5CWSB

Crystal structure of the intact chaetomium thermophilum nsp1-nup49-nup57 channel nucleoporin heterotrimer bound to its nic96 nuclear pore complex attachment site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
223
structure length
223
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFNVYSYSIHWVRQAPGKGLEWVASIYSYYGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARLTWRSYRGVHALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sAB-158 Fab Light Chain
publication title Architecture of the fungal nuclear pore inner ring complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 39
structure length 223
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cwsB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cwsB01
3CX5K 2PYFA 5I0ZA 4TUKL 5D8JH 4U1LA 3I9GL 5L2KA 1FYTB 1I1AB 4JHZA 3KPNA 3H6JA 2CDFA 4GAJH 5IR1A 1YJDC 5J6GA 2ICEB 1JPFA 4KK8D 5ECJE 5DLML 3DO7B 4F37F 3EDFA 3O6KH 3ROOB 3LMJH 5HHVL 1HXMA 2VSDA 1MCOL 4RGNB 5I8OL 2R29H 2BOBB 1KTRL 3MRDB 3K4ZA 3VE0A 4I3SH 1V8HA 2APTA 5CJ5A 1WAAA 3G04A 3DETC 2FECI 2AK4A 3PWVA 5CIPH 4HC1H 3S36X 4HJGA 1INQB 1MI5D 1UG9A 4U1LB 5L2KB 2LU4A 3KPNB 2CDFB 4OZHA 3AS3A 4U1SA 5IR1B 2VN7A 3QRFM 3QUML 4NZUH 3WUWG 3HE7B 5J9PB 4TQEH 3KNBA 1T7XA 4FQXC 4YIQA 5SV3A 2AXHA 1HXMB 2BNRE 2DYPD 1UXWA 3HA0A 2Z8WC 3IAQA 3UPRB 3QFJD 2IJ0C 3SO3C 2G60H 3BWAA 3G04B 4NQCA 1S9YB 4QXTA 3ULVL 2GJ6A 1CDBA 4Q9QH 4JRYE 4KJWD 2YKLH 5DHYA 1H15A 5CINH 4Y88A 2BP3A 3MSPA 1FN4A 1U92A 4NSKB 4U1SB 4OZHB 2V5SA 3LPFA 1OLZA 4J3XA 1MFDL 4YDLB 2O5XL 5IMMB 3C5ZC 4LKXA 5L9DL 3SDCA 3NFNA 4DGVH 3VFSB 5FF6A 1KG0A 2N4IA 3B6SA 2IQAA 3X12A 2JJTA 3T8XA 1MCKA 3DO3A 2WWKT 3F7RA 3TLRA 1R24A 3QFJA 3MLPA 1P7QD 1KB9K 2C1OA 4ERSL 4W4NA 1W8OA 5E9DE 3ZZ1A 2IEPA 4YDVA 5GS0L 1MI5B 2X4OA 3FONB 1H15B 4ZS7H 4QRPD 3GMQA 4DFHA 3Q5TA 4X9FA 4PJBA 3LRSA 5GGSA 4I0PC 4L3CA 4QHKI 5I71B 4BKLB 3GNMH 4RMQA 4FTVE 2DM7A 1PSKH 4IOSD 4QRRE 3B6SB 3JTSB 3GGWA 4R4ND 3QIUD 4ZDHB 1LO0H 3U6RA 5EU7C 2NX5E 2DYPB 4TSCH 2C3HA 4KK9C 5F8QC 2RJMA 2D2OA 2CLZA 3QFJB 4EDWH 3LS5L 1P7QA 4PRPB 2HT4D 4AY0A 2XTJD 4FXLA 3WD5L 2MSPA 3R1GL 1MCRA 4G6FB 1MFNA 2E9JA 3KPQB 3GMQB 1XGQA 1H0DB 4NHCH 4QRPA 1AXTH 1F90H 1FZKB 5K9KA 1GOGA 2IBBA 2XQBL 3O2WH 5CLTA 1BZQK 1SY6L 3AVEA 4M9PA 4KUZH 2Z8SA 3F5WA 1RZGB 1S7SB 4EI5C 4C56D 4OD2B 1KC5L 2E6QA 5LGHH 4GUPB 1MAJA 1VFAB 2ZG2A 4OCSL 3H3KA 1MNUL 3I02B 4JM2C 5HYFA 4N0RA 3BO8B 5CSGA 5ITFA 5GRUH 1H3WM 5E24E 1EMTH 2H1PH 4KDWA 4QRPB 5DJZA 3Q48A 3LIZH 1IQDB 2FYYB 4X8XA 5JIPA 1R5IB 4WGVB 1O0VA 4IOIB 1HHHB 2EEDA 3QIUB 4QTIL 1TPXB 2W0FB 3H3BC 4QT5A 1GZPA 2XZAH 2EDTA 4XTRC 4I2XA 2XTJB 3EOYG 4HDIA 4LFHG 5SX5H 2JB6A 3WIFA 1AGEB 4HUNB 5F9DC 1KGCE 3ZT5A 4GG6E 4F7MA 4OLYL 2HFTA 4OGXH 3MRJA 2NR6D 4JFFE 2R0WH 2IPTL 2JJSC 2ATPB 2F54E 5GZOC 3C60B 3TVMA 5C1MB 3ROLA 4HWZB 1L0YA 3QHFL 4QXGL 2EYTB 4MAYD 5E5RB 1XAUA 3B9AA 4C56B 4NNYA 2VL5A 2JTDA 4GKZB 1J1PH 4LASL 4QT5B 4TSBL 5TFSH 2GCYB 1GZPB 3OXRA 5EZJA 4WI5A 2P46B 1MREL 1F2XK 1ZEAL 5INDB 4I2XB 4D8PB 3S37X 4F33A 3NPZB 4ZPVA 2ADIA 4HDIB 2A6DA 5C71A 3MV8A 3WIFB 1JFQL 4WW2C 3OKDB 4OLZL 5KSBA 3IF1A 1BFSA 1EFQA 4CVUA 1BD2D 3GO1H 1MSPA 4PRAA 5GQBA 1K5NA 3IGAA 4G7YH 3M07A 1VPOH 4MAYA 1P1ZA 5DO2D 2VLKB 4NNYB 5JO5B 4Q9RH 3OXRB 4C83A 1U8KA 1D6VL 3MUHL 3IDUA 2ADIB 4NKQB 4W4OC 1R3LB 5CS7A 2QHLA 3A67H 2A6DB 4LLMB 4YQXL 2PKDA 4DUWA 5JPMA 3WNMA 4R7DA 5CWSB 3IDMA 3EYUH 4XT1C 2FX7L 3SGDI 1BD2A 4RNRA 4BQ8A 3TGXA 5AYUL 1F4XL 3B5TA 4JY5H 4MAYB 4NQSA 1H3PH 4P4RA 2D4DA 3FQTB 3VD5A 1RZJL 3WN5B 5A43C 3WYRA 4JHAL 2XY1A 1FFOB 3O3UN 2GUOB 4KQ4L 3CZFB 5HHOA 3TESA 4QRSA 5I73C 4NC2B 2XQYG 2E7CA 4R0LA 3MLYH 1OARH 4A6YL 2AGJH 4R7DB 5GS3A 5A40E 3IDMB 3TN0C 5A16A 1SVZA 1EO7A 4NQSB 4P4RB 3RRQA 5B38G 2DD8H 4EUPG 3RL2B 3X13A 3ZHDA 3MOBH 9CGTA 4OT1H 3ZDZE 1MH5A 4JDZB 4OB5L 5GS0C 3DI3B 5I75B 1IZKA 1F00I 3ZSSA 1IGIL 3O45A 2ARJA 1RURL 2EC9T 1WUNT 2A6JA 1G7LA 4LGPB 1XH3A 4RFEA 3GI9H 4ZOAA 3MJ9H 3MLVL 3SGEH 1QBAA 5DK3A 4XH2A 1PG7X 2FHCA 5JW4N 1C5CL 5DWUH 1OGTA 4TNWF 1T03H 4IJ3C 3VDAA 5LGJA 2R1WB 5FYLE 4J23A 1MH5B 4K7PY 3MROA 4CRPA 1XGUA 3BP5B 3NCJH 2BOCB 5DRNA 2OP4H 3O45B 1FBIH 1KENL 3CIQA 4TVSa 4D3CH 2A6JB 1G7LB 1EHAA 1XH3B 5IVXB 2OR9H 1AI1H 4PJIF 4XH2B 4Y2OA 4GAFB 4HIXH 3RDTC 2Y5TA 3LEVL 4R4BA 1DVFC 1YY9C 1YN7B 5B21A 2YS4A 3TJHC 5ACZA 1WWBX 3D25A 3OG4B 4LSUL 3VRIB 5F9WC 4JDVB 1TVBA 2X4UA 3MXWH 3C8HA 3F7VB 5FECA 2X4TB 3HAEA 3BI9X 4F58H 5DRNB 2WUCH 3G6JF 4CVXB 4P9HH 5JW3L 2DTSA 4FQXA 1I9EA 4PV9A 5DHVB 1MRCL 2B7DT 4L3EE 3S3JA 3BGMA 2FD6H 5K9JL 5DC9B 5TGBA 4WFHD 2V7HB 3NAAH 3TT1H 3CLEL 1F3JA 3KR3L 3P73A 2LAGB 4R4BB 4HUWB 1AGDA 3RVWC 1MUJA 3MA9H 4KUCF 1FAIL 2A77H 5E2UL 5ACZB 2HTKD 3U79A 4QY8B 3DX9A 3I6GA 5CEZD 1FZMB 3FO9A 3ARPA 5CHNB 5D4QA 1TVBB 3VXQA 3HAEB 3C87A 4LRIC 3MRIB 2JELL 4HG4J 1QBLH 3SDXE 5E03A 4CADA 4H1LG 5DJAA 4XVUC 5FDWA 2QQNH 3NA4A 3BPNC 1JZ3A 4HEME 4UINH 5TGBB 4CMMA 4NKIH 3UTSE 3P73B 2AJUH 4OAWB 1AGDB 5IF0A 4J3SA 3PQYD 3W11C 5D2LE 4LSQL 1NFIA 5IHUL 5K33A 4X83A 5FV2A 1M05B 1MCEA 4LNVA 3HS0B 3VXQB 1CS6A 2QQQA 2G75A 4I0PA 2Z9TA 1ACYH 1PKQA 4JREB 2W0PA 4JKPH 4M43L 4PJHA 