA 4JG5A 4NCDA 4OQTL 4OSUL 1Q0YH 2WLMA 2XACC 5CKGA 5KSAA 4NZRH 3VNYA 2AQQA 4H1LG 4OLVL 2NQDA 3S5LG 2H26B 2JCCF 5JLZB 5B1JA 3FCTA 3V95A 1E8ZA 1T5KA 4AIZA 4DW2L 1TQBC 5IMMA 5E0FA 4KDWA 5ALBL 4Z7IA 3IKKA 1ADQL 2WW8A 4N9OB 3MC0A 4AM0A 2P9RA 3FTGB 5C97A 2QPUA 1AZZC 5A6LA 4YL9A 5IT2H 1NM9A 4H5SA 5AVWB 2E59A 3HPJB 4DEWA 2BNQB 4YFDB 3SDDC 4GSQA 1RZ8B 4AQEA 1EJOH 2FB4L 4PWFA 4G70B 1W15A 2DQMA 4DAGL 1QNIA 2JELH 1JMXA 4UINL 1FNSL 1NBYA 1UH2A 1V7ML 2IQ9L 4PWJA 3MJGX 3WKMH 4IRSC 5A2LH 2BNQD 2WANA 3KYMB 5CJQL 4ORZC 5K59E 5C6PB 2VABA 1MFEL 3G5YA 1AHMA 4Z5RA 2ENPA 1MVUA 2B08A 3F3HA 4P4KC 3KVPA 1DBKH 5I0WA 1W6WA 2OTUA 4AKPA 1MWAA 2B1HH 4H0IA 1MFDL 5B7FA 3GC3A 4HJIA 4NZTH 1ETB1 3UDWC 4KHTL 2K6WA 3KCPB 2DI9A 2JJSA 3CC5B 4IS6A 1UZ8B 3UIZA 3W2DL 3WUWG 2FO1A 1G9MH 2GIMA 3FU9A 4NQVB 3WL9A 4KWUA 3SJVB 1T1WA 2VDRB 1ZIAA 1S78C 1A47A 1T7ZA 2LOEA 2Q3ZA 4HJSA 4U6YB 3MBWA 3RWCA 5LBSH 2D7NA 1JV2B 3AU0A 3NK4A 5I30L 3QUXA 2UZYA 2DV6A 4IRSA 4NBXB 3H9SE 4E5XA 4EZLA 3B5HA 5E99H 3MXWL 3SJVD 5A3ID 1TZAA 2H0EA 1L3WA 1OPGL 1FCGA 2P5WA 4PJ9A 3W81A 4JK0D 1AQDB 4PJHB 4N2FA 1KBKA 1I1AD 4JQVA 3O4LE 3PQYE 2OAAA 1KPRA 1MLCB 4HP5A 4I85A 5AOJA 5E2UH 2VITB 1UYWL 2R29H 4LLWA 2YQGA 1DQLH 3L5HA 1M6OA 1JI1A 4G7VH 2Y7NA 4P2RA 3REVA 5EIQA 4UNUA 5KVFE 1MI5B 3FB8B 3IRPX 4AT6B 1JWSA 2CCWA 3L54A 1MF2L 1NMBH 2WKLA 2XA8L 3KXFE 3BDYH 3F7VA 3GSOB 4BKLA 4A7VA 3HC2A 1ASPA 5D1ZC 3H9YA 1KB5A 3QZLA 1MI5D 4X5WB 3FOLB 4HLZG 1INQA 3I85A 5GSVB 2YQ3A 4DP4X 2AHIA 1AGBB 4F8OA 2ZCLL 4AUYA 4LLDB 1AXSB 3QSKB 5J6HA 1FL3B 4MAUL 4EXKA 5CU9A 4A2FA 4M6OL 1GS8A 3Q3GA 1AIZA 4GQRA 3WY2A 2FH6A 4PSRA 1AGDA 5D2NB 3ZBMA 1FA4A 5I1IL 4U7SA 1BEXA 4ZUTA 1KMGA 1Q0YL 3T0AA 3NAAH 4LLUB 3RWFB 3RIKA 2NY1B 2VM3A 4FLSA 4V2BA 1YC8A 5TDPA 4ES9A 3EBGA 1XCQB 3E2HC 