2OXHA

The soxyz complex of paracoccus pantotrophus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
ADDAKPRVKVPSSAKAGETVTVKALISHKMESGQRKDADGKLIPRSIINRFTCELNGVNVVDVAIDPAVSTNPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 19
structure length 107
sequence length 107
chains with identical sequence C, E, Z
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08770 SoxZ Sulphur oxidation protein SoxZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oxhA00
3JWOL 3GBLA 1SY6L 4H0IA 5GGTL 1VSCA 3OG4B 4UMGA 5T33H 4WFFD 2ZOLA 5SX4I 2CKBA 5L2JB 4H0GA 8CGTA 1T7VA 4L3EA 4L8SC 2BP3A 5C86A 1EIBA 4C56A 3VG0H 4HK3N 5F7LB 4JFFD 4ODHH 5HHME 4PV8A 4P4KB 2EYRA 2VXQL 4NWUH 2KH2B 4KXZI 4PJGB 2IAMA 3SDAB 2X40A 4D9LH 4JM4L 3M45A 4ZOAA 1AP2A 1FO0A 3W0WD 2ZG3A 3IVKB 2P42B 4M8QB 1A7NL 3DETD 1CIUA 1T21B 4NQUA 4OLUL 2A83B 1JGVH 3NCFB 1SJEB 4EBQH 2M8XA 1DBAL 2D9QB 4RWYH 4ZOEA 3QRFM 2RR3A 1JNNH 3U9PH 2OP4H 3O6LH 3GMPA 4KQ4H 4MMZC 2VH5L 3MBEC 3S6CA 5J57B 3ZYOA 1FYTB 5DURB 3RTQA 2OL3L 1UM5L 2DQDL 4JRXE 4NNYB 3MUGB 4P2QE 3TBTB 1OP9A 3QULB 4BH7B 3IXAA 5CIPB 2AJUH 3WIFA 4X0KB 4IS6B 1CQKA 5I73C 2A1WH 4LKCA 4FQQB 1DBKL 4MWFB 5KVDL 4M7JH 4G9FB 1T1XB 2G9HA 4GAYB 1A1MA 4XNUH 4KROC 4EUPG 4C56D 3DI2B 1Y6MR 1N5AA 1RK0A 3DVFA 1SJXA 3W5NA 5BV7L 5D2NC 3QZWB 3VFWB 1OW0C 3G5YB 1IC4H 2ZUQB 2YD8A 1C08B 1YY9D 4RISH 2VL5B 1F4WH 1CGXA 4NUGL 5FGRA 1SBBA 4V2BA 4XZUA 2VC2H 1HILA 2FX8H 1F4YH 2J8UF 2BXZA 3MSPA 5JHLH 4WCYL 5J7CC 4F2MB 2UZIH 3O3AA 3MRJA 5E95B 4XVUD 1XR8A 4DGIH 5IV2A 5D7SH 5EBWB 3I2CH 3LS5H 2GJ6E 1AI1L 2VZ1A 4HGWA 4LOUC 3RWFA 3I6KA 1F13A 3MUZ1 4K9EL 5EBMB 5HVGB 2QSQA 4HK0A 1CR9L 2K9UA 2OZ4L 2KBGA 4KVCH 1CVRA 1IBGL 2WBJA 3LV3A 1CFBA 3C08L 4PJBE 3NPSC 2AJXH 3MV7E 4PJ9A 3UX9B 5CMAB 3WIHH 3IS0X 4J1UA 5JHDB 2N7BA 3VFPA 1B0GA 3W11C 3LB6C 4NGHH 4JZJA 3WHXB 2Q8BL 4A2MA 4MS8D 1D6VH 1N8ZB 3DRTA 2ZUYA 2XA8H 4M5ZH 4Z7VE 3VI4E 5E94B 3WMSA 2OJEB 3LS4L 3MGTA 3O41B 4YHMH 4J12A 1ZA6B 3RI5F 1MFEH 3MLXL 4KFZC 4NO0B 5I1KH 2WAHA 1R24B 4M6ML 4F7EA 3VXNA 1TVBA 3T0DA 5FYLL 4X6DF 1R3KB 1UB5B 4Z7UB 2VO5A 3TYGH 2QQKH 3A67L 3V5KA 2CQVA 5EFIB 5K93A 1LWRA 2F15A 2DQEL 2OJZH 3BN9D 3CX5J 3T0EE 5ICXA 3VXMB 3QHFL 4LDLB 4KDWA 4KI5F 1A6AB 5ISZA 5E1AB 4YNYB 2V5YA 4YIQB 3O6KL 3Q6GL 3DVGB 2O5YL 1BJ8A 3MRPA 3HRPA 3MRMA 3KXFB 4HCRA 3RA7L 4NJAH 4PY7A 5DGRA 4M93B 5HHOE 2FATL 3S36L 4J7RA 1G9MH 4UV4L 1A64A 3GBML 4HV8B 2QADD 4KUZL 4LLDB 2XWTA 4N0CC 5HXMA 1ZS8B 2J1KA 1OTUC 2GUOB 3K4ZA 4N8CL 4RAVA 4QOKA 4QHUB 4RGOH 2IPUK 4DTGL 4EN3B 4AEFA 4G5ZH 4ODSH 4ETQA 3QQ3B 3F12B 5JXAL 1OSPL 1RZGB 1XMWA 3KPRA 3RWIA 3BIKA 3WDHA 1YNLH 1AGBA 1EFXB 1XF2B 3VXUE 3P0GB 3WFHA 3VWJC 4H1LH 3QJFB 4ZPVA 1FVEB 4I2XE 5ETUA 3V5HB 1C5DA 3P11L 1BLNB 1CYGA 2E7MA 4BQBA 2BVUA 2HFFB 1BWMA 3OGOE 4R4FH 1QTYT 2GTWA 1RULH 4Y4FB 5C0CB 3VI3E 3W9EA 3AREB 1T6VN 5DUML 2C7UB 1LEGB 1PD6A 3L3IB 4XWGL 2GK0A 1I3RA 3DTXB 4XVUC 2A73A 3HAEH 4ZSOB 5D7LB 1A6TB 1JMZA 4KRMB 1U8PA 1A1NA 2D03H 2EDJA 4YHIA 5KN5A 3C60D 1N0XL 5C8JB 1A6VL 3QWOB 4PR5A 3L7FB 3LHPL 5DZLA 4P2OD 5E99H 5KOMC 4PJIA 1IAKA 4UT6L 3W81A 5IFAL 4N0UA 2NY1B 1E4WL 1NMAL 1T5XA 5D5MB 4FXGB 4HJ0D 4N5ED 3O6ML 4HT1L 3KPRD 2J88H 2EC9U 4U7SA 2Q87A 3VFNB 5TQ2L 3SDDB 4WDIB 3HE6D 4ODTH 