4KO7A

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/w48f/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48F/V95I)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ko7A00
3AG2B 2HX7A 1SJMA 1AR1B 2UXFA 4YSDA 2JKWA 3KW7A 2BW5A 4NERA 4QLWA 3FYIB 1AZCA 2IDQA 2BW4A 1ZPUA 1OOWA 4GY4A 4YSCA 2PP9A 1ET7A 4G71B 4DP9X 3UGEA 3KW8A 1SF3A 2R7EA 1DYZA 2BO0A 3WNJA 1ZV2A 1W8EA 4E9YA 3CDZB 3T71A 1AS7A 2CUAA 3T6WA 1GY2A 4G70B 4A2GA 4E9WA 2VSMB 2YAPA 1ZIBA 1SHXA 1AZNA 1X9RA 2J55A 1JVOA 2DV6A 3X1NA 3T9WA 7PAZA 4N8UA 1QHQA 2TSAA 4YVNA 4HCIA 2FQGA 2GB2A 3G5WA 4E9XA 1F56A 1E67A 1JZJA 1V55B 3HB3B 3FU7A 3MX0B 1BXUA 4AX3A 3QJVB 4G72B 3IN2A 1WS8A 1BYPA 2E86A 1L9PA 2GI0A 1J5CA 1J9TA 1JOIA 3CG8A 2XU9A 2XWZA 4N4YB 1NIAA 1V54B 4A2DA 2UXVA 4L0PB 4W9ZA 1PLAA 3NJHA 1PZCA 1L9OA 1XB8A 4KO5A 1AAJA 1M57B 1V10A 2CALA 3QJRB 1NDTA 1J9RA 4F2FA 1PZBA 2FTAA 3UABA 4A2EA 4A68A 2CCWA 4WKXA 3SBRA 5FC9A 2XYBA 1PLBA 4KO6A 3DKHA 3ZDWA 1GS8A 3NJMA 2AVFA 1MG2C 1E5ZA 4HCGA 2IDSA 4GXFA 2FJSA 2HRHA 4YSOA 4DP4X 2TSBA 4A2FA 1AACA 3BVDB 5B1AB 2VW6A 2H47C 3PAUA 2PPAA 5I6LA 2EIKB 4KNSA 1KYAA 4GP4B 3TASA 3NJKA 1J5DA 1IBZA 3PPSA 4CSPA 3S8FB 2Y1AA 3IEAA 2MRYA 1OE1A 2I7SA 5PCYA 2I85A 2YAFA 3CVCA 3PXLA 3ZX1A 6PCYA 4HHWA 1KCWA 3RYMA 2DWSA 1PF3A 2IWEA 1PCSA 2HZHA 3CVBA 4JHVA 2I7OA 1KCBA 1NIEA 3TBCA 3JTBA 2GC4C 2BP0B 1JXGA 4UF7C 3QJTB 4A2HA 1L9RA 4E9TA 4GYBA 1JZEA 2UXGA 2FQEA 2MTAA 3TBBA 2PP7A 4ENZA 4HALA 3FSAA 2AANA 3H56A 1URIA 2CAKA 2IDTA 2ZWNA 1RKRA 3OMNB 4DP1X 2VN3A 4UAHA 2FNWA 4BXSV 1NTDA 5I26A 2W88A 3WNIA 2PCYA 2RACA 3S3DB 3T6ZA 4E9RA 7PCYA 3NT0A 4A67A 3SBPA 1NICA 1KBWA 1GYCA 1A65A 3QJQB 2AZUA 1E5YA 1WAEA 1HFUA 1CYWA 1L9TA 2QPEB 4DP5X 1JZHA 2YAEA 1A4CA 5AZUA 2IDFA 3NJJA 4P5SA 3EH5B 1QNIA 2UX7A 3DIVA 3FT0A 4HAKA 5B7FA 1KDJA 1FA4A 2YXVA 1KGYE 5F7BA 3AG1B 1M56B 1HAWA 3IN0A 2VSKB 3GDCA 9PCYA 2BZ7A 3CVDA 1OF0A 2H3XC 3AG4B 3ABGA 3FU8A 4BWUA 2XV2A 4GP8B 1SFDA 5F7AA 5B1KA 5B7MA 1OCZB 1MDAA 1A4AA 1PY0A 2BZCA 2BP8B 2GIMA 4BK5C 2J57A 2IH9A 4YSUA 3WIAA 2FWLB 3ASOB 1ET5A 1AZUA 1TEGA 1XMEB 2YAOA 1NIFA 1E30A 2CBPA 3IE9A 1KBVA 1FFTB 1TEFA 1B3IA 2A3TA 3S8GB 4E9QA 3NSCA 4TXVB 3JT2A 4QKTA 4HZ1A 5I5IA 2GBAA 1A8ZA 2W8CA 3CZUB 4X4KA 3UADA 4BWWA 2WO3B 2OCCB 2WSDA 2P80A 2FT7A 3IBOA 3QJUB 3ZBMA 2BWDA 1J9QA 2DYSB 2XXGA 1NPNA 4GP5B 3ASNB 1GW0A 3UACA 1NWOA 1OE2A 3AZUA 4HIPA 1J9SA 3PCYA 1NWPA 3OMIB 2OJ1A 2HRGA 5D4HA 2PPFA 1RZQA 3H4FA 4M3HA 2PPCA 3V9EA 2PLTA 5AKRA 5I6KA 2IDUA 1HAUA 2LLNA 1SFHA 4EF3A 1AG6A 2OV0A 3FPYA 3X2QB 4NAJA 4BDVB 1GR7A 1GY1A 3D12B 4G7QB 1ZDQA 1KV7A 2WO2B 3DTUB 2IAAC 3FQ1A 3CDZA 3X1BA 3MBWB 4DP8X 1ZIAA 1L9QA 1T5KA 2YAQA 3PAVA 4PCYA 6PAZA 3WKQA 3T6XA 1MG3C 1W6WA 4YSPA 3OM3B 4M4RB 4YSAA 1A4BA 1L9SA 2BP8A 2EILB 1PAZA 2XV0A 3S3BB 3EH4B 3FSVA 3NSYA 1BQRA 1PNCA 2PP8A 5I6OA 3QJSB 5I6PA 1NIBA 1A3ZA 3FPXA 1GSKA 4G7RB 2Q9OA 4KOCA 1BQKA 1SHWA 1EZLA 1AANA 3NJIA 2DWTA 5I5MA 1OCCB 4FAAB 2PPDA 1BAWA 4P5RA 3FU7B 2FT8A 2FQFA 2B08A 4FA7B 3FU9A 1ADWA 1AG0A 2CJ3A 2VW7A 3FSZA 1SDDB 1XB6A 4MFHA 4YSEA 4BWTA 1NIDA 1AS8A 2ZOOA 1M9WA 3AG3B 1ETJA 1ID2A 2IWKA 4DP2X 4KNTA 1PNDA 3WG7B 1NPJA 2X87A 4YSTA 5D4IA 4CSZA 1IBYA 3NJGA 5AFAA 1R1CA 2UXTA 1XB3A 1KDIA 3N55A 2XV3A 3WI9A 2BWIA 1ILSA 1ASOA 3BQVA 1PLCA 4F2EA 1AQ8A 4BXVA 1ASPA 1DZ0A 3X1GA 4UANA 1OV8A 1AOZA 1JZGA 3ABMB 1JVLA 4NB7A 2Y69B 2VM4A 4HCFA 4BDVA 4KNUA 1JZFA 1WA1X 5B7EA 3FYEB 1N70A 2YAMA 4KOBA 4G7SB 1VLXA 3PLYA 4DP7X 1TKWA 4PAZA 5LDUA 2DYRB 1OCRB 1GS7A 4DP0X 4W1TA 4ZK8A 1MZYA 4YSRA 3QQXA 1I53A 3OMAB 3L45A 1ILUA 2JXMA 1GS6X 5B3SB 2QPDB 2B3IA 3NJNA 2BP0A 3NSDA 3AY2A 1RCYA 4AKQA 1AS6A 3SBQA 5B1BB 3FQ2A 3V9CA 4DPAX 2UX6A 1BXVA 4K9JA 1E65A 3FSWA 3FQYA 1TU2A 2HX8A 4YVUA 4KO9A 5I5JA 1BXAA 4Q8BA 3U25A 1CURA 2GSMB 3ABLB 3N2JA 5D4JA 2N0MA 3NP4A 1OE3A 1IUZA 3NP3A 3EF4A 5I6NA 4JKNA 4AKOA 2PPEA 2QDVA 2QT6A 4E9SA 2BHFA 1AZBA 1SNRA 3EHBB 2XX0A 1QLEB 2QDWA 1SDDA 2XVBA 2YXWA 1AZRA 3C75A 2FQDA 2JFCA 3TU6A 1NZRA 2GC7C 5PAZA 2J5WA 1SF5A 2EINB 3NJFA 2GHZA 3ZIYA 1OCOB 4DPCX 3WKPA 2VW4A 2XXFA 2XX1A 1JXDA 1WA2X 5A7EA 2EIMB 2HXAA 4DP6X 2EIJB 2PCFA 3GYRA 4AZUA 2NRDA 2R7EB 2YARA 2XLLA 2H5UA 1N68A 5E9NA 1FWXA 3T6VA 1NINA 1MZZA 1PZAA 2P80D 4WTQA 3SQRA 2HLEB 1BEXA 3X1EA 1JXFA 1BYOA 3NYKA 2VM3A 5EHFA 1UATA 1BQ5A 1ASQA 2IH8A 1PMYA 5I28A 2ZONA 3HEIB 1ZDSA 3FS9A 1ET8A 4YSSA 3NSFA 1RZPA 3PAZA 4E9VA 3TA4D 2ZXWB 5IY5B 1WS7A 5I6MA 1EHKB 5ANHA 4A66A 1CYXA 1X9UA 3QPKA 3ABKB 8PAZA 4YSQA 3OQRA 2YAHA 1CC3A 2HX9A 2XUWA 3GXUB 4HHGA 4Q89A 1JZIA 3EH3B 1IKOP 4KO7A 3H4HA 5B1JC 3ERXA 2FT6A 3S3CB 4YL4A 2Q5BA 2X88A 1JERA 2AZAA 2VMJA 4F7KA 2YQBA 2DY2A 3X1FA 1AIZA 3UAAA 3NJLA 1YLBB 5TK4A 1CUOA 3OD3A 4RH4A 1W6LA 1IC0A 2J56A 3UAEA 4AKPA 4DPBX 5TK2A 2IWFA 2AFNA 4JHUA 4AI7A 5B1JA 1WA0X 3AW5A
chains in the Genus database with same CATH superfamily
