4PP2B

The crystal structure of der p 1 allergen complexed with fab fragment of mab 10b9
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
215
Chain Sequence
EVQLVESGPSLVKPSQTLSLTCSVTGDSITSGFWNWIRKFPGNKLEFMGYITYSGTSYYKPSLKSRISITRDTSKNQYFLQLNSVTAEDTATYYCARRGFLTTVNYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain of Fab fragment of 10B9 antibody
publication title Structural Analysis of Der p 1-Antibody Complexes and Comparison with Complexes of Proteins or Peptides with Monoclonal Antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 215
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp2B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp2B02
3VI4E 4TUKL 1Q9WA 4OI7A 3O4LB 3W5MA 5F9JB 1DQLL 3HZMA 3C8KA 3QXDB 4PBWD 5A3IC 3D0LA 3UTTB 3CGTA 4KVNH 4JM2B 5LWYL 5A2LH 1SVCP 4BQCA 1Z0NA 3UBXG 2CDGB 1A2YB 4YHOL 4Q9QL 1QFWM 3RZWA 3D0VB 3HUJE 2E8YA 2YK1L 3L9RA 2NNAB 4RISL 1CBVH 1FVCA 3UTZB 3PNWA 2CKBB 3SDXB 4PD4J 4I2XA 2R69L 3EYFB 1M05A 1HDMA 1LP9B 4NHCL 5D6CB 1J0JA 1MLBB 2AEPL 2LTQC 4HS6A 4WGVB 4DW2H 1S7RB 5E2WL 4BQ6A 2IALB 1E28A 4GT7A 1U3HC 3VXSD 3JZ7A 3SDDB 5ICXB 1OAUL 3AFLA 4TVPH 3FQTB 2YD9A 1KJMB 5C0CA 1NCNA 4FFVD 2CGRH 3MUJA 2FCBA 3AS3A 4NQUA 3PGCA 5DRWA 2XXCB 5C0AB 5DMJB 4HWNA 4O5LL 5IQ9B 3TZVB 5GS0D 1WEJL 2BZDA 1MWAA 4L3EB 1DE4A 4LHJB 1SJEA 1BZ9B 4LKCB 3SCMA 3UBXA 3RVWC 1E6OL 3HNVL 4PB0L 3S37H 1OSPL 4J3SA 4HC1A 4HJJL 1HI6B 1YY9D 1NC4A 2VLRA 3O3AB 1MI5D 4EN3B 4HS8L 1NFKA 3OXRA 3S98A 2E3VA 1H3TA 3GJFK 1QPPA 3DXAD 1ACYL 2I60L 1JGUH 2G75B 5IV2B 4XNYL 1UYWL 1B3JA 4F33A 1N3NA 3MLSL 4PR5A 4X98B 3I75B 1FO0L 4JO2H 4NO3A 4KUZH 4LOUC 1U8JA 3VFUA 5DHVB 1HEZB 3FFDA 5IF0B 2F8XC 4QLRA 3OAUH 4G8GE 4NKDB 2AK4B 5D5ME 1MJJA 3T0BA 4JFHE 3PWUB 4PUBH 1G9NL 2D03L 5FYKL 2XA3A 3KWWA 5T1KD 5GRUL 4NQEB 3L1OH 2EO1A 1C8PA 3ES6A 6CGTA 3MOAH 2NY5C 1CFBA 3OKEB 1CFSB 3RX8A 1KJ2B 1DBAH 1T20B 4JPIB 4XBGB 1MY7A 1GVIA 1ES0B 1W0VA 1EA9C 4U1MA 3TBSB 1NQBA 4S2SB 2R4SH 5EZIH 3MNWB 1FJ1A 4RMSA 4C56A 3B6SB 1CGYA 2NY1B 2I07A 3CXHK 2Y7QB 1IAIL 3O4OB 4M7ZB 1R3HB 1N4XH 2ZCHH 5HI5D 3FB7B 4J6RL 1J1OL 4LEOA 2O5XL 4NZJA 1QOKA 4WJ5A 2YC1B 1P7HL 1QVOB 3WIHH 1NFIB 4JHBA 3SBWC 3D25A 4IS6A 1QQDA 5F7EL 1QA9A 5H37H 4I3RH 3OF6D 5L2JA 5DA0B 3SKNA 4IM8A 1DTUA 5KW9L 5CJXA 5T1LD 2QHRH 5L6YH 5D1XD 1TJIL 3U82B 3BJLA 4YK4B 1R3KA 2VZ3A 2AKRB 3KPSE 1JNJA 15C8H 3K8MA 1R24A 1YY9C 4ELMF 1F8TL 3VG0L 5T5FL 2BDNL 1WSST 3CU7A 3QDJA 3HPJA 1KB5A 1NCDL 4MX7B 4UT6L 3RI5K 4CMHB 3DX9A 2ED9A 3EFDH 3X11B 2GHWB 2VJXA 2HT4D 4V1DA 5E7FA 1JF5A 1OAQH 4FZEH 4JDTL 3K0WA 5DR5H 5D6DC 3WEXA 3NACH 1FYHB 2EKJA 1FVEB 1K4CB 5KSUA 2FEEL 5F9OL 4CRPA 3LDBC 4WEMB 3TIDA 3G08B 4U6YB 5KJRH 2A38A 4U1KB 3HCVA 2IAMC 3BVNA 3OPZH 1ORQA 3KVQA 4P5KA 1YEIH 3QWRD 3MV9A 3BKMH 1OAZH 1I1AB 3G5VB 5E2TL 1NC2B 4XNQB 1E0OB 4JPVH 3HZYB 4RA3A 4EBQH 3CIQA 3P4LA 4QHNA 2JJSC 4RGND 4ZUTB 1MJ7L 3PG2A 1IJ9A 3BIAX 4IIQB 1R3JA 5CHNA 4MJIB 5DQJA 2WANA 1D5MA 1SJVA 3F58H 5FO7B 3LAFA 3LKQB 5JTWA 3VFPA 3BHBA 1QG3A 5F96L 1PLGL 4OZIE 2DLIA 1UM6H 1T7WA 3HE7D 2YD3A 4I0PD 1ZLUH 1RJZB 2A6IB 5KSBA 4BYHA 1LO0H 3S96A 3HE6A 5KN5B 5KS9E 4MNHA 1MHCB 3U0PB 1ODAA 5L8JB 5H35A 3CD4A 25C8L 4G9FD 5EOCL 5D2LF 3RGVC 4ZXBA 1CZ8H 1T0MA 4LVNC 5IJKA 5KSAB 4UU9B 4Y5XA 5D1XC 1FPTH 1NJ9B 3L3GB 1QSEE 2FJHA 1CDHA 1IGFH 4DOHB 1RHHB 4UQ2A 1AH1A 4K9EC 4LLWA 1AQKH 1Q0XL 3UJTL 2VDOH 1JV5A 2WV3A 3WUWB 5EN2B 3MNVA 4Y5VC 2XPGA 3W2DL 3G6JF 1AXSB 4ZS6C 5GJTL 4QRPA 2NX5D 5CIPA 1CXFA 1BQSA 1HNGA 2J7LA 2F8VA 3AC0A 2RHEA 4DJMA 4ODSH 3ZE1F 2ZOKA 2MOVA 4LLMB 3P4NA 4GLRI 1T6VN 2YD4A 1NCTA 3RU8H 1U8NB 3SDCB 2V7HB 1I7TB 2YZ8A 2HT4C 2OL3A 3T0EE 1HXYA 4KHXH 2ADFL 1GGBL 2D7MA 4NQDD 1N6QH 4Z0XA 2BJML 4GUPA 3BESR 4MQSB 4BH7A 4OM1H 3BZEB 1WGOA 1KXQE 1X7QA 1FZJA 2WIIB 3D18B 4HCRH 5DMGD 1OAXH 3MRKB 3PL6B 2E8ZA 5IB4A 4F58L 4E41E 1FGVH 5L2KD 5D7IA 4NZTL 5E9DD 3RPIB 2VOTA 4PS4H 4ZG1A 5DGQA 3BZDA 1WTGT 1H8NA 2Z8VC 5J89A 5GRWA 1U6AL 4N5EC 3F7QA 4G3YL 1HNFA 4RGNC 2H2PC 4APQB 4BSVB 3K2UH 1FL5B 2EXYD 4P46C 2BNRE 4PP2B 1VFOA 4F7CA 5DEGB 1A6UH 5AYUL 3V9FA 5J3HC 5DZLA 2HLFD 3GJEB 1MIEL 5DVOA 1NMAL 4J1UA 3HE7C 1T21B 1G7QA 3GSNA 2VC2L 4Z7WB 4HXAH 5HDQL 4UB0H 2VWEE 4RMQA 4M1CD 3A6BL 4BJLA 1HSAA 3VFSA 5C0IA 1CXEA 2MWCA 3S34L 5IUSA 2QQLH 2A73B 4KDVA 2J5LB 3Q0HA 2YZ1A 2IC2A 2DMBA 5DD3L 4DK6A 4OZHE 3L5JA 3SOBL 5JXAL 4XCYA 2CKNA 3OKOB 4JZNA 2H3NB 3CZJA 1JNLL 4YIQB 4UDUA 4KTDH 2YPKB 2OTWB 3O6KH 3S36L 1A64A 3IGAA 1OGAD 3TJEL 2FD6H 4JQXA 2XTJC 5JHDD 3MRLA 1FP5A 2OR7A 1RD6A 2PXYB 2DD8L 3PWLB 4X9GA 2DIJA 1JTTA 3RDTD 2N7AA 3DECA 1K4DA 3QPQC 4GAYA 3ARWA 3FKUS 2Y36H 4PJAB 4AH2A 2DQIL 2R2HA 2X89D 3FRUA 5HYSB 4FQCH 4HBCH 1A0QL 3V4UH 4PJFA 4ZOEA 5C08A 1QLEL 3HAEG 4ZFOB 3VJ6A 1BP3B 3PQYB 1JF1A 4RFOL 5D7KD 1S5HA 3S37X 4JG1L 4NNYB 4ODWB 1T5XA 4RA0C 2VQTA 5MENA 2ZPKL 5JA8B 2VRAA 2WLYA 1FBIH 3GO1H 2FRGP 3FQNA 2OS7A 1YDPA 3U6RA 1CICB 3TO4B 4LIQH 1TETL 1G6RA 2BOCA 3JVGC 1W8OA 2YN3A 1ZS8A 4PJ8A 4NWUL 2KQNA 3UZVB 1YNKL 5EU3B 5HHME 1RJYB 1XZ0A 5E1HB 1JPTH 5GRVK 4AY0A 2NXYC 3QIUC 3C5SA 2YD6A 3L3HA 4OZHA 3BW9A 1YECH 1K8DB 2A6DB 3E6FA 4CMMB 2DLFH 2WWKO 