5DHVB 3KLHC 4WNQA 5E1HB 1BVZA 1XGUA 3F6IA 1J05A 4HBCH 1INEL 1BM3H 3G6JB 3AMLA 4LLVB 4NYLB 5I9QB 1I75A 3SQOL 2R23B 2QTEA 3O2DH 1ZHKA 3X3FH 5IJKC 3DO3A 3GBNL 5EO0A 4NKOB 4Y4HB 5C07B 2YD5A 3LH2L 1WFOA 4LLYA 1K8IA 3MJ9A 4C4KT 2W9EH 2XZAL 5DJYA 5ANMA 3BDYH 5DC4B 4HIHA 5EU3A 4ZFOL 3GHBH 2GSIA 1A9BB 3DSNA 2BSRB 2VAAA 4P9HC 5JDSB 4NFCA 4ZUWA 3MREB 2UWEF 4D3CL 4P3CL 4R3SA 4CU6A 1XAUA 3EYVB 1FFOB 3FKUS 5E00B 3QA3B 1NFKA 5IQ7L 4TQEH 1S7TA 1YUHB 4C4KO 1D3CA 3CCHA 4U7KA 5GGRA 4AMKH 3DBXB 4LCUA 3DXAB 2O5XL 4O58H 3U0PB 2QKIA 3QUYA 4I5BB 1ONQB 2R56H 2OXHA 3QXUA 1C1EL 1DL7H 2R2HA 4KI5D 4CW1B 4JHWH 2CR6A 1FFNB 4JKKA 2X44D 4ERSH 3CLFL 5ECJE 2V2XB 3NIFE 1NC4A 4M4PA 3ES6A 1A1OB 1EEYB 3K4AA 4RIRA 1BVKB 1IZJA 5IHBA 1WWBX 1UWXK 2BNUA 4PJEF 1BF8A 3U6RB 3INUH 5B3JE 1WK0A 4FQ1H 5GS0C 5D2NE 5E56A 4HWEL 4PV9A 4XNZC 1JNLH 3ULUL 5FK9A 1GGCH 4B0MM 1DQDH 2A74A 2GSGA 3E6FB 1EMTL 2HT4C 1XF3A 5DQ9A 5F7EH 2F54A 4Y1AA 5JPMA 43C9B 5LVEA 3MRDB 1RJCA 1Z9LA 3BZ4B 3RWHB 1N3NA 1N64L 3TH2T 4HCRH 4H5SA 2G75A 4GQPH 5FUOH 3U4AA 4TSCH 3GMMA 2DQFB 5E6IA 4ZNEE 2RJMA 1RJLA 4OCYL 3JV5A 1Q94A 4YK4C 4ZPTB 4YZFF 4AIZB 2WM0A 1H0DA 1RK1A 3STZA 5DJ2B 2R8SH 4X7EC 3P73B 4XVTH 3O4LE 2HA1A 5BMFL 4YDJA 3HPLA 2EEDA 3L3OA 1OP3H 4YHZL 1KB9K 2QJDA 5DQDL 4OT1L 3MNZB 3OV6A 1JUFA 5LGJA 1OT2A 4NHUB 3A6OA 5I76B 3QEQA 4PRBB 2ZPKL 3KPOB 2BY3A 4HKXB 5D1ZB 1I9JH 2PKDA 2J7LA 4P2OC 3ALPA 1J8HE 1UEYA 3GJEB 3MV8A 2YWZA 1A7QH 4IRJB 1DTUA 4HJ0C 2CDFB 2RB8A 5FYKH 4E41E 4QRPA 4DZ8A 1ZXQA 2EDBA 5HY9B 3HE6C 4MAUH 5BOPA 2ESVA 4JFFE 2F54D 3CH1A 2V5RA 3I3DA 4S2SB 3WFBL 4E42A 4P9MH 4J3VA 3AUVA 3MC0A 4H20L 3G5ZA 5E6ID 1P4LB 3Q2CA 2W65A 3EHBD 4J6RL 5E2VL 1RUQL 1BJ1H 1EJOL 4WI6A 4JVWA 5I0ZA 3QFJE 3SE8H 5MP6H 3S5LG 4X4MA 2HJFB 1PEZA 3LIZH 4YHKL 2GI7A 4HUWB 2OTUB 4MA8H 4EUPB 1Z2KA 2EDYA 3OKOB 5C6WH 4XP6L 3MLRL 4F7TB 4GW5A 3D3VA 4XPTL 1DQQB 3K81A 1I1AD 3PWUB 4R7DA 4BQ6A 3WCYA 4TTDC 4JDVB 5IG7A 3IDIB 2J2ZA 4HLJA 4KI5C 5DRZB 3CMOL 4FTVD 5DD6B 1IM9D 1N4XL 2A6DA 5DK0B 3V0VB 3MV8D 5ESAB 1FAIL 4HH9A 3LRSA 2CLVB 5E8EA 2Z31C 3B6SB 4FQIH 4QRPD 3PWPA 5GGSA 1FNGA 2HJKB 3JUYA 1QPXA 1RSFA 3GIZH 4WI2A 1IQDB 3GJFA 1FL3A 3NZHH 4YWGH 2HLFD 1E4XH 2HRPH 2QR0A 5EORH 2VZUA 3SE3C 1PZ5A 5I1DB 1JF6A 1IGTB 1KPUA 2OLDA 4MB3A 2VDOH 3FQWB 4XPAL 1Z5LB 2BFVH 3C5SB 3ZDYF 1MHHB 4OFYA 1NFIA 3TIDA 1F11B 1EHXA 4R6UA 3O3BB 3SKNA 1PDKA 3GB7B 3HLAA 4NQCB 3HUJA 4TUKL 4J2XA 2ICWB 3NTCL 1T7ZA 3ULVF 1O7VA 3QIBC 1KULA 1I8IA 1YN6B 5IMOA 1FG9C 1HHHA 1XGQA 3BESR 2BCKA 1NAML 1ZLUK 4OLXH 5CJQL 2ZCLH 2IQAA 3IJSA 1KV3A 1HQRB 1PX4A 2BZDA 2I5YH 1T20B 1YDPB 4PJHA 4KY1H 1AXSB 2R0WL 2DI8A 1DUYB 1E28B 4JKWA 1QBML 4U1KB 4K8RC 3D39B 3LN4B 4RMQA 3LKOB 4AT6A 2LV4A 4JANA 4NZTH 4P3DB 5EOTA 3L5XH 1ZGLB 4GG6A 3CFDA 4JJHA 1NQBA 5DRXB 1OAKH 5CKGA 4OCRH 4MYWB 3IJYB 1CD1B 2AK1H 3K8LA 4ZFFB 3VD9A 3VW3H 3L3GA 1NBVH 1AKJD 3FB7B 3CFCH 5SWZE 5TQ0L 3PP4H 5A2LH 1T4KA 4OFYD 3MV9A 4MCYA 2XACC 5AD0A 3GSXB 3TCLA 3EHBC 4OZ4A 4OD3L 1YEHH 2AK4B 1VGKA 4DZBB 3WEXA 1AD0A 2FEEL 2X70B 1OAYH 4JO4L 1J11A 1QSEE 1WCBB 3F62A 4D94A 4HKJB 4YBHA 4Z0BH 5GGSY 3VGEA 3RHWK 2PTTA 4WEMB 1I1AC 4LNRA 4IOSD 1D9KA 4OSUL 3T8XB 1AE6H 1H9VA 1JGDB 5C7XH 1Q0XH 5IMLA 3TZVB 1Y0LA 1E4KC 4Q97A 1OSZB 2H26A 4MJIB 