4JK0D

Crystal structure of t89q-mutant of rna silencing suppressor p19 with 2nt-5'-overhanging double-helical rna 21mer puuug(cug)5cu
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
120
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCQYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA silencing suppressor p19
publication title Procrustean bed of RNA silencing suppression
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
total genus 37
structure length 120
sequence length 125
ec nomenclature
pdb deposition date 2013-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jk0D01
4JGNA 4KQ0A 4J39A 4J5VA 4JNXA 1R9FA 4KNQA 1RPUA 4JK0D 4KTGA
chains in the Genus database with same CATH superfamily
3PJSB 4ISVB 1HH9B 2J3SA 5CJOL 1P2CB 2V3EA 2F53E 2JJUA 1NC2D 1CO1A 4W4NA 3TCLA 5HJBA 3WDHA 3ZN6A 1WISA 3U9PL 3MACL 5EF1A 1BFSA 1FFPA 5I76A 3RY4A 3X2QB 1AGEA 3HCVB 1OEZW 5GHWH 1FG9C 1TJHH 3H9SE 2ICEC 7PCYA 2WINA 1MCIA 3U46A 5HHXL 4S1DC 4FA6A 1T5XB 2YD5A 3N3EA 2DJ4A 4NHUA 3WKYA 4P2QB 3TPUB 4YOKA 2CRIA 1DANU 4F57L 1E5AA 4QAWA 3N91A 2X7LA 3SOBL 2ESVB 1AZBA 4TPRH 4U1KB 2H3NB 4LSPL 3E6HA 5GS0L 2XQBL 4HBCH 5JIHA 1U8HA 4JO4L 4MD5B 3ZDYE 2MWCA 3W57A 1ZLVK 3MFGB 2WIIA 1CXEA 1JS4A 1UWEL 1WCBB 1AE6H 2YZ8A 4JFZH 5GRYA 4WHYG 5D2LE 1E43A 2ZXAA 3LVEA 1FDLH 4FXLA 2NQCA 2R2BA 1FUNA 4IBLT 5F89A 3RJDA 3MRLB 1EQWA 1X6LA 3P9WB 3V6OC 2BVUA 4MDRA 1KCKA 3A5VA 1OT1A 3QNXB 2XXMB 4IIZA 3VFGH 1UB6A 3ARBC 4JZOA 2WLHA 4HCRA 2YBGA 4LPYA 4ZQKA 3DA0A 3KR3L 1S2EA 4ZAKD 1PG7W 3X13A 4LVOC 4JUTA 2FATH 3KVDD 2KLTA 4I0PC 3MSPA 1L4IA 2J88L 3BKJL 3MXVH 4RCAA 4U7KA 5AAPA 1Z32X 3V5HA 2A9NH 1JK8B 5D7KD 1LP9A 5E5UB 1RUAH 2WXJA 5D6CB 5ICZA 4NQVA 1Q94A 3OL2A 1TTBA 2CDFB 1BP3B 5BQ7B 3HRZB 2DV6A 5H4YA 1MF2L 2WGNB 3QJXA 3W9EA 5J6GA 3NP3A 1ZANH 5DMIL 3PY9A 3WN5B 3H55A 3VMNA 2BP5M 4TULL 4N3UA 4YWGL 2ZP0T 4Y5XA 3SDXA 5K9QG 5CLTA 3CX5J 4TYUA 2O61B 3UYOD 4JFHD 1FL6B 4G8IA 4GUPB 2CUHA 5KJ7E 4KY2A 4PRNB 4UQAA 4F92B 4TNWF 1KC5L 5B8CC 3FFDA 1IKFH 4PTUB 4J6RL 3TNMA 3FCTB 3KPPB 3DX2A 1H5BB 1SBSH 3NDYE 1ORQA 2FO4A 5C0DA 3UO1L 3RWEB 3QRFM 1JTPA 4O5LH 4ELKB 4LHQB 1I1YA 2HT3D 5IVXB 1HJCA 2V7NB 1HX0A 2XWRA 4UNVA 1MJ8H 4JREC 3RPIB 1NAMA 3HUJE 1RURL 3CFJA 1LE9A 3U36A 1KXTA 4R5XA 2QHRL 4Z77B 2YUWA 2XOTA 3V4VL 4NN6C 1XD1A 3F7QA 1T2QH 4H2CA 4JKMA 3PWUB 5D7EA 4ANWA 4MASA 1MWAB 5FYJH 4HAGA 2IAMB 4IEFB 4X7TA 1XGUB 1BFVL 5F9JA 4BFBD 1I7ZB 4OTXH 4ZBJA 4P59L 1LYQA 3MYJB 4MGXA 5D7IE 4RFEA 9CGTA 2ZAGA 5EBMA 4ZMWA 1HNFA 4LHUG 3MRRA 4FLSA 3PYCA 4L29B 1I9EA 4OKDA 4OBRA 4HXAL 2ZOUA 4OD1H 3TJEH 3GHPA 2EDXA 1OTUC 3WHXA 4HJ0C 1HH6B 1K4CB 4D0CB 2R15A 4QHUB 3TCTA 1S7XB 1A7PL 1DBAL 2WLIA 1WA0X 3OF6A 3I84A 4QHLB 1JPFB 1J05A 3JV5A 4KPHH 4I85A 4QXVA 1T80A 4GS7C 1JK9A 4NLAA 1QLEH 4L1DA 1YN6A 4YIQB 4HJJL 1BQUA 1H3WM 3KNBA 3WNMA 1MI5D 2WTPA 1MFEL 1U42A 2EIZA 3APCA 3RY6C 4RETB 1NGWA 3P4OA 5FFLA 1CXKA 4FQCH 3D08A 4GRLA 1QOKA 4QO1B 4XBGA 2K9FB 2AXFB 2DYPB 1OB1A 3LDBC 4FNRA 2C7UA 2E27H 2G30A 3F6IA 5T5FA 1ZHBB 2NDGA 2CUIA 2PUQT 4WV1B 3BGFB 3QDJE 4HCRH 4QAMB 5GS0C 1L6PA 4R7NA 4XNMB 2VDNL 5FB8A 4KVNH 4P57A 3VYPA 5CJBA 2WB7A 4WHYH 4XMLH 5F8QC 1EDQA 3SY6A 4FQIH 4U1IB 2ZKWA 2YEQA 3IDNB 1KIPA 2X4NB 3GYRA 4L2LA 4I77H 5B1JC 3AXHA 3ZL4H 1CD1A 1C5CH 2G0LA 2DN7A 5TFSH 3RTQA 2BNQE 2ED9A 2HJLA 4TQIA 3TASA 5C86A 3RZWA 2HFFB 3HG2A 1PZ3A 4UM9B 3DROB 3SGKC 3B3BA 3CSTA 2GTZA 3JWDH 4RGNC 1FQ9C 3D9AH 4H8QA 3FH8A 4N9GB 2WMPB 4KROD 3I9GH 3S7GA 2H0PA 1XH2A 2WLMA 3FCGA 5DVMA 4X6EA 1SOXA 3PV7A 4PH8A 1WTLA 4I9WE 1BAWA 5EA0L 1JMXA 4XN5A 3CZEA 3HG0A 4A6YL 1QBLL 3J7HA 3MUUA 3FB6A 1AYOA 1XGPA 4U1GB 4MA7H 2NW2A 2OSLA 1TZGH 2DEXX 3BVWA 1EANA 3K91A 5CHNB 3N5AA 5IMMB 1U2HA 2X1XR 2K7PA 4Q9QH 4U0RC 1HESA 3GUTA 1E4HA 1ROWA 2R1WA 4YX2L 3U9WA 4U1LB 4WO0A 3MZGB 3MJWA 4KV5E 4CW1A 1AYRA 3MV7D 3IRZA 3KVQA 5SX4H 1MCJA 4X5LA 1JZJA 1IX2A 1FI8C 3GNML 3GHBL 2V2XB 1NBYA 4GG6B 3IFPA 4F8LA 5BZWA 4N8PA 5CINL 4ONHA 1XVSA 1N68A 2XXFA 4YSSA 1NBQA 5FM5M 3UMTA 4JHAL 2PO6A 3RAJH 5L8LB 4RESB 3VVWA 3W11C 4MYPA 1I9RL 1DO6A 4APXA 1SNRA 2UY7B 4Z7NE 3B9VA 2OP4L 5IEHA 1R0AL 5DK0B 4U6XB 1X6NA 2JJVA 2UZIL 4M43H 3PHOB 2QSTA 2V7HA 2NSQA 2NY6B 5DURD 1F3DH 4W93A 5LGJA 2DPKA 4LDEB 1S7VA 1EAQA 4R2GD 5FGCB 1JFQL 3GI9L 4XVTH 1VCBC 3CC1A 1PL3A 2HMIC 5IHZB 3A4AA 3D4CA 3QQNA 1KUMA 1X5MA 5DHVH 4ZMOA 2A73B 3BZDA 3QCUH 5DRXA 4LASL 4WY7L 5H94B 1C9SA 3FRUA 3KJ4B 4BCXA 3ULUH 3C60A 1IT9L 1NCDL 5HHVH 2EYTA 3AU1B 2FD6H 3ET9F 2BOBB 3ATBA 3ROOA 4KNQA 5ALBL 4XO5A 1QSEB 4FFYL 4FZEL 3C6LA 4GBXB 2NW3A 4CILA 5T3XL 3QFGA 5AD0A 1MVYA 3MCKA 4Q6IA 4JZJA 3SE3A 5KVGH 4FJ6A 4KVCL 3UO8B 2R69A 5AW8B 5AYUL 4UILL 1AGDB 4R96B 4JHWL 1BM3H 1IM3A 3OJMB 5D4HA 3ARXA 4OZFH 1HL8A 2WTRA 3TYGL 2WO4A 4UB0H 5EBWA 4AYFB 5HYQA 5IBUG 3GSUB 3D0AA 3BPNB 3BSHA 2WKGA 3VU1A 2X4OB 2XIBA 2YPKB 1GYWA 4TTDD 1NCBL 3VJ6A 4ZOBA 5CBAA 5DMYA 1OAKH 3RTQD 5IMOA 3LX9A 1WEJL 5T33H 2J55A 4X6CA 1BYOA 2R29L 1KT2A 3FB8A 5DEGB 1GC1L 2O5ZL 5FCUH 2AGJH 4KXZH 3ZDXB 3PE9A 2AC0A 3E8VA 4GW1B 2EAEA 3F5WA 1W72A 2VXUH 5CSZB 1L3NA 3LH2H 4WO4C 1FGNH 1IEAB 3FONA 1X9UA 4JY4A 5C2UB 5IBLC 3BDYH 