5DD1L 3GSUB 3FF8A 5INCB 2CLVB 4F92B 3QEGL 1AR1B 2BNQA 2V5RA 5HGHA 3RDTD 3HTLX 3HN3A 2MFNA 4TUUA 4LQFL 5C8JB 4FC3E 1AZCA 4O00A 2Y2TA 3MGOA 4IRZA 4WJKB 1B0WA 2CCLA 1QQDB 1F4AA 4R7VA 5SWZE 1MCIA 4ZUSA 5IFJA 1J10A 15C8L 4PVMA 4WQOA 2IOIA 2X28A 2OM5A 1XMWA 5E00A 5H8DA 3TN0A 2V17L 3QB7C 4WWNA 5FM8A 4E9WA 2R1YB 4N2CA 4OM1L 1T3FB 5BZWA 1JPGA 5D96B 3ARFD 2J3SA 4QJ3B 3T9WA 4FFZA 2LU5A 3A6OA 3L5WB 3MNWB 4KU1A 4E9XA 3NPZB 2ZOTA 4JEGB 2DB8A 5KAQG 2B0SH 4FQIH 1MAJA 1ZSDB 5ITFA 4AW4A 1USZA 5JUEL 4JPVL 3MTRA 3PWPD 4PCSA 1BYPA 3TH2T 2D7OA 2E86A 3L3HA 3DX7A 1XEUA 2YKLH 1PBYA 4WK0B 2E7DA 3KCWA 1ZTXL 3AWFA 1ZVSA 1MCJA 2EDEA 2WXLA 1L9OA 4WWKC 4CMMA 1M57B 3VNZA 5DJCB 5EFIA 5FXCH 4LVOC 3OKNA 4XB3A 1IAIM 1T89A 2CBQA 1WHPA 1NANH 1VJSA 2VH5L 1I82A 5I23A 3T4YA 4XN9A 1F8TL 3LZFL 3BRDA 3GBML 1ZPLA 1T0OA 3BUYA 2JK5B 3QIBB 1BAGA 4FP8L 4RBPH 3ROOB 1E5ZA 2WNWA 3O41B 2YHGA 5CU9A 3WEMA 4A2FA 3BD5A 1SXAA 3UCQA 2B9BA 5J11C 2H6PA 3WFEL 1MF2H 2V2WB 4HQQL 3SQOH 3DROB 2C9SA 2J88L 4M56A 5D1ZD 3UEZA 2OMUB 3EYFB 3BZ5A 4PJ7B 3EG9B 3IJEA 1HU8A 4FNPA 3RX9A 5F1IA 3O6KH 3F04A 5H4ZA 4GAAA 5FV1L 5E8OA 3SO3C 4PJAF 3BT2H 3MTXA 4YUEL 1D6EB 1UXSB 3WS6C 4AGNA 4EKJA 2AJVL 4NO0B 2VDNH 4JHVA 5HJ3A 1GC1C 4CDHA 4Y5VB 5EZOH 2W0FB 3O6FC 2ZYSA 3K2UL 5D7LE 3WHXB 1C08A 1I31A 2ADJB 3DX0A 3IDGB 1MI5D 1YDPA 1S7RA 3SCMD 3U4BH 4HUVA 2UZXA 4WTZG 1MUJB 5I16A 5BOPA 4Y2DC 1OGTB 4ZXBB 3TVMB 3T0DA 5E4AA 3KPRB 1OGAE 4FQHB 3L7EA 4MRBA 4LVHB 3KJ4C 4FRWA 1U8MA 4U1HA 5HHVH 4AV4A 4U1GB 2X4SB 4RMTA 3ULSA 1OK0A 4XWGL 5F72S 5I26A 5I1EL 3VFGL 3QUZA 4RGNE 5DHVB 4B9FA 2X4OA 3PIQB 4PP1D 4Y19E 5EC1B 2Y4SA 3O4LD 3ZO0A 3LVEA 3TURA 2QKIA 4JHWL 4FG6D 4R0LB 2QPEB 2IGFH 3BSZA 1MFDH 2DQUH 3QA3A 5IG7B 3ULAB 1OAJA 1A1OA 4J3BA 1L3WA 2BWQA 4KFMA 1UD3A 3RFZC 1CR9H 1TT6A 4MDJB 2P26A 3D4YA 4PRHB 1A6AB 1NCJA 2G75A 2D9QB 4QYOA 2WMPB 3FRPA 5HVHC 4MS8C 1ERNA 2JKNA 2B59A 3CFDA 3K74B 3ZE1E 6FABH 3FZUD 3TBTB 3FU8A 3IFLL 2XV2A 2GSGA 5B1KA 1Z5HA 5TE7H 1WZKA 2R9HD 5AVUB 4N28A 3ZKSD 1X5XA 3SSGA 4LLVB 1NBVH 5CR1A 1PY0A 3VM5A 1DTUA 1KLUB 4WI2A 1FGNH 3MRPA 1L0YA 5HHQA 1YJDC 1RPUA 4FXTA 4S1DC 5H4YA 4I48A 2P7TB 1JV2A 2Z0BA 5E4IA 3JTTB 5KSAB 5BVPH 1AH1A 2OCFD 2CK0L 1KJ2L 3PF2A 4U3XA 4UB0H 5FKAA 4LT7A 3IK2A 3LPFA 5BRZD 4J8QA 5F7NC 4P2OA 1E8YA 2IPTL 3VWKA 3ZK0A 3MLPA 4U7SA 5HI3C 3OKOB 3KYAA 4AC2A 2DIAA 1ACYH 4F33B 5DJ8A 2AK4B 5B38A 2Y5QA 4ERSL 1MFBL 5AB2A 5I1CL 3SY6A 1VADA 2CM6A 4HIIB 3IWVA 4BWWA 2JJVA 5IMLA 1BQUA 4HZLA 4Q6KA 2E0PA 3SO5A 1XGTB 1JNLH 4BSVA 3P9LB 3VXMD 3CFCL 2CGYA 5JPNA 4RFOL 2EVHA 5G4MA 2FEDD 4JY4A 4JFEE 2B7DT 3F01A 4XMPL 3SY0B 1E7VA 4P5MB 4GQPH 1TFHA 2CMRL 1GW0A 1AO7E 2NCEA 5CXPA 4AJYV 1NWOA 1J9SA 1WAAF 1NGWB 3GRGA 3IMTA 3JWOH 5DRZA 2NQCA 1FGVL 3VVVA 2C26A 4ODTH 5EMYA 4H8QA 4R4FL 1ORQB 3TJEH 3F83A 4KC3B 5EA0H 5C0BE 4L4TD 4L23A 5AW8B 2WYZA 3E6FB 4A04A 3D2UD 5JA9A 4CC4A 1F11A 4G8GD 4IGBA 2YA0A 4N87A 4L8DB 1YEFH 3ZMRA 1E40A 5C0GB 1CI3M 5D8JL 2AEPL 1DJYA 2CO7B 2WO2B 3MV11 4YDMA 3HHSB 1XX9C 1NMBL 3EGXB 1ZIAA 1NCGA 1T5KA 4M7LT 4OD3L 5KJ4A 1KLGB 2PWEA 3FN0L 1PCXA 2JTDA 2H9GB 3ZTJH 3HI5L 4HX1A 3KLHC 3L54A 3BZDA 5BZDB 4RRPA 2V37A 2P43B 3T5WA 4ATTA 4NRXA 4MHHI 3HG1A 4MJ4A 4ZG1A 5GS1A 4ZO9A 5KBMA 4DTGL 3EH4B 4N2FA 5I6PA 3UPRB 2K0RA 3HNSL 4XVJH 1Q4NX 4YX2H 2F54A 5K5YA 2HN7A 5EBMB 1ANUA 3NK4A 4BQ8A 4TSAL 4QHKI 2CHXA 3A67L 4FI6A 3ZDZF 3UP6A 4EDXB 1FIEA 4FQCL 3VRJB 5ABAA 4GW1B 1JD9A 2FQFA 2W9EH 4NX0A 3S3SA 4FA7B 5DFVD 4Y16B 1U58B 3II2A 2NW3A 1W8OA 4LSVL 4OF6A 3BKMH 3D0AA 1B0IA 4JY6A 3N44B 2QLYA 3WJJA 3RGBA 4XO8A 1XB6A 4R4ND 4YSEA 5GS0C 5INDB 1SQMA 5EU6D 1ETJA 3IGFA 2IWKA 1LD9A 1AY1H 1LO2H 1A1NA 3HAEB 4M8RA 4KKBD 3WG7B 3L3IA 2LU7A 4ICWA 3BZEB 1IM9B 3K6DA 1WQVT 2E47A 2QQNH 3IRPX 3GMOA 5DZPA 3QJHB 2WNGA 5I1KL 2R4RL 3Q43A 1ILSA 1ASOA 2K45A 2VLKE 3PABA 4FOMA 1VERA 4GG8A 1HL9A 3C6LC 3NABH 3V6ZB 5F6IB 3RAJH 1CICC 3X1GA 1S7TA 4ADJA 1YEHL 3N1QC 4G11A 1JVLA 2Z8RA 1U8NB 2NYKA 3BAWA 1JPST 3BGFB 2HKFL 2I07B 1N70A 4LCWA 2O61A 4GSDH 5E4EC 1TKWA 1E6OH 3EHBD 4UT9A 3HPLB 4PJXE 5JDJA 4HKZB 1RJYB 4GW5B 5CHNB 4YBHA 4XO5A 1XCTA 5EUKA 4YSRA 3VI3B 2VN5A 4HBCL 1QUPA 1R46A 4ZT1A 7CGTA 4B9JA 2NTSP 2DDQL 3WIIL 1SHSA 4AIZA 4CSTA 2GTZA 2BS9A 2O6CA 1QMUA 5HGDA 1N10A 4AYDC 4CILA 1A6TA 1BD2E 1JMZA 2UX6A 5DZAA 1P6AB 1WF5A 1OGAB 3OAZH 1CL7I 1WFUA 4QHKJ 1QO3A 2BZDA 2WOBA 4NM8H 5IJDC 4EIGB 2DLEA 4I18A 1GH7A 2LLGA 1C5BH 4Y5XC 4N8VB 5FYJD 4QRFA 3QUMH 4QF1A 2VQ1B 3PL6A 1TJGH 4HWUA 3WY2A 4YHOL 4RGNB 4DQOL 1KB5B 1MVUA 4PY7B 1PZSA 4Y19B 4R4BB 3FOMB 3S88H 2W91A 3MYJA 1K2DB 2G2RA 2JELH 3AU1B 1NGYA 3L6FB 4D0BB 4ZUVA 5IBTL 4NO2A 5EU4A 4AMKH 2NLJA 1RQ5A 4NO0D 4F3FA 2EDDA 2HUEA 2A77H 2BDNH 4HK3J 5A7EA 2ZUUA 2J21A 5K9KA 5FW6A 4NHCH 3C12A 25C8H 2ATPA 1YEJH 3C5SA 4PP2B 3HZVB 4HIXH 4EOWL 4L3CB 4XVUC 3ZE1B 3CFIC 3HAEG 1WC7B 2JTYA 1DBBH 3A4FA 3PQYA 1DL7H 3BUIA 3KPRD 4RNRA 3T0XA 2HAZA 4QLRA 4YQXH 3D3VA 4FULA 4YDIH 3VGDA 1BQLL 1ZANL 2ORBL 5BZXA 2NY1B 3SYOA 3V9FA 4DN4L 1LO0H 4DERA 1FNEB 3C5JA 2YOAA 3CNKA 3T3MF 4IBWA 2CUIA 5DZOA 4MA8L 4CRPA 1D5BB 3S36L 2ZUWA 1HNYA 4IKNA 4WKZB 1CYXA 2UZYB 3ZOAA 1AGFB 3QPKA 5E6IC 4MCYB 4G6FB 4N8CH 3VH8B 4ZMQA 3DGGB 1RZJC 4PRHD 3VFNB 4YSQA 4FQ1H 3RWDB 3MN8A 4JKMA 1Z6JT 2WVTA 5IJCC 2HTKC 4UAOB 1H0DB 4JFPB 5B1JC 4RLDA 2XKUA 2FX9H 2BSBA 3BKYL 3TBWA 2J72A 2OFQA 