4PP2B

The crystal structure of der p 1 allergen complexed with fab fragment of mab 10b9
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
215
Chain Sequence
EVQLVESGPSLVKPSQTLSLTCSVTGDSITSGFWNWIRKFPGNKLEFMGYITYSGTSYYKPSLKSRISITRDTSKNQYFLQLNSVTAEDTATYYCARRGFLTTVNYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords light chain of Fab fragment of 10B9 antibody
publication title Structural Analysis of Der p 1-Antibody Complexes and Comparison with Complexes of Proteins or Peptides with Monoclonal Antibodies.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 215
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp2B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp2B02
1RULL 3MV7D 2DQCL 5DFTA 1RZJH 2OTPA 2X4SA 3OB0K 1Q1JL 4MGXA 4XX1G 1H8NA 5C0BB 1WLHA 1ZA6B 4U1HB 3WIHA 1JFQH 3QUXD 3KWWA 1J9CT 1GZQA 2BHZA 2FNBA 5J3HD 4YBQD 3IDMA 1DQDL 1H3GA 1E27A 2D7TH 3K2UL 1NBVL 3MNVA 4P9HH 4U6TA 1HCVA 3OKDB 2ICWI 4AIXA 5EIIA 3VFTA 5C0JA 1NANH 3KYMB 1PGRB 1PG7X 4WI6A 3REVB 2YSSB 1LP9E 3EJYC 4ESKA 2NCMA 4MJIE 5KSBA 3UROR 2BVQA 5D72L 5E24E 4ZG1A 3FFDB 3B9KA 4OZHF 2AXJA 4FQXB 2NY4D 3AXLA 2BOBA 2VXQH 4WHYG 1XGYL 3MLUH 1J5OL 3IJSA 4K55A 4JY4B 5KVDL 1X5FA 1I7ZB 1DBKL 3MBED 1IQDB 4NRXB 4X4YA 4N90D 5HI3C 2JK5B 4LFHG 5EBWA 4AENA 4YXLH 4CADA 3J7HA 4GRLD 3SGKC 3NPSC 1QFHA 3WIHH 1G7MB 5GJTL 1AQKH 4LBEB 4LLWA 4AIOA 2D4DA 1S78D 3KYNB 1JMXA 1HHKA 4HIXL 4WU7A 2IMNA 5TH2A 2NY5L 3SDDA 5B38A 4NO5A 3LQMA 4GRWB 3LKNA 5EPMA 2DBLL 4JCMA 3ROOB 3V79C 4G9DA 5GRVL 4FZ8L 1DQLL 3LS4L 2NZ9D 2E3VA 1AXSB 2AKRB 3BQUB 4P49A 4F15C 4XI5C 1WBZA 1UGNA 3HUJF 1BX2A 1REIA 2X4QB 4FQ1H 4WFED 4ZSOA 3P4MA 3BDXA 1KOAA 5IJVA 4L29B 1RAMA 1D5MB 4KKBC 5JW5A 4U6XB 2VOTA 3WJJA 3WIFA 5FGBC 4YUEL 1IBGL 4JQXC 4M43L 1QR1A 4WHDA 1U8QA 3VE0B 4LNVA 2CQVA 4B0MM 1QO3A 1C08A 3NFPA 4CMMA 1QRNA 2BSRA 2Q7YA 4JFDE 3ZKXB 3AB0C 2P42B 5J11B 3H0TB 3RWIA 1RUPL 3CSBA 4KI5C 2NZIA 3WFHA 4M7KH 4L4TA 3LB6D 3BT2L 1BZ9A 3QSKB 2W59A 2ZZUT 2DL9A 1K4DA 4X8JA 4GFTB 4FFWC 1MWAB 1N6QL 1LP9B 1NCDH 3NZHH 4MJIB 4XNXL 4ZUVA 3FMGL 4NM8H 1S7RA 1KN4L 4XVJL 2ZUYA 2ZCLL 1NGZB 1G9ML 5T1KD 4HPYL 2OZ4A 3RDTD 5F89B 1U8JB 2AXHA 5C0IB 2YBRB 1OAUL 3PJSB 3IDYB 1I1AB 3M07A 3O41B 4YAQB 5DJXA 5I71B 4F7PB 2BK8A 4DZBA 2WUCH 3QEQA 2MKWA 3ARWA 3VFUB 4DCQA 2DJUA 5E03A 1I8IA 2EIZA 1JNNL 4YGAB 4Q2ZA 4KJQD 2HLFD 4DKEL 4XBEL 4QRSB 4XCCH 1M7XA 4OV6F 4FTVA 4JO1L 2R4RL 1NCBH 3CFCL 4FXGB 2IFFH 4M6MH 1F6LL 2H41A 4CRPA 1QACA 4PPTA 3FQNA 1A3LL 1EHLL 5EO9A 4YBHA 3GSXB 3GMMA 1HKLH 3G5ZA 4MQXD 3KNBA 1IM3B 3HB3C 4UIMA 4N5ED 5D5MA 1AI1L 1OGAA 1T1ZB 1AR2A 3LS5L 2I60H 2LV4A 5FK9B 3BI9X 3MV7E 1ZTXH 4WTZG 2O26U 2DKUA 4OJFH 3BPLB 3MOBH 4J6RL 5JUEL 1WWAX 5B39G 3IDJB 4ZTPH 5CZVH 1Q9WB 1Q94B 5F7YC 1I9JL 3HNSH 5C7XL 1I1FB 3V7AE 1U91B 2AEPH 3BZ4A 1J8KA 2QSCH 5JXAL 4JFDB 5FIEA 1BJ1H 4XP6H 2P7TB 1S9WB 1UJ3A 5B4MD 3STZA 4OZGE 1LO3L 1MJ7H 2A6KA 1OP3K 4O2CB 1BLNA 3VG0L 3O3BB 5DEGA 3GSNA 4BSVB 1U36A 4F9PC 1UEMA 2AV1B 3HA0A 5DJCB 5FOBB 2FD6L 1T0PB 2MSPA 4RMSA 4C56A 3VXSE 4R4FL 5B8CA 4HHAA 4ALAH 1P1ZB 4HJGA 5E95B 2OMNA 4LMQI 3HE7A 4F80A 5D1XD 5T1DL 1B3JA 1NCCL 4WO4A 1AGCB 3SGJC 4KHXL 1IAII 2R0KH 5HHNA 3O6FD 4Z95H 3RIFF 4S2SB 2H1PL 3HG1E 5D8JH 1RUAL 3MNZA 3ULVH 2Q6WB 1T83C 4GAGH 5D6DA 5ESVA 4NZRH 1YEDB 1NAMA 4KAQL 7FABL 1RURH 4UT9H 1EBPA 4E5XA 2YC1B 4LF3B 1LE9A 2IF7A 3WHE1 3EO1B 2VLJD 1AHWA 3PWUB 4KUCF 4RSVA 5EC1A 3GBNH 3PGFH 2XTJD 3QEHA 5D96B 3GJEA 3SE3C 3GK8H 3GSNH 5I1JL 3TIEA 4Z77B 1NBZA 3NZ8A 4YNYB 1PZ5A 5FYKL 3NH7L 2IPKA 3QIBD 4JM2F 4J3TA 1A7NH 4WUUD 2HFTA 2Y6SD 3MV7B 2VL5A 1N64L 1PG7W 4JFYA 4NHCL 3CX5J 1WEJH 1GPOL 1MFCH 1QOKA 2BMKB 4L3EA 2OTWA 5DF0A 4KRLB 4LCYA 5EU5B 2P46B 3DGCR 2R23A 3QUXB 5A2LH 4NBXB 3DYMA 2W9EH 1OTUC 3WKNA 4YXHL 1OAKH 5GGUB 1KCRL 3NABL 5FO9B 2VZUA 1WWWX 4HEPG 3UYOD 1NCWH 1MCFA 3GHBH 4LCIH 4JANB 2ZSVA 3HLAB 5KVFL 1DN0B 4QCIB 5IK3A 3ZHDA 3RPIA 4CVUA 4OZGB 2DLTA 4QRRA 5J6HA 4M93C 3RX8A 2DMBA 3QIUA 3LQZA 2WIIB 1LO0H 4B5EA 2MFNA 4CN1A 3OR6A 4TQEH 1OD7A 1KLUB 1YEJL 3O6ML 1EA9C 1MHCA 3PNWB 2VDQL 2NY4B 5IVOA 1VGKA 3VXSB 1NLBH 3KPNB 1ULVA 3IS0X 3BN3B 5H35A 2Q8BH 3BGMB 3BEVB 1C16B 4H20L 3RZCC 2A83A 4P2RA 3O6LH 3ZO0A 3UO1H 5IMOB 4JM2C 5CILL 4PTTB 4F7TB 4GRLB 4RISL 1FVCA 4F37F 3PDDA 4OQTA 3D9AH 3FO9A 3STLB 4KZDH 4HIJA 3DTXA 4KWUA 3HG1B 3CX5K 1BQLL 5SX4I 1TVDA 2FEDC 3HZVA 4HK3N 4H1LA 3V6OC 1HWGB 5EFIA 1WSST 1BM3L 1T7ZA 1U8PB 3UYRH 1X7QB 3FQRB 5D7LE 3S3JA 5JDSB 3CDGA 2J88L 3DV6A 4ZFFA 4D0BB 4NOBA 4JEGB 1HH6A 2VDNL 5ESAB 1XF3A 4N9GB 4OCNC 1EERB 1A6TB 1CGWA 5EU3B 3CSPA 4D9RD 4LFHD 4WFGD 1BREA 4L8DB 4Z5RB 1BVKB 3MOQA 4RMTA 5I73B 5GZOD 2D31B 1I1RA 3TIDA 4UT6L 4HUUB 3SGDH 2FJFB 1Q9KB 2QADC 1NKRA 4H5SB 5I9QB 2KBGA 2VQUA 3SDAC 1CD9B 4XP9L 1T1WA 4HS8L 1V7MH 2OJZL 4BQ9A 4L3AA 1RUKL 1DEDA 5L2JA 3QJFA 4GW1B 4M7ZC 3FRPG 3AREC 5T33H 1TZIB 3HHRB 4BQ6A 3ALXA 1A6UL 2HKFH 1FYTA 2X4RB 3MLZH 2DQTL 5I66B 1YEHL 4RGOL 2J12B 5I8OH 3NFSH 3T3MF 4JFXB 1FDLL 1U9KA 4G6FD 1HYSC 4G8EA 4LCCC 2WBJD 3RVTC 4ODXB 5D4QA 5CJQH 3CC5A 3TO2A 4I0KA 2HVJB 3RDTB 1A3RH 1KF9B 3I02B 3NFNB 3KLHD 3S35L 4Z9KB 4NNXA 4PJDA 