1F4YH 3RWFB 2FBOJ 5CEZE 5MERA 3BYTA 3GMMA 3DX4A 5AKSA 1QR1B 5DQ9B 2EVIA 3D6GA 1T3FB 2FEJA 2N4IA 4G8GA 4HKBB 1VESA 3M46A 5AAWA 3AJ7A 5L2KD 5EO1B 4OFQA 4RDQF 4HZLB 5IESL 3EYVA 4WFED 3V0FA 3R7RA 2VJ8A 1VFAB 2YIHA 2Y72A 2YLHA 3QA3B 4O58H 3HC3H 3PWJB 5ANMB 2J1YA 2OKMA 2VZUA 1KGYE 1ZHNA 2OMWB 3GS7A 4AVHA 3QNYB 3L7FB 1NDGA 4PJGB 3E9UA 1UKTA 4RWYH 4TLSA 4U1NB 1E4KA 4FZ8L 1U6AH 1BQKA 3EHBB 3GBEA 4A38A 2GSIB 4P4KA 3WNJA 2IV8A 3SE9H 3BPLB 4PJAF 2OMNA 5E9AA 3U25A 2ZNWA 1VHPA 1GGTA 4IGBA 4X7SL 3WJMA 1EZVY 4HIJB 4BK5C 1VZIA 2KDYA 2ZPKH 1CFNB 4B5ZA 3CLFH 2H2SD 3DI2B 4MS8D 2WZ6A 4P46B 4LEOB 4MZIA 4XPTL 4EI5C 4EQ2A 1FG2A 4KO7A 5I0XA 1ZS8A 4MYWB 3X1NA 2PMZA 2WIMA 2DWTA 5DWUH 3O2VL 1KCWA 2X2UA 2GBUA 3RZCB 4GJTB 2Q2LA 1YNKL 1K8IA 5JHLA 4PJFE 2D7QA 4DZBA 4TN9A 5TDPB 2IALB 3C60D 1CZ8L 4N0FB 3BKMH 4ODHH 2OQJB 1J86A 1DJHA 4N2BA 4MVBC 3BKCH 3C6LD 1A6ZA 4BKSC 4HCFA 3X12B 4P3DB 5L6YH 5F97E 5FKPA 2ZOKB 1JZHA 1HHIB 2BSCA 3QR1A 1AD0A 4JG0H 5JW4M 3MZTA 1XF2A 1AGFB 1HXKA 2WAQA 1TEYA 3S37L 4D3CL 1IM3D 4F3FB 3BAKA 3T6ZA 2F8OA 4AQ8A 4JO3H 3B5GA 3TN0B 1Q0XH 2YMXL 3IRCA 1A7OH 2GFBA 3UBXA 2XX0A 4NJ9L 4ORGA 3QG7L 4QCIA 2X70B 1A9EA 3DV6A 3L3DA 3HNTH 1OAQL 3DO3A 2HSIA 3K8MA 2UVFA 2DQFB 1JPTH 5TE4H 2NLJA 2JQAA 2BC4B 4NDMA 3S2CA 3UH8A 3BQUC 1IKNA 5JA9A 2YPVH 1K8DB 3HI6H 4UV7H 1DCLA 5J0BA 3TEXA 4I48B 3HVDA 2VTFA 3T6QC 2XY2A 2HRHA 4NWTL 5E6YA 1U92A 5IG7A 3QG6B 1YAIA 4UQ3A 2VMCA 3ORJA 4F58H 3TC9A 5C0CA 1CFSB 4NO0A 1S9WB 4UOQA 3GK8H 1E27A 3G6JF 5GGQL 4U7SA 1X7SA 5HHPA 2NY2D 4AYSA 4G8GD 5CILH 3BO8B 4AVIA 5HHQB 1W72H 2GK0B 2F5BH 3ZE1B 3MRPB 2PTTB 2X53A 5HBBA 2KZ1B 3D0VA 4IRJA 4Y19B 1EK3A 1LTXA 3MLVH 3CLEH 1U91B 3H0TB 2DDQL 4PU2A 4V2BA 3NOIA 4IHOB 3VE0A 1Q38A 4NC0B 3MFFA 3P3UA 1D9KC 3H2QA 4PN6A 3WBDA 5KVEH 4DETA 1A4KA 4CMHC 5J1AA 1ODAA 1RUPH 2MQGA 3GI8L 1VPOL 3BQVA 2WSKA 4G8FB 4P4KD 4G9DA 4PW3A 5IQNA 1P5UC 1M7DB 3V6ZA 2G60H 4IGBD 1T83A 2VAJA 4N0YL 4O51A 4QF1A 5D7SH 1CVRA 4R0LA 1C5DA 2WYTA 1XAKA 5G4OA 3VRIB 1NFKA 1JGUL 4OGXL 3BXNA 3VXQB 2NTFB 3OXRB 1JXGA 2X9YA 2H6UA 4OGZA 5G4MA 4W9DC 4HPYH 4M7LT 1NKRA 2AERT 3IPBA 3QWRA 2P7TA 1CFTB 3F58L 5F1NB 5GJTH 3O9WA 3GMQB 3VXNB 4ODXA 5E8DH 3LV3A 1IC1A 4HJ1A 2PCYA 4R97B 2EC9U 3PQYA 1XF4A 2PYFA 4IRSB 3LEVH 4W4OC 1BOYA 3AS0A 1MUJA 1T1YB 4NNXB 3E6FA 3VXMA 1G7IA 4LSUL 4MA3B 4FKKA 3CZSA 4TVPD 4X9YA 1QPPA 4QY8B 3DJSA 4NFCA 2XT1B 3V8CA 4WU5A 2Z91A 3GUFA 4DSYA 3RL2B 4BFKA 2MPAH 2JI1A 2BMKA 2OZNA 3MRQA 3ARWA 1PQZA 3CZNA 4IU2B 4LGSB 1HHHB 4ZMXA 1MSPA 2ESVE 2D31A 1UT1A 5DT1H 1LWJA 4TOYH 4IOSA 1UXLA 4LL1A 5I0WA 2IQ9H 3AUVA 5HI3D 5K33A 4BELD 1J9TA 3HG4A 5HGHA 4AMWA 2OL3H 1RZKH 3DMMC 3NJVA 1OOWA 1JTOA 4HLZH 3WFCH 1E3FA 3DO7B 2GY5A 1BD2A 1T20B 6PAZA 3W1ZA 3L5IA 3MNZA 2QQLH 3T71A 4C4UA 1HILA 1Y1UA 5FLVA 3BUDA 4EI0A 3UC2A 4HLEA 2NY1C 3BZ4B 3KPRB 3NJHA 4DPCX 5F7UA 1WUZA 4WEBH 2FX8L 3L4TA 1ZGLP 2JMRA 2E76C 4PW9A 2QGBA 4BH8A 2X89A 4OB5H 2AEWA 3JTTB 1HYSC 2ZCKL 1FL5B 4HIIB 4L18A 1DVFC 1GGBL 2OMVA 5I73C 5LWYH 3FUEA 5M95B 3G6DL 1XL4A 1HKLL 4FD0A 5C0CD 2VDQH 3IFOB 4NO0D 4NI3A 4ZD3L 1MVUA 1KXVA 3Q06A 1HSBB 4XCCH 3VFVB 2FR4B 2VITA 2VQ1A 4K8RL 3QJQB 5I1CH 1YMMD 2QV2A 5KVDE 1UOVA 3PAVA 2UX6A 5AL8A 4URTB 4QXGL 4YHPA 1RAMA 2WBKA 2QPUA 1E4XI 1T04A 2WO2B 3HFFA 1DZ0A 5D1QB 3MLZH 3S3JA 3N1GC 5F7LB 4OZHB 1DJWA 4CVZA 4U1MA 2WXNA 4IRJD 3GXFA 1KBGL 3B2UD 1BQHA 3I85A 1P4LB 4KY1L 5JHDB 3B9KB 3NRQA 2BSBA 3N9GL 4XXDA 3NJLA 1KJMB 2OR9H 2HJFB 1MRFL 4DKTA 3IGLA 5LDSA 2H0FA 4JPQA 1D5XA 4XP6L 3ZYOA 1UWGL 5DJ8A 1X5ZA 1ETZA 3CPLA 2O72A 2HT2D 4B0MB 1M2VB 5GGRY 5KYXB 5IQ7L 3V7AG 1CI5A 1JJUA 3O11A 2AJXL 5D2NC 1VRSA 2P5WA 4PQXA 4ZSOB 2VM3A 1E6JH 4DESA 4UAHA 1QG3A 4XNDA 4GKZB 3RVXC 1DDHB 2LTQC 4QEGA 4NFBA 3WJLC 3QWRD 2OMYA 2R1YB 4BE6A 3BGAA 1M57B 3O9WD 5IVXE 1JWUB 1BVKB 1DSFL 5ENWB 5MEPB 4LPVA 4PRBB 4KZEH 2R39A 2ROXA 1XCQA 1CLZH 2ZSWA 4MXVF 4CSTA 1EJOL 3PQYD 3TNNB 3QULB 4F33A 5EO9A 3GO1H 1INDL 4N1CA 1BIIB 3PHQA 1I7UB 2VWEE 4J3BA 3MLUL 5BVPH 3OXSA 3EO0A 3AROA 2VXSL 4AEIH 2H9GA 1DVYA 5HDQH 3L4XA 4WI0B 1DQDL 2GG1A 1HQRB 5EOCL 1BYPA 1P9MC 2ZCHL 1P0SE 4ILDA 3HG1B 3ZHNA 4CSZA 3WKQA 3CZUB 5C0AA 5T1DH 4N2DA 2YEVB 3EFFB 2DB8A 1NCWL 3NIFF 4MQTB 1U4FA 4XNXH 1W8EA 1F41A 1R33A 2CPCA 1CYWA 2ALAA 3D51A 4CJ0A 4IOSD 4WK0B 3Q8CA 1YEKH 3EOAA 1AP2A 3FQXA 4JVPA 3MVSA 4CRPA 1WGOA 5TE6L 2TRYA 4TNVF 1BD2D 5GGTA 3O3DA 4XNUH 4Y9FA 2A74A 2B2XH 3SDAC 4WI3A 1WCQA 5IK3B 1UYWH 3PNRB 2R9HC 2VCOA 2N56A 3O2DH 4G43B 2X1WL 4O2CB 3MLRH 4JFTA 5IJDC 4IBUA 4F7EB 2Y7MA 5IHHA 4Z95L 1SXZA 1YY9D 4HPOH 5AW0B 2X89D 4ZTOH 3FNKA 2WNXA 1N7MH 4XNZB 4G6KL 1Z66A 1IBBA 2IADB 4KO6A 1G84A 2YQBA 4OT1L 2XICA 3U7WL 3L7EB 1Z3GH 2X28A 2I60L 1A6VL 3WGVB 3C9NA 4WKZA 5LKNA 4NPYA 3PWPE 3B3IA 3PDDA 3NZ8B 4ETQA 2Z31A 3ZKMD 3MU3A 5A1AA 1OARL 2QHLA 2HLFC 5MI0C 3HMXA 4BKLB 2G75A 1E6OH 1G4RA 2AK4D 1FN4A 1EJFA 5FUOL 5CUSL 4XCNB 2R4RH 4CADA 1I8LA 3H7BB 3VWJC 4YXLL 2NY0B 3I9PA 4LEBA 2Q6WB 5FF6A 5FKAA 4ERSL 5CKGA 4ZODA 1A8ZA 1WAAE 2CBQA 3QHZL 4AZ8A 4GUCA 3JV0A 4JRWA 5C09A 2F74B 3OX8B 3EGXA 4LPUA 2OJZH 1G1OA 5JZ7C 2I27N 4UU9B 1XFPA 4G7VL 3ROLB 2ZCZA 7FABH 4YO0B 4PJCB 4HV8B 3VFPB 