4M93C 4Q0XH 3E6FA 3FONB 4TUKH 4ETQB 2DQ6A 2E8ZA 4NQSB 5F93C 1QG3A 5DLLA 2QPSA 5D1ZA 2NY1D 1WFMA 1V3JA 4H88H 4R3SA 3ATEA 2BMKA 3BCFA 1LYQA 2Y9RT 3H54A 3QXDB 3RG1C 1IT9H 1IARB 4GFTB 4GLRI 1E7VA 1U8CB 1NOFA 4G1EA 4KKPA 3VRIB 5IT2L 3HAEG 4PJFB 3GEWB 4WO0A 5HHQB 2CLVB 5EU4A 3G04B 1HCYA 5T1KB 3IFOB 1HCFX 2F54B 3NK3A 1NM4A 5LDUA 2YPLB 4OFIA 1WE5A 1EJOL 2BIIA 5DJ6A 5FFOA 3GEFA 5KANI 4YN3A 2JELL 2O6FA 2YA1A 1OTSD 1JZJA 1X4ZA 2VLKB 2MSPA 2DQHH 3WKML 1AMYA 2VO8A 2A9CA 2F54D 3AGWA 2YPLD 2Z91B 3LRSA 5FWRA 4MXQC 3DXAA 1OAJA 4FHJA 2D3JA 5CD3A 1DBKL 2AK1H 3U7WH 3FUEA 4DERA 5HVHB 2VLKD 2GVYA 1D5BB 1DUZB 2B1HL 4Z78A 2Q7NA 4R4BB 5FK9B 4WW1A 2G0KA 4HH9A 3AROA 4ACTA 4LPXA 3VX1A 2K1MA 3PIQA 1WS8A 5IJDC 5E7FA 1G9ML 2X4PB 5DUMH 1X5IA 1S7SA 3NABH 3EH1A 3VWJC 2J8UB 1WK0A 1A1NA 2Z8SA 2Y6SD 4HKXA 4B7IA 1P5UB 1VESA 3POHA 5FUCE 5LBSL 3U1SH 5E99L 2XN0A 1SVBA 3FT3B 4X6FB 5BZXA 3WXWH 3T0EA 4V33A 2UY7A 3VXMB 1Z9OA 4H26A 4F7TB 3TYFB 4UDTA 1URIA 2WC7A 1JNNH 2VDLH 4L5FH 2Z35A 5IBLC 3DTDA 3T3PB 5EA0H 2DTSA 1WT5C 3DV6B 2DTMH 3L3JB 2R29L 3BPCB 5E2UL 1RZGA 2IALA 4FQ1H 4NKDB 3WNNA 1DQLL 3DSFH 1NMCB 3AB0C 4G7VL 4JZOB 3VXMD 1F58H 1L5GA 4E9QA 1QI3A 3ECWA 1PIGA 4H25A 4ANKA 3KJ4B 1NMBL 5F9AC 3BDYL 1QR1A 5D1QA 2OMTA 2X6AA 3ILPA 2W9DH 4KAQH 5B38G 5D71H 1VFAB 1KT2B 3FQTB 4JQIA 4JDTH 4QTHA 1IBFA 5EZIL 4ZUVB 3VJ6A 1J7VR 3IDMB 2XLLA 1A5FL 2CU9A 2X6BA 5BZZA 4RWYH 4WU5B 1N8ZA 3GYRA 3MLUH 3Q6FB 1ZV9A 1BFTA 2PABA 1DBAH 3PWLA 7PAZA 2FSEA 1EERB 2X2JA 4CILA 4YHNB 1L9RA 4K7PY 4AC4A 4L4JA 1JVOA 4WUUA 2DQIH 1WT5A 4PVLA 1M7XA 2F8VA 4L05A 4E9SA 5HI5C 3NAAL 4XVJH 4B9FA 3FH5A 4HH8A 3MNDA 5FO9A 1FFNB 1ZTXL 5MI0B 4NHUB 2NY4B 3Q8EA 5G55A 2FZ3A 4TUKL 5KTEH 1WWWX 1AE6L 2WXHA 4Y5VC 1U92B 1SJEB 3K91A 1UZGA 4K9EH 4H88L 3E9UA 4N2KA 4GH7B 