1L6XA 1SYVB 5DQDH 4NNPH 5T5NF 3QA3A 2IG2H 4OQTA 5BXFA 1AP2A 1GZPB 4LLUA 4MWFA 4PJGF 5L9DL 4F8QA 3KJ6H 1OT1A 1WIOA 3NH7L 3HAEA 4K3EH 3N85L 4P2QA 1R5IA 2HT3D 3BDYH 4EXKA 2QQNH 4UZGA 4HWEH 4I4WA 4XVUD 5TQ0L 4EVNB 5JIKA 3OR7B 5I19L 3L3IB 5I1KH 1B0GB 3CVHB 2C1PA 4LDLB 2D7OA 2DQTL 2PYED 4OAWB 1KJVA 5GSRB 1EZVY 4HV8B 1QKZH 4GW4B 1JNNH 5GPRA 4O58L 3ULVD 5HGGS 4OBRA 4JZOA 3WLBA 3VXSA 4YHIB 4YPGA 2GTWB 2N4IA 2R0LL 4M00A 4H8WC 4JCLA 5IB5A 4PJ9C 5IWLC 4GJTB 5T3XD 5DJ6B 3LKRA 3CXDL 3A6CH 3SE8H 3UZEA 2FIKA 5AD0A 4P5TB 3QG7L 2C9AA 1INQA 1SBBA 2IH3B 2P5WE 4OB5H 5EWIH 4IMLA 4RGMC 2JJTC 3MLPA 3MODH 5GZNC 5E24E 4NO0D 1F3DH 4M7KH 4QGYA 1JUFA 1ITCA 4FZ8H 4JZJC 2X4NA 3H3PH 2P4AB 4PJBB 4UAOB 4ZS7L 3ELAT 1A7PH 1Q0YL 1T3FB 2NY7L 1T1XA 3NIDE 1F3DJ 4C54A 2MMXA 5EO0B 4YHKL 3VXTB 2EDRA 4HWZA 1MI5A 4DZBB 5TDOB 4XBEH 4LL9A 5E6ID 3P0YL 3H9HA 3DXAA 4LBEA 3ZHDA 5DSCB 2X7LB 4M1GL 5GS3A 3SPVA 1NGPL 4Y19E 5IROA 5AYQA 1N8ZA 4MCZB 1WFTA 1EHNA 1XIWB 4LRNL 4IOIB 5B39G 3PP4L 1CF8L 3FZUD 5ACZB 4YO0B 5C2UB 5EU6E 2FR4A 1VADB 2EEAA 4NQXA 5LCVL 5D70L 3O41B 1QR4A 5IVXE 1OW0A 3MBXH 4TTDC 4Y2DC 1JMZA 4GW5A 5T1KA 1AJ7H 4TOYH 1A3LH 3K1DA 3O2DL 4Y8AA 3SDYH 3BKCL 1ZLSH 2VISB 4ISVB 1MRDH 4P9MH 1SYSA 4OD3L 2X4UA 3QZWB 4NIKB 4U49A 1QBMH 1GGYA 1I4FA 4MA8L 1XF2B 4PY7B 4WTXA 4MB3A 1BD2D 5DDHA 1N7ML 3NABL 2EE9A 2QTEA 2UZIL 1AE6L 3WO4C 5GIRB 1EO7A 2DJUA 4Z7UB 3U7WL 2H9GB 4HUNB 4NQTA 1INEH 2XFXB 5INDA 4Q0XH 1RURL 2GUOA 4DZ8A 1W2KT 1KLUA 4FQQA 1FZKA 5A40E 5B39A 2PR4L 3FQRB 1RJLB 4PJEA 3BDBA 4U6HB 4XWOC 2Y07L 3GIZL 1A7NH 3LQZB 1Y18A 4NQCB 2IGFL 2ICWA 3OF6A 4XH2B 5IEKB 1FH5L 3LQAC 2G9HB 5FKPA 4JFED 1I9JH 4XMPH 4AM0A 5HYQA 1MCSA 2DI8A 3ZSTA 2XKNB 4NJ9L 1IKNC 5BOPA 2PO6B 3ULUD 3Q6FA 3C09C 2EDNA 1OP3K 1HZHL 4XP1L 1F6LL 4XI5D 1PDKA 2Q7YB 3PV6A 1P7QD 2X4SA 4AIZB 1NBVH 2GIYA 3X3FH 5BQ7B 3C6SA 1QSFB 5J1AB 5C0BA 3RWFB 3O8XA 3V4PL 1CCZA 3VXNA 1NDGA 5FB8B 4XNUL 3MTRA 2J8UF 2ZG1A 2D9QB 3HZVB 5J6HB 1IAII 3CPLB 3ZKMC 3R8BB 1R5VB 3FZUC 4YX2H 4KQ4L 3RI5F 1Q9WB 3ARQA 3A67L 3HZMB 3C8KB 5JMOC 3D0LB 4DKDC 1IFHL 1NKOA 2EDEA 3HC0A 5BO1H 3ALXA 1R5WA 1EHLL 4XNXH 4IMKC 4GKOA 3K8KA 4CN6A 3L9RB 3UYRL 4HG4J 4L5FL 1RUML 3GZKA 4IRJD 4L4JA 1FVCB 3QWRA 5IK3A 1U3ZA 3PNWB 2XZCH 4I2XB 1YJDC 5FGCE 3QXAA 1M05B 2H8PA 1CK0H 3UTPE 4HS6B 3S3SA 4AZ8A 2XV6B 3MBED 5I1GL 2F19L 1E28B 4P4KD 1T5WA 3L3KA 3MJGX 3IDYB 3KYKL 1AD0A 5C0CB 3E1F1 1NAML 4R97C 4X6EA 4GAJL 5TH2A 4I0PA 3WHXA 3DURA 1BQLL 1S3KL 3PGCB 3I84A 5DRWB 4KVNL 3O6MH 3W0WE 1M7DA 3BWUC 1I3UA 4X6CA 1MWAB 5ALBL 3VFOA 4K7PH 3EO1A 3VFMA 3BGAA 1DE4B 3MFGB 4G9FA 2YEZA 2X10A 3SCMB 5HYEA 3UBXB 4K8RC 1DFBL 4PIRF 2FEEI 5DQ9A 1J88A 1UWEH 2VXSH 3ZDYF 4NDMA 4TNVK 1NC4B 2Y06H 5DURB 2XICA 4XWGL 3RZCA 1G1CA 3O0RL 4PLOB 4P4RA 3OXRB 4DW2L 2LVEA 5C2BL 2NY6D 4JFHD 3I6LD 2VXQH 2R0WH 3OGCA 4F33B 1N3NB 4PR5B 4TVPL 2YD8A 3BPNB 4NO3B 4YPJA 1B4RA 3EKCA 3MLRH 1U8JB 4ZODA 3VFUB 4PG2C 2DQEH 1KIQA 3FFDB 2CGRL 1AR2A 5ISZA 5TDPA 1MJJB 1BMGA 5FYKD 4UTAL 1FAIH 4NQDA 4KKLD 3KWWB 1RIVL 1JE6A 2HWZL 2GCYA 4KZEH 1NUNB 3ES6B 1KIPB 3S37L 5CKGA 4EUPH 4MXVE 3GJFH 5TE4H 4M7JL 3MO1A 1W0VB 4S0TD 3UTSE 3GHBH 2EDQA 4U1MB 5A16A 5L2KA 3WNNA 3MPCA 4GH7B 1F3RB 2YXMA 2NY3B 5E9DA 1MNUH 1FJ1B 4C56B 2PCPB 3RUGF 4PJIF 2H45A 4NSKB 1T1WA 2FX8H 3TV3L 5E2VL 1MCIA 4KUZL 2RIKA 3O11B 4GQPH 4TUOB 4L9LA 4PRNB 4LEOB 2LVCA 2VLJE 5A2IH 5KVEL 3FFCD 1J1XL 4PUBL 4WJ5B 1KCLA 1QLRA 3QUMA 4KY1H 4OLXL 4OF8A 5ILTL 4IS6B 1QQDB 3IAGC 1QA9B 3MOAL 5CP3H 2OYPA 5L2JB 4PRIA 4P23D 3MRRA 3SKNB 3VGAC 3H9YA 3GSQA 1DBAL 2Y23A 3O9WD 1C16A 3ZTNL 4HPYL 5D9SB 4HIJB 4B7IA 2R4SL 5EZIL 3D48R 3GB7A 1R3KB 1CGVA 1DLFL 1R24B 5ANME 1FFOA 4MVBD 4A2MA 4HD9A 4JHWH 5C0GA 3JUZA 3KJ4C 1N4XL 5ALCH 3CXHJ 2MCPH 3V8OA 3L95A 3AVEA 4KV5F 4WUUE 5I71B 5I1EH 1A7RL 3O6LL 3QDJB 3NCBB 3PDDA 3HPJB 3MRMA 5DC4B 5E0QA 4OCWH 4QKXB 3DX9B 1OGAA 3CC5A 4V1DB 1IAKA 3ZDXE 5IHBA 1NGZB 2AP2A 4AL8H 5F89A 4I3RL 1WWBX 4OIIH 1G7PA 4MZ3A 3WEXB 1L7TH 3STZA 2K7PA 1G9NC 3QR2A 4OFVA 3SGEI 1CD1A 1JP5A 1VFUA 2QHRL 3ARED 4KQ3H 5C3TA 3RDTA 5KSUB 4IJ3C 4URTB 5L6YL 3TIDB 4LARH 4LSPH 3HCVB 2X89A 4JR9H 3MV8D 1NKRA 3BVNB 5GSVA 1ORQB 4P5KB 4OCRH 2FLBT 3O2VH 2NY4B 2VXTH 3QQ4A 3KPLA 4KI5F 1MCPH 4S1QH 2A1WL 3FB8A 4QHNB 4C59B 1MREH 2O5YH 5FCUH 1R3JB 5CHNB 3BYYA 5E8OA 5DQJB 1RZFH 5HVHC 3IAQA 5K9KA 1D5MB 3EFDL 1BIHA 1NAKH 1ZT1A 1OAQL 3BHBB 4FZEL 4LSSH 3WJJC 1MJ8H 4KUCF 35C8H 2IPTH 4JM2F 3NACL 1B90A 4LEXH 5DD0H 5KSBB 4NUGH 4L8CA 3S96B 3HE6B 5I75C 3PF2A 4MNHB 3PGDA 1LE9A 2BCKA 3MFFA 5H35B 1H0DA 2Y1VA 1JGLH 5CBAA 3DGGA 5F7MC 5ADOH 4ZXBB 5FHAL 1T0MB 3SDXF 4KU1A 1YEIL 3O9WC 43C9A 3IDMA 1LP9F 2JB5H 4KJPD 3LS5L 3VXME 2FJHB 4JPVL 4I3GA 1DUZA 4EBQL 1V3KA 4HGKC 4UUJA 4I3SH 4UQ2B 4YHLL 4M62H 2DIAA 3W39A 5FM5M 1TQBC 4LLWB 5HBBA 1UEYA 4JLRA 4JQIH 1JV5B 3W11C 3BH9A 4LDOB 2OP4H 3MNVB 2XPGB 3F58L 3CSGA 4XPFL 4WFED 1CVSC 4QRPB 2WAHA 4XB7A 4JO1H 3IFNL 2A83B 1UM6L 1S78C 1U8OA 2YA1A 3VFRB 2ZOKB 1AFVH 3P4NB 2J1KA 2IMMA 3I6KA 4JN2A 5MI0B 2Q86A 2OL3B 1KENH 4Z0XB 2FGWH 4GUPB 3DX6A 2N1KA 1ZXQA 2OQJA 1FNHA 5CGYC 4BH7B 1M4KA 1FPTL 4B5EA 3MJ7A 1KPRA 1FZJB 2DAVA 1TZIA 1KIRA 