3R8QA 3HHMA 1LMKA 2B4CH 3AABA 4I9XA 4LLMB 4U3HA 2IOOA 4XP4H 4WAFA 5B3JF 5IMLB 3PGFH 3ZR5A 4GYBA 4M56A 5HTSA 3T09A 3E3QE 1NCHA 3JYCA 1SQMA 3WKNA 3MLXH 5JR1H 2CGRL 2P5WD 2HB0A 4LLQB 2XVKA 1G7LA 1VFBA 4RMQA 1JGEB 4K8RC 4M3KB 2YA0A 1IFHH 1LWRA 1TZHA 2DH2A 2J2ZA 4GLRH 3LKNA 1JN6B 1NCUA 1TU2A 5F1SA 1WA1X 3QZWA 3VQ2C 4X0KA 1JG9A 5HDBB 3RVVC 4JFUA 4MD0A 1S5IH 1IGFL 4GG8A 3T8XA 2A9MH 5IFHL 1IZKA 1L0XA 1GZQB 3OMZA 3IEAA 3LOWA 4ZT1A 3ZZSA 5IW1B 4X7CC 1UGKA 1SLXA 2XWDA 4I2XB 3ZT6A 4D7PA 1GOFA 1ADWA 4ZOEA 3Q6GL 3CGTA 5F44A 1UTDA 4HX1B 4G6MH 4GG6E 3Q8BA 1HXYA 3SBWC 5I74C 3LZOA 5AB9A 3WKML 3SPCA 3U4BH 5ESAA 1O6SA 5KG9A 2BSEA 3F12A 4ZFOA 4N6RA 5C0AD 4DPBX 4HWBA 3OKEB 1G7MA 3D3VD 4L5FL 4PW4A 3BH8B 12E8H 4ZPVB 3VI3A 1MCFA 2C9VA 4XC1L 2IPUK 2VLKA 4FKEA 5FUZL 4LMQI 1RLWA 4JPIA 4FTVB 4NRYA 1FE8L 1QBAA 1A6TB 4NKMB 3L9BA 2MNJB 4FC3E 4XPAL 4OI9A 4IIQA 3TA4D 2VT0A 4UIMB 3ISWA 4X0NA 1OP4A 3L3KB 3HLAA 5L0QB 4NWUH 1C1EL 3G6JE 1W6WA 1WITA 4YSQA 2R8SH 1IGMH 1YEJL 2NNCA 3QGVA 2EUZA 4OLUH 1S8DA 4HC1L 1QSEE 3U0PA 3S37X 2FIRT 1CDJA 2VR6A 4OR1A 2FJSA 1TQBB 3C2AH 5JPMC 3S88H 2X3AA 3PGCA 4LLWB 1YY8A 3ARDA 4G1MB 3EUUA 3OKOA 4LOVA 3BAWA 4RA0C 2A38A 2PP8A 4LNRA 4V11A 5IZ7A 3OHXC 2DLFL 5EORL 5GGSY 3ZLQC 3HZ3A 1Y07A 4PS3A 2Z31D 1HEJC 3NG5A 3PU7A 4M6ML 1YEGH 4MZ2A 2BIMA 3VX0A 3LB6C 2SODB 4WWKC 1WA2X 4LLUA 1A6UH 1V7NL 1R5VA 1T1ZA 1ZWIA 3HE6C 3NJGA 3OLDA 5KZCB 3A6CH 4C4KO 3U1SL 3VFUB 1QEWA 5B1BB 4R26H 2P8PB 1YMHB 4APQB 5SWSE 1FGVL 3LMJL 3IFNH 4MBRA 1WFIA 3QQ9D 1LO4L 5FDYA 5DK2A 3WXWL 3FMGH 3NEXA 5EEXA 1L7TH 3B7RL 3MUY1 4ZFGL 1MHHA 2KI6A 3FO0L 4R90L 1PX4A 3NN8A 2OSWA 15C8L 3KYKL 2PN5A 7PAZA 4N5EC 3SPVA 3QRBA 1KIQB 1BGXL 4MMZC 5E6RB 4BZYA 2FECI 2Z92A 1ND0B 4W9GC 3BP7A 1ZTXL 3BZEA 1OK0A 3Q3GA 3QARA 4KOBA 3MV01 1T0PB 1BPLB 1ICTA 2BNUB 2XTJB 3O3EB 1S78D 3BN9D 5HHOE 2BS9A 4YDIL 4AJWA 2WUBL 3PL6B 2CK2A 2CMRH 2X2JA 1UM5H 3LNGA 2Z1KA 4EN3A 5D4JA 5DVOA 1SDYA 4PJGE 1P69B 3U0TB 4Y4KA 2ZOWA 1GOGA 3FU6A 4YEEA 4F2EA 4S0HA 3MV8A 2JKLA 1CTOA 5HJDA 1P7QA 3UTQB 4IDJL 4X4YB 4E41D 5F3BB 2A3TA 2I9TA 2BSED 4FTDA 1XAUA 2CUMA 5D1XD 3EJCA 1DBBH 4L3AA 4BRVA 4P4RA 1MHEA 3W5NA 1LE5A 1HK6A 3LS5L 1PIGA 1AMYA 4ACPA 1I1AB 4YHLH 5C0FB 1DUZA 3GKWL 3QCTH 5IGXL 4JFOA 1NCCH 3ME0A 1U8LA 5CLWA 4LVHB 4PYGA 2DTSA 2HAZA 2NNAB 2ISDA 3HB3C 4RQQB 5C0RL 1J5HA 3DJZA 3FW6A 3R7QA 4ZMAT 1CF8L 2Y1YA 4PLJC 2XCMC 4W81A 1QRNA 3RDTC 3U4AA 5M7QA 4PJ6A 5J11C 3TF7C 4Y5VA 2OXHA 1FV1B 4UQEA 1MAMH 1K5NA 2NZIA 4IKKA 1FH5H 4UT9L 3VSQA 4DVRL 2VDKH 5LXVA 3DHPA 5E6IA 3ML8A 4HUVB 4N2AA 3B1UA 1K2DA 3GIZH 2CGZA 3DTXB 4M1GH 3C5JA 1N70A 3CX2A 5TF1H 3CVBA 3JWNE 3KL3A 3QEUA 4FQ2H 4YL9A 1U8OB 4Q52A 4L4VA 2ZAHA 4CNIA 3ARDD 2GKIA 2XPGA 3A6BL 3JV6B 5HYJB 2P24B 4V1DA 3NT0A 3LY6A 1BZ7A 1XR8B 2BY3A 5IF0B 4LHJB 4FYQA 1GSKA 4JDTH 3WLWC 5JO5B 4S1SH 4MA8L 4CJ1A 5HVGB 5BCAA 2CJ3A 2PCXA 3LH9A 5D5MB 2EYSB 4CU8A 2VSCA 3DX7B 3QJSB 4KK5C 1RMFL 2VKWA 4HUXA 5B38G 2X4UB 4C59B 1UD8A 1XTMA 5I6KA 1A2YB 5AB2A 3MV9B 3TV3L 5LN4A 3APFA 2OJEA 1DL7L 4PGEB 4FQXA 3MLYH 3BHBA 4IOIB 5FX3A 5BUGA 1DQML 4NGHH 1NIAA 3IM1A 1TZ8A 1B3IA 3NCYP 5CEXB 2CIKA 4XT1C 1MN4A 5FYKL 4DEPB 3NACH 1FYHB 3BWZA 4B60A 5HYFA 1CLVA 4P23A 1RIVL 5ID1B 1VGKB 4BZ2A 2AABL 3IU4H 4WLCA 1LWHA 5AZ2H 1XZ0B 1FORL 1DQQB 2AP2A 2R2HB 3B8YA 5I1JH 3ZE1E 5KYWB 2XWJB 2DWSA 3MRMA 4FX5A 4XC3H 3S34L 2R56L 4LRIC 1NL0H 1QKZH 2YAOA 3K72A 2CNYA 1FP5A 4LKCB 1Y0LA 4XODA 2TAAA 4BSVA 4F37K 5AFAA 4PJIA 5CD5C 4EN3D 4AXWA 4FA8A 4Y4KD 4B96A 1AGBB 3KBFA 1NBCA 1BZ9B 3WIAA 5I28A 4JFEB 3FT2B 4EAEA 3CH1B 4OCYH 3UC0H 1E5BA 4FLOA 1P7QD 3KL5A 5LGKA 1B6UA 2GI7A 1BBDH 3QI9C 5FWRA 5SX4I 4L8SC 4V2CB 2WNWA 5K9QI 2O30A 5GHWL 1TJHL 2EIEA 4N8VB 5EZLB 2JKSA 3ETBJ 3GDCA 4ODVH 1UASA 5GPRA 1M6UA 3L2NA 2R59A 4Y4FA 1F11B 2AKRB 3DIVA 4MQ7A 5TH2B 1HVXA 1IGTB 1VLXA 2J44A 3VFTB 4DVBA 1YEIL 5EIIG 1DP0A 3SGEH 5L7XH 5AYQA 1P6WA 4AG4H 3OSKA 1X9LA 2NR6A 3TO4D 1QRND 5K93A 3F7YB 3ZZQA 4ES9A 1INQA 3CFQA 4FJYA 3CFEA 5J6HA 1R75A 2Y69B 2GSGA 3S3CB 4E9VA 1M1XB 4H88H 3QUGA 1F1DA 1QWNA 4K5NA 1I4FB 1IEBB 1XO8A 1G0XA 5TJWK 4PJ5B 2WVUA 4PGZA 4GP4B 3OKNB 1J8HA 3QWQB 1GZPB 4NUQA 3QDHA 2BLFA 4CVXB 4YZFF 5I2IB 5FDWA 1I3VA 2R0WL 3I6GB 2DKUA 5AOIA 3DDFA 2Q76A 2X40A 4L4VD 5I16B 1HTYA 1DBJL 4RRPA 3M8OL 2HG5A 3AWFA 1JZIA 4V1DD 3AS3A 3VI4A 3H9HB 3I2CH 5EUOF 3CMOL 4ZS6C 2E4FA 3DSNB 4JFPA 2OTWB 2FATL 4YK4B 3ZE2F 2AMGA 2ARWA 4KJYA 1T22B 8FABB 3OLIA 2HKAA 3VSUA 3CQPA 1G1CA 1K4DA 4G5ZH 4ZO8A 3S35X 1DFXA 2J5LB 1KNOB 3Q7JA 2MCAA 3SQRA 3KPRE 5F3HB 1Q9KB 4WTZG 2ADIA 4F8QA 1NMBH 1F4HA 3LSOB 5FO7B 4FQXD 4OCNC 4QWWC 2YA1A 2F7RA 3PUCA 4LAQL 4Y9GA 3G3LA 2DIAA 4TLTA 4JAMA 1L9TA 3QORC 2YK1L 4HG4J 4LSRL 5B7FA 2QGDA 1N0XH 5GIRB 3KWVA 3WL9A 2W60A 1OP3H 1MCDA 2C3GA 4X6DA 1E4JA 1FLTX 1FNGA 1XH1A 3BUIA 2IWKA 2R4SH 3FQRB 4PJ9A 3TEUA 4D9RD 3HG3A 3WNLA 3BW9B 1OM9A 1SBSL 2DS4A 1RIUH 5GRVK 5JLZA 1UB5A 1MHCA 3DIFB 5E8NA 1HHKA 1T89C 3WFDL 1JGLH 1KTJA 5I8CB 1R24B 2AQ2A 5E56A 4DKEL 5IJVB 3QB7C 1KGCE 3EBGA 2RACA 4EF3A 2H0JA 3X1GA 4K3EL 5I1EL 4JNXA 1KY6A 3QIWC 2JKJA 3T08A 4UI2A 4NOBA 4N2MA 4B97A 1WT5C 1FFOB 3WJJA 1AY1H 3FRPB 3QQDB 1KTLA 