1DQTA 2HLFD 3BLPX 4S10A 1IT9L 2FO4A 3G7TA 3NPSC 1IBBA 1NCAH 4DESA 4ZMYA 4Q7DA 3ES6A 4IBVA 1RUKH 2EDRA 2Z7YA 4GKLA 4I48B 2G75B 3L95A 1L7IH 4A63A 5BJTA 2O61A 3BKMH 1F4XH 4KI5D 4CN6A 3SN6N 1NC2B 5DRXB 1BQHG 2DQHL 4OI9A 4U1LA 3MRNB 2BNQE 2OZ4A 3CTTA 4X9BA 2MCG1 3G9VA 4Q89A 5JR1H 2IH1A 1U58B 1IBHA 5MP6H 1IM9B 1ZLDA 2WIIB 3U0TB 5ES4B 1NC2D 4O5LH 3N1PC 1N5AB 1HHKB 1S7QA 3FQNA 4XBGA 3LKSB 4HUNB 3C5ZA 3OB0K 4N3TA 5K9JH 3TLRA 4ONFL 5JXAL 4CMMA 1IM9D 3DBXB 3FB6A 4X9HA 3KYNA 2E46A 4YDJA 3PWVB 4BYHA 2G2NA 5CAYB 5DUML 3NABL 4YSCA 5AVTB 1G1KA 2RACA 3N40P 1TCRA 4YGVA 4OLUH 5K9OA 4MKMA 3QFJB 1M1XB 1HE8A 1VEPA 4K5NA 3AXLA 3STZA 2APVA 4RFNB 1TTCA 4TL4A 3AMLA 3U1SL 1I1FA 3B9KA 3QFJD 3FT0A 4KKLC 4PG2C 5E6IC 3WXWL 3PAZA 2P8PA 3P11H 5JYMA 3AAZA 3VG0L 5I6LA 1WIUA 4KK8C 3II1A 4HCRA 1WG3A 3AWFA 4L5FL 1C12B 3V0VA 4V2CB 4A39A 2DTML 2EDEA 4FQ1L 3H9SA 1W0WB 4OKDA 3IJSB 4X6EB 4PJHE 2LT9A 5C0GB 3UMNA 3EGXB 1F58L 5AKTA 4DH2A 1KBVA 2VAJA 3V5DB 4PJ5A 3O4LA 3PQYA 5EBWB 2YC1A 3NIGE 2W9DL 4KAQL 1QACA 5D71L 4HWZA 4FA6A 4PSPA 1MI5E 4JDTL 1NC4B 4UUJB 1HNGA 1ECYA 3ZVVA 1X6NA 4LAQH 1YAIA 1E43A 4XTRD 4RWYL 1S8DA 2DL2A 3KXFA 5E6IA 2X7LA 3IDNB 3OLEA 3MLUL 3ARDA 3CVHH 3FZUC 4M8QA 1DBAL 5KSUB 1HSBA 1NC4D 3FN9A 1KNOB 4XH2B 1MVYA 1QOKA 3QC5X 4ADIA 1P84J 2DQIL 1K2DB 5EOCJ 4YSTA 4QRTA 5IJVA 2A77H 2W5PA 2OMWA 3KDMB 4MJ2A 3NJKA 4XVJL 3E0GA 3IPBA 1CTMA 2CBQA 4I13B 5HJGA 4KX8A 3KM1A 4JANA 1A4AA 1WSST 3VM7A 1T6WA 2DMBA 2PPFA 5IHZB 5D93B 4QHKJ 5KTEL 4PS4H 2VLMD 4HIJB 4MFHA 1KGYE 3OXSA 4PS7A 2VZTA 3U0PB 1WBXA 1AD0B 2DF3A 2EAEA 2NQ3A 2PXYC 4L1SA 3RP1A 3RX7A 1BW8A 1YEDA 3H6JA 1NCAL 3P9LA 2BDNH 4K7PH 4ZMOA 2WINB 3QQDB 1VACB 2EXWC 5CN3A 1CLOH 1F1AA 1N6VA 1XGYH 1XZWA 2YR3A 1HAUA 1RUKL 3DX6B 1F4HA 1YN7A 3MR9B 3NMEA 1L7IL 