4JK0D

Crystal structure of t89q-mutant of rna silencing suppressor p19 with 2nt-5'-overhanging double-helical rna 21mer puuug(cug)5cu
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
120
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCQYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
publication title Procrustean bed of RNA silencing suppression
rcsb
source organism Tomato bushy stunt virus
total genus 37
structure length 120
sequence length 125
ec nomenclature
pdb deposition date 2013-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jk0D01
4J39A 4KNQA 1RPUA 4KQ0A 4JNXA 4KTGA 4JK0D 4JGNA 4J5VA 1R9FA
chains in the Genus database with same CATH superfamily
3ARFB 3UC0H 3MCKA 5BMFL 4DGYH 2A38A 1KJ2H 5BRZA 2WTPA 1IRAY 4M43L 3MRNA 4PHXA 1R3HA 2ALAA 3H7LA 3D39D 5AQ0A 4QRPB 3DMMB 1QSVA 4D9QE 4EI5D 2XKSA 4PMEA 3WKML 2YPLA 4M93C 5FCUH 3EYUL 3CN1A 4RMRA 2C1PB 4OZGF 5AZ2L 1XAKA 5EU3B 4GP5B 4PP1D 4UM9A 3QNXB 3K6NA 1Q9KA 1M7UA 1FZOB 4JFPA 5BRZB 1J05A 1Q9WA 1Z0MA 2DV6A 2VLME 3SJVE 1HQ4B 1HN1A 5GJTH 3MRNB 1TJIH 1R3HB 4Y5VC 1TJHH 3BP5A 2JH2A 3IRPX 4WI0A 5C0JA 1BBDH 3SDAD 4LIQE 1PLBA 4D7PA 2IXQA 5AVVB 4N0UA 3HR6A 3MMEB 5EIVA 5JO5B 1EANA 1SUJA 5JTWA 3MACL 4BIKA 1OAZL 1U93A 3O0RL 1LQBC 5DMIH 2Z64C 5KN5B 3BWAA 3QFJA 4JFPB 1X5IA 4KZCA 1Q9WB 3CFQA 3LZRA 2QGEA 1SM3L 1QFOA 3GHEL 4Y1SA 3LNDA 4QTHA 2XPGA 3C87A 4HKBB 2EILB 4PJDF 3HKFA 1O9WA 2AJZA 1BD2E 3MCLH 2ZP8A 5C3TA 4N0UB 4PJFA 2PTUA 4ZMQA 2AQQA 2ENJA 4J6RL 4JPSA 3RUGE 1U4EA 2NY5C 3NCYS 3G5ZA 5C0DA 4M6OL 3E0GA 3H9HA 2A6KA 3MREA 3TIEB 3VXMD 4S2SA 4L8SB 4QHKI 5INCA 2H0PA 2J44A 2QJDA 3DIDA 2XPGB 2XJKA 3LHAA 4GSDH 4W6WB 1BMWA 3SCMD 4L3AA 5CGYC 4N0FB 2AJZB 5BO1H 4A2DA 4PJFB 2E75C 4KGLA 5C0DB 2UZXA 4HLJA 4LDEB 4BWUA 1P5VA 3KPMB 2A6KB 2I24N 3MREB 1RAMA 4ACTA 5IVNA 1JYVA 2WXPA 2Y07L 4PS4L 2DQUL 3AY4C 3QPXL 4PM1A 4HIEB 1LO3H 4WSKA 4KPHL 4BM7A 1ZS8B 3ZOAA 5HY9B 1H8LA 2AK4E 1R17A 3QQ9C 4APQD 1CC3A 1WZ1L 3Q8CA 2EE2A 4L4VB 1CFNA 2AEQH 2FK9A 4KI1A 1MY5A 1RVFL 4X6FB 1CBJA 1RZQA 3MGTB 2BLFA 2X5PA 3ETBJ 4BUHA 4FG6D 4G9FD 2F7QA 3Q9PA 4L5FH 1S3KH 2R69H 3FTXA 5CEYA 4ZW5A 1PW3A 3GPEA 4PRIB 4J4PA 2FQFA 4XX1E 2NNAA 1LWRA 4CVZA 2IQAA 1A2YB 2EKSB 1RUPH 1CFNB 3BEWB 5DVLA 3I9PA 4ONFH 4XOAA 1QLEL 1Q72L 4ZO9A 2GJRA 1FL6A 3WFBH 4X9YA 2QTVA 5KSUA 2BRQA 4QGTA 3U6RB 2APVA 1EHNA 3AJ7A 3G04B 2Y7QA 4OI9A 5F0MB 4H1LA 3RY5A 3UIZA 2WYHA 3GZQA 4QAWA 3RNQA 1R9FA 3HMXH 2NNAB 2QDWA 3QP3A 5J6SA 1SLUA 3IWVA 2VDKH 4YBQD 4J2QA 4FADA 1CFTA 1LDPL 1Z5LA 5JIPA 2Y25A 3T3ME 3WN5A 2IAMA 3CMGA 2O5ZH 2QHRH 4HK0B 4XCYB 1NCJA 2NUPA 2GSGA 3IXTA 4PVBA 1Z5HA 3AB0B 2WLIA 2WOBA 3MR9B 4H1LB 3MJWA 3NG5A 1VADA 4X4ZA 5EN3A 5HDBE 3RNQB 3FXIC 3SDDD 2QKIC 1TNMA 1N6VA 4BFRA 4ZO6A 4L1BA 5DT1H 1CGUA 1CXEA 2CO7A 4NUMA 2NR6C 1K5NA 3O6FA 3UJJL 4Y4HB 5KVDH 1S9YA 1N0XH 1U8CA 3UYPB 3UZEA 1JRHI 3VDCA 1CMOA 4AL8L 2GSGB 3IXTB 1TZGL 1CVRA 1DQLL 2WLIB 2C3VA 5DVOA 2XHNA 2LLNA 2R0ZH 3U0WH 2YAHA 5IROD 3SKNA 3EJZC 2VO5A 1X44A 4KK6D 3GI8L 5D1QC 4HJTA 5KAQF 5FO8A 1K5NB 4QRAA 4YLCA 2GBUA 4FQQB 5D7JC 1AKJA 2CUHA 3MGOA 4AGPA 2Z4QA 5FUZH 3APMA 1MW1A 2FX8L 1H3PH 2JELH 1ZTMA 5DVMA 2YXFA 2C3VB 5HJ3A 3H54A 1QUNA 3UJTL 2DMBA 3SKNB 4JQVC 4HUUA 3N1GC 5GRYA 2ZPKH 5TE6L 3X3GL 1SHMA 1M1SA 3OSVA 4NHUA 4U33A 3ULUE 2D7MA 2H2PC 2Q3AA 1MQKL 4PJBF 4AMKH 1AKJB 3TCLA 1BFOA 3MGOB 3MN8A 3ZKQD 3OJMB 1FFOA 4OJYA 3HA0A 4JR9L 3VFRA 3JTSA 5IMLB 2AFNA 2Y36H 4YC2C 5BS0B 1HCVA 2NY2D 2J72A 4HFUL 3EJYD 5AW1B 2EIDA 5F96L 1IGJA 4AV5A 3ZJAA 2EYSB 2DLGA 2UXFA 1BYPA 5DHMC 1ZIBA 3K6OA 2GY5A 2VM4A 5F1IA 3ZKND 1BFOB 3ESPA 3LEYL 3O3DA 4QWWC 1XBRA 2KUTA 3UCQA 3IFOA 3UADA 2WLZA 3TURA 3MV01 1I3GL 4C56A 5IBUG 4XMZA 4IHBA 1K4DA 3F83A 1R3LA 5L9DL 1YHPA 5BOJA 1RUAL 4P2OB 5F1IB 4BYHA 1XX9C 5JHDA 1DVQA 4Z7UA 4EIGB 4HS8L 1ZK5A 1V7MH 3WEAA 4JY5L 3L5WA 3GLDA 5I74B 4X6CA 2J4WL 4MA8H 4FFWD 2VMDA 4C56B 4AWJC 1B4RA 4P23C 1LEGA 4MAZA 1A6AA 1Z9SB 2W60B 1DBAL 3QC5X 5DTFA 1S7VA 3IBEA 5C71A 3F7VB 5JHDB 4KBPA 3LQZB 5IW6A 1E6OL 4XVJL 1FO0A 1ZLWK 4LLYA 3RGVC 1KCRH 4BK8A 1RP8A 2LU7A 1ZCRA 3L5WB 2VJ0A 1S7SB 3LB6C 4HX1B 2XNAB 1KPRB 2HG5A 5MP6H 1I9JH 4YHNA 5D4QA 1A6AB 5LBGA 4AY0A 3QEGL 2DWEA 4Q89A 1S7VB 4G7QB 3CSTA 2XSKA 4UT7H 1JTTA 5E51A 1QATA 4ABUA 5B1KA 5AYUH 1A9EB 1FO0B 3VWKA 1EAJA 3VFMA 1KC5L 1LMIA 4POYA 3MLUH 3WS6A 4KK8D 2HG5B 3KBHE 1E65A 3PE9A 4I0PA 1FIGH 1IC5L 1MWAH 2A74C 2G5RA 2K8QA 2FE0A 1CTNA 2OMUA 5ISZE 3MRLA 1ID5I 1T0MA 4P2YA 2AZUA 2O6PA 4OSUL 8FABA 2BSDA 5HHQB 2WBJD 3QJRB 5F8RC 3IJYA 4OV6F 1E7VA 4ONHA 4TNFA 1GYVA 1AGCB 12E8L 5H94A 4Y5XB 5TF1H 1QBLH 4EIBA 4ZOEA 2VDRB 3L1EA 1LWHA 3GBNL 5K39A 1E30A 4POZC 1A9VA 2YMXH 2QSCL 4DJMA 5EOCH 3K2KA 3VGBA 1EFXA 1B0RB 1MCWW 1XXDC 3ERXA 4QRFA 4FGMA 3KR3H 1S9KC 3STBA 5AZEH 4NENA 3ZYOA 2VLRA 4G8GA 4RMVA 3LNFA 2QV4A 3B9VA 3EDKA 2VDQB 3BJLA 3ZE0B 3ILEA 5TJWK 4HBQA 1NCBH 3GMNB 4WSJA 5TGBA 2G30A 4EPSA 1PG7W 2X88A 2GQHA 4WENB 2JKRM 3CVHH 3O8XD 4JZNA 1J87A 1RIUH 3O4LA 5FYKU 4UTAA 3NPZB 4NENB 2WXMA 2R7EA 4G8GB 2OMTA 4MAUL 2YWYA 3I02B 4XNMB 2VDOB 4QDGA 4R9HA 1SFHA 3A3YB 2R29L 1E3FA 1I7RA 3QG6B 1A64A 1TXKA 5TGBB 