4IIQA 1P69B 1I7UB 1U8OB 1OB1B 1YEIH 4JG0L 4M1GL 4FFZH 3TWCH 1RULH 1IGYB 1OAXL 4RZCB 4Y5XC 5C0FB 4ZTOH 3SKNB 1Q1JH 3QUZA 5EO1B 4LSRL 1M71A 5GS1B 3IDNB 4I2XE 1A1MA 5C3TA 2DQEL 5DRNA 4PB0H 1CFTB 4K3EL 3B3IB 3LOWA 2PO6A 3K2UH 4WW2F 3M1BB 1NBVH 3SGDI 3MRBA 1ETZA 2XTLA 35C8L 4M1DL 5D7IB 3GUTB 1P4LB 2CKBB 2XTJE 5TDPB 5D7LB 2F5BL 1EEZB 5BXFA 2VE6A 5C0AD 2EXWD 5DHXB 2I27N 1RHFA 5D72H 2V7NA 5TGBB 3M8OL 1RFDL 3KPRA 3RX7A 1AXIB 1MLBB 4XGZB 5DD1H 1W0VA 1KELH 1KV3A 4RAHA 1AP2A 5L2KD 1JZ8A 2BNRA 3CVHB 1J5OH 3BJLA 2RFXA 4QTHB 5JIPA 1Z3GH 3PHOA 3AFLA 2VLRE 3KPMA 5KVDH 3VWKC 2PUQT 5IQ9A 1DBKH 2UYLA 4OCLC 5HGDB 2V9RA 5C0CA 4MNHA 2V5RA 5GS3A 4XAKD 3MJ8A 1WC7A 2HT4D 3BW9B 1SEBB 3FFCA 5T1MB 1N6UA 2KH2B 4PJGE 5FKPB 3CSGA 3DYPA 4LLYB 2QSTA 2OSLA 5JHDD 1CGSL 3A67L 4PGDA 5I15L 1SJHA 4NQSA 1X4YA 4HKJA 3WEXA 2NY5H 1NCTA 2VAAB 3AVEA 5CEXB 3OXRA 1TQBC 4WW2C 2DBLH 3VGGA 2VKWA 3A6OA 4XX1E 5TDOB 4OF6A 5HY9B 4FZ8H 5IBUG 1DQLH 3AMLA 2OBGA 3FQXB 3LS4H 4GKOA 5DRXB 4KKAD 4QY8B 2ZUQB 3LRHA 5HHOE 5D1XB 1XF1A 1XCTB 2VXUL 5T1LD 4GXUN 2DL2A 3MV8D 3EJZD 3TT1L 4XCYB 4KMTL 3O6FB 1BIIB 5KG9B 5C0DA 3CFBB 4YUEH 4RNRA 4M43H 1G9EA 1ZT7A 4GKNB 3GSWA 1OD9A 3TZVA 4I2XB 4P3DA 4HEME 3DHMA 4EI6B 5LCVL 1FGNL 3UAJD 5I1AA 4XMLL 2BJML 1YA5A 4DZ8B 1RUPH 3B5TA 3MREB 1KGCD 4F15B 4QXTB 1CDIA 4X5WB 2ICEA 4HXAL 1SQ2N 2IANE 4PGBA 1NGXA 2XTJB 3WSQH 5C71A 1CD1B 4PGCA 4ZXBD 4IS6A 4XNXH 2VIRB 2YD4A 4Y88A 5BVPL 3DNKA 4D9RE 3QIBB 1MCWM 4XVJH 1FLTX 2BSSB 3ARRA 4OQ1A 2ZCLH 3E6HA 4YFEA 4JKPH 5D93C 4LKCB 1TVHB 5GS0D 3EOBA 1FNHA 5I1DB 4S0SD 1YMHA 1OAUH 1K8DB 3V6FA 4JY5L 3EDJA 5CAYB 1UH3A 2VLRB 5CGTA 4C57C 1HHGA 3RIFK 3FAXA 1L4IA 1JZ6A 3BRFA 1FLRH 1KJ2L 4DKEH 1XGPA 4XBEH 4ONFH 3T0EC 4KTEL 4UIKH 4JO1H 2E5EA 3MRJA 5C6PB 4YWGH 4PJGB 4PLNC 3HR6A 4V1DA 3RUGA 4Z7UF 4JE4B 5I8KL 4HF5L 1IEBB 1EHLH 4OUUA 4YHOL 2Z92B 4EDXA 4YHKL 1MFAL 2Y06L 1UT9A 4Y5VA 5D2LA 5BS0E 2I07A 4QHLB 1OTSC 2B0SL 1WQVT 5I19L 5HPMA 2P24A 4JDTL 2UZYB 1AI1H 3BP5A 1IMHC 4Q6IB 3IDXH 1JTPA 3PDOA 5CBAB 3HMXH 1MHPL 1Y18A 1W72H 5HHOB 1B6DA 4NFBA 3PP4L 4J6RH 5JUEH 4ZUTB 1XIWD 4H0GA 4OGAD 4I77L 4Y7MA 5EU7E 3BN9C 5AG9A 1UM6H 4GBXD 1JGUL 2YA1A 2A0LD 4RIRB 1VFAA 1QR4A 4X0KA 1A9BB 1JNLL 3LEXA 5C7XH 3HI5L 4D94A 3PUCA 5JXAH 1XF4A 3DUHA 2D7QA 3TCXA 4S1SL 4BZ1L 1ZK9A 2MHAB 4RDQG 3DX7A 5HHPA 3NN8B 1AH1A 4X9FA 5E2VL 1LO3H 4PY8J 1KXTB 5DO2D 5C0AE 4DUVA 1NDGA 1N2RB 2IANB 5IKCA 4P5MA 5EUKA 1AGEA 3ARDC 5EG6C 2ZG3A 3VG0H 4PY7B 2WP3T 2GJZA 4TULL 1SVZA 3VA6A 3FRUA 3CD4A 1FCGA 2DKMA 3V5DB 1A14L 3AAZB 1M05A 1J0KA 2FJHB 5CZXD 4WV1A 1KYOK 4LVHC 3OF6D 3VW3L 2E7MA 1SBBA 2GJ6A 2Q86B 3JWDL 1NC2B 3K4ZA 4H0HB 5T1DH 1NCCH 1EEQA 3QQ9D 4XAKE 4R7NA 4F37K 1B6UA 1S7SA 3I6LD 4L8CB 4KPHL 5I74B 1ZE3C 2AJ3B 1OP9A 1FBIL 3BKML 3P9MA 2H1PH 4OFYD 5J6GB 1RUAH 3CH8A 3MLPA 2PCPB 4JRXD 4X9IA 3QG7L 2DWDB 4MNQD 1VGEL 3GO1L 1ONQA 1DFBL 2W65A 4WGWB 2A38A 3CPLA 3PIQB 4KAQH 4JCLA 4LCWA 2Z91B 4Q97A 7FABH 2H8PA 3VFPB 3P4OB 1HHHB 2P5EA 1B2WL 2YXMA 4G6FB 2WBJB 3F62A 3B8SA 3EOTL 5BS0B 2YPVH 4JZJA 4UZGA 5ADOL 3EOAB 3U0PB 1MCQA 5H2BB 3QWRA 4ZFGL 5I1JH 4XHQA 4CU7A 5ICXA 4E41A 3LHPH 4JN2A 3X14B 3MV8E 2R0LL 2R56L 4Y0GA 2I5YH 5JQHC 2H3NA 2DJ4A 3NGBC 2GI7A 2BNQD 2X1WL 3S3PA 3TH4T 2M1KA 3QXWA 4LARL 5C0EB 3V6OE 2XWTB 1J87A 2UWEF 2C7UB 1GPOH 2NX5A 3EJJX 4AYFA 2YA2A 4NQVB 3JSSA 1KXVC 1IFHH 5KW9L 4KH2A 3MLRH 2GJJA 1TNNA 5IV2B 1OPGL 2YUWA 4RDQF 5ANME 1MJJB 2ORBL 3PQYE 2Y7QB 3QUYB 1TZHB 1ES0B 1KCRH 3NABH 4Q9BA 4LLVB 1KEML 2E7LC 3VXMA 3B8YA 2XRAL 1T2QL 1MY7A 5J1SC 3JBG7 5KVFH 3IFPB 3MRMB 1T21B 2YPKA 3QDMD 5C0AB 3PWVA 5E6IC 4WEBH 5LQBL 2I9TA 4LLMB 2MTPA 5E08L 4NUGL 1FG2B 2MCPL 3OV6A 3GB7B 2BCKA 4GAFB 1YEJH 3O6MH 1GOHA 1KPUA 2VDQH 2QKIA 5IWLC 3TA3D 1U8HA 5CINL 5GRXG 4H20H 3LV3B 4H25A 1XR9B 4OD1L 2LU7A 4PREA 3U30C 3IF1A 3W5NA 4FQHA 5FV1L 3WN5A 5IEHB 1QNZL 3TFKC 2GAZA 1FIEA 1XH3B 1JN6B 1Y6KR 5CILH 2FJGB 2UY7A 3WFBL 1LO5B 1J8HA 1DVFA 4X7TB 4DWHA 4HGMA 5C8JB 2Z35B 1V05A 5CLTA 4KK8D 3V0VA 3HRZA 3U83A 1BFOA 1PG7L 4ZNEE 5SWQB 4OD2A 1AIFA 1FZMB 4Y1AD 1VADB 5EORL 1MEXH 4ZPTB 3DHJA 2APFA 5DMJB 3E8UL 3C5SB 5DMKB 4HIEB 4NNPH 5EZJB 1T2XA 3CK0H 4UILL 5AWNH 3SQBA 2J88H 5TE7L 3Q1SL 5B39B 3RKDC 2W38A 2RIKA 4GG8B 4JM2B 2OL3L 4PV8B 1T20B 4N0FA 2JJSC 5T1LB 3T65B 1B0RB 2VDNH 4IRJA 5LKNA 3MV8B 5K59E 1NLDL 1WITA 1LE5A 4WNQB 3MCKB 1FZKA 1S3KL 2EEDA 5B38G 4UT6H 3C6LC 2XQYK 1UWGL 2Y1VA 4NDMA 4KK5C 4C4KO 1MCWW 1N3NA 1PAMA 4HS8H 4LSTL 1KIQA 4IOIA 3MJ9H 3Q2CA 1RUKH 3QXDB 3LCYA 4O9HH 4I4WB 1R5VA 5ANMB 2BNUB 3PQYB 4M3KB 1QFWM 1DQJB 1TQCC 2K7PA 3PV7A 4Y4FD 2JIXD 1A6UH 4PP2A 3T3ME 3FO1A 3QI9C 5L6YL 1XF5A 4KKNA 3DROB 5CD5C 4L4VA 2DQTH 1K8IB 2ZUSA 4PRNA 2VRAA 4ZXBB 4JJHA 1CI5A 5T3XD 4X99A 4FG6C 4WI4A 2QADB 3G9AB 2NXYD 3IETA 1VACB 1ZT4A 3DECA 3F6LA 3MJ7A 2YRZA 3LKOB 4AQOA 1SHMA 4OCRL 3VFVB 5FA4B 5I17B 4PJ9A 3DO7A 1QP1A 3S35H 3S6CA 5FECA 1BFVL 4AL8L 5K33A 4BH8B 4JG0H 1YJDL 3I6LE 1F4XL 1OAXH 3UDWC 3TNMA 3V5HB 4NO0A 3D2UA 1MUJB 5C9JA 3ZYZA 3TBSA 4EI5D 2CDEA 1WZ1H 5DDHB 5I1CL 3KPPA 3RY4A 4K3EH 2MQ3A 3IB4A 1S7XB 3MOAL 4QRPE 3ZTNH 1UQSA 3CDYA 1TIUA 2X70B 5D2NA 2ATKB 1RZIB 35C8H 