3ASWA 5IB3B 5AG9A 3BKML 4M8VA 4YDNA 1J9TA 1F4XL 1E4KC 3FXIC 4P23A 2E4TA 1F3JA 1KTLB 4L3EB 3TEXA 2C9QA 5JR1L 1FP5A 3CSTA 5IW6B 2V5TA 3FOMB 1WICA 3Q8CA 4P4RA 2YD7A 1JN6B 4KO7A 5F96H 2G60H 3OZ9H 1BQLH 4ZX5A 5MP6L 5AW7B 2XA3A 3JV4A 2H3XC 4O5LL 4L3ED 2H5UA 3QG6B 3IJ7A 1QA9A 3BD4A 1F56A 2G0LA 2PXYA 2Z3FA 4NP4H 4UMGA 4G9FA 5K9JL 2Q8AH 1LEIB 4KUCF 1GTNA 1RJZB 1Z2KA 2YGPA 3L3DA 4K3GA 3VGBA 1CI3M 2J88H 2JLLA 3OPZH 4B3VA 1S9WB 4WWKA 5E03A 2XI9A 4QHLA 1N64H 2NYZA 4OLUL 4FEIA 4LBAA 3VI4F 4XBPB 1F8TH 1E4KA 1TVBA 3ESVF 2WUBH 5A16B 1SQMA 2P44B 3FB5A 3BW9B 2J8UE 5JIPA 4H8WH 3VGAB 1EZUA 1NIDA 3P11L 5DHYA 3MRCA 2AVGA 1I8LC 3HRZB 3UTTE 3MLZH 2W94A 4PV1C 4XNMA 3WJLC 1KJ2H 1NANH 4MNQB 1HTYA 3RZCC 1I7UA 4HJ0D 5HJDA 3LKPA 4X4ZA 4NM8H 5EOTB 1OAUH 1UOKA 2IAMC 2CRZA 5AZEH 3V0DA 4Y2DA 1IGYB 1EWHA 4LLVB 3X3FH 4GKNA 2EILB 2PTTB 5IOPA 5DHEA 5G2NA 3WAJA 4MNQD 1QWUA 3ZE1F 3UIYA 4EUPH 4QXUH 2VJ8A 4GINA 1FH5H 4LVOC 4RETB 1VGEH 4QHPA 3GJFA 4MJ6A 4ZFFB 2OX5B 1XXFC 4Q6IB 5FA4A 4FKEA 2F6AA 1NIFA 3VTMA 2FHCA 2PO6B 2KI6A 2XY2A 4GG6F 4DO4A 1TEFA 4KQ3H 1W9XA 2VQ1A 4LAQL 4IIQC 3OZLA 4JRYB 5AD0A 3CVHL 5F7YC 1I8LA 2ED7A 2PO6D 5D72H 4BK5C 3RWEA 1MCKA 3TT3H 4MX7A 4LPUA 3L2LA 4L29B 1KLUB 3RZCA 3EOBA 2A77L 4FNLH 1D5MA 4EKJA 3IAQA 1LK2B 4JRYD 1ZLEA 8FABB 1DVFA 4RIRA 4CGTA 4PLOB 3UPRB 4L0PB 2EP6A 2NLJB 2XV3A 4JKKA 4QY8A 5JPNA 1DVQA 3O3EA 3CG8A 1C08B 4PS4L 4PD4K 5CNHA 5HY9A 4DUWA 4N2DA 1FZKB 2ZOKB 2NT1A 4NQUA 1NOAA 3P69A 5HDBF 1IGMH 2K4AA 3RA7L 4LHUG 5C3TA 4ZOBA 1MHEA 3IDUA 4K7PL 2BDNL 5KS9F 1BAWA 1KYDA 1CLOL 1VENA 1XGYL 2DQFA 1MCDA 1TZOA 4IIQA 4JJ5B 1KGWA 1QEXA 2DYSB 4I18B 2DDQH 4XXDA 4MA7H 1U3NA 4KTYA 4ZW8A 5JIDA 2YUXA 4BK5A 1RK1B 3I3EA 5IMLA 4KI5E 2BSRB 2IDCA 3GT6A 4XZ4A 5SWQB 3O0LA 4ODWA 4BFIA 1O6SA 1P1VA 2E6QA 