1RP9A 4H20L 1T21A 4OF3A 5B8CB 2OTUB 2CXGA 4PJ8A 1F58H 1AFVH 3D12B 3NBNA 3I6LE 4ZSOE 3O8XC 4GT7A 3U6XS 1TT6A 3IJEB 4Q2ZB 2XN9A 5C6PB 1RK7A 5GSVA 5C08A 1GAFH 4Y4FD 5F9AC 3NEEA 1SLVA 3V5KB 2H8PA 1R3JB 1XT5A 5E8PB 2WZ0A 3T0AA 1KB5H 2KQMA 3CDFA 3E80A 5AALA 4K5OA 2CDEA 1Q4NX 2NR6D 4BFJA 5GGVL 2EH8L 1XGQA 1Y6NR 4PJDA 2DMHA 4NN6B 4S2SA 4G5AA 3TYFA 4NQDB 3WMQA 2IPTH 2Z9TA 1G9HA 4X9BA 5EF0A 2G9HA 3N0PB 4H8HA 2EZ0D 3RUGF 1J8HD 4HEPA 3GJFH 3QXWA 4MCMA 5ALCL 2FIKB 1FVEB 3HG1E 4XWOC 3L3OC 1ET7A 1QLEL 3AGWA 3D52A 3CN0A 1DN0B 4ZO7A 3KWTA 4M6NH 3QNFA 1YEFH 1JUFB 4R7VA 2F53A 3ZO0A 2D03H 3HZMB 3VXPA 4W6WB 3FTZA 5E08L 2N0MA 3EOTL 2JKWA 5MEND 1SHSA 4D7BA 1KJ2H 2WWMD 4NN5B 3LKPB 3H9SA 4YGAB 5DXWA 4QXTB 2C3WA 2KH2B 2YKKA 4HT1H 5DSCA 6FABH 1KEGH 2XA3A 3NJJA 4HCRL 4OCSH 3UMNA 3VD5A 2F0CA 3B9DA 3D7PA 4TSAH 2XI9A 4NZTH 4HD9A 4EDXB 2AJSH 3MJ9A 4XMLL 3TCLB 3PDGA 3E2HB 4XOBA 4CC1A 4C55A 2VXQA 2CKBA 2CXKA 1AGEB 1CBJA 3ZL4L 1G9MC 3N41F 5L4MA 4BK4A 3WCYA 4NO2A 1G7PA 2BP0A 3IDMA 3QFJD 2ARJQ 3ZPDA 3RWJB 4XRCB 1NWOA 2P48B 4TSCH 2X7LB 3LDBB 4FYSA 3D9AL 4YPGB 3UPCA 3WTWA 3I9GL 3FO2B 1U3HB 1UGNA 3FU8A 3RGVD 4M48H 4E9LA 1FNFA 1YN7B 4XP9H 4LPXA 3TZVB 4MSWB 4XN9A 5H2BA 4BZ1H 4PJ9D 4LIQH 2XNAA 32C2B 1E40A 1S5HB 4NNYB 5HDLA 3SOTA 2ZJSH 1Y6KR 3LD8B 1QLEB 3NK4A 4MA7L 3UP6A 1NEZG 2CNZA 4IMLA 4N90E 5IVOA 3UIZA 3UTZB 4DKFL 2CO3A 4W68A 1O5PA 4JL2A 1AQHA 5DD0L 2J73A 2ERJC 1A65A 5DEJA 4BFRA 3AQXA 4Y4HC 3F62A 5DS8B 4EKJA 4JZOB 1OO2A 5DO8A 4F9PC 4NIYE 1R19A 3LKOB 4Y2NA 4PJCE 1ZVSB 3CHQA 5CD3A 3UPRA 1EGJA 2GBTA 3F04A 3LPWA 3PABB 1FHNA 4FDWA 2DLGA 1S7QA 3RIFK 4QYOB 4NCC2 1NAML 1OP3K 3V7MA 1B2WL 1EMTL 2BZ7A 3DGCR 1I3RB 5AW5B 2OXGA 2VLRB 5EN2A 3C5ZB 5IFJB 2XN9D 2Z7ZA 2H6PB 5C08D 4OZGF 5E2WH 2DOCA 4AGLA 2W9DH 3DVGA 5HDBE 4M43L 4QRPA 4MMYA 2Q2EB 4OF0A 1QI4A 2QKIA 3A21A 4OGAD 5ITBH 5EOQH 2ZOTA 1ET5A 2OMUA 1MXDA 3DX1A 5IROD 2NT0A 4I2XE 3UJJH 4ZX3A 3TTSA 3JTSA 3MUZ1 2BFVL 3ZE0B 3WNNA 1CFQA 3QCUL 5AKTA 5FGSA 1RJLA 1OAJA 4MD4B 2YS4A 2HT3C 3O0RL 3P40A 2YJLA 4GXVL 5PCYA 3DO4A 4BK8A 5EN3A 4F2MB 1ONQA 2V9UA 2FD6L 1WLHA 2ZTBA 3LXUX 4KKRA 4F7CA 3K6FA 2F53D 3EOBA 4NQSA 2I24N 4FNQA 3RE0A 2FTAA 5IT2L 1ORQB 1J5CA 3S3DB 4B9KC 1D7CA 5KVGL 2EEAA 4X8JA 3LZPA 5AW7B 3H4HA 4FTVE 3T1FB 3I6KB 5BV7L 5KSAB 3H9SD 4AZUA 1EX0A 2Z0BA 1KWKA 2AEPH 4LFHG 2FDBP 3IFLH 5D1ZA 5CIPA 2WSDA 2FL5B 3NCMA 4ENED 2J1KA 3AREA 3PWVA 5EOCJ 3CWGA 1DQKA 4MTMA 1N4XH 2DD8L 4XPFH 5D7IA 4UB0L 2KMWA 2VDPL 4MWFB 3CHPA 1GGIH 4AW4A 5T5FL 2BZDA 5LCVA 3HZVA 1QTYT 2EVFA 1IAOA 5IW3A 1ZLWH 4K73A 3L2MA 1OAKL 2HCZX 4NC1E 4OZIF 3DXAE 3OG6B 2UUDH 2CGYA 2WXRA 3ABZA 4PJAB 3HNVH 3WFZA 3S97C 5ADOL 3FOMA 4X4ME 5FCUL 3L6FA 2AGJL 5KVFL 4LPWA 5DHVB 4OCRL 4PJ7B 1VZHA 4NM4H 4BH7B 4LB8A 3ULVE 3Q8FA 2B16A 5KYYB 4HJUA 3H9ZA 4OUUB 4M7JH 4DZ8A 3M07A 4LEXL 5ADPH 3OM3B 1M53A 3PUUA 3D34A 1Y6MR 4ADJA 3WEXA 3QQ3A 3TURA 4NENB 1BVNT 2EDDA 3CVHH 2D9CA 4L5FE 5J9PA 2OS7A 1CTMA 3Q1SL 1FPTH 3AFLA 4NBZB 1N8ZA 2P43B 3M17A 4LHUB 3NCCB 3IMBA 2UY6B 3HC3L 2W94A 4O58L 4LARH 2CHZA 4LSVH 3OKDB 3ZHLA 4DUVA 1JNNH 1FIEA 1T0NA 4K7FB 3NMEA 3T6VA 1BSIA 3V4PA 1U95A 4OZFB 1EO8H 2VDML 3MRDA 4GRLB 4B5EA 4RWYL 5J6SA 2P9RA 2BWIA 2XTSA 5SWQA 1WFJA 3ALPA 1B4JH 1Q8MA 4JPVL 3SGDH 2BNQA 3SE9L 4JBSA 4U6HB 5D96C 4P2RB 1U8IA 3OKMA 4NKDA 5AVUB 4A7VA 1MLCB 3TBSA 1EH9A 1KACB 2JLLA 1RULH 2B8OT 4Y5XC 2ZPKL 4ODWB 3CLFL 2FJUB 2XTJE 2FK9A 4KROC 4HW6A 2HTKD 2MQ0A 4EZKA 1YJDH 4ZPTB 4OD2B 1HFUA 3WLBB 2ZUVA 3TWCH 3PXHA 35C8H 2ZUSA 1AHKA 1X5LA 2XY1A 4ZMQA 4UV4H 2N59A 1LO5B 2X1QA 3ES6B 4R4ND 4IHBA 4ZUTB 1CI3M 4Q0XL 4QJ4B 4JRXE 3QWOB 3TBBA 1SPDA 3OLGA 4LCIH 1QQDA 1Y1DA 2ED8A 3BKML 4ODHL 1U8QB 5JA8B 2MOVA 3NEOA 4NO3A 2CHXA 3RVUD 2FT6A 4HWEL 1U58A 2AQSA 5D7JA 3PHSA 1WDAA 1MNNA 4ORZC 2KL6A 1S7RA 3L1EA 3QPQD 3HRPA 4XNYH 4D9LL 2D8KA 3BP5B 4TNFA 3KYNA 1J9RA 4Z7UB 5F7DA 3S48A 5D1ZD 2ENQA 1QFHA 3GSQB 3WFEL 3ARED 3IN2A 1CE6B 2I07B 4B6ZA 3DURB 4NM8L 1UXWA 4WNQA 2DEWX 5DO2C 1ZTXE 1B90A 2IO5A 1X4ZA 1LP9F 1OGSA 3Q9QA 5CIPH 4YLQT 1RL1A 1ZSHA 3O4OC 3EADA 1KIUB 2IGFH 1VGEL 3T77B 5DR5L 4NRZB 4PTTB 4JDVA 2X12A 1BZOA 1R5IB 1K6QH 4WIQA 4R2GC 3SODB 2PO6B 1JV2B 4EKXA 3FU9A 5D7LE 4D2NA 2YWZA 1ODUA 2AQTA 1INEL 3TO2A 3RHWF 2H2PD 5HYJE 3QDGA 5BUPA 2HRGA 4PD4K 1SUJA 3S8WA 5EEWA 3VMPA 2DQUL 4F58L 3AWEA 3PV6B 4DP2X 3EJRA 2K1MA 3EGDB 5BV7C 1PCSA 1CLOH 4XPHL 5FOBA 1XEUA 2HX9A 3MCLH 2H4EA 4KBPA 3IGUA 2ZD0A 5D5ME 3TX4A 1JMZA 2VDLH 1HSAA 1WE5A 2G3MA 2XQYA 2IC2A 3LEXA 4AT6A 5EU7C 3EOYG 1W72L 2OYKA 4F5CE 2X41A 2P47B 1YPZB 4UTAA 5ITFB 3HFMH 3THML 2F5BL 4IKJA 2I7OA 2R7EB 3MV9E 1FNHA 3QDJD 1A02N 3CLEL 2IQAB 2FWLB 2UUDK 3HS9A 1SDDA 2E9BA 2NW3B 1EWHA 2X0UA 4YBLB 2EO7A 5AD0B 3RI5K 3NQIA 5IUSA 3QK0A 4BDVB 5KVEL 1CBVL 4TUOB 4EUPG 2W9LA 4F15B 4OCXH 5C0IA 2BRRH 4MMXA 4RSVA 3WO4B 2HLAA 4IJTA 2BNQD 1HXMA 3S8FB 5SV3A 3RTQC 4LKXA 1OY3B 3BGMA 2V8LA 3V4PH 3CN1A 3L1GA 3CSFA 4N0CD 2VN3A 1JVLA 3UCQA 1XMEB 4PV8A 1XBRA 3MLWL 5BVJB 3W39B 1KCSL 3BWAA 4HPYL 1I3UA 1S7UB 4Y89A 1NSNL 1U8MB 1YYLL 3ATFA 1KN4H 4UIKL 1CFVL 4D8PA 4JCLA 2BSRB 4GLRI 4QTFA 4HK0B 1OCOB 3B2XA 1OALA 4E9YA 1N12A 2I69A 1W0WB 