4JFEB 4I0CC 4AGOA 3NESA 4F7MB 2YQBA 4KAQH 2ESVA 1FCGA 1WV7T 4GBXB 3RX7A 1AO7B 5E99H 2DQIH 4ZMOA 3MRIA 4I1NB 1MQKH 1W6LA 1TVBB 1FDLL 1X5KA 4J3OC 5MHSD 4PIBA 4N8VG 4B9KC 2Q7YB 5A2LH 4JHUA 3VJ6B 4PW9A 1GYAA 5F71A 3CSFA 4JANB 2H1PH 5C0BB 3WD5L 3INUL 4YZFE 1G7PB 3A6CH 3IFNL 1NFDA 4X80H 4YK4B 1PLGL 5IEKA 1A5FL 1T83A 2ZSWB 1ZE3C 1PAMA 1U6AH 2BNQE 2G60L 1UWEH 5GGUA 3D69B 4KX9A 3LRSB 4XCFH 1IVTA 1IE5A 5FFLA 3IBEA 3G6JA 1BOGA 5TPWL 4KY2A 2J8UF 3NRPA 1DUYA 3TIDA 3MV7D 3SBWA 3ETSA 3ZDYB 4E9YA 5K9OB 3TX4A 3EW3B 1H3WM 5CEZE 2X6CA 1A3LL 1QP1A 5GRXG 5JW4Q 3T6WA 1KIQB 3T0EC 4PB0L 4XRCB 4H8WC 1F58L 4W9HC 1AZNA 3U0WL 3LTVA 1LP9F 3E38A 3ARBA 4Y4KB 5KBLA 2BVPB 3BVNB 2AQRA 1U8QA 3CK0L 3ARGA 1X9QA 1CDJA 4EQ3A 4OV5B 1Y0LB 5CN1A 4LU5L 1M3JA 1IJ9A 2VM9A 5HPMA 1BXUA 4K2UH 5I1DB 3NN8A 3MFFA 2CIIA 2IWGA 4IRZL 5F8QC 1HIMH 3RBSA 2WWKO 1BIHA 3UAFA 2W9DL 4LASL 3PE9A 3ZO9A 3ZT7A 5CEZL 4P57A 3QG6A 3MRGB 5CSZA 5SWZD 3ZHKA 2WXPA 5C92A 4LLQB 3MMEA 3VH8G 1G1OA 4OFPA 1H3XA 2JJSA 4PJGF 3MKGA 2EVJA 1NDTA 4L9LA 3FKUS 4LHQB 2BVOA 1U95B 2EE2A 4A2EA 1R5WB 2VXQH 3E8UL 5KW9L 4FFZL 3V0JA 2G5BA 2VLKB 1GS8A 4NZFA 3NJMA 3KAAA 4LE8A 1UXMA 5IMMB 1KIRA 2Z65C 4XVOA 1LK3H 4MXQC 1M2VB 3V52H 3G6DH 3PWJA 1KFGA 1XCWA 4Y16D 1HCFX 3BO8B 3JTSA 4AQEA 3DRTA 2XFXB 1J0KA 4NZUH 4LSDA 4MD4A 4KVPA 3HR5B 1PCSA 3BPLB 1U3ZA 1F1DA 4JN2B 5CF3A 1DQMH 2P47B 4RAVB 4CKVX 1U92A 5IR1A 4MDRA 3RZCA 1NCIA 3GK8H 2COQA 3WSQH 3CBJB 5EOQL 4P4KB 2FD6H 4ZQKA 1IAII 3FHAA 3KL0A 2ZCLL 3VGAC 1BIIB 1BM7A 1MCOL 3CHOA 5L9DL 2DWDB 4OLYH 1W8NA 2FQEA 4Y8AA 2PP7A 3SGJA 2P48B 1E4KC 2ZKWA 2C3WA 4AQ1A 1SDYA 1EEYA 1NEZA 3PP4H 4UAHA 2FNWA 4YBQC 1XH3B 1NTDA 2ZNXA 3WEBA 2L7QA 1OSPH 2PCYA 5D7KD 2NNRA 4P46D 1CTMA 2WBJB 3SE9L 1T2QL 1SBSL 3ZDXF 1BAFL 3IDXH 3FBKA 1AXSA 5E2UL 1UJ3C 1HZHH 3QC5X 1L9TA 5AD0A 5JXEA 1OL0A 5L7XH 4YHLL 4L37B 3CFMA 5D7LD 3WO4B 2FECI 5IESH 3BEWA 4I0PA 3TWCH 2QR0A 2D3LA 3QCTL 2DWEB 4PREA 4MSWA 1G9NL 4NWTH 1T7VA 4OZIA 5GRVL 3T0VA 2F8XC 5AZ2H 3BXNB 1YEGL 3LX9A 1HYSD 3DBXA 1U9KA 2VDKL 4P2OC 2IFGA 2CKBA 4JM2B 5H35B 1AHKA 3K46A 1KN4H 4KK9C 1AOHA 5B21A 3MRJB 4OCYH 1F3DH 1YNLL 1T7YA 4A7GF 4TSCH 4ZUWA 4HHAB 1SDAB 3T0WA 3BSZL 2DQCL 4YDKL 2WCGA 1KZQA 4FHKA 1JGEA 3HS0B 3N42B 3HRPA 1JDDA 3IE9A 2CLRB 4NKOA 3WNPA 4OI9A 5H94A 4AEFA 5KYXA 1E8WA 1TEFA 1OANA 3S8GB 4LAJH 4MXWH 3ECVA 1RIHH 2ZG3A 1FP5A 4E9QA 4XVTH 4MZRA 4WHCA 4WDIB 5IB3B 3TEUA 4IMLB 5MENA 4IDJH 3OJDA 1OAUH 1TTCA 2EP6A 5SX4H 5IP4A 4PMFA 3F2LA 2CNYA 4M4PA 3QJUB 3H9SD 3ZTCC 4FXKC 4LCUA 4OSUH 2NY5C 4P0DA 5DK3A 3QEHB 5ITBL 1EJOH 4IGBC 1NCWH 1ES0A 2WSKA 3A4DA 2R56L 3HMXH 5F0LB 1J18A 1GGBL 2OJ1A 3VFSB 2EH8H 1RZQA 1I7TA 4AQ8C 5AB9A 2X4NB 4N20A 3O0RH 4ODWB 5MEOA 3LN5A 3O3DA 4TVPE 1M05B 3L5JA 4FFTA 5AKRA 4FS0A 5FYLE 2BNQB 1CVRA 5K1VA 1CU4L 5HGHB 4FFWD 3AXHA 5GS1C 2X38A 3FB7A 4FZEL 1WT5A 1PIGA 1PS3A 1AXTL 1WISA 1ZDQA 2CD0A 1IB5A 1SXCA 3KYKH 1J5HA 3UCRA 4PEEA 2YK1L 4JFED 4M5ZH 4ZUSB 3FU0A 4FTVA 5AL0A 3ECUA 1D9KA 1RK1A 3X11B 5D1XA 3U30C 3CFKA 1AO7D 4TVPL 3TN0B 1EA9C 3BP5A 5FYLL 5F21B 1E9OA 3LN4A 3I2CH 5BZWB 1JPGB 2A9AA 3CFJA 4WGKA 2FDBP 5ADPL 1CYGA 1JI2A 3DVFA 4KFZC 5L2JA 3GM8A 2J73A 3POHA 3PGFH 1C12A 2F54E 4EI6A 1AJ7L 1O6TA 4JFHE 3QXDA 5F1KC 3AROA 3C5ZD 3L3KA 3RPIA 3P3TA 5C0AE 1ADWA 1AHMA 3AXLA 3DX7B 5I8CA 3FFOA 3QIWC 3G5VB 3LPGA 3I3BA 4XX5A 4POYA 2C3HA 2XPYA 3JWDL 3GI9H 1P2CA 4PS7A 1U93B 1ZVSB 1M9WA 3GXIA 4WHDA 2FYVA 1UC6A 2D7NA 3BKCL 1YNTF 5EFIB 2PXYC 2JB5L 4YSTA 2YGPA 2BFGA 4YFLF 3M1BA 5DQJA 4KK6C 2WK2A 3LV3A 3T4YB 3WTYA 2B4CL 2E7CA 3VFTB 1CLOH 3BE1H 3HE6A 4NCC1 3BUYB 5DD1H 4F57L 3QEGH 1FFNA 5HYSA 5TF1L 2NNAA 1XCQA 5F8RC 2HB0A 3QEUA 5I0VA 1F4WH 3UJIL 4JREB 1HH9A 5AKVA 2H6PB 2ZAHA 2ITCB 3LEXA 5JA8B 3FYEB 3GT6A 3MV9A 5FLUA 1VLXA 1B9KA 4UYPA 1S78C 2R69A 4HJ0D 3T2PA 3H9HA 1A1MA 4FDWA 3ZGHA 5IHZA 3IJEB 4LCWE 4R83A 1XGZA 5F1IB 3ET9F 4F58H 3QUGA 3GF8A 1SYVA 4IK7A 4Z7QF 5DR5L 5BZZA 5IHLB 1E5AA 2YD9A 5E8OB 4BH8A 3NQKA 4U2YA 1J8HD 1E42A 4KDTA 2BERA 2WXOA 3SE8H 1H9DA 1E4XL 3B2VH 2V17H 3MJ6A 4J3OG 5HJ3B 1GPOL 1KXTB 1TXKA 3NCWA 4Z3JA 2DAVA 1C08B 2VLKD 4RMRA 1X4XA 1KF9B 2XHNA 3TT1H 3VI4F 1YDPB 1ZSHA 1B2WL 4U6VH 1AC6A 4FNLL 3B6SB 4PI2A 3ARZA 4HWBA 3NPSC 4JG0L 5LCVA 2X2HA 3J07A 3L7EB 1IUZA 2C3VB 3QRBA 3W5NA 2P9RA 4Y4HA 4UT9L 1U8MB 2HUHA 1RUAL 2VSCA 4XOAA 5AW5B 4NKIL 3GJFH 3ULSB 5F96H 2VDKB 3R7QA 1ID5I 5E03A 3QQ4A 4KKAD 3HNTH 1ZTXH 5IQ7L 1NMAL 1E2ZA 3QUZB 2X4OB 4QHUA 4DVBA 4GG6F 4NFBA 4HPOL 1NZRA 1WWAX 1CFQA 2QKIB 2EDFA 4NNYA 4KKLC 5LAXA 4D8OA 4L4JA 5LN8A 1ZEAL 4UUJA 3UBXA 5JIDA 3R8BB 2GJPA 3QA3B 4QIRA 5E8NB 2GEEA 1A1OB 4LARL 3MAWA 4FYTA 1OTUD 1IBHA 2OL3H 1ICTA 1BD2D 1HOEA 4RMUA 3GBNH 4P4KD 2A1WL 2G75B 4QYOB 1IGML 2Y1YA 2O4EA 3ME0A 4RDQF 3FRPB 4FP8H 4X0KB 2YUVA 4Q9RL 2B59B 3CFDB 4OIFA 1WSST 3QUYD 1ZLSH 5I1LA 2HLEB 5GGSB 3PQYE 5F93C 2JV6A 2GSGB 4HQQH 4DZBA 5A40E 4OLZL 2EECA 3MCLL 2J88H 4P8QA 5MP6L 3ZW3A 3RUGE 4P99A 3TYGL 2X05A 1N6VA 3V0DA 2MPAH 4X9FA 5HHQB 4PRIE 1GGIL 3FS9A 1MJ7L 4I48B 3B3BA 4PBDA 3HAEH 5LNGA 3AQZA 3JUYA 2YPVH 4K7PY 2X1XR 4YUEH 2LVCA 1YPZF 