2ZUWA 4PR5B 4IU3A 4RZKA 3BEVA 4W9LC 5D7IF 3SDAB 4EO5A 5F96L 5KYWA 2F53B 2G60L 1BQLL 3OZ9L 4MBRA 2DZEA 2FQDA 4YSUA 3FTGA 3SGEH 2GKIA 4OUOA 1SLUA 4WNQB 3HPJA 4NP4L 3SDAD 2OBGA 4TNWF 4AUJA 2F53D 1K3ZA 4PPTA 4U4BA 2JKTM 4WW2F 2EIZA 2XZZA 1KG0A 1RZ7H 5A3IC 2L7JA 3HG1A 5HDQL 4GKZA 4GRWE 3OPZL 4KOBA 2MNJB 4TQIA 2X4TB 1NEPA 1R17A 4MNHB 4I3SH 1I1AC 3CVHB 4LVHB 1N64L 4XP1H 2MHAA 2NX5E 3A23A 3KYMA 3QUML 3MX0A 4LLYB 1JGEB 3HI5L 2BJMH 1F8TL 2X1PA 4QXVA 2ZXCA 1QSFB 5CZKA 2WUBL 4BA8A 2QLVB 4A1RA 4LSRH 3VFOB 1F4WH 3RUGB 4UNIA 4H8WL 4P3CH 5FDWB 3QFJE 1NA8A 4DCQA 2WVSA 3KPQB 4UQ3B 4HLJA 4AQ1B 5IREA 3OR6B 1QSFD 5HBBA 3D9AH 4Z7WF 3MLZL 1EIBA 1ZTXE 4Y19B 1YDPA 1M71A 4NM8L 1OAUL 5AZEL 2UZXA 1A9EA 2ITCB 3LNFA 4UT6A 3ECBB 5J56B 4GP4B 3T0BA 2X10A 3MA9H 1I7RA 4JY6B 5A2KH 3GHBL 4OQTA 5JO5A 2XWBB 1I1AA 2AW2A 4Y19D 2R2BA 4FXTA 4OFVA 4OZGE 3OZKA 4Y9CA 5JHLH 5G4MA 4G5ZH 1BYNA 1F1DA 1FH5L 2ODIA 1VGEL 3BSZH 3CN1A 3EYFA 4QNPE 3B8SA 5DSCA 2Y06H 1MDTA 1AQDA 1DJWA 1G0XA 1QLFB 1YZZA 3CMGA 3QNZB 1R75A 3ISWA 3PPEA 2QTEA 1E5UI 1NFDB 3IJ8A 4KQ3L 2BNUA 4GG8B 1SM3L 5D2NC 3ZO9A 1ADQA 1MLCA 3BCDA 4JFDE 1GZQB 1NSNL 3FTZA 2ZOUA 4DKDC 2D03L 3EZJB 1JWUB 4Z0BH 1CR9L 3SD5A 4BQCA 3KLLA 2NY1C 3GMMA 1N0LB 2PCYA 1HXYA 4PIBA 1KXVC 5D72L 3FB8A 3KLAA 4FNLL 3SBPA 2IOOA 1O0VA 4PCTA 4QRBA 2GITA 1JHTA 4Q97A 4G80B 2IGTA 5EHFA 3UYPA 3WG7B 4D0CA 1DE4B 4N20A 5DK0B 3I02B 2DICA 3FH7A 2CBTA 2VLME 2EUWA 3QUMB 2BOBA 5F0MB 3QE5A 2YA2A 1AXSA 3NJFA 1OTSC 2CGZA 1IGML 2H9GA 1IAOA 2KQMA 3HR5B 2WTRA 3QNXB 2AEOA 4BEIA 1GZHC 3KH3A 8PAZA 4TSBH 1QLEH 1F6AB 2ZP0T 5HYSB 4N8CH 4UNTA 5IVXE 5A2CA 5KG9A 1KLGA 3JWNG 3O6KH 1QATA 2VDQH 3S3DB 4LLUA 2EDOA 3RWFA 2O30A 4MA7L 4DKAA 3NZ8B 1KXVA 1HEHC 4H44C 4DETA 4X4KA 4M7LT 3U6XS 1NAMH 4EEEA 5HVHC 3FONA 