2DWEB 1V5JA 2AXGA 3K2UL 1KSRA 4U0QB 3CFMA 3L3JB 1TQUA 2NY4D 2KLRA 5KYNA 1ETB1 3NSFA 5E95B 5INDB 5IBUB 3ZX1A 5AENA 5DJYA 2ZF8A 1IGJB 5JXAL 1FYTB 1U93B 3GMMB 4XMZA 4EZMA 3HBPA 4MJ4A 4OJYA 4Y16B 3EXLA 1SHWA 43C9A 2EKSB 2O5YH 4PG2A 4BXSV 3MRNB 1PF3A 3IJHB 2RJMA 2HX8A 1CLYL 2VH5H 4PIBA 5HGBA 4KUZH 5DUJA 2IQ9L 4YVNA 2VO5A 4I3RL 2QQNL 3QCVL 4AUYA 3L13A 2HTLD 1RI8A 5FYKE 1KTCA 4JQIH 1M7IA 3NIDB 1KTKE 3VFRB 5CAYB 4JDZB 2P80A 2UYLB 4XBPA 2JLPA 2XSKA 3ZT5A 1EHLH 2Z7YA 4W6XB 2B59B 1R5WB 3D5OF 4PJ5E 3V0GA 2QQLL 1IZJA 1LILA 4Z7VF 2H2SC 4DEWA 4MS8C 4GW4B 4PP1D 2CCWA 5E03A 1NTDA 3ABKB 1QRKA 3QUMA 1IIKA 2BIQA 5LO7A 2WQ8A 3T0EB 1CFMA 4OH2A 3GZOA 4PBVC 4PJFA 3ZMNA 2FHBA 4PGCA 2JXMA 3TWYA 1O9ZA 3BYYA 2AQRA 4JM2A 4P3CL 2MRYA 4UINH 3DMMB 3QUZA 3C60C 1ZS8B 3VRJA 4BQBA 1M9WA 4PVNA 4DCQB 3C6LC 1IMHC 5L4FA 3QUKA 1XCTA 5I9QC 5ICXA 4Q6IC 3SE3C 4JZJC 5I18H 5F9OH 4DZBB 4XNAA 1OB0A 4K71C 4UQ2A 4AQ1B 3FAWA 3MLZL 3FQWA 4QRTB 4YAQB 2ZG3A 3QIBA 2FT8A 3PWLA 2XKSA 1PLBA 1L0YA 1MJUL 1S7WB 3FT0A 3GLEA 4MHHG 3UTPE 1I8IB 2OR9L 1RZIB 2XU9A 1T4KA 5I1DA 2OL3B 1MFNA 2A6JB 3EF4A 2QTEA 4OCMC 2A77L 2PW2A 5D71H 4I0CC 2I5YH 4XAWL 1S3RA 1QBMH 4ZUUA 3UAJA 3OJDB 4KRNA 2XVLA 3OGCB 4Q9CA 3US0A 5LQBH 1KCBA 4M62L 4U3XA 4LPTA 4NBYB 3U79A 1MFBL 3UBXB 3R4RA 1D7BA 4Z3HA 5KTEL 2G5BA 4QCIB 3UIYA 2UZXB 2VZTA 3CU7A 4K94H 2GAZA 1DO5A 5ABAA 4CN1A 3WE6A 1GW0A 5DI8B 4ZTPL 4KZEL 1G6RH 5CEZD 1SDAB 2VJ0A 2CCLA 4Q6KA 2NLJB 1BEYH 2UV3A 2VDQB 1AR1C 3A24A 4QTHB 2QADB 3GO1L 5ESQA 3RFZA 3HOGA 3BSZH 4JEGB 2NY2C 4BWTA 4N4YB 5KBDA 1ITBB 5AAWC 3CQFA 1GZHC 2A9DA 3ASOB 2RIKA 3PCYA 4TQEH 4EUPH 5IB2A 1JPSH 3EKCA 4JL1A 3ECBB 1C16B 2V2WA 4K3HA 5C0JA 1KPVA 3BEVB 1EHKB 1FAIH 4Z0BH 1QMUA 3DX9A 4FP8H 1KG0B 3WY3A 3RGHA 4QJ5B 2IDCA 2X4QA 1DEEA 2MOQA 3A4FA 3P77A 4LCWB 3KDMB 2R0LL 1E4KC 1OCWH 3SKOB 3MXWL 4KZCA 1WZ1L 2YMTA 1N26A 3BDXA 4P4KC 1HU8A 1UH3A 1AO7B 4PREA 2L4OA 4OF5A 4OQ1A 4MX7A 4ZG1A 2HN7A 4JQVA 4IGBC 3EJYD 2P80D 3X1BA 4H0GA 4NQDE 2CG9X 2YRZA 4JFWA 4CMMA 4AM0Q 1J1PH 2B2XL 3O6KH 4YSOA 2GPZA 4JKPH 1RY7B 4X4XB 2VXVH 4ZMVA 3AB0C 1CD8A 1TVHA 1OTTD 5J1AB 3GTVA 3HC2A 5IBTH 1JHTA 4FQ1L 3PJSA 4ISVA 3SDDD 1GGYA 4HXBH 4JX0A 3ZO9A 2IV9A 3MMEB 2NRDA 1HH9A 1XSKA 5K1NA 2AJUL 1P2CA 4ZNCD 2J56A 4LSTL 4R0LB 3ARYA 3U2IA 5E7FA 1N7ML 5I0ZA 2D73A 4NBXB 1W15A 3PP4H 2PWHA 3FSAA 1GOHA 3WIFB 4JM2D 4X6CF 5CZXD 2ZONA 2AV7B 3HCVA 2J4WH 1XX9C 2A2QT 5CF3A 3FUDA 3LV3B 4P2OD 4AIZB 1T5XA 4P2QA 3MNWB 3TPUA 2DI8A 5F9DC 2D3NA 2ETWA 1UT2A 2E74C 5FYJE 4DP4X 1RHHB 4HYTB 5J12C 5CLYA 2ESVA 3E6FB 4WFFE 2VN6A 3OBAA 1O5DT 1E6OL 2H3NA 3GM8A 4U1KA 1ERNA 4UMSA 2APSA 4OFDA 2OW7A 2X05A 1PSKH 3I3BA 4M93C 1OSEA 3QIBD 4JCWA 4OIFA 1MOEA 2C3XA 1UEMA 3WXVH 1DE4B 4MD5A 4Q7DA 3TFBA 4ZXBB 1PG7L 5HI3C 1WCBA 5BZDB 4MLSA 1KCRH 4AQ8C 4EXKA 2OJZL 5DVLA 4OV5B 4NO5B 4K4KA 2D31B 1V54B 3IMUA 3MRLA 3AY2A 1NIFA 1QFWL 1I9JL 4OJFH 5DRNB 3FU3A 3STLB 3QJUB 5DD5H 1P6AB 2VLLB 3EG9B 1IC5H 3VGDA 4QGTA 3PGFL 1C7TA 3QNXA 1R1CA 5D7HA 4JG9A 4M6AA 4UOZA 5JR1L 1IKNC 1BJ1H 1MFDL 2DQEL 5FXCH 5DJZB 4CL7A 4ZMYA 4PRHA 4IRZH 4EO5A 2BSSB 3O6FB 1E4WH 1YZZA 4JY5H 4ZW8A 5CCKH 1GS8A 1KCUH 3UOAB 5CJXA 1ES0B 5I1IL 2XQYK 1R17A 4J3OG 3EH4B 3ZT7A 1S5IL 1JK8A 3B6SB 1SMDA 4WHTB 4BH8B 2NNFA 4N2LA 1PD1A 5D6CA 4KQ3H 1N3NB 4OLEA 3H7LA 3HS0C 5KJRL 2CDFA 4BV1A 5BQ7A 3CK0H 5AW4B 2H3XC 3HRZA 3KPQB 1H3PH 3MRGB 5TDNB 1GYCA 4G6ML 4HUCA 3T3PB 2ZE0A 4IRJC 1UD3A 2F1AA 4PJHB 3LZQA 3UYPB 3WN5A 2CO1A 1KYUA 2VLRE 1IAIH 1NLDH 2PPEA 4UAOC 4JPKH 4PAZA 1S9YB 1WG3A 3QZBA 4PJEF 2O61A 4HJTA 1FL6A 2X4TB 3OB0H 1YAZA 2F6AA 2F7QA 1QNIA 4GUPA 5CP7B 3F8UB 4NJAH 4PRNA 5IOKA 2HT2C 4PTUA 4YNYB 3KS0J 4GAYA 2A9CA 2SEBA 1H8LA 2E4TA 3FCTA 3KPPA 3RL1B 1B0WA 1H5BA 4RRPM 3SDXE 3DPBA 3RWEA 3ZE0E 3SGEI 1IBGH 3MOBL 1A5FH 4ELKA 3P9LB 1M71B 5IVXA 4XH2B 2V7NA 4LL9A 2AF2A 5D93B 4Z8FH 4NWUL 3OAUH 3O9WC 3FJTA 4DP1X 3RPIA 4F2ME 1IGML 5GGTL 5KUKA 1IGIL 1QI5A 1E9OB 2CRMA 4JANB 4XBEL 2EO9A 4HCGA 3ESUF 2YD1A 1VADB 4Z77A 1Q9LB 4NOFA 2VR5A 2V6HA 3C2AL 3S88L 5KS9F 2FWSA 4WW2B 4LCYA 3PWUA 4F2FA 1PJ9A 1E28A 1MWAA 4F1ZA 4NT6B 5CP3H 2IAMA 1LK3H 4JVUA 4I8DA 4IEFA 4UT7L 5E2JA 5F6HJ 1M56B 1XGUA 3G9VA 4GFTB 5DJXA 3FDWA 1I7ZA 3CDZA 1HZKA 5B39G 2H26B 3MYJA 1J18A 2ESVD 1QFUH 5F0LB 3U30C 5KOMC 5EEZA 3OXSB 1TQCB 3DVIA 3KLAB 3PLYA 4L29A 5DZVA 5C7ZA 4FQPA 4IJ3B 1A3RH 4GEIA 1YA5A 3FTWA 1HH6A 2VC2L 1OF0A 1DLFH 1K4CA 4D0CA 3HMXL 5I6LA 4R26L 4QHUA 2CLVB 5FGRA 1S7XA 3L54A 4YE0A 1FFTB 5EU4B 4QHLA 1JPFA 3OZ9H 3OLEA 3TT1H 3UABA 4PJ7E 4CVWA 1YLBB 4KDWA 1GGCH 3EOAB 2ZUQB 3FQXB 1M4KA 3QBTB 4RFOL 4YIQA 5EEUA 3ULUE 2Y7QB 3MJ8B 3T3MF 1YY9C 3QZWG 3R8BB 2BHUA 1L9NA 4RZCB 1MREL 1ACZA 1S7TB 1U30A 2PR9A 4L1BA 4QO1A 4KQ0A 2AXFA 3INUH 2DYPA 4MA1B 3P02A 5KVGE 2Y07L 4JN1H 1ZHBA 4KRPB 4WV1A 2ATPB 3TVMB 4W6YB 2F7IA 4G9FB 4F7PB 1D6VH 4XNMA 1VZGA 2XC8A 1PD6A 3ZZLA 1UM5L 3ZKMC 1EEQA 1OD7A 1UA7A 4H8PA 1TMQA 4GQRA 4U1IA 3UZQA 3ISYA 3IDNA 2X4NA 1BOGB 4K3GA 5EBLB 1P4BH 5LAPA 2QELA 4JO1L 3G5ZB 1YECL 3BIBX 5GS0D 1WAAA 4U4BA 2HFFA 2CBTA 4P2RE 1BHGA 5IQOA 3KPLB 4UM9A 2BIPA 3DROA 4Z3FA 1DBBL 1MIMH 2BWDA 4BFFA 3G08B 5H35B 1NUGA 2C34A 4J7RA 