4CADB 1FNEB 1JPST 5AZEL 4I0CC 5EO0A 4GT7A 2YK1H 3V0WL 3UYRL 2MHAB 1NL0H 2GIYA 4IRZH 5F96L 3RHWF 4HGMA 2BSRA 3QDMD 2YPLE 4Y2DD 4LSRH 3X11A 1R6VA 2D9QB 1VFBB 4JM2D 1KPUA 2WLYA 5D8JL 4NN7C 1HI6A 3BH9A 5T1DH 4X6DB 4GAJL 3FOLB 5CGTA 4UT9H 4HFUH 1RZIB 1PKQB 4UUJB 2DQGH 2CK2A 4PJEE 5HI3C 5MHSD 1CDUA 1BZ9B 3FB8B 4PIRF 5CMAB 3KXFD 4MXVE 3O6KL 4EI5A 5DMIH 3LMJL 5D2NC 5MEOA 4Z9KB 5TJWK 3FQUA 4WW1A 2R29L 1EIBA 5C0BA 4I3SL 3X11B 2A83A 4KK6C 4MJ4A 5CUSH 4JM2A 4U2YA 4D94A 1KPUB 2RGSA 4P2RA 1RZJC 3PQYB 3TM6A 4HC1L 1L6ZA 3VD4A 4X4ME 3ZKND 5HPMB 1ULVA 3VA6A 3KLHC 3L95A 2BFVH 4WEBH 2EDFA 4BZ2H 1VGKB 1ZHBA 4P5TC 1EO5A 3P3YA 5DXWA 3O41A 4JFXA 4NZUL 4TQEL 1MCNA 4R8WH 4G8IB 1DQDH 3LSOA 4NQEE 4L29A 5MEOB 3G5ZA 3L3JA 2CQVA 2J88H 3QDMB 2G60L 4Y2DB 1XF2A 4AENB 1FJ1A 4HULB 2A83B 4HBQA 5JW4R 1J88A 4JM2B 2V2WA 4YXKH 1NC4D 1CF8H 1MCBA 4Q9QL 1U3YA 4ODWB 2YKLL 4PJAE 5CINL 2BSSA 3D39E 4XXCC 1A4JB 4WJ5A 4XBGA 5HD8C 2DBJA 1ZHBB 4S1DC 5DZNA 4ELMA 2JJSA 1KCRH 4JZNA 3O41B 4YHMH 3OBAA 5F7DA 1WVZA 4DGVL 4DK3A 3KXFB 4ZOEA 3QCVH 3IJHA 2ADGA 3LSOB 4PGCB 1EFXD 3DMMD 4L29B 4OI8A 1QFWH 3RL1B 4JKWA 4F37K 1MHPH 4XCEA 1XF2B 1FJ1B 2A6KB 4RFOL 1I7RB 1UENA 2F53E 3RZWA 5HVFB 3HG1D 1NC4A 1JPTH 1WZKA 1J11A 2BSSB 3P4NA 4WW2A 5IB2B 4ZS7L 4WJ5B 4HWBH 2IPUG 3ZMRA 2EEBA 4OCMC 4B50A 5FXCH 2FZ3B 4NPYB 3IDYB 5F7DB 3GNML 4JKMA 1PSKL 2ADGB 3E3QC 1LO0L 1ZE3C 4LVHC 4TSCL 3MLWH 1EEYA 1II4E 1WCQA 3DV6A 1MJJA 1N0XH 1A6AB 1NCWH 4HIIB 4AIOA 2YD7A 4W4OA 2AVGA 5D1XD 1NC4B 3BZFA 5IFHH 3P4NB 1BGXH 3I6LD 3LQAH 4JFEA 4U3XA 3EDDA 3UROR 5M94B 1RU9H 4N8VB 4NHCL 4HLJA 1AXTL 1F90L 3VGFA 5ID1A 5JQ6H 3GMMA 3TN0D 4XNQA 2YPKB 3S4SG 3BP4A 3O2WL 3QUMA 4KUZL 4P23C 1EFXB 3DMMB 4F80A 1AHWC 3V5HB 5LGHL 1SQ2N 5CD3B 5GGVY 1T3FA 2P24B 3BKYH 3QJFB 4HH9B 3HG1B 5GRUL 1Q9OB 3BZFB 4CDHA 5EU3B 5DD3H 1EMTL 3PABB 5C09D 1KPRA 3KGRA 2H1PL 4K8RD 1CFSB 2GY7B 5HHPA 4XXDA 2A38A 2EC8A 3LIZL 2YA0A 1L7IH 3TN0A 3QEQD 4XNQB 3IDXH 4NDMA 1NCUA 4RQQA 3KS0J 1IQWH 5J12B 4F3FB 4GKOA 5DJYA 3BN3B 5F6IB 2W1NA 1UJTA 8FABB 1MLCA 3E6FB 3QDGE 3D69A 5D7KE 1ZHLA 5JIKA 1UJ3B 2XZAL 1BVZA 4WFGD 1HQRA 4X5WB 4LCCC 2Q86B 2HH0H 3CGTA 3U1SH 1D5XA 5D1XB 2ZUSA 4B7IA 3BPOB 3MNWA 4BH8A 1J5OH 5C09A 1S9WA 4LLVB 4XCCH 4LEOA 1NUDA 4OGXL 2R0WL 3TN0B 3QEQA 1B0WA 4YHKH 3VG0H 1QBBA 3DECA 5D7IF 3MFGB 5DJYB 5HHMD 2FJFB 1ZVSB 3C08L 1CZ8H 1HZHH 3S9DB 5DQ9B 4JQXC 2X42A 4HJJH 1ZAGA 1JF1B 4DCQA 5CP7B 1J1PL 4PS4H 1DVFD 5TFSL 2Y7QA 3TJHD 5DMKB 5I8CB 2D4FA 4Z7VB 3FFCD 1HQRB 1OTUD 1T5XA 1C08A 3QQ4B 5DD1H 1HYSD 3MNWB 4BH8B 2WIIB 5FGCE 4UNVA 1S9WB 3TPUB 4LEOB 1YPZE 4PY7B 2WWKO 4LLYA 4ZO8A 4O02H 3TV3H 3QEQB 3M45A 3RVVD 1IMHC 3GO1L 5F7LB 5I1AB 5C0AA 5C0DB 1C16B 2FIKB 1A3LH 1VPOL 4WHTB 1SY6A 4L4TD 5DYOA 3RDTA 4JE4B 3O6ML 1DVFA 4PG9A 4Q9RL 3HNTH 4FXGB 4PLNC 3FFCA 1MCIA 1G7MA 1XCTB 3NPSC 4H25B 3AFLA 2A6IB 2C26A 2ZCHH 3A67L 4UQ3B 3BKJH 1AKJB 2Y4SA 4ZUSA 2K3TA 3OL2A 2FJGA 3O4LE 2M2DA 3EO9H 4GFTB 4NRYA 3EYUL 4GAYA 3OTTA 4JFHE 3ZKMD 4IMKC 5HHMB 1RSFA 2FR4A 3GHEH 5FO9B 2XV6B 4JY5L 4JPVH 1H3PL 1OP5K 3MV7E 2VKWA 1WBZB 2OMNA 3FFCB 3W11D 3UYPA 4I8DA 4AL8H 5HGHB 5HSFA 5KS9F 3HI1A 5GISH 32C2B 4LRIA 3MLYL 3UJJH 1OARL 3TA3D 4PJ5E 2I9LA 3ZKQD 2AGJL 2OI9C 3LEXB 5MEQA 3QHZH 1K4DA 1A4KB 1QEWB 3ZDXF 1QSEE 3D85A 3U9PH 2GJZA 2FR4B 4XBPA 5H37H 3W9DA 4O2EA 4L4TB 1P9MA 1RUPH 2CLVB 4MCZA 2DD8L 5CZKA 2DLFH 4JO4H 5D7LE 1JTOA 3MOBL 2QSCH 4XZUB 4L9LC 4OT1L 3Q3GB 3JV4B 5DI8A 3HI1B 1NGPH 4M6AA 4OFYD 1JPGB 2AXJA 4QTHB 3ILPA 5HI3D 4WFEE 2B1HH 3OJDB 1GSMA 1ZLUH 4KAQH 3RWHB 4P0DA 1Q72H 3PWLA 3GI9L 3IDGA 3OJMB 3MJ9L 1ZLVK 4ZOCA 2ZUWA 5GRJH 1JYWA 1UH3A 4XBPB 3OWEA 3HPJA 3MO1A 4O2EB 4UZGA 3S36H 3VD3A 1TQCB 3W9DB 4KK6D 5DWUL 4MCZB 3OAZH 4OFKA 1OF2A 5IMKA 4F9LA 1T03L 2F5BH 5EBWB 2AP2A 4LARL 3FT2A 1B2WH 3AC0A 5KSVB 5L6YH 4P5TD 3ILPB 3NCJL 3SGEI 3TA3B 2OP4L 3B5HA 2BVPA 1FBIL 5EOCJ 1WZLA 4M7LT 3VFRB 4D3CL 1WBYB 3L5JA 1PZ5B 5CEXB 1QRNA 5D2NA 2OR9L 1AI1L 2J8UF 5HHXH 4FFVD 3C6LC 5F21B 4NQDE 4O2FB 2DMCA 2FX9H 4HIXL 4KHXH 5H8DA 1OF2B 5HYIA 5IMKB 2DKUA 1FYTE 1KSRA 2P42B 4EZMA 4WU7A 4KGJA 1KB5H 3UYOD 1U8PA 3NA9H 1KIPB 5EU5B 1BJ8A 3FT2B 2AERT 5HD8D 1IAOA 4X7FC 3ARBD 4W6YB 3MXWL 4P5TA 2WUCL 3N50A 1WIOA 2EXYD 1BLNB 3WFEH 4P9HL 2GT9A 2VSCA 4EJ1C 1H5BB 1K8DB 1CLZL 3MRFA 5TDPA 4RWYH 3MV11 3QNXA 2FD6L 1I3VA 3NAAL 4WTZG 3TT1L 5DS8A 2CH8A 1WV7T 4GW4B 1N6VA 3D48R 1DBBL 4GRLC 4PRNA 3T2PA 3MA9L 5L2KE 2A77L 4WU7B 3PV7A 2GITB 2VAAA 1HSAA 4I0KA 4XXCA 2D7NA 1GOHA 1M7DA 4TNWK 3T65B 4P5TB 4NYLA 1CFNB 1QBLL 3N9GH 2V6HA 4Z7QE 3UP1A 3BSZH 5ILTH 2VXSH 3MYJB 1V05A 3F6LA 2QQNL 4MX7A 2NY2D 2WQRA 4PJFF 4UINL 3HI6H 5T1MA 1KNOA 4XGZB 2AK4E 4NKIL 3DX8A 4MWFA 2AJUL 4PRNB 4IHOA 1EHLH 5I16B 2CKBA 3T2OA 2ORBH 3TH4T 2X4PB 2CR6A 3Q6GH 5I9QC 4MHHG 4OZHE 4PD4K 3TNMB 3WLWC 5I18H 5IB1A 3ZYIA 4G42B 5C3LD 3ARBB 2FDBP 1B6UA 2GKIA 4NYLB 1ACYL 1JV5A 3PWUB 4K94H 2ILLA 4JKPL 4CUCA 1NLBH 4JFYA 1IM9D 4P23D 4MX7B 1F4AA 2YK1L 4HXBH 5T1MB 1NL0L 4IRZL 2DL9A 1KTDB 1X4YA 3PGCB 5I74B 1KXVC 4Z78A 3QDJD 4LSRL 4MWFB 4IHOB 3MX0A 3DJ9A 1MI5E 3PL6D 4PJGA 2ICWB 1ZMYA 2CKBB 2UVEA 3DVIA 4OZFH 3ZL4H 1X5LA 4N9GB 2CGRL 1AR1D 3VFNB 