4UT7L 4BUGA 4ERSH 2ZOLB 4I18B 3WLWD 4J4PD 5JNYB 3O2DL 4X7FC 4QF1B 3BX7C 3B43A 2F5BH 2FIKA 4Y5XB 5FO8A 4AIZB 3WO3B 3O9WD 1SMOA 3BYTA 5DQ9A 2BNQE 1RFDH 3FB7B 2ADJA 1UG9A 3HCVA 5FGSA 2Q76A 4U1IA 5DHVA 1N59B 1XIWB 1YDPB 4K2UH 2VN4A 5AZ2L 1JF1B 1J7VR 2R1YA 4GBXB 4OUOA 4FFVD 2A6JB 4HUMB 5C0RH 5E70A 4LP4A 4KJYB 2DIBA 3MA7A 2HTLC 4JN1L 3RHWK 1IAMA 1VEMA 1ZWIA 4GS7C 4HKXA 2VLLA 3G6DL 5C9KA 1QEWB 1IQWL 1KIPB 2CDGA 4W4OA 2WBKA 4WFHE 2VLKA 5I16A 1GGIL 1AQDB 2FB4H 3MRFA 3MUJA 1Q0XH 4DVRL 3WFDL 1XZ0A 3BMWA 4P4KD 5I15H 2SEBB 3W0WE 4PG2A 4OLYL 4NJAH 3VWKB 2A6DA 2B1AL 3I6GA 3F7VA 4X4XA 3EOYG 2Z31D 3VJ6B 1PLGH 1HSAB 1LHZA 4JDVB 4P5TA 4NO2A 3ZKNC 4MA1C 5DWUH 3T0EE 1ZHBB 1MFEL 2VXUH 4J8RA 4P23D 1T4KB 5SX5K 5B21A 2BY2A 3TT1H 5HHME 3D18B 4M6NL 3SDDC 4G8FA 5IJKA 5SWZA 4KMTH 2HFEB 2G5BA 2MOVA 1SJVA 3CFJA 4U4BA 2B39A 4PBWD 5DUBB 3RAJL 5ITBL 1KJ2A 2BRQA 4IMLB 4DW2L 4Y1AE 2ITCA 4RGND 1PX4A 1CLYL 2BY1A 1HOCB 5LCVH 4ZYKA 4DJMA 3U0TA 4MNQB 4BZYA 1FGNH 3BYYA 3MXWH 4HDIA 4QRPB 5FO7A 2BJMH 4JGJA 2AQ3A 4PRIA 3EYVB 5MEND 5BVJA 3X12A 1LD9B 3ZLQC 5ALCH 3WJJC 3ILPA 3WDJA 3U9PL 3BESR 4NHUB 1OSZB 2PNDA 3BP4B 5EUOE 5DVOA 4XBGB 1LO4L 4KVNL 5LAXB 1RJLA 1W0YT 3H9HB 5BVPH 1YY8A 1G7JB 2VB5A 3UCRA 4DAGL 3B6SB 2BNQB 3GBML 4G42B 4PJHF 3SJVD 1IAKA 2CSPA 2JJUA 5ENWA 3KLAA 2ICWJ 4RFEB 3LVEA 3RY5A 2WV3A 3L3JA 2ZPKL 4NWTL 2EE6A 2UVFA 4JY5H 4R8WL 1BZ7B 2H26A 5F7EH 2DJSA 5DJZA 2G9HA 1RPQA 3VFRB 5LGHL 4WFFD 1FFNA 1EMTL 4LGSB 2L0DA 1R3LA 1KJ2H 2W9DL 5TE6L 2O61B 4KTEH 4I3RL 5IBLD 5IHLB 2HH0L 1T66D 1IT9H 3O3DB 5T3XE 5I8KH 1XGRA 3QO1A 3TPUB 4HF5H 4PRDB 4HUVB 4WI9A 4YHOH 4YHKH 1MFDL 2DLIA 1F5WA 5GHWH 3E2HB 4P46C 5HI5C 2B0SH 15C8L 5F9DC 5I19H 5ICYA 4OD3H 3TA3B 1BBDL 1FL3A 4JDTH 4NBZB 2I9LA 2VABA 4QGTA 3KAAA 5EA0H 4LU5L 2DQGL 4WEUD 43C9A 1MHPH 1X5YA 4BFBD 3T0EB 1BIHA 5F9OL 4F3FA 3PP4H 1RZ8B 4U7MA 1MJ8L 5HHMB 32C2A 1OM3L 4G9FD 1H3VA 4I77H 4L9DA 5IFHL 2YN5A 4U1JB 3REVA 2DN7A 1JGUH 2HVKA 2IPUG 2NLJB 3MLXL 4RBPH 3KPQA 4KTDL 3R06A 1TMCB 2NY6C 4POZC 2BC4B 4Y1AB 3ELAT 5D1ZA 3HI5H 3BP6B 2RR3A 4WVRA 3VGHA 1DE4A 4MD0A 5GSRA 5E4EB 3SDCB 4BZ1H 3VFSB 1JNJA 3BIBX 2WINA 5HPOA 1UM5L 1BD2A 5J1AA 4MA3B 4XNZC 5E2VH 3PWPA 1SY6H 1I7ZA 3RQ3A 5EUOB 5E99L 4TULH 5FYLH 3O8XA 4OFDA 3SQOL 1A14H 4R2GD 2C1OA 4H1LG 3HNTL 1G7MA 4JFQB 4XWOD 3VW3H 2R2CA 1KTRL 1FVDB 3B9KD 3JWDH 2DQFB 3FT4B 4P2QA 3N0PB 4O2EB 2FYYB 5J13C 3LKSA 1SYVB 3CCHB 4M9PA 5IFJA 3FO2B 4NKIH 4FS0A 1KIRB 1FBIH 1IKFL 3MRKA 1Y6NR 2A6IB 5B8CC 4QXGL 2JIXB 2F5AL 3ISWA 1RQ5A 4DN3L 5SWSA 1I7TB 3HE7C 2NXZC 5IBUB 3V4PL 4G80B 3GO1H 1T04A 1ZSDB 2HT2C 4WO4C 4P59L 1J12A 1HSBB 2XN9A 1VKXB 5KOVC 5BOZG 1B2WH 2OTUA 5JW3L 5BQ7A 3ZSSA 2EYSB 3S36X 1FFRA 3EZJB 5D71L 3EOTH 3C5ZC 3CDCA 3QEUB 4QHMA 5GIRA 5JHLL 3V4VL 1ACYL 4ZFGH 4R6UA 4MQ7B 1PW3A 1NGPL 4K9EL 2R0LH 2R56H 2VWEE 5I1LB 2UWEE 4OTXH 1Z9SA 3LH2L 2H2PD 2XYCA 4ZDHA 3GMQA 5IMKB 4XMPL 3L6FB 1MSPA 2IADA 2Z8RA 1B90A 1UENA 1JMZA 4EI5B 2FZ3B 2L7JA 4ODWA 4RGNE 3LDBC 2P8LB 4QRUA 4FOMA 1OPGH 4YX2L 4HS3A 2ORBH 4YIQA 5AYQA 5L9DL 5MENE 4PRAA 2CIKB 3W9DB 1FIGL 1KEMH 1II4E 1LQSR 1QRND 2XRAH 3REWA 2YEZA 3HAEA 1XGUA 1MAKA 3A0OA 4LOUC 3CXHK 5IVXE 1QBLL 5CP3A 3RGVA 2GFBA 3O9WB 2ED7A 3ILQC 4R97C 1V3JA 2VR5A 5JW4Q 5LQBH 2OL3A 3LN9A 4MB5A 2AJZB 1I1YB 3SJVE 4NRZB 5BZWB 1PSKL 4DFHA 5ELIA 4LQFL 4XPFL 3GI8L 4UOJA 4PGEB 3EFFB 1MOEA 1ZLWH 5CINH 3U6RA 3LKRB 4WFFE 3BVNA 1NKOA 5KSAD 1QNZH 2BOCB 4LVOB 4QTIL 1S7WB 4NQXB 5E8NA 4XVTH 2GY5A 4KXZH 5EN2A 3WFEH 1CICA 2MNUA 1JPSL 3EZ8A 5KSVB 3JVGA 3QP3A 2EDFA 3BO8A 2ZUWA 1PG7H 1T1ZA 1DCLA 3IRPX 3UZQA 3ZTJH 1D5XA 2Z8VC 5DK2A 1KTDB 5EORH 3R0MA 4S1QH 1WIOA 4P4KB 2XZAH 3GSVA 4FTVD 4KK9C 4APQA 1KJ3L 1AKJA 3E8UH 3WHE0 3K74B 3BDBA 3HAEH 2HT3C 2YD3A 3U30B 5TE7H 5E00A 2GTWA 1AGDA 3Q1SH 4PLJD 1B4JL 4IOFC 4PJCA 3BRGC 1ZGLB 3MQIA 4PR5B 4YXKL 3KXFA 4P23B 4GH7B 1MAMH 1NLDH 2UWEB 1UB5A 1RZ7H 1S3KH 4MB3A 4HUNB 2JCCE 1EO7A 3O3UN 2VC2L 2PXYA 3ARGA 3R8QA 1UWGH 1OAYL 2ICWB 5IB3B 3JWNC 4RGNB 1IEAA 1CT8A 1PYWB 4JO4L 1OF2B 5DGQA 4ORGB 3WL9B 1JL8A 4Y4HD 3JTSA 1P53A 2GHWB 2HRLA 3FCTB 5MENB 3DX9B 4PJ7A 3ULVD 3UPAA 3HC3L 4R0LA 5DMGD 3HRPA 4P57B 4U1LA 4JPIA 1ED3B 3EYSL 5L6YH 2RJMA 3O2DA 3DVGB 5E1AB 4F57L 1JK8A 1CDCA 1YPZF 5IVXB 4KXZI 4HFWA 3GKZA 5ITFB 1OTTC 5KSBE 2ARJA 1UA6L 3BEWA 4S2SA 3SJVB 3OJDB 12E8L 2EKSB 4UV7L 1PKOA 1JGLL 1P4BL 3WDHA 3NIGF 3WD5L 4AL8H 3RWHA 2O5XH 4O58L 3BFOA 3L5WB 2J7LA 4LF3A 5IMLA 3CXDH 5DJYB 1EVTC 2AJXL 4I48A 1A4JA 2VQTA 4BH7B 5IM7A 2Z4QA 3VFMA 4TSCH 2DQDL 5FOJA 5I1CH 4GKZB 3E6FA 3JWOC 3H9SA 5E7BA 3D39D 1Z9MA 4IIQC 3BPCA 3MOAH 4KZEL 1BWMA 2DQJH 3FONA 3GIVB 1WISA 4NNYB 3V4UL 2F58H 4UT7H 4NC1C 3RWCB 4KK6C 2NNAB 3O2DH 1U8KA 3QUZC 1VFBB 4JREC 5CGMA 1LEGB 4Y4KD 3X11B 2B8OT 1QZ1A 5JTWA 1TNMA 1PBYA 1GZPA 3PL6A 3Q3GB 1LGVA 5GGUA 2ZUVA 2JKXA 1A4KB 4EN3C 1I3VA 5EC2B 2AQ1A 4MZ3A 3BKYL 4ZSOE 4BQCA 5AZ2H 2JCCB 1EZVX 3L3KA 5BRZA 2NR6C 4NFDA 1FVEB 4OFIA 4XC1L 2X4SB 1KC5L 4Y8AA 1EFQA 3DMMD 3C08L 3P4LA 4L3ED 5LXGL 3G6DH 2RAMA 1WT5A 4KKLC 1YUHB 1IQWH 1X5XA 1QRNE 5T3ZD 3KWWB 1GZQB 1DQML 3IDMB 1E27B 4DTGL 1YN7A 3WO4C 1GGIH 3MNVB 4LMQE 3SY0A 1R3HA 