2APVA 2ZWLT 5IB4B 2UVEA 3D3VD 4ERSH 5D72H 1NMBL 5D7IB 1J10A 4PY8I 3MA7A 5EU7E 1AQKL 2VR9A 2VDOL 5DFWH 1ZMYA 5FYKU 4YGAB 4MNQD 4BFIA 4LCWD 5CSBA 4X5LA 1WWCA 1A1MA 3TVMD 3CLFH 5E6IA 2OI9C 3T0DA 2ZCLL 4F7CB 4CN1A 2XWTA 4POZD 2XOTA 5DJYA 3MRJA 4KHXL 4KRPB 4J1UB 1N6QL 1IT9L 4X9BA 4F9LA 5E08H 5JW5A 3WCYA 1G7QB 3GSNB 2WLZA 1ZLVK 1S9YA 1JI1A 2G2RA 2BP3A 2X9XA 1HSAB 1KGCE 4HUKB 5C0IB 1FGVL 2WNGA 5EIQA 4OJFH 1CDGA 3WJLA 3VW3L 3PDOA 1WAAF 4N8CL 2MCG1 2VDLH 4JRYE 4POUB 4XCYB 2FJFB 4D0BA 1ZK9A 4JZNB 4YDVA 2P7TA 4LLQA 2XZQH 1II4E 1XT5A 4OM0H 4UDUB 3T0EC 4X99A 4OCSH 1ED3A 2EE2A 4GXVL 4LKXA 4HF5H 4YNYA 2VTFA 1VACA 2CRIA 4NRZA 2CUMA 2DLTA 4PBXA 5T3ZH 3TBVA 3GSVA 5LQBH 2AI0H 4G7YH 4ODXA 3MRLB 2O93L 4ZUWA 3TWCL 4HXAL 1VHPA 5LAXA 4UB0L 3NIGF 3U4BH 4ODTH 3TT1H 4Z18A 3N9GH 2K9UA 1ZHBA 1DVFD 2OTPA 1NCUA 1K4DB 4GAYB 4JFOA 2QQLL 2C1OA 1RU9L 3ZT6A 2R2HB 3FRUB 2BY0A 2XZZA 5C08B 3L5XH 4K07A 2CJUH 2O26U 3GK8H 1WZKA 2J6EH 1S5HB 2YUWA 4JFEA 3WN5A 1BGXH 1T5XB 1DBKH 3MLVH 4Y4KC 5MENB 1IEAA 3U1SH 2MPAH 5F1OB 1DP0A 5HHMD 3O6FC 3GBLA 4LNRA 3FQNB 4YC2B 3UYPA 1YDPB 2C3VA 4I18C 3U6RB 1G6RB 5HHOD 3O6KL 2X4RA 4R7NB 5JLZA 2BOCB 5J11B 3V79C 2GQHA 1V8HA 5C0EA 4IBLT 2FD6L 1ZS8B 2VXVH 4PJ8B 2VWEC 3PHQB 4R2GC 4HIIA 1NGWB 1CFVH 1PKQA 3GKZA 4FQHA 3HG1E 1FV1A 5K9OA 4P99A 1XZ0B 2ZUYA 1MCWM 2YPLA 1DANU 4XAKE 3C5SB 2R1WB 3L3HB 3BW9B 3GSXA 4HUWA 4OCYH 2Y36L 3E6FB 3MRPA 1OTSD 1ZT4B 4EDWH 4FQCL 2YWYA 3V4UL 4ELME 3MV01 3QA3B 1IM9A 1FYTD 4Y88A 5BXFB 1AP2B 2AVGA 3QIBA 4LLUB 4MWFB 2WWKT 5DYOA 4Q6IC 1NH6A 3NCMA 3H9SE 4GG6F 3TBTA 3HAEB 1FBIL 4P2QB 1R5IB 3GO1L 4UI2A 1JPFA 3E2HB 5BZWA 5FOBA 3E6HA 3WFDH 4I4WB 2V5RA 4LCCA 4IRJA 4PRHD 4QRRD 3QSKB 2W9LA 2RR3A 4NKMA 3WLWD 1ZVSA 1OP5K 2C1PB 4C57C 1KJVB 3QEUA 4YDJA 3RVUC 1J8HD 3MBEA 3WKML 1Y0LA 1VKXA 3V52L 1FGNL 2D7NA 1Z3GH 4YH6A 2DQDH 4QOKE 1MCLA 4P4KA 4JZOB 3WLBB 5D96B 4QNPF 2BNQA 3VXSB 4YPGB 5FDWA 5IB5B 4U4BA 3QDAA 1H3PL 3LKRB 5DQDL 1FIEA 5BRZD 2FIKB 5AD0B 1V3MA 3W81A 5IQ7H 1INQB 2H32B 4L8DA 4LPTA 3BPOB 4IMLB 2EDKA 3U0WL 5DWUH 4FQ1L 2R29H 3RBSA 4CN4A 2X4OA 1B0WA 1JUFB 3CLEH 3FONA 4D94A 2VL4A 1UWXK 4R0LC 4HWEL 2J2ZA 2X4NB 3P40A 2XY2A 1C7SA 4OI9A 4Y19D 4KJWD 1N2RA 1U95A 4XXDA 1CE1H 5I1KL 4AEEA 2PTUA 1MI5B 1E4KA 1JNNL 1J12A 3H9HB 3MREA 5FUOH 4JG0H 3CMOL 3DXAB 4LBEB 4DVBA 4YDKL 3MRIA 3SPVB 1YQVL 4PLKC 3QXUA 5BW7C 1N8ZB 5AG8A 4JHAH 3H9SA 4KK5D 3UYOD 2BRQA 5BOZG 5DS8B 5EWIL 4KDTC 4G80A 3HNSH 1UACH 5C07E 1XGQB 5E56A 4GW5B 5T1KB 1OW0C 2WUBH 4U0RC 4YXLH 3G6JE 4OFKA 2NY5H 3LCYA 3MGTA 1SYSB 1I3GH 2X4UB 3L7EA 1B6DA 4HIXL 1KJ2H 1I4FB 1C5CL 4ODUA 1MFAH 4N5UA 4TSAH 3PE9A 5DDHB 4NN6C 2VLME 4KTYA 3N06B 4XCCL 5FYJE 3V6OE 3QNXA 4X4YA 4LLDA 1OOAA 3QFJE 1ZOXA 4MZ2A 4Z7WF 4YLQT 4W6WB 1I1CA 1XF3A 4MNGA 2WP3O 5INDB 1AIFA 3D9AH 1KV3A 1VA9A 1ZVHA 4D8PA 2GUOB 3IDIA 3OXSA 3FFCA 1KLUB 4DZ8B 4FQQB 1FZKB 3B9EA 2VIRA 5B39B 1N0XH 4PJEB 1K8IA 3KPPA 4R8WH 4TSCH 1Y18B 4Q9RH 2X40A 3EFFB 3OX8A 3SDYL 1ZLSL 2ICWB 3BQUD 4P23A 1MRDL 1P2CA 4E9LA 5T1LB 1CFNA 3ETBF 5FKPB 4GRWB 1F3JA 3QWOA 4AM0B 3MRBA 3WV0A 1YMMD 1N5YH 4UV4L 4AT6A 4LSUH 3V4VH 5D2LA 3DO3A 3Q6FB 3GBMH 4PYHA 1ZSDA 4YHPA 4KGJA 1G0YR 2BSED 3QT2A 4JFFA 4L4VE 4CVZB 1P5VA 3PV6B 2X4SB 5HD8D 4LPXA 3C6SB 5C0BB 3O8XB 3VXNB 1INEL 1NDGB 4HBQA 1F97A 4AQ1B 2JELH 4Q0XL 3CH8A 3LD8C 4J3OC 1LO2L 2EDDA 4PJAF 4P3CL 3WS6A 1OTUC 3ZKSD 1A7NL 2BSTA 4KK5C 5BV7B 4X7DC 1MFCH 2B5IC 4PRBA 4MD0A 3AREA 1I9JL 3GMOA 4XMPL 3BKYL 3HC0B 1OM3L 1R5WB 1MCJA 1KCVH 3AMLA 1OP3H 2IQ9H 3TN0D 1ROWA 1PG7W 2VQ1A 3CFKA 1NGXA 3MV8A 1SY6A 3ARYA 4ZSOE 3W82A 4G6MH 3DV6A 3HPLA 1X9QA 5IK3B 4FTVE 2BY1A 1L6ZA 4OCLC 1NBVL 3QXAB 3X3FL 3UPCA 4ELKA 2H8PB 1D9KA 3MYZA 4LU5H 4LLYA 3VGBA 5TDNA 3V6ZA 3S6CA 2DM2A 5TE7L 4BZYA 5CGMA 2R4RH 1T5WB 3U79A 3L3KB 5LKNA 4K3JL 4YDLB 1AD0B 4YX2L 3SE4C 2AABH 1HWHB 1PX3A 3DO7A 1A22B 1YC8A 4HXBL 5TH2B 4I0PB 3WHXB 4MLIA 3ZHLA 5BO1L 1M7DB 5TFSL 1RIHL 4X6CB 4JB9H 3VFOB 3TCLB 3EO1B 3KPOA 3VFMB 3VFNA 5F7YC 3BQUC 4G9FB 2YEZB 2CDEA 5TPWL 2FZ3A 5IBLD 1MCCA 2XZCL 3B9VA 5DQ9B 5J7CC 4M4RA 4NDMB 4X6BB 2IPUK 2VZUA 2W0FA 1I85C 1XF4A 3AXLA 4HUMB 1KT2A 3RZCB 4NN7B 4K9EH 4P4RB 5FM5O 5SWZE 2DF3A 3ECBA 5EBGA 3N1GC 4PJ7A 4U6TA 2XRAH 5JOEA 1BX2B 2NMSA 4TVPD 3OGCB 3RIAF 2NX5B 1EVUA 3LIZH 5F3BA 5EZJB 5H94A 5CZXC 2CDFA 3FMGL 4ODHL 4MYWB 1H5BA 3QUYC 4PJGE 1KIQB 5C92A 3TJHC 1KCRH 3MRHA 5ISZB 2UWEA 4TPRL 3RPKA 5DVLA 4U1HA 5TDPB 4OZFH 2CPCA 1X5AA 2F5AH 4QHLA 4W4NA 4NQDB 2DOCA 4PJBF 5IKCA 4UIKH 3ORJA 2GCYB 1BWWA 4KK6C 5DLMH 4Y4HD 3U7YL 4KROD 1UWEL 1W72L 1MJUL 3MO1B 2COQA 3GSWA 1KC5H 4UOJA 5T5NG 1J5OL 1FE8H 5A16B 5L2KB 1UT9A 3VWKD 4J4PD 1OCWL 5E9DB 3X14A 3LY6A 1B4JL 2GAZA 4LVEA 4P2RD 1F58L 1T1WB 4L8SA 2R0WL 3FN0L 4JQVA 1UXWA 3U4EA 4LLVA 4MNQA 5D7JD 3D5OF 1YPZE 3H42H 3AU1B 3QNYA 2F54D 4LCWA 2ZUWA 8FABB 2R8SL 4ZTPH 3TVMA 2DQEL 4EZMA 3RWDA 1BZQK 4LCIL 1ZAGA 3T3MF 3OHXA 3DI3B 5J13B 1FAIL 1QLRB 3QUMB 5I0DA 1MLCA 5A1AA 2GEEA 3AB0B 3IXAA 2ESVE 2NPLX 4PRIB 5CZVH 2W59A 3MRRB 3GSQB 5TE4L 1C16B 3GHBL 1M6OA 2EIEA 2VSDA 5JQ6H 1HK6A 3GB7B 3T65A 4KJQD 4MA3A 2FSEA 1CU4H 4HK0A 4IOFD 2FX8L 1FFOB 2EE3A 4LSVL 3CVIH 