1W2KT 3W81A 2DIJA 5T1DL 1KPVB 3DUUA 1JN6A 3QIBD 4YHYB 5ITBH 3VXRD 4P2OC 3LH2L 4OFPA 3MGOB 4HFUL 4PY8J 4UT9L 3HZMA 1HQ4A 4X7TA 3GSUB 1F3DH 4P23A 5DMIL 3QFJE 2NY2B 1NAMA 4EN3C 5FGBC 3TIEB 2DQEH 3WHXA 1XEDA 3T1FB 2P8MA 5FYLH 1LGVA 3BESR 4KY1H 3L9RB 4HXAH 4BELD 3NIGE 3KHQA 3GIZH 3V6OC 1IFHL 3RGVC 4HMCA 4W6XB 1QP1A 1T80A 4PJIA 4BFGA 1JN6B 4WEBL 1SJVA 4BZ2L 4NKOB 3QI9D 3QFDA 1HQ4B 3Q1SH 4KUCD 3LAFA 2VLJD 1IM9B 3VXUB 4P23B 4R8WL 1DQDL 4XVTH 1NBVH 3ARXA 4JHWH 1YEDB 1NAMB 2EH7H 2NY6C 3S37H 3WHXB 5C92A 2J88L 2P8MB 3NH7H 5B39A 3MLTA 3QDJB 3PDDA 4NFDA 3PL6B 4LCCA 1TZGH 4HGWB 4PR5A 1MWAB 4YXKL 2DWEB 4TNVF 1CF8L 3RHWK 2OQJA 4QRPE 2R2BA 3WUZA 4XNZC 3GK8H 5GGTH 5E56A 3U2SA 4PJIB 3QIBB 4MQ7A 3VXRB 3LY6A 3QI9A 4MYWB 3AMLA 1KCRL 1TJGH 4YDKH 4YHML 1T6WA 5K59F 4GBXD 3B9KC 3QCVL 3OKOA 4JQXA 2VZTA 4XMKH 4N90D 4NO3A 1QFWL 3G6AA 3RX5A 2XTJE 4KI5C 4DJMA 1MHPL 5B39B 3MLTB 3NN8A 3G6JB 2XKUA 3GMRB 2GAZA 2P49B 1J1XH 1EEQA 2OQJB 4J3OC 1JPTL 2V17H 1KEMH 2F9BT 4HWBL 5C07D 1ZT1A 3QI9B 4MSWA 1JGDA 3U4AA 1YQ2A 1KXTB 4C56E 2VLJB 1VERA 5FO7A 4NQVB 1BREA 2VZSA 3KS0H 4Q58C 1OAUL 3JXAA 2VDRH 3MLWL 5AD0A 5J3HC 1JF6A 4I2XE 2M26A 3V4VH 1N0XL 3K1DA 1NCWL 1FNLA 4ZUUA 1I8LC 5CIPA 1KJVB 5IFHL 4HC1A 1A02N 1BGXL 3LQAL 4PFEA 3FMGL 3S96B 4W70A 1RU9L 2BVOA 5F89A 5C08A 1FLTX 3WO4B 1I4FA 3WSQH 4MDJB 4YBHA 3OXSA 3L5WA 5JQ6L 1JGDB 4RAVA 4OV6F 3B9VA 4G5ZH 4IMKA 4GBXB 5EUKA 3FTGA 5FO7B 2QHRH 2YSSB 5LJYH 4P9HC 4YC2B 4J4PD 5AD0B 3OR7B 2VH5H 4ZFGH 3H9YA 3BHBA 4FMKA 4QWWC 1E0OB 1KUMA 1LO2H 5I1JH 2B20A 3BKYL 4HUUB 4FFYH 4HV8B 1OD7A 4F7CB 2XIDA 3EFFA 5DD3L 1W72B 1G0XA 5J6HA 5C07B 3T3PE 3T4AA 2BVOB 1ZWIB 2X4SB 5EN2B 2APBA 4IIQB 2FGZA 4RAVB 1L7IL 3IDXL 3BEWB 4ZXBD 1IQWL 1SBSH 3FTGB 2APXA 2F8VA 2BNUB 1V3KA 3IETA 4JPIB 3ME0A 3ILQC 5LWYH 1Q94A 5C6TH 3QB7C 2W65A 1HEZA 1EDQA 2Z4QB 2A0LC 3BHBB 2AV1A 4XI5C 4L9LA 1N8ZB 4GMSH 3DYPA 1W0VA 2HH0L 4BJLA 1IEBA 4K9EH 5ETUB 3U1SL 3EYVB 3CH1B 3EFFB 1HH9A 1J5OL 1X5FA 2LAAA 1WWAX 2DOCA 3P0VH 3T4AB 3IVKA 4XCCL 1BD2E 1VSCA 4OZ4A 2CDEB 4U0RB 1VEMA 4YHKL 3VG0L 1RV6X 3BUYA 4NBZB 3CX5J 5FYJU 4QXUH 1CZ8L 1HZHL 4OCRL 1U8IA 4GKNB 4HJJL 3CFCH 2FWOA 1JWSB 3ZYZA 4Y4KD 1CYGA 5EU4A 4PS4L 4PBVC 3ZT7A 2W65B 3G08A 3VG9C 5DMJB 2AV1B 3MRBA 3QXWA 1QFWM 4L5FH 3QEHB 2EO1A 3DV4B 4LAQH 5DD1L 1INEL 4ZTPH 1MCQA 1QLRB 1NFDA 5KVGH 3BISA 3N1FC 4O02L 4OZ4B 2OTPA 3TV3L 5DGQA 4XMLH 4ZXBB 1JGVH 3C6LA 3ZTJH 3V5DB 4AZ8A 5JLZB 1A3LL 1U8IB 3QUYC 1T66D 3G08B 1IGCH 4ZNEA 3HNTL 2R9HC 3STBA 1RPQA 5D1QC 4KTYA 2ZCHL 1XF1A 1E28B 3BKJL 3Q5OA 4ODXA 2EYSA 4OF6A 1DEDA 3EO9L 3BXNB 1XR9A 4XP4H 4V2BA 5IVXE 3CVHH 1S7RA 3CZJA 2K1MA 4X5XB 5L8LB 2XKNA 3NCCB 1MJUL 1SJEA 2PTTA 4Y5VC 2VDKH 3GHEL 4IMLA 4NJAH 3J7HA 5T3XH 4JPVL 1P4IH 3VFWA 3KYMB 3VFTA 4Y4KB 4RMTA 4GRLA 1FVEB 4F8QA 4RGOH 4NBYB 4WTWA 3MUGA 1ZTXH 3CFKA 3TCLB 4ZOBA 5I1HH 5ICZB 1WZMA 4AL8L 5GISL 3E6HB 2IWGA 1FO0H 2DIAA 2CXGA 3UJJL 5EA0H 1XR9B 1GHFH 1P6FA 1IL1B 3QHZL 1OAKH 5KN5A 5EOCH 1KB9J 3VFUA 1UWGH 3U9PL 4Y16D 4HHAA 3VFWB 5FB8A 2XA3A 5KOMC 5T5NF 1RUPL 3LKRB 1X5ZA 1RJZB 2PXYD 5E99H 2DLFL 4JO4L 2HJLB 4GO6B 3FQRA 3MUGB 4O58H 1A9BB 2QSCL 2OBGA 2ZOKB 2C5DC 3MCG1 4X7CC 1CGSH 2CIIB 1NGPL 3DPBA 2VDMH 5FKPA 4TOYH 1D6EA 3VU2A 2HT2C 2YWZA 5HXMA 4OCXH 2YD3A 2B1HL 2VMFA 5D5MA 5DC0A 1S8DA 1T1YB 5HVHC 1O7SA 4KAQL 5GS2H 5KN5B 1Q72L 5M95B 4PLJD 3RWIB 4YPGB 5GRJL 3PGFH 3GSNB 3S36L 5FB8B 4M61B 1T1WA 1XF5A 2PXYA 3E0GA 5D71H 3O8XC 4OTXH 3RAJH 5F9JA 2EDWA 2F5BL 1ZLWH 3CSYB 5FK9A 5D7IA 4RDQG 1WFUA 1B2WL 1R3JA 1D6EB 2WP3T 5L6YL 2WAHA 3SKOA 4NOFA 4WV1C 3V4UH 5C6WH 3WLBA 3RWGB 2CIKA 3WS3A 4M6NH 2VZUA 4WFHE 2OXGA 3TBWB 3BIKB 2M8XA 5FGBA 2NY6D 5HHXL 4J6RH 4Y16B 4PB0H 2NW3A 2EDQA 4S1SH 2FX9L 3MRCA 4KHXL 2Z92A 3EYSH 5J89A 1YNKH 2PXYB 2I5YH 1I8IA 5CEZE 3C5JA 3V6OA 4X6DE 4MCYA 4KMLB 3RGVA 1KB5L 5D7IB 3NA9L 4W81A 1PKQE 3U46A 4H26A 4ZODA 3SKOB 1MHHB 2MFNA 3WLBB 3WFEL 3EOBA 4ODSH 2CIKB 4P99A 2XPGB 2IBZX 5IP4A 2HG5B 1JP5A 3ALXA 1H3VA 4RWYL 1HHKB 5HTSA 2ZSVB 3MRCB 1IAIM 3PQYE 3KPRA 3QXDA 1CICD 1I8IB 1P7KA 3NGBC 4S11A 3C5JB 2OM5A 4NO0B 5LCVH 3G5YB 4MNQA 1YY8A 5D6CA 4X6EB 1OT2A 3U46B 3C2AH 4HFWB 3QXTA 5BVPH 5KAQF 1IKFH 3ELAT 3OKYA 2EZ0D 3SCMD 3TZVC 3ARGD 2VWEC 3B9KA 3BSZL 5ILTL 1B88A 3L3GB 5SX4H 4WI6A 1GGTA 2VXSL 1ORQA 1HOCA 3QDME 1LEGB 5KS9A 1XGRA 3C09C 1S7UB 2H9GA 3HI6L 3MJ9A 4XVJH 5DJ0A 4LPVA 3GHBH 1A3RH 2NNAA 2VIRB 3FCTA 3QXDB 1IAKB 1YDPA 2Q20A 1EHLL 4PREB 3GB7A 3STZB 3M8OH 1ETZA 2ORBL 1GRWA 3MTRA 3Q6GL 1IC7H 3HC0B 5I18L 1V5JA 5IHZA 2V5MA 2P8LA 5MHSE 5DEZA 4HWEH 1U58A 3TO2B 4XRCA 3DWTA 1ES0A 3KXFE 4ZQKB 4K94L 2RIKA 3QO0A 1J0IA 1NLBL 1BWWA 3R8QA 1ED3A 4FQPA 3UTOA 2EDDA 2KZ1B 3S35X 5KS9B 2PN5A 4HXBL 1AIFA 2H9GB 3RTQC 5HDBE 5HY9B 1U8HA 3FCTB 5MI0B 4E42B 1CICB 4ZFFB 3RIFF 5ISZA 1ETZB 2BMKB 3ZL4L 4YEEA 5IW6B 3D18B 3WCYA 5IHZB 3J8F7 2UYLA 4Y1AD 2UWEF 1U58B 5ITBL 1S7XA 2OS7A 2VLLB 2ITCB 4JAMA 1ES0B 1XZ0B 3SCMB 3WUWB 3V6ZB 3ARGB 4OLUH 1I85C 1BQSA 3S97C 2GW5A 4XCNB 2DQEL 1FCCA 3AAZA 1EVUA 4RSVA 5FYLL 1D5BA 5CP3H 2A0LD 1BIIB 4XI5D 4KY1L 3H9SB 1LK2A 4HXAL 2EDJA 4H20H 3GIZL 5FIEA 3HR5B 1DQQA 3ARYA 5LQBH 4LHJB 4WNQB 2UYLB 