3BI9X 2B2XH 3TNMA 5I74C 1S7QB 5FKAB 4PU2A 3ABKB 3B56A 3VWKB 1IGCL 2C4FU 3MGTA 1SXNA 5DJ8B 5B38B 2Y3AA 3Q2WA 3LZOA 3SPCA 2P49B 4HD9A 4ZMNA 4OLXL 3X3FH 3OC5A 4OJDH 4HZLB 4IDLA 4BSVB 4EZMA 3PGCB 3HMWL 4HOWA 5JPNB 1PKQA 3X1FA 1U41A 1PG7X 5I1JH 3WE1A 3VFGH 1CJYA 2J56A 4LMQE 3VD3A 3TJPA 3ILEA 4AKPA 4FA8A 1HKLL 1U3HA 2AFNA 3ARVA 1R5VA 2AJSL 1J5IA 2CRYA 5T1KA 3C08L 2M83A 4M62L 4OCWL 2NY4D 3RZWA 3SE4C 4QNPE 3EDKA 2NR6D 2BW5A 3BH8A 5D5ME 4OR1A 3D51A 2KL6A 1NFDE 2VB5A 4ZW3A 1F11B 4DP9X 1KCLA 4PJBF 2OULB 2MKLC 4HXBL 2YXMA 2IOMA 3ZR5A 1GC1H 2VLRA 5I71B 1QBLL 3G6JE 4E68A 2E7LA 4APQD 4N22A 2MIZA 3S97C 3KGUA 3IB4A 3MBEA 2ZOLB 3DDFA 3QXAB 3FRPG 3L1FA 4HX1B 4LL9A 1KZYA 5DJXA 2FSDA 2ZYIA 3DHUA 4NRXB 4YBLB 5DLML 5HDBF 2OLDA 5FHBH 2P8MA 1MPAL 4JS7A 4I1PA 1FIGL 3OPZL 2AGJH 5IBLC 4U1MA 1KJ2H 1E3XA 3P69A 4HOXA 2JJSC 2F54B 2IPTH 4L9LC 2HN7B 5I18L 3MCG1 2ZXCA 1YNKH 3PHQB 2CIKA 1FN4A 1LHZA 4PG2C 4ZTEA 5C0AB 1CD0A 3L2LA 2GI0A 5CZXC 4LOEA 5T3XL 2IAMD 5I1CH 3STLB 2QZ5A 1T4KB 1IGIL 1ED3A 2R0LL 5LVEA 2NW3B 5FS5A 1YYCA 3S2CA 1PZCA 1WBZA 4JY6B 4KO5A 4AUYA 3CFCH 1JNNH 4M6ML 4AC4A 1R3IH 5HYJE 2H2SC 1J9RA 4I3RH 1RJZA 1VENA 5B38G 1UURA 2P8LA 3GI8L 1LWHA 4FKHA 1A1NB 4WJG3 3ZKNC 2CCWA 2DEWX 4EDWL 4NT6A 3QH3A 1R3JB 1V3LA 3QWRA 5JPMC 3GMOB 3QXVA 1FGVH 3F7QA 3SDAD 1RZ8A 1GOHA 4Z7VE 3VXSA 2QSVA 4C4KO 3PABB 3A5VA 3GHEL 4BUGA 5IK3A 4XHQA 1YJDH 4NBXB 1S7TB 5D7IA 4DGVH 5IBUB 4MLSA 3ESOA 5JW3L 3UH8A 4K7PX 4IKLA 3TJHC 4MAYA 3LEVL 4LCWB 4L05A 2I7SA 2NY0D 4G3YH 4KJYA 4MJJA 5EWIL 1I1AC 3NIFF 2YAFA 1E2VA 2O61B 2ZXBA 3MLTB 1ZGLA 3QCVL 4RSYA 4NQEE 4YPGA 4EEEA 3SGJC 3SDYH 4OD3H 1FE8H 2NY6D 5DHEA 5HYFA 3BIAX 3FN0H 4BUHA 4R90H 4AIZB 2ENPA 2WPGA 2GTZB 3K2MC 2V7HB 4H88L 2FWOA 4P2RA 2RALA 1JZ7A 5HGDB 3DECA 5K39A 2AHIA 2ZXQA 3H6AA 1CGXA 4CVXA 2VQUA 2D2OA 1A6TB 3T1WA 1S9XA 3EDEA 3HOGA 2YWZA 4KROC 3LZLA 3Q1SL 4IU2A 3CLEL 2AANA 5JXEC 4ZYKB 1EXHA 2EO9A 4RRPG 5HHNA 1EO7A 4TSAH 3NACH 4I18B 5K1JA 4ZUTB 4ZI8A 3A67H 5EUOF 5K9QG 1TPXC 2WW8A 4I0PC 3PL6B 3V0WH 2HT2C 1NAMH 4A67A 1MVUB 4LSVH 4I5BA 1HDMA 3MYJB 4JPWH 4G8AC 2G2RB 2WLYA 1HFUA 4NIKB 5IUCA 3QJZA 5LQBH 1CQKA 1HHKA 2NDFA 3K4AA 3M1CA 4B5ZA 4U7KA 3SODB 5DD5L 3DVGA 4NO2B 5EU4B 2FYYA 2Z31D 2NLJB 2E7MA 3FT0A 3PWLA 3OKYA 4F3FB 3QGVA 2OI9B 5K9KB 4J6IA 1H3VA 3QWNA 4BSJA 1U2HA 4LF3A 5ISZD 3ATFA 4HW6A 4GI6A 3AUWB 2C7UB 3PQYB 5E8EA 4GP8B 1YEHH 4OZIE 4C56D 5KYWA 3ARPA 2LFGA 4QXUH 2BP8B 4N2AA 4UQCA 4F8QA 4BK5C 2IH9A 4KJWC 3GO1L 4OQTA 2IQAA 3AS1A 1OM3H 4WV1A 4AK2A 2K8QA 3B7YA 1TEGA 4GLRH 3C5JB 1UFGA 2YAOA 1H5BC 3CWGA 4MA7L 1NIFA 4AJVA 3TOPA 4HBCH 1K5NA 1J87A 5IBUG 1NANI 2J8HA 2DYPA 3NMEA 4JDTH 5A6LA 2H32H 2XRAH 3S34H 2YO3A 1QLFA 2XWJA 4R7DB 3DOSA 3EJYD 4ALAL 2CXKA 3FHQA 1HZLA 5D93B 4DKAA 5GS0H 4PJ7F 3CZUB 1E27A 2ODIA 2XWCA 3DETD 4YHIA 3VE0A 4PWHA 2CKBL 5JW5A 2AQ1A 2AERT 4F24A 3G9AB 4RMBA 3TBWB 4JFDE 2XWXA 3ZVVA 1NPNA 4EZLA 3IMBA 4J6RL 2XWBA 4NRZA 1KTCA 4TUKH 5KG9A 1M6UA 2VERA 5AAMC 5JZ7D 3NDYE 3W57A 2CDGA 1NWPA 1TQCC 2YGNA 3OMIB 3SZ6A 3S7GA 3CZSA 4R2GC 5A3IC 1CBVL 1U36A 1O6SA 1A47A 3U1SL 2RR3A 3EDJA 3WEXA 4B50A 1R5IA 2BOCA 5I6KA 3BN9D 1FLRH 1D9KC 2LLNA 1NFDB 3L9BA 1OP3K 4IBQA 3RWEA 3C2AH 3DRQA 5IEKB 4XP5H 2C9PA 1XGYL 1MCWM 2E7HA 4BCYA 4QAMB 5TDOA 3MYZA 1BF2A 1W72A 3HNVL 5GGUB 5GRZA 3DTUB 4J5VA 2ZKHL 4P48A 2AXJA 1BECA 2CJTA 3G6JB 4KKZA 4GT7A 1DUYB 2RCSL 3ZJAA 2YAQA 3B2UC 3HC0A 3PAVA 4HV8A 1P5UA 3T6XA 3WKQA 1W6WA 1OAXH 4P2CG 4GOSA 2B20A 1BQLH 4FEIA 2XVLA 3BW9A 2LOEA 3OGOE 4IIQB 1GW6A 5E5RB 3F5WB 4DGIL 4FTVE 1DEDA 3MJ8A 1XBRA 3IRZA 4AW7A 4I1RA 2WP3O 2DH3A 4MA8H 1PZ5B 2AQ3A 2FWSA 4AIXA 1C7SA 4N3TA 2BVQA 3ARBB 4LKCA 3P0YL 1BLIA 1U8QB 2DQGL 3CHRA 3ARGB 4HFUL 3I3DA 4M8UA 3WBDA 3VVWA 3AWEA 5HPMB 1IGTA 1YEKL 1KTRL 4JRXE 4Q97A 3MFFB 2CIIB 1HE7A 3QFGA 4L3EA 4NZDA 4AENA 2BOBA 2CBMA 5C09D 3ZQXA 1LJMA 1G6RA 1TMQA 4G6AC 3UTTA 3NZUA 3GD1C 4P57B 2YBRA 5SWSA 3FSZA 3QG6B 3VWJC 3ZGIA 1A6UH 3BKYH 4NO5A 1IAOB 4JZOA 5IB4A 3ULVL 4MXVE 3I9GH 4WO0A 3MMEB 1OD7A 1PNDA 1EGJH 4YHMH 5BVJA 2IQ9H 3OZ9L 3NJGA 2NQ3A 3BJ91 4LPVA 1R1CA 2JB6A 3L3OC 1FDLH 1LMIA 2DQTL 2VZ3A 2G5BB 5EO9A 4W93A 3PPEA 3WD5H 3INUH 2R39A 4S11A 4UIMA 1MFNA 3Q2CA 1P5VA 1IT9H 1KIRB 3HG5A 4W4OA 1AHWA 1KEGL 4L8BB 5C0AD 2WNXA 4XNYL 4X9BA 2J6WA 3NAAL 3DLQR 5TPWH 4NQEB 3JTSB 3Q7JA 4HS8L 3SGDH 3KMDA 1Z3RA 4HJGA 3D2TA 4MJ6A 5E24E 3K0YA 1VFOA 4MD4B 4DEPB 1RZJH 4F7EA 3L7FA 2B3IA 1ZLVK 2YRBA 3IJYA 2JVUA 3BQUD 1B4TA 2VAJA 3KLKA 5D1QA 5IR1B 5J1SC 5B1BB 1K4CA 4WNQA 1F58H 4LESA 3RZCB 5C6WH 3U0WH 4HJTA 2PCPA 1YYMH 4WTWA 1FG9C 3TIEA 2J1ZA 1D7DA 3BUTA 2HCZX 3KGSA 4S0HA 2HVKA 2VDRB 4ZTOH 1H3UA 4IRZH 4AKOA 1KTJA 1T0PB 2DIJA 2R69L 4CVWA 2VUOA 2ZD0A 4J3OH 4JE4B 4AQ1B 2VR4A 3ILQC 1EEYB 1PFCA 1NEZB 2GITA 4RZCA 4Z7NE 2EE3A 2W81C 2P5EA 4BQCA 2IXQB 1EZUA 3QDMA 1TQBC 1CXIA 1SYSA 1CFSA 1AZRA 3S48A 3X14A 3B9EA 2D31A 4V1DE 1ZE3H 1AXSB 1IFGA 5AD0B 4JJOA 2ZP0T 4BZ2A 1VFMA 4RWYL 5GZND 2P46B 4Z3HA 4B9CA 4GAJL 3W37A 3MJGX 1JXKA 2D8KA 4M5SA 1A25A 3BEWB 4PWJA 4TQEL 2QR0B 3LCYA 2HVJA 4HWBL 5LCVL 4PREB 4MSWB 1N18A 3I6GA 