2JJWA 1UXSA 4XC1L 4OLYL 1QEWB 1YN7B 4MA1C 5EULV 4GXVL 1KN4H 3BEVB 3N1GC 1FC2D 4DKEH 2XI9A 1IC1A 3L3DA 2X89D 2ZCHH 2XQBH 4UAOB 1KJ2H 3L7EA 3W39A 2FR4B 2IANE 2X4TB 4U1LA 1NCCH 2YD6A 4KKAC 3VXRD 4JFQB 1I1FB 1IEBA 1DBBL 1FP5A 2EDXA 3RGHA 1D5BA 3OKKB 3KPSD 4N68A 4PP2B 3ROLB 3O4OC 5KSAD 3TO4D 1EBPA 3KS0J 4N9GA 8FABB 4PJ8A 5KSBE 1QO3A 4DKFH 4XP4H 4HDIA 3HE7D 3ZTJH 3ZKNC 3W5MA 1SMAA 2DIBA 1HKLH 1FZOB 1VB9A 4U1IA 1JIBA 5J11B 4LGPB 3LCYA 5T5NF 5E9DD 4LCCB 1AD9A 1WT5A 3QG7L 1OQXA 3NOIA 2AGJH 2BSED 1OLZA 1WCQA 2J8UE 5I1EH 3MRNB 4I8DA 2EH7H 5EN2B 5K59F 4WI4A 1GAFH 4PJ5E 1KCSL 1LO5A 1Z0NA 1IAIH 5FCSH 3DARA 2Y7QA 2DS4A 5JZ7C 2DRUA 3P30L 3FAWA 4M1GL 3ULVD 1P84K 3MLZL 3PL6A 2PYEB 5C6PB 1MCSA 5ESVA 5C0DA 5C6TL 5FOBB 3S9DB 3BUYA 2R2BB 4R0LB 4PJBA 2Z93B 1IM3A 1EEQA 3MV7A 5DQJB 4FQPA 32C2B 4I18C 5DYOA 3OSKA 3DLQR 2BOBB 4ZMAT 1N0LA 3MRKA 3S98A 2K3TA 4DOHB 3P3YA 3PXJA 4R2GB 1F5WA 1IAMA 3AY4A 12E8L 4NQDB 4O4YL 4PJ8D 4TSAH 3TBSB 1LHZA 2DJ4A 4JRYE 4F9LA 5EU5A 5E5RB 2R39A 2WWMD 4X6DE 4UU9A 4AL8L 4MDJB 1IGIH 3OPZH 1A7RH 2P43B 5ADPL 3QIUB 4P2RE 2YA0A 1YJDL 2CMRH 3M17A 1YYLL 2H6PB 1G7JB 2GHWB 3Q3GA 3VGGA 1ZANH 2LU4A 3DHMA 1H5BB 1MEXH 3U79A 4NRXB 3KYKL 4KI5E 5JXED 4NN7B 2RQ8A 2CLZA 4LVNC 5D71L 5JNYA 1KIQA 1T6WA 1HHJB 3RGVA 1CDGA 5FXCH 1UWEL 2B7DT 1JK8B 1U6AL 3PF2A 4KRPB 3CLEH 3QXWA 3I50L 5DHYA 2FYYB 2WQRA 3PL6D 1SEBA 1T0NA 1KIRB 2DDQL 4GW4B 3ILPB 3FZUD 1OTTD 2R15A 3SGJC 2XIDA 4XCEB 1JHKL 5TE6H 5HDBF 4XAKE 5KVFH 5C0EA 3FQNB 5IESL 3ARVA 4DGYL 1NGPH 3QT2A 4AH2A 4U6VH 5E8OB 3VGFA 5IB4B 3TO4C 5KSAC 1FNHA 4G6ML 5FB8A 4I9WE 4BH8A 1BAFL 2J6EL 2VQ1A 3HE7C 4L8BA 2F74A 1U3HD 3RZCA 5C0RH 4HAFA 3VFTA 5FYKU 4ZXBC 3MRIB 4LSPL 3FFCA 1YEEL 5ACZA 2VLKE 4RAHA 1AY1H 4NO5A 3QO0B 3VGBA 1LVEA 1MCEA 4U1NA 5DA0B 5H2BB 3MJ7B 2R0ZL 4NQEA 2MKWA 1TDQA 2OMNA 4PGJA 1F3RB 3BPOC 3C5ZB 4U3HA 3SDXF 4B7LA 1MLBA 1MJUH 5DJCA 1PQZA 2A77L 1IGCH 4LK4A 2DM2A 1CFTB 5EIIA 2H32H 3MODL 5CD3B 2QQQA 2Z0BA 3ARFD 1VFAA 1CCZA 4D0BA 3S5LB 4OLVH 3TC9A 2NXYD 3O3UN 3WJJC 4QTHA 2ITDA 3OKYA 4LPCA 3F7PC 4MVBD 3S34H 3NN8B 3C6SA 3MA9L 1BEYL 4LCYB 5FM5M 5H8DA 2X4PB 4HEPG 4Z7WF 2HKHL 4XP9H 1WGOA 3RFZC 5EZLB 1AHWC 1XIWB 3GSOB 2FL5B 3SKOB 2VIRB 4KJYA 5I8OH 3HNTL 3ULSA 4ETYA 3BI9X 2AW2A 3SDCA 3BE1H 4GOSA 3KDMA 1BFOB 4YDVA 2K7QA 1MJJB 3QIWB 5AYUL 1R3JA 5FYJD 1I1YB 3ZE0F 3T0XA 1QPPA 1S3KL 2C1PB 5I19L 2UWEE 3CVHL 5JXEC 1P4BL 4UBDC 2XQYG 1G7HA 5DXWA 3HMWL 5K33A 4ZUSA 1N59A 3EOAA 1EUTA 3TH3T 3FTGB 5F71A 4NQVA 2FZ3B 4PD4J 3MBEA 4PUBL 3O2WL 4NHCL 1AGFB 5MEPA 3WLBA 4P46C 4X6FA 1MY7A 2HH0H 3O2VH 2NY2D 2EDFA 1FORH 5FGBC 3DUUB 1OARL 1OTTC 1UZ6F 2ITCB 4JJ5A 1XR9B 2Y6SC 1OGAA 4H1LB 1QRNB 2YSSB 1YMMA 5FO7A 3X12B 4X6BA 4PLKD 1AQKL 1WWCA 5D7IB 4JZOB 1JNHA 5F44A 2Z9TA 3AS2A 4RGND 1S5IL 2V17L 3PV7A 5T5FL 2VDRH 4WGWB 3U1SH 1A2YA 3X11B 3HI1B 3C2AH 3HAEB 3HC4H 1CZ8L 3S37H 4JR9L 4Z7WA 4YZFE 3V5DB 4UTAL 4FRWA 4BZ1L 1G6RL 1GC1L 2AAVA 1Z9SA 4X5XA 5TDNA 3BZEB 3HZKB 5DD3L 4Z0XB 3FQRB 2CRZA 1UWGH 4TNWF 5TF1H 2E9WA 3RWJB 2QQLL 3X3GL 1F3DJ 1KCKA 5HYJD 4KMTL 3M1BA 1GZQB 3OX8A 4QRUB 5DMKA 2B5IB 1NBZB 3RL1B 4X5WA 5F9OH 3IU3A 4HC1A 1U9KA 1B2WH 4JLRB 1AQDA 1F3JA 3UAJC 2NXYC 2QSTA 3ARQA 5CINH 3V0AC 1S7UA 4UNVA 2E6JA 1OGAD 1BZ7B 