1BOGB 1BF2A 2EE6A 4MS8D 4K55A 1PAMA 4Z7UA 4YGVA 4JAMB 1R3HA 2AJVH 2HFFA 5F93C 3T0ED 3Q1SL 1OSZA 5I19H 4LSSH 3LV3A 3MBED 4XVTL 1NBVL 4JHWL 1RUQH 3FAWA 3LQMA 2EH7L 3S37L 1XT5A 1LO4H 5H37G 1NDGA 2VLRD 4OBSA 4ENEC 3NH7L 1VADB 4QRQA 4LMQE 4EQ3A 3HG1E 4Y19D 4RFNB 3VFMB 1Z9LA 1TZGL 3OAYK 4MNHA 3MRHA 2AXFA 2HN7B 4JFEE 1CU4H 3BAEH 3DRQB 3HC3H 4HK0A 5GGTL 3GK8L 5C0JB 2J8UB 1KTLA 2QADD 4UOW1 2NY4C 4Y1AB 3MQIA 1T4KB 5J13C 4YGVB 2B5IB 1SJHA 1TJGL 4YDKL 3P4MB 2R23A 5IB4B 1GC1H 5JMOC 2BY0A 4BQBA 2DDQH 4XMKL 4FG6D 1BVKB 3QUYD 3OKKA 4YUEH 1NDGB 3PV6B 2A9ML 2R9HD 3QHTC 1H3UA 3V6BR 3MRRA 3I6LE 3MRHB 2AXFB 3BKMH 4PRDB 1J1XL 1QSVA 1G7PB 3BH8B 2V17L 1KTLB 1KEML 4PJFA 1PQZA 3RA7H 5FYKU 4ETYA 1XGTB 1C5BH 2UUDH 5EBMB 2ATKB 3T0EB 3LD8C 1B0GA 1LO3H 1M7XA 5I6XB 2R23B 4NQUA 3MBEB 1K2DA 2EDEA 1N6UA 4P3CH 4KXZI 2VDRL 3UDWC 3QUYA 2VLRB 3V4VL 5E8PB 5HI4D 3VG9B 1DLHA 4Y19B 3MRRB 1CDIA 5C09E 3KLAA 4MA1B 1DQJB 2MKWA 2X1XR 4JRXD 3RZCC 2QADB 1B9ZA 1N4XH 3QEQE 4Y0GA 2VL4A 4L8DA 5DFWH 3WSQL 4LVNB 4M8VA 4BUHA 4G5ZL 5E5MA 4Y5VA 1CXHA 2BHYA 2E6JA 2QHRL 4ODHH 4ZAKC 1ZA6B 4WFGE 1C12B 2VH5L 1NGYB 5E2WH 5GGQH 4JKLA 4JZOB 4ZFGL 3UTTD 3UBXG 3CDCA 1LO2L 5I1JL 1KJMA 5E6YA 4DUVA 4FFYL 4WHDA 1C1EH 2HT2D 3R06B 3QWOA 1U8MA 5GS1B 4K3DH 1KOAA 1KFAH 4L8DB 5H35A 4ZYKB 3MREB 1OAXH 5HHME 1NMCC 4PB9H 1SBSL 3WV0A 2R2CA 2HYMA 4JFPB 5C8JA 1H9VA 2BRQA 4UTBH 4LHUG 3FFCE 1NAKH 5C6TL 1G7IA 3VRJA 3O8XD 3NIDF 3JV5A 5TE6H 4HIEA 5JQHC 4U1JB 1CFQB 4LCUA 4GMSL 5C0NC 4AM0B 4K9EL 1IT9H 5ERWA 4JN2A 2NXYD 4JRXB 3CXHK 3T2NH 5IBUB 2ZJSH 3P0VL 4JY6B 5H35B 1VKXA 2B8OT 3AROA 3SGKC 2P44B 1U8JB 2PYEB 1INDH 4LKCA 1EXUB 3BW9A 4L4TE 5JW5B 4K94C 5D96B 4QXUL 4Y5YC 1KYOK 3WJJC 2HJKA 5C8JB 3CFCL 4PJ9D 3NCEB 5B8CC 4YDJB 4NT6A 3UJTH 2CDGA 3O8XA 4HIEB 4HUKB 4UBDC 3L3KA 5D93C 4OGAC 5JDSA 3UTTB 1HILA 1PG7W 3U36A 3VH8A 4OZFG 5GSVB 1K3ZA 4L5FL 1U95B 4G8GD 1DCLA 4LPUA 5ERWB 3B83A 4LAQL 4D0DA 2CJUH 1NBQA 4ZTPL 1NEUA 1T7YA 4WV1A 1WFOA 4WUUD 1U8NB 4K7FA 5KVGL 1KJ2A 1VKXB 2H6PB 5KSAD 1ITCA 4XMLL 1A9EA 3BW9B 1A22B 5AEAA 1F02I 3LDBB 3P2TA 4X98B 1BFOA 1A47A 2AEWA 1EZVX 1IGCL 2YWYA 5JNYB 1HILB 3VH8B 2NTSP 4G8GA 1A1MB 3KHOA 3BGFB 2N56A 3HRZA 5TQ0H 4WO4D 3BRGC 1RIVH 2AQ1A 3VWKD 2NXYB 4GQ9H 3LHPL 3RX7A 3TZVD 4WUUA 3TO4D 4XP4L 3ZHKA 1KJ2B 3CVHL 1AD9B 4DVBA 3T0WA 3ET9F 6FABH 1S5HB 4L8BB 2W0KA 1CLOH 2GTWA 3EJYC 1RI8A 3IXTA 2VDKL 4HT1H 3EOAA 4NJAL 5T3XL 5B38B 4IRSD 1P4IL 4PJ9B 4CNIA 4PJXF 4EUPB 4PJ8D 4C4KT 1DDHA 2DI8A 4RGOL 3FZUC 3UAJD 3H7BA 1ZTXL 5I1HL 1GVIA 2J8HA 2GTZB 3VWKA 2YXFA 4OQTA 3B43A 3VJ6A 4WUUB 3TZVA 5IKCA 2HLFC 3MV9D 4GXVH 1HCFX 2AEPH 1GHFL 1QRNE 1CQKA 4KTEH 4QOKD 5GHWH 1FDLH 2L4OA 1OAKL 3L3IB 5KOVC 5KSAB 2CXKA 5EOCL 5BZDB 4WUKH 3N1QC 1IGMH 4BSJA 1UWGL 2BNRA 3RTQD 4NQTA 4IRSA 1MHCB 3QJHB 1O7VA 3BDXA 3QWRD 1DDHB 5E99L 3L3OA 5IK3B 2JJWA 3LPGA 5FFLA 3IFLH 4O58L 4L8CB 1SMOA 1F4HA 2CR3A 1BQLH 1CGSL 4NQXB 1WT5C 4WO4B 3WFDH 2VDML 1GYAA 4TOYL 3VWKB 4OCXL 1I1FB 1JZ4A 1P53A 3TZVB 5IKCB 1KELH 3TO4B 2EDKA 3F6IA 2UY7A 2APVA 2MQ0A 2PO6C 2C4XA 3SY0A 3RTQA 3PGFL 2XNAA 3TEUA 2NXZD 4IRSB 1KT2B 2DKSA 4PJ8B 4X0KB 3QWRA 5E9DA 4LQFH 3IJSB 4QRUA 5D71L 3AM8C 4OTXL 3RAJL 4BH7B 1IEAA 3GBMH 1IEHA 2OJEA 1T1ZA 3O4OC 5HDLA 3O0RH 43CAA 3KYOA 2V9TA 3BVNA 3WNPA 3TFKC 3MV9B 4XP9H 4QOKB 4UB0H 1I85A 4M8QB 4M6NL 2FB4H 3PIQB 4DKFH 3U4EB 2NX5A 4J6RL 3SY0B 4AIXA 4P4KC 2Z93A 4KJQD 4PB0L 5JA9A 4GKSB 4S1SL 5IROC 1RUKH 3EYSL 3OAZK 1YNKL 4F15B 3FFDA 5EZLA 4LLDA 3MLZH 2I5YL 3DBXA 4UNTA 4JR9H 5F71A 3EW3B 2NQCA 3PP3H 3JUZA 1T1ZB 1WIUA 3CJJA 3CFIC 5KVMC 3U9UA 2LE9A 3VMNA 3KYOB 4MB3A 4R7NA 3LN5A 1X5GA 5I1EH 3E3QE 2H2PC 3RNKB 2JB5H 4ODSL 3KYKH 3SDDC 5DUMH 2IQ9H 5HYQA 5JUEH 4RX4D 2P45B 1AC6A 2R0KH 2Z93B 2NXZB 4XB7A 1D3CA 3QNZB 3TH2T 1WCBB 2R1XB 3WNLA 5IW3A 2Q3AA 3FFDB 3PDOB 5EZLB 5I1LB 1MHEA 3DBXB 5ACMA 35C8H 5JW4Q 4IDJL 1TTGA 2DB8A 1TXKA 5LCVL 5LXGH 1NUGA 1PGRB 2X1OA 1G84A 1NGWB 3BPLC 4TTGA 4HZLA 3C2AL 1L0QA 2JIXD 4Y4HC 1EVTC 2AJXH 4K9EC 5BVPL 1IKFL 1WTGT 2OL3B 4G8FA 5DMGC 2E9IA 2SEBA 4KDTA 4ZO6A 1D9KD 2FNBA 4Y8AA 5GSRB 4CDGC 1OTTC 5GGVH 3QG6B 5HGAA 2UZYB 5TDNA 2YEZA 5IUSA 3QDJE 3MRKA 4JO2H 2IH1A 4XVJL 2EDNA 3D5OF 3GHBL 1A3RL 5CZXD 3LQZA 4Y5XA 4P57A 2DIBA 4HKJA 3M8OL 2R1YB 4PJIE 4HCRL 4FN0A 1V3MA 1IC7L 5ALCH 5DHVH 1JZ6A 3RZCD 1E4KC 3VXRE 1WFTA 4MZ2A 3FOMB 4PY8I 2JIXA 4HWEL 5SX4I 1FVDA 5FYJD 4JFFA 5AAMA 3MFFB 2VXTH 1T0MB 2EE2A 3KWWA 4CU7A 4P3DA 3VWJC 1U8LB 4DUXA 4B0MM 4AQOA 2KUTA 4ZAKD 3VFVA 4PUBH 1QPPA 2YEZB 5TDNB 3UDWA 5IIEA 4K3EH 3G6JE 3MRKB 5DQJA 1J9CT 4HEPG 1XF4B 2AKRA 4ZUTA 2E5EA 3HAEH 1JHTB 1TZHB 4Y5XB 4JJ5A 4OLVH 5HHNA 2NZ9C 3SKJH 4X99A 3CFEA 5H2BA 3RZCA 5J11B 2ADJB 5E6ZA 4Y8DC 1KB5A 2JIXB 1IGJA 4BSVA 2EDXA 1YEKH 3RI5F 2VLJE 5MEPA 1D9KB 4OLUL 3MJ6A 4M48H 1LEKA 4ZAKA 5IIEB 3BZEB 2D0FA 3FT4A 5DQJB 4L4JA 1UVQA 4HK3N 4I18B 2V9RA 3ESUF 4ZUTB 3F12A 5F7HA 5FM8A 2WP3O 3N85H 5HHNB 4U1MA 5C0ND 3OF6D 5JORA 5EUOF 3QEGH 4FFWD 4H20L 4X99B 3CFEB 1KBGH 5LQBL 1YYMH 1IGJB 4BSVB 1A0QL 4JG1H 5ID0B 1IC4H 4TTDD 1MFEL 2AJVL 5F7UA 1NLDH 4N90E 5I19L 4LSSL 1SMAA 3PE9A 1KULA 4ZAKB 4AQ1B 3GSQA 1A7OH 1RULH 1RUQL 1DLFL 