4X98A 1EA9C 1A3QA 2V0AA 4QD2E 1CFSB 4R26L 3FSAA 1PZUB 4JE4B 4FI7A 4EZMA 5CXPA 5C09E 2C9VA 4CVWA 2Q7AA 1UT9A 3SKJL 5I23A 1JPEA 2GJPA 3ZN6A 3RIAF 1HXMB 4YFLI 3B4NA 3LZFL 4M7LT 2DICA 4TSBH 3RGHA 4U6VH 5L4FA 1ZHLA 2WANA 3I84A 4KUZL 2ZUXA 3TBWA 4X98B 1LM8V 3BLBA 3NJJA 5GZOD 2VR7A 3VI4E 1F00I 4WK2B 1BVLA 5JUEH 4GMSH 1WO2A 2VXSL 1YC7A 2JKIS 5B39A 3OLGA 5GGTA 3QJFA 3ILPA 1HH9B 5DZOA 4O00A 2UY7B 3NZ8A 3HNVH 4N2AA 3TTSA 1ZHLB 2X3BA 1JZ8A 5CP7A 4Y1AD 3L45A 5DQ9A 5EOCJ 5EIIG 4C54A 3RL1B 1YPZE 5F9JB 3U9PH 2DQJH 1PYWA 4N90E 3RI5F 5BZZA 2FWOA 5E9DD 2Z6FA 5GGRB 3S36L 3QJFB 4HUWA 1GGIH 3ILPB 1K6QL 3ZRCC 2ZKMX 9CGTA 2EVJA 2L4OA 3NZ8B 1PF3A 4G7VL 1EHKB 2BNQB 3BUYB 4E9VA 3VXQA 7TAAA 1A7OL 1XT5A 5B8CB 2BIQA 3WXWH 5C0AD 3OVUB 5TDPA 4F93B 4HAKA 5EEXA 1J9QA 1TKWA 4HWEH 2N1TE 4IRZA 4OJDH 4YO0A 4LFHD 1EPFA 2VLJB 1CLZH 4P5TA 3FS9A 4XP4L 1OO2A 1H19A 4P46B 1T1WA 4HUWB 4FG4A 5EU4B 2IF7A 3FUHA 2MOQA 3IXAA 2O26U 3HJEA 1WAPA 2I5YL 3Q7JA 1CF8H 4K73A 3B2DC 2DBLH 5TDPB 4JKPL 4LSVH 5IHZA 4MJ6A 1YEIH 1H3WM 3OXRA 4KJYA 3OKMB 5ID0A 4P5TB 3V8OA 1HHJA 1SQMA 2BVPA 4HUCA 1OZUA 2GITB 4BHUI 5DJAA 1T1WB 5FDWA 1ZEAL 1HE7A 25C8H 3WE6A 2R15A 3KPRD 2Y2WA 4JDEA 4PGCB 2PP8A 1UXWA 5C1MB 2CQVA 3V0EA 3RWEA 1MW3A 3D0VB 4JDTH 4IU2A 3WSQL 4KJYB 1D5RA 1P84K 4DK6A 5KSBF 4Y5VA 2BVPB 2O6CA 1M9SA 3FQYA 4Q4IA 4WZ9A 3EGXA 5LWYH 4JHAL 1PLAA 4WHYH 4JDEB 2AEPL 5DK3A 1K9TA 4WTZG 1GIGH 3HNSL 1C12A 4NNXA 4Z7QF 2XYCA 4YSOA 3EYFB 4YHIB 4N8VG 1N8ZA 2AMUA 1PNCA 3EH2A 1W8EA 1XIWD 2AQPA 4ODBD 4ZZKA 1QQDA 2C4FU 4LEXH 4O02A 5K93A 3WEBA 1NM4A 1UGKA 3BIBX 1PNDA 4HD5A 4X6BB 2OI9C 3EGXB 4I13B 1Y0LA 5D1ZB 3BZ4A 3CWGA 4KXDA 1EJFA 4ZFOB 4HEPA 3VXSE 1MAML 3BJ91 5CZKA 1QEXA 4N2FA 3MNDA 3PHOB 1P7QD 3FO2B 1EEYA 3VQMA 4KQ3H 4FFYA 4OR1A 4CMHC 4YDKL 4PJXB 5KS9A 4O02B 3TPKA 5DFTA 1BPVA 2G3NA 3BGFB 4GT0A 4DN3H 1PVHA 4D0BA 5IFHH 1Y0LB 4O4YH 1I8IA 3BZ4B 4LBAA 3K5RA 4FYTA 5JORA 3KCPA 4UQ2A 4DCQA 3GJFK 2AJXL 3V0WL 2CJUL 1PZ5B 4H20H 3I6KA 2CKBH 1IT9L 4DPRA 4NQQA 2ITCA 3DTUB 2YUXA 3U1SH 4ADJA 1L3WA 1MFCL 2V8LA 3AY4A 1JK9B 1GR7A 2Q6WA 3BESR 4NGHH 3VSVA 2HRPH 4R7DA 4I5BA 3RTLA 4XI5C 2QFPA 3RWIA 1KJ2A 1OAYH 1B4TA 3RAJH 3KCPB 4UQ2B 4DCQB 2QVFB 5I6LA 5EPMA 4XX5A 5E8PA 2NXZB 1HSAA 3CK0H 4TNWK 1PD1A 4QRBA 1NTDA 3WAKA 4OGYH 5I0YA 3WDJA 1BM3L 3F7YA 3C2AH 4ZSOA 1G43A 2CPCA 3IN0A 2VTFA 5I0WA 3CQPA 1KJ2B 1ZPUA 2NMSA 1J8SA 5C2BH 1YEGL 2ROXA 4PJFF 3HHMA 5I6NA 1ONQA 2KLRA 2WWKT 5DFWH 4AK1A 2MPVA 2AGJH 2KLTA 3GDCA 5CZVH 4ETQB 3I9GL 3IDGA 5DHXB 5E8PB 4A1RA 3IMSA 2OMNA 1NCIA 4LGSB 3DETC 1RZGA 4IU3B 1ASOA 3LNHA 2X7LB 4GQ9L 3DI3B 4ZUVB 3RL2B 3T8VA 5D72L 1T21A 1OSYA 3KPNA 2VMFA 1MNUH 1AO7D 4LCYB 2FD6H 3ELQA 4PGJA 2H32A 4XPBH 3SBRA 4BE5A 3U0PA 1OP4A 2NX5E 2DQ6A 4X5RA 2GJ6A 3IMTA 1JERA 5T3ZH 4KX9A 3SKMB 2PPFA 3G6DL 4TYUA 5F7FA 4FQ2H 1CXHA 2AHIA 1S9VB 1RZGB 4IRJC 5IVOA 1A6ZA 4LOFA 1HINH 4YE4H 2AJUL 5IBUB 2XACC 2A9BA 4XOEA 4JK0D 1IBBA 5D6DC 3O2VL 4GW5A 1KIUB 1J8KA 5F21B 1QYGH 1TMCB 2I26N 2QKIA 3LH2L 4HCIA 2R4RH 3IJEA 4KI5C 3VSQA 3QVAA 2DIJA 2NR6A 3DX7A 3RFRA 1QR1B 3QYNA 4ISVB 1XF2A 2GJ6B 4U1GC 3MRJA 2XWBB 3NIDB 1AXTL 1JD7A 4U0RB 3QDMD 3NT0A 3WHXA 1X5XA 4W9LC 4AJWA 1PPIA 2DYPA 3A22A 3MLSL 5L7XH 1RH8A 4JM4L 5TPWH 4NBZB 3LRGA 5H37G 2L7UA 4LQFH 1UATA 1C5CH 4YVUA 1CTOA 3RVXC 4NQVB 4RESB 4L2YA 2QKIB 3AXIA 2G75B 4ZTEA 2HT4C 2VJXA 5D1QA 3W0WD 4P4KB 5EZIL 1YJDL 1NGWA 3FT4A 3Q6FB 3HB3B 5PAZA 5D7JA 4DP8X 3NIFE 2ORBL 2Q8AL 1LD9B 3KM1A 3HPLA 2JCCA 4DGIL 2R8SH 4NO5B 4YEFA 2EZ0C 2VZOA 3VFWB 4U1IB 1RZ7H 3UG4A 2QLVB 1AZVA 2DQGH 3OGOE 1TJXA 3LKNB 3NAAH 4JQVA 1UVQB 2R69A 2DLTA 4Z7WA 4KZEH 1L7TH 1NGWB 3FT4B 3ZYJA 4NZFA 3WDIA 4F2EA 2UWEA 5HI3D 4ODVL 3HPLB 1JHKL 1MCPL 5DRNB 3JWOH 3B9DA 1ACXA 4RGOH 2W80C 3HCVA 4QNPF 4HZAA 1PGRB 3MZGB 5SX4I 3C5JB 3D2UB 3KE0A 1OSEA 1BX2B 3N3EA 5TQ0H 4NKDB 3Q06A 4OCXL 4X5WB 3FL7A 4PPTA 1OTUC 3HMXA 4OGXH 4XMPH 5DLLA 3RWCA 1DSFL 3MPCA 1QASA 1TQBC 2B4CC 2ZNWA 4PRHB 4AVIA 2V3EA 3HCVB 2OZNA 4HKZB 4FC3E 5CAYB 4EN2A 4P5MB 3FFCE 5I1IH 1ETJA 1KN4L 1X5MA 1WBXA 5JIKA 4JFQA 1E50A 3LAFA 3DO7B 1NWOA 1EXHA 5A43C 3U6XS 2ZF9A 1KDJA 1WICA 2XCMC 2BHFA 3O6KL 2P5EE 1YCSA 2EDEA 3PDOB 3RWCB 2VDKB 5GQBA 4JG5A 5D1XE 3WUWG 4IKKA 3SIKA 5DHEA 2WUBH 1WAAA 3PWJA 1GZQA 5DJDA 3PP4L 1VGKB 5FOBB 3T8XB 1N12A 2YAMA 1N70A 2EDOA 3QYMA 1WBXB 2YO3A 3B6SA 4M6ML 1CURA 1EZVX 3QUZD 4NO3A 2GJZA 2P8PA 4P23A 2OMXA 3GRWL 4TXVB 5B38A 4E5XA 3V4VH 3NCEB 1BIIB 2FJGB 2F18A 3S9DB 1J12A 3MRIB 3HC0A 3PWJB 3RGVA 1J9RA 1OV8A 3T04D 2BOLA 3TX4A 2YRZA 3UBXA 1L9RA 2VUKA 2V3FA 5D5ME 3SYQA 4MWFA 5E2UH 1OP5K 2OMXB 2KKQA 3MLZL 3V52L 3BH9B 3OHXC 4UYPA 3CFNA 4GT7A 3V6OE 2BIIA 3P9LB 2FR4A 1YNLL 1PY0A 3SO3B 5C8JA 1CICB 4PS7A 4JQIH 3NN8A 4G6KL 3RGVB 5FYJD 5H35A 4IBUA 4XNYH 4TQ8A 4J3OC 3UBXB 3ARUA 3CVIL 4W68A 4M5ZL 3JWOC 5E4EB 4JY4A 4MWFB 4NP9A 2A74A 3ZO9A 4AM0A 2FR4B 4Z7UF 3DGDA 4KQ4L 2FH8A 2BS71 5I15H 1KGUA 2KLSA 2XBTA 5LQBL 2EQDA 3G7TA 5H35B 3F05A 2W92A 3F64A 5F7KC 3ULVD 2MFNA 4X6CF 1KBGL 3KL0A 5DMYA 4Z8FL 4KMTH 1OZTG 4JPVL 2VIRA 3H42H 3RKDC 5ACMA 3ISRA 3TU6A 3REVB 4AM0B 3GM8A 2B3IA 3LXAA 2FB4H 4NQDA 3KL5A 4UMSA 2CXGA 1SXCA 