4OZIB 3T6VA 3N44F 2VSDA 3D0VA 4HA1A 4P3WA 4M29A 1MCNA 1ORSA 4F8TA 3NRQA 4H8WH 1BYOA 2F0CA 1QSEE 4JY5L 2CKBB 1UATA 1BQ5A 3GEFA 2ZE0A 4M1GL 3S3JA 3UJTH 43CAA 1OB0A 1PMYA 3RVXC 5I28A 4PTTA 2WTRB 4EI5D 5CCJA 3KXFA 1AQKL 4ZUWB 3CX2A 2JKSA 3KCPA 3PAZA 3V5DA 2NSXA 3TA4D 4WFHD 4OZGA 2ZXWB 1JGDA 5G4OA 1Y6MR 5I6MA 4IRJD 2DQJL 5DGQA 5CM1A 5DO2C 2QADD 2IFFL 4NKOB 1QBMH 1H6UA 1NC4A 5H94B 5KYXB 1SXBA 2ZQKA 5K9JH 3OQRA 3HZMB 3D50A 2QELA 2QFPA 1XXDC 2YEVB 5GXBB 1I3RA 4I9WD 2A4CA 2RA1A 4J27A 2H1XA 4K23H 2QQQA 3H4HA 2PR4L 4ZMVA 3OJDB 5MENB 4Q7DA 4Q2ZB 5DS8A 5L88L 4JFDB 4X2UA 1ZJAA 4JFFD 2AZAA 2FR4B 3T4AC 2I60L 4HGMA 3BVVA 2A6KB 3MC0A 1HHHB 2GK0A 3H7BA 2FJUB 3MSPA 1YLBB 4K3JL 1RUQL 2WWMD 4PRID 4F8OA 1PKQE 3OR7A 3B9AA 1ZGLP 3P3SA 1GOGA 4ONFL 2YEQA 1FL6B 5BQDA 1IC4L 3MQIA 1BAFH 5E2UH 3AW5A 3H55A 1I7TB 1SJMA 5HJDA 4PCKA 1NEZG 2E7LC 5MEOB 3LN5B 5C0IA 4ZUUB 2CE6A 1I8IA 5EF0A 3JYBA 4QLWA 4ZW8A 2ATKA 1K5WA 4YSCA 2OXGA 1SEQL 2O5YH 5EH1A 3QCTH 1WZLA 2NDGA 5DHMC 3JWNE 4UOQA 3RNQB 5BO1H 3U9UA 4PLKC 3SDCD 4UTBH 1U8LA 3GKWL 2W94A 1CG9A 3MRMA 4JHAL 4OY9A 1H9VA 4UQ2A 2VLRE 2OTUA 4FTVB 4G70B 4CADA 1RK1B 4FQ2H 3RGVA 4CBPA 1E4WL 1YNLH 3D48R 5D1XB 3EKCA 2J55A 1D5RA 4JJHA 2WCPA 4V2CB 1NCBL 2DQCH 4YDKH 1OLLA 4UNTA 4WSKA 3WTWA 4B6ZA 1E9OB 3LN4B 3CFJB 1QRKA 3ZE1F 1E67A 1CFNA 4A6YA 1V55B 3GWJA 3HB3B 2NY2B 4JL2A 2FGWH 1L3NA 2BRRL 1S7SA 3DV6A 4UQAA 3BPCA 3G04A 1C12B 3IN2A 3UAJD 1H3PH 1VFAA 2NY3C 1O9ZA 4KK8C 4EI6B 4P06A 2HKHL 5CD3A 3L3KB 1L7TH 3DJSA 4MQXD 4RAUA 3RPIB 4PH8A 1VSCA 5E2TH 1P7HL 3CMOH 1MFEL 1PLAA 3AXLB 4DESA 1JDCA 5I8CB 3NJHA 2AI0L 4F8NA 4A2LA 5JQ6H 1G1CA 4WEBH 3QIUD 5C7ZA 1P2CB 2YPLE 2DN7A 1XL6A 5D9SA 2OXHA 1PZBA 5CEXA 4PRNA 5ITBH 4CC0A 4PJAA 1QFWL 1X5HA 1OZUA 1KCSL 2R56H 3M1BB 3LKRA 3LV3B 2VIRA 4N1HB 5D71L 2IG2H 2EYRA 1JXJA 2FBOJ 2IDSA 2IH1B 3HE6B 3QE5A 4MMXC 1CDIA 1KENL 4I77L 5F7KC 4KTYA 2XG4A 3LH8A 5HYSB 2NNAB 5JDSA 5D2NA 4Z3IA 1XCQB 1K6QL 2ICWI 2PW1A 3NJKA 3QEUB 2CPUA 2QHRL 4OVUA 3VFRA 1HH9B 3ESMA 3LEXB 3MV9B 1J0YA 1QKZL 1EZVY 1T2JA 2A73A 3Q8FA 5CJXC 4CKQA 4O58L 2I85A 1BJ1H 2VO5A 5I6XC 3H9HB 1A1MB 5D7JA 5IHZB 1KXVA 5HYJD 1OY3B 4EPSA 2G3NA 1DUZB 1SYVB 2O5ZH 3FT2A 3UG3A 3V4VA 3VFOA 1IE4A 1IGFH 4BH8B 3WUZA 2ZKMX 4ELME 2CSPA 2Y07L 2D7PA 1MAKA 4A7QA 2BSED 3WLBA 3OJVC 2DTML 3J2PA 5F7EL 1DBJL 1B0GA 4GYBA 5EC2A 5FCUL 3AQYA 5ADPH 2FIRT 5I8KH 3BD4A 4PRAA 2XZQH 2NY5H 2E75C 2VJ0A 3P2BA 5CCKH 3VDBA 3BWUC 1H6FA 1EQWA 3ARQA 4CU6A 4J39A 4S1RL 1O7DC 1QATA 5HGAA 3VRIA 1JUFB 5DRNA 1D5IL 2F15A 4NPKA 5MEPA 4HIHA 1XSOA 1QSFE 3HE7A 4ZTPH 4Y4HB 1N0XH 4HIQA 5CMAA 2ZUTA 1ZK9A 4NQED 3BMVA 3L5XL 3T1FA 2AZUA 2HG0A 5IZ7A 1INEL 3TONA 1CO1A 4QHUB 4DVBB 3VD9A 1OP5K 5KOVC 1CFQB 2F53A 2MWCA 1CFVH 2CR6A 5C07A 5LAXB 3WEAA 2JB5H 3FOLA 3NCXA 4UUJB 2ZG2A 3UBXB 4UILH 3TO2A 3CZFA 5ERWA 1DVFC 1I3UA 2NUTA 1FA4A 3B8YA 1N6UA 1YQVL 2VITB 1WIOA 3QO1A 4H0IA 5CILH 5CLTA 2VABA 5F6HI 4WV1C 2VZ1A 3DOHA 2L8AA 9PCYA 1I8UA 2BZ7A 3ME0B 4IW4C 3TFKC 3P0VL 2WKOF 5B7MA 5TF1H 3HVDA 2HJFA 1W16A 1QSEB 1IQWL 2XPGB 2F08A 3MLZH 2B1HL 4Q58C 1ZLWH 3ZXAC 2YEZA 3NDZE 4HIJB 5I1LB 4MLIA 2DQEL 3WTXA 2WXIA 4DZBB 2ILLA 4GFTB 2HFGH 2J57A 3DTDA 5JNYA 2BNRE 2V9QA 4V11A 1ODUA 3ZN6A 1ZHNA 2R0WL 5GZOA 4HCRA 5HYSG 5DR5H 4BQ9A 4PS4L 4JRLA 3DVIA 1Z9MA 3RX8A 1OQXA 1YEEH 1MIML 1GKOA 3WEOA 2A3TA 4CA4A 3B7RL 1WAAA 2YJLA 4U1SB 5BOJA 3GJEA 2HVBA 2JQAA 1HNGA 2LR4A 1T2XA 2D4DA 3QNFA 4IMKC 1E9QA 2YJQA 4OGXH 4QKTA 2M8XA 4O51A 3CLFL 4PJXF 4HXAL 4GKZA 4U4IA 4WEEA 1VZIA 1B2WH 3JV0A 2LTQB 3QUXA 4LHUA 4FNLH 1ACCA 1HCVA 3BC9A 2QKSA 4JG0H 1WBXA 1J9QA 5E2WL 2QTVA 3SQBA 2XXGA 5CJQH 3L3JB 1KJMB 4B53A 1NQBA 3CCHA 4OQTL 4WUKH 1PKQB 1RUAH 5F0MB 3LD8B 4KKPA 3UACA 2NYZA 1OW0A 4HIPA 3GBEA 2A74B 2HP4A 5IQ7H 2HRPL 1IAMA 1NMAH 1FFOA 4H2CA 4ANUA 1YZZA 1MFAL 1U3HB 3QK0A 1E6JL 1IFRA 5ENWA 1P9MA 1R5VB 5FM5M 3QWOB 2OYKA 5T1KB 1NKOA 1WHOA 1ZEAH 1P5UC 4XMTA 1OAQH 3D5OF 2E7BA 3X13A 5F6HJ 2XQBL 1T0NA 5EOCL 4LARH 1EZVX 2ZXDA 1FAKT 2YBGA 4BDVB 1GR7A 3VXQB 1S5HA 1RULL 1TLMA 5JO5B 3DMMC 4FX5A 3RTQC 1P6WA 3IDNB 1S5IL 4QHMA 3EH2A 4XPHH 3FQ1A 3CDZA 4MJIA 4IS6A 3GGWB 3X1BA 3UBXG 3SYQA 3SJVA 2HH0L 2VLRB 3T3PB 3DX1A 3UYOD 5JOPE 1JRHI 3QUHA 4AQOA 5BV7C 3MCLH 1AQMA 3MBEB 3SEPA 1F13A 4OIAA 3S3BB 1EJFA 5DJXB 1MJ7H 2YN3A 3GB7A 1FFPA 1ZKAA 3MX0A 5TD4A 3ULUC 2AKRB 3MOBH 4J3XA 5FGCE 4NUMA 4E5XB 1TJHH 3ALXA 4FQQA 4U1MB 2PPDA 3CN1A 3DGDA 3O81A 5I1GH 3CDGA 5CD5D 1W72L 2VLJD 2P45B 2D4FA 2WXMA 4JM2F 3IXAA 4JZJB 1VCBC 5T1LA 2GUOA 3TZVD 5IQMA 4UNVA 5I1AA 1KYOK 1J8RA 2XVKA 3VM7A 5DURD 4L3EE 1X9LA 1RXLA 4OLXH 1TITA 3PDDA 3GS0A 1WG3A 2X1OA 5CKAA 1SDDB 4FG4A 1Z9OA 2YPLB 4D0CB 1WBZB 3N42F 1KBPA 5SWSE 3L4CA 3DK0A 1FYTE 5AEAA 2BFVH 2X3BA 4HOMA 4HGWA 3MOAL 5HI4D 1AHWC 4CC1A 1XO8A 5AFAA 5J6HA 3ARRA 1PZ2A 2P8LB 1MVFA 1AFVL 4XGZA 1HKLH 4NLHA 3QH3B 4ZMPA 3GMMA 4NQDE 3B4NA 1TYEB 1B4JL 3EO1A 4Y0GA 4I13B 1DZ0A 1KGXA 5F3HA 3TBSA 2CGZA 2NY2D 4QO1A 4JRXD 1AOZA 2VLLB 3P11H 4NQVA 4OBRA 4UM9A 5IK3B 4GRLC 4FXGA 2EC9U 2GCYA 3CPUA 4HH9A 1G6RL 5D7IB 5I30H 2WQRA 3HKZA 4IEFA 3U9WA 