5CEZH 1CFTA 2H3NA 2RBLA 4MB5A 3FT4B 5E4EC 3VFPA 4EIGB 3ULSB 4EVNA 1LO4L 5JHDD 1UVQB 4LHUA 2V2TB 1REIA 2NW2A 3IFPA 2FJHB 1U91B 3L7EB 4LLWA 5DMYA 3OF6A 4Z77B 1E6OH 5DEFB 4ELKB 5TF1H 1J1OH 1CU4L 3BAEL 2XACC 3FT3B 5C07E 4M7JH 3HC3L 3MRPA 3S98A 1DE4A 5M7QA 1XF3A 3GUTB 3QO1B 1N59A 3RVXC 4DFIA 3RWJA 4RAHA 3SGKA 1DEEA 4B41A 1ZA3B 2E6PA 2OLDA 4NWUH 5LKNA 5F1OB 2VDPL 3W9EB 4J2XA 1A5FH 4Y5YA 5J1TC 1GC1L 4GQPH 3WJJA 2KZWA 3LN4B 2DDQL 3KPMA 2H3NB 5B8CA 5JHDA 1ORSA 3EYOA 1ONQB 2P5WD 4YUEL 3SO5A 1G7HA 1N5AA 1RZKH 5DK0B 1I8MA 4LLWB 4YWGH 1QR1A 5KBNC 2DF3A 1U41A 3B4NA 3BKML 2FRGP 4KZEH 3U0WH 2V5YA 3QDHA 3GRWA 1DE4B 3EGSA 2NZIA 3B9EA 4U6HA 1N59B 5BRZD 3RA7L 1KN2H 2ICWJ 1P4LB 2XN9D 5T3ZD 1C5BL 2H8PA 3RBGA 1F4WH 1FP5A 1LO3L 4PRBA 1Z0MA 4Y5YB 3HC4H 4MQTB 4P3CL 1HHGB 5DDHB 5JHDB 5ESAA 4LHQB 2P5WA 1FG2A 3FZUD 1G7HB 1CK0H 1N5AB 3D87B 1NBYA 1AJ7H 3WMSA 2IPKA 4QLRA 1QR1B 1I7ZB 5JOFB 4LDOB 5HBBA 3QZWA 2NMSA 1VACA 4UDTA 4JANB 5E1HB 5EIVA 1N4XL 5BRZA 1KLGB 4WWID 3IJYA 2JCCF 1LP9F 1ZXQA 2H8PB 5I1DB 3IXAB 4YNYB 3SDAC 4L1HA 5JW4M 2P8PA 4ODHL 4KC3B 1U8QB 2P5WB 4UILH 5E2WL 1T7VA 5GGQL 2ZOLA 2GK2A 3NIFF 1L0XA 2BY1A 3OKNB 1E4WH 4UNUA 4MZ3A 5HDOA 5DRXA 4L4VD 4OZGF 1JBJA 1AXIB 2BCKB 4CMHC 1C1EL 2DQJH 3BEVB 2BDNH 4IM8A 1VACB 1C7SA 4K3DL 5EIIA 3TWCH 2X4RA 1KCLA 5BRZB 1GGBH 5GGTA 2FH8A 1MCHA 2LTQB 4PP1C 2XN9B 4NP4H 1OAXL 1A7NH 2PO6D 1RJYB 4U7MA 1RVFH 3KDMA 1U0QA 1A6WH 4APQD 4PB9L 4QF1B 5F1IA 3D6GA 4J8RA 4M7ZB 5DJXA 1Y0LA 4ZTOH 2FO4A 4PD4J 3ES6A 4UTBL 1NAKL 2UWEB 2AJYH 5IQ9A 5TE6L 4PJ7F 5F88A 1SEBA 2COQA 4RISH 1S7QB 1V3LA 4M6MH 4L4VA 2FEDC 4RAUB 2X05A 2Y6SD 4CAGA 5LG1A 4BZ1H 3T2NL 4YO0A 3WIHH 2ZJSL 2X10A 1I3GH 4YBQC 5E8NA 3SDXA 1BQHA 4YXLH 2KPNA 4M5YH 2AJSH 2PO6A 2HMIC 1INDL 5E8OA 3KDMB 5D9SB 1M7IA 2H2SC 5F1IB 1AQKH 2JE8A 4NN5C 4P4KD 4PJCF 1Y0LB 3F8UB 5DJXB 2O5ZH 2FO4B 3ES6B 1S7WA 3UJTL 4X6FA 3AM8A 2MOVA 1BVLA 3QH3A 2HRPH 1BX2A 2M1KA 1BAFH 5BXFB 5EOQH 1A7RH 1A2YA 2BJML 2CJUL 3QXAB 5EC1A 3ARFD 3R4DA 2YZ8A 4KMQA 1YMHB 3M1BA 3RGHA 2A2QT 4TULH 3CD4A 4MXQC 2DM2A 3WBDA 5ELIA 5TQ2H 2PO6B 2NY3D 2ITDB 4WU5A 3EJZD 1MIEH 3S3SA 1L7TH 1M7IB 3CFDA 4APQB 2VE6A 4JFDD 4P4KA 4E0RB 1DUZA 1JTTA 2DMBA 1LQSR 5IROA 1F6AB 3K8LA 3X3FL 1LO5B 3TP4A 3Q5YA 4PGEA 3GKZA 4XWGH 3GSRB 3MCKA 1HINH 5IWLC 4PRID 4NFCA 5B4MD 4PV8A 1TCRA 5TQ0L 3S5LA 5CKGA 3C8DA 4KZDH 2AJ3A 4Q6IA 5EC1B 4GRWF 2X1QA 3O9WC 4KU1A 1FHGA 4GQ9L 4PJEA 5DMGD 2VYRE 4PTUA 4JFQB 2YPVH 1U6AH 1OTTD 3OKEB 6FABL 4JPKH 2XZQH 1S9XA 1CLOL 4LEXH 2Q6WA 4MD0A 4HT1L 3G5VA 3P4OA 1UA6H 2DTMH 2ZUXA 4K8RH 5D7IE 4Z5RA 1JL8A 5E1AA 1I1AC 4X4MA 4PRIA 4CVWA 4QHMA 1SHMA 3WEXB 3S5LB 1CN4A 4Y4HA 3KPPA 1PKOA 4Q6IB 4YPJA 5L8JB 3ZKSD 3ARFB 1I3UA 3X3GH 4YXHH 4YHOH 3S35H 3F7YA 1UCTA 4GXVL 3VXMD 2AEPL 4KTEL 3MBXH 4CVZB 5GHWL 2CD0A 1LE9A 1FDLL 4I5BB 4RGNC 2NY3B 2VR4A 4WUKL 1IGML 1GIGH 1LD9B 5ICXB 4JFDB 2E9WA 1BIHA 4POZD 4M00A 3OGCB 5J56B 5IB5B 4OFVA 4TVPD 5KZCD 1JPSH 3C6SB 2AI0H 1ZT4B 3CFBB 3EYQC 3IFLL 1IGYB 4PJAA 1E4KA 3ARED 1BQLL 3D39A 4WEMB 3WFDL 5C0RH 3KPPB 4OQ1A 2X1WL 4Z7WF 3HE7C 3O3AB 3HCVA 1WITA 1KELL 3VWJA 5AWNH 1I3RA 3SJVD 4PTTA 4KKAC 2BERA 1UZ8A 1IBGL 5TF0A 3BDYH 3TT3H 4KKLC 5E95B 4UOW0 3K7UA 5FA4B 4LF3A 3F62A 1PVHA 3S6CA 1OHQA 5T3XD 3MRQA 4LQFL 1X5KA 2VRAA 2F53A 3UZVB 3VGEA 5FYKD 1FNSH 3B5GA 4HUMB 4MQXC 4WI3A 3B3IA 1E4XH 4YDLC 1UYWH 3GBML 4LCIL 3BD5A 4KK8C 4NJ9H 1CGXA 5ENWA 3LVEA 3O0RL 3HCVB 4NZDA 2GEEA 3VXMB 4XP9L 5KS9E 3SJVA 4UB0L 4PTTB 3GMLB 2FB4L 2XI9A 1XIWD 3CVHA 3FQWB 5DURD 4LLQA 4DKFL 2ZNWA 2LVEA 1GGUA 4MD5A 4FABH 1J86A 2QSVA 3BZ4A 3ZDXE 1RUKL 5KZCB 1FLRH 3MLZL 1FE8H 2GYSA 5EC2A 2AK1H 2D03H 4JR9L 4MA8H 2XXMB 1MAMH 2NY1D 1IM3A 1ZSDA 5IM7B 4Y4FD 2O5YH 1CDCA 3AREB 2UZIH 1DJSA 3RVXD 3VXPA 4R9HA 2FHFA 4GW1A 1I1YA 1FO0A 5I1EL 4NQDB 2X5PA 2JB5L 3SJVB 4AMKH 5FUCE 5DUML 2IQ9L 1I7TB 2AABH 5JUEL 4LLQB 1T22A 1GAFH 2R2EB 4YHPB 2R0KL 5IOPB 4GSDH 3IAGC 2B2XH 4KDVA 4FQHA 4NO5A 4KJWC 3EKCA 35C8L 4NZJA 3TF7C 4G80A 5LXGL 4BFEA 2Z0BA 4KJPC 3ISWA 1RJLB 1M1SA 5HGDA 3VXPB 2AJXL 2G5BA 4F57H 3BIAX 3QP3A 3TPKA 3ORJA 4JY4A 1PD6A 4GW1B 3BRFA 2IH3A 1CD1B 1OP5H 3O11B 3MLUH 5GGVL 4RWHA 4C4KO 1VDGA 1XIWB 5DURB 2DICA 1RZ8A 4G43A 4F2MB 3QDGA 4JO2L 4NRXA 4KJYB 4OLXH 4NO5B 2AW2A 2J8UE 3TIDB 5L8KB 4G80B 2NY1B 5ALCL 4Y1AE 1RHHA 4Y4FB 4Y7MA 3HN3A 1MRDH 3IAPA 4PJXB 3RPIB 3ZHLA 3BZDA 3VDBA 4KV5F 2VXTL 4AEHL 2MKLC 3QIUC 4R4NC 3D0LA 4GRMA 3SDAD 3W0WD 2IH3B 1TPXC 1N64H 5TDOA 5I1KH 1JTPA 1Q9WB 4PUBL 5A2KH 3CNKA 3OQ3B 2XTJC 3MRMB 2KQMA 5L2JA 3DIFA 4OLVL 3WE6A 1XGPA 1TZIA 2GFBA 3SKJL 3ZE1F 2P7TB 1G6RB 1RD6A 2C3VA 2NLJA 4OM1H 2OYPA 4HIHB 2J2ZA 2X4NA 1PW3A 4X4YA 3PHQA 3T0EE 2P47B 1X7QA 1N3NA 3C60C 1YEKL 3SDAA 3D0LB 4ONGL 3MJ7B 4O51B 4ZNCD 3ULUF 2D0GA 3SPVA 2Q3ZA 2A73B 4M48L 5FA3B 5IFJA 2V7NB 4NZTH 2VLRE 4LSDA 4Y19E 4OKVB 5GGUB 3P77A 5LAXB 2VQUA 3BQUD 5L2JB 5BQ7A 3MR9B 3N85L 1RUAH 3WE6B 1XGPB 2ESVD 2GFBB 1HHIA 4TUJB 4PJFE 1J0YA 3QEGL 2C3VB 3EYFA 5C0GA 2NLJB 4X7SH 4AIZA 1KBGL 3O4LA 3ALPA 3PP4H 4AT6B 1OGAD 4X4YB 5AG8A 2BVYA 1YYML 1GL4B 1X7QB 1IAMA 1N3NB 4JG1L 1IC4L 3SDAB 3STLB 2PW1A 1T04B 3IDNA 2DM4A 2CKBH 3W0WB 1WIPA 1NLDL 