4L4TE 3MBEA 3QHFH 4DVRH 3WFDH 4C54A 2WWKO 5EIIB 3GRWA 3VFTB 5C0JB 3MV01 5FUCE 4PTTA 4KY1H 3ABZA 4OLYH 2X5PA 4QRRD 1S5HA 2B1AH 5KSBB 2BVQB 1YY9D 4LHUD 4JY6A 5JZ7D 3QIUD 3ZE2F 3L95A 3V6BR 4F33A 3B9KB 4FXKA 2BOBB 1INDH 5IB5A 3WFZA 4O5LL 3IJSB 1JYWA 3DRQB 3QEQE 2FBJL 5JDSA 3MACL 4D0BA 3RAJH 5ETUA 4X4YB 5HYFA 4DW2H 4DUWA 1T0MA 4AENB 1CLYH 4CADB 5C3LD 4JFED 5ESAA 1EBAA 2ITDB 4FTVE 3RIAF 5EU3A 1UZ8A 1INQA 4EDWH 3I3BA 3HS0A 3U4EA 3TJHD 4LLWB 4AT6A 1A2YA 4QNPF 1ITCA 4AEFA 4NOFA 5CGYD 1HHKB 4WU7B 5KN5A 3BWAA 1Q9KA 5TH2B 3SDDB 5B38B 4NO5B 5HTSA 1X3DA 3ULUF 4J12A 4WWID 3OKOA 3HPJA 5EPMB 1T5XA 4KVNH 3ZDZE 3DSFH 1VB9A 5D5ME 3OR7A 4G9DB 4DAGH 3O2WL 1OGAE 3QO0B 1MY5A 2CD0A 2EDQA 1H8OA 3GBMH 4NQUA 1WBZB 1IGMH 2X05A 1Q72L 4ZSOB 3F12A 4KRMB 3P4MB 4M5YL 1B9ZA 3Q5TA 4NWTH 1JPTH 4PUBL 5IJVB 1T89A 1EMTH 3WIFB 4GQPH 5C2BL 1QR1B 5T1KA 1U8QB 3ULVE 1UWXH 2NY1C 1U3HC 2W9DH 4WI8A 5TE6H 2B4CL 1C08B 3NFPB 4I3RH 4CMMB 1J0HA 1QRNB 2BSRB 3L3GA 2Q7YB 3UTTD 2CR6A 5LGJA 4R7DA 2IALB 3S34L 3V0WL 2EE9A 3LPGA 1I7UA 5HYQB 1DR9A 4KJWC 3WFHB 4L4TB 1FYTD 3R4DA 5A2JH 1BZ9B 3AMKA 4WTWA 4D9QD 4O02L 4UAOC 1K4DB 4X8JB 2EC9T 1NMBH 1I8MA 2FEEL 3QA3A 3ARUA 15C8H 4ZUVB 3VXTB 1BBDH 3GSRA 3ZHLA 1EGJL 1S7RB 4NZTH 4P9ML 5HJ3A 4OCYH 1H3PL 4XMKL 2BDNL 3ULUC 2IPUK 3JV0A 4FP8L 4FN0A 5F9OH 3A6CL 5D7IA 4JLRA 1G6VK 4HGKC 4MDJA 5IFHH 4K23L 3B9EA 4DZBB 3QEQB 2MQ0A 1T3FA 3MLXH 4HAGA 4DCQB 4JG1H 1FL6A 1I8IB 4YEFA 2EIZB 2CRZA 4Q2ZB 1FO0L 3ARBC 3BKJL 3GHEL 4FTVB 4JQVA 2D9QB 4ELKB 4LL9A 2W0KA 5I8EB 4Y2DC 3FQNB 5ACMA 4PJBA 5EO9B 2X1OA 3GMMB 5DURD 3G5ZB 3KNBB 3IFNL 4UIMB 2R2HA 5D5MB 5ISZD 1MCCA 5J7CC 3TF7C 1L7TL 1JZ7A 1OGAB 3TPKA 3W82A 2NY6B 2WBWB 3HNTH 1KENL 4TSBH 4Z76A 5F96L 2G60L 3IVKA 3QRGL 1QKZL 3KPRD 3QH3A 4ZD3L 2YN3A 2YXFA 3VXUA 3CZJA 5E5MA 5GISL 5IW1B 3RVXD 1NMAH 2BNRD 4L3EE 2OJEA 1IC5H 4TVPH 3MLVH 3FZUD 4UDUA 5T3ZE 2BSED 2EXYC 1IKFH 4TOYH 5C0CD 5HY9A 2NW3A 4QXGH 4K71C 1BOYA 5AAMA 2F5AH 4X98A 4DN3H 3BZ4B 4QY8A 5C0ND 1N7ML 3N1MC 2DOCA 4GMTL 4U3XA 1J0IA 1IC7L 3V4PH 1AFVL 2CLVA 2X4UA 4BKLA 4P59H 3QZWA 1UJ3B 2CKNA 3STZB 5C08A 4UTAL 1MIEL 3BPOC 4QRRE 5JW3H 3CFIC 4OZIA 3WUWG 2A6KB 3OPZL 1BLNB 1BOGA 4TNVF 1IGCL 3CFBA 4M4PA 1MCPH 3GSNB 5J13B 4NN5C 4GKNA 3V4VH 4I2XA 1ACYH 2FR4A 2AK4D 3MFGB 2VQ1A 1NCNA 4M7LH 5B8CB 4HHAB 4R9HA 2IH3A 3MA9L 3PGDA 4PJ8D 2CXKA 3LH2H 4HJGB 4K3GA 1SEQL 4P2RE 1VEOA 2DIAA 2VLJA 4WO4B 5ACLA 3MPCA 5GGVY 4JFEE 5HHNB 3M45A 4YX2H 5FA3A 5HYIA 3E0GA 4Q58C 4LSUH 4WUUA 5L9DH 3WNOA 1GIGL 3MNZB 3TZVD 4F8QA 1FIGH 5ESVB 5I1DA 2DM7A 4EEEA 1QFUH 5HYEA 1MFBL 1D9KA 2F9BT 4KJPC 4EOWL 1MCEA 1NAMB 3OXSA 4JPWL 2W92A 1D5IH 3SO3C 1QBLH 2A9NH 4E5XB 3CVIH 4HCRL 3S37L 1ZVHA 1AHWB 3VD7A 5EC1B 3QEHB 2EDYA 3ZE1F 3GJEB 2DBJA 4G6JL 3TIEB 1NBZB 1PSKH 3NZ8B 4XPHL 3GI8H 1PZ5B 3I2CL 4LSDA 4IJ3B 4PJGA 5BOPA 4YPGA 3DVIA 2VL5B 5F6IC 2AJSH 3BZFA 4JFYB 4FZEL 2C4FT 4P3CL 2LTQC 4RFNC 1HNGA 3D25A 2OR9L 4QTIH 4L3EB 2OTWB 4LCYB 3RWGA 3V5KA 2YWZA 5ESQB 2R23B 4KRPC 1JPSH 4FQ2H 2EYRA 4LCUA 4ONGL 3O0RL 2YA0A 3A6BL 5CBAA 1FYTE 3L1OL 1I8KA 3RA7H 1NGYA 4D9QE 1BPVA 3WN5C 1YC7A 1IEHA 3T77A 1JHKL 2X4NA 5IK3B 3RPIB 5GS2H 4QRRB 5J6HB 5DJ2A 1YNKL 3PABB 5DJ0A 3QIUB 3LQZB 1B4JH 1CS6A 1A9BA 4FQQA 3O2VH 5DD5L 4YXKH 1MHCB 1YEGL 5KAQF 4K7PX 1VGKB 1F45A 1V3MA 4PJDE 5H35B 4CVZA 3NN8A 3BZEA 2A83B 4P2RB 2J8UF 4ZS7L 4LPYA 5T5NG 1OAYH 4AM0A 5HDBF 2LAAA 5GRJH 3FQWA 1OHQA 2EDRA 4G7VL 4X6EA 4JFEB 3UJJL 1FVCB 2NY0D 4IRJC 4TUOA 5FGCE 4ELMA 2APWA 3FO9B 3V5DA 4RWYL 4HIJB 3DTXB 5KJRL 2QTEA 1IJ9A 1ADQH 2VDPL 3QIWA 3GIZL 3HZVB 3HC3H 3QPQC 3UC0H 3QNZB 4M4RA 5ADPL 4NPYA 2C3GA 3QB7C 4H1LB 4KTYA 5EFIB 5DD0L 1DDHA 4GW5A 4F57H 1YQ2A 5F1NA 5IVZA 4NFCA 3VGEA 1O7SA 4R96A 3QXVA 5IW3A 3HZMA 4HWUA 2PN5A 4GMSL 3S98A 3RNQA 2D2OA 3DV6B 5F6HI 4ZFFB 1UA6H 1ZKAA 3TH3T 4BYHA 3KPRE 12E8H 1HH6B 4JRYA 2BERA 4UV7H 1XF3B 5JPMA 1ZEAH 3NAAL 5FYKD 4BUHA 3L5IA 3WD5H 2BNRE 4PLOB 3P0VH 2APTA 1EHAA 3VFPA 4O58H 3TIDB 4FNLL 3DRTA 5C0CE 4LAJH 4PBXA 1LDPL 2AJXH 3DVNA 3I84A 1T1WB 3U0PA 3VI3F 5L2JB 2DQDH 2IMMA 4PJ9C 3RIAK 1X5HA 1NMCC 1NCAL 3FFCE 2DM2A 2A2QT 5JO5A 2RHEA 3R0NA 1FYTB 1IC4H 2EE2A 2IG2H 2QL1A 1WICA 4EZMA 4CDGC 1S5IL 4LCWD 2FECL 1DUYB 3RVVC 2AK4E 5JA9A 1O0VA 2P5ED 4G8EB 2XZCL 2DF3A 3X3FL 3WIIL 1YEKH 4QHKI 3VWJA 2RCSL 2NYYC 3CC5B 3TO2B 4PJEA 3P11L 4ZUSA 4XBPA 3ARFC 1TZHA 4ONHA 3QWRD 1HYRC 5GGTL 4LLVA 4E41D 2ADFL 4QWWD 4NNXB 3BKYH 4RRPA 4PJDB 5IGXL 4OLWH 4IIQB 1C5DA 4ZO7A 1BBJA 4S0TD 1GGUA 4AK1A 1KC5H 3QUZB 1ZS8A 2WSKA 3FQTA 1M71B 4OCMC 5JQ6H 3VFOA 5LXGH 1A1MB 2Q8AL 5DRNB 3FT2B 3MO1A 5L2KA 5IW6A 2N1KA 2PO6B 4G6AC 4DTGH 1G6RL 2XA8L 5KS9A 2YKLL 3MRBB 1ETZB 1ZHNA 3MLWL 5KVEL 3EYOA 5D70L 5DURB 2YS4A 2AERT 5GGVL 4POUB 3BPNC 1QBAA 1WGOA 2FJGA 5ICZA 3T2NL 4X7TA 2VE6B 3IAGC 4DKFH 2FSEA 2V7NB 43CAA 1BQUA 4W4OC 5E56A 3FT3B 3KPRB 4WUKH 3KJ6H 5JHDA 1W0VB 3K4DA 4KKCD 1S7QA 1GH7A 1T7YA 1CYGA 1AP2B 4Y16D 2BNRB 4MQTB 1N4XL 3PWJA 3WO4B 2RFXB 4HIEA 2XKNA 3PHOB 2E8ZA 3KPMB 2FBJH 2ENYA 3MCLL 2UYLB 5C0CB 4MNHB 1GHFL 3OBAA 4CL7A 4I5BA 2ED9A 4MAYC 2DYPA 4YBLB 3MLSL 3MJ8B 1DVFD 1WC7B 2Q7NA 4DOHE 3FFCB 1BFTA 4WNQA 4I1NB 3RUGE 