4N9GA 3HS8A 4ZMNA 3CFNA 3LKSB 1S9VB 4QRFA 4KX7A 2ZCLH 2XV2A 1Q72L 1DDTA 2X4SB 4J3OH 2WXIA 1YNTB 4HWBL 4MJIB 2NYKA 4NKQB 1IBZA 3QISA 3UYRH 1H0DB 3U2JA 2AI0H 1OSPH 2VYRE 3MJ6A 4XB7A 4N9OB 5IMMA 2DQJL 1E8YA 1MAML 3H56A 4X7DC 3B2VL 2D9QB 3Q0HA 4K9EC 4QPEA 4YDNA 5D70L 1QACA 1RUML 1EO5A 2EDLA 3OKKB 3PGDB 1NUDA 4WI9A 2ZYRA 4YSUA 1I9IH 4AVKA 4FQ2L 1RUKL 1ZVYA 4XCFL 2BW4A 5JPNB 1TZHB 2V2XA 2J2ZB 3V9EA 4GG6A 5DUPL 4XMKL 2Z8WC 4Z7UE 2IAMD 4HUKB 5C9KA 2F08A 4Y1TA 3CXHK 4ZW3A 3IDXL 1OGAB 3D2UB 4JDTL 3PG2A 4R7DB 1PNDA 2Z0UA 4S1SL 3NJKA 2X4PB 2UY7A 1RZGB 4PGDB 2ZXCA 5DK0A 4U6XA 4BCZA 2EIMB 1HQ4A 3PHOA 4YHIB 3TBCA 2ENSA 1H8OA 1M42A 2QDVA 3H3KA 4B9IA 1IRAY 1BWWA 1XGZA 3J2PA 2FO8A 3WIHH 3NK3A 2VSDA 3D18B 3NABH 4QIRA 4CGTA 4M5ZL 3LS4H 4X9HA 5IHZA 4GRWF 1G7MB 4N1HB 3S3PA 4RMUA 3ZJAA 2A74C 3SE8L 2A73A 3VI3B 1J5OL 4ZZKA 4KJWD 3L4CA 2R0KL 4ZYKB 5H94A 4HKJB 5E2VH 3BT0A 4J3WA 4GMTL 4GSDH 3L2LA 4GAGH 3AU1A 2BOBA 3HBQA 3HE7B 1QSEA 4W9ZA 5AVQB 5FUCE 4GBXA 5GRJL 3WMSA 1OCRB 1P4UA 2WXQA 3NACL 4WI8A 2VDKB 3MX0B 3ZY7A 3ZSSA 1MHPH 1Z0MA 5BMFL 4AKPA 2DYPD 2DQDL 1YPZE 2JKRM 1AGDA 4R96A 1SMOA 3CFCH 2P45B 4NEHB 3BKYL 4XC3L 3I02B 1S8DB 5ELIA 1QKZL 2DYRB 3LYRA 2WWKT 2Z31C 1SXCA 4W9IC 4AYFA 3GSUA 5AW1B 2G4GA 3SPJA 2WBWB 2X4OA 2YPKA 1XV8A 1YY8B 3T2LA 3L5WB 1I8LC 4TUJB 3GBLA 3QRGL 1BBDL 3RX9A 1MG3C 5EIVA 1GPOH 2F61A 3RYMA 2WLLB 1OXYA 2BOLA 4UM9D 5G55A 3KPMB 5DEGA 4N85A 4P5SA 3PPEA 3GXTA 3QQ9C 4GW1A 5E1QA 3NZHH 5CSZA 3P3YA 3L4YA 5KAQG 1IEAA 1UA6L 2Y5TB 9PCYA 4E36A 1QEWB 5PAZA 1W91A 1QR1A 4RGOH 5DQ9A 4AG4L 1T3FA 4HKBA 1T4WA 2F18A 1WUNT 4XOAA 3BVUA 1I1CA 5FM5O 5CZKA 4XMPH 5EO1A 5EU6B 1LO2L 4A1RA 4HZLA 5JDSB 1GMEA 1U3YA 1VFAA 1OGTB 1MRCH 1MJ7H 2NPLX 3QA3A 5IBLD 4HH9B 3PWJA 5ANMA 1DBMH 1EAPB 1S78C 4FG0A 5I75C 4MRBA 3BN9C 1GMIA 2OMZB 1FYTE 2EYRB 3ILQD 3QNYA 3CVCA 3L7FA 4Q14A 5AWNL 3UACA 3Q6FB 3MRHB 4PJGA 3BP7B 4G8GE 3SPIA 4Z7OF 5I6PA 4OW6A 1EXGA 5F7EH 5F6HI 2UVEA 4FABH 2GSIA 3FO9B 4H13C 4KH9A 5KVEE 3BIAX 2NY7H 4TVSa 4AJ0A 3D0LB 4ANXA 3KYMB 2XG5B 2IMMA 4HIJA 4IDLA 3HMWL 1EHNA 2N0KA 4H4NA 5A2LH 5D1XC 1M2OA 2WPGA 1H15B 1CFNA 4G7YL 4F7KA 1TLMA 3V4LA 1YRKA 2NMSA 4P46A 3TBTB 4LEOA 4QOKB 3T0BA 2NY6D 5LGHL 3KPSB 4NN7C 4QHPA 4K7PL 3CXDH 3CDYA 2QGEA 1AQKH 1F02I 1RLBA 3T0EE 3IKCB 3RZCA 3P0GB 1EJ6A 1DQJB 4IIQC 3EZJB 3FS9A 2HG0A 1Q9OB 3NFPB 5TDPA 3FN3A 3U48A 4JFOB 4MLIA 4N0FA 4XPGL 2OQJA 5TTRA 3L9RB 1BV8A 4OLVH 2GVYA 1QSED 2D7NA 4GBXD 5SX5H 1N0XL 3CG8A 3X12A 4P3DA 2MH4A 3GGWB 5E4AA 5LNGA 2W80C 2ZOKA 1HHIA 1JGDB 4ADGA 1WO2A 1VACB 1PG7X 2YRPA 3QJTB 2WXMA 4OAWB 5IFAL 1AGFA 1ID2A 1CL7I 1N6VA 3LNDA 3JSSA 1FFNB 3ARDC 4F3FA 4NQUA 3CFIC 4N25A 3MPCA 2IAAC 1F56A 1TQSA 3RUGB 4BZ2L 3FN9A 3TN0A 1RVFH 4HDIB 3TJHD 3TOPA 3QEUB 3HBGA 2X70A 1BXAA 1U3NA 4ABUA 1AY1L 2WYIA 3QIUB 3W0WB 2DQFA 4YQXH 2Y36H 2BC4A 3FULA 3KGRA 3H4FA 4FA7B 4UT6A 3FU7B 3O3BB 4OIIH 3O0LA 2MSPA 2EIBA 4I48A 4A37A 4M5YH 3SGDI 4BA0A 3G5YB 4HAKA 4K3DH 2OR7A 4P9HH 3QG6A 4GT0A 4ZFZB 4EI6B 1FLRL 2C9AA 4M1DL 5IQMA 3VX1A 1CFSA 4JRLA 4OGYH 1U3JA 3BQUD 1S9WA 4PWGA 2WC7A 4Y2DB 3K7UA 4G11A 3BO8A 5HHQA 3TF4A 2GK0A 5A3ID 2O5XH 1VEOA 1GYUA 2YPLB 2Z8VC 3MRPA 2PTTA 1L9MA 4GUOA 3QUXB 2L7UA 4Y19A 1PKQB 2MQCA 5HHOD 4ES8A 5C0CE 3Q44A 4LQFH 4RRPG 2A7BA 3H0TA 1TO5A 4G8AC 1KENH 4KQ4L 1LO3L 4MDJB 3SCMB 1AGCA 4YDLC 5B38B 2HH0L 4IHOA 1SN0A 1JI1A 1TMCB 4PWFA 5CLXA 1JYVA 3ABLB 5I1GH 4M6NL 4EN3C 3JVGA 4QHKJ 3AS2A 4QI3A 4Y4KC 4A68A 3EHBD 4XVSH 1GXEA 5CJ8A 4G8FA 3G7TA 1M7DA 5KW9H 1BVZA 3VRIA 1AANA 4HT1L 4KTDH 4RMTA 1B2YA 5E1HB 3RKDD 4M8QB 3T2QA 3VXQA 1U8JA 2NTFA 3OXRA 4N22A 4HWUA 4TSAL 3SDCB 4NZTL 5K39B 4P46D 4K5MA 2RGSA 3BLPX 5A16B 5TPWL 1CFTA 4FJZA 1W0VB 1RXLA 1Z5YD 3GMQA 1JSYA 3VXNA 5I19L 2ITDB 3Q01A 1YYCA 3GD1C 3RG1C 1TTCA 3ZKQD 2VM4A 4NS0A 5GISH 5EWIH 3RZCD 4IRSA 4OQTH 3EYOB 1KB5B 2WVVB 1T1YA 4NNXA 5GS1B 1AXTL 4EOWH 2BCKB 3TO4C 4MA3A 5J13C 5FYJU 2IOMA 4Y5VC 3HI5H 4QY8A 1YC8A 2HT4D 3EDJA 4K55A 4TXVB 1Q1JH 2O4EA 2ZXQA 4R3SB 1ZT7B 3RU8H 4YR6B 5E6IC 5K9JH 3F3HA 3PQYE 3W5MA 3GJFB 5C71A 4J3TA 3D39B 4IU2A 4LIQL 1HHHA 4X8XA 5E6ZA 1IC7H 2PYEB 1PU0A 3VXME 2X1PA 2OR8A 2LGNA 1S46A 4YGVB 5I17B 4TRPH 1JYXA 1RERA 2AJYH 2ZKMX 2EDYA 3K80A 1AHWB 2RFXB 2BXYA 1Q1PA 3TN0D 4ELMB 2Y5EA 1KJ2B 3DO7A 2N1KA 4L1SA 1T20A 2DBLH 2C3VB 2IOIA 5EIIB 1UXSB 4MNGB 2WM0A 5I8KL 3U2SB 1IGYB 1ZJAA 2Y7SA 1FNAA 3VWKB 3BZ4A 3KPRA 3AT9A 3UAAA 3U0WH 1KFAL 5SX5K 2ROYA 4JO2H 4G6AD 5EB9A 3JTTA 4DAGH 1NANH 2IBBA 3BZFB 4W9HC 1OAUL 4AYBA 2D0FA 2Z1PA 1FL5A 4FQXC 4HIIA 2FJHB 3X3GL 4JE0A 1K4DB 4HQQL 5E99H 4RMSA 4ZAKB 3IFOA 2ZSVA 1HSBA 2ERJB 3P11H 3VFVA 1ADQA 1NCAH 2QFPA 2FR4A 3BJLA 1BJ1J 5EFIB 3BLBA 4U33A 3ZKSD 5FV2A 4YZWA 4N0RA 4P23C 4FXGB 4KI5C 2RHEA 5EMYA 4HK3N 5D1QA 5I5JA 4PLNC 1BAFH 4OZHA 2W38A 4HIHB 4Y19D 3V0EA 1LVEA 1O7DE 1P4LA 3L5XL 2DMCA 4XP1H 3T3PE 5JHDA 2P28B 2CK0L 2AJVH 3QXDB 4PJHE 1KJMA 2HJFA 2QVKA 4UYPA 4OJDH 2D3VA 3H42H 1YC7A 4X80H 2ICCA 3GRWH 3F7LA 1QABA 5EV7A 3TPKA 4WTQA 3EYSL 2WLJA 5E8NB 2R0ZL 1M2VA 4LLDB 5KYXA 2BM3A 3PRZA 1BMWA 3L95B 5AVZB 3IFLL 3ZTCC 4ZSOA 4ZZFA 3NIGB 4FF9A 4BIKA 1FBIL 3HZYB 4GKZA 1DDHA 1SJVA 2R1YA 