3EGSA 2WBWB 3CJJA 5E00A 1LMKA 2XIDA 1MCWW 4X6DA 5E03A 3L95B 1G7HA 2F15A 2Z8RA 3WS3A 2OR8A 1IAIM 32C2A 2ZOLA 2APBA 1OGAB 3CC5B 1RZGA 5DC9B 4GBXD 5F9WB 1IAKB 1QFPA 5EC2A 3K80A 4MAYC 2YRPA 1CQYA 3QXWA 4GW1A 5L88H 5F89B 1T83C 3FHQA 1G7PB 3QRGH 4XCFH 3STZB 4GS7C 1CD1B 3RDTB 3QUKA 1DVFA 4A6YA 5FYLH 1BAFL 3ARVA 4HPOH 4F7MA 3ZLQC 4Y4HC 3OKYA 3VXRA 4ZD3H 5GSVB 5D1ZC 4JHWL 3RHWF 3KYAA 3RX7A 3KPLB 4KKCD 3VWKC 4JAMA 4OCNC 1N26A 2MCPL 2NY0D 4I0KA 3QEQE 4YUEH 2YMXL 3LEVH 3KS0H 3OR6A 3FB8B 5CD5D 5I1EL 5KVDH 2YBRA 4Z77A 1F45A 2WZPD 4OCWL 5D7JC 5E8OB 5HHOA 1UWGH 5K9KB 3GMLA 3QJHB 1SQ2N 2ESVA 2G60L 4QHMA 3KS0J 1JYXA 3KLHD 1ZT1B 1JWSA 2MTPA 4AL8L 3CAFA 4OIIL 3UPAA 4AG4H 1L7TL 5FCSH 4U3HA 3EJZC 1LO4H 3THMH 4LNVA 5AG9A 4KQ3L 4L8CB 2C3XA 4H1LG 1WZLA 1LE9B 1HH9A 3MFFB 5D8JH 1S8DA 1H0DB 1KEGH 4LARL 5CBAB 3DGGB 5F72S 4JR9L 3HC3L 1NSNH 4OCRL 1JHLH 1FYTA 43C9B 2DLHA 3IDMB 3L3OA 5EO9A 1DUZB 2W91A 2J12B 4XP6H 5I0ZA 4UUJB 1MCPL 4KJQC 4KK9D 3W39B 4OFDA 1MREL 2O5YL 3DHJA 4U6XA 5FCUL 2J8UE 4JLRB 1RZFL 4LPYA 3VD4A 3P11H 3BH9B 4PRHA 4M4PA 4QRRA 4O02H 5M7QA 4CDGC 3SE3A 4PJ5E 1HYSD 4LSSL 2O61A 3Q5YA 1MJ8L 1U8OB 35C8L 4IDJH 2IPTL 3QUZC 1RZKH 2EDOA 3W9EA 3GI8H 1UB5A 1X5XA 3I6KB 4JN2B 2VERN 2Q86B 4LSTL 4R3SA 3PHOA 1JGLL 1BOYA 3DX6B 4XXCA 5ADOL 4EDXA 4H8WH 2OQJB 2PYFA 4H1LA 5BRZA 4L9DA 1KPRB 4MA1B 1TZIB 1KIRB 4Y4FD 1BEYH 1WC7A 4M62L 4OGAD 1YEGH 3PWPD 5CINL 3ZE0F 1DDHA 3T3PF 3MA7B 4JQIL 2YKLH 3OSKA 1CT8B 2GJJA 2OP4L 3LZFL 5IVNA 1IGML 3C09B 2Z31D 5HVGB 4BFIB 4JO1L 2QSVA 3ZYZA 5E8DL 1A1MB 5E6IB 4GLRH 3B5TA 5BZDA 1FDLH 2D31A 1I1YA 1EV2E 3F6LA 3OJVC 2XWTB 1NBYA 1ZANH 5JPMB 3HLAB 3QUXC 5DJYB 3MRJB 5JIHA 3T2NH 1KENL 3NVQA 2FGWL 1S5IH 1J05A 5JW5B 3R0NA 2ZUTA 2DI7A 4HW6A 4M61A 4YXKL 1DBJH 4JRYD 4N0UA 5GRZA 3ZDYE 1S9YB 2KDGA 1ZA6A 2NXZD 3QB7C 3BSZH 3MV7D 3RA7H 1SEQH 3F8UB 1QBLH 1RUPL 2YN5A 5D72L 1JPST 1PSKL 3O2DA 3MRQA 2DQJL 1TQCC 1WZ1L 2D7TH 5D1QD 2WW8A 3T4YA 5SX4H 4Z95H 5GRYA 3K3QA 4JO3L 3GKWH 1H3VA 4F3FA 4YDVB 2P7TB 2YUXA 4LLQB 5DJ0A 1CWVA 4X99B 1CGUA 1BD2B 1ED3B 4LKXB 2FB4H 4YNYB 3Q1SH 4JREC 3BUTA 4M6AA 1VACB 1ZLVH 4NRZB 5ACMA 2EXWD 5E08L 1MHPH 3TBVB 3GSVB 3JV4A 4D9LL 2G5RA 4ODXB 1WIPA 4ZUWB 1CLOH 3WE6A 4PJXE 5LAXB 5EU7C 5I1IH 4FNLH 1KCKA 3WNMA 1GPOH 1ZHBB 1AY1L 4XHJD 4JFOB 3RUGE 3V5DA 2C1OB 4ZFZA 4PJIE 3SO3B 4X8XA 1EGJH 2NY2D 4WWID 2QADB 2CUIA 5HPMA 2E7LC 4OGAC 3MX0A 4JFEB 1Y6MR 5ESVA 3WN5B 4WO4D 3HG1D 1IEAB 1IC7H 1YMMA 2XZQL 5E2UL 2X41A 2Y6SC 5F6IC 4OM0L 3HHRB 4MXWH 3RL2A 3SGKA 4QXUH 4LNRB 4WFFE 4OCSL 2C3VB 2EDYA 3C5ZD 4FMFA 2KZ1B 3QWQB 4BZ2H 2X4RB 5JLZB 5BJTA 5I1CH 3WFEH 4M9PA 2H2SD 5C0EB 2AJ3A 3ARFD 5T3ZL 5LQBL 4G7YL 4WWKC 3HFML 4J3UA 2AJVH 4WI3A 2F58H 1PKQB 5CJ8A 1FV1B 5K9OB 1WBZA 3U4BL 4QCIA 3RWCA 5JOPE 2YPLB 2BNUA 2VDMH 3N9GL 3X3GH 3GSXB 5JZ7D 4HUXA 3T2QA 3EYSH 4PB9L 3MRPB 3CDGA 4JDVA 4RIRA 5JQHC 1LEKA 3BH8A 2D7QA 3L5XL 1IM9B 2CJUL 1U8HA 2J6EL 3ARUA 3QIBC 1XFPA 3LN5A 3A0OA 4M9OA 1DBKL 5CGTA 4KV5E 4Z6AT 3TBTB 5GRJH 3RQ3A 2MPAL 3U1SL 1FSKC 4LRIC 4NC0B 3TN0A 1JPFB 5HYFA 3NZHL 5BZWB 5FOBB 3NCJL 1TTGA 3RTQD 4IRJB 1W8NA 4I48A 5H2BA 4LCCC 4JRXD 1NEZG 4NKMB 5I6XB 1ZVSB 2VXVL 5KG9A 1H9VA 1YJDH 5JNYA 1H3GA 5KSBF 1A4KA 3QEUB 4NWTH 1J18A 1DLHA 3LPWA 3MBEB 1VKXB 4EI6B 3BGMA 5F9AC 1KLGA 2EXWC 4P4KB 2BNQB 4OCYL 4OV5A 5FDWB 3ILQD 1RK1A 4JFDD 4UBDC 4YGVA 4MB5A 2UYLA 2VMFA 3DSFH 5SWSD 4KI5E 4L8DB 3T8XA 3FL7A 3VRIA 2W92A 1GJIA 1RVFH 2X4OB 2QV2A 3FONB 3EOTH 1E4XL 1OP5H 1GAFH 2E7CA 2RGSA 2V5YA 1N2RB 4JDZA 1U95B 4XXDB 3O4LE 3RWHA 3JTSA 1CDUA 5C0FA 4K8RH 1JGDA 3VU2A 5GRVL 2CKBL 5J06A 3U30B 5I8EA 3UTTE 3C5ZC 1K9TA 1NEZA 4Y1AA 3MREB 2HTLC 4GO6B 1Z3GL 4DVBB 2NY6B 3MRIB 1IZKA 3HC4H 4HZLA 1NL0H 3HA0A 2VR5A 4L8BA 5J56B 3QI9C 3SDXE 3T0AA 2DQUH 4DGVH 5E6YA 4G9DA 4FQLH 1VEMA 1UKSA 1LP9E 2P24A 1IL1A 1EUUA 1FL6B 3MLUL 2YD7A 4G80B 2BK8A 5DWUL 4HMEA 1S9KC 1TPXB 1I9RH 3WKMH 3CLEL 2MQ0A 4TUKH 3EZ8A 3AROA 5HI3D 3TA3D 2V2XA 2X1WL 2VLMD 3S5LG 5T33H 3KPRD 1MHEA 4DN3L 2V2TA 4BUGA 4ETQA 2C3GA 5LWYH 5HHXL 2XWBB 3L7EB 4Q9QH 3CZFA 5C0AE 4ODUB 3FQWA 1OVZA 4J4PA 4RISH 2B7DT 2DJ4A 2X6MA 5FUOL 3IS0X 1AO7A 4P2RA 4L3EE 3QNXB 2ZUQC 4X4YB 4LLDB 2F54A 4LK4A 1XF3B 1OF2A 1VCAA 4MNGB 1AIFB 5H37G 4D8PB 3IDIB 3FFCB 2WP3T 2VIRB 1MEXL 5CEXB 2PW1A 1K8IB 1FFQA 3KPPB 2WUBL 3MOBH 4CAGA 3OX8B 4JFZL 5GGTL 2YRLA 3HMXL 4P23B 4O5LH 2NY5L 4OTXL 5F44A 1P2CB 1I3GL 1CFNB 3S5LA 2AXJA 1F3JB 3QWOB 1KJ2L 2VH5L 2AK4E 3MRBB 1MFAL 2GTZA 3QCVH 4OLWL 4AT6B 3FN3A 4XGZA 5D2LB 5GGRY 1ZSDB 4ORGA 4YHPB 1AGEA 4NQEE 4JFFB 2BXYA 4DEPC 2Q8BH 4DQOH 5B21A 1ACZA 2Q1EA 2I60H 2IBGA 3NPSB 1VEPA 4XNYH 4I1NB 3MLSH 3QG6A 3WIHA 2K1MA 1KB5H 4Z78A 6FABH 3BRGC 4TSCL 1JGEA 3OV6A 2BSTB 4GBXA 1U8QA 2VXUL 4NCDA 3TIEA 4Q9RL 1H8OA 5SV4A 4UT7H 1S7VA 1A9EA 4FTVD 3TZVA 4PRBB 4WHCA 4MD0B 4CBPA 1RZJL 3AREB 5HI3C 5FECA 1G9NH 3GMOB 1WICA 1YEEH 3V6OC 3LKOA 5GRUH 1BZ9A 2NZ9C 1JL8A 1YN7A 1N5YL 3V4VL 2VQ1B 3CFKB 1H3UA 4NFBA 1NGXB 1A3RH 1BF2A 3MV8B 3JV5A 3T2PA 1U58A 1BHGA 4L3CA 1WWWX 2WQRA 3DV6B 1XGTA 1KNOA 2VLKD 3C6LD 4R4NC 1NUFA 2XY1A 5CCKL 3F7VA 5F88A 2PW2A 4LPCA 4FQIH 4LVHC 4ELKB 1N5AA 3PV7A 