2OSLB 2ZP0T 4PGDB 3K1KC 2Q1EA 1SJHB 4NQSB 4HD9A 3WEXB 3GM8A 1QHOA 1NDMA 5D2LE 5I1HH 2AK4B 1F58H 3NTCL 3OXRB 1PX3A 1KJMA 1L6XA 4M3JA 2D03L 3QXDA 4K7FA 5ANMA 3O2WH 3RWDA 4PJ8B 1IRAY 1DQJA 3U0WL 2W0PA 4D0DA 5HI4C 1U8NA 4OZ4A 2XICA 4M5YH 4QOKA 5IEKA 4PUBH 2EDJA 1QLEL 1EZVY 1P9MA 5C0DB 5C2BH 4RNRB 4U1SB 1ZT7B 3TZVB 3GSWB 4P3DB 3TFKD 3UTZA 3AGVA 3GJFH 1S8DA 4GAYA 2B4CH 2BHUA 2D4FA 4LDLB 1QBML 3QG6A 1UM4H 1PD6A 5TQ2H 1F4YL 3V0WH 1TLKA 4NSKA 1RMFH 1KCLA 2ICEB 3D69A 4LKXB 3H7BA 2HTKD 4TNVK 4PGBB 3LEVL 1M4KA 1NGXB 4HH8A 4NBYB 2EH7L 1BECA 3N1FC 4PGCB 5M94B 3KHOA 2DICA 4IS6B 3INUL 2VDRL 3OL2A 2EKJA 1EGJH 4JO2H 5FYKE 4A6YL 3ZDYF 4P9MH 1H3PH 3E6HB 2BDNH 4XMKH 2NY1B 3HAEG 4ACPA 5A3IC 1JWMA 2ATKA 2GJ6E 1YMHB 2VXSL 4RFOL 5L8JB 3A6CH 4OM0L 1N6VA 5IMMA 2DI7A 3V6FB 4I18A 1I3GL 4C55A 4QF1A 1FORL 2D9CA 4J7RA 4ETQB 2F54D 1KPRA 3MGOB 1HHGB 3OAYK 1VSCA 3U4AA 3D2UD 3G5VA 3GI9L 4KK5D 4AJ0A 3FB7A 1HIML 1FO0H 3KPLA 3GHEH 4GRWF 5IROA 1DBAL 4C59B 4DOHB 3KYKL 1Z9OA 3MRJB 2V2TA 4LPVA 4PJXA 1TDQA 3B2VL 1JF1A 4LCWE 3RUGB 5K9KA 3RNKA 3MFFA 1M7DA 2P5EE 4OUUB 1OARH 1NL0H 4EDXB 2XPGA 4TNWF 1FNFA 3N9GL 2NY3D 4Y5VB 5D2LB 2I07B 1GVIA 1FFOA 3IFNH 3QCTL 2BSTB 4E41E 5HPMB 2P24B 3BP5B 3VA2C 4FQXC 1NH6A 4ZOBA 1KENH 3VFWA 2WQRA 5F96H 2G60H 1Y18B 4YDJB 3QRGH 4ZD3H 4P9HL 3VH8A 5FUOL 3W11D 3BDYL 1D5ZB 1ZLUH 2XY2A 2NX5E 1WAAA 2XFXA 1DUZA 2NY0B 4UQ3B 3FHAA 2R8SH 3LQAL 3RJDA 1VFAB 4X0KB 4XH2A 4HULB 1JYNA 1U3YA 4BK5A 3LEXB 3OF6A 3KLDA 3TESA 2FX8H 3DWTA 4J3VA 1XF4B 4GMTH 3VXME 1ORQA 4N5UA 2ERJC 3DX7B 5HHPB 2A1WL 4XVSL 3K0WA 3VFGL 2CJUL 3NCJL 2VLKD 4XAWL 4UTAH 4HCRA 1ZAGA 3P2TA 5FFLA 1CCZA 2EDEA 1NDGB 5DSCA 4MXWL 4MCYA 3OPZH 5IKCB 4P5MB 5EUKB 1AGEB 1IGCH 3DIFA 2EECA 5DTFA 4OFYA 3D6GA 4BFGA 2GJZB 4LSVH 3FRUB 5HGHB 2MKLC 3OX8A 4JRXA 4O00A 3V0AC 4MNQA 1RV6X 4J3SA 2ZG2A 4NQCD 3L7EA 4WV1B 1AD0A 1XFPA 4QRTA 4UINL 1P7QD 1AQKL 4P5TD 4WHCA 1IARB 1LD9A 2GJ6B 1SEQH 2R2EA 4UBDC 4X6DA 1I7RA 2H32H 3U7WL 3DV4A 1OSZA 4R7NB 1S7SB 2J4WL 1J8HE 3FB6A 4NUJA 1JBJA 4LASH 4ODTH 3DJ9A 3ZKXC 3ARSA 3P9MB 4NN5B 3B6SA 3TP4A 1GIGH 3FRPA 2YD9A 4DUXA 4P0DA 5C09A 1MFBH 1ONQB 2W65B 3C9NA 3CPLB 5DVMA 4OLXL 4JPWH 4LCWB 2P4AB 4ZUWA 2CLZA 3KDMA 4PRID 2H8PB 1YZZA 1A8JH 2P5EB 1BHGA 1Z9LA 2YWYA 2ARJQ 4JZJB 4MMXC 5DC0A 4G6JH 5ICXB 4E41B 2J6EL 4JN2B 4XPHH 1A9EA 2H3NB 3I2CH 1I1AC 3QDMA 3T0VA 3O3DA 5I71C 4M7KL 4ZOCA 3RGVC 4FZEH 4P3CH 5KSUA 3ZYJA 1E6OL 2NX5B 5DZOA 4JHBA 3U4BL 3UTQA 1G7LB 3ESUF 1ZGLM 1QLFA 4MJ6A 2BVOA 1NCDL 3NZHL 4NP4H 1KG0A 3V52L 1RY7B 2G5RA 3O0RH 3UYPA 3RTQA 1DLFL 1F6AA 1BWWA 3VXMB 4YFDB 4JPKL 4AQ1B 4L4VE 1W8NA 1EFXA 2YPKB 3NA9L 5FYJE 2NTFA 5EZOL 3PWVB 1YNKH 4JGMA 2I9TB 1CICC 1TZGL 3O3AB 3JVGC 1BQHA 3B5HA 1A7BA 2BCKB 5DD5H 3AU1A 2DQHH 1KPUB 4XCCL 3MLYL 2QKIB 1U8HB 1BP3B 5A16A 4F2MA 4M6ML 4H25B 4ZS7H 4PREB 3IF1B 4FQHB 3WN5B 1RZFH 2FWOA 5F1KC 5F7DA 5JMRA 1S7UA 1QG3A 2GAZB 3UJJH 1J8HB 1DVFB 1F3DJ 1RZKC 4Z8FL 4MAUH 4K8RC 4RWYH 3V0VB 1BFOB 5CWSA 3VU2A 1AR1D 4OD2B 1AIFB 5D1ZD 5D2NE 1ZTXL 4OJFL 3DUUB 3MOBL 5DD0H 3PP3K 1S9XB 5EBLA 1MF2H 4M8QA 4GMSH 1BD2D 4TSAL 3U46A 1KTLA 3QUML 5EOCJ 3FN0L 3VRJA 2BFVH 4Y4FA 2B1HL 1FHGA 2JIXA 1HK6A 4N0FB 5GGTA 4IRJB 4R0LC 3O8XD 4G8GA 4N0CD 1ZHLA 5E2TL 1OAQH 3NAAH 4XP6L 3U79A 2ESVD 3EYQD 1FZKB 1LE5B 1ZSDA 4Q9QH 1BQSA 4NT6B 3VI3E 1MCBA 4CKVX 1P5VA 1OGTA 4B7LA 1LWRA 1QPXA 4FNLH 4NDMB 2C3HA 3JTTA 4P2QD 1A7OH 2AJYH 1QSEA 3K8KA 3RBSA 1LDPH 3CH1A 1N3NB 4X80L 1KIQB 4IOIB 3C60D 1OW0A 4OZGF 5EULV 3KPSD 1R5VB 3HZYA 4LEXH 4PP1D 3AC0A 4ALAL 4CJ0A 2VLKE 1A6WL 3FO1B 1WZKA 3GKWL 5SWSD 3SKOA 3SE9H 2OXGA 5DQJA 1XF5B 4M7JH 4L4VB 1HQ4A 4PRNB 4EI5A 2XN9D 2R69L 3OKLB 5D96C 4LLQA 1PEWA 4X99B 4XCNA 4S10A 1HZHL 3SCMA 3IETB 3WIIH 1GGYA 1IGTA 1G7QA 2YD8A 1ZT4B 5D8JL 3P11H 5F21B 3MJ7B 2Q3ZA 5GGTH 2CR3A 2ADFH 2V7HA 4LPXA 5FECB 1VCAA 5IGXH 4EIZC 3PV6A 4J4PA 1RUQL 1CN4A 4K7PY 3OB0H 4NCDA 4GLRI 1DBJL 4UT9L 5SWZE 2V5SA 4PRPD 3TNMB 4NO0B 3D2UB 3O9WA 4PG9A 3QUXC 1U8LA 5A2KH 4MNGA 4H88L 2OCFD 5C9JB 5J3HC 4YBQC 1D7FA 1FE8H 3TBSB 5I1EH 3GBNL 5MEQB 3MUZ1 1JZ5A 3SO5A 2CDEB 5JLZA 2Q8AH 3IDIA 3KPPB 1NJ9B 3EFFA 3NVQA 4WTXA 1RZKH 1UQSB 4K8RH 4PLKD 4PRIE 5E8PA 5D2NB 1G6RH 2XA8H 3X17A 4JGUA 5TPWL 1GYAA 3LKRA 1CFVL 3MLWH 4P5KB 2NY3B 5D70H 5E8EA 1WEJL 3P0GB 1MFCL 4J23A 1A0QH 4PRBA 2FIKB 1AGFA 3V6ZA 3BSZH 4N0UE 2W9EL 2NY4C 3HI1B 2XQBL 4EXKA 5CEYA 4MD4A 4KHTL 2ADJB 2Q76B 5GGRY 1KTDA 3GMPA 1HH9A 4U1IB 4RGMB 5DHVB 4M5ZH 3MBEC 2FIRT 4JFFA 1HEZA 2FECI 2R1YB 2GK0A 1CK0H 1R3KA 4NM4L 4PBVC 4LLUB 4KROD 4HZLA 1DANT 4GRLC 5EH1A 3MCLH 1HINH 4G6ML 3MA7B 2Z31A 3KYOB 1GHFH 3AY4A 1ZWIB 4HKXB 2VH5L 3EKCA 3GFUA 3MLSH 4FQJH 4HUWA 1INEL 3I3EA 1S78C 3TEUA 1NGQL 5D7JA 2O5YL 2CDGB 2LVEA 1EXUA 4R4ND 4IRSA 5DQDL 2VLKB 5I16B 5IVNA 1ZLSH 3WFCL 3MRFB 3RVWD 3O6LL 4TNWK 1XZ0B 3EDDA 1FNEA 2P49B 4APQD 1AKJD 2NZ9C 4GRMA 4X83A 1PYWA 2M26A 1OF2A 4LIQL 2A6DB 1JCKA 4A6YA 2D03H 3I6GB 2DI9A 3F7VB 3Q0HA 4WW1A 4HJ0D 3V8OA 1D3CA 2GSIA 3U0WH 4P5TB 4BK4A 4NO2B 4HMDA 1CG9A 4B53A 3KXFD 4J8RB 4BM7A 5I73C 1OCWH 1ZMYA 5ABDE 3S96A 5C86A 5I9QC 1IAIM 4G8FB 3QHZH 5SWZB 5F7UA 2G5BB 1QLEH 2PXYD 3CFJB 