3B9DA 2OSLB 1I8KA 1A7OL 1RULL 1LEIA 5CEZL 1DUYA 3DGCR 1BP3B 2EDLA 5BQ7B 4CL7A 2ESVA 1E6OL 5TF1L 1J1OL 1FL3B 3EYFB 4Y89A 3IDJA 4M7JL 3BMVA 4AIZB 2NR6C 1OGAA 4PJ5A 3C9NA 4ODTL 4DGYH 3BMWA 2PW1B 4MAYC 3BIBX 4NWUL 4YBLB 3WKNA 2QQKH 5E2TH 3WN5C 4QHNB 1A5FL 3KPLA 4YJZL 1TQBB 3FQNA 1SVCP 3U4BH 5DEGB 2C7UA 5I1GH 5I8KH 3VFOA 1RZKL 1M71A 1TLKA 3BQUB 4TSAH 4WDIA 4X6BB 1S78D 3ZTNH 4YWGL 4JRXE 2AJZA 4K07A 2WZPD 1D5IH 5C0EB 4KZEL 3U0WL 4AH2A 3IDJB 2QL1A 3FO1B 4H88H 1NAMH 4EDXA 1X5IA 1ND0A 4NUGH 2BY2A 5KSUA 4GH7B 4P5MA 5EO1A 5TH2A 4R2GC 2VABA 1ODAA 2CMRH 5DO2C 1F4WL 3HE6B 3DUSA 5I30H 1MWAH 3HC4L 3SE8H 3GIVA 1FIGH 3UTTE 4G7VH 2C7UB 1YC8A 1CK0L 1AJ7L 5IWLA 4G9DA 5CP3A 1T2JA 5BJTB 4LOUD 5I75C 1MJ7H 1YEFH 3ECBA 3CVIH 3WL9A 3QDAA 3O9WA 1T7ZA 5FHBH 4YX2H 1HNFA 2BC4A 5ICYB 1ND0B 4LSVH 5KSUB 5TH2B 5EO1B 2VABB 2ED8A 4RGND 1KLUA 3MNZA 3WHE1 3UX9B 1AO7B 4Z0BH 4GG8A 4DAGH 1I1CA 1S7TB 1GH7A 1YN6A 2ZCLH 5HGHA 1NC2D 3AY4C 2FBOJ 4WHYG 4UILL 5K59E 3EYQD 2JJUA 5FCUH 4QO1A 1I1AA 4G9DB 2VITA 4XBEH 1E4WL 1UADC 3KYNB 3VXSB 2ICEA 2QQLH 4PGBB 2I26N 4ZD3H 2DQJL 3RWEB 2BDNL 2ZUTA 3WL9B 3DO7A 3HE7D 1A64A 1CGWA 2UY6A 2X89D 3TWCL 3ROOA 3HB3C 1GGBL 5FOBA 4NP4L 1A7NL 4FQQA 2BOBA 5F7KC 1RVFL 5IHBA 1A6WL 3MRDA 3DGGB 4JDTH 4K23H 5INCB 4KKLD 5F3BA 4YGAB 3RNQB 1CXLA 4ZTOL 3B2VH 5D1ZD 4U1GB 4YAQB 1INQA 5E6IC 3N1MC 4XPFH 2AJYL 4MAUH 3IFNH 4Z0XA 4G8GE 1QFOA 2FECL 2VITB 4MQXD 4RISL 2N7BA 2EE3A 4M6ML 1UB6A 1NKOA 1GCFA 4WUUE 4I1NB 3HHRB 3HE7A 5I76B 5J9PA 2YD5A 4BZ1L 3QUZD 4F9PC 3WIHL 4Z76B 1I3GL 5FOBB 3O2VH 4YXLL 3HPLB 4M5YL 2AJSL 4FQQB 3B2UD 4NWTL 3UPRA 3P0GB 4NCC1 5F3BB 5EUOB 3QYCA 1Y6KR 2GSGB 4GS7B 4JLRA 1AQKL 5DJ8B 3O6LH 1S9YA 4R96B 2O5ZL 4IBLT 1NC2B 1W72H 4M7LH 2W9DH 2IFFH 4Z0XB 3HAEG 4NOBA 1VGEH 1DBJH 4NSKA 5A2IH 2HRPL 1UB6B 4GXUM 5IMMA 5EOQL 1A7RL 4Z7VF 1V7NH 2JLLA 5K93A 2VWEE 4X7DC 1WEJH 3MXVH 3D1MC 1NCBH 3MOAH 3VFSA 3VGGA 2YD9A 2BVUA 4JGMA 4LMQI 2DLEA 4TULL 3NCFB 3LKNB 1GGCH 5TQ2L 4FZEH 2VC2H 1MIEL 1L7TL 5CLWA 4JLRB 5CBAB 4PRPD 5HGBA 5L88H 3TYFB 5D72H 1HE7A 1OY3B 5D1ZB 1IILE 1MI5A 5JR1H 3FONA 2DKMA 4G6FD 4XWGL 1HINL 3EDJA 4M03A 1FFNB 4I9WD 4KJPD 1ZK9A 4JREC 3MV9E 4KZDL 4BKLA 4NZRH 3GSWA 4ORGA 4FXKA 4QOKE 4LL9A 5J4MA 1T7WA 3QUZB 3JTSA 4ZDHA 2ZWLT 4OI9A 2AEIT 5F7EH 1U6AL 2DYPA 5DC4B 1A6TA 3EJJX 4JPKL 5KANI 2XZQL 4KWUA 2MTPA 4LEXL 4PRPA 5HGBB 3ESVF 1U8OA 3BGAA 1RHFA 1SYSB 1UA6L 1ZHKB 2BHZA 1RK1A 2DTML 2HTKC 1KCUH 4K8RL 1MOEA 4D9QD 1LP9A 3MJGX 5IVNA 3KPQA 1H0DA 4LQ1A 1FZKA 5KVDH 1ERNA 1Q9KB 4RMRA 4MJIB 4ETQB 4ORGB 3GSWB 4FXKB 5HHQB 1QHOA 4URTB 4J3WA 3X3GL 2J4WH 4YXHL 4YHOL 3S35L 1CT8B 1SEQH 4LPWA 1RZGA 1S7SA 3MBXL 1QLFA 4OD2A 3WFHA 1A6TB 3CUPB 3HTLX 2J1KA 3PJSA 4GUPA 4K71B 1VFAA 3AU1A 1GIGL 4NHUB 1U8OB 3I02A 3BO8A 1RZ7L 2NY7H 1RK1B 1JPSL 2AI0L 2JCCB 4XX1E 3MMEB 1LP9B 4P2YA 3T4YA 4JFZH 1RZKC 5CSZB 1IQDA 4NO2A 3DX6B 2FYYA 1R5IA 3C60D 4IOIA 4O5LH 1CBVH 1RZFH 1LVEA 4I4WA 1HHHA 3QQNA 3QIUA 4XVSH 4PJ7A 4DEPB 2W0FA 4LLUB 1QLFB 5AWNL 4KKBC 3WFHB 3PG2A 4U1IB 3U0TB 3PJSB 4OZGB 2J5LC 3AU1B 3QQ9D 3BDYL 4Y2DC 4U7SA 5FOJA 3TT3L 3GKWH 2ZKHH 5LGKA 1NCTA 2VKXA 1A3QA 2VAJA 3BN9D 1NJ9B 4J12A 1I1RA 4ORZC 1AGEA 4Z7NF 3T4YB 2BVQA 3L3HB 1FNSL 4UAOB 4HQQH 1E4XL 4WY7H 1UYWL 4NO2B 1TVHA 4NJ9L 2ATPA 3LKPA 4S0TD 3C60A 1WTLA 8CGTA 1B0RA 4I4WB 3SE9L 4HWZA 4N0FB 3GZKA 2EYTA 4V2CB 4PJ7B 2VLKD 4C56A 4GKZA 5SWQB 2GCYA 1JHKH 3O81A 4OIIH 4ONFH 4M3KB 4HKZB 5INDA 3WXVH 4D8PA 4FABL 1UKSA 1E4XI 1EERB 4WGWB 4XC3H 1QTYT 1ADQH 1FLRL 3ZKNC 1FE8L 4M9OA 2AK1L 2D03L 2HVJB 4MA8L 3OKDA 2I60H 3NFPA 2BVQB 1MAML 25C8H 1YMMD 3LB6D 3BYYA 2EIDA 4LNRB 4N68A 4FOMA 2O5YL 2PW2B 3QBTB 1TVHB 2UZIL 4PJCB 3LKPB 1FNFA 3IDYC 2DS4A 3GSNH 1B0RB 3RP1A 3QG7H 2VLKA 5JO5A 4AMKL 4LPYA 3DURA 4G6KH 1NSNH 2AABL 4HS6B 4UTAH 1GAFL 1WJ3A 4R97B 3UC0H 5BW7A 4GSDL 1R3LA 3DVGB 3MJ8A 3IB4A 3CXHJ 1NGQH 4LLMA 2B2XL 2H26B 3HZYA 1KIQA 3P9MB 3NFPB 3PGDB 5IJKC 5CWSA 5FYJE 3PP3K 5A3IC 5J7CC 5T5FH 2E7BA 1KYOJ 4R2GD 3W2DH 4F57L 4P2QD 3V7AE 4I48B 1E27B 3PNWB 3DMMC 3FQTA 3WN5A 3DURB 3MLUL 2Q1EA 2F8XC 1FFOA 1JVKA 2GUOA 3CZFA 1WWCA 2VDOH 4GRWB 5T1LD 2QLVB 3MJ8B 5IBTH 3KVQA 4OLXL 1CFVH 5IVZB 5DD6B 1FNGB 3HZYB 1KIQB 1R0AH 1QBMH 4MB4A 1YMMB 5E70A 4OV5A 3LS4H 4FTVB 3VW3H 3V5KB 1MRDL 4P2QA 5J12C 5F6IC 2D3VA 3GJEB 1K8IB 1N64L 1QVOA 1U3HC 4DOHE 5C2BH 2WV3A 1UJ3C 3RL2A 4ISVA 4RRPA 4Z7WA 5T1LA 3D9AH 3E8UL 5KANG 1LE5B 4JDZA 5DA4A 2KH2B 5D1XC 3PWJB 3BPOC 4LSTH 4OM1L 3K3QA 4OV5B 5ESQB 3HB3D 5CGYD 4U1KB 4R2GB 1MY7A 2R2HB 4P2QB 3O3BB 3FB5A 3ARDC 5IBLD 5GGRY 43C9B 1UKTA 1SBBA 5JHDE 1QVOB 2Z8RA 3U0PA 4NZTL 5J1AB 2D7OA 2HLAB 3AY4A 3SQBA 3K81A 4ISVB 3DTXB 5E6ID 3X14B 4Z7WB 5A2FA 3SKUD 2R1WA 5T1LB 1FZJB 4ZFOA 1RUAL 1F45A 3BP5A 2BOCA 2XTLA 4K8RC 2D31B 4OD3H 4X7SL 1X4ZA 2HFEB 3PP4L 5IVXA 3FB5B 2DJSA 4G6AC 4M62H 1HIMH 2CKBL 4ODUA 4M93C 2P5WE 3NBNA 3U0PB 1TNNA 4BM7A 1YN7A 4KHTH 5E6IA 5C9JA 3GJFK 4GOSA 4W6WB 3VRIA 2VZ3A 5LVEA 4JDVA 4ZFOB 4LRNH 3F7VA 4YFDB 2X4TA 2ED7A 5BRZE 4CVXA 4XPHL 3EO0A 4OI7A 4M4RA 4E9LA 4KKNA 2XN9E 2R0ZH 4F9PA 2ICWI 4NN6C 5T3ZE 3VXOB 3S88H 5DHVA 3MGTB 1JZ8A 2YA1A 4N1HB 4DGYL 2V7HA 1EA9C 4ODUB 