3H7BA 1YMMD 1OD9A 3EO9H 5LCVL 4PJCA 1ED3B 5I1AA 3QUZA 5SWSB 2EDDA 1YNKL 1FE8H 5CD5D 1R5WA 5E6YA 1FFPB 5C0AE 4MXWL 1YPZF 3BAEL 4XPBH 1NCDL 5DDHA 4AIOA 4Y5XC 5L6YH 3TGXA 4F57H 5IJVA 1HH6A 1DQLL 2NLJB 3H9ZA 3V4PL 4MAYB 5D6DC 5D9SA 3U0TB 5IHUL 1PG7L 5I16B 5GJSL 4LKXB 4LLWB 3RL2A 1DDHB 3QR2A 3VRJA 4LLMB 1SM3H 1S5HB 3G6AA 5F9JB 4PRAB 4ZYKA 5KS9B 3UTPD 3IF1B 4FQCH 3T4AB 2VXUH 1TJIH 4OCWL 4X6CE 2EEBA 4WFED 2XFXA 2EO9A 5KSVA 1JBJA 3H3PL 3OKNB 2AABL 2GFBA 1AC0A 3TFKD 5I8EB 1CICA 3FHAA 5CEXA 4LU5H 4G8GA 3QFJA 2LQRA 5EUOB 1SBSH 5DD5H 1WIUA 3OXSB 3WIIH 4A6YL 1SQ2N 2ORBL 3EZJB 3Q6FA 5C9JB 3THMH 2AV7A 3ZYZA 3BKJL 1YEIH 2O5ZL 1WLHA 2BOCA 5B38B 4HWZA 1PLGH 3EYSH 3DX9B 4ODVL 3B9KB 5KVMC 4M6NL 4Z95L 4YE4L 3GEWB 4DK6A 1PBYA 1BX2B 1IEAA 5MERB 2NY2C 4G6FD 4GS7C 1U8IB 4XH2B 2XWJA 3D48R 3TBYA 4WW2F 4OCNC 2NY7L 4DJMA 1BMGA 1OP5K 1K4DB 4PLKC 1R5VA 1S8DB 4G9DB 5ID1A 3OQ3B 5LG1A 3HR6A 1N7ML 3G5VA 3C6LC 2XKUA 4WFGD 3SY0A 3KLAA 4OAWA 4RGNC 3TNNB 1UC6A 1DFBL 4N0FA 4Y7MA 1PJ9A 2QBWA 3SGDI 4P59L 2FBOJ 2PCPA 3QDGB 3ZDYE 5JQ6H 2YA1A 1WTGT 5C09D 2OTWB 1EGJL 3IFOA 1CICD 2Y06L 2XN9A 4DCQB 1NBYB 3S7GA 3OKMB 1RMFL 5DK2A 1MVFA 1MFCH 3OKDB 3F5WA 3BPNC 3D0VA 4JPKH 2ERJB 4NDMB 1JVKA 3V4VL 1XH3B 3TA3B 3LEVL 3WNMA 4LQFL 1KB5H 1PVHA 3GSVB 2Z35B 4X9BA 5CSZB 4EI5D 1GGTA 5FHAH 1KIPB 4HX1B 4LPWA 1RUMH 1TCRA 3EOYG 4AEIL 4Q0XH 4QO1A 4HJGA 3VXQA 1WBZB 1JN6B 2B4CL 3P40A 1FVDB 5DJZB 1J0YA 1GSMA 3AS0A 3C5JB 2NW2A 2G60H 4G7YL 4RGMC 5GGVL 1KENH 2D9CA 5IHZA 2FCBA 1AR2A 1J18A 1X5AA 1A14L 4MGXA 5T33L 3BSZL 4WW1A 2BNQE 5F6HJ 2GK2A 2VLRB 5IVZA 3OF6A 5HGDB 3IRZA 2VDMH 3L5HA 1MWAA 1QLFB 4JN2B 1LDSA 4M93C 1HNFA 3QDAA 3QI9D 2YC1B 1EO8H 2C4FU 1CD8A 3KJ4C 3HZYA 4NNPL 1U8HB 2DI9A 3BP4B 1RIHL 2YUVA 4GW1B 1DLFL 1ZOXA 1RJYA 3CFEB 1KLGB 2XWBA 3F7VB 3TYFA 5LJYH 4HC1H 5SWZA 2VWEC 3MX0A 4PGBB 3MMEB 5ELIA 3BW9A 4QRQB 1CN4A 5ITBH 1JNNL 1W0VB 3U9PL 3WJLC 4ACPA 3TN0B 1SEQH 2DBJA 2X4UB 4KVNH 2Q1EA 3ZKXB 1QSEA 2LAAA 1ZVSB 3JVGC 4FFYH 4KK8D 1AGCA 4X7SH 3DGGA 3FRUB 2H1PL 3LDBB 3DSFL 4G7VH 1U8NA 3MROB 3T77A 4ZD3H 1RVFH 4KHXL 5HHXL 5IB2A 2E7LA 2G2RA 3RVVC 5F7UA 4PRPA 1ZLSL 1PKQE 4WI8A 1EEZB 2G5BB 1A7OH 3K8MA 4F15B 1NMBH 3QEHA 5ALBH 2GQHA 4HKBB 3WS3B 4ODUB 4D9QD 5AG9A 4M7JL 1F2QA 1RZFH 4JPIA 1F00I 2KZWA 3OF6D 4DVBA 1MVUA 3ESUF 3RWEA 2EE6A 2GYSA 3LQZA 2DIAA 1KPRB 3T2OA 4HG4K 3BOVA 1J1OL 5GHWL 5JOEA 3AM8C 4LSSH 4CGTA 1W2KT 4LHJB 1GZPB 2ATPA 5CGTA 1LMKA 2EYSA 2Q7YB 1IC4L 1XF5B 2P49B 1UH4A 2XZCH 3ARPA 4GBXB 4JFDA 4EEEA 3GUTA 1F4WL 2X1QA 1SYVA 4RMUA 5HYSG 2NTFA 3FO1A 2IANA 5GIRB 4U6TA 3DYOA 2FX8L 2Q7NA 1F4YL 3QWQB 2EZ0C 5JHLL 5BZWA 3B3IB 1T2QH 4D8PA 2UZIL 5BQ7B 5KSBA 1HDMB 1HYSD 3TIEA 1XGPB 3IU4H 1JWUB 3B83A 3I2CL 3LS5L 5C0BE 4OFPA 5D6CA 3KYAA 3C2SA 3BH9B 2ZCKH 1JGEA 1KJMA 2Z8RA 2VLJB 1M7IA 4E0RA 4LAQH 4Q9CA 3KS0H 5I9QC 4KVCL 1IGFH 5I15H 5K59E 4Z7OF 1HI6B 4BJLA 1HIMH 4Y4HC 2Y9RT 4EI5C 1CD9B 1VFBB 1WAAA 3P2TA 4P5TC 3R8BB 4UILH 1K85A 3PWLA 3VE0B 5JIPA 4AY0A 2NX5D 1RURH 3EYOB 1NDMA 5IMMB 3MNVA 2XA8L 4CRPA 4L4JA 4KAQH 4YHML 3CZFA 1JF1A 3N0PB 4JHZA 1E4JA 1MFEL 5LGHL 3S96B 3MRFA 3QNXB 2CLRA 2ZSVA 3D18B 1F8TH 4WV1B 2JCCA 1N26A 5TGBA 4DVRL 2AJVH 4MJ5A 3QDME 1FYTE 4XNQB 3T08A 3PG2A 1LK3H 5T3ZD 1TPXB 1QR1A 