3T0DA 3ARGD 3F5WA 5D7IF 4ODSL 3TBTA 1KJ2B 3RWFA 3B9AA 3EFDL 4LHJB 4XHJD 4HKZB 3OJDA 2ITCB 3OHXA 5IIEA 3S36H 4IMKA 4ZYKB 5JXEA 3LB6C 4OB5H 3U0TB 2IAMD 4Y89A 3OKNA 4RCAA 2WWMD 4HDIB 5FO7B 4B7IA 1F4YH 4PRIB 3QDJA 5BVJB 3X12B 1E4KA 1BD2E 3S5LA 3TCLA 2D7PA 2FGZA 1C8PA 3QAZB 3PWPE 3ILPB 3MRPA 4BZ2L 3D5OF 3ZDYE 1MLCA 3LEVH 4LNRA 2EH7H 1V7ML 4URTB 3RDTC 1RJLB 3INUH 2VDRH 4N0UB 2BP3A 2ADGB 1VFOA 1YY8B 1ZVYA 4KV5E 4PTUA 4JDZA 4TTGA 1IAKB 2XI9A 2HKFL 4RFOH 2VXSH 1IKNC 4D8PA 4CW1A 4PD4J 3L3JB 4OM0H 2ZUXA 4P2QE 1CGYA 1I3GH 2WANA 4KJQC 2HLFC 5BV7C 5DJZB 5GS1C 3VXQA 2G9HB 4K07A 4J1UA 1FFNB 2HYMA 5TF1L 3QDHA 3AM8C 4L1HA 5CJQL 1CU4L 1R3LB 2YR3A 2EDDA 4MLSA 3Q3GA 1HIMH 3QDGD 1A3RL 4HWNA 5SWSE 5LWYL 1A4KA 1CIDA 4HBQA 5INCA 3KYKH 2APXA 3H9SD 4ZAKA 5FM8A 4G9FA 2JCCA 3B2VH 2XN9E 2QQQA 1I3RA 1E6JL 1XGRB 3QO1B 4FFZL 5GRZA 4N5EC 3TBVA 4ZTOL 3OAZK 3TO4A 3N9GH 3C8HA 2V5YA 1VPOL 1PQZA 3IRZA 4HH9A 3T8XA 1BVLA 2J1KA 3QCTH 5ICYB 1R3JA 1FL3B 1YUHA 4HC1L 4PB0L 4JQVC 2I9LB 2VABB 4P2OD 4YQXL 2AGJL 43C9B 5IR1B 3KJ4B 3PL6D 3P40A 4O51A 1NFKA 4I0PA 4F3FB 3NCEB 5FUOH 3BDYH 2VISA 2BZDA 4OT1L 4AH2A 3C09C 3UTPE 2APBA 32C2B 5CJOH 5DFVD 4NKQB 1U93A 2BRRH 5BRZD 2CO6B 2UUDK 1HILA 3G6JA 2HVKB 2OXHA 3CFEA 3LQAH 3KPQB 1JP5A 1JGVL 3R06B 5I76A 3T0WA 4PD4K 5D1ZB 2V2WB 5DC9B 1BJMA 5IESL 1DE4B 4MD0B 5DD1L 5GSRB 1HKFA 1KELL 2B2XL 4PJAA 2WINB 4WWKA 2A1WH 4XVSH 3VFGH 3NCJH 2CJUH 1BD2B 4XAWH 1Z3GL 5J1AB 1P4IL 3DRQA 3PWPB 5F9JB 5JPNA 4MXWH 3OG4B 1FQ9C 3VCLA 2VITA 2Y72A 3TBWA 1EAPB 2J6EA 4RX4D 3BH9A 3D87B 3O8XB 1YYLH 2ZUQC 5D1XC 2ITDA 2C1OB 1DQTA 2PETA 3P4NA 4UINH 2DM4A 2HMID 1T7VA 3O6FC 2RB8A 4KUZL 4P2QB 1IE5A 4EN3D 2ERJB 3U7WH 4PJGF 3LKSB 4AY0A 4YDKL 3FOMA 2J4WH 1VERA 2J5LB 5IFJB 3BE1L 1T1XA 4F7CA 3C2AL 3MRKB 1R24A 5E2JA 3QO0A 1DP0A 5D1QD 2V5TA 5J57B 5SWSB 3RVUD 1GAFL 5L0QB 5DZLA 3BIKA 1T04B 4OLXH 4DN4L 1NANI 2XN9B 2XTJC 4ZUUB 3ARTA 2OTUB 5BQ7B 1CD8A 3ET9F 3PXHA 2P43B 1MRDH 5F8QC 3QIBC 4QHMB 5GIRB 3RPKA 4PJCE 2EIDA 5BO1L 2X7LA 2Y6SC 2NTSP 3N1GC 4JVWA 2J6EH 3KXFE 4LRIA 3PF2A 1ITBB 3SGKA 5ID0A 5FHBH 2IALA 1VESA 3O4OB 4ZDHB 5HYQA 3MUY1 3GMQB 3WKML 2MJWA 3CVHH 1E6OH 1CDJA 3QULA 4XCEA 2IADB 3U4BH 3WSQL 2H45A 4WEMB 4ODWB 4M00A 1CF8L 1B0GA 4QRUB 4HS3B 3VXTA 3V52H 2YRLA 4YIQB 4RRPG 3BMVA 4JKPL 4PJ7E 4PRAB 5JIHA 1DLFH 2JE8A 2AS5M 3MTRA 5C6WH 5KSAA 5C0GA 4JPKH 5CS7A 2YEZB 3REWB 5L7XL 1RK0A 2XACC 3HAEB 1XGUB 2XXMB 2HJFA 1GXEA 3NA9H 4HXBL 3QUMA 5EZOH 3RGVB 2GFBB 3DETD 1TZGH 4NGHH 1MH5A 3RL1A 1Q38A 2OL3B 3Q48A 5IOPA 5DJAA 5FGBA 4Q6IC 1FLRL 1Z2KA 3O81A 2X9YA 4ONFL 5IB2A 3MLYH 4UIKL 3KGRA 5FDWA 4ELKA 4YWGL 3DO3A 1KLGA 4OIBA 2E7BA 4KROB 5I8EA 3U6RB 1J1PL 2VUYA 1UACL 3DX6A 3BVNB 3JV4A 1YNLL 2JF1A 3LN5A 2EDHA 3O11B 3V9FA 4UDTA 5E8NB 3OJMB 5EN2B 3QDGE 5DT1L 2C3WA 4MXVE 4Z8FH 1CICB 1JUFA 3H9SE 1LK3H 3SKMA 1JHLL 3BO8B 1D5XB 3IDXL 5DK2B 3HMXL 3KPOA 2DS4A 5H94A 4IHOA 1W72L 3TT3L 2VXVL 1QYGL 1U92A 3GSVB 3VMPA 4APQB 5IW1A 2YUZA 4WY7H 2H2SC 1AKJB 3PHSA 1T6WA 1UM6L 4TSAH 3QUMH 1TJIL 4Y4HA 2GTWB 1AGDB 5E00B 3FN0H 4C83A 3RRQA 2B1HH 4PJCB 2HJKA 3MR9A 3OQ3B 1OWRM 3KXFB 2DLHA 5GZOC 5E2TH 1UB5B 5F88A 4PJEF 4XWGH 5BRZE 1HHIA 1LDSA 2DMKA 5CHNA 1K85A 4P2CG 2PXYB 3ARGB 2B20A 3MROA 5I74C 3VXUD 1T03L 3T0BA 3UZVB 4X80H 1IEAB 3VGBA 1CT8B 2E6PA 2IAMB 1FSKB 3JTSB 4H0IA 1CXKA 2YD6A 1E4XH 4PJ7B 4KRNA 5IQ7H 2IQ9H 1A6WH 4R0LB 2VYRE 3GKWH 4U1LB 4JPIB 4Z7VE 3FB5A 1RIVL 2WBJC 2YPLA 3C6SA 1JK8B 5FUZL 1UVQA 4N90E 1C5BH 4HFWB 2R69H 3NCBB 5C08D 3KLHC 3ZZ1A 1HZHH 4DGYH 3D39A 2ARJB 3BEWB 5AUMA 3U48A 5CSGA 3LMJL 3C8KA 3DURA 2DB8A 5HVWA 1XGQA 5AZEL 4CUCA 3RWHB 1RUQH 3WNLA 2F15A 5EU7C 1F90H 1DBJH 2OLDA 4Y4KA 3ZSTA 5IMLB 4H88H 1G9NC 4IRZH 4F7MA 2YPVL 4I48B 1A4JB 5TQ0H 3QDGB 5IM7B 2Z4QB 5EBGA 3QUYC 3VFMB 3NIDE 1HI6A 5ILTL 3LHPL 3E6FB 4F9PA 3H9SB 2CK0L 4WFEE 3I85A 2I5YL 4N8VA 1G7HA 3BPCB 5ERWA 3D3VA 3FONB 5TPWH 2R1XA 2YOCA 1CFVH 4Z7WE 2EXWC 4DKAA 3ARPA 2XIDA 1UYWL 4L5FL 1D9KD 5GGSY 2PYEA 3DMMA 5CJ8A 1U8KB 4WHYH 4PIRF 2C26A 5GS2D 1IFHL 5DJ8B 3SGJA 3MLRL 5E9DD 4OLZL 2VZTA 5ESQA 4NCC2 4NN7B 3UJTH 2MWCA 2XQBH 1TCMA 1KCVH 1GZPB 3PL6B 4KHTH 5HD8C 1YN6A 1A47A 3LKPA 1T83A 2ATPA 3L3KB 5BRZB 3I75A 4I3GA 3CSYA 1QSFD 4NM4H 5F6HJ 3U7YH 5JW4R 4EUPA 4WEBL 3QXTA 1X5AA 2HT4C 4LHUA 4XNYH 3PABA 4G6MH 3QQNA 4RMUA 4LDEB 3IDGB 1IAOA 2VH5H 5E4IA 3QWOA 1INEH 2IBGA 3SE3A 2R9HC 1OOAA 1P5UA 1UC6A 1NGQH 1ORSA 1XCQA 3VH8G 2O5YH 3DXAA 2BVYA 2VO5A 3LY6A 5DQDH 4CDHA 1YN7B 2Z9TA 4OI8A 3SY0B 4KGLA 1R3HB 3WFCH 4Z7VB 3MBEB 3VDAA 4XTRD 1OLZA 5L8LB 1BGXL 5JIIA 4FQCH 5L88L 1U95A 1YEEL 4KKAC 2F19L 1K9TA 4JFEA 3QNYA 1S5HB 4LIQH 4OAWA 3U1SL 4JY6B 4NKDA 3EJZC 3L95B 4F33B 3CLEH 3SDYL 4GO6B 3ULSB 1MEXL 4FXKB 3QNZA 1AJ7H 5D7IE 3GSOA 2EICA 5IB5B 4NNPL 3FHQA 3CK0L 4KDTA 5AWNL 4QHKJ 4EUPH 4OGYH 5I8CA 4ODSH 2HG5A 5ETUB 3UZEA 4WDIA 1T0MB 3EFDH 4JKKA 3DYOA 3HR5A 5DJDA 1FV1A 3WHXA 1VFUA 1UZ8B 4V2CB 1INQB 4OKVA 2IQAA 4KRPD 1GGCH 3HS0B 4OF7A 4O4YL 3U4EB 3L3OA 2OX5A 3QIWD 4ZXBC 3TVMD 4AT6B 4PJBE 3RZCA 4Z7WB 1A2YB 4AMKL 2R2BA 5K59F 3WJLC 5KN5B 4BZ2H 3BWAB 4U1GB 4PJXF 3OKOB 3HPJB 1T5XB 5GS0C 2X2YA 4LSQH 1AO7D 3MJ9L 