2XICA 4LSTL 5SX4I 1XR8A 2DM7A 5C08A 4MAYB 2OTWA 1NUDA 4KJYB 4R8WL 1Z9NA 5LGJA 2R2BA 1ZGLB 2XN9A 4XWOC 4YZFF 2NXZC 4YPGB 1ILUA 3TA3C 1D5MA 5B3SB 1DJXA 1BP3B 5TFSL 3JWNG 4NJAL 1JNJA 5GHWH 1IC1A 4JAMA 4Z3EA 2R8SL 1W9XA 4N2NA 4W9JC 3V9CA 4JPQA 3C9NA 1T03L 2FWOB 5E8DH 4MBOA 5D55A 1CFBA 2X0WA 1CT8A 5AVXB 1MPAH 4CVXB 1OGSA 3FU6A 1MN4A 1S9XB 2V33A 5AALA 3FUKA 5L8LB 4L8SA 2OP4L 2CDFB 4IU2B 1QSFB 3ECWA 1C1EL 2QDVA 3P30L 4EBQH 1IX2A 4S1SL 1SOXA 4YGAB 5T3XH 1TQUA 2FRGP 1IGIH 2CHWA 2QDWA 3D87B 3MRDB 1F3DJ 3C75A 1NCDH 5KVDE 1ZT1A 2B15A 2P5EE 4M6MH 4D2NA 1J48A 5AOIA 1N9PA 5GJTL 3LHPL 4MB1A 1A14L 3OKDA 1CLYL 1HHKB 3ZL2A 3RRQA 1G4RA 3R4RA 1OHQA 5CJBA 3DVGB 3T8XA 2FYYB 1JCKA 2VISA 1WFTA 3ZUNC 2EIJB 3PWLB 1IGYB 2Y7NA 5DVKA 1DJWA 4G82A 2EIBA 4QTIL 4Z7UE 2Q76B 4OJYA 1VFBA 1ZA6A 1MH5B 4H0GA 1PJ9A 5CIPH 3GHEH 1DN2A 4ZBJA 5B8CB 3EFDH 2APSA 4XTRC 3GLZA 3FAWA 4OFDA 5E8EB 5E1HB 2VM3A 2Z0UA 1BVKA 4MMZA 4N5EC 5DK2B 5KVDL 3F00A 3CZKA 4WY7H 4PR5A 1QFUH 2OK0L 3RWHA 5EWIH 3OAYK 2YD0A 1JGLH 3PAYA 4E9VA 4V1DD 4WV1B 1XGPA 4NP4L 3VA2C 8FABA 4WWKD 3KXFE 4NO3A 4BZ2L 4N0CC 1GRWA 2IGTA 3QORA 4XH2B 1K5NB 2DYPB 3DNKA 3QI9A 1MHPL 1NEUA 1R4XA 2XWTA 3MACL 4YAQB 4H26A 4KMLB 4LAQH 4WFFD 1QPKA 2Q8BH 5JQIB 1RP8A 4KVNH 1UENA 1QLFB 3FQXA 5KSUB 3DOSB 1Z5LA 3EGDA 4XPGL 5TQ0L 1JZIA 3EH3B 4NN5C 2Y5EA 2AABH 4IOFC 5DK0B 1E27B 4DWHA 4YHIB 2Q5BA 2Y7QA 5F7DA 4XBGA 3VE0B 5JW5B 2WXKA 1G9HA 3H3PL 1QSED 5KUKA 3UYRH 3T04D 5SX5H 4FNUA 3ARDC 4MASA 4PN6A 3HLKA 3BGAA 4RSVA 1QX1A 4RH4A 1BZ9A 2XWBB 3GMRA 1RY7B 1RZ7L 5J12C 1QHPA 1J8KA 5KG9B 3CVHH 1A6WH 3AT8A 2CDGB 1MCQA 3LS5L 3BRFA 5J06A 1J1OL 3K3QA 2CG9X 4P23A 1O6SB 3W82A 3WEXB 4FABL 1YG9A 1LP9A 2BOCB 32C2A 4HWEH 3O2DA 2IDQA 3O6FD 2XOTA 2CJUL 1OOWA 2BXYA 5ABZA 3RWEB 3UTSA 1UM5L 4G71B 4KI5E 4LK4A 2R7EA 5C3IA 1F86A 3Q2VA 4N5UA 4LP5A 4NZRL 2DQFA 4Y2DD 3MLVL 1GHFL 5AW2B 1NCCL 4HV8B 3HC0B 3LRKA 5CZVL 5JPMB 3QYNA 3C6EA 4G6JH 1A02N 4WAFA 3BW9B 4Y1AE 1JVOA 3GO1H 1AIFA 4XNBA 3L4XA 3MJ8B 1KEML 3QUKA 3D4GA 3IDMA 4MA7H 2GB2A 2R0ZL 3G5WA 3LKSA 4YDLB 3TO4A 5C7XH 2H41A 3DXAA 4JM4L 4OUOA 5L4MA 2BVQB 4LKCB 3HZYA 4TNEA 2C3XA 2DQDH 4HJEA 4NQXA 1E9PB 4JM0A 1IGTB 2G5RA 2F7QA 4PGEA 3PV6B 4L3EB 2XWZA 2XA8L 4AENB 2BOBB 4L0PB 4MS8D 5FF6B 1MHCA 1G6RB 4RIRB 4OCRH 3UTTB 4JGMA 1AD9A 5SWSB 3TESA 2DMCA 1FYTB 4GW4A 4NQUA 2DBLL 4ORZC 3MJ7A 4NO5B 4OF7A 1MDTA 5CN3A 4F9PC 1KCRL 4FYQA 2R29H 1TTFA 2FHBA 4J6RH 3ZKQD 4TULL 5F7FA 4TN9A 4WKXA 3OAUL 3UOAB 5BVJB 1Y7VA 4KO6A 1LNUA 4S1DD 4NQDB 1B3JA 3A0OA 4C4BA 2M2DA 4PLNC 4A6YL 2JB6B 2EICA 1EEQA 2RFXA 3CFQA 2FJSA 1U8PA 4KDVA 4LSRL 4G43B 4WSGA 5F9JA 2V0AA 3VXNA 4UIMB 4RISL 3FTGA 1Q8MA 4KNSA 4KUCD 5IVZA 2QSCL 2C9AA 2AK1H 4L5FL 5CJ8A 1JGUL 2PABA 3BISA 2AEWA 4GSRA 1CXHA 2X2UA 1LO4H 3B2PA 1MSPA 3ZRSA 2ZKHH 3ZT5A 4NN6B 2YFNA 3QPXL 3MI6A 2HZHA 2YPLD 3C6SB 3FT4A 4B7IA 1QW9A 1PDKB 3D8MA 1UOLA 4LSSL 4MJ6B 1NBQA 5BS0D 4F7EB 1A7QH 3VQLA 3L7FB 3NSJA 3FO1A 5ICYB 4F15C 1MW3A 1RZGA 5D1QB 1K4CB 1FFRA 2X41A 3L3GB 4M7KL 4MYPA 3D52A 3VCLB 2PCPB 2VDPH 3ZHLA 4PB9L 3KBEA 5GGVL 1J1PH 3WN5B 3WFCH 3TIEB 5A2FA 3WNNA 4WNSA 3S5YA 4XR8C 1EANA 1OWWA 2HVKB 1YEKH 2ITEA 2FCBA 2ZF9A 2VN3A 4OCNC 4PGDA 4S0TD 4BXSV 4OFQA 1HX0A 2DIEA 3BKJL 4IRSA 7PCYA 5E6YA 5DJ6A 1GMEA 2GITB 4Y5YA 1LQSR 4HK3N 3VA6A 4URKA 4JB9H 1MIEL 2WD0A 4P4RA 2P5EB 3NFPA 3NFNA 5L2KD 2MNWA 1WAEA 2Y23A 1DJZA 1RZKL 3QCUL 4C54A 2WM0A 4ZODA 1CFSB 3S37L 2VC2H 3Q13A 3LXCA 4K71C 1QFPA 2SEBA 1YYLL 2D31B 3T2NH 3X14B 1OF2A 2BLFA 1WUZA 4F8PA 1R17A 4KXZI 3CPLA 4JDVB 5DZVA 3WELA 1MJUL 3M7FB 4OJFH 2F53E 4Z7UB 5C07E 1NGXA 5DHXB 3WNKA 3GDCA 4EN3C 1RERA 2YD1A 4TOYH 4OCXH 1IEHA 3CVDA 3RPBA 3JV4A 3AG4B 1TF4A 4ZZKA 2HVJB 3WFDL 4BWUA 1WFIA 3I6GB 1O6VA 3DO7A 2ICCA 4PYHA 3D0VB 2Z8VC 3P40A 1BVNT 2WQ8A 3EJUA 4K9EL 4S0SD 1YEDB 4ZMZA 3KGTA 4C8XA 3RPKA 3KWWA 43CAB 3S8WA 4ZX4A 4WVRA 3BAXA 1DSFL 3KXFB 3VW3H 3RILA 1NBZA 3QUXC 5HGBA 3V5DB 5GS0D 4XBPB 4XAWL 1JGDB 3O8XC 5DJDA 2JKTM 1NAKL 4LCCB 3CZGA 1J1XL 3MRLA 4NQSA 4PIRF 1NA8A 4CMHC 1NC4B 2BK8A 5DQDH 2COVD 3W9EA 4AVIA 2TRHA 2XTJE 3IPBA 2YQ2A 1VPOH 1ETZB 4ZFGL 1JK9B 3AFLA 4JO3H 4OTXH 2BM3A 1I3RB 12E8H 4R3SB 1SN5A 3C6LD 4GRWE 3UJJL 2G9KA 1CICD 3FBQA 4ABVA 2MQ0A 1KJVA 4Q14A 5DJAB 5DS8B 4MNGA 2R69H 2QV4A 5CNHA 1QNZH 5EZLB 2BNRD 4WRLA 5LG6A 4N9GA 4HCRL 5CGYC 3O2WH 2GK0B 3TT3L 2ZYRA 2VR5A 3G6AA 3OR7B 5LGHL 4M6OL 3H4FA 2MJWA 2JKXA 4NN5B 1F2XK 1UYWL 5T3ZE 3MODH 1GAFL 2R15A 2Y36L 1M9SA 1HQRA 4PJ8C 5I1IL 2A99A 5ABDE 4EF3A 2K3HA 4GAJH 2IGLA 3X2QB 4NAJA 3TCXA 1UWXH 5ESVA 3K6SB 4MA1C 4JPSA 2ATKB 3V0VB 4PGCB 2IADA 2OXGB 3AREB 5E6SB 1PD0A 1JE6A 3UO1L 5KN5A 2WQUA 3R18A 4D3CL 4G9DA 3VXRD 4EZJA 1L9QA 1KTBA 4YSPA 3U9UB 1XIWB 3ARYA 1U8LB 3RVWC 1F18A 4JY5H 4OF5A 3MRMB 1CG9B 1RIUL 4E41D 4UQ2B 4QCIA 4OM0L 3SJVE 4FG2A 4Y1AB 4YHZL 2OTUB 5C3TA 4X83A 5FK9A 2R2EA 3RGVB 3ARWA 5DDHA 1KGCD 3MLRL 3QJSB 3OLDA 4EUPH 3US1A 2PWFA 2DQJH 3QHFL 3RDTA 1FUNA 1QG3A 2GVYA 3NJIA 4DFHA 2MCPH 1CFNB 4APXA 1AD0A 1TMCB 4FJZA 1I9RH 2H3NA 3O9WC 5I2IA 4A7SA 2VCOA 3DV6B 3CTTA 1KIUA 1A7NL 2YUWA 3BPCB 3G04B 