2XRAH 3L8QA 2ZCHH 3RPBA 2N4IA 1SDDA 4JDVA 4RDBA 4PWHA 3J7HA 1NLDL 2YGVA 5JXED 1OGAA 1DVUA 3VD4A 5FW8A 5E4IA 4UT6L 4TLTA 4AYGA 1AHWB 2Q86A 4HJJL 2VIRB 5F9OL 5CUSL 4N2EA 3SQOL 2UX7A 5EF0A 4HWNA 2IOOA 1VACA 1YEKH 3KWXA 4CADB 2FDBP 4ZMTA 1OP9A 4QOKD 2YEQA 3H3KA 4ODSL 2ZOLB 5D2LE 5JLZB 5F3HA 1F56A 1SDDB 1CE1H 4LARH 3T2LA 1OAJA 3DIFB 1OGAB 5K59F 4NNYA 1CJYA 4RA3A 4GLRH 4UILL 3PWLA 1EAPA 4HS3B 4JFHE 2L04A 3GHPA 3MTXA 4H8VA 1AP2B 4WKZA 1RY7B 4UNVA 4KZ0A 2V3DA 4Z77A 4JFYA 2XTJE 4Y2OB 2GG1A 4ODHL 1S6NA 5I1DB 3A6OA 3BHBA 5F3HB 2NQCA 3CFEB 2I27N 3BIKA 3JVFC 1OB1A 3G5VA 1JDCA 2OQJA 2W1NA 5CO1A 1DN2A 2PP9A 3KH4A 2OR9H 2EJ1A 3ARED 4JM2C 2V5MA 2WINA 4WWOA 2VLKA 1DZ0A 5IY5B 3E6HB 2P45B 3EO0B 5DMGD 3PHSA 4Z3JA 2NY6B 4JFYB 1IQDA 2FX9H 1MWAA 5I30L 2L7JA 2F8OA 3WO3B 1OB1B 3G5VB 4GP4B 1W72A 2D0GA 1MNNA 1B3IA 4P2RB 4XPGL 4Z7IA 35C8H 2EDJA 3ZL4L 4P3CH 4NFDA 1D6VH 5AW0B 4K94L 4Z7NB 3SE8H 2QHLA 4N8VB 2A9ML 3SQBA 5HYJE 2V2XA 4L4JA 4GEJA 2OTWA 1IQDB 3MNZA 2Z1KA 1ZA6A 3PP3K 4HD9A 3NGBB 4WW1A 2QQLL 1U92A 3CIAA 3PWPB 2NSQA 2QPDB 1UD5A 4XNUL 3RJDA 4D9LH 4U7SA 5L0QC 1CU4H 3SSGA 1IEBA 2WIIB 3JSSA 3TV8A 2OTWB 4M4RB 2HVKA 4XNXH 2ED6A 1OANA 3MNZB 3VFTA 4ZUSA 2AITA 1ZA6B 3PREA 3D3VB 3VG0L 2WLMA 2F5BL 3WFEL 3QA3A 3PPSA 3FUNA 3CDFA 2NDGA 3PXJA 3W81A 4OJFH 3V4PL 4QRRA 1BECA 4WW1B 5DD5H 1IFRA 1MG3C 2V2TB 4LLVB 3CVHA 2ZUWA 4Y4FD 3WOVA 4NC1E 2WN2A 1ZRUA 5FK9B 1AC6A 4A2FA 5ALBH 2HVKB 4ZUSB 3VWJC 2FT8A 1HEJC 1ETA1 4GAYB 4NZ8A 5IT2L 4XB3A 1MCSA 3DXAD 2I9LA 1A5FL 4FG6C 2CR0A 5C2UB 1QFWM 3L4YA 3TEWA 4ZUTA 4M61A 1B4LA 3BI9X 4NHCL 4GUPA 4HSCX 1SJVA 4DP9X 4NJAL 2W88A 3LRSB 1A02N 1SVZA 4BSVB 3Q6GH 5FB8B 4Q9QH 5CU5A 1JYXA 4LMQI 3MRHA 5FF6B 4Z1PA 4CW1B 5EU5A 1KTCA 4OQTH 2OFQA 2R1XB 3TGXA 1DBJH 1AOHA 2X4NA 2I9LB 2R56L 4K07A 3L4WA 1MVUB 3IJHB 1EFQA 2VDOL 4LSRH 4YK4B 3LTVA 4M61B 4JGMA 3K4AA 2HT3D 4K3DH 2BJML 4Z5RB 2EC9T 4WTQA 3H4HA 3D18B 1FHGA 4JVWA 1UM6L 3UTTE 2PWEA 5CJ5A 5F7DB 4LNVA 3ORJA 4XNQA 4XP1L 3T4AC 4LKCA 3AWFA 4M3JA 5J1AB 3S35L 1FP5A 3DI2B 1WV7T 1P4LA 2BIMA 4DPCX 5LDSA 4KJWD 3D69A 4WEBH 2PO6D 2FLMA 1DHKA 3KNBA 2Y5TB 3VG9C 2FAUA 1RZFL 5INDA 3NIGE 3DRTA 3SDDC 3PWUB 4ZNEE 2ESVD 2DIAA 3BWSA 5IQ7L 5JA8B 1CL7I 1U30A 3H9SA 4D94A 2FUQA 3L1GA 1KXHA 4P2AA 5CHNB 3QI9D 5D7LD 1FNFA 5GGVH 4RWYL 5AW2B 2BHUA 4HJGB 2CIKB 2EDLA 3VGDA 5MHSD 1CXKA 2IADA 4FRWA 4HSAC 3DVGB 5GRJL 3NEXA 1U36A 2YUVA 4P9ML 3DRTB 4YAQA 1IILE 1ET7A 3D52A 5K9KB 1WG3A 4CMHB 4KK6C 1ZHBA 1FSKC 3D85D 3INOA 3P9MA 3KHQA 4PWEA 3H9SB 3MV9A 4UIKH 5HHOA 4C4KO 1LEKB 2VISB 2ED7A 5JPNC 4OLYL 4B3VA 1Z1WA 4LHUD 1SBSL 4YX2H 2BOBA 4WTXA 2RCSH 2X0UA 5L2KB 3BP4A 1RMFH 1NPUA 2IADB 4EF3A 5FGSA 3RDTB 2ZJSL 1NCOA 2CLRA 3VFNA 4W6YB 1KXQE 1ZHBB 2ZWYA 3IF1A 5C0FB 2WLYA 3EGDA 4PAZA 4F5CE 4Y5YC 4M29A 4HIXH 3ILQD 1TETL 3RHWF 2GW5A 1MVYA 2DQDH 4ZPTA 1R0AL 1T2QL 2Q8BH 3BRFA 2NTFA 2XKNB 2BOBB 5H4YA 5I1JH 4YHML 4ZDHA 3BP4B 4MKMA 4MNQB 2YUWA 4OJCA 2CLRB 2DB8A 4KHTL 3VFNB 5ICXA 5CEZD 1W0YT 3TVMC 3ZTNL 3BSZL 3OAZH 3POCA 2P8MA 3EGDB 5I1GH 4GBXD 5KS9F 2BOCB 4ELMA 3CGTA 3U4EA 1NBYA 2MHAA 3HG1A 3X13B 3QNYA 3U2IA 3ZKNC 5HGAB 4R4FL 3LXBA 5E94A 4TPRH 1KEGL 3P69A 3X3FL 3QDAA 4B5EA 4Q6IC 1KLGA 5HGHA 4NBXB 1DEDA 3ZE2F 1E4XH 2OJZH 1JIBA 5ICXB 4LLUB 4IRJA 3SYCA 5DS1A 5D6DA 4HUVA 3Q3GA 3FO1B 5GZND 1LILA 2WV3A 1HCYA 4ELMB 1HHHB 1ZA3A 2MHAB 4PJGA 2W0FA 1YDPB 2OMVA 4EVNA 3UZVB 1BVKA 4AIOA 1A7QH 2LAGB 3SYAA 4QXTA 3VXNA 1AYOA 1QTYT 1WLHA 2E4TA 3FB8A 1II4E 1IGTA 1RK7A 1WZKA 2IVFC 2DRUA 2Z35B 3L4XA 2OYKA 3L3JA 5LLIC 1T03H 4UYQA 2XQ0A 2FLRT 2VABA 4YOKA 1MDTA 3ETBF 2JI2A 3BUQA 1T4KA 4IS6A 2Z92A 3QQNA 1ZA3B 3CZJA 1VFAB 2CKBA 1D5IH 3QDHA 1IAIL 5IJVA 4BGLA 4P2QA 4Z3GA 3BPLC 4ZFOL 4EVNB 5E6RB 2YKLL 1CLYH 3VGEA 4PJ8D 1DL7H 2DJMA 4PB0L 5F89A 1JHLH 3FB8B 4LSSL 5IP4A 1JPGB 3S4SA 3GXNA 1IGTB 2AS5M 2EXTA 3FU3A 1UM5L 2W0PA 5D71H 5E0FA 2FX7H 1OGPA 2VABB 4XO5A 4W4NA 1AG6A 2EUXA 1T4KB 4IS6B 3S98A 4NM8H 3V8CA 2CKBB 3V6FA 1G84A 3EUUA 3WKPA 2BX5A 4Y19B 4JDZB 3WNIA 2N3JA 5J6HA 2X53A 1JBJA 2IALB 1AE6H 4ELDA 1KYOK 4HWUA 3SDCC 1C5DB 1BFVH 1TEFA 5FUOL 3KHOA 4ODXB 1OF0A 1N68A 3ESOA 3ZTJG 4OT1H 4RSVA 4FYRA 3V6FB 3MLXL 3ARTA 3AT8A 2IANB 4HLZG 4XMVA 5J6HB 5FWQA 4G8AC 2OM5A 4LEEA 2WBJC 4QY8A 4F3FA 4XZUB 4EQ3A 4KDVA 2ZOKA 3A5VA 5MEPA 3RX8A 4G43B 3C8DA 4PU2A 1A9BA 1VPOH 2X38A 4ZFGH 1U3JA 2OR7A 4FJZA 4DKTA 3RWJA 3U46B 2DMKA 5B1JC 4M1GH 4M4PA 1CD0A 1XCQB 2ITDA 2NYZA 2H8PB 5TDNA 2P3YA 1UC6A 3IDXH 3DVIA 4G42A 3NZHL 1KSRA 1R19A 4JHZA 4IIQB 2XZCL 3LPPA 4QY8B 2JCCF 4PLOB 4MCZB 2HTKD 1AAJA 4BQ6A 4EIZC 1AI1L 3CDGA 3FUDA 3QHFL 3TA3D 5FGCE 3ES6A 4BK4A 4LDOB 1U91B 4MNGB 1A9BB 1O7DE 4HCRH 4BFEA 5IJCC 5DD3L 2E9WA 4Z7WF 5K1VA 2ITDB 3M1BA 5F3FA 3WFCH 1DQVA 2DAVA 2WYZA 4AH2A 1QUPA 2F53B 4HXAH 1A65A 1SZNA 3L3KB 3MLPA 4RMBA 4DVRH 3ABLB 1QR4A 2UWEF 3EFDL 4OCWL 5C0BE 5SV3A 1F11A 1Q0XL 1ZVSA 1JGDA 1WD8A 4FA8A 4Z3FA 4XN2A 2A6DA 5HHME 3MCG1 3VXRD 2DYSB 1XSKA 1TYEB 3MNWB 4KY1L 4JO5A 2VLLA 1URLA 3TBVB 3ZMNA 3OHXA 4ZFZB 3IVKA 4AH2B 3EOTH 1BZ7A 5EZLA 5SWSA 3TZVD 3ZX1A 3TEXA 1OCWH 4A2EA 5AAPA 1L9MA 2CU9A 4HUKB 1UD3A 4KXBA 1FNSL 1M71A 3DKHA 