1D9KB 4WW2A 3NIGE 4WV1C 3SDAC 5TDNB 3V6ZB 5HHVH 5FXCH 2JELL 5HVFB 5HI4D 1X5HA 4P2OD 3KXFD 3OB8A 5T1MA 1GCFA 2P8LA 4TVSa 1CQKA 1J1OH 2AK4A 3E3QE 3DO7B 4OZGF 1MFCL 4P48A 3KHQA 3DMMD 3K1KC 3SQOH 5DK2A 1KCVL 2IQ9L 3TP4A 2VDKH 4Y16D 3KPOB 3VFNB 1ZGLP 1CFSA 1TNMA 1NDMA 5CUSL 4G6ML 2FZ3B 4QYOA 5KANI 1TJIH 2W0FB 3KHOA 1VSCA 2AJUL 3EDEA 3AXLB 1XF4B 1KT2B 1YC7A 2I27N 4M5ZL 3I3DA 3RAJL 1E6JL 3ECBB 1WTLA 4PJ7B 1OD9A 1WAAA 3FN9A 4GAGH 3VG0H 1KACB 1TXKA 5J12B 2R4RL 3G6AA 4JFXA 3GMNA 3PUCA 5T5FH 5F3BB 5H94B 4F7PA 2CDFB 1PEZA 1NCDH 4UT6H 5CIPH 1H5BB 2FBOJ 3HI1A 2X9YA 5I66B 2WBJA 2DDQH 1VFBA 3MRHB 2UWEB 4KXZI 4U1HB 4MJIE 3LKNA 3DPBA 4JB9L 4QHLB 1QRNA 5IKCB 3ET9F 4GFTB 4PTTA 1CR9L 2RQ8A 5I76A 3LEYH 4EKXA 4Y4FA 5BS0D 3GSWB 4AEIH 3D3VB 3PWPA 1C08A 2EDTA 4K9EL 2HFGL 3VXUA 2CK0H 3X14B 4Z7OE 4NKIH 4FFYH 2GAZB 5EU5A 3KYOA 2XRAL 4QNPE 4L8SB 2KQMA 1UXWB 3U4EB 3BZ4A 1NFDB 4LLVB 4MNQB 2Z31A 3LIZL 2BY2A 3QNYB 4LCWB 5LJYH 1YYMH 4DOHE 3TVMB 3RWDB 2CD0A 2CUHA 5C09A 1V7NH 1F5WA 4NT6A 2J8HA 3HRPA 3OHXB 2CLVB 3ISWA 5ITFA 1MLCB 4UIKL 1UA6H 3IT8D 3DMMC 3IXAB 4HCRA 3MJ9L 4YE4H 2GJ6D 1KC5L 5DO2C 5HHPA 1FE8L 1M6OB 5EOCH 2GK0A 4IRSC 3RY6A 4NFCA 4MA3B 2FSEB 4HK0B 5DUBA 1Q38A 2ITCA 4HMCA 1U9KA 3HZYA 4M6ML 5D1QA 3EGSB 3CH1A 1EUTA 4FQPA 5E00B 4X6DB 4AQOA 4GG6A 4ZQKA 3QNZB 4ZTPL 3VA6A 1HHIA 1G7HB 2NLJA 3C2SA 3WS3B 2CLZA 1QEWA 3W2DH 4PJEF 32C2B 1WT5C 5DA4A 2ZOLB 2D2OA 1RZGB 3L5IA 2EDJA 1U41A 2BC4A 1JWUA 5EC2B 2DWEA 4LP5A 4GW1B 3QDMD 5CILH 4GRMA 2QKIA 3QIWA 4I13B 4JKLA 5CZVL 2GKIA 4GRWF 1ZE3C 5I18H 4HGMA 4MJ4A 5LVEA 1GGBH 1Z9MA 2BJMH 3QUKB 2ZUXA 3QULA 4KPHH 1DVFB 2IWGA 4CL7A 4TRPL 5ACLA 4A6YB 1XF1A 1CU4L 1WIUA 5LGHH 5CFHA 2EICA 4N1HB 4E5XA 1U8PA 3VG9C 1PVHA 5IOPA 2W0LA 4Z7WE 2XN9A 4PP1D 4NZTH 1I8MA 1JYNA 4WO4A 4OLYL 3OR6B 5HHMB 5I17A 2YBRB 3GSUA 4Z77B 1U6AH 2AW2A 4NPYA 5HHOB 4NQSA 3GMLB 1D5ZA 2IBZX 5EUOF 5DJ2A 1PZ5A 3ARFA 4LLMA 3BN3B 3D2UD 1CXLA 1JWSB 4K94C 3VDCA 1QRKA 5AYUH 3C60C 4XCFL 4OGZA 1DBBL 3VD7A 3MYJA 2RCSH 1HH9B 4QRQA 1S8DB 2HKFH 5FYLL 4HPOL 2VC2H 4ZD3L 4U1SA 1EO5A 3PL6A 1FYTB 3PGFH 3AAZA 2IAND 4PJ5D 3L3OB 3O3UN 4C83A 5EO9B 4OQTH 4PPTA 1UJ3C 3QQ9D 3WBDA 3LEVL 1BBDL 4GRLD 5KVDL 4U6XB 4GMTH 2DWDA 2AERT 2Z4QA 4XVJL 1Y6KR 4PJAE 1UWGL 4KKAD 4O51B 3RTQA 2BFVH 4E0RA 3OKKA 4M48H 1CD8A 4PRHB 5JXAH 4QRRB 1B2WH 1HH6A 5CEZE 3MJ8A 4Q6YA 1JNLH 1ZHLB 4NP4L 3PQYE 5C6WH 2EDLA 5L0QC 2O61B 4ZAKD 2E27H 4AG4L 3VCLA 3VWJA 4BH8A 1EEYA 1FRGL 3LRHA 3UZQA 3W9EB 1J8HB 4OF3A 1UB5B 4JY6A 3S4SG 1YMHA 5D8JL 3PHOB 1KEGL 2CXGA 3EYVA 5C71A 4EDXB 2BXZA 2PYFB 4JFDA 4H1LB 5E5UB 1JHLL 4LVOB 2UUDK 5BRZB 5HHQA 5I73B 1YEHH 3BD3A 4YHZH 5SWSA 4NJAL 3RKDC 1UADC 1WC7B 3P9MA 2L7JA 3FJTA 5DT1H 2DQIH 1UH4A 1A0QH 1DDHB 3TM6A 4B41A 3P11L 4MD4A 4RFOH 1PBYA 3O3BA 4O02L 2APXA 2ZPKH 1QO3A 1S7QB 4G6JH 1U3YA 1LQSR 4IDJL 1RZKL 5BZDB 1TETH 1J0HA 2D31B 1I1YB 4Q9BA 4HWBA 3RWEA 2XQYK 1NBYB 4PJHA 3LRSA 5CKAA 5HYIA 3BUYB 2WINB 4PGJA 1J05B 4H8WL 3HS0A 3S4SA 4M61B 3PWLA 2FBJH 2HLAA 1LDPL 1CGWA 2AS5M 4PV9A 4N0UB 1ZA6B 3WFCL 5E95B 1BEYL 2R2CA 5KVMC 1YEGL 4X7CC 4XAWH 4PRDA 5EUKA 2K3TA 4ZFOA 2YKLL 2H26A 3MRQB 3KPRA 3NA9L 3JV6A 4U7MA 2AJXH 4Q97A 3T4YB 3N85H 4K3HA 3BGFB 5GS1C 4F3FB 1FDLL 1DJSA 1E4XI 4MD5A 5DJ0B 4O4YH 1KULA 1X5JA 3ARDC 1MUJA 4BK5A 1ZANL 4EI5D 1KCSH 3VMNA 1FCGA 3EYUH 4PJBE 4O2EA 2DQTH 3UC0H 3WFBL 1RJYA 3JV4B 4EIGB 2W9DL 4O58H 3IDJA 3LH2L 3BSZL 3RA7L 1SEQL 1QBLL 4PGDA 4F37F 4H0IA 4XCEA 3OB0K 1TLKA 2ORBH 4WFFD 4PGCB 3CXDH 4M93C 4G6FD 3JWOC 5JDSA 4MQTB 3V5DB 1BECA 1DBML 4ZFZB 3WD5H 3VXPA 5HPMB 1CLZH 4Z95L 3KPTA 4YJZL 5HJ3A 1MHHA 1YMMB 2BSRA 3DLQR 3RL2B 4H20L 4ZS7H 1Q0YH 2NY7H 3IDNA 3Q1SL 4BFEA 5BJTB 3EO9H 5FFLA 3HR5A 2AJ3B 5T3ZD 2R23A 1BFSA 1KF9B 1CLOL 3RY4A 1WBZB 1DEEA 4QCIB 4FNLL 3RWCB 5I1IL 2BNUB 1AGFA 1GPOL 5JMRA 4ORZC 5DJ6A 4HUXB 1T7XA 3PP4H 1CF8H 4P5TA 1WCQA 3LEXA 4JDVB 4RIRB 1EGJL 5EZLA 1LEKB 3BH8B 4Z7UE 1S9WA 1I8IA 4TSBH 1G9EA 1U8HB 3CMGA 2Z91A 5D70H 4XT1C 3LN5B 1EJOL 2VDNH 2Z92A 3TN0B 4QXUL 1IKFL 4WU5A 4DKEL 2ARJA 5IHUH 2I24N 4BZ2L 3VFWA 4KK8D 4X4MA 4I48B 5H2BB 3VXTA 4NQCE 1A9BA 5DMKA 2F9BT 3GSOA 1AC0A 5DZNA 2VLKA 3C6LA 4MA8H 2IFFL 5KG9B 2YS4A 3K46A 5DJXA 5JNYB 2F58L 1GGCL 2EDHA 1A4KB 4LHUD 1DLHB 4U1GB 1B6UA 1DQDL 3RRQA 2V5TA 3BGMB 2VDML 4RDQF 3BFOA 1KLGB 4Z7VA 3VA2C 3U7WH 4P2OA 5D7LA 3KXFA 4OV5B 2AXHA 3EYSL 5ACZA 1RK1B 4AIOA 5I1JH 2QR0A 4YGVB 1RURH 2UYLB 2AV7A 4XNZC 3D85D 2PR4H 3B9KD 3T8XB 3VRIB 3UTTD 1KBGH 2DL2A 2DQCH 2Q76A 5GRJL 3ARBC 4OFYD 4Y16A 2QSCH 1YNTA 5IHLB 4ISVA 1FH5H 3SGJA 2HFEA 1J11A 4JDZB 5A2FA 2HRPL 1ZVYA 3JTSB 1LNUA 1F4XL 5C0FB 1VGEL 1XF2A 3JUYA 1YJDL 5I8EB 2JCCA 5F1KC 4G7VH 3EUUA 4NWTL 3T1FA 1NEZB 3ULVF 4N0CD 4Y1AB 1KFAL 2HJKA 1F2QA 1HZHH 4XP1H 3UX9B 1G7IA 2ZJSH 3RL1A 4ONOA 3VGGA 1QZ1A 3DIFA 5DMYA 1AI1H 4HZLB 4L8BB 3SDDD 2IEPA 3I6GA 4I2XE 1EK3A 2AJZA 1IRAY 4G9DB 5DK0A 1P4LA 2D4DA 2P24B 5I74C 1IL1B 5KOMC 5F3HA 4MA7L 1BOGA 2JK5A 5C0AD 4EUPG 3ARSA 1AQDA 4OGYL 4KQ4H 5DI8A 2NW3A 3B83A 2JJVA 3TC9A 1A1OA 1MWAL 1MAKA 2HA1A 1MHEB 1XCTA 3BPLB 5C0CE 2V2TB 4ETQB 1P4IH 3ULSA 4L4TD 1XGUA 3OQ3B 4K8RL 4KROB 3RVVD 4EQ3A 5BS0A 