1VFAB 2X6UA 4FI8A 4Z1PA 2N01B 2ZTBA 5CD3B 3PFUA 5C8JA 2QVTA 4RAUB 3RIFF 4KNQA 2ZX5A 1C7TA 1EV2E 5L88H 1SJEA 3MLSH 3MV01 5HHMD 2NZ9C 2BCMA 2I60H 3WTVA 1CDYA 1EEZA 4QGTA 4XNUH 1YY9C 3PNWA 1IBYA 4V2BA 4K3EL 3SKOA 4XNZC 3ARFA 2OXHB 4GLRI 4K3JH 1AE6L 5D9SB 3T2OA 4PRNB 4TLKA 5CEXB 1XF1A 4AEEA 5I0WA 1Z2KA 4PJAB 1RU9L 1AGCA 1DVZA 3DO4A 3LKRB 1TTUA 1MLCA 2VIRB 4GAFB 4AQAA 2FO8A 2EYRB 4GXUN 4KMTL 4UANA 2Z8SA 4W6WB 3WUWA 1JZGA 3Q8CA 3PWPA 3O11A 3FF7A 1TSHA 2OSWA 5E6ID 2Y69B 1PU0A 1UB6A 3QR0A 1X4YA 4Q9CA 3GNML 5DRXB 5AUMA 1SEQH 1UFUA 5D2NB 2PW1B 4KX8A 1FJ1B 4J28A 3WS3A 4QWWC 3VFRB 3WIFA 4YR6A 4KQ4L 1REIA 5I73B 2HTKD 2A73B 4K15A 4OT1L 2ISDA 3KLSA 4DKFL 3JXAA 5D7JB 1HINL 4K7FB 1INQA 3AVEA 4H0HB 5C08E 3U9PH 1FYTD 5IFHL 5A2IH 4HSAC 3KPSE 2FIKB 5FYKH 4QNPF 3FT2B 3NSDA 4Z7OE 5I0XA 4Q52A 5D5MF 4AKQA 1TENA 1E4WH 4GG6A 1NFDF 2F68X 2F58L 4WHYG 4ZMYA 4NQDD 1EZSA 4P3CL 1X5FA 5BXFB 2EABA 1JPSL 4M43L 3FSWA 3WLBB 3ILPA 4M5YL 1DJSA 4HWZA 5IHWA 1B0GB 3G08A 5EC2B 3G6JF 2WIIA 5D4JA 2EXWC 3VSTA 4IJ3B 4JGNA 1JDAA 1NOAA 5D1ZA 2PPEA 4QRSB 5HGAB 5TQ2L 4X7TA 3VRIB 1UD2A 2QT6A 2Y06L 1MCWW 2F8OA 3OSKA 4M1DL 4N68A 4P5TB 4XPBH 5DRNB 5MEPB 4HIHB 2WLMA 2HKHH 1R6VA 2VRAA 3HE7B 2MH4A 2J5LB 4FLQA 1NBCA 2XX0A 5DEZA 1U8CA 3EBIA 5CMAB 2VJ8A 4URTB 4N3UA 4ODVH 2FQDA 2AI0H 3GHBH 4HS6A 3QHZL 4FQXC 3T1FB 2AJXH 3ETBJ 3HHRB 2YQGA 2EVIA 2R51A 4WJ5A 1O9VA 1JG9A 3BWZA 4LSQL 4MMZC 2F53B 5C07B 1MI5A 3B9VA 3FOLB 4ZPVA 3FUMA 1X5GA 3AS0A 1QFWH 1SXZA 3L08A 2AEOA 4KTEH 3SCMA 1YPZA 5ERWB 2NUTB 4TTDD 4NYLA 4HMEA 4LDOB 2ZKXA 5FUZL 2VABB 3EXLA 3OKLA 1RH8A 1F6AA 4N0FA 1LEKA 2W5PA 1BMZA 5DD0L 4B9ZA 3FUDA 4XO3A 1CXLA 1UD5A 3F85A 3QI9C 1Q0XL 3TTYA 2NOYA 5FKPA 3HS9A 3S3PA 2YEZB 2Q20A 4KHTH 2EXTA 2VRKA 3FQWB 1QKZH 3CDYA 3Q5YA 5JNYB 1RZPA 3PHSA 1ZHNB 1OT1A 4YHPA 1KGJA 5IWLC 1R47A 5I0ZA 2X42A 1X9UA 2A9BA 1X5LA 3ZKMC 3T6QC 3ML9A 3ZE2E 2XTJB 2YAHA 3GXTA 4G6ML 3GJEB 4N1EA 4WW2B 2GFBA 3NOIA 5DRWB 8CGTA 3IAQA 5BJTA 5I75C 1P4BH 2DF3A 2DTMH 5IW3A 3B7TA 1BA9A 3PGDA 1DBJH 5D7SL 1E9QB 5KVGL 1IKOP 4PHXA 4GRWB 2X6AA 4O4YH 3NA4A 3WKNA 4J4PC 1BBDL 4O51B 4ODXA 1Q9WA 2FT6A 4GKZB 3I50L 1MJ8H 4LHUB 3ZHNA 1XVSA 2D3VA 5ECGA 3DSFL 1HQ4B 3BLBA 1D5IH 3HFFA 4PJBA 3LVTA 4MXQD 1WBXB 1EHXA 2Y3NA 3NJLA 3SQBB 3SYAA 5AW0B 1UM6L 1A6VH 1KELL 3KD4A 1CUOA 4QY8A 1TJIL 1CE1L 2K6WA 1KACB 3CCHB 4FHBD 1NGQL 4DPBX 3FO2B 3K80A 2QHLA 3BD3A 4HJIA 3C60B 5BRZA 4YHNB 1OPGH 1FFOB 1INEH 2FE0A 1T66C 4XP4L 1ZHBA 2F2HA 5ENWB 1H8LA 1UOWA 2O30A 5CINL 5BW7A 1T80A 1NGPL 2F5AH 3BFOA 3IFOA 4H1LH 3NZSA 3BPNC 3EDFA 1CIUA 1FO0L 1L9NA 1Z66A 3X13B 1XGRA 2X4TA 3FN3A 3GSRA 1YQVH 1U2CA 3UGEA 1RK0A 1S5HB 3GXFA 2BO0A 3VXMA 1QW8A 3A47A 4AGQA 1XZWA 1WUNT 1MREH 3L4YA 3MREA 3P0VH 3CDZB 4GS7B 4M61A 5IHHA 4Y4FC 4OIIH 4IS6B 3V79C 2LGNA 5I17A 3JYCA 4E36A 3SJVB 4P3DA 1RV6X 2DQEH 3BP6A 2VDQH 3FN9A 4YBQD 3UPAA 4UNUA 4Y9GA 1SHXA 1BV8A 2HSIA 4PBWD 3NCCB 4YOKA 4LFHG 4W6YB 4AJWA 1OO2A 3R06A 2R0WH 2O6EA 3QFJD 4M93C 2AXWA 4HFWA 3SE3A 1UT1A 3ABZA 3GB7B 1EUTA 1FFPB 4L4TA 1MIMH 3DBSA 3BCFA 3MX0B 5DUML 3D2UA 3O2DL 4OZIF 1NM4A 2DLHA 5E6UB 4POZC 4AX3A 4G8GA 4MB4A 3KH3A 3L9RA 3QNYB 4LGSB 4FQQB 3UBHA 4G6KL 3CDGB 4Y1TA 2AJUL 1J9TA 3IXAB 4MQSB 1DQLL 3GSQA 3N40F 5T1LB 1N3NA 1V54B 2GUOB 4GAYA 4HXAH 4IOSD 4LLYB 5I1AB 4L3AA 1RMFL 1U3YA 3BWAA 4XNMB 2PWHA 2PO6C 1JSYA 5CWSA 2EO1A 2WN2A 2C9QA 1UZGA 2IMMA 3SZKC 5GRVK 2UUDK 4GMSL 4AVHA 1N5YH 3P54A 1IC5H 4KK9D 4OQTH 1MEXH 3SBRA 3NG5A 2XYBA 3EYOA 1FG2A 4HGWB 5EU7C 1JZ6A 2FO1A 1SUJA 4HS3B 1RLWA 5J6HB 2E6QA 4Y7MA 4LHUG 4A37A 4XGZB 1OPOA 1I7UA 4HCGA 5D2LA 4GUQA 3GMMB 1P6FA 4NOBA 2VW6A 3LIZA 2YMXH 3GSNH 3KE0A 5F3HB 4QO1B 2VDLH 3TBSB 5EOCH 1UM4L 4K3HA 4W6XB 3ZY7A 4WHTA 4NQVB 4YNYA 3D9AL 1YEIH 2VXUL 2APVA 4TVSa 3BSHA 4LVNC 3N1MC 4UM9B 1I8KB 4FXGB 2GCYB 2Y2YA 3DHMA 3Q0HA 4IEFB 3NEXA 1S5IH 3QDJD 5DUPH 5A7BA 5C2BL 2J25A 1XR8B 5J4MA 3DX4A 2K1MA 4NCC2 2HT3C 4GSUA 5C08B 3RVTC 2DKMA 4PBXA 5EU6A 5EUOA 4DT2A 3KPSB 2DJ4A 2HH0H 4Z7OB 4XMKL 5LGJB 1BWMA 2R2BB 4XN7A 2I7OA 1KCBA 2D3JA 3AJ7A 3QR2A 3TM6A 1NIEA 1E3ZA 3TBCA 1D5MB 2XJKA 4X7FC 3JTBA 3SKMA 3B83A 1BGXL 4IGBD 4JAMB 1TZ8A 1H3GA 1XHHA 1QYGL 4Y5YC 1E8ZA 3C9NB 2DQHL 1FNSH 1CT8B 5JORB 1ZWIA 3MNZA 1URIA 4KQ3L 2YZ1A 1QPXA 1FZMA 3D7PA 4L8SB 4DGUA 1W72H 4RCAA 5DT1L 2EEDA 5EOTA 4M48L 2RACA 3HG1D 4GAGL 2BP5M 4N2DA 5KBNC 3ULVF 2JCCA 2CO2A 1OARH 2PTUA 1A65A 1AR2A 1KCKA 5IJVA 5CBEA 4QUOA 5J13B 3HUJA 5AZUA 1ZT1B 2LLLA 2FX7L 4Q9BA 1QNIA 2MCAA 3QXWA 1IC7L 1YMHB 3OKDB 1J05B 4HAKA 4NKDA 2X3AA 2ZX6A 5JOEA 3T8XB 5HHOE 4KZDH 3HRZC 3N41B 2VISB 2YC1A 4X6EA 3ISWA 5AYUL 5JR1L 5E5LA 4X4ME 5FUOH 3DYMA 1HKFA 3DPBA 3O41A 4U6XA 3LNHA 3ZZSA 1ZA6B 5JYLA 4N2OA 5HDOA 4LL4A 2XN0A 4BFFA 1FF5A 4MXVF 4NQQA 4NNPL 1IKNA 1UG9A 2OZ4H 3DROA 3G5ZA 3RJQB 3EIFA 3VDCA 1OSZB 3SOBH 4AWJC 3MVSA 4JN1H 4JO5A 4LKXB 4PW3A 3BVWA 4ZW7A 2OAAA 3GTNA 3ASOB 1ET5A 2F18A 4PR5B 1XMEB 5F7MC 4GKNA 3QIWD 1CGSH 4PPTA 3V7MA 4DN3L 1FHNA 4C47A 4NO0A 2W92A 3CBRA 1XGPB 3K4ZA 3RA7L 1IZKA 8FABB 1MCPL 1Q0YL 3ZE2B 2DIBA 3EO0A 2X4UA 3H3BC 1WIUA 3PRZA 4NJAH 