1JG9A 4EN3B 2CK0L 4TTDC 2MCMA 1NDMB 3DYPA 3HC3L 2X40A 2VERN 4O2FA 5E5MB 3WJMA 3HI6H 1MREL 3UPRA 4XAWL 4LIQH 4KWUA 4WWKC 1FIEA 3E9TA 1FZKA 4XAKD 1NCDL 3SHSA 4OZHA 2VLLB 5C0CB 4FFZL 4QRTB 3IVKB 4GOSA 2A9AA 4JFFE 3UJIH 5EZLB 3K71A 3QIWD 2P42B 1F6LL 1OM9A 4TSCH 2OYLA 5B39G 1N4XL 2YC1B 4JRYB 4TQEL 2L7EA 5HJBA 3ZLQC 1M71B 1TVBA 3RJOA 3ZRSA 4XC1L 3CXDL 1WAAF 1A1NA 2GVYA 3SYOA 3NFNA 3R8BB 3UTSE 5CD3B 1NH6A 5EOTB 3W38A 3FYIB 2K4AA 4KKAD 3O3BA 4O5LL 3QORD 2KYIA 1XL6A 4AEHL 3GMQA 3HZYB 3TCXA 4MNHB 5L88H 1B0WA 2JKJA 3CLWA 3JQOB 2VQUA 2BO0A 4UB0L 5AW8B 2PUQT 1A1OA 2CA4A 4U7KA 3E3QC 1TVBB 2ZP9A 4AQAB 1A1NB 2B0SL 4FNPA 3NFNB 2Q3XA 1QG3A 4HIJA 3MV7A 2G2NA 4TVPL 3ZDZB 3HUJB 4MVBC 3O3BB 5JQIB 5DZ9A 3ARDD 4W93A 4KROB 4ERSL 1EBPA 2DEWX 4GW4A 3SBQA 2P5WE 2XIBA 5BUPA 2FNWA 4RBPK 1WA2X 4I7ZC 5IFAL 1OTSC 2UY6A 2BDNL 1S7RB 1YMHB 4F58H 4L4TE 1MEXL 2FO4A 5E2JA 1L9OA 5HJGA 2PN5A 1I3VA 4HIJB 5F7YC 1TTUA 1N6QL 1G1CA 4KTGA 1NEZA 3T2PA 1KWGA 1RURH 1S2EA 2ZP0T 5A7EA 4HUMB 5LN8A 4K9EL 4WFGD 2WXIA 1F97A 2ZCZA 4JFDA 2CR3A 4OTXL 1P0SE 3MYJA 3ZK0A 2JB5H 2C3HA 3QO0A 3V5KB 2CO1A 2E3VA 4IBSA 5F9AC 2GYSA 4EDXA 3FQUA 4LCIH 1IGCH 1JNNH 2FO4B 3D39A 3QDJD 5GS2H 1MPAH 2JB6A 2EDNA 5JQ6H 4NIYE 4TUOA 3V4VB 1NEZB 3IPBA 3WN6A 5C07E 2E0PA 3DV6A 3X1GA 1FLTX 3HIZA 3W2DH 3VX0A 1PX4A 4JFDB 4JQIA 2CDGB 4JM2A 4R8WH 5EU6B 4Z6AT 3FCSB 1J0IA 3VM5A 3DYOA 3N1QC 2P47B 2E47A 2GY7B 4HEME 4M00A 4EDXB 1RUKL 3B7SA 3FQUB 3KBFA 2W9EH 3HE7D 5FWRA 1I9RH 1VEOA 4BFNA 3AXHA 3VSTA 1LO2L 2RGSA 4EI0A 1GC1H 4TUOB 3QZNA 3UZQA 5C9KA 3OKLB 4Y9GA 1PZDA 1TO4A 3O9WD 4JM2B 3BP7A 5A6MA 5JW5A 1UGNA 4YDJA 3G9AB 3IMVA 5E2WH 2JQAA 4XXCC 3TYFA 2IBZY 1J1PL 1TJMA 3QWOB 2WBKA 1HWWA 2K3HA 4WU7A 5DJ6B 4HEPG 5GS0D 1UWGH 1ZANH 4FQXD 1G5AA 4JRXA 1A6UL 5GXBB 3FUEA 3MNMA 2B8OT 4JFEE 3RI5K 1L9NA 3QDME 2E86A 5L4IA 4KKCC 3ECBA 2YKKA 4FFVD 4ZS6C 3H3PL 1CZ8H 3QGVA 3VXMA 3GXUB 3QT2A 3SY0A 3QULB 2XWJB 4KXAA 3TYFB 3K80A 5DRXA 4YJZL 5A2IH 4A7TA 4WU7B 2Z34A 1KZQA 2XX0A 4FZ8L 1HT6A 2VRKA 5IREA 2I9TA 1V10A 2LR4A 1FG2B 3A23A 4WTWA 5EC2B 1V3JA 1KXTA 4U4IA 1BZOA 3KPSA 4W9KC 4LSTH 4BFFA 4FQLH 1IC4H 1NMAL 5FR3A 2AK1H 4WJ5A 1U8HB 4TNVK 5L0QB 5FGRA 1Q1JH 4GAJH 4X7TB 2ZOUA 5AOIA 1ITCA 4A7QA 3VWJA 4WWID 2QEJA 2NQ3A 1SXSA 2Y23A 3LKOB 1S4IA 3PNWB 3V4UL 4CKVX 3NCYP 2EO9A 3QRGH 1GYAA 3K72A 2C7FA 3ULUH 3KXFE 1KXTB 4AIEA 1JNHA 2XXCB 3B8SA 3LV3B 3OMIB 4KZDH 2AKRB 1C1EH 4FABL 4WJ5B 3CXHJ 3VRLF 1IC7H 3D51A 2ADJA 3GIVB 5F7BA 2V7HB 3CJJA 3UBFA 2WQRA 2YGQA 3VFOA 3VWJB 4QRSA 3L5HA 4KH2A 2P24B 3T3PB 1P6WA 1DBML 3INUL 3T9WA 4C57C 5EUOE 1NFDB 2YD4A 1U8JA 4ZTPL 3U4BL 2H1XA 1RZJL 5AB1A 3VRIA 1LQSR 1S9WB 4HH9B 4FTVB 3VFOB 4FL4C 4F1SA 3UYOD 3VDBA 4MZRA 4GKLA 2E59A 1JPFB 3NJKA 3T4AA 1I8MA 4HKXB 2B14A 4LCWD 4NYLA 3LS5L 3OZ9H 5GSRA 2OX5A 4DQOH 5JW3L 1N64H 1GW0A 2D8KA 3ML8A 15C8L 3SDDA 1FGNH 1WA1X 1UWXK 3FTWA 3TBTB 1J8HD 1GS7A 3CCHA 1GCYA 2Z0BA 4G80A 4BK5C 2DQCH 1Y7VA 4YHLL 1QSED 3C60D 3IMRA 4KAQH 2YWZA 4H5SA 3D8MA 3U9UA 4FXKB 1HX0A 3NJVA 4HCGA 3WLWD 4L48A 2DWXA 2E8ZA 3CFCH 4M7LL 4PJCE 4H25A 3MLVH 2WGNB 3JVGC 1AS8A 1JFQL 3V0AC 2YD1A 3MBEB 5D7KE 3BCDA 5A2BA 4OJEH 1ZSDA 2HWZH 4CRPA 1KXVC 2QR0A 5IKCB 2VL5B 5JPNA 2EXWD 4ECNA 1ACZA 4JRFA 3OJVC 3U9UB 3T8MA 2A6IA 3ESVF 1JGUL 1VEMA 2F7IA 2OJEB 1UJTA 4N2DA 3DX0A 3FB6A 3ULUC 4S1SH 1IZJA 2NW2A 2F8XC 1HDMB 4XNAA 3KWVA 1F42A 3X1NA 2V6HA 4NJ9L 5AOKA 4U1MA 3BD5A 5ITBL 1ZSDB 4WEUD 2QR0B 4Y5YA 1UM4H 3F58H 4MJID 1ZT4B 4UT9H 2VR9A 1Z9NA 3ZDXE 3O11B 4OF3A 5HI3C 5J9PA 4PRPE 4NWTH 3CFBB 5MERB 1E5YA 1OAXH 3NEEA 4JJ5A 4OQTA 5AZEL 4PMFA 3UBHA 2NCMA 5IR1A 2AXGA 3OB8A 3DYMA 2JFCA 1S8DA 5J11B 3NCMA 2XN9D 3TVMA 3CH1A 5B3JF 4GSUA 3CHRA 4JO1L 3LOWA 1OK8A 2DN7A 2YBGA 3V0DA 1QBMH 3GSRB 1VLXA 1KGJA 4XPFH 1SDYA 1THAA 4B96A 5IGXL 1LP9E 1XF1A 4G6FB 2JJTC 5DDHB 4JJ5B 5IB3B 3FN0H 4Q6IA 5IR1B 1AHKA 1NGQH 2HFTA 2ZCLL 3AXLA 3D25B 4DW2H 1ORSB 3RZCB 1NCAH 3IKKA 5FO2A 4YDNA 4FAAB 2VM3A 1ESOA 1MJJA 3HHSA 3BPNB 1MAJA 5FCSH 4XN1A 4JKLA 3C5ZD 2DKSA 5D6CB 2Q7NA 3T6ZA 3JT2A 4YXHH 2OL3B 4IIZA 3ZQWA 2C9XA 2IH1A 3LRHA 4HAFA 4OGAD 2NY4C 4MQ7B 1KCUL 4GI9A 3EF7A 3UAAA 2FQEA 3WG7B 3AXLB 1ZTXE 3QEUB 2CDFA 1R3JB 3O45A 3NH7L 4X8JA 3HC4L 4W81A 4FXGC 1MJJB 4M1CD 1B4JH 1Y18B 4Q9BA 5I5JA 1B2YA 1HCFX 3QZWA 4X8CA 3PQYB 3V5HA 2IH1B 2X2JA 2V2WA 3IU4L 5CMAA 1CXLA 2VMJA 5D7IE 3ZZ1A 5IMKA 3O3AA 4ZQTA 2XVBA 2QELA 2BNRD 3KG5A 3OMZA 3D4ZA 4ATTA 3MLRH 4X8JB 4K23L 3OV6A 1R3IH 3T0BA 5ESQA 1OM3L 1UUNA 4IRSC 3R1GH 4Y2DD 4ELMF 3MRKB 1CD8A 4P05A 4LCVA 2R2EA 4IKJA 3BLPX 5D96C 1VCAA 2M1KA 4I0KA 4PJEB 2C4FT 2H7WA 1JYNA 4Y9CA 3DHMA 4DAGL 5E5RB 3O3AB 1I85C 4B3EA 5IMKB 3SDCA 3VTAA 3CHQA 3G6JB 4GRWE 3ALXA 4NCDA 4I87A 4LCUA 1XF3B 1XD0A 3RWFA 1MZYA 3WFDL 1BW8A 3FUFA 3A67L 4BH8B 5BQ7A 1DFBL 2Y7LA 5PCYA 4BBWA 3LKSA 1HESA 3O6MH 3PAYA 1HZKA 3QQDA 1YMMD 4HIIB 4X99B 4N0YL 2ILLA 4PJGF 5BV7C 4KI5F 1LO0H 4FG0A 5AEAA 1MCFA 1UXSB 1A1MB 1HVXA 1UB6A 2P1YA 2WBJA 4XMXA 3SDCB 2IH3A 1AR2A 2A6JB 1IB5A 2V9RA 4X6EA 3IRCA 3RWFB 3L54A 2MH4A 1MH5A 3MOBL 4QGYA 4M9PA 2Y5EA 1GL4B 1ICTA 3WIHL 4JFOA 4I48B 1VF5C 5B1JA 3VW3L 2J1XA 2FRGP 3MZTA 4I3SH 4UQ9A 