1H3XA 1H3UA 3UTTA 3OR7B 4O9HL 3RWJB 4TUKH 4JRYD 1PZUB 3VXUE 4B41A 3F12B 5EDXA 2R39A 3HPLA 4NCC1 1JHTA 5DS8A 1DUYA 1CLCA 2PYFA 4YK4B 3QQ4A 1H3WM 5TF1H 4YC2B 3FKUS 3CU1A 5T1KB 1CU4H 2XWBA 5D6CB 4XPTH 5LWYH 2ZWLT 3L3GB 3UTSD 1TXKA 5FV2A 5LGJB 5FB8A 1OLLA 3IAQA 4R7DB 1EUTA 4I18C 4ZODA 2Q87A 1E6JH 4NKMA 5C08E 3IJYA 4OZIE 3K46A 1WTGT 3QPQD 4KGJA 4M6OL 4UNUA 1PVHA 4MHHI 1VPOH 4YLQT 1GC1C 1I8MB 1TVBA 3QA3B 5BV7B 2DQIH 3UJIL 1WZ1L 1H9VA 3SDAA 3GSRB 4HC1H 3AS1A 3FT2A 4H8WC 1XIWC 3OKYA 5HJ3B 4YQXH 3VWJD 4OGAC 2AGJH 3AREA 3ZTNL 3EGSB 3GNML 1B4RA 5IFAL 4PB9L 4GBXC 1KSRA 4R3SA 4XP1H 2A0LC 4LEOA 4OT1H 4ERSL 4JLRB 4OSUH 1WVZA 2VLJE 4JFOA 4MDJB 5I18L 1BQHG 5ISZA 4FHBD 1T3FB 5MERA 1FL6B 1JGVH 3OGCA 1S9VA 4LCCA 5GGRA 4WUUE 3FT3A 5DFWH 2R0WL 5CBEA 1P6AB 1HHJA 5DO2C 5IESH 2OYPA 2B2XH 1WZLA 4K2UL 2VSCA 3WCYA 4LK4A 3NIFE 4XNUL 4K7PH 5CSZA 4PJBB 1P4IH 3WXWH 5C0RL 3C09B 2Q20A 3N1QC 1SM3L 2EDWA 5CZXC 2FLBT 1EV2E 4Z0XA 3U82B 2R2HB 1EUUA 4GG6A 3N85H 4Y19A 4HPOL 1QSVA 2EDXA 2BXZA 4Z76B 3QQ9C 3IVKB 1QSFE 3L3DB 3QH3B 4GUPA 3PDGA 2FB4L 3VXUB 5MEPA 5E5MB 1Q0XL 4KUZH 3QNXA 3MBXL 1MCIA 3W5MA 2OJEB 5EIVA 2AK4A 3K4AA 4YDKH 1N0XH 3EHBD 4NJAL 4FABL 4UDUB 3BE1H 3GSUA 3C2AH 2NW3B 2N56A 4PJ8A 1PLGL 1M7IA 3Q6FA 4X98B 2CO7B 4G7YH 2DYPD 5DWUL 3WLBA 1GAFH 2CLVB 2X4UB 4BKLB 3IXTA 1LEIA 4DN4H 3QZWB 4LP5A 5C07A 5C08B 2WP3O 5K9JL 3X13A 4OZIB 1PY9A 1MRCH 5CEZL 1BOGB 1IM9D 3T08A 4U1SA 3VG9B 3HC0A 5D7SL 5BO1H 2FR4B 2VQ1B 5GPRA 1CXHA 3TH2T 1X6NA 4XRCA 4ZFZA 3MXWL 2IH3B 3PGDB 5BJTA 4XPGH 1TPXC 4H8WH 4JVPA 5ALCL 3WKMH 4LKXA 2GUOA 4L8BA 1P2CA 2VLJB 5IBTL 2AP2A 4QOKD 4XB7A 1CF8H 1WTLA 3FB8A 4AEEA 1FJ1A 5F3HB 4WW2A 4ZOEA 4ELME 5FA3B 3RKPA 2C3XA 4LGPB 3HMXA 1T22A 1KJVA 4WUUB 5EUOF 3TJEL 1W72A 4WFGE 3MCG1 3JUYA 4MXQD 3W9EA 4LDOB 1C12A 3C2SA 1D9KB 5L7XH 3OXSB 4JFHD 2BX5A 3F58L 1MCDA 5F7EL 4HXBH 3E2HC 1AO7E 4ETQA 4MCZA 4U1MA 4F7EA 3ZT7A 3MGOA 4E42A 3TA3C 4XCFL 5LG1A 8FABA 2P5WD 3PGCA 3RHWF 1I85C 4X5LA 4JRYE 2X9XA 4YDIH 1KNOA 2DTML 1OP5K 2PW1A 4O2FA 1IT9L 1F4AA 4GT7A 2OS7A 1QSFB 4YPGB 1UWEL 3S9DB 3BZFB 4MD5A 5F1IA 1J1PH 1UACH 2JLLA 3RY6C 1YNLH 4WJ5A 4KK8C 3D25B 3T0XA 4JAMA 4S1DD 4XPBL 2CMRL 5EOTA 3U36B 5A2IH 5GHWL 3RWGB 5DT1H 4HBCH 3V5KB 2MMXA 2BSTA 5I6XB 4OD3L 2EYRB 1YC8A 4LCUB 3SE4C 5GGQH 5E4EC 3SDCC 1JHLH 5EA0L 3B2UD 2B7DT 4YDJA 3TT3H 2VXVH 1MFNA 1I8KB 4Z78A 1NGYB 5IHZA 1QYGH 1D5ZA 5CP7A 3T77B 4JZOA 1V8HA 2X4NB 4RMWA 1ERNA 2DMCA 5DJ2B 4UQ3A 1TJIH 2ICCA 1TETH 5DJ0B 5DD3L 3S4SA 3WNNA 4N9OB 4PJEE 3O4LA 4FQQB 4TTDD 4YGVA 2XG5A 5CJXA 3D85A 4NZDA 3K1DA 2EIBA 4A2LA 4CVZB 4JVUA 3BZEB 5JOPD 2VDMH 1NCUA 3F8UB 4ZS6D 4MA7L 3SEPA 1SY6L 1D5BB 4AM0B 1T03H 1U2CA 3FQWB 3QFDA 1BF8A 4WHTA 4X6EB 1F8TH 5FYLL 1K3IA 5HGHA 3ZMRA 4TUOB 4ELMB 4U0QB 2R0ZL 5JORA 1MCOL 5L2KE 1EHNA 3CNKA 2CRIA 3QIWB 5DGRA 3TVMB 3S88H 1CR9L 5KS9E 5F7HA 4WCYL 4NPYB 1FAIL 2EDLA 1DDHB 1RIVH 2NXYC 4GW5B 4XXDA 5FUZH 1U8IA 5F1NB 5IVZB 3I6KA 4R96B 3HZMB 1AO7B 1CFQA 1JVKA 1NBYA 4I0CC 2WIMA 3RNQB 3GZKA 4NKIL 2N7BA 3NCYP 3LMJH 4JRYB 4QO1A 2OP4L 4L9LB 5JPMB 2E9WA 5JHDE 3AS2A 3S5LG 3CAFA 5AZEH 1L7IH 5HHXL 1U2HA 4EI5C 4Q9RH 1ZLUK 2QQNL 2OR7A 5C6TL 2QR0A 3DRTB 3T4AA 1FNGA 1FP5A 3DVNB 3BZDA 3ARDA 5M7QA 5ILTH 1H0DA 4Z7UA 2CK0H 1JE6A 4CN6A 5CIPA 4OTXL 3WLWC 4J4PC 5JO5B 1BJ8A 4QGYA 3T4YA 5DVNA 3MMEA 3K3QA 4KVCL 3O9WC 4BSJA 5C09D 1UYWH 4L5FH 2E7HA 3BUYA 1G7LA 4FXLA 4HGWA 1G7PA 4Y8DC 1A64A 4OLZH 3UP1A 3P0YH 1K4CA 4U0RB 3QCVL 5KANI 3VWJB 3IU4H 4PJEB 1KGCE 4ZUSB 4XBPB 3T3PE 1TTFA 4ONHB 4FFVC 3THML 2BVPA 1JGDA 3ESVF 1QRKA 3BQUD 5DRZB 4S1RH 4MWFA 4QOKE 2WLYA 3S7GA 4WI2A 1C5DB 4LVOC 1CTOA 4Q0XH 1BBJB 3M17B 3EO9L 2OI9B 1YNTA 3O3AA 1WBYA 4LVNB 4I13B 1ZS8B 3FQTB 4RA0C 1ZOXA 1G84A 2G75A 2UZIL 3VFOB 5IVXF 4XZUA 3FQUA 5I30L 2RBLA 5EB9A 1S7TA 4P4KC 4Y16A 3MO1B 5L2KB 5M95B 5IW6B 4JFHE 5CIPH 2VR4A 5KS9B 4X7CC 5KOMC 3RTQD 1ZHNB 3VXRA 3EYOB 4UI2A 2XG4A 3MRLA 1K5NA 1BGXH 1W0WA 2Z31C 4K94C 4ENED 3AY4C 5J06A 1YEEH 5L88H 1XF2A 3MRDA 1EFXD 2F19H 5ICZB 3MJ9A 4XVTL 4W70A 3WFEL 1J0JA 2X4OA 3U1SH 1R5WA 4P23C 2FSEB 2VWEC 2X41A 3CFDA 43CAB 3HMWL 1EJOL 3ZYOA 2P8PA 2CH8A 5DYOA 3SDYH 5SX5H 5JHDB 2W0FA 4NQTA 4S1QL 4RMRA 5DMYA 1S7QB 2XZAL 3TC9A 2AQ2A 3DUUA 2E7LA 4DQOH 3PWJB 4YFLI 2XKNB 1S9XA 4RGNC 1YEFH 4TRPH 1A21A 1I1AD 4HIHB 4H26A 5DRWA 5E6IA 3N50A 3GJFB 4I5BB 2EDKA 2DYPB 4P2YA 4X4ZA 4HW6A 1MAML 5FAAA 3OJVC 4NZUL 3G5YA 1NUFA 5IWLA 1RZ7L 4JR9L 4MJ5A 1FH5L 4PJXE 3W39B 1DTUA 2EDOA 4O4YH 3GMOA 4MYWB 4NT6A 5DHYA 4AMKH 4F58H 1IM9B 2E7CA 4OF8A 1TCRA 2IEPA 1EO5A 4KQ4L 3GM0A 1NDMB 1CLOH 2JCCF 1KJMB 1MPAL 3WUWA 4IMKC 3B9VA 5TE4H 4K7FB 3RWDB 5DUPL 3HFML 3GEWB 2HN7A 3MLTA 2DTSA 4D0DB 3ROLA 2YRPA 1RZJC 1U8NB 4Z7OE 4G8GD 2PR4L 4OZ4B 4OI7A 4QOKB 5HYJA 5IEKB 2K7QA 1WAAE 3OKLA 2AEIT 3L7FA 5IBLC 4G8IA 1T66C 4LLDA 5J12C 4N8PA 1QSED 4WU5A 3UTZB 5DEFA 1S8DB 4GAYB 2APVA 4P9HC 1IGIL 3G6JF 2EZ0D 2JJSA 3QG6B 5AEAA 5KSBF 3QR2A 3SHSA 4NSKB 2XXCB 4JFDD 3X3GL 2ADIA 2O5XL 2GCYA 2F54A 3D69B 4M6OH 3H7BB 3P73B 4PJAF 3C6LA 3CXDL 1T5WA 4NWUL 3EDFA 4LHQB 3MC0A 4UTBH 5MEQA 2A74A 5F3BB 1CFSA 4TSCL 3UJIH 4JRXE 4HMEA 1S9YA 1CLZH 4MNQE 