1QBBA 5DMIH 5IVZA 2PO6A 5KZCD 5T1DH 3CZFB 1F11A 3UYRH 3VWKB 3FQWB 4L5FH 1RUMH 1NMCB 1AO7B 4P2RB 1WF5A 5A43C 4BFBD 3HC4L 1NL0L 3OTTA 3SKOA 1QSFA 2APFA 2I9LA 2DQUL 3IDUA 2F54B 3E0GA 4KI5C 4LOUD 4DGVL 1NGYA 3IS1X 2VLRE 5I1GH 4MJ6A 1OF2B 5IFHL 3UEZA 5DJCA 4L29A 3KYKH 5E4EB 3ZE0E 1I9RL 3R1GL 3T3PE 1ZEAH 5HVWA 1NAMH 2PW1B 4GAJH 3UP1A 2FX9L 5T33L 4LQ1A 5AAMA 3NZ8A 1BQLH 5JW3H 1NUDA 1S3KH 3B9KC 4EUPA 3VRJA 1F6AA 3GJFA 3WXWH 4JM2C 1YEKL 3S5LB 3BE1L 2GJ6A 5ALBH 3V6FB 5IEHA 3ALWA 2GTZB 4W4OC 3CCHA 1TMCB 1JRHH 4XGZB 1DFBH 2DJSA 3WXVH 4ORGB 1AGEB 2VABA 4Z7NF 4XWGH 2B0SL 4ZFFA 2YD2A 3DVNA 3O0RH 1T80A 1LGVA 5E6ZA 4P57B 4N0CC 4LLAA 5C2BH 4FA8A 4S0SD 1T89C 4X5WA 1G9ML 3QG6B 3SDDC 4C56E 5KVGL 1CD0A 1FC1A 5LGJA 4BQ8A 4Z78B 3X13A 5H8DA 1JGEB 4GBXB 1U8QB 2P42B 3MOBL 3TIEB 3HMWH 3QDMA 5CP3A 4FXGA 3PWVB 1S7VB 1A9EB 2YOCA 3GBNH 1VGKA 4JM4L 4UTAH 3ZE2E 5FECB 3LN4A 3FOMA 1RIVH 1D7FA 5IESL 2HWZH 3LKOB 3ULUF 1YN7B 4X6FB 3QCVL 4HIEA 3SY0A 3IFLL 1U58B 3RVVC 4L3CB 4M7JH 3VI4F 1E4WH 1KCUL 1XGTB 2Q8BL 1KNOB 5DZOA 4DQOL 4EN3C 4KZDH 3F7VB 2VDPH 5F88B 2PW2B 3GM8A 2HRLA 1BQUA 2NY0B 1N5AB 3AY4C 4OCMC 3AM8A 2X2YA 5F1SA 4TYUA 4WW2B 1QFUH 4ONHA 4U2YA 3QISA 3TV3H 4M3KB 5D71L 1KB5L 5E2VH 2VLLA 5L8KB 2XYCA 6FABL 5T1MB 2R0ZL 5JA9A 2P8LB 3D2UA 3EYQC 3PP3H 4UT7L 4AJ0A 5KVEH 2LABA 1J1XH 1HN1A 3QDJE 4OLXH 2A0LD 5IMOA 1YEEL 5DK2B 5ILTH 1QACA 4HLJA 3MUGA 1KIPA 2IAMD 1A3RL 4I9WD 4V1DE 5CD3A 1BLNA 1NDMB 4QYOB 3ZTNH 4HPYH 1YEDA 2AEIT 4HHAA 1I1AD 1HE7A 4FQIL 4HX1A 3PHSA 5CSGA 2VAAA 2PCPA 4GRLA 1GOFA 1X5KA 1DLFH 4HKXA 3CUPB 4JVWA 3MRGA 2FHFA 4NSKA 5HHVL 2NY1C 5EZOH 3VGHA 4H0GA 4MJID 3O4OC 3S88H 3G6AB 4M7ZC 4JFXB 3GMNB 1RFDL 2J88L 5GZOC 4C58B 2ZUUA 3O11A 4W81A 4JREB 3MV9E 4TUOA 4PRNA 1A7RH 3O6LH 3RNKA 4F7PB 4ZAKA 1HOCA 3HI1B 2EYSA 2WBJB 5FA3A 1DANT 1VFBB 3PXJA 1MCRA 3SQOL 3LKNB 5GGUB 1C7TA 2P48B 1QRNB 2VDKL 3RGVD 1RZJC 2B1HH 3E8UL 3GI9L 3QDGD 5B8CA 4PTTB 5I15H 3NGBB 4MHHI 5I76B 5CWSA 1YYLH 4KVCH 5D9SA 4HIJA 5SWQA 4Y4FB 3DI2B 4I0CC 4YBLB 5KSBE 4YK4C 5JXEC 2VR4A 3PWPB 1C08B 3M45A 4N1CA 1XEDA 3VXUB 5KOVC 4N90D 2DN7A 1QFWI 3FOLA 4GAGL 4PFEA 3KYOB 5EU5B 2HTKC 2UY6A 3QJFA 4I5BA 4Y2OA 5C0NC 3HRZA 1UB6A 1EIBA 3BZ4B 3E3QC 2BVOA 4ZS6D 1IGJA 1YNLH 2Z31B 2A1WH 5FOJA 4U7SA 3WSQL 1V7ML 2B1AH 1NLDH 1FN4A 3OZ9H 4XBPA 2WQ8A 4JFYA 4CMHC 5C09B 2DDQL 2RBLA 4NT6B 4OSUL 2D0HA 1NGZA 4NO5A 5E2JA 5ITFB 5CJQH 4Q2ZA 2OL3L 3OGOE 4QRPE 2AAVA 2A0LC 4FP8H 3LEYL 2NXZB 4FXLA 1QLFA 3MV7B 2DTSA 4AEIL 5HHPB 4X83A 1A5FH 12E8H 1D6VH 4HKZA 2GK0B 5FHAH 2CK0L 1EO8H 4M43L 4NKIL 3I9GH 4FFYL 5DUBB 2ITCB 4MQXD 1I1AC 3LS5H 3DX7B 4YHLH 4N5ED 1SBSH 5D1QB 4UNTA 3CH1B 1CGTA 2H2PD 4ZQKB 4GG6B 1YYML 5J9PA 1HHIB 4IIQC 1TIUA 1DSFH 2NLJB 4P46D 1MCBA 1X5FA 2CLZB 1V7NL 4XNMA 5D7IE 1QEWB 2N56A 4XPFH 5J3HD 1QP1A 1PG7X 4EI5A 3TPUA 3EBAA 4DFIA 1LO3H 3IFNH 1G0XA 4ODVL 5K9QI 4JANA 2BC4B 1JWUB 2DWEB 1UA6L 1CL7I 4GRMB 2QKIB 3QIWB 4KKNA 4Y5YA 4D0CB 2JLLA 3GSNL 4J12A 4YE4L 4JKPH 5MEQA 3QULB 4QXTA 4FRWA 3ROLA 4XRCA 5AZ2H 5KSAC 3B2UC 2NY2B 1RULH 3WYRA 4E5XB 3CSBA 1U8PB 5IOPB 2XN9B 1NMBH 3ABZA 1I8MB 5EA0L 4WO4B 5I17B 4RBPH 4GAFB 3GSUB 1UVQA 3MROB 3UDWC 4NPYB 2VNCA 4NQSB 1D5ZB 2A83A 4LHUG 2X9WA 5DJ2B 4XVTL 1HQRA 1PZ5B 3VFRA 2PF6A 3ARFB 4FFZH 3ARGA 2XTJD 3C08H 4PRPD 1U8LA 2ZCLH 3X17A 5CILL 3SDCC 5C0RL 1Z6JT 2YUZA 4PV8B 5I18L 4YFLF 3P77A 3MYJB 1IT9H 1PGRB 1CYGA 5FYLD 4KPHL 5HGDA 4QRQB 4FQXA 3QPQD 1F4HA 4FHBD 3FB5A 2VZSA 4N8VG 3MUZ1 4U1SB 5LGHL 3AAZB 1CG9A 1MQ8A 1P7KA 4WNQA 3TNNB 3PQYD 4C83B 1IGIH 1SHMA 2QQKH 1CFTB 4LPUA 3NN8A 3VW3H 1OWRM 4MQXC 2DWDB 4QRTA 1DR9A 4N8CH 1AHWA 2Z4QB 2C5DC 1D3CA 4LQFH 3RTQB 1R0AH 5SX4I 2OJEA 4E0RB 2R2EA 3OKKB 5DJDA 4GQ9L 4JRXB 4PJFE 1G6RL 5C08E 1HH6B 4APQC 3MJ8B 3VE0A 4OLUH 2ZUQB 3G5YA 3VCLB 3VWJB 4BH8B 4GXVH 1EEYB 1I8LC 4JY4A 5MENE 4LHUA 4RWYL 4OI8A 4JY6B 2NXYD 5MHSE 2RCSL 1YMHB 3QIUD 2VQUA 1X5LA 2HKFL 5D2NA 3TWCH 3EYVB 5IR1A 1FCCA 4K3DL 5AUMA 4JFDB 4YHML 5HHQB 1A14L 1BJMA 3PGFL 2HJLA 3NIFE 1DQQA 3D85A 5HYJD 5SWSB 1PEWA 4OQTL 3P9MB 4BFGA 3H0TA 4N8VA 4X9FA 1RU9H 2J5LC 4PJ7F 1Z9OA 3MZTA 2NCMA 4GMTL 4N0YH 5EBLA 3ZZ1A 3IETA 3O3DB 4U3CA 4MD4B 1MFBH 2BFVL 5B3JF 4M48L 2FJFA 1B2WL 3O3BB 4TN9A 1Q9OA 4HK3J 2X5PA 1MAMH 1QO3B 3FTGA 4RZCA 4K7FA 3EHBC 2E27L 4TTGA 3QP3A 1O5DT 2UWEF 2NTSP 2CXKA 4P2QE 5GGQH 4XVSL 3RWEB 1T2JA 5L7XL 1FNFA 3N1FC 4R26H 4PJHB 1U3HA 3LRSB 4UINH 4PJ9D 3ME0A 3K74B 4CADA 3HS0B 2PXYC 3S4SB 2HLAB 2V7NA 3K7UA 1NLBL 4PV9B 1YEHL 4YHZL 2P46B 5GZND 4R7DA 4PRDB 5DT1L 3RP1A 3W9DA 4D9RE 5EUKB 3TA3B 3VXSE 2YSSA 3S97C 3TFKC 2H26B 1BIIB 1NFDF 3KPRB 5D93C 3D39D 3JV6B 3V8CA 4L4TA 5B4MC 3DX8A 5FEBA 4G6JL 3OAZK 4NCC2 1CICC 4MD5B 3TO4C 4R7NA 4OF0A 2Y25A 4FMKA 1MUJB 2BVTA 3SJVD 3GMQA 4WCYL 3LKSA 4N68A 3PHQA 3DYMA 3NCEB 4O2EB 1NGWA 1OWWA 4CUCA 1O7SA 4MS8D 2FBJL 2IQAA 2OJZH 4CU6A 3V52H 1FGNH 1MI5E 4NZUH 3IDJB 3GRWH 2R1WA 4PGDB 4XAWL 3HI5L 4XCEB 1ZT4A 1YEFH 3BO8A 3DXAE 3H3BC 2F53D 4N1EA 1H3PH 3QEGH 3MV11 1QNZL 5JDSB 4TTDD 4Y2DD 4WDIA 3BT2L 3EOYG 3VXPB 5AEAA 2CLRA 5HDBF 1BVZA 4OZGA 5EU4A 3U0WH 4X6DF 2AJXL 3HB3C 3MRFA 4FQ1H 4NRYA 5IMMA 4G42B 2EDBA 3CFDA 