4PRDA 3HS0B 1TJGL 3QI9C 3P9LB 1FJ1A 1I7RB 2GTZB 3EJJX 2ZSWB 4YDKH 5T1LA 1KELL 3RNKB 2AEQH 3NGBC 3VH8A 4JRYA 1CBVL 1GGIH 4X8JB 5B3NA 1D6EB 2DAVA 5FF6A 1BFVH 1V7MH 3P4NA 3IRPX 4RAUA 3BDBA 4P2RA 1I1RA 4IOIA 4NBYB 5IT2H 3D0LB 1IL1B 1A9EA 4TVPD 2CKBL 5J89A 4KK8C 5EB9A 2VR4A 5IKCB 4ZUUA 4U6XB 5L2KD 4LPVA 4PGCA 5JOFB 2FH8A 1K5NB 1T7WA 3HMXH 3H9SD 4RZCB 1KJ2B 4RGOL 1BP3B 1NH6A 3FT4B 1UJ3C 4U33A 3AGVA 4UDUA 2NNAB 4ODSL 1CDJA 4X4ZA 3QDJB 1FO0L 1XF4A 1K8DB 5CZVL 4DEPB 3IETA 3CUPB 4P9HH 2VDNH 3RVXD 1NCTA 3VA6A 3A0OA 4G43B 4RGNE 1ITCA 3CFJB 3IFPA 2DQIL 4N1HB 2H3NB 3QWRD 4CVZA 2ZWLT 5HDBE 4JB9H 4NSKB 3RAJH 3WN5B 2NPLX 2VISA 4CL7A 1VERA 5D1XB 4GG8B 3IYLW 5ENWA 1RUAH 4CMMA 5T1LD 1UCBH 5JO5A 3MNWB 4PBXA 1ZA3B 3VXPB 4WW2C 3U36B 3N1FC 3NCBB 4QT5A 1UT9A 3NFPB 5KOVC 3Q48A 5I18H 1ZT4A 1G7MA 3UTTE 5DJ0A 3QQ9D 5DR5L 5F7FA 2FIKA 1CL7H 4ZTOL 4TUJB 3G08A 4MNQA 3QIBA 2HRLA 1QBBA 2PXYB 5HYJE 2D03L 1OAQL 3GSNH 1OD7A 5E4EC 4EXPX 3WFCH 1UYWH 1H3GA 1MHCB 2FO4A 2VE6A 1OPGL 1Z3GH 3AXLB 3AS1A 3FB5A 1X5JA 5HHPA 5E99L 2VLKA 3N9GH 4YXKL 1AGEB 1JF5A 1HOCB 1KTLA 4GUPA 4RFEB 3UZVB 4OI8A 1NGYA 3SDXE 1MREH 2VN4A 5HPMA 5TJWK 1F4XL 3VFGH 4PG9A 2YPLB 2DM4A 4HUVB 2DKSA 2J88L 4HUKB 3NCJH 4C59B 3VXSD 1F58H 3GNML 4TUOB 2ZZUT 4HBCL 5EO9A 2MJWA 3P4OA 5CJOH 1A7PH 3NZ8A 2DWEA 2ZUSA 4JFZL 1IILE 4YHNA 3UTSD 4YPGA 3FHQA 3U2SA 2NY0D 4G3YL 2VXVH 4CADB 3FO9B 3UTPE 1S9XB 4L4TD 4XTRD 3KJ6H 4H25A 43CAA 3GHBL 3CFBB 2VWEE 5FM4A 1ZHLA 1FRGL 4XMKH 2EICA 2R4SH 5C71A 1F97A 5FO9B 4AG4L 3FOLA 4Q7DA 2P5ED 2FLBT 1CF8L 4M1CC 3ARDD 3TVMA 3MLUH 4OZHB 4NIKB 4OB5H 4LVOB 3C9NA 4AMKL 5IQ9B 1RZJC 1HXMA 4O58L 3CXDH 1C5BH 1TXKA 5E70A 2R69H 3ZE0E 3HB3C 4IRSB 2V2WA 1T1ZB 1CXIA 2R56L 7CGTA 3VWKB 5DFTA 5JIHA 5DMGC 1E4KA 1I4FB 2O26U 2AEWA 4GQ9L 5HHMB 4FQ1L 4K7PX 1L7TL 5BO1L 1KLUA 3I6LD 1BIHA 5GXBB 2XY2A 1JNLL 2C1OA 2MPAL 1QSFD 1UKQA 2RFXA 4QRRB 1ZHBB 1S7XB 5ESQA 3IKCB 5HD8D 4XCCH 3UTQA 4AEEA 5D70L 3BQUB 2EDOA 4HCRL 2RAMA 4PLNC 1HN1A 1I7TB 5C09E 4JPWH 4XRCA 1FIEA 1FNAA 4CKVX 2A0LD 2PO6B 2D4FA 1FIGH 5F7DA 3IGAA 2R8SL 2FEDC 4OIIH 2ICCA 2DMBA 4IJ3B 4JRXB 2FB4H 4P2QB 3QQ9C 1G7PA 1VFUA 5EUKB 4G8FA 4ZDHB 5C07E 3PHSA 1OTSC 2I25N 4ZS7H 1O0VA 2H32B 2JJUA 4KUCF 2W0PA 2QSVA 1CXFA 3ARBA 1T03L 2X4OA 2ED9A 2HG5B 5TPWH 1JFQH 1I9JL 1S7SA 3T3PF 4KK5D 3D9AH 4U1JB 3BGFC 5FKAB 4P48A 3MRLA 1LILA 5DWUH 5CBEB 3EOBA 1NCBH 3O8XD 2JIXB 1PW3A 5FYKL 4P23A 5KTEH 5BRZA 2WIIB 3DECA 4YLQT 1MCRA 3ZL4H 2AXFB 4ZAKC 3TM6A 3QAZC 3FB6B 3GMOB 3C09B 3UJIL 1MAMH 2IBGA 4XHJC 5LXGH 4JPVH 4P9ML 1X7QB 4QGTA 3GMQA 2C3XA 1CXKA 5T1KB 1JRHH 5HGBB 2GJ6B 5C08A 4XTRC 1YPZE 2VAJA 3MLSL 5KAQG 1FNEB 1KPVA 2F5AH 4WO4B 3TJEH 4EKXA 4KJQC 5HVFB 3B2UD 3ZTNH 3V79C 3PGDB 5MP6L 1EHLH 5IEKB 3RHWF 1DE4B 2FX9L 2CH8A 4KK6D 1SJHA 5D1QB 3JWOC 3OJVC 3OKEA 2I07B 3ARDC 1S7RB 4X80L 4NO2B 4HPYH 1I1CA 4QHMB 4K8RH 4JFEA 2B0SH 5I30H 3ARBD 4X6CA 4Z7VB 4IMLA 5L88L 5HYSB 3RVTC 4DW2H 3DYMA 2LVCA 1NGZB 1MCCA 1ZHNB 3MJ9L 4HIEB 4M00A 1FC1A 1ORSB 1ZLWK 4Y16A 3O11A 5IB3A 2HFEB 1MLCB 5F7KC 5E8NB 4P23D 1ORQA 1NAKL 4FQIL 3MRCA 5C0GB 5DI8B 5EU4B 3SHSA 1D7FA 3QQNA 3QUMA 3JV4A 3GIZL 1MH5A 3T0EB 3SGJA 1R3LA 1E4XL 4Z7NE 3E2HC 2R2CA 1WC7B 4QXUH 5A2KH 5HDLA 1HHGB 3Q1SH 5HD8C 5C08D 4JCMA 