3DROB 5E2TL 2UWEE 4HUWA 1X4XA 1A1NB 1AD0B 2QR0B 3KPOA 1HSBB 5E6IB 5C9JB 4QY8A 3U4BL 1OTUC 4OFIA 1FGVH 3OR6A 1FZMA 5I8KL 5I1GL 5CHNA 2O93L 4TSAL 1HYSC 3ZTNL 1D5IL 3MRIA 3EO0B 3BUTA 4H88L 2GK0A 1NAML 3QT2A 4WIQA 4NUGL 3RVVC 1I7UA 3GM0A 2CMRL 1IC5H 2MQ3A 3CFJB 4G9FD 5I30L 1MWAL 1YUHA 4OAWA 2RCSH 3EO1B 4R90H 3KPOB 4DGIH 4AEIH 1FIGL 4YR6B 5IHLB 4G7VL 1XCQA 3HZKB 3OR6B 3LEYH 3UBXB 1X3DA 4L4VE 1WAAF 2BXZA 1M05A 1U93B 1CR9H 3HS0A 3ULUD 1MJ7L 1YEFL 3CVIL 1FNEA 2GK0B 5FHBL 4YX2L 5EPMB 2XRAH 5F97E 1I7UB 4LSVL 3IFOB 3CMOH 3ZKMC 5CD5D 2MHAA 2YD1A 4L8SB 1Z6JT 4RIRA 4J3TA 1AXSB 5CKAA 1TQCC 1P9MC 4Z0BL 3GBNH 1NCDH 4I13B 1YUHB 1Z0NA 4DAGL 1P2CA 1VFBA 2C3GA 2ZCLL 3MNVA 4ZG1A 2DJ4A 1RFDH 1F13A 1XCQB 1VFUA 5EULV 4HBCH 5FCUL 4M4PA 3GJFB 4X6DA 3H9HB 4XBEL 3WKML 3FOLA 4LCWD 2QQLL 1RZIA 4UUJA 1FQ9C 1UACH 3TA3C 4ZD3L 1BZ9A 2CO7B 3EZ8A 3FB8A 5CMAA 3G9AB 4OZIF 4F7TB 4AK1A 1C8PA 1LILA 3VMOA 4KKBD 1FSKB 4N0CC 3V8CA 4RIRB 4JDTL 4G9FB 2PNDA 4K23L 1MLBA 4OCWH 2PETA 1P2CB 3B2VL 3KLDA 3MNVB 12E8H 2Z35B 3PQYA 4F9LC 3CC5A 4XNMA 4XPFL 4MAUL 5HPMA 3IFNL 1S5IH 5F7MC 5TE7H 5SWZD 5DJCB 3L5IA 2BSTB 2ID5A 1VGKA 4LCWA 4CW1A 1M6OB 2WINB 3LKQB 4HS8H 3VA2C 2IFGA 1H5BC 1I9IH 4G8IA 4PJBF 3LKSB 3O2VL 2B0SH 1PZUB 4JFDE 3WFCH 3QDMA 3SKNB 5HI5D 1UFUA 3QUXD 4Y2DA 1MLBB 4AENA 5I66A 1T0NB 1AGFA 3O6LL 1S3KH 5F9OH 2DQTH 3OAYH 2HP4A 1CFBA 2GY5A 1W72L 4M7LL 3CC5B 1CLCA 2W9DL 2IFFL 4XNMB 4ODWA 3CK0H 4PRIE 3P9LA 1A4JA 4HS3A 1DBJL 1FGNH 4LCWB 4LCYB 4CW1B 2CUHA 4NM4H 4KI1A 1V7NL 2K7QA 3MXVL 1NCBL 3L1OH 3KXFA 5GIRB 2A74B 2ZCKH 3EBAA 1A1OB 3NCYP 4OLWH 4PGCA 4N8CH 2YHGA 2CRMA 1GGCL 1IGTB 4FFVC 3RL1A 4FZEL 2VC2L 2O61B 2J5LB 3QUXA 2A6KA 3GSOB 5I66B 1I7RA 1AGFB 1XR8B 5D72L 1ZHNA 3DX7B 5JR1L 2X40A 3P9LB 4MA7H 5IB2A 4OCLC 5SWZB 4HS3B 1MEXH 3ARBC 1MQ8A 5A3ID 4OF3A 2FZ3A 4NPYA 3EDEA 3I2CH 3REWB 1F3DJ 3NIDE 3RQ3A 3VXME 4LSPH 4NZRL 2IGFH 2EXYC 3OMZA 4L3EB 3FB7A 5F7EL 4K3HA 4TUOA 4M1CD 3KPTA 1T21B 5EG6C 2NY5H 5I74C 3MC0A 3QUXB 1A6AA 4TVPE 4HIIA 3RPKA 3V2AR 1UM4H 1XGYH 1ZHNB 5BOPA 3RBSA 1KCUL 2B1AH 1KEGH 5GRWA 5F7YC 5ADOH 4N8VA 4YHYC 5IJKA 4QGYA 5KVDL 2YPKA 5DR5H 1B4RA 2J12B 3SJVE 4XAWH 2XWBA 2J4WL 5MEND 1G0YR 1SEQL 3FB7B 4TUOB 1EFXA 2NY2C 3DMMA 3QIWB 5F6HI 4U6XA 3WIHA 2F5AH 1U3HD 4BK4A 4BUGA 3V5HA 3LOWA 4EDWL 5CD3A 5I1IH 5F8RC 5T3XE 3BJLA 1K85A 2P24A 3QJFA 2NY7L 2X1PA 4HH9A 3HG1A 5FYKE 3RU8H 1Q9OA 2Q76B 4R3SB 5EU3A 4KK5D 5DSCA 4N0UB 1KJ2H 3PABA 2BVTA 1PX4A 1CFSA 2OZ4H 2XFXB 3U82B 3Q6FA 2VQ1B 4N5EC 4O5LL 4F3FA 3WDHA 2H45A 3ARDD 5KSBF 4RMUA 2XWBB 3PXJA 4EUPH 4EI6B 5MENA 5SWSD 5EH1A 2IMNA 4XVSL 8FABA 5E8EA 1OL0A 3E6FA 4U6XB 1U3HA 3CPLB 1UJ3A 2FSEB 2XYCA 2E7HA 2WLZA 2ZKHL 3GKWL 3PL6C 4X5WA 3FRPA 2Q86A 4NUJB 5KJRH 5D1XA 3AB0C 5EORH 3MUJA 3JWNC 1AR1C 5DSCB 4U2ZA 4FP8H 1BFTA 4NRZB 3QIBC 4HUVB 3Q6FB 4LLVA 4PJXE 4HQQL 1W0WA 4WY7L 3BE1H 1AH1A 1S7VB 3K0WA 1DANU 5DJDA 5AZ2H 3BFOA 5KVFH 4FMFA 1KACB 4G3YH 3ARDA 2FJFA 1ZVSA 2JJVA 4G6AD 3TBYB 5MENB 5SWSA 5DQ9A 4P2CG 3HZVB 5E8EB 1JF1A 5B39G 5CP7A 1U3HB 4ODVH 2W92A 1JHKL 4OIIL 5DMKA 1X6LA 3HLAA 5I8CA 4ONFL 4Z7VA 4QCIB 3WXVL 3MCLH 4OQTH 3RVTD 1ZGLA 3QQ4A 1AKJD 3PWNB 2DQIH 4XC3L 1ADQL 2HT3D 3FO2B 2WIIA 1DQMH 2H32B 2I60L 3TPUA 1QKZH 25C8L 4PY7A 1W0WB 4W68A 5I17B 3QI9C 1XMWA 1JNNH 1HDMA 5C0IB 3RKPA 5DJDB 4HX1B 3RY4A 2YOCA 4ZSOB 3GSNL 1EO8H 4KVCH 3UPAA 3ARDB 5I1AA 5C0DA 1C16A 2FIKA 3DOSA 5SWSB 3SHSA 4WHTA 3QG7L 3K8KA 2YRLA 4WI7A 4OGYH 2WNGA 4FXGA 4UTAL 3HLAB 2EIEA 1XCTA 3UC0L 4H25A 4C59B 2A6IA 4UQ3A 2VO5A 1ZGLB 1CGVA 1NGQL 1OTSD 1AKJA 1BM3H 1G6VK 5KVEH 1T1XA 1IKNC 3WHE0 2R8SH 1YEJH 4PGDB 4CGTA 3I75B 3WO4C 2W38A 4WI2A 1HDMB 2IAMD 1JGEB 5T5FL 1Z3GH 3ZLQC 5D70H 4CN1A 3W0WE 4YK4B 4GBXC 5F7NC 1CXIA 4P3WA 1LNUB 5FO9A 4G7YL 1HNGA 1BF8A 4YC2C 4M93B 1WBZA 2UZXB 1CTOA 4V1DD 2DWDB 2VDOL 3TJEH 4DKDC 5IBTL 32C2A 1CFVL 1T1XB 1R0AL 1QBML 3UTZB 3LEXA 4IIQC 4NN6B 1A4KA 1QEWA 1QR4A 4GLRI 3ZE0F 5EZIH 3VW3L 3I85A 4XPTH 1F3RB 5SV4A 3BD4A 4OFDA 1ZEAH 4KPHH 4L4TA 1UEYA 2CLVA 1TDQA 4XNXH 3QNYA 2ZG1A 1F58H 5C2BL 5DQDH 4HPOH 4JVPA 5EO9A 4MD4B 4XZUA 4MJ6B 3KPSD 2ESVE 3Q3GA 4XWOC 3D9AL 3JV4A 2OL3H 5F3HB 3EAKA 5C0FB 1JPGA 4DW2H 4QTHA 2VLMD 1OGAE 1GZQB 3OJDA 2ZNXA 3T09A 1UQSB 4XPGH 3VGAB 3RWHA 2IAMB 4U0RC 1JWMA 3N0PB 2RR3A 4N0CD 2Y5EA 4MLIA 3EOTH 5F72S 3ZYOA 4YZFF 1RK0B 4J4PC 4G6JH 3QNYB 3HRPA 5EO9B 4K7PX 3V7MA 3TBSB 4V1DB 4TPRH 2HWZH 4Q9CA 5EBWA 5KSVA 1IRAY 4AG4H 1UXSB 3QULB 1ZS8B 3TA3A 4OD3L 3VFRA 1WBYA 3GFUA 1RJCA 2YUZA 1JWMB 1PZ5A 5CEXA 4ZXBC 1PEWA 5JXAH 3A0OA 5E00B 4X6CF 4M62L 1HIML 4O2FA 4DKAA 4O00A 2N1KA 2ZG3A 4DVRH 2ENSA 5E7FA 3RUGF 4D0BB 1R5VB 3KPSB 2EE9A 1KIPA 5EU5A 2NY0D 1TNMA 2MJWA 3GMPB 1OCWH 1JYNA 4LRNL 4OFYA 4JM4H 4X9HA 3E1F1 3P40A 3RWCA 1BLNA 2R0ZL 1K6QH 1H5BA 1T20A 1K8DA 3S88L 4ZFZA 4UV4H 5JXED 4PJHF 2BVEA 4GW4A 4P48A 4Y4KC 2DI9A 1MVFA 5EU6D 2WMPA 5BZWB 2GITA 1FGVL 2FCBA 3JTTA 5FYJH 3NVQA 4LP5A 1F6LL 2BRRH 3T65A 4UQ2B 4HWNA 3CXDH 3EHBD 4F58L 2E8ZA 1CFNA 4S0SD 2A1WH 1JNJA 3RWCB 5CAYB 4EQ2A 1T20B 3MYJA 4RGNE 3DRTA 5EUOE 2W59A 4ZFZB 1B90A 1IC5L 4S1RH 5F1KC 4XGZA 3MZGB 1Q1JH 4EKXA 2AXGB 2E3VA 2DL2A 5I16A 2RCSL 