1DR9A 4BQBA 1UB6B 1C5BH 3HG3A 2JIXA 4XH2A 3OG6B 2FL5B 4E0RB 3O3UN 5JIIA 5JXEC 1AR1C 4X6EB 3OKEB 1MH5B 3TJPA 1DEEB 2PCFB 4FXTA 5DRWA 4GKNA 1KG0A 4U6YA 1H3GA 2MCPH 3H3BC 3MGAA 1KEMH 1DCEA 2OW7A 1YY9C 2WXNA 5ALCL 4JFXA 3ME0A 2XVGA 2B1AH 3R4DA 3K6SB 2JV6A 3S5ZA 2HPTA 1X9LA 1A3RL 1V5JA 4ENED 1OAQH 5CKGA 1R5IA 4XVUD 2O5YL 4XMKL 4YQXH 3GGWB 2IV8A 5IVXA 3VB9A 4NQED 3WD5L 2ATAA 1KB5A 1VA9A 1R5VA 4QRQB 1LK3H 2DLHA 5I0DA 2E56A 3HKZA 3VMPA 1JF1B 4XPAH 3DIVA 5DEGA 3P2DA 1BQSA 1RIVL 1D5MA 1SEBB 4QHUA 1U8OA 4WV1C 4BZ2H 4F2MB 2WJ7A 3QUYB 3GMOB 2Q9OA 4I9WE 1R3KB 5ICZA 1NJ9B 4JPWH 4MXVE 3ARFD 4AIZA 1MY7A 5AUMB 1G6RB 1R5IB 3L9RA 3AREC 4X4KA 5FO7B 1YNTA 3L7FB 2D03H 5JOPD 4WWKA 1B6UA 5GGSA 5DUML 4FLQA 4P9HH 4QRPD 3DMMD 5AD0A 1W15A 3BE1H 5DMGC 4UQBA 4M3KB 5DEGB 5DHVA 1JUFB 4BDVA 2AMGA 1RIHL 4XVTL 4QHUB 4JPQA 2CSPA 4Z0BL 5IW3A 3Q2WA 5JA9A 4OFQA 4LGRB 5C9JB 1QFWL 1PCXA 2ENYA 1FPTH 3A6BH 1G9NH 1EDHA 5BRZD 1DLFL 4UQ3B 5BQDA 4WWKB 2R4SH 5GGSB 1ZGLA 4LP4A 1X5LA 4I85A 2APFA 5DWUL 1EAOA 1ED3B 1JSYA 1GZPA 5AW4B 5AW5B 2O30A 3EBHA 4Z3IA 3KGSA 4AG4L 2Z3FA 5E9DA 2J8UE 2BRRH 4PJAB 5E1QA 1TZ8A 3F6LA 5ADPL 4JUTA 1KENL 2PMZA 2ARWA 1ODAA 1T5KA 1TIUA 1QSFB 2A9NH 2CRIA 2OLDA 4R7NA 1ZGLB 1RCYA 3VD3A 4GRLB 3WFZA 2VYRE 5J89A 1TSRA 4C4KT 4QHMA 1IGMH 3ZR6A 5DEJA 1B0GB 3GBLA 4HCRA 3TBSA 3ATBA 3P73A 3UX9B 2XPZA 1MCKA 2DWSA 5FYLE 1VZGA 4J3OF 3CPLA 5E1IA 2X4TB 1I4FB 1IM9B 5ESVA 5L8JB 2UZIL 2OAAA 1ROCA 1REIA 1X9UA 4OZHF 1ASQA 2CO6A 2PYFA 3PXLA 3DO3A 5ACZB 1QRNB 4QHMB 3N41B 3QS2A 3N44B 5DI8A 3P73B 1DUYB 4N2GA 4Z76A 1Z3GH 1AZZC 2AC0A 3EJSA 3CPLB 4BCXA 5AAWC 4HJSA 1FFPA 2VB5A 4MA7H 5FKPB 4PI2A 5AALA 5LGHH 1IJ9A 2YSTA 3SEPA 4HPOH 5DJZA 4L4VD 1YQVL 5JW4N 3HG0A 3TT1H 1FV1B 1J86A 1MFNA 4DGVH 3DHPA 4HG4K 4PR5A 2G4GA 3GS4A 5I26A 1PD0A 4PRID 1T04A 1FC2D 4GKSA 2BH0A 4RAHA 1AZNA 4G71B 2AVGA 2HT3C 5I17A 5AVSB 3SJVB 2P8LA 4P99A 4X42A 3IE9A 1G9NC 1Q38A 1UB5A 2Z0UA 3H6JA 4LQFL 3Q2CA 4XN7A 4J23A 1EJOL 1KV3A 4XXCA 3V6ZA 5K69A 1T1XB 1CL7H 2DTSA 3QB7C 5C6TL 3BZ5A 4PRBB 3TA4D 5I1LB 3RUGA 4XO4A 1AMYA 2X4QA 3CZLA 2Z9TA 2AI0L 4KJWC 4AJ0A 5I17B 2PO6C 2F7RA 2P8LB 4MDRA 4MMYB 4U6XB 4D9RD 1CGYA 3E80A 3OXSB 4WUUE 3QHZH 1IZKA 4JPIA 3HBGA 1H15B 1NBCA 4HOWA 1BD2B 1UCBH 1MI5E 2JJWA 2YEVB 4MCMA 4MXWH 4PJHE 3QIBB 4XHJD 5CBAB 3FRUA 3RUGB 4JO2L 2F0CA 2FJFB 4NQCE 5SWQA 4PB9H 4RNRA 4Q8BA 5KVGL 3MXVH 2QGBA 3BFQG 3TL5A 2KBGA 5BMFH 4HJEA 5DFVD 4P4RB 4U3SA 4BHUA 1BHGA 1CFVL 4JM2F 4N6QA 2B2XL 4M43H 1U8NA 4JPIB 2OYPA 4Q0XL 4Y4HD 3V0GA 4KOBA 5B1CA 1HYRC 4I18C 1FYTB 2Y3NA 2Q2EB 3GXPA 2X41A 3WKMH 2V5TA 5BUGA 3BW9A 3EYUH 1KBBA 5SWQB 1G87A 1AH1A 5AZ2H 3RIKA 4MD0A 3PV6A 2J25A 1F5WA 4FHKA 5F93C 3SOBL 4LF3A 3X14B 5CBEA 2AQ3A 4U3SB 4X6DE 1NBZB 4KDTC 4NIKB 4UTBA 3NESA 4GI8A 3HEIB 3P3RA 2HLFD 5JYMA 3N2JA 2AK4B 3US0A 1E4HA 3O6FD 1A21A 3NRPA 4KJPD 4Z7VE 3IDNA 2ZUSA 4AYEC 3SGKC 2E7MA 1M57B 4N2OA 1KYDA 3PWNB 3A4DA 4JZJB 3MACH 1OAZH 1G9HA 3O0RH 1JZGA 5LO7A 1LNUA 3PV6B 4PFEA 3T0EE 2DF3A 5CBEB 3DTXB 5T5FL 1K3ZA 1SM3H 4XP6L 3GHEH 1AIZA 4NKOA 4BXSV 1BMZA 2CMRL 4RFOL 3LKQB 1M4KA 1NMCC 4FHBD 2H3NB 1PQZA 3QJSB 1AKJD 4GBXC 2IGFL 3KPOA 2NPLX 5CP3A 5ACLA 5I76B 1AO7A 5DO2D 2VSCA 2OMWA 2ZWZA 3E6FA 4J6RH 2A1WL 3BVNB 5IEHB 3E7JA 1DN0B 5BS0D 4M6OH 4MGXA 1KGWA 4NQSA 1KYFA 5HGDB 4D0DA 3QIUB 3PF2A 3QPKA 5GGUB 2ZKWA 4NI6A 5E03A 4L8DB 3H85A 5GZNC 3RY6C 1E5ZA 3VGHA 3T3MB 3ZKXC 1KGCE 2CJ3A 1NDGA 2OMWB 3E6FB 1MJ7L 1Z32X 5AW9B 4BK5A 2FECL 5FKAB 4WI9A 3T3PF 3L4VA 4RLDA 2CDEB 2XYBA 1BZ9B 2Y07H 4PS4H 1FLRL 2CD0A 2DQUH 2NY3B 2D0HA 2MNUA 2Z31C 3EO9L 3QPXH 5HDBB 4JKKA 4KPHH 1XR9B 4UDUB 1J8RA 2GUYA 3BAKA 3GF8A 3JVGA 3PAZA 4HBCL 1MCLA 1U6AL 1WZ1H 4P2OD 3V6BR 3OAUH 4XCNA 2GBAA 2WJ5A 1RVFH 3P0GB 1Q90A 2YSSB 4IGBC 1NDGB 1P9MC 2HP4A 4KVNL 3W0WA 5I1AB 1ZVNA 1KXVA 3DPBB 2G60L 2YS4A 5CCGE 3BRGC 5T1KA 2AV1A 5BOPA 2RBLA 4C56D 1SMOA 2C8NA 3PFUA 2QPUA 5KW9L 4TVSa 1RJZA 2ALWA 1KBKA 5CD5D 3DJSA 4C4UA 4MD5A 1N10A 3GB7A 5JHDD 1QEWB 4I88A 3UPCA 2XX1A 3EJTA 4DK3A 4LNRA 1QLEH 1Q72H 3CN3A 1DVZA 3MA7A 4LVNC 1RL1A 4PJDE 1JGEB 2H3XC 2Q76A 3NJFA 3KWUA 1DQTA 1EVTC 3QUKA 4UAOC 3KLDA 3U7YL 3ZQXA 2EUVA 5T1KB 3BQVA 4RIRA 3RHWK 4YXKL 1ACYL 3RG1C 3ROOA 1F3RB 1X7TA 3L95A 3LZLA 4HALA 4W9GC 3W5MA 1OLZA 1HHKB 2F58L 1GZHC 4IJ3C 1BLIA 3IAPA 2A0LC 4LPCA 1OSZA 2Z7UA 1LDPH 1BIHA 1CG9B 1GJWA 4ZMWA 5I71C 1JZ3A 3VD1A 1DP0A 2BSCA 3MA7B 4ODUA 4X5LA 2DJ4A 4FQIL 2EYTB 1TQCC 1QHQA 4HWBH 2BC4A 3L95B 3JV4B 2JJTA 5I66B 3H1ZA 5EUKA 4IYKA 1CN4A 2APBA 3UEQA 2D0FA 3TWCL 1KIQA 3UJJH 2BVOB 2JVUA 3WLBA 5DMJB 3WY1A 4U2YA 2JK5B 4KRPB 1YN6B 2WZPA 4AL8H 1QVOA 1WWBX 1TZGH 3KYMB 1L7IL 2BC4B 1DQLH 2VITB 5MEQB 4M6NL 3H0TB 1IMHC 3HVDA 4I0PD 1PZBA 2XZQL 1AIFB 2OSWA 5KBKA 5EUKB 1SXAA 1A66A 3P11L 1QLFB 1O6TA 3GI8H 1KIQB 5I0VA 3AG4B 2ZXQA 2KERA 1FFNA 4DIXA 1KCWA 3WLBB 4FXGA 1HWGB 2DI8A 4XZ4A 4DKEL 2KMWA 3LN9A 2FX8H 4MS6A 3SE4C 1DJZA 1CCZA 4LVOB 2APXA 2NY4B 2J71A 4M7ZC 3UJTH 2DWYA 4RFNB 3ZZLA 1RZIA 4KXZI 1L6XA 2X4PA 5TE6H 3TBBA 3X3GH 3WENA 2H41A 3JUYA 3QXVA 4H0LC 3ATFA 4K8RL 3M7FB 1FFNB 1MQKH 3V6OC 5F0JB 3VGAC 3FQ2A 2Z93B 1AGDA 5F7MC 2ZWNA 3NZSA 4IRSA 