1QD0A 5HJ3B 1MHHB 2FHBA 2BSRB 4K71C 1JVKA 4O4YL 4NGHL 3IDNB 4HT1H 1KCSL 2D3VA 2L0DA 3L3JA 3EYUL 3HR5B 4S1SL 1RZKC 4R9HA 3UC0L 2R23B 2DMKA 3SHSA 1IAMA 2D7PA 1A6TA 1GOGA 1U93A 1RUKL 3CMOH 4YDKH 1DEEB 1YQVH 5GISH 5JR1L 4X9IA 5HY9A 1AGFB 2ORBL 3SBWA 4XWOD 2A74A 3WD5L 3LEXB 5J6GA 5EZLB 2H32A 1S9WB 3GDBA 5E8PA 5CEYA 1I8IB 3IFPA 1LK2A 1CLZL 2Z91B 2DYPD 3RGHA 5I1HH 3DROA 5DD6A 4QF1A 1WITA 2KPNA 3FQXA 5IBTH 2Z92B 1FFNA 5FYJH 4WU5B 4UAOC 3WDJA 2VZ1A 4KRMB 4PJEE 1DL7H 2ARJB 1RAMA 1F13A 3VFWB 2X1PA 3EO9L 5DHYA 3GFUA 1A9BB 5DMKB 4HIXH 3FB6A 3GSOB 4PGBA 2VLKB 3C6LB 1C5CH 2OZ4H 3N0PB 1Z2KA 1BJ1H 3BMVA 4GKZA 5DJXB 4GRWE 1X4XA 4XCCH 2P5ED 3DGCR 2LFGA 3BP5A 1U8MA 4MS8C 4Z7VB 4P2OB 5D7LB 3KXFB 4PREB 3ZKMD 1BJ1J 1XIWC 2E9IA 2QR0B 5DS8A 3KAAA 4TSBL 1JBJA 5D6DA 5HXMA 5C0BE 2AV7B 4F9PA 4H5SA 1XGQA 4JGMA 1OAYH 4ZMAT 4KKBC 2Q76B 2VDNL 3V5KA 4I8DA 1A6VL 1ONQA 3HKFA 1FZOA 4OF6A 4Y16B 1ZLUK 3TO2A 2IAMA 1YNTB 1C5BH 3R4DA 5IHUL 2FL5B 4AEFA 2HFEB 1B0RA 3REVA 1KTRL 2OMBA 1LNUB 1TZGH 4RAUA 3WFHA 2WWMC 4UV4H 2XQBH 4Y7MA 2JCCB 2LU4A 2JJSA 1PG7L 4NN5B 3T1FB 5CMAA 2HJKB 1WFNA 1G7IB 3RL1B 5IFJA 5E1AA 3DIFB 2ERJB 5DVMA 1UM4L 3D69A 4QTIL 4XC1H 1RUAL 4OZFG 5I1JL 3I6GB 4DUXA 3NIDF 2AJZB 1EEQA 1P9MA 5DK0B 1P4LB 4YBQC 3TH2T 5IT2H 5EC1A 1LO2H 2YRZA 4P3CH 5F3HB 1J8KA 2QEJA 1BOGB 1F02I 2JK5B 3BRFA 1KBGL 2DQCL 4MGXA 2R9HC 1AQDB 4QXGH 5KBNC 4HGWB 3EFFA 5DI8B 3UJJH 2NW3B 2QSCL 3G6DH 4FQJL 4R6UA 1A1OB 2FEDC 4Z5RA 3RGVA 3QDGA 3KLAA 5T1LA 1XCTB 4K8RD 3ULSB 5D1XA 4GXUN 3BKYH 1XGUB 4U1JA 1OM3H 5BS0B 1WV7T 3M07A 1NC4D 4JO4L 5IVZB 5DURD 2VLRD 3DWTA 4G7VL 1F11B 2PO6C 4F15B 4IDLA 5TQ2L 4HFUH 4X6CE 2ZJSL 4CVZA 4G9FE 4Y5VA 1AI1L 5BMFH 3SKOB 4JY5L 4BUHA 3VGFA 2I9LB 3CFCL 1VERA 5HTSA 1Y6NR 1NGYB 2W60A 1CLCA 2A77L 2Q3AA 4Y89A 5TE7H 4MJ6B 1XGPA 4OZFA 5DJCB 4K3JH 4L29B 1GH7A 3ILPB 1FFPA 1HHKA 4RX4D 3BYTA 1KXTB 2GSGA 5EUOA 4ZUUA 4JVUA 3CU1A 4HXBH 1GIGH 4XP4L 3NZ8B 2NX5E 4R4FL 1MIMH 5DD1H 4EUPB 3VRJB 1F6AB 1P4IL 5C0DB 3GJFB 1PYWA 3RWGA 3HN3A 5C7XL 1H8SA 5TFSH 1RIHH 5DMIL 2GJ6B 5T1DL 5IEHB 5ISZE 5FUZL 3QAZB 1U42A 4I77L 5TPWH 4G8EB 1FORH 1RZ8A 3CCHB 4X0KA 4NQDE 1KELL 3L3DA 5I9QB 2VABB 3MLYH 4H26A 1T03H 1FFRA 3WL9A 1IEHA 1D5IL 4GMSH 4ZFFB 3DVNB 1UH2A 5DUPH 2H6PA 2YD1A 2UV3A 4KAQL 4P46A 5L2KE 2WMPA 3H8NA 4Z8FH 5ERWA 3IDYC 4X5WB 5E9DE 1WQVT 3B2VL 3QO0A 2GW5A 3ZKQD 1ZEAL 5LGJB 3UROR 3X13B 3FMGH 3BP7B 4ODHH 4PLJD 3HE7A 4FFWC 2ZZUT 5JW3L 3QDMB 1CDYA 4OD1H 4FXGB 1GRWA 4LCYA 5F6HJ 3WXWL 4TPRH 4BKLA 1KUMA 1T0NA 1VGKB 3G04A 4ENED 3LN4B 2HP4A 3FOMB 3TCLA 3SKMA 2FH6A 1X4ZA 3SCMC 1KIUA 1JRHL 4HIEB 3SY0B 3P30H 3U7YH 1RZ7L 3WXVL 3FO1A 4X6BA 1LE5A 2ADGA 1W72H 1MJUH 4BK4A 1J5OH 1V05A 4OUUA 4X5XA 5F71A 2FYYA 4M3JA 2DLEA 2JE8A 4PRIE 4G8GD 2ITDA 2Q6WA 3ARTA 4LP4A 1OCWH 5D7SH 2XTLA 1B4JH 1LD9A 3VFVA 2HVKA 1YZZA 1F58H 5ENWA 3S9DB 1BX2A 3Q5OA 3FN0H 4ONHB 4N0FB 4PYGA 5EBWA 2NX5A 1M7IA 2DL9A 5EZJA 3BPNC 1UM5L 2VLLB 2R8SH 1KN2H 2P49B 2UY7A 2LU3A 4HQQL 3CDFA 4V1DD 2Q8AL 2R0KH 3D2UB 3P0GB 3HMWL 1QHPA 3BD5A 3LS4L 2HKHL 4LCIH 4PRPA 3WFZA 3ZTJH 3REWA 4K94H 4Q58C 3GBNL 4KHTL 1IILE 4NM4L 4ONFH 4FN0A 5IMOB 2E9BA 3MUGB 2DIBA 4HEPG 4M6OL 4ZUVA 1OGAE 1F4AA 5I8OH 4MDJA 5CD3B 1BLNB 2A9NH 2FX7L 1E4WL 2NY4D 4KZDL 1YEDB 3MV9D 2IANB 2Q7NA 4HHAB 4TULL 1BWMA 2VDPL 2M8XA 1ZHKA 4HX1B 5ESAB 2NY3C 4AK1A 2VAAB 2VDQH 3KPNA 4GRLB 3ZL4L 4HKXB 3MRGB 1QFUL 3I3BA 1X5GA 4LSVH 4OLZH 3V7AG 3AU1A 4YHYB 8FABA 3SKUD 3JVGA 4P9HH 4DKFL 5J8OA 4UNVA 2VZTA 5D7KE 3RNKB 1G9MC 4ZNEA 4ZAKB 1HOCB 4M7LL 2EYSB 5FA3B 1FL3A 3KPSD 4RMVA 3QIUA 4PLJC 1OQOA 1F4WL 2B20A 2JIXD 4HKBA 4G8FA 2PETA 3INUH 3L5HA 4FQ2H 2L7UA 1T22A 5CJXC 5B8CB 1EAPA 4ENEC 2Q87A 5CWSB 4M03A 5HYJA 4NOBA 3TBYA 1HILA 5DJAA 4PJCA 5SWQB 2JJUA 1ND0B 1BAFH 4NC2B 3DHMA 2QSTA 1P84J 3GGWA 3QXTA 5EZOL 5DGRA 3FOLB 3N50A 1TZHA 1CXIA 3S88L 3QJFB 4I5BB 3W11D 4KH2A 3FAWA 3HRZB 3ARRA 1UB6B 1S7XB 3MOQA 2HYMA 2BVOB 1IGJB 2YMXH 5I71C 2ZCKH 4QRSA 3OKDA 5ESQA 3LB6D 1FN4B 1ULVA 1S78D 4XBPB 2BERA 4JFYB 1CDIA 4W70A 1P1ZB 3S3JA 4KXZH 1ZKAA 2G60H 4LCUA 4NO5B 3L7FA 3V95A 5JHDA 2JB6A 5DHXB 4Q2ZB 3BDXA 4PJ9A 4RDQG 5IWLA 2ZNXA 2B1HL 4RGOH 5CGYD 5I15L 4B0MM 5T3XL 3VFGH 1YYLL 4XC3H 4KVCL 1QLFB 4CVUA 3BZFA 3JTTA 4CDHA 4CW1A 2JJTA 2KUTA 1NCWL 3ULVE 2FNBA 4HKZB 3HC3H 1IEBA 2DM7A 4JZJA 3ARXA 2NY4C 3O45A 1CLYL 1BQHG 4BQ9A 5T3XE 3D39A 3BAEH 1YNLL 2B1AL 1NLDL 3MXWL 1BF8A 3OZ9L 5J9PB 3UAJC 1ZT7B 1B88A 5DRXA 4XNMB 3QJHA 5E99H 2MJWA 3K81A 1IM3A 2W0PA 3SJVA 4EI5B 1IC1A 3TPUB 1I7RA 1UKQA 4NO2A 5CJQL 2ED7A 4PJDA 3U2SA 3TESA 4JANB 1QSED 3QEHA 4UMGA 4AIXA 2PTTA 4FP8L 4Y5YB 3HE6C 1IGCH 4LSTH 5MEQB 1ADQA 1A5FL 4QXTB 12E8L 1D6VL 1RSFA 2F53A 1EO8L 1FZMA 1U2HA 4G6FB 4ZXBC 3VXQA 2X4TA 4Y2DA 3ROLB 3I9GL 3NOIA 4XRCB 5IJKC 3JWOH 4Y5XC 2Z8SA 1KEML 5JPNA 3ZDXF 2FDBP 1L0QA 1SBSL 1YN6A 3TYGH 5CINH 3RIAK 1T1ZA 1BQHA 2GY5A 1DSFL 1P69B 1Q9KB 4K23H 3T0ED 1CTNA 3LZFH 4P59L 1UVQB 1BBJA 2G5BB 4LSRL 1IGMH 3OJDA 1CTOA 1LO3L 4DVRL 3LB6C 4XPGL 1HQRB 5E8DH 2PYEA 1PW3A 2ARWA 3ARGB 4HULB 3Q2CA 1U8LB 3FCTB 5F7LB 4E41D 4W68A 1TCMA 5MI0C 2Y9RT 3P77B 1GGTA 1VPOH 4JKPL 1BD2E 4G5ZL 5HGDB 4FQXB 