3QORB 4NO3B 5TFSH 2PXYD 5C0RH 1GCFA 2DLFH 3H6JA 4HKXA 2XWTB 5GISL 1A7PL 4H26B 4OLWL 1TLKA 4KK6D 3FCSA 2Z92B 1MCSA 1MELA 2ZCKH 2VR6A 1Z5LB 3KPRA 3EGDB 2OCCB 4ZMXA 1FO0B 1GCYA 2K6YA 5FUCC 1EDYA 3S4SA 2MQCA 1EHLH 1PQZA 4RWHA 2GT9A 3ZBMA 2X4SA 1SVZA 4DVRH 5F7DB 2Y7QB 5FECA 1I1CA 2NXYB 2ZUQB 3O3UN 3P30H 4KUZL 1G9ML 1DO5A 1JAEA 3ASNB 5CU5A 5EC1A 4KRPC 1S78D 3FB5A 3S98A 3PCYA 2WC7A 1IFHH 2EDRA 2MOVA 3UC0L 4F8LA 1GXEA 2HRGA 2PPFA 3GMRB 3PREA 5IG7A 3RVUC 5JHLH 3MRRB 5AZEL 1SOKA 5E9DE 1T20A 4OF8A 2VXVH 3NEOA 4MDJA 4Z95L 3VQMA 4PRHA 3VXUD 5HDLA 4NN7C 2DJMA 4P23B 4WI6A 2OMTA 1XF4A 2XTJD 1R0AL 4MZ3A 1A4KA 2X1WL 3AT0A 1FNAA 5T5FA 1HCYA 4HP5A 2IAAC 3QRGH 3D05A 4JE0A 3UTSB 3WFHA 1WH0A 3D07A 4NPJA 4LVEA 4YIQA 4N0YH 2VDML 2DQFB 3RDTC 3KDMB 5C70A 4YS4A 4LLVA 4DEUA 2R1XA 3RY6C 3LAFA 1MRDH 3NIDE 5A6IA 2XFGB 3IU3A 4YDZA 3H42L 2OK0H 2BS8A 4X8CA 2BX5A 1TNNA 2DZEA 4XB8A 2V5MA 1A3ZA 3C60D 2AJYL 1IKFL 1UKQA 1AIFB 3HC3L 5T3ZD 4P9HC 3CDCA 3QUKB 1Q1JL 3IDMB 4BZ2H 2HWZL 2WVSA 3LKSB 3D3VD 1ZXQA 3JVGC 3RL2B 3TO4B 3M86A 1BAWA 5EULV 3WMPA 3MACH 2AK4A 3HZYB 1OT2A 3QZLA 5FAAA 4YHYB 1AZVA 3ARTA 3PWNB 2F5BL 2ODHA 3K5SA 4JDEA 2V2XA 4RA3A 2E27L 2H26A 5F89A 4HIIA 3MV7A 4XPGH 4PGEB 7FABH 5FYKE 1C9SA 4H20L 1IBDA 3P9LA 3C8HA 5H37H 3MLUL 3NCJH 2IEPA 1WTLA 4HLEA 1MHCB 1CDCA 1BJ1J 1AD9B 1FH2A 1WWCA 4QJ5B 2ITFA 4CVZA 4GW4B 5F88A 3SY0A 3MJ7B 4XPAL 1H8SA 3D0LB 4AITA 2B16A 2V9TA 3B9KC 3WJLA 2W0PA 2KC0A 5AW3B 1LNUB 4HG4K 4ZFZA 5GRJH 3FQ4A 3L95A 3A3YB 3DA0A 2ENQA 1E4XI 4LCVA 2K9UA 3QZWA 2RFXB 1J1OH 1U8PB 1BM3L 5G5DA 4LL1A 5IF0A 3S9DB 4JQIA 1V7NL 2X6BA 5F9JB 3VXNB 2ESVD 1JZFA 4N2BA 3DIDA 5SWZA 1XL4A 4RGMB 4PAZA 4XCYA 3NGBC 1XZ0B 3HHSA 1TZIB 4NAQA 2DI9A 4DP0X 1HXYA 2H6OA 3HPJA 3FCUB 4NZRH 4Z7AA 3U4KA 4H44C 1GHFH 3E0GA 1WWWX 4JZNB 1JD7A 4KRNA 4HUWB 2H9GA 5M95B 5CBAA 4JR9L 4NUQA 2E76C 5LXGH 3K2KA 5D1ZC 2J6EH 5DVLA 3BUPA 4WK2B 4NFCA 2O26U 4F9LA 3DURA 2Y0SA 1LMKA 3FO1B 3CSYA 3VYPA 4HF5H 3RIFK 4JPKL 1RZFH 2EDOA 4NXSA 1WAPA 3FQYA 1QEWA 1LO3L 4RFNC 3WU1A 3PJSA 3JT0A 2GSMB 4DKEH 3L17A 3N2JA 2QVKA 2D3NA 2UZIL 4OW6A 3T3PF 1OAZL 5D6DC 4Y16A 4PGDB 1G0DA 3SYCA 3HBPA 3SCMC 1JZ5A 3LEYL 1COBA 4WHYH 4TYUA 1XF3A 1A4JA 4UDUB 4IRSB 4PJEE 3LKQB 4W68A 2FO4A 1DLFH 2G9HB 2ZUXA 3NFNB 3KPSD 2DBLH 4M7ZB 5DMIL 4UTAH 3UEQA 3WKPA 1QRNE 2I32A 3WL9A 4UT6A 2SEBB 2ZNWA 1RURL 5C0CD 4TULH 1ZS2A 4YEFA 1SJXA 4HBQA 4KUCF 1NJ9A 4G1EA 3VU2A 5CAYB 1E5UI 5DWPA 4M3JA 1BZOA 4HAGA 1MCBA 4A6YH 1MI5E 5DTFA 1JTPA 4Q56A 2J1WA 5IB5A 1BZDA 4UMSA 4KKCC 4PJIE 2XLLA 4K5OA 5IBLD 5FOJA 5DJ0A 5FM5O 4WTQA 5AVSB 3JV4B 1MCKA 2QQKL 3SQRA 1RFDL 2KLTA 1VZHA 5D72L 3ZL4H 5EHFA 2GTQA 3RU8L 3SHSA 2K7QA 2XBDA 2IH8A 4P46A 1L4IA 4L5FH 3HPLA 1JGUH 5CZXD 2KLRA 1RJYA 2RBLA 4GW5A 4B0MB 5CHNA 2FB4L 1ZDSA 5KYYA 3NIGE 3KWWB 2WBXA 1FBIH 1DJIA 2NX5E 2RD0A 3IWUA 3O4LE 3ZZLA 4YHKH 4FQLL 5MI0B 1WO2A 3NBNA 1NBZB 4LSSH 1K9TA 1TFPA 2H2SD 1I9EA 5D7LA 5HGBB 3V95A 3WKML 5DJDB 3VFUA 2B1AL 3ZKND 1JGIA 3J7HA 3V0GA 3MRLB 3RWIA 1ACZA 3W9EB 4K55A 1MLBA 4M7KH 3VO0A 2NNXA 4DGWC 3LMJL 3QW9A 3QR1A 3MHZA 3ERXA 4PB9H 1NOLA 5LBVA 3IU4L 4JLRA 3HG3A 3EFOA 1OGPA 1S3KL 3HFMH 4AYGA 5BW7C 1XF2A 1KJVB 1KB5A 4Y19A 2MOQA 2IOOA 3BMWA 2EKSA 1G1KA 2VDMB 2XNAA 3FOMA 1WFOA 2NQDA 3OD3A 4R4BA 1K2DA 5C9KA 2BSDA 5HYIA 1J86A 3TJHD 3L6FA 1JJUA 3AWGA 1I1AD 4R97B 5CZRA 5AW6B 3WHE0 1QFWM 1ZA3A 3G6AB 4U3SA 3V4VH 1A7RL 4XCCL 3ELQA 2XYCA 2FEDC 1YYLH 4FFYL 3KLAA 1GGCL 3Q6FA 4L48A 1XSKA 4Z3TA 1G84A 1SY6H 1HQRB 1F4YL 2WZAA 3WNLA 3L4WA 1VGEH 3HZVA 2Z7WA 3IJ8A 3KYOA 5ESVB 3U2IA 4GUPA 2L04A 2IADB 3RWFA 4P05A 4KROD 4K8RD 3H9SA 1NUGA 4AY0A 2GW5A 5KN5B 4MBRA 3VXME 3QT2A 2FLMA 3FO9A 3S0PA 3GQFA 1GY2A 1T1ZA 5C3LD 4GSXA 2YAPA 4S1QL 3P3YA 2HT2D 4QCIB 4GQ9H 3X1NA 3M07A 2WINA 1MHHA 1BOYA 2HPTA 5FK9B 2R2EB 3WFZA 1DSFH 3N6YA 3HG0A 3U48A 4L3FA 1U8KA 3MRCB 2BSSA 4U1JA 4ANWA 1F56A 4K94C 1JZJA 3BIBX 2BIOA 2R2HA 3RDTB 1KB9K 1IRAY 2DL9A 1NAKH 1L6XA 3DGGA 2JJTA 4QHPA 1J1XH 3VFNA 3CXDL 4APXB 1AD0B 4UU9A 3CXHK 1L9PA 1H6EA 2JJWA 4NFDA 2N1TE 5I2IB 5K1NA 1KIUB 4ZFGH 4N86A 5HSFA 1JS4A 4LIQL 3BAEH 5GGQH 2NT0A 1WFJA 1V10A 1AR1C 4JFEA 3L8QA 1GIGL 1YCSA 1F5WA 4KH2A 4JKPH 4XCEA 3IM1A 2FLRT 3AB0B 1AO7A 1SJEB 2Z34A 5CP3A 4F2FA 3FT9A 4FA6A 5KZCB 3UABA 4BD4A 2XIIA 1NL0H 4PHZA 5LWYH 1S8DA 3N9GL 3PNWB 4R5TA 3TT3H 4KJWD 3ARFB 4Z7QB 1CD8A 2AQPA 3DV4A 4JANA 1G7PA 1DQVA 1UYWH 4NC2B 3BH4A 1ZLUK 4PLJC 1G9EA 1KV3A 3BVDB 5TE6H 5A2JH 3L5HA 4TV3A 1MLCB 4KKBC 4X7SH 4JFOA 5D2LE 3QQ9D 3WUWB 4ELKB 1PSKL 3C5ZA 5DC9B 3PWPB 4ZS6D 3C09B 3O11B 2W60A 5D96C 4CSPA 3AITA 1CCZA 1UB6B 4WI7A 2MRYA 5AUMB 3N3EA 2L0DA 3UDWC 3WS3B 1N7ML 3WIFB 4YR6B 4JKLA 3RX5A 2QQLL 4RDBA 1B4LA 1WTGT 1KIQA 2ENYA 5BMFH 5I0YA 3RDJA 5ESAB 4O5LL 1DLHA 3BZ4A 4OM0H 4YHZH 5D7EA 4XBEL 4Y2NA 5C6TH 1D7FA 3F7VA 3HLAA 2O1AA 3MLRH 4HJSA 4GKOA 2F19L 3PV7A 1WDAA 2W9LA 3LIZL 3ILPB 5AKTA 4R2GD 5A3ID 4HALA 4JPIA 3D25A 4JO8A 2IDTA 1PPIA 3ULUE 3G08B 1JHLH 3KWXA 4FFVC 3WAKA 2CXGA 2FATH 4I4WB 4UV7L 4AOFA 4H8VA 2NY7L 4M7LH 1A7NH 3MRGA 3LH2L 3QIBC 4PJEB 2WKOA 3VD4A 2D7TL 1TNMA