4MYPA 4YNYA 1A0QL 5IBLD 1UZ8A 4JR9H 1F13A 3P4NB 3CZFA 2KQMA 2WVTA 4HFUH 4JJOA 4LSQL 2GI7A 4G8GD 3U2SA 2WKOA 3P1VA 1D5ZA 4GKOA 5F96H 4J3OG 3ZYZA 3LPWA 1I85A 1RZIB 3OB0H 4U1JB 3LQMA 4LSDA 3SOTA 4UT9A 3HS9A 4YUEL 4E9YA 2NW3A 1HIML 5DC4B 1VKXB 2YAFA 5ISZA 2LV4A 1WFMA 4IRSB 4YNYB 3LEYH 2EH8L 5AL0A 3GFUA 3NJXA 1SOSA 3QIWC 2XZAL 1PZ3A 1PDKB 3FTYA 3D7PA 3KDMA 2XG5B 3G08B 1I3GH 3IEAA 2BCKA 4L29A 4KKAC 1UXLA 1TTCA 5DA4A 4CGUB 5L9DH 3T6QC 1RUAH 1JF5A 4NO2B 5AYTA 2DQIL 5T3XD 5HVHB 5ABAA 5ISZB 1C9SA 5LHDA 4PVMA 4EXPX 5DJCA 2CKNA 5DZNA 4WRLA 4HS8H 1HNYA 3CE1A 1E2ZA 3U6XA 4DOHE 5BXFA 2EUZA 4CL7A 1CGSL 1V7NL 2MKLC 3LSOB 4JY5H 2ZG3A 3KDMB 3HBQA 1KJMA 2J4WH 5CLZA 4QO1A 4PS8A 5GHWL 3LXUX 5D8JL 3D09A 5JXEA 1DBAH 5DUJA 1UJ3C 2C3WA 4G5AA 4DZ8A 1DZBA 2J6EL 1E6OH 5IVZB 4XVJH 2OCJA 3KGRA 3EH1A 5DD6B 2MOVA 3KGTA 4M9OA 2RJMA 3B7YA 3ISWA 3F12A 4QOKA 4M02A 2ETWA 1W6LA 3JV6B 4LHQB 4JREC 2BNQD 4CVUA 3VU1A 1D5BA 3LZQA 1AR1B 2F19L 3QEGH 3MFGB 4HK3J 2G5UA 3GK8L 2X3AA 1IAII 4BQ8A 5D1ZI 3S88L 2WP3O 2VLJD 2XTJC 4J3BA 1PY4A 1V3MA 4GXFA 4H44C 2OL3L 5C09A 4LCCB 3G6AA 5E8OA 2IBZX 1A6TA 1KC5H 4WFFD 5AVXB 4XB8A 3HS0B 4U0RC 3D3VE 4WV1A 2V8MA 3KYKL 1MCEA 4FNQA 4I2XE 1HYSD 1G0XA 4UUJB 2ATPA 4RZKA 1NKRA 1IC5H 5IW1A 3EFOA 3VD7A 3DX8B 3AREA 4U3XA 3QXWA 4P5TD 4GFTB 5AZUA 4N68A 4NO0B 3VI4A 1PZAA 1ADQL 3ECWA 3EYSL 3G6AB 4OSUH 1PCSA 2VH5L 4LRNL 3GLAA 4PYGA 4WJKB 5EZOL 2YA1A 3FHEA 2DZEA 5MENE 4XRCB 1JNLL 4LLQB 3UC2A 3WCYA 5A2LH 5EBWA 12E8H 1XGYL 2ATPB 4D8PA 2BP3A 4HPYL 1TDQA 5KYXA 1AXIB 4OF0A 1XVSA 3OWRA 3GBNH 4OLVL 2CHWA 1IBGL 3B2UC 1NKOA 3FOLB 3LIUA 1UA6L 4A67A 4EZKA 4HA1A 3VI4B 1YPZA 1ZPLA 2QSCH 4WEMB 2OSLA 1CYGA 4M8QA 5IQ9B 1M7IA 1KTLB 3L6FB 2ZKHL 3S5YA 3L5XL 3IPEA 1UCTA 5I6OA 4RQQA 5TFSL 4D8PB 1JV5B 3QJHB 4JFTA 4WFHE 1BVOA 2NTSP 1A8JH 5IVXF 5C92A 4NAMA 1YPZB 1HNFA 5AOZA 4P8QA 1TCRB 2R51A 3V0IA 3B34A 3BKCL 1GMEA 5GGTL 3KEHA 4M8QB 1E4KC 1M7IB 4ONGL 1A14L 3BX7C 5D1ZD 3QQ3B 1H9VA 3EBGA 2YZ1A 1OEZW 2YBRB 3IFLL 1AS7A 4V1DE 3VM7A 4MAUH 4GH7B 4GAGL 3JTBA 3TH2T 4AQEB 3GBML 4WI4A 4L1HA 4NC1C 2R29H 4MMZC 1YNTF 1O6VA 1TITA 3ZGIA 1U4FA 4R26H 2RQEA 3B2XA 4A04A 3ULSA 4C83B 4WO4B 5IB5B 3X2QB 2XQYA 1L9QA 3SKJH 4N24A 2LHAA 4Z3EA 1BZEA 3N43F 1FHNA 4IKNA 4B0MB 4O9HL 3U48A 3LZFH 4EJ1C 4XXWC 3VFVB 1SJHA 2WNKA 4MFHA 4Q58C 4BZ2A 4OUOA 3MFFA 4KUZH 3P4OB 5AAWA 4R5TA 4F9LC 1GOGA 3HPJA 3ULSB 5CGYD 1PX3A 2YK1L 2LQRA 4N28A 3TXAA 2VXSH 5J06A 3BZFA 1XR8A 2HFFB 3OGCA 4LOVA 3ZPDA 4X7CC 1PJ9A 3HMWL 4PY7A 2CO2A 2CXKA 1XGUA 2NXZD 2CRZA 2QKSA 3EGSB 3ZHLA 3VXTA 2BFVL 3HFFA 4X7DC 4N9OB 4YMPA 2WTOA 3VQ1C 1I3RA 2YARA 2KDGA 3QQ9D 2CG9X 4PVLA 3S96A 4H40A 1FUNA 2VJ8A 4HZ1A 3ARYA 3G5YB 4ORZC 3S36H 4F7PA 1XR8B 3CIQA 1K6QH 2H1LM 4F15B 2BZDA 3GSWA 4G7VH 3CUPA 1G6RL 1U58B 4GKZA 3VXTB 1A7OH 4AYBA 5EORL 1I3RB 4XTRD 3BGAA 2W95A 3KPPB 5ANME 5E56A 5ES4B 2PO6A 5A2KH 3NTCL 3C6LC 3OPZL 4L3CA 3BKJL 4XP4H 5C3LD 3MRGA 5KJRL 1RI8A 1ZK9A 2ESVA 4YFLF 3HN3A 3RB5A 1D6EB 4J3TA 1KTDB 4BSJA 2VDMB 1W80A 3VXSB 1RLBA 3B7UX 1HEZA 5DEFA 3RBSA 3CUPB 1WIOA 1TQVA 2G2RA 2I5YH 5D7LA 1SBBA 1QO3B 1S9XA 4XMWA 5I2IA 2EDHA 4O51A 3Q05A 4JKPH 3T65A 1NAMB 2J2ZA 2K0RA 2DI7A 4C4BA 2IO5A 2PPEA 2PTTB 4OZFG 3UH8A 4FI8A 3MRGB 5IIEB 3REWB 3QDGE 3GJEA 1N5YL 5G5DA 5ADOL 4I18A 2GJ6D 5FPIA 1ZEAH 5AWNL 5BZDB 1HEZB 5CJBA 5DEFB 2EXWC 3VE0A 2ZKYA 2UZPA 4LHUA 1S9XB 1F41A 2VN4A 5CNHA 2QVTA 3WSQH 3VCLA 5LXVA 4KDTA 3FO9A 1NUNB 5GGRY 2NR6D 4P4KD 3OAWA 4XGZA 3HE6B 4GIAA 2FIKB 3HB3D 3LIZL 2EADA 4WU5A 4EBQL 5KJ4A 1KF9B 1MLBB 2EDTA 1A4KB 4L3EE 4NP4L 3SGKA 4JHAH 3TO4B 3RUGF 1YYCA 3IDXL 3VE0B 1HI6A 4J12A 4S0TD 2AEPH 3FONA 4FZEL 5DJ2A 1ECZA 2DWDA 3HNSH 3FT3B 4GB9A 1J11A 4TV3A 3T2NL 3VD2A 1NGYA 1W0VB 4OD1L 4ADIA 2Y6TE 3VCLB 3EJZD 4Y2LA 1T83C 1E9QA 4Q2ZB 4CU7A 3TIDA 3BKYL 1G7HA 3KBPA 4GW1A 2FHFA 4WU5B 4GBXA 4RGMC 2NX5A 3IDYC 1VHPA 3GD1C 4S1DC 1GYUA 4HJ1A 1WZMA 2DH2A 4Y19E 1MAMH 3GXMA 5DJ2B 2DWDB 4LDCA 4K2UL 4OLZL 1I1FA 3SE9L 3D2UD 1QTPA 4KV5E 3EJRA 3L3OB 3CMOL 5I16A 4YDKH 4DP1X 2XV3A 5IB4A 1R47A 4RRPA 2HRHA 1XGTB 3TIDB 2H2PD 2K8MA 2XA3A 2NX5B 5GZNA 3RY6A 3UBXI 4JCWA 4P48A 1X6LA 3QJTB 5E0QA 1ZLSL 1NICA 2IANE 4PRHD 3DVFA 2AJXH 3V0WH 3LHPL 2CJUH 3QJUB 1I1FB 2PXYB 1GJIA 1IT9H 5I0ZA 3QNZA 3TFKC 4LSPL 1MFCH 4NKIL 1H6EA 2Z31A 5IB4B 2XLLA 3F85A 1CE6B 1BMGA 1KGIA 3QUXC 5KYUA 3GMLA 1JFHA 1WS7A 2WQSA 3LKRB 1XSJA 4NCC1 3HI5L 5KSBE 4HGWA 1MUJA 4IGBA 3FQWA 3FCBA 1DYZA 1P9MA 1QACA 3BVXA 1WSST 4ZI8A 4X0NA 5E2TL 4PWKA 3L48A 2HT2D 4WNQA 4Z7QE 1VIWA 1I7ZA 1G7QA 5CSBA 1BM3H 1QFUL 2ZNXA 1FFTB 3MRFA 1YAZA 4F27A 2VOTA 2VUYA 4HDIA 3L3HB 4JZOA 4YSUA 4OIBA 5I5IA 1YEGH 1MUJB 4HGWB 4IGBB 3FQWB 4OFIA 1RD6A 3IKCA 3NIFB 5EC1B 4L05A 3I9GH 2KZBA 4AEIL 5F9WC 4MTMA 3RFZB 5IOPA 2HFEA 4WNQB 1S3RA 4XMLL 1CT8B 5CWSA 1G4MA 4GQ9H 2M8XA 1GZHA 2VN3A 3MRFB 5EIQA 3CH8A 5FA4A 5D72H 4HDIB 1P7BA 4JZOB 2J73A 4TUJA 4ZOCA 4XNDA 4QIRA 2AXFB 3DX4A 3KW7A 1CICD 4BZYA 1M05B 5FGBC 3RGVD 2YPLE 3G6DH 3GHBL 5DS8A 2I60L 5SWZE 5LJYH 1M6UA 3LB6D 3BUIA 1NGXB 5CWSB 4PRNB 1DE4A 2AJUH 1MFUA 5H2BA 3FK3A 1PEWA 3O2VH 4PD4J 4MBRA 3LH2H 1VFOA 4DUWA 1L6ZA 2Y6SC 1WCBA 1AY1L 