3ULUF 3GMRB 3OJ2C 4FMFA 3O0RH 4HS3B 5HDQH 3BP7B 4HS6A 1K6QL 1S7WA 5F3HB 2D0GA 5HHOB 3RUGA 2VDQL 5J9PB 4APQC 1CE1H 1L4IA 1QRKA 3SJVA 3L5WA 1CGTA 2JLLA 3VFVA 4C83A 4ZXBA 3FRPG 4G80B 4KHTH 1P4IH 5ADOH 3N1PC 2GAZA 3WFEL 1PSKL 3FONA 4I0PB 1A6UH 4LEXH 5FCUH 1RZ8B 4MJ6A 1FCCA 1NC2A 5BV7C 1P6AB 3D2UA 2ZCLL 1Y18B 2O61B 4MJ2A 5CZXC 2J5LB 2NX5E 3T0WA 1LP9B 4R9HA 1M7XA 2BMKB 2I5YL 1DLHB 1QFWL 3E6HB 1RU9H 3RNQB 5KBNC 4KK5C 3PQYA 3VXUB 4KY1L 4R7NB 1XCQB 2AEPL 1MUJB 4HUUA 4XCNB 4GKNB 2F9BT 3CD4A 4I2XB 4KKLD 1J12A 3O8XC 4KUCD 5CP3A 3MJ8B 5MENB 4BZ2H 3QIUC 4NZTL 4ZQKA 3JWNC 3MRGB 3MZTA 4KTDH 4NOBA 4I0KA 4M7LT 4TNVK 5HJ3B 5T3ZE 1OAKL 3I9GL 1JWMA 4MJ4A 1DBMH 4OCRL 3ARGB 3U9UB 4K9EC 4P5MA 3IJHA 1KCVH 1W8OA 1NBVL 3BKML 1D5ZA 4NN7C 4PRHA 4DK3A 2Q86B 3GHEH 3PP4L 2F53A 1AHWA 3IXTA 4KTEH 3WL9B 5EZJA 1AR1C 2E9IA 1GVIA 2BNQA 3EDFA 2OCFD 3DMMA 4Z5RA 4ELMF 4W70A 3B2UC 1LD9B 1OAYL 5K9QI 2P5WA 4QHLB 4XAWH 5HHNA 5D7JD 5BS0A 3RPKA 4F7CA 4TVPE 4GAGH 1NC2D 4LSTL 1SYSA 3D2UD 4Y5YB 1DVFC 1A0QH 5L2KE 3QB7C 4L8SB 4MNHB 1TCMA 4X98A 4LHUA 4XCYB 4JDTH 5DTFA 3MRQB 4M1DH 2A9NH 1AE6L 4TVSa 5EO1A 1TTFA 3OR6B 3KVQA 4FNLH 4KDTA 3TO2B 5CCKL 3RBGA 4IM8A 4WWID 1KN4L 2CXKA 4P46A 2BK8A 1IZKA 3QRGL 4G6JH 3O3DA 5M7QA 2JB5L 2UZYB 4LNVA 3UO1H 1FZKB 2XQBL 4I13B 2OM5A 5FGBA 1ZGLP 3ISWA 1X5XA 1NJ9A 5HGAA 4XCFH 4O2FA 5JMOC 2D7TH 1HXYA 1PKQA 4OGZA 1S78D 3ARWA 2P7TB 4FQXC 3ZMRA 3LD8B 2H2SC 5D2LB 5ICZA 1G7IA 2YKLL 5MEQB 4DKFL 3DMMD 4XP4L 3T0BA 1G7LB 1EFQA 1QVOB 5E8DL 1UB6A 3BVNB 4PY8J 4RFNB 1HKLL 3DVNB 2MWCA 1HYRC 2WUCH 4KKCD 2V9TA 4EVNA 3FMGH 4PREB 3IDGA 3VH8G 2BVYA 4XHQA 3ULUD 1MCHA 4BSWA 4YXHH 3QXAA 5E7FA 4R8WH 1RZ7H 3O6FA 3RY6C 1HQ4A 1I8KA 1KB5B 1HH9B 1GAFL 2PW1A 1IAIL 4XGZA 5GSVB 5D2NB 1HEZB 1OLLA 1BGXL 4BK4A 3HG1E 3BYTA 4QYOB 4JAMB 5L2JA 2XXMB 1XIWC 1AC6A 4Z7OE 1MRCL 1EDQA 2FGWH 1OP3K 1TVHB 4P4KA 4KKLC 4PJGA 4XP5H 1QZ1A 3SDAA 3UTSE 1X6NA 1LO0L 3O9WD 2DL9A 3VCLB 2NTSP 1JZ2A 5K9JH 5ABDE 4J3SA 1LO4H 1CFQB 2E9BA 1ZEAL 2LVEA 3IVKA 4M8QA 1I85C 5L8JB 5FA3B 3LQAL 1T21A 3O4LB 3JBG7 4TSAL 4I77L 2A83A 4Q9RH 4EIZC 1SJEA 2KDGA 3EAKA 1PZUB 4PRID 3SEPA 4PLJD 4JY5H 4LFHD 5HI4D 4D0CB 1MSPA 3CVIL 4ONFH 4URTB 1VGEL 2IG2L 1KCLA 2FBJL 5E5MB 1QR4A 1R5IB 1OWWA 5DEFB 2WINB 4NKQB 5CJ5A 1FYTA 5D7JC 2CGRH 4JFYB 3O45A 3O6FD 4NNYA 3MUGA 3TBTA 1DQTA 1J8HB 3QULA 4BH7A 4AYFA 2AQ1A 1NMCB 5CIPA 5DFVC 2DQGL 4FZEH 3LN5B 4X0KA 4IS6A 2MHAB 4NCDA 4FQQA 2X10A 4MWFA 4E41B 4G9FA 1T1XA 1EPFA 2YN3A 1KXVC 3KHOA 1HNGA 3JWDL 3REVB 1W72H 4GAYA 4JFFB 3PWVB 5I1IL 3PUCA 5GRVL 3I6LE 4H8WL 4P4KD 3V9FA 2ICES 3QZWA 3G5YA 3VFWA 2OBGA 3W0WB 2B1AL 4AQ1B 1C08A 1QSFE 4GRLD 4OCXH 3SDAD 2VL5A 1YC8A 3O81A 3CDYA 4F9PA 5HYIA 3BXNB 5TE6L 3PE9A 5KVFL 3WLWD 1FZMB 4IEFB 4JM2F 4FFWC 3SKUD 3PJSB 3V8OA 4F2MA 1QFPA 1RQ5A 1C12B 2GKIA 4U6VL 5H37H 5D72H 1UQSB 4JCLA 4NZJA 2BX5A 4WHTB 4HXAH 5EBWA 5LAXB 4Z78B 1XGTB 2F19H 2ICWJ 2FHFA 3G6DL 5EBMA 4NT6B 5C0RL 4W68A 5LKNA 5I1HL 5DURD 2DM7A 4M62H 5CMAA 1CVSC 1IQWH 3PDGA 3H9HB 5JHDA 1CFSB 2ZUUA 1I9EA 4WY7H 2D7OA 1JPTH 4DOHE 2BSTB 3WHXA 4G9FD 1YEJH 1N8ZA 5E94A 3VWJB 1WEJL 2OJEA 3O41A 4K94L 4V1DE 1ZA6A 4OLWH 4NO0A 3MUJA 1BD2D 1NL0H 1R24A 1DBJH 1I8MB 3OZ9H 1R3KA 1UB5A 4Z7UA 5CAYB 2BRRL 3SPVB 5EFIA 