1EIBA 1NJ9A 3SCMD 4OIAA 4HWBH 4X6CA 1T0NB 4N0RA 2DQJL 3GNMH 5IFAH 4J3XA 4GW4A 1JWMB 2AEQL 4PB9H 2F58L 1XGTA 3QI9A 4OBSA 4P5KA 4X6DE 5IMMB 4LPUA 5I18H 5GQBA 2E6QA 1L6ZA 1KPRB 4LAQL 3G5VB 3HI1A 5IHUH 2W60A 3QQ3A 2QLVB 3KPLB 5J56B 2R0WH 4KU1A 5DK0A 2V2TB 5C09E 4PJXB 3CZFA 1NUGA 4M1CD 1R5IA 4XNUH 5JR1L 2GTZA 1CGXA 3RGHA 1UCBH 3RNKB 5INDA 5K9KB 3MFFB 1M7DB 2HJLA 4LLUA 2XPGB 2AV7A 2V5MA 1FGVL 4R2GC 1ZLVK 1SM3H 3LIZH 3KYOA 5FM5M 1K6QL 1FFOB 4XWOC 2D3VA 1RHHA 3B9KC 1HDMA 4HPOH 1MVFA 4AG4H 4PJIA 3VFWB 3L9RA 1UXSA 3QDME 2VZVA 3VH8B 3QHFL 4IEFB 2YZ1A 4JFFD 3MBXH 1MCNA 1PKQA 4J2XA 2XFXB 3TN0D 3BGFC 2YZ8A 5FCUL 1DUZB 4KY1L 4FABH 4MS8C 1K2DA 5DJ6B 4XH2B 4NQCA 1V7NL 1JI1A 1P7QA 25C8L 3RU8H 4EQ3A 4XVUD 1V5JA 5F9WB 5GZND 4R90L 1ORQB 1NBQA 3NACL 1INDL 5D7JD 5AD0A 3FN3A 4IRSD 4BJLA 3LKQB 1JPST 5K9JH 5F93C 5TFSH 4OCWL 2NW2A 5DSCB 5I2IB 4XNMA 2FX7H 4MCYB 5CEZH 1D6VH 3DIFB 5DTFB 1A1NA 2H2PC 2V17L 1QQDA 5D7SH 3U7AA 4HKZA 4IDJL 3OX8B 2K9UA 4JRXB 1J0ZA 3L7EB 1U8MA 3GMLA 1AD0B 4EDWL 3JWOL 4QRTB 3VXSD 3EYFA 2R2EB 3T1FB 3BH8A 4YZFE 4JHZA 4WIQA 4X6DB 1I7RB 3L3IA 5IBTH 1JYVA 1A6AA 3DV4B 4OCXL 5SV3A 2G2RB 4XNQB 1UKQA 3ZKMD 5HGBA 3FB6B 3DSFL 5IT2H 4KI5F 3PHQB 4LRIC 4NUJB 4N0UA 2ADGA 2FHFA 3J8F7 5F71A 3TJEH 5HYSA 1B88A 3VFNA 4WENB 3ZDZF 1IGML 3HG1D 5D5MF 3MNWA 5JXED 4NN6C 4UU9A 5LBSL 4OF5A 1IVLA 4I9WD 5C09B 3C9NB 1TPXB 1JPTL 4ZUWB 2CLZB 3KDMB 3QDJD 2JELH 3F58H 5FUCC 4MA8L 3N1PC 4X5XA 4XCFH 5KVGL 2Z93A 4N8VG 3VMOA 2FATH 3LRGA 4YHIB 1WWBX 3IJHA 4G8GE 2DTMH 5C2UB 1A9EB 1CE1H 5KSAC 1RD6A 3VDBA 1YQVL 3P9LA 1C7TA 3QDMB 1F3RB 4X6FB 3ULVF 4MVBD 3BRDA 1UWEH 2NY2D 1SY6A 4BA8A 5KSUB 4HG4J 2PTTA 3EDKA 4YHML 3UTQB 3JZ7A 1QSEE 4XPBH 2CMRH 4JPVH 1NMBL 3L5XL 1ODAA 1QLFB 1WFTA 3OMZA 4MJ6B 2BVOB 1KG0B 3HZKA 1JPFB 4NZTL 4NQEA 4OCYL 1C7SA 5EBMB 5IR1A 2GYSA 3RTQB 4F8TA 1F6AB 2AEWA 3MUHL 4PLJC 4EUPG 1JZ2A 4ZAKD 4LHUG 1EFXB 4XXCA 4MHHG 2RGSA 1NEUA 5MP6L 2NTFB 3HE6D 1A5FH 3TV3L 4JG1L 2MPAL 5DD3H 3TO4D 1BQHB 2KUTA 1MVUB 3QDAA 2V2WA 1J1OL 3AU1B 2AK1L 1FNSL 3HI6H 3IKKA 4YR6A 1GJIA 1H15A 1KB5L 4L1DA 4YHYB 5A16B 4F2MB 1F00I 4U1NB 1F13A 4I0PD 4MA7H 5F9JA 4Y4HC 2FWOB 5F7DB 2L4OA 1S7UB 2ZUUA 4MNGE 4GXUM 4EKXA 3OGOE 4KFZC 4YE4L 3MJGX 3ULVC 2X4PA 1EAPA 5DMGC 4U6HA 4P46A 2R0ZH 1BZQK 2ESVA 8CGTA 5CWSB 1MCOH 1U6AH 4G5ZH 5DR5L 4HG4K 4TSBL 1P7HL 3U2SA 1KFAL 1CR9H 1FN4A 1UJ3C 1RI8A 4WCYH 4M61B 1DBBL 4S11A 1FAIH 3FOLA 1RZGA 4WWKD 1NMAL 5CJBA 5EBLB 4M8QB 3C60A 1IC5L 3L3HB 4TVPL 3U46B 3MLVL 1IGFH 1KTLB 3KPSA 4PJHA 1WV7T 4FA8A 3VRJB 5D7LD 3P30H 4TOYL 1IAIH 1XR8A 4Y4FB 1X5IA 2LU3A 2OP4H 1EAJA 2YK1H 4G8GB 4YHNA 1ZHLB 4OZFA 2X6MA 1J1XL 4JFFE 2OZ4H 5HHXH 4KI1A 3GSQA 2X1PA 4ZUUA 2AXFB 2QQNH 1OGTB 2NXYB 1AY1L 5C6TH 3MX0A 1LEKA 3JTTB 5MHSD 3QT2A 1QSEB 3CH1B 1MCPL 2OR8A 3CFKB 5I1IL 4F9LA 2CIIA 1CL7L 5D6DC 2GSGB 1EO8H 3HZYB 4M7LL 2DD8L 2ZG1A 5DUML 2IWGA 3LRSA 3EJYD 1G6RB 1WJ3A 3VXNA 4NZJA 3CDFA 1JGEA 3SKOB 5MI0B 5DQJB 4Y4KC 4PRPA 4LSSL 3ULUL 4KVCH 2A9ML 1F6FB 1HQ4B 3MRHA 1AHWC 2KKQA 1CTNA 4XP4H 5EU4A 1VEPA 4LLQB 5I75B 4XCNB 2JJVA 5JOFA 4I8DA 4OLVL 3Q6GH 3QCVH 3OWEA 3SCMB 3DX8A 2CK2A 1IGTB 3QXAB 1G7QB 3SDXA 5ID1B 2O93L 4LSUL 4IJ3C 2CDFA 3THMH 5CJ5A 5HI3D 1G1YA 2V7HB 1QFUL 1DN2A 3PV6B 1TITA 4OZFH 3DMMC 2XZQL 4G6KH 3H9YA 1D5IL 4CVXA 4MX7A 2A9NL 4ODVL 3EO9H 3CMGA 3CVIL 4PG9B 1U8LB 4MNGB 3QBTB 2ED8A 4YDVA 1MCKA 5CKAA 3C5ZA 2UZIH 2VJXA 5JLZB 5I30H 1L9MA 5E94A 3IDIB 3V95A 4I9WE 1MHEB 2PW2A 3BISA 2FRGP 1KT2A 4Z7NE 3QDJE 5E8PB 4EVNA 2WMPA 2LU4A 2A77H 4HWZB 2AJSL 5E8EB 4XI5D 1WFNA 1YY9C 4KDVA 4XP5L 5JZ7C 3CUPA 3QIUC 3O11A 2W1NA 4PRBB 4CN4A 1AGFB 3V6ZB 4KKBD 5AYUL 4FQ2L 4U33A 1ZV5A 5CEYB 3HMWH 1EJOH 4MD4B 3IFOA 3GMPB 1HH9B 1WCBA 1NAKH 1C1EL 2B5IB 3RA7L 1I75A 4JFFB 5SX4H 1HEZB 4DK3A 1SYSA 3STBA 3TNNA 3TN0B 1H3TA 2CLRA 2GK0B 2QBWA 1R3KB 4M6AA 2C3VA 4HZLB 4KI5D 2ICES 2LQRA 2N4IA 2VLRD 2Z31B 4FQLH 5DVKA 2E9JA 3TJHC 1L0QA 4HUWB 3WUZA 3O2VL 5F7KC 5HGAA 1WFUA 1N26A 1ACZA 4FFWD 1MRFL 5CGYC 3DUSB 5D7JB 1S7VB 4NZUH 1EXUB 4JR9H 4IRSB 1FH5H 4G9FE 4EQ2A 1NAMH 4KDTC 1FNEB 3SPVA 3UBXA 4DEPC 4XB8A 4KQ4H 4PJDF 5GRJL 2HKHL 3IGAA 1BJ1J 4GRMB 4FFYL 1MPAH 1F4WH 4CAGA 4A6YB 2IAMA 4WW1B 3WNPA 4Q7DA 3ARQA 5DUPH 4DVBA 2GSIB 3HFMH 5FCSH 4EBQL 1ADQL 5F70A 3H7LA 1NUNB 3GMRA 4OFVA 1CG9B 3UC0L 3LSOA 5K9OA 5F1OB 1FPTL 3IXAA 2PR4H 3S96B 4U3HA 5HHOD 3NCCB 1BVZA 1R6VA 3VGAB 2KPNA 2HRPH 3G6JE 3F5WB 3LN4A 3TBTB 1SVCP 3H8NA 4GQ9L 3RWFB 4M48L 5T3ZH 3OHXB 5IIEB 1U3ZA 1IGIH 3QFJA 4JHAH 1ZEAL 3HB3D 3OKNB 4PJAE 3QDJB 3NBNA 1VFMA 3P0VL 3X3GH 3S5LB 3TCLB 4MLIA 4YHZL 4HX1A 1MNUL 1X6LA 1S9KC 1XT5A 3MRPB 3KPTA 1MLCB 2YPLD 3SKJH 4LNRB 3VXOA 3BP7A 4OGXH 1MI5A 2H2SD 3H3BC 4NWUH 2IAND 3QDGA 3GMNA 5C92A 1F2QA 4MDIA 1EEYA 5J12B 4PTUB 4JDZB 4W6YB 3OKKB 2NY2B 3UPRA 1QVOA 1IC4L 4BFIB 2AEQH 4GG6F 4D8PB 4CW1B 2IG2L 1MQ8A 5MHSE 4CU6A 2X89A 1NC2D 3G08A 5DJ8A 4FQIL 4W81A 2F53A 3VXQB 4J1UB 4QHUA 2DLEA 4LAQH 2FO4A 4P2OA 1KN2L 1YEKL 4X4MA 1YMMA 1I9RL 1LMKA 3ARYA 4OQTH 5IHBA 3MODH 2PO6C 1NPUA 2XQYG 1HXMA 5HVGB 5INCB 3DARA 4ZAKB 1RJYA 4OLWL 3WXVL 2NY5C 4G9FB 5FKAA 1I3RB 5HHVL 5JR1H 4H1LH 1NFIA 3D3VD 3BHB