2CJSA 1E8YA 2JB5L 5DQJA 4AYFA 1D2PA 5EBLA 1AXTH 4IBYA 3BPCB 1S7WA 3MLSH 3Q48A 5DS8B 4JM4H 1GMIA 3FFCB 2TSAA 3S5LA 3WNPA 4UZGA 4PJIE 4AXWA 2X1QA 1P6AB 3QFJE 4BFIA 4M6AA 5TE7L 1JPST 2XDHA 2Y1YA 2QVIA 1KTBA 1M2VA 3ULUF 2ICCA 1MDAA 5EZIH 1WCBB 1YJDH 3E2HC 4TSAL 1OCRB 2VXVL 4AYFB 2P5EB 4NUJA 1MJ8L 5D1XB 5EBLB 2ORBH 2Q8AH 1RXLA 4DGIH 3EOAB 3TS8A 4QJ4B 1G1YA 5EBGA 3SE4A 4QT5B 3I3EA 1F18A 2CO3A 3DROA 5DZVA 1E9OA 2PP7A 2R0WL 2VDPL 5D5MA 3L4TA 3F01A 2UYLA 5GJSL 3HUJE 6FABL 4XVUC 3SKOB 1N59A 3HNTL 1J9CT 1M2VB 3UCRA 4BWWA 4V33A 4TLSA 4NQDD 3VXRA 3S97C 3V6OA 4CUCA 1L5GA 4KTEH 5GRUL 3U36A 4ODVH 5JOFA 1JHKH 1MCPH 3AADB 2JE8A 3DK0A 4MHHG 4EI5B 2DM2A 1GVIA 3DROB 1OGAD 1E9OB 3VA2C 3FSVA 2XG4A 3K74B 2CO4A 2C7UB 3QFDA 2ZKXA 3ARFC 3R8QA 2UYLB 3KJ6L 2DQFA 3IJ7A 4PGEA 2YJLA 4ZAKB 4MD4A 4OCXH 3SGDI 4ZQKA 4BGDA 1BZ8A 1MWOA 1E9PA 3DMMC 3VGAB 4A66A 3DJRA 5HYEA 1WDAA 3VFSA 2BIOA 5JOFB 1DSFH 3K6DA 3QIWA 2LABA 2XG4B 1KN4H 1NFKA 1JP5A 1HILB 3QFDB 2Y5QA 4OKVA 2WXQA 3PJSA 3I75A 3HLAA 3NDYE 5E6IC 1HSBB 2YQGA 1FAIL 4E9QA 3V7AG 2NY6D 3T1FB 4JKWA 4PBVC 2RFXB 4FERA 3S3BB 1CDIA 4NFBA 3PP4H 2QBWA 4MA1B 4OV5A 4Q14A 4P2RD 4RGNE 4P49A 1T1YB 4PG9A 2A83B 4MX7B 4M6MH 2LVEA 3CTTA 4OKVB 4IM8A 5IB1A 4MSWA 3I75B 2ITEA 2K9FB 2YAOA 3HLAB 3ATAA 2R59A 3GRWH 3STZA 2ZXWB 1UJ3A 4L37A 5JR1L 1ET8A 4LFHG 2MNWA 1ZSHA 5D2LA 5ELIA 2WLNA 4XE5B 1KNOA 1CPUA 4OV5B 2DQMA 1CD1A 1I82A 2WKOF 3PABB 2QDVA 1JPTL 2GK0A 2CM5A 2PKDA 5F1NA 1NIAA 3PWPD 4JN2A 5I1HL 3IAGC 4QNPE 4XNBA 4P07A 5T1DL 2X4UA 4L8SC 3W56A 3MLZH 4HUXA 3V52H 4ABWA 4F57L 1WD9A 3ECUA 5E95B 1VFBB 1TEGA 5TH2A 1YNLH 1SPDA 5D2LB 4FQHA 2O61B 5HYSA 1T20A 4CSSA 4G6KH 3BWUC 3GUFA 1OT1A 3BN3B 2X2HA 5F1NB 4G8IB 3CVIH 4K4KA 1ORQB 4JN2B 4G9FB 2I07A 4IKIA 4M5ZH 2X4UB 1CUOA 4HUXB 2RAMA 3L08A 1FNGB 2CHXA 3PG2A 5TH2B 1ANUA 2WO3B 2IJ0C 1U8PA 3QISA 4X8XA 2XTJB 4HKJA 3FCTA 4KQ4H 2B39A 4N5ED 3FNKA 4FQHB 5IFJA 1XB8A 5LQBH 5FHAL 1G7PB 2X3CA 3FUMA 1KBGH 2GSIA 3L9EA 4Z8FH 2ZT9C 2I07B 3WO4B 4P57A 2EO7A 4JPVH 2FYYA 4GAFB 1JZHA 4A2MA 3KPLA 4UQDA 1HWHB 4XB7A 1E67A 2PPDA 4I77L 2EEXA 5E1HB 3RQ3A 2BVTA 3DUUA 4C59B 4N2CA 4ETYA 4Z23A 1MXDA 5ERWB 5A7BA 5HYJA 4AZ8B 1MZZA 3FHAA 4HKJB 4J27A 1T5WB 3WHE0 2R2HB 1ODUA 2F1AA 3GRGA 5C6PB 3RP1A 1NLDH 1T7WA 1HH6A 2F5AL 2ZXBA 4M8UA 4JHWL 4UT6H 5F9OH 2FYYB 4HJJH 3RRQA 5CUSH 4KO5A 3SQOH 3EH3B 1EXGA 1AQHA 5DZLA 3MRCA 5HYJB 2D7NA 4JO8A 1UTDA 4ABQA 4OUUA 1CTMA 4ODSH 2R1WA 4F7KA 3K6FA 5AVZB 3MRMB 1W72L 1X4ZA 4XHJC 4NKMA 4X4YB 3N0AA 1E4KA 4OZ4A 1HH6B 1HEHC 4UILH 2XWDA 5DRZA 3D4CA 2GTWA 3AB0C 4AVHA 4FQJL 3T0DA 4HFWB 3MRCB 4TNEA 5DFVC 4JG0L 1F90L 4MMZA 4PLKC 2AXWA 3NABL 4W9IC 1KIPA 3PY9A 3GYRA 4OZFB 1F8TL 3VI4F 1INEL 3FB7A 3FMGL 4ODHH 4EUPH 4Y4HC 3FDWA 3GTNA 1PY9A 4Z7UE 5LGJA 4OZ4B 1DQDL 2PCPB 3PYCA 2R2CA 4HF5L 1ET5A 2O6EA 2KQNA 5FA3B 5DRZB 3BD3A 5KWYC 4APXA 3WBDA 3MI6A 4X6CE 4XXWA 5KG9B 4XBEL 2VDNB 3QRFM 4UNTA 2HXAA 3X17A 3KAAA 3OF6D 3R7QA 4DKDC 4F9LA 3RX5A 3GXFA 3H9SD 5JDSA 1YPZF 3SPVB 4ANWA 3JWNE 3DX6A 5I30H 4KJPC 1BLNB 3MJ6A 3B3IA 2R0KL 5LGJB 4GPVA 4NOBA 4NLHA 5D9SB 3UACA 3FU7A 5L2KD 1T0NB 1MFAL 4XPGH 5CJQL 5E6SB 5F3BA 1GW6A 3IDMA 3ZL4H 4APXB 5F88A 2PR4L 1A25A 3DGGA 4K94H 5EA0L 4Y16B 2G5BA 4PGZA 2YAQA 3VD5A 1KPVA 2A9MH 4R0LC 4U6HA 5E6UB 1HXYB 5E6YA 3JWDL 3TJEL 2FWUA 5JDSB 5LAXA 2HRGA 4XI5D 5KYYA 1FA4A 5D93B 2EYRB 3FU7B 5DO2C 3D48R 4NUGL 4ZODA 3IMBA 3KZ8A 1KTRL 5F3BB 3DOSB 2QQLH 4MNQD 4N9GA 43C9A 4LCWA 3KVDD 3I6GA 4XNUH 1ETB1 3ZL2A 4CSZA 3UTTB 4ZNEA 1I3UA 1ZHKB 1EV2E 3VFGL 3V0HA 1LL1A 4NRXA 3A4AA 3CVDA 3QR0A 3C6LA 5JZ7D 4XO9A 1RU9L 3ZDYF 5CLYA 5JIQA 1K8DB 4AI7A 3LH9A 3VG0H 3AGVA 2F5BH 3WFEH 3TNMB 4GUQA 1J8HA 3A24A 1QWUA 3D87B 3CSGA 4WFEE 3V4PH 3U30C 4HC1L 43C9B 4HIHA 3FN9A 4P04A 1L9SA 3DETD 1D7FA 3TO2B 5CZXD 2JMRA 1XH0A 1P1ZA 3AU0A 3PUCA 4H8WC 4UIMB 1XEUA 1X7QB 1SFDA 3C6LB 4P2OC 3HAEA 1F6AB 2Q7YA 3FUIA 4RZCA 5IT2H 3NSYA 1M3JA 2IG2L 4YIQA 4LPVA 1A5FH 3ZIMA 5C0EB 2V33A 1U95B 1M9WA 4HIHB 3F5WB 2EIJB 2VLRE 3ISYA 4FEMA 4NHCH 5E8EB 5I74C 3UPAA 4NJAH 1EQWA 4Z7OF 1JDAA 2XFXB 1XH3A 1KACB 1KXQA 3ML9A 4NLAA 2AEIT 3WIIL 5ENWB 4F5CA 5HGBA 1N67A 4IHOA 4A6YA 4YHYB 4KI5D 1LK2A 3M7OA 3JUZA 5I0XA 2WQVA 2R56H 4UOZA 1RLWA 2VDOH 3O4LE 3ETTA 2BXYA 3ARXA 2BJMH 2O6DA 1P5UB 3GS0A 1KV7A 3RVXD 1UM6H 3F7RA 3DGCR 4LBEA 1PFCA 4LHJB 2NQDA 1R5WA 3FKUS 4JQXC 3IJSA 1T83A 2EE9A 5E4AA 4K94C 5HGBB 2ZX7A 1J5IA 2HT4D 4P2QD 4ICXA 4XP1H 5CSZB 2XN9A 5AOJA 4M5YL 3S35H 3WY4A 1WBYB 2EINB 2WSDA 1NUDA 3IMUA 3IGUA 1I9EA 2ZD0A 4DUVA 4F7MB 3V9FA 1AQDA 1W9XA 4ZX4A 1RZFH 1AQKL 2F08A 1K72A 1VENA 1ZT7B 3UO1L 1UH4A 1UZ6E 3IMWA 2N56A 4X9IA 3K3QA 5K9OA 1JGVL 5ABZA 4GQQA 5IQ7H 3BO8B 1LO5B 4FKEA 4IOIA 1VCBC 1JTOA 4JLRA 4YL4A 4R90L 3RNKA 4MDJA 3IDYB 3LEXB 5F2FA 2XTLA 4RWYH 4CC4C 3UMNA 5M7QA 1AQDB 2CRMA 3O41B 1QBAA 2ZSWA 4OCRH 5GRJH 1GS8A 4LPTA 4Y5XC 4WDIB 4P9MH 2L3BA 1FN4A 3B2VL 2CGYA 2VRQA 2Y9RT 4WGKA 5K9OB 2OMYA 4KXZH 1G6VK 1PD6A 4QJ5B 4YBHA 4XCFL 3QUXA 5F1OB 1OTUD 2YEZA 1UACL 1MFEL 2E6JA 4OLYH 1R34A 4YR6A 1NOAA 4MDJB 1SBSH 4RDQF 3I3BA 3NP4A 1EERB 5EZJB 4OF7A 1BXVA 3FRPA 4GG6A 2GKIA 3BZEA 4MLSA 2ZJSH 3B56A 