1CE6B 1CWVA 1OAZH 3SGKA 3VDBA 1IGYB 5HI3C 4RWHA 5E24E 1Q9OB 3KYOB 5TFSH 3NABL 2DQCH 4JGMA 3VXMA 4KRLB 4J8RB 1A6AA 2BVTA 3NH7L 5E1AA 2I9LB 4W6YB 3KPQB 4YNYA 4YIQA 4PJDF 4H26B 4OCMC 1UM4L 1L6ZA 2ADGB 3DVGA 4OM0H 2D7QA 3KXFA 3TV3L 5I8OL 4OD1H 4PJFB 4DN3H 5I1CH 3BE1L 4HV8A 5JW4R 1QBAA 4XMPL 1HZHH 4ESKA 4LLDA 1BOYA 3GM8A 2Y07L 5B21A 5JHDD 1V8HA 5FYLE 1ZS8A 2XQYK 2GUOA 5EU6D 3OJDB 4QHUA 1DN2A 4EN3A 3QEGL 2CR3A 3QQ3A 3F12A 4L5FL 3GO1L 1XGYH 1RZGA 5A2JH 4NO0D 1ND0B 2OK0L 4R90L 4MNGB 4KZDH 1H3PH 2XICA 3OAYK 1MCPH 5D93B 5DUPL 3TNMB 1EFXA 5ILTH 3ZHKA 1XF2A 2AJSL 3GK8H 4QLRA 4B7IA 4BA8A 4TPRH 1CLOL 2HH0L 1CS6A 3CSBA 2ZOKB 2VZ3A 3QJFA 4NRZB 3V5HA 1FVEA 4JO2H 3ZKMC 1BLNA 4GRLC 4OGAD 4PJ7F 2HFFA 4X9HA 1HSBB 1KC5L 1JTTA 2H41A 3H42L 3I75B 1NFDF 1I3GL 2NY6C 2RCSH 5ERWB 4Y4FA 1QUNA 3WLWC 5C0CA 3AREA 4NQXB 2BVPB 2C7UA 1LEGA 4OFDA 3L3IA 4WHDA 2W0KA 5CIPH 1MF2H 3DTXA 3KXFD 2EC9T 2WSKA 4ZSOA 5D7LA 1A6TA 1EVUA 2QADB 3L95B 3U1SL 2X7LB 1CTNA 5BVPH 5C8JA 3QFDB 1OWRM 1OY3B 3QWOA 1TZIB 3HC4L 3SGEH 3L7FA 3FQUB 3D25B 2EDRA 4AK1A 1U2HA 2AI0L 3U4BH 5I8KH 3GSNB 5IHLB 3HC3L 4JQVA 3EFFB 2UYLB 2R0LL 3HFMH 4E5XB 3D85D 2R1YB 4BSVB 3K46A 1V3MA 1VCAA 5CWSB 5D5MA 4FXGA 5DFWH 3FCTB 3U46B 2W9DH 3VFNA 2LFGA 3SDDA 4WDIA 2LTQC 5TF1L 5DHVA 3EJZD 3K3QA 1TLKA 4J4PC 5A1AA 3GFUA 4LLVA 2DB8A 3G6JA 4JFOB 4NYLA 4Y2DD 3MYJB 2R23A 2HT2C 1A5FH 4ALAL 4NKOA 4Y4HA 5C07A 1B2WL 4HFWB 2EDQA 4QEGA 5D8JL 4Q9BA 3KHQA 3NA4A 3T3PE 1U95B 2JELH 1KB9J 3WV0A 4LSRL 1RZKC 5CINL 5FUZH 1PG7W 3W2DL 3GJFK 2H9GB 2WK2A 5DEZA 1A9BA 3KPTA 3NCCB 1MIMH 2BSRA 5JDSA 1UA6L 3ARED 5KVEL 1FE8L 3MREA 3MFGB 3K2UH 3QJHB 5IWLA 3FAXA 3EYVA 1FFOA 5E00A 4XPBL 3QA3A 5FYJL 3C60B 1YUHA 4N0YH 4F57L 3ZDZE 2J8UB 3B2VL 3DBXA 3DXAA 4JKPH 4P2OB 4ZFGH 3U0PA 2R2EB 3ZKXC 5FA4B 4PJ5B 4I5BA 4UOW1 1ONQA 4YHLH 2VKWA 4CW1A 2VXUL 1TJIL 1FFNA 5FHBL 1WQVT 1A8JH 1QRNE 4OQTA 2V2XA 1KJ3H 1KCRH 4RBPK 1A1OA 1EEYA 1IGMH 3HE6B 1BVKA 2VL4A 2GITB 2VLME 1MQKL 1UKTA 3SDDD 2I27N 3U6RA 1KTDB 5DD5L 2XTJC 3LEXB 1JYWA 1MI5D 4NZRL 2VXTH 2CJUL 3F7YB 1KTRL 4CMHC 3E6FA 1YEIL 4EJ1C 5F1OB 3EYSL 43C9A 3MRDA 2A9MH 3BZ4A 3RWHA 4OUUB 2BSSB 4EOWH 5EU7C 2Y25A 1N2RB 3M8OH 3NAAH 4JE4B 3MV01 4OGAC 2DQFA 1JYXA 4X6DB 1JPSH 4ZPTA 5CP7B 4AIZA 3RVWC 3IDUA 4NUJB 4CU7A 5DJ2A 4NN6B 5IEHB 3AROA 3QG6B 4ORZC 5GRVK 2I9TB 3CX5K 3P73A 4X9IA 2GT9B 4OZGF 4F3FB 5J4MA 2HKFH 1I9IH 5IF0B 3WKNA 5AYQA 1B6UA 1CLCA 4RA0C 3MNZA 5CEYB 4NHUA 4TULH 1CI5A 3U7YH 4CAGA 5I76A 4PRBA 4UUJB 3FO2B 1CGWA 3QNYB 4JM2C 1DZBA 3HKFA 3KPOA 5FIEA 4HKXA 2Z31B 5D1ZA 5JQ6L 4WEBH 5FGCB 1BOGB 3OGCB 2E8YA 3R8QA 3ZYIA 4YDLB 1KN2H 3GJEA 4Q2ZB 3MLPA 4IRJA 1KF9B 4JHAL 5H37G 4XXCA 1Q72L 5E03A 2CDFA 3UJJH 3V4UH 3HRZB 4KRNA 5HY9A 4QXGH 4LHUG 1Q1JH 4XVSH 4WJ5B 2CDGB 4S2SA 3ARXA 3C8HA 3MFFB 4OZIF 4LIQL 4MA3B 1TPXC 5L9DH 1KACB 4Y4KD 3CK0H 1P4LA 1IT9L 3LKQB 4NOFA 4UT9H 4LSVH 5DSCB 4GMSL 4WHCA 2VZTA 4M61B 3DHJA 4G42B 5J6HB 1VPOH 2YXFA 4PJXF 4PRIE 1HHIB 2GJJA 3P0VH 3MCKB 1EV2E 1U3YA 1EX0A 2HJFA 2UVEA 4QRSB 1U8LB 1BQUA 2VDML 2HLAB 3GSRB 3JUZA 4HUWA 2OTUA 4EUPA 3L9RB 3HI5H 2H2PD 3OKOA 4K3DL 3HNSH 4BFEA 4F7TA 4LLQB 4ENEC 1DQQA 1KG0B 3MGAA 3PWUA 5DHVH 4L4VD 3LPFA 4YUEL 4MQ7B 1GPOH 2IFGA 4JDVA 3IDIA 5D1ZD 1AXIB 2WW8A 