1MLBB 4S0SD 3P69A 1JWUA 1BVKA 1N19A 5ENWA 4Y4FC 5MEPA 2FBJL 1GGIL 2BK8A 4PRBA 4NAQA 5DHEA 3ARTA 1HL5A 3OZLA 3UG3A 3TNNA 4Y8DC 3QULA 5F3FA 4IRSD 2E7MA 2PW1B 5DFTA 3GBML 1BIIA 3N43B 4LDCA 2NR6C 4OIBA 1I7UA 3MJ9L 1QLRA 3UTOA 3OGOE 4DGIL 3ECVA 3HNVL 2VXQL 5E23A 2CKBL 1IGCL 3SE4A 3DX6B 3QC5X 2EZ0C 4LLAA 1RZJC 3ARRA 4EIGB 2AAVA 3VDBA 5DD6B 3HG1A 1MIEH 5IB3B 5DYFA 2A6KB 3AQDA 2NSXA 1JD9A 2EKJA 2JE8A 3W82A 4M7JL 3EFFA 4XPBH 1B9ZA 1DQTA 3FU5A 3MODL 2JCCB 3DHUA 3TT3L 2J6EH 2JKTM 4BQ8A 1BF5A 3QXUA 2JELH 2WWMC 4MB3A 3MLSH 3ZQ9A 4LLVB 5BXFB 1HIMH 5SV4A 5FA3B 1TO4A 5FEBA 4Y1AB 2VQ4A 1JPGB 3CVIL 5IK3A 4G43A 4O2CA 3KPRD 2RALA 4PJIF 4BFNA 4F7EA 2IANA 2I32A 1WFTA 1QYGL 4PGJA 3CSPA 2R83A 2FX7L 1NFAA 1MI5B 1KULA 2NUTB 4ANUA 2IADA 1EGJL 1T0MB 4NUMA 1FO0B 3FUFA 5GRUL 5CMAB 1YEEH 3L7EA 4OGQC 4TM9A 3EFDL 4TVUA 1N59B 2Y4SA 4G9FE 3NH7H 3NZ8A 3RGVC 2X3BA 2EJ1A 4BKLA 4PJ9C 4BGDA 5I5MA 3D07A 2BP0B 3UBHA 4GXFA 4E0RB 3MNVA 3BUPA 3FQUB 1MQKH 2WLKA 1X5KA 4XCNA 1G9NH 2GT9B 3H7BA 1ADQH 1IQDB 2CH8A 4UV4L 3D85B 3QJVB 4E42B 5C2BL 2YD9A 4DERA 2VERA 2Q6WA 1MCBA 3B9KD 3A3YB 3WEOA 4ZO9A 2Y2TA 2I85A 3CVHB 3T6WA 5DFAA 1KGCD 5HJGA 2F74A 3OX8A 4QHKI 5A2BA 1AC6A 4UQDA 5K59F 2XNAB 2DIJA 2PWGA 3OR6B 2DI9A 2OLDA 2YRLA 4JRYB 4UU9A 4LSSL 2Z65C 1NUFA 1P1ZB 1TQWA 4YO0A 4HV8A 3V52H 3VFPA 4LLMA 3WJJC 3WO3B 5IMLA 2F8XC 4XNYL 4IMLB 4GOSA 1BZEA 1N5AA 1PZ5B 3I6LD 4MJIE 4RMWA 4LLQA 3QJRB 4PJ8C 3VI4F 5C09E 4JG1H 4DWHA 4YHYC 1GIGL 4PHZA 1OAYH 1AAJA 4HIXH 3EXJA 4HAFA 5EO0B 1F90H 3SBRA 2W0FB 2W92A 1Y18B 2X09A 2Z4QB 3NCBB 1OE3A 4PWJA 1CGTA 4KXCA 4UZSA 1JHLH 4I3SH 4U7MA 3WENA 1GZQA 5BO1H 3BP4B 5IW1A 4OGAC 4I2XA 2VAAA 4MJHA 4H8VA 2FQDA 5EN2B 4J2QA 5IROC 3UROR 2EUWA 1GYVA 4LNVA 5LCVL 5GZNA 2C9PA 4HX1A 2VUOA 4A7UA 2F19H 3JWOL 4EN2A 2QMKA 4KC3B 1J1OL 1AZRA 4QRPB 3HG1D 2B39A 4NPJA 3VFNB 4J8QA 1OGAE 2IVFC 2W59A 3OKEA 3GMPB 2EUXA 3BH8A 3MCLL 4ZPVA 3QZMA 5C0EB 1KELL 2YUZA 3VDCA 2VDLL 4X6DF 5I71B 4DO6A 2VMDA 1A6WH 5E4EB 5HP5A 4FTVA 4MJ5B 3NGBB 4C56B 5KSVA 4PB0H 2OZ4H 2QQQA 4FQLH 1CF1A 1A6TA 4NKMA 4UTBA 3ZTNH 5KWYC 4ZO6A 5E2TL 5AG9A 1UG9A 1JD7A 2CIIB 2AQ3A 4D0DB 2CUAA 2VJXA 4NQSB 3L3KA 3VI3E 4DGYH 1S3KH 1XGTB 1BZ8A 1JF5A 2V3DA 3GMNB 2VQUA 2VLKE 2BIOA 5E2UH 3W2DH 4X8JB 5BQDA 5C3TA 3N40F 2BRRL 4XX1G 2WTOA 4PS8A 5F1IB 3ZHKA 1PAZA 5LG6A 3EH2A 2R2EB 3SQOL 3VB9A 1JGIA 5CIPB 2V5RA 5DD3H 1SJEB 4DQAA 1PEWA 1GY2A 3V4PL 2HX7A 4HSQA 4OUOA 4HS3B 4BQCA 3UDWA 4X4MA 3FSOA 3MNDA 4LLWA 4G1MA 4NIKB 5DS2A 2HFGL 2Q86B 1UACL 3X14B 1U8PB 3R1GL 5A6MA 1KN4L 5E9DB 4Z7VB 1BZQK 1OOAA 1WQVT 5A40E 5FHBL 1A7QL 5HD8D 5DZOA 4GO8A 4WSJA 3DTDA 2J8HA 4LBAA 3EZ8A 5KSUB 4S1QH 3C6SB 4N90D 1REIA 2LU5A 2PABA 4MHHI 4PJDF 1B0RB 4IMKA 4P5RA 4PJXB 4J1UB 4KDTA 2NQ3A 3EFOB 5KBMA 2P8PA 1YMHA 1C5BH 3SKJH 3NCWA 3ARPA 4APQA 5AW2B 2VNCA 2IG2H 4WWKD 2G4EA 4LQ1A 1QO3B 3T2NH 5ECGA 2Y1ZA 2Z8RA 2EIKB 2Z7UA 1KIQA 2VH5L 5C0ND 2WXLA 1RFDH 2DAVA 1ND0A 4POZD 3OJVC 2WWNA 3QE5A 4YSCA 1N5YH 1WICA 3GEWB 4JQIL 3C09C 4E9RA 4HUWB 2WGXA 4RGMC 5L2KB 5EU6E 1LK2B 3FT3B 1SOQA 2BNUA 3O3EA 4OFPA 4CVUA 3HPLB 5JORB 4KTEH 4KKLD 3PL6A 2NZ1A 4BQ9A 1OLLA 1A1MB 2QKIC 4LBEB 3W56A 2FB4H 1PDKB 3ZDYF 3DSFH 5GZND 2QLYA 1EXHA 3BP6B 3UTQA 4M7LH 4X4YA 5F3BA 4R4NC 3F85A 4O02A 2J20A 4XMWA 4U3CA 1RUQH 4BFEA 4NKIH 4K15A 4NXSA 4U3SB 3S96B 4AI7A 4PG9B 5ILTL 1I1AA 5TE7L 5C0FA 1F3JB 2XRAL 2XPYA 3MBXH 3QAZC 3VD4A 1KYFA 3MA9L 4FTVD 3SDYH 3MV8E 2NCEA 1E50A 3CX5K 5JOPE 2ODIA 3QPQC 2PWEA 2Q7YB 4JMXA 2NNAA 4OM0L 3T4YB 4AYMC 1EERB 4RQQA 1I8MB 2F58H 5D1ZC 3N1FC 5BJTB 1AS6A 5T1LB 5AB1A 3AREC 4LSQH 1BFTA 3KLQA 3MA7B 4X9IA 1FV1A 1SEQL 1USZA 2R1XB 4BKTC 2D0HA 4UTAL 1IO4C 1BIHA 2CO6B 4YHKH 1JERA 4YSRA 4HUVA 2MIZA 2D7OA 2NY5H 3ZYZA 3VG0H 2CO4A 5I82A 2X6MA 3EBAA 3DTXA 1NKGA 3DXAD 3JWOC 3AQZA 1JPEA 1U8OA 4S1RL 4A2FA 1QRNE 2WP3T 3HJ0A 3JV6A 5AG8A 4G7SB 3H9YA 5HYJA 2P24A 4MDIB 2H2PC 1XR8A 5IF0A 3NJFA 3ULVD 1SUHA 4K94L 4HWZA 3BWSA 2FYVA 3P4LA 4LOEA 1RIHH 5JO5A 1F0LA 2I9LB 2D4FA 2WBJD 5DZPA 5DEFB 4HFWB 4HMEA 5AUMA 1GH7A 4J3UA 1A7RL 5CGYC 4N2OA 2B20A 2EYSA 5T3ZH 4WEMB 3X3FH 3DX7A 2AHIA 2QR0B 1UA3A 4FCAA 1XGYH 2HWZH 5F96L 5KZCD 1RZ7L 2X4UA 1JRHI 3P0VH 3PIQB 1YQVL 3W0WE 1A2YA 2A9BA 2BH0A 4OLZH 2UWEB 4NHCH 1ZLUK 3MV9A 3RB5A 5CEZL 4NZ8A 4APQD 4YDKL 2Z3FA 2E86A 4YHNB 1NCIA 5DHYB 3UJTL 4HJGB 5HI5C 4PGEA 5FOBB 4AGNA 1ETA1 1UCTA 3RURA 2DWXA 1HT6A 4FP8L 3VXRB 3HUJF 3MBEB 4F1SA 1KLFB 2E0PA 5CEXA 3QPXL 1F4WL 1OCWL 5DFVD 4P5KB 4B53A 3N44B 1UWFA 5K69A 4FNSA 1KXHA 2DWDB 2KZKA 4P2CG 5IJBC 5ID1A 1AD9B 1JWSB 1VGKA 2VDRL 5F9WB 3I3DA 2MQ3A 1XZ0A 1DQQA 2R2HA 4N0CC 2YPLE 4M7ZB 4AY0A 2XTJD 3O6KL 5KYWA 2XWJA 4JKPL 3MDJA 2VXVL 1PKQE 1YO4A 3DUSB 2X2HA 5D7IF 2QVTA 3PL6D 4TMPA 4LKCA 4PJBB 2YQ3A 2E5EA 3CHOA 1PVHA 4X99B 4KI5E 3SGJA 4HVBA 2OX5B 1AGBA 1G6RB 1BZ9A 4JFEA 3FT2A 3CH1A 4NQEB 4JRXD 4DKAA 3L17A 3M1CA 1HAUA 2NY4C 1X4YA 3FSZA 3QUML 5DUML 1GJIA 1IJ9A 3RVTC 3GFUA 4N8VA 5K5YA 3AUWB 5EZLA 3BAEL 3DJTA 5AVTB 4AENB 3T8MA 4EUPB 4A2EA 4DF9A 1I1AD 4RBPH 3SY0B 3FHEA 1CE1L 5D7JC 2MHAB 4YHZL 2K6WA 2ODHA 4O02H 5J89A 1BF2A 1JYNA 1F11A 2AKRA 5E70A 5HPOA 4OLWL 3L3IB 5TH2A 