2OMBA 1T66C 3L7FB 1C5DA 5EU6A 4DGIL 3S8WA 4AEIL 2X4PA 1CG9B 1N7MH 4PYGA 4S10A 3TNMA 3JTTB 3LEYL 2NY0B 3ZKXB 1HWHB 3SGJC 4G42A 3D3VD 1ZT7B 1CR9L 3ARBA 5BV7B 3KYAA 1EBAA 3PWUA 1VFMA 1NUFA 1PBYA 2CLRB 4F7PA 2XRAL 1WICA 3DRTB 3CMOL 1YYLH 3RJDA 2DBLH 3DVNA 1KTDA 3PGCA 3GMNA 3K74B 3GBNL 1NCDL 2ICWA 1C5DB 1YNLH 5EU6B 5EOTB 3ETBF 4N9GA 4I3RH 5C0CD 1RFDL 3O6FD 3VFNA 1QQDB 1KPVA 2HTLC 3D3VA 3VFGH 5JZ7D 4MNGB 1JK8B 1VHPA 3HMWH 1UB5B 3Q0HA 3MGOA 3MRLB 1UACL 4N5ED 4F7PB 3GSUA 3B8SA 1BOYA 2PCPB 3VXUD 4ELMF 1AE6H 3RY6A 3SDYH 3TIEA 3DVNB 3T1FA 4Y16C 3GMNB 5IFAH 1MCSA 4OCWL 1JMXA 4MXWH 3L9RA 4JGJA 1NBZA 2PXYC 3GRWH 12E8L 5C0CA 2FBJH 1BZ7B 1S5IL 1YNTA 3D3VB 1KCSH 4NKOA 2DQGL 4HS8L 1A6ZB 1IM9A 1I9IL 3VXUA 4PLJC 1JRHH 1YEDA 1ZVYA 2B0SL 4PRPE 3WFCL 3QDJA 3ZDYF 3PL6A 2OJZH 5CUSL 1NBZB 4RA0C 4HGWA 1S3KL 5F9OL 2DQTL 3ZT6A 5I0DA 4G6MH 1LP9E 1MWAA 1QO3A 4X9BA 2DWEA 5C0CB 3KJ4B 3O6FB 4XP6H 4I9WE 3CK0L 1YNTB 2BFVL 1MCPH 5T3ZH 3QIBA 3VXRA 1FGNL 5DJ2A 4Z7OF 4NM4L 2DLIA 1OOAA 3CAFA 3NIFE 5FHAH 5D7JC 3PWPD 3L1OL 2ZCKL 5D7SH 3V95A 1YA5A 3G9VA 5DUPH 3OKLB 4N8CL 2FLRT 1NQBA 2MCPH 2EH8H 3G6JA 2D9CA 3GMRA 3OV6A 4L3AA 3IDIB 4D9QE 1QO3B 3AB0B 3DSNA 4MA7L 5HYSB 1MEXL 1KJ3H 4EIZC 5LBSH 4LK4A 5DJ2B 3IKCB 3U30B 2CRZA 5JMRA 4NKDA 1YEEH 3I2CL 3ULVF 4PJ7E 4LSPL 2WBWB 2IGFL 2VLJA 3PWPA 1JJUA 4NQVA 1MF2H 2R0LH 1K4CB 4IDLA 1NEZB 4BK5A 2X7LB 4NQCD 5CGMA 1CD0A 2NY5L 2PYFB 1GJIA 2GJ6D 5MI0C 1CICC 4KXZH 4J3UA 1UM4L 1XGYL 4I77H 5L0QB 5J6GB 1HH6A 4TYUA 1IKNA 1JPFB 1KJVA 1SYVA 1T83C 2B1AL 1KEGL 3SDCD 3S96A 4PJCE 5ADOL 4KFZC 4MDJA 2EZ0C 3SCMC 4NKDB 2MQCA 5DR5L 3ARGC 4GBXA 4XAWL 3TC9A 3PWPB 2EKSA 2RFXA 2JF1A 2K7PA 1EHNA 1TTUA 3VE0B 2YSSA 3QPQC 1QNZH 3K4DA 2F5AL 3NCBB 3OR7A 4RZCA 5FUCC 2AK4B 3PWVB 4HJGB 5IV2A 2UVFA 1A6VH 4POUB 5I1IL 5FKAA 4XWOD 1QPXA 4HUUA 4OZIA 3OSKA 4HV8A 3RU8L 4F7CA 1HH6B 1IARB 4OUUA 1SYVB 4U1NA 1KJ2L 1W72A 1MPAH 3JZ7A 5C07A 1I75A 1UWEH 2OZ4L 1ZWIA 2X4SA 1W8NA 3KNBB 4IIQA 4NBXB 5EN2A 2Q7NA 4YIQB 5DD5H 3BEWA 1UXWB 2QEJA 4D9LH 2VLKE 2EKSB 2D7QA 2RFXB 4OBRA 2BNUA 4HUXA 4JPIA 4RFOH 3BWAB 1KXQE 4NQCB 4RZCB 4QXTB 3WJLA 4GRWE 5IV2B 2GJ6B 2QJDA 2Z4QA 5DHYB 4RFNC 1N8ZA 5FKAB 1FN4B 1U92B 4ONOA 2I27N 5KJRL 4OZIB 5ETUA 4KRPD 3E2HB 1X5AA 3EYVA 3CH1A 2LABA 4LKXB 4MMZC 1YMME 4OUUB 3JV6A 5EORL 4U1NB 4FP8L 3SDCB 3NFNB 3INUH 1FFPA 3I3BA 1KG0B 5FF6B 5FGSA 2IQAB 3X12B 3T8XB 3BE1L 4KRNA 2B5IC 2CDEA 5AZ2L 1H3XA 5KVFL 5IT2H 4G3YL 1R24B 4HUXB 4GKNA 2C1OB 1JWSA 2JKXA 4J4PA 2LV4A 3JVGC 4ODVL 4YDVB 1EBPA 2X4OB 1TENA 5B3JF 4E5XA 5E08H 1TCMA 3QEHA 3MCLL 3DV4A 3OPZH 4OQTL 1QZ1A 1CDGA 4PJBB 3LRSB 2DQIL 5GGSB 2ZSWA 3JV6B 4L3CB 1DQML 1QLRA 1PJ9A 1FFPB 1DANT 1QKZL 4MS8C 4HJ0D 2Y06H 3GGWB 3JSSA 4P2QE 1JNNL 3U6RB 4OM0H 3T0EC 3H2WA 4ZXBA 3K1KC 4KVCL 1EO8L 5I6XC 2CLZB 1T2QH 4IEFB 4JVWA 1A7QH 3V5DA 3MBEC 5JLZA 1P7QB 1RIUH 5E2VH 4Z18A 4Z7WE 5DT1H 4OGYL 4EBQH 1EJOH 2RB8A 4E5XB 3HNSH 2J8OA 1PDKA 1XGQB 4KRPB 4MA1C 1E28A 5K9KB 1BM3L 2ZSWB 1SJXA 5KVEL 4YHNA 2QADC 2ZPKH 2R8SL 5GRXG 1YEJL 3BXNA 2F19H 3TVMD 4X5XA 4LVNC 1VEPA 3F5WB 1Z3GL 1IE5A 5D70L 2VUYA 4UU9A 4TVPH 3V4PH 5J57B 2OR7A 3KYMA 4Y4KA 4FG6C 1FVEA 5ITFB 3L6FA 3MV8D 4CBPA 2FEEL 3TJEL 3TCLA 5ICZA 1P84K 5DJZB 3E6HA 3VGHA 4YHNB 4KKCD 5GS1C 3QAZB 2X9YA 3C08H 1IL1A 4K2UH 5DFVD 3MUY1 3HNVH 2ICCA 5EZIL 5JIHA 4UU9B 4XPTL 1F4YH 4KROC 2V9QA 2FEEI 4H8WC 4KPHL 3A6CH 4XNXL 5FYKH 3LKRA 1F58L 1RJZA 2R4RH 5DQDL 3L6FB 4HPOL 2HJLA 4QNPF 5HI4C 2JB6B 1A9BA 4Q9BA 2ZOKA 4Q6YA 4F7MB 3SGJA 2HTLD 2CIIA 5IBUG 2OL3L 5IEKA 3MRJB 4DW2L 3MRGA 2AAVA 1ADQA 3TVMB 5FM5O 3BJ91 3ROLB 1NMBH 1T1YA 4LPCA 4XPGL 4WFFD 3MRNA 1FAKT 3RWIA 2VL5B 3O6MH 4YPGA 1S9KC 1KCVH 5EZJB 5GRVK 5D96C 2HKHH 3EOTL 4WVRA 1UEMA 3GSNA 4M61A 3N1GC 4F33B 5HHOD 4ZPVB 1F42A 2WUBH 4G6JL 1R3IH 3A6OA 3QISA 1DBAH 3VI3E 1GGYA 3MV8B 4TPRL 2HWZL 2NY5C 3CSYA 5KSBB 3IF1B 4RGMC 5IEKB 3PUCA 2QV2A 4JCLA 2WSKA 4AG4L 1TJIH 3MRGB 4NFBA 4KTDH 4N5UA 4PRAB 1JZ7A 1K5NB 3IGAB 3RWGA 1P1ZB 3MRNB 3TBWA 3BIKA 1QLEH 5JXAL 4C83B 1KCKA 1U8KB 4Y16A 3OB0K 4ZPTA 5CEYA 1O5DT 3LDBC 2VTFA 4HAGA 1TETH 4JKKA 4DVRL 2AQ3A 4WI4A 3VH8G 4FA8A 1G6RH 1LDSA 4KV5E 4NO0D 3ULVC 2EXWC 3BGFC 4NC0B 5JPMB 1OCWL 3DYOA 5EZOH 4JM4L 2CUMA 2NXYC 1YQVH 1BD2B 1JMZA 4RNRB 1MHHA 3NABH 3B8YA 5D7JD 1K6QL 4K3JH 2XPGA 2HG5A 5GZNC 5CILH 4G9FE 1HHKA 3ZE1E 1LK3H 4UV4L 2F8OA 4JHBA 4ZPTB 5CEYB 4XNYH 2ZSVA 4PJ9C 5HHOB 1OQOA 4QRSB 4R0LB 4NO0A 3G5YA 1G9MH 1OSPH 4DN3H 4MQSB 3ULUE 4X6EA 5FYJL 4PJGF 2YMXH 4HFWA 4QYOA 4P9MH 2BRRL 2D7MA 4FRWA 3CXDL 5A16B 2A1WL 1FNAA 1MY5A 1QFUH 5CJXA 5D7JA 1WISA 4NC1C 3L3GA 4S2SA 5KSAC 4LVOB 1LEGA 1S7UA 3DETD 4NNPH 5FGRA 4Q2ZA 4S1RL 3X13B 1EGJH 2VIRA 1Q1JL 3QRGH 1IAKA 4LARH 5D6DC 4PREA 3FL7A 3STZA 1N7ML 3HC0A 1FH5H 4KRMB 4XNUH 4LCWE 2XZZA 2ARJB 3RIAF 4WO4C 5DF0A 1I9JH 2EDRA 4QYOB 3TO2A 4FQXD 3VWKC 1RMFH 3QXUA 4RFEB 1NCCH 4UDUA 4ZQKA 3N9GL 2MPAH 4PG2C 3TO4C 2CKNA 3RWFA 1MRFH 5D7JB 4S2SB 3DUHA 5FV1L 3QPQD 1YYLL 1OGTB 1MCWW 2DBLL 4Q2ZB 4R4FH 1X6NA 4WHCA 5HY9A 4IRSC 1JNHA 5LGJB 1BWMA 1NKRA 4E42A 1CICA 4PJ8C 4ZFFA 3H9SD 3JUYA 3MROB 1YNLL 2BMKA 3FRUA 4HWUA 5SWZE 4I3RL 2VZ1A 1XGUB 3C5ZD 3UAJC