4ETQA 4Z6AT 5B1BB 4IDLA 3UO8B 4X80H 2LLGA 4Y7MA 1HL8A 3S3PA 1JXGA 5LNDA 3QXDA 4EUPB 4HMDA 2Y6SC 1U8CA 2ZUSA 1ZT1B 3K1KC 4L3EE 1U3YA 3DUSB 1H6EA 3M07A 4XPFH 2OYLA 1Z0NA 1JF1B 4NPJA 1GOFA 3SDXE 3IFOA 1ZJAA 5B7EA 3S6CA 1KIQB 2YN3A 4XNBA 3WNOA 4WWNA 2LU5A 2RJMA 1GZHA 4FJZA 1BP3B 2XQBL 3Q2VA 4YHIB 3CX5K 1P5UC 1XT5A 1V7NH 1MJ7H 2JNZA 4I3SL 1X9LA 2Z7UA 1LP9A 4UANA 4XP1L 5BVPL 1MHCB 1ZSDB 2C3HA 3REWB 5C0BB 4EIUA 2BJML 1TJIH 4M6NH 2AJZB 1MLBB 4LSRL 1SZNA 1F4WL 4G72B 1ITBB 4PLJD 3GBLA 3FFDB 4AENA 4CJ1A 1LD9A 4ELMA 1BVNP 1OTUD 2HG5B 1NMCC 3BXNB 3D9AL 4NO0B 4UM8A 2ID5A 3WS3A 4GQPH 4PLKD 1IGFH 3KJ4C 2N7AA 1JIBA 2WWMD 4LSTH 5DDHA 3BO8A 4E36A 1DSWA 3Q2NA 2CDEB 4NO0D 4H8HA 4XP5H 3FU7B 3H9HB 2GI0A 5C2BH 3UTTA 3N2JA 1U0QA 3JV6B 4MNQE 5JHLL 3TBYA 4G5ZL 4N87A 2YRBA 1NICA 3BSZL 2FJFB 3GSVB 4X6FA 1QTYT 1B9ZA 3U7AA 1V3KA 4YPGB 1IGIH 1KTDA 3L5XH 4GRMB 2EO9A 2C9XA 2O72A 4PVBA 3IU4H 3D4CA 5C0DA 1FVDB 1OOWA 3L3JA 2R8SH 4XX5A 4Z0BL 4NENA 5KSVA 1PDKB 3OKMB 2CK0H 4L9LB 5MI0C 5CZXD 5F7FA 3AWGA 1G9MC 2HLFC 2ATKA 1TLKA 4OJYA 1C7TA 3D6GA 1YUHB 2LLNA 2FX8H 4JRYE 1CDGA 5KSBE 3EBHA 3MJWA 1R19A 3FQTA 5LO7A 4XNZB 4ZUVA 3TBVA 3MUY1 2XCMC 4JRLA 4KI5C 4JFOA 1H3GA 1U8PB 4GO9A 1S7VB 2FGZA 1KTJA 3EAKA 1FGNL 1CF1A 3Q2CA 4RAHA 3RWIB 4PJ7F 3DX9A 1OANA 1ZHBB 3Q6FA 2J43A 3DX2A 4XN7A 4TSBL 1QLEL 2VQ4A 4BDVA 2X4SB 2A4CA 4X4XB 2VERN 4N8CL 1E5BA 4F57H 4FNTA 3SQBA 4ZI8A 3O6KL 2VDQL 2I26N 1QVOA 1UZ6E 1E5ZA 2XX1A 2GPZA 5IR1A 1XGPB 5TFSH 3KCWA 4WU7B 1MEXH 1PIFA 1NAML 2CQVA 1SOQA 1ZGLP 3EOAA 1U92A 3KWWB 1SJEA 5CINL 1JE6A 4X80L 1EZLA 3T4AA 2CDFA 1CMOA 1PCXA 3ABLB 3CNKA 3GB7B 3QWNA 4TNWK 2AZUA 1OK8A 4B6ZA 4YVUA 2HB0A 1ZVYA 4W9FC 5AB0A 3MA7A 5ICYB 1E67A 1S6NA 4ENZA 4XPFL 2IADB 1L9PA 1EGJA 4NJAH 4P2YA 1T83A 4V1DB 1HCVA 3MROA