3VFTA 2FQFA 4Z78B 2WJ7A 5TF0A 1RK0B 3DI3B 2HRPH 5TQ0L 1OVZA 2B1HH 2E7DA 3ZTDC 1T5WB 4FAAB 3F7YA 5FOJA 3V4UL 5LXGH 1KCRL 4J4PA 2HTLC 3FK3A 1M1XA 2YD7A 3FQTB 5GGRB 4YS4A 1I4FA 2QQKL 1IEBA 1I75A 2YAMA 3RILA 4AEFA 1DN2A 1IC4H 4JFQB 3OKNA 3G5WA 1NOFA 4LVNB 1JI2A 4FHBD 1GZPA 5F1OB 3T0DA 2Z93B 4OJFL 2XTLA 4DN4L 4PJEB 4F9LA 1D5ZB 4CVXA 5I2IA 4PP1C 1IC5L 3GDBA 3I6GA 4MAYB 4NZUH 3D39E 5I5RA 2JCWA 5I16A 2PYEE 4LO9A 2F9BT 1TTGA 1Z9OA 1B9KA 5HYJD 3TS8A 3H9HA 5D6DA 2A9AA 2WKLA 2VM9A 3GRGA 2OTWA 3BH4A 4R5VA 3AACA 3CFKB 5C07B 3L4WA 3QXTA 3LKQB 4EBQL 4ELME 1I82A 5EDXA 8FABA 1T22A 2A4CA 1UEYA 2EDOA 1NMCB 4U4IA 1O0VA 4MNGE 3TGXA 3NA9L 5F7WC 1DANT 3QUHA 1I8UA 2A99A 5FM8A 4AMKH 1QSZA 1KNOA 3NTCH 4N2CA 3VVVA 5I6XC 1E8ZA 4YHMH 3ZDWA 1PEZA 5F3HA 1Q9KA 3CN2A 3MV9D 4UNTA 4WUKH 1GVIA 2AXJA 5DJ6B 4EDWH 2ZXBA 5KS9B 3LSOA 1T7VA 5FO7A 5DA0B 2GJJA 1AKJB 3I75A 2BS8A 4F24A 3HNSL 1FZMB 3MYZA 4POUB 3QEHB 1IAIL 4A2HA 5LHDA 3VW3H 2J8OA 3MJGX 1HHJB 4ONFH 1D5BA 2WHVA 1CG9B 1SM3L 4UQ2B 4KV5F 4YXKH 1BFOB 4QD2E 5GIRA 4MMXC 2FLBT 2ZX9A 3R19A 3FQRA 5E8OB 1C12B 4P06A 4WJKB 1XH0A 5JUEH 3ZBMA 2BY0A 3HJEA 2ZKHH 1X4XA 3BW9A 4AW7A 3NAAH 1MPAH 4LIQE 3DRTB 3DIFA 4N8UA 5I8CA 1GYAA 3WIIH 1R24A 3OAUL 4ZX6A 5IJVA 1WFUA 4PRAB 2DLEA 1TJGH 2ENYA 4X98B 1HE8A 1ZEAH 1ZXQA 2LAAA 3SSGA 4RAUB 1FFOA 4PWIA 3FRPA 3U83A 2UXVA 2UZPA 3QQDA 3T3MB 3KGUA 3UAFA 4WJ5B 4EMZA 3VSVA 1I7RB 4KWUA 5B8CA 5HYSG 3D1MC 4ODSH 2YXFA 3SJVB 1EZVX 3KD4A 3VG9C 1XL6A 5L2JA 5LNEA 3NIGE 3QIWD 1A3LL 5ESQB 3IJEA 4Q2ZA 2BW5A 1QFUL 3V5KA 4F80A 1A3QA 1V7MH 1DCEA 1R3JA 1EUTA 3LNEA 5E8PA 4DUXA 5HVHB 4LOUD 2QSVA 5L4IA 2YSSA 1KOAA 1OPOA 1A3RL 3GXIA 1ZHLB 5A6LA 3FH5A 2MNUA 4J4PD 2DICA 5E8EB 2KYIA 4NQDA 1UH2A 3EJYC 3NCYS 3H85A 5E1AB 1T2XA 4PJ5D 2GB2A 2A83B 1MFAL 3P77B 3V0VB 3KLHD 1UQSB 2FIKA 1OTTC 5I1KH 1FVEA 1GGCL 2VKXA 5EUKA 4QHMB 1IQWH 1DN0A 3M1BB 5JHAA 4RBPK 2YR3A 1JUFA 1CVSC 1L0QA 2B1AH 1J8RA 2WVTA 4PJDE 3V6FB 3HZMA 4X9FA 2PCFA 4NSKB 1NZRA 2WK2A 4ZFQA 1OAXL 2PP9A 3INUL 4JM2C 5CZXC 3QUZC 2H3KA 4IKIA 4QXTA 5I5IA 2A1WH 4R4FL 5CU9A 1OT2A 4P2OC 3M7FB 4GQ9L 4Y1AE 4WGWB 4EDXA 1HL9A 3LQZB 1GHFH 5JDJA 2DEYX 4JKNA 1MCSA 2ZX5A 3FOLA 4OCLC 2L0DA 1USQA 5AYTA 1NBVH 1D6EB 1E8XA 3BSGA 3QIBC 5KVDL 1WVZA 4AE0A 4Z18A 3IU3B 3UTPD 3VGAB 4J3VA 4R6UA 4AYGA 1HWGB 3RWJA 3W9DB 4XRCA 5GGUB 2ADGB 4L3EB 4Z5RB 4H8WL 3GSVB 4XVUD 1WHPA 4OFYD 4XP5H 4YPGA 1IVTA 3NCEB 3FO2A 1U3HA 25C8L 1YN7A 1ILSA 2KPNA 4L3FA 3TZVA 1HEZB 4MSWA 5ID0B 2AEQH 1NAKH 32C2A 5IM7B 1S5HA 4NNYA 5EZIL 3IT8D 3KLKA 2M83A 4QRRB 5CGTA 2FLMA 3TXAA 2Q8AL 3UP1A 1CGSL 2V17H 3UTZA 2FCBA 3EBHA 2XBDA 2XETA 3K1DA 3R0NA 2Z35B 3CSBA 4KVPA 4ABQA 1Z1WA 1WBYB 5BRQA 4JFXB 4IS6B 2EH7H 3GPSA 2QBWA 2NXZB 3SKNB 4ODTH 3N42F 3FYEB 2VERN 3LQAL 3V0WH 5DS8A 3OWEA 1R3KA 4JRYE 3V0JA 1E5UI 3RFZC 1OAZH 3BWUF 5GJSH 3UXFA 4HIEB 3LKOA 3ZTJG 4N1EA 1ZVSA 5GGSB 3NPZB 1A14H 1W9XA 3PABA 4PRHB 3WFBH 2ILLA 4PJFF 4QYOA 1UENA 3P2DA 3PXJA 2OMXB 3WMPA 1WWWX 2ITCB 1X5FA 4Y4HD 4JM2F 1I3RA 3PP3H 1HN1A 1UZ6E 2VLRA 3C5ZA 2Y5QA 5IFJA 3VXSB 2H6PA 4Q97A 2D2OA 4XHJD 4KKQA 1XR9A 1MWAL 1N6UA 2ZYSA 4GAAA 4H1LG 1SMAA 1RSFA 4RNRB 2H5UA 5DZLA 5DLML 4TV3A 5K9KB 3U6RB 4GMSL 1WH0A 1M3IA 4NQDD 4JQVC 1IM9B 5EIQA 1YEDB 1ZOXA 2XN2A 3VTAA 4RDQG 4XXCA 3N6YA 4MD4A 3SBPA 2XV6B 3IXTB 4QRPE 4GAGL 4F2MA 5ES4B 1I85A 5EZPA 4FNLH 1K9TA 3A6OA 1ZXKA 3D3VB 3CAFA 4GAYB 4NRXB 2SEBB 1KN2H 4GI9A 3DPBB 1JNLH 1DBKH 1SOKA 1MFCL 1ZHKB 4C56E 3T1FA 3I6KA 4U2ZA 5KSAA 5DU7A 3JUYA 4I4WB 4GRMB 1N6QH 3MLTB 3ATEA 3LEYH 2FLRT 4DTGH 4JW3A 2FL5A 2GHZA 2ICES 1MW0A 5FYJD 4PP2B 4DGVL 3NJNA 1T03L 1JZGA 4WFFD 1AXSB 4MWFA 2YAQA 4OCWH 5DJDB 3GSWA 4LCYB 2IH3B 1RPUA 5E5MB 1E28B 2Y6TE 4X42A 1J0YA 3L4ZA 4PRIB 5KYUA 4GW5B 2LT9A 3GZKA 3WTXA 1GPOL 5DJXB 3QYMA 3CDZB 4MFHA 3OPZL 4PJAA 3U9PH 3MACH 2B1OA 2XV3A 4DN3H 5E24E 1ZK9A 5LBSA 5AOJA 1L9OA 4HKZB 3QZNA 3U1PA 1NANI 2ZNXA 1U3HD 3CCHB 3IDGB 2RTTA 3ARVA 4PJ7A 2WCPA 5DHVA 4BH7A 5KSBB 1N10A 3JZYA 3NZHL 4QXWA 4KJPD 4HP5A 1GA2A 3TZVD 5KYYA 5E9DE 3WFHB 4OUUA 5FR3A 3ALXA 3LHPL 2EDRA 3SOBH 3ESNA 3KL0A 4XCYB 3S5ZA 4RGOL 1EZLA 1A66A 4LSPH 3BPOB 4OI8A 4NENA 2C9SA 2XQBH 2XZCL 4B0MM 5B39B 3OR7B 4RZKA 1PZSA 1RZPA 2ENPA 1UWEH 4PJXE 1E2ZA 1VERA 3QJFB 4LHUA 5CJXC 3F7VB 2UY6A 3LKRB 3ZZ1A 3N55A 3R18A 1DBML 1RK1B 3AZUA 2GJ6B 3OKDA 3HN8A 3FFCB 4LLYB 5F2FA 3VMOA 4K7FA 2XBZA 4OZFA 2EABA 2WQVA 1JZ5A 5LAXB 4Z7IA 3MR9B 2Y06H 3HRZC 4XI5D 1FIGH 4H8WC 4GP8B 4FABL 2AMUA 3H6JA 1QSFB 4L48A 1FNSL 2XV0A 4U6HA 5JIDA 5DF0A 3SZ6A 4P2RA 4M6OL 2VLRD 3C5ZD 1MLCA 3WN5C 4WTWA 3VD1A 5I1LB 2XJKA 3ILDA 2BVPB 1TIUA 4WSGA 3UZQB 4ODWA 4EQ3A 2VO8A 4P8QA 1QP1A 3BKJH 3CC5B 1OP5H 1BXVA 4AV5A 1CDBA 1HZHH 4G1EB 5IV2B 3P4NB 3BLKA 1ZLSL 2EDFA 4ZPTA 4OD2A 5H37G 4GAJL 1G7JB 3WLBA 2X42A 4OVUA 1TJXA 2AV1A 1H5BC 2DZEA 3LQAC 1LO5A 2CJSA 2PETA 3ES6A 2FEEI 3DYMA 3WN6A 4ZUTA 1QWHA 3R06B 2HKFL 1KCVL 3QWOA 4C47A 2DW5A 4E41B 2A0LD 3V0AC 2J12B 2GCYB 1U8QA 4FEMA 4TULH 4YWGH 5EZOL 5D1XB 2O6EA 5AOZA 5CEYB 4NLHA 5IHWA 4EI5A 1JF1B 5AAMC 2PXYB 2VMFA 2VWEC 1THCA 3TU6A 3BVNB 1U2CA 1KB9K 2KPWA 4G3YL 4MNHB 5GGVY 5KSAD 4H1LH 3BP5A 2XG4B 4DGUA 1XB6A