4YXKH 2AV1A 3EDDA 5AZ2L 1G7JA 3FB5B 5TGBA 1A7OL 4Z7NE 1RULL 3IDXL 1RUPH 3KG5A 4WHYG 1UCBH 4NO0A 1C5DA 1CG9B 1P7KB 2DYPA 4OCXL 2BNRD 4WNQB 1SMAA 4XTRC 1KG0A 3D6GA 4WW2F 1PSKH 4Y4KD 1VEOA 3NN8B 4DTGL 5MEND 2DQJH 3O6FD 1IKNA 1CT8A 1BFOA 1WZ1H 4QRTB 1AHWB 3B3IA 5IGXL 2OJEB 2R2EB 5DJDB 4JO3H 3FRPG 2GT9A 4OKVA 3HR6A 4GXUM 4FFZL 2R15A 4HEME 1F00I 3VE0B 3C08L 1S7WA 3V0WH 3G5YB 4R2GD 4JFEE 4RFNB 2DS4A 4JY4B 4LHUB 4XMLH 4ZO7A 5JPMA 3HLAA 2P5EA 2R2BA 4KRPC 3ULUE 3DOSA 3LN9A 4D9LH 2MKLC 5D2NB 3NPZB 5IR1B 5AUMB 2AJYL 2UZXB 3BN9C 4PGEA 2HJLB 3U9PL 1DQQB 1PKQE 3D85B 1AY1H 3B9KB 1IGIL 2MHAA 2QQKL 3IXTA 3H0TB 4N8VB 1CVRA 3C2AH 2YPLE 3G9VA 5EBLB 4P2QD 4IMKA 4ZOCA 3IETB 3DETD 4LQFL 1R0AL 1LDSA 2ICWI 1Q9OB 3P0VL 5C70A 4R4BA 5E2UH 4OLVH 4OLUL 3FTGB 1ZGLA 4RZCB 4K7FB 1BD2A 5IIEA 1HQ4A 4PTUA 1IC5L 2LTQB 4BM7A 1HIMH 3FRPA 4QHUA 3RVUD 2BOBA 3HZKA 1KPVA 5E7BA 2ZG2A 4D9RD 1U3HB 5K9JH 4JQXC 2EYTA 4KFZC 2GITA 3HFMH 5IVOA 2B8OT 3S36X 4CADB 1K2DA 4UTBL 1AR1C 2V7NB 1Z0MA 3RHWK 1OD7A 1T0PB 3P4OA 1NPUA 4PB9H 3CX2A 4R7DB 4HAFA 5B3NA 1NCAL 3W9DB 5HPOA 4N0YL 1M1SA 1NANH 5AAWA 2BNQE 2YSSB 1MFBL 3GUTA 4KGLA 5JHLL 5A2KH 4L4TB 3DX8B 1DQTA 4GG8A 1MAML 3KR3H 4MMZC 1JFQH 2AQ1A 2PKDA 5B38G 4IRZH 4YC2C 3NZHH 5KZCB 3NCJH 3O3EA 4NZDA 1AKJD 5GGQL 5J11C 2WUCH 3BPCA 3BKJH 1P7QA 3GMQB 4R26L 1WK0A 1NBQA 3LKSB 4PLKD 1JZ8A 1J0ZA 4PJ8C 1DUYA 4UINL 2CO6B 3KPQA 3NCYS 2BHZA 1Z9SA 2IQAB 4PG2A 4L1DA 2XZAH 4RRPG 5FAAA 4YWGH 3WDIA 2W9EH 2ARJQ 3HUJA 5F7FA 4RX4A 3BO8B 5DVKA 2HMIC 3I6LE 2OBGA 3QRFM 4WDIB 1XAUA 3OAZH 2CLRB 4W6YB 5SV3A 5EOTA 4OZGB 5EU4B 1TENA 3MGAA 5IFAH 3MRFB 2CIIA 4NRYB 5IMMB 1QFHA 3CFDB 4UILH 3E2HC 3DETC 5FKAA 4HKJA 2I25N 1E4XH 1RIUL 2FWOA 5FYKE 3KNBA 3T04D 3O2WH 5B38A 3B43A 3L3JB 2CKBH 4KC3B 2HFTA 1KB9K 2MQ3A 3I2CL 3RIFF 1BVLA 2P5WD 1IMHC 2E9WA 1A6TB 1U93B 2OJZL 1C1EH 3R06A 2CR3A 4EI6A 4NZUL 3GRWL 1T7ZA 3VGEA 4XMKH 5D96C 4YEEA 2VL5A 1SEBA 5ETUA 3NCYP 5HY9B 1JHKL 1YEFL 3QEGL 4HS3A 4RRPA 1YUHA 2A74B 1KN4L 1EEUA 2DM3A 5CLWA 2X70A 4P49A 3MLUH 5J6GB 4FFVC 5E8PB 2EC8A 5CEYB 3BPOC 1KYOK 1LK2B 3IFPB 4HH8A 1LEGA 4YQXL 3DROB 4MNGE 1OTTD 5DD6B 5GS0C 4QF1B 3FQXB 4RMTA 1CIDA 2VO5A 1FFNB 3FFCE 3IJSA 4DN3H 4LSQH 5DRNA 5KSVA 3S35X 5HHXH 4HT1L 4P0DA 1KTKE 1IARB 4Z76B 5DHYB 1OB1B 3FB6B 5E8NA 4PGBB 3JXAA 1HXMA 4G8GA 4HJGA 5EU6D 4GKZB 5D5MA 5C0BD 3O8XD 2AGJH 5GISL 1FO0A 4KMLB 5ADPH 5IROC 3BP5B 3T4AB 1U8MB 1UCTA 4JFPA 4XX1E 5D2LE 1WVZA 1CFQA 3MLZH 3EYOA 1OTUD 4ZTOL 1ZV5A 4JFFE 5IHZA 2DQHH 1FL6A 2HH0H 5I1AA 1EH9A 43CAA 4JKWA 5KTEH 3I50L 5DHVH 3T08A 1I7UA 5FA4A 3NFSH 4H5SB 4F9PC 5I1HL 1MEXH 2ICES 2VDRH 4RQQA 5IBTL 3V5KB 3MMEA 2M26A 3LDBB 5FYJL 2K7QA 1ONQB 4JFZH 1FZOB 5GGTH 3ZHKA 3TO2B 3BEVA 1DL7L 2IAMB 3HMXH 3MCG1 4JRWA 5FGBA 4OTXH 3U36A 4XX1G 2DKUA 2XWBA 2OX5A 1B0RB 1VESA 4N8PA 1SY6L 3ZE1E 3REVB 2VH5H 1WBYA 1OARH 2OZ4L 4RAUB 3WFHB 3V0AC 2EIDA 4JKKA 4OLWH 4F2MB 1JRHI 3F12A 1NUGA 1IBGH 5CMAB 3VRLF 3ZDZF 3RJDA 5E1AB 5IFJB 1F90H 3MV8E 2CIKA 4EEEA 5HI5C 4NKOA 1SJHA 4F57L 3D69B 3FO9A 4J8RA 1S9XA 3WJJA 3FHAA 1P9MC 5EC1B 2IPUG 1SVZA 4GKSA 4U31A 3RBGA 1OAYL 5CEXA 3KPSA 1AGDA 3T77A 2GSIA 4QY8A 1HCFX 2VXUH 3EDJA 4JPWH 5SX5K 2JIXA 2IADB 4OKDA 1C5BL 3U4AA 3RGVB 4Z5RB 3QDGB 3KLAB 4X80H 3O9WA 4WI7A 4LVNB 1OTTC 1RZJH 5D1XB 2H41A 1TZGL 4U1JB 1A7QH 3ZYJA 2ZUVA 1AGCA 2XQBL 3RZCD 1URLA 2X09A 3IKKA 4WUKH 4YXHH 4F7TA 4PJHF 5CSZA 4NHUA 1A8JH 4Y5VB 5CCKH 4XC1L 1ZGLM 3O8XC 5CZXD 3MR9A 3QYCA 5LGKA 2W60B 3QUYD 1A1NA 5IT2L 5FIEA 1XGPB 1S7TA 2P43B 3TJHD 1WZMA 3B5GA 4U1LA 4OZFB 2E7MA 5ISZD 3MXVH 1FFPB 4PJ7E 1GOHA 1HHKB 1T1YA 4QXGL 4OIAA 5EUOB 2GSGB 2V5SA 3DJ9A 3Q5TA 4ZUUB 3UJJL 1O0VA 3TF7C 1EBAA 4Z0BH 4LASH 4OFIA 3G6DL 5BV7C 5B3JE 4HSQA 1K85A 4WFEE 2X4PB 4KK6D 1IE5A 4ZFGL 3UTPD 2B4CL 1PYWB 1HKLL 5E70A 3RWGB 2ATKA 4RMUA 2C4FU 4WVRA 2UWEE 3DARA 3QH3A 3MNZA 1JNHA 1UQSA 5CUSH 5MERA 1RZ8B 4HFUL 2F5BH 4X0KB 2JKXA 4O2FA 1MSPA 3L3DB 2P8MA 4H26B 5BMFL 4OZIA 2AJUH 3WL9B 5IM7A 1BM3L 2HAZA 2VN4A 5E5RB 4RGNB 2EH8L 4M5ZH 3RAJH 2H6PB 1E6JH 5KS9A 3B4NA 4MAUH 1P4BH 3W0WD 1A47A 4P46B 3D3VE 5DTFA 5ERWB 4WI8A 2EIZA 2VUOA 3MLTA 2X1XR 4YDLC 3Q6GH 3QO0B 3GMRA 4C4KO 1NFDE 1GIGL 3HE7B 1QSEA 4MNQE 3K4DA 4I0PC 1AC6A 1MIML 1PQZB 4QEGA 5DD1L 4U1NA 3BIKA 4LCYB 4LCWE 4WEUD 4BKLB 2CO7B 2GFBA 4PRID 3MA9L 1T0NB 2ATPB 3G04B 4JHZA 1XR8A 3SKMB 1L4IA 2VB5A 5GQBA 4JN1H 1FORL 3N1QC 4Q74A 1CR9H 3OL2A 5F1NA 4DGIL 2BSSA 1TVDA 3FO1B 1LE5B 2ADGB 3IFOB 3MLYL 1T03L 4OUUB 3P3YA 4X5XB 2FYYB 4GMSL 3RZCC 4NN7C 2ITDB 4P2YA 4QTHA 5DUPL 2HFGH 5F97E 2Q6WB 2EIBA 1N64H 1LD9B 3VFVB 2HVKB 3T0EA 5ENWB 4Z8FL 2GK2A 1I8KA 5F7HA 3VD5A 5EBWB 3JWDL 3PWNA 2C7UB 4GSDH 1M7IB 1MCQA 1MCOH 1UC6A 5CZKA 4ALAH 1W0YT 5HDBE 4MAYD 1JK8A 2XTJB 5I66A 1A6WH 3CDCA 4OD1L 4PRPB 5D4QA 3UTSD 4CJ0A 4X6DE 4E41A 3REWB 3AUVA 3I02A 1IQWL 3T2OA 1ZWIA 2V17H 3CFIC 3G5ZA 4KDWA 2E7BA 4WEBH 3D1MC 1OGTA 2EH7L 1PD6A 4MJ5A 3EIFA 1EMTL 4ZUVB 3P30L 3MJ9H 4A6YL 5D1ZD 4MDJB 5DMGC 4M6NH 3RVXD 1D5XB 3ARPA 5CJOH 3D3VA 2BNRA 1V5JA 4NC1E 5D93B 1ZHKB 5D7SL 2VLJD 4Y4KA 3C9NA 3KPNB 1A6PA 3QCTL 2ZUSA 3O6FA 4KWUA 4XPAH 1XCQA 4Z7VF 4I18A 4LGPB 4M6MH