1FN4B 1TG8A 3T4YA 1JCVA 1TSHA 3WL9B 2BNRA 4LP8A 4M8VA 2AABL 2LAAA 4XBGB 1TETH 3QUXB 3GKWL 2F53D 1HFUA 2YEZB 2VDML 3NK3A 3QYCA 1HU8A 1T2QH 2XETA 4YR6B 1ADWA 1R0AH 4L8CA 1U8LA 4YHMH 4X4XB 5IBLC 4NN5B 2WTRA 4A2HA 4OM0L 4LLMB 3WEMA 1TFPA 1LGVA 2E7CA 1CGVA 3DRQB 1NAML 4KHTH 3AAZA 2EH7L 2WUCL 3ZTNH 1NOFA 3BSZH 4WY7L 4U1HA 3BWZA 5HDQL 3SN6N 1E8WA 3PWVB 3ZY7A 4LEBA 4BSWA 4KNQA 4R2GB 4L8CB 4OAWB 1YMMA 2B1HL 2BNUA 2EEFA 2I7SA 4R4FH 1KEGH 3X3FH 2XQBL 3ZHDA 1JCKA 4LK4A 2Y7OA 4EN3D 5FGBA 1WTGT 3CSYB 3GXDA 2HN7A 5F9WB 4F2ME 2VAAB 1K8IB 1Z7JA 3I6SA 3IWUA 1AS6A 2HLAA 5C0CD 3MO1A 2DIBA 4NRZA 4LVHB 4YVNA 1SY6L 1WP6A 4QCIA 4XBPB 4PTTA 4BSWB 4TLUA 3I6LD 2VMEA 3GIZL 1FZJA 1OAUL 1TF4A 4JRYD 1NDTA 1GXEA 1OP5H 1SDAB 1T7VA 4W9ZA 4XP9L 4IDLA 3NIFF 4LPWA 3AGWA 1QBBA 3GSQB 4O2CA 2HN7B 5BPPA 3CC1A 5KVFL 3V10A 2HLAB 2FHBA 5E8NA 1XH2A 2DD8L 3Q8BA 4NRZB 4OY9A 1HL9A 3VMNA 1GPOL 3K8MA 4PTTB 5AG8A 1IAIH 4ES9A 5IHBA 1XZWA 3LN5A 1FZJB 2YKLH 4HVBA 5IQMA 2ADYA 1BOGB 4PB0H 4LSSH 2B4CL 5CF3A 4H0HB 4PJ5E 3DJ9A 2X70A 1UM5H 4U7MA 3H6AA 2V17L 2XJLA 5FGCB 3MRBB 4KROD 1P4BL 4WGVB 3VACA 4EZLA 4ODTL 3GSXA 3FSZA 2LLLA 3UOAB 5B8CC 4NT6A 3MLYL 3CLEL 1INQA 1HHGB 3L1OL 3DVNB 5KS9E 3CFJA 1MAKA 4NQEA 3GUTA 3E2HB 4NB7A 4KKZA 5E99L 5LCVA 3BKML 4P46C 5C0BB 4ATWA 4R4BA 4ZUWB 1YEHL 2CLVB 2Z7YA 5FUOH 1MCWM 1IL1A 3T0AA 5HHMB 4UOQA 5ID1A 1JHTA 3ARFA 3P4LA 3ZE2E 5JMOC 2E7HA 4NT6B 3C9NB 4PCSA 1Q94A 1INQB 3MLXH 4JANB 3MRPB 3FAWA 4KVCL 3GUTB 4QRPA 3DMMA 3FU5A 1F58L 1OGTB 3ZHFA 1NOLA 1LE5B 2OP4L 3QWRA 1V3KA 4R4BB 5MI0B 3UTSA 1IL1B 3UAFA 3H7BB 4JFDD 4U3HA 3BC9A 5EU3A 5D7IF 4LLWB 1MELA 3QNXA 4OVVA 5EU6D 4RMWA 2FUTA 1FZOA 1Q94B 2GCYA 1NUGA 4JFFB 5E6IA 3RKPA 1HQ4A 3MYZA 3NZHH 3WNKA 4ZSOE 1D7DA 2C9AA 4X9HA 2Y22A 2XZCH 3CLFL 5SV4A 4A2GA 3GMRB 2A4CA 3AMKA 3UTSB 1AI1H 3MMEA 2V37A 5JO5A 3QHFH 4GLRI 4GSXA 4LQ1A 1M6OB 3EOBA 4IBTA 4JM2D 5D5MF 4FG2A 5KN5A 5DMKB 1AYRA 4X2UA 5DD3H 2F15A 5G4MA 1MHHB 2GCYB 5C0IB 5E6IB 3NUKA 4NAQA 4DP7X 4K3HA 1NGPL 1UOLA 2BVUA 1EO7A 4X9BA 4HKBA 1IGIL 4L4TA 4IMKC 4PGDB 3EFDH 3V0VB 4OCWH 3HZKB 1Y6NR 3OQ3B 4X0KA 5DVNA 2XIDA 5D1ZC 1TMQA 1Q0XH 4EXKA 1YYML 4KO7A 3UG3A 1Q9OA 4RSYA 3JZ7A 1OCCB 3NYKA 2BSSA 3EOBB 4L9LB 3MHZA 4AW4A 3BSGA 1HL8A 2DM4A 3TIEA 3A4EA 1UH3A 1KBPA 4KY1H 2P5WB 5I18L 4L8SA 3S37L 1L6PA 4N2HA 4JG9A 4PBDA 2XQYG 3BGFC 4L4TB 2PYEE 3PS6A 1XCXA 4N22A 3ROLB 4N0FA 1USQA 4X0KB 5E08L 1FNSH 3O0LA 1L3NA 2C26A 2QSVA 2VQ1A 4JRXD 4ZUUA 2CUMA 2DL9A 5ETUB 2CK0H 4K7PL 1Q9OB 1RJCA 3HC3H 3JV5A 2MQ3A 2LE9A 1MREH 3BN9D 2BSSB 4XAWH 4B9CA 2H2SC 3IK2A 3KPMA 2XBDA 3PP3H 1NCDH 2XWTB 1T1ZB 3V79C 1BA9A 1WT5C 4FFZH 4RA0C 3GI9L 4HIEA 1K2DB 4JHUA 1ZS8A 4DERA 5HY9A 4YDZA 4O58L 1N4XH 4TQEH 5D1QE 4HP5A 4W1TA 5DLML 4L4VA 2VQ1B 4XC1H 2Y69B 4ZUUB 3CXDH 4X6FA 1FYTE 1DJYA 3MGTA 3B7RL 3UTPD 3CU7A 5C07B 3PPEA 4PG2C 2JCCE 1H0DB 2ADGB 2CJTA 4AGLA 5BW7C 3KPSD 2NXZC 4O5LH 4AEHH 5BO0D 5KSVB 2JQMA 4PRIA 5TDOB 4L0ZA 5DD0L 3EDFA 4UB0H 2WLHA 3QEQE 4PLNC 2BIHA 4Z7WE 5AVTB 3LCYA 3VWJD 1A2YA 1P7KA 3IE4A 5HVWA 2EKSA 1D3CA 3BEWA 3OAUL 4LZKA 5D2LF 1T2XA 2B0SH 1NFIB 1QI4A 2UWEE 4PWFA 3ZIYA 3HFML 4HXBL 2IWEA 4TVPH 2IH9A 1Z66A 2EIMB 1OE2A 3U6RA 4ERSH 4G1EB 5KVEL 2PW2A 4NS0A 4OKDA 3G04A 1KYUA 4QJ3B 4XTRC 5IFAH 1XSIA 4YDMA 2ITFA 2BDNH 4FTVD 4UANA 4AE1A 1P7KB 5DVPA 1MEXH 3T08A 4ZXBC 5E24E 1RZKL 2OTUB 3GRWA 1FDLL 2WPGA 2YQ3A 1KJ3L 1N6QH 4RISL 3IGAA 4JFEB 4NDMA 4HK0A 4Y88A 3QDMB 4XCYA 4K9EH 2PW2B 1D7BA 3FQNB 4OTXH 1NLBL 4FCAA 3Q13A 3MR9A 4G7RB 5JYLA 1OALA 3EHBB 2G9KA 3BYTA 3FOMA 3DSNA 4FKKA 3J2PA 4W9FC 5JOEA 4IOSA 1G0YR 4K8RD 2NRDA 4QTIL 2B3RA 5EU7C 4BJLA 5B7MA 4Y4HA 3BUBA 2W65A 3GZPA 1Z5YD 2R39A 4LHUG 3FQTB 2PCYA 1CK0L 3D2TA 3IGAB 1WC7B 2Z8SA 4NDMB 1ZDQA 4HGKC 1AD9B 3KXFA 4NRYB 2VCOA 1WAAE 3VFUB 4DESA 4ZMLA 5JNYA 3KS0H 4HWBL 4G6ML 2HUEA 3D4GA 2V9UA 3FOMB 3DSNB 5ECJE 3MBED 5L2JB 3ZU8A 3RA7L 1RUKH 1BQHG 5FYKE 1PAZA 3D4YA 4P4KC 4DHLA 1LO2H 4FQQA 5LXGL 2W65B 3P30L 1F1GA 3HB3C 4DGUA 4TQIA 1JMZA 2L7QA 3T0EC 3KXFB 4HOMA 5JNYB 2KS0A 2ODIA 2OXGB 5EUOA 1G7IB 3KJ4B 2VXQL 3X11B 2FSEB 4R0LA 1J1PH 3AZUA 1FH5L 5J3HC 1MJUL 3FULA 3F3HA 1M42A 1YYLL 2ARJQ 3AACA 5I1EL 1VRSA 4CVXA 4ZTOL 1A6UH 5J7CC 4K5MA 4TF4A 1IFHL 3BMVA 5HVFB 5IMLA 5BS0A 4YSRA 5EUOB 3EZJB 3TBCA 3H3PH 1T7XA 4RRPG 2B9AA 4YSTA 4X80L 1BXUA 2EYSA 4R0LB 3FFDA 1U8KA 4UT6A 4W9HC 1WHPA 2BVYA 4K3JL 4K55A 5GS1C 2Q20A 1C8PA 4CVXB 4N2BA 4FZ8H 1WYJA 4UZUA 3ZKMD 1WFIA 4MQTB 4XO8A 3GZOA 4G6FD 2H26B 4XCCL 3G3LA 3UGXA 4PJCA 3PDDA 4HV8B 4Q56A 3RZCD 3D9AL 1IGYB 1NMAH 2Q10A 3MA9L 1IAMA 2ZX8A 3FFDB 4K9EC 4GUCA 1U8KB 4PQXA 3TVMD 4BFBD 2GT9B 5EF3A 1PU0A 5E9NA 4P2OA 4NQDE 3V4UH 4M7KL 1A7PL 2AV7B 1W0WB 4ANXA 4EUPA 4PJ7E 5F1SA 3RX9A 3IS0X 3EJCA 3U30B 3CV5A 3FF8A 4E41E 4PJCB 1I7TB 5IWLC 2HT2C 4FABH 1MW2A 3IU3B 2BS9A 3F7QA 5ABDE 3Q43A 3PDGA 4AQ1C 1GGYA 1NANH 3RILA 4YSCA 1Z9SA 2W60A 3ARPA 1ETZB 1J5CA 5B7FA 1FJ1B 1A4CA 3PQYD 1Z6JT 3F7VA 4UQIM 4CNIB 3LQZA 1HJCA 4EUPB 1X5FA 5C3IA 1DBMH 4J28A 4WHTB 3INUH 3ECQA 2Z8VC 1KDIA 4HX1A 1E4XI 1S7SA 4Y4KC 2H9GB 4NPYB 2XNAA 1ILUA 1KPRA 4MKTA 4ZTPH 3NIGF 3U4BH 1RZJH 3U7WL 1DQQB 3CZUB 2VKXA