3BH8B 5DRZA 3TWCL 5DD6A 4HC1L 3FFDB 3AVEA 4NN5C 5DK0A 3V0VA 2DWDB 3L1OH 4ELME 2EIBA 2BRQA 5ESAA 1ZLVH 2ZUTA 4IRJD 4OTXL 5HYEA 4UNUA 3RVUC 5J06A 1QP1A 2CLVA 2YRPA 5ITBL 1S7VB 3BGAA 5HGHB 4MXVE 4U1GB 3B6SA 3BRGC 3FB8B 4ZUVB 4DEPC 2WQ8A 2HJKA 5FFLA 1QBLL 4K23H 5IBLD 4OD2B 4X7SL 1IQDA 4PGZA 4M6OH 4UI2A 2JJTC 4WI7A 1TZGL 4C58B 1INDH 1IC5H 4Z8FH 4PB9L 5I1DA 1IGTA 1TETH 5DGQA 2Y5TB 5CJXA 3I6GB 5TDOB 4ZOCA 1YJDC 1A7OL 3FQWA 3V95A 4M43H 4NKMB 5ALBL 1Z5LA 3C5SA 3MO1B 1MHHA 3LMJL 1RZFL 1UGNA 1F11A 4XT1C 3O3BA 3GB7A 4F33B 4NQCA 1DCLA 4MQXD 3UYRH 3QXDB 5GISL 5A40E 1LK2B 2ICWA 1I1AB 3IKKA 3S35H 3FN0H 4ONHB 1YN6A 1ZT7B 4NZUL 2UWEB 2DTML 4R4BB 4FTVB 2HWZL 1T7YA 3UBXB 3IS1X 1IM9B 1GRWA 4JVPA 3QHZL 2J4WL 3WD5H 1V5JA 1T2QL 4HULB 1HQRA 4X8XA 2R9HC 2Z8WC 3HCVB 2VR9A 1T20A 2GY7B 2IGFH 4XI5D 3IU4L 1YDPA 2VLRE 1AXSA 1DUYA 1E28A 4U1KA 2IMNA 3D39A 3LN4A 3T3MF 5JORB 2ILLA 2PN5A 1M1SA 3T4YB 3LKOA 1SMOA 4P3DA 4X7TB 5I15L 1ZGLA 4WTWA 1ZVYA 1YECH 4IHOB 1HIML 5DRXA 4PJEB 4JO3H 2YUZA 3QSKB 3IJYA 1CD1A 4ZFFA 3SDYL 3GI9L 1PEWA 5GS1C 4XWOD 3FB7A 3WDIA 1X44A 4N1CA 3KPMB 3WKML 4Y4KC 3QZWG 5GRXG 2XG5A 3GSXA 2DTSA 1AFVL 2AK4A 3QDHA 4KAQL 1MFBH 4DZBA 1QQDB 1MFDH 3J7HA 3CXHK 3LEYH 4QTIH 2X70A 2P48B 4W6WB 4MHHG 3EJYC 5CKAA 1ACZA 1WCBA 4KK9D 1P84J 15C8L 2HVJB 5CILH 5IFHH 3FOMB 2VB5A 1LK3L 3PWJB 4HKJA 3DV6B 4S1QH 4P4RB 4MQSB 4NZDA 4JDZB 1MNUH 3RDTD 3EUUA 4JN1L 2OI9C 2X4RB 5EU6E 3MLVH 3IAQA 3T8XA 3LKPB 4HWBA 4XB8A 1BBJB 1JGDA 3VWKC 5JR1L 1AO7E 3J8F7 1HINL 1ZSDB 3TZVA 2XTJE 3PDOB 1OSZA 2FJGB 4MJIA 2C3WA 1QEWA 1YN7A 3MLTB 3BEVA 3D39D 1V7ML 4I18B 2DLFL 1U41A 1NLDH 5KANI 3QH3B 1L9NA 5IT2L 1QLRB 1ZV5A 4MZ2A 3NIDF 1GOHA 1AKJB 3OAUH 5EU7E 5JQHC 2FR4A 2X4TA 4WWKD 5T3XL 3VRLF 5E08H 1TMCB 3VGAB 5C0AB 1MWAL 4JFQA 1I1FA 1NSNH 3OKKA 4PP2A 3ROLA 2NXZC 4EDWL 8FABA 1X5IA 4I3RH 5T3ZH 3GKZA 1YYMH 3VFRB 4FXLA 3VXOB 2VXSH 2PO6C 5GRUH 2ZG2A 1FZOA 1LE5B 2VLJE 1F02I 3IDNB 4Q74A 3I02B 3GIVB 4CJ0A 4LCCA 1TNNA 3JTTB 2Y36L 3RAJL 5EOCJ 5IBUB 3MRNA 1EO5A 1RZJH 5EN2A 1NUGA 2OMBA 3P0YH 1A21A 1TJHL 1UCBL 3BPCB 5EZIH 1E6JL 5GRWA 4TVPH 4LQ1A 4PG2A 2ZKHL 3AMKA 1DQMH 4K2UL 1ZTXL 3EW3B 4HUMB 3F6LA 3K80A 1CL7L 4FP8H 2F8XC 3CMGA 2PYEA 5FOBA 1TZHB 5BJTB 1WJ3A 2R2BA 2ZJSH 4R0LA 1FGNL 3VXRB 1UYWL 2Z93A 5GS0L 4POZC 3B9VA 2VKXA 3C09C 1Z3GL 5DQJA 4Y5VC 4JREB 3KPSB 5E6ZA 2YBRB 32C2A 3N9GL 5H35B 3TO4B 5KSAB 2BOBA 5IVXF 3E3QC 4HD9A 3HE7B 1MREL 7FABL 3VFMB 3ETBF 4NQDA 3TBSA 5CSBA 1MRDH 4WI9A 25C8H 2VERN 4L8CB 1KT2B 2YD1A 4WO4C 3RU8H 1BQLL 3MLWH 2CO7B 2AXGB 5F1IB 5E9DB 1D5MB 5F7YC 1F58L 1IKFH 4MDJA 3G04B 3SKMB 4Z7QF 3EYFB 1GC1C 1RUPH 1UXWB 2CIIB 3QIUA 2LU3A 3T2NL 5DD1H 5D1QC 2H6PA 3EIFA 4IDLA 1G7JA 4IDJL 5DJDB 4UB0H 3H0TB 1H5BA 4KK9C 4NRXA 4XX1G 5E7BA 3PHOB 1WFTA 2K7PA 2DYPB 1EAPB 2HN7B 2FH6A 3SCMD 3VXTB 1J0HA 5CGYD 1HHJA 2R4SL 3RDTC 1FG2B 4UV7L 2A6KB 2NZIA 3QUXD 1JK8A 3RQ3A 3QDJE 2EIZB 3QQ4B 3IFNH 4M3JA 1WUNT 4PIRF 2FYYA 2PYED 3EYUH 1KFAH 3MLUL 4NNXB 4OB5L 1KIRA 1W72B 4JO1H 4PJAF 5CEZE 3CXDL 2FX7H 4GW4A 1C5BL 3ILPA 4U1SB 2XTLA 1JNJA 3FO0L 2R69L 4N1EA 4XCEA 1LDPH 3FQNA 4R2GD 4WWKC 5HHQB 2IBZX 2JJSA 5E8OA 2AS5M 5IB4A 2V5SA 4X5LA 1Q0YH 2NY4D 2IH3B 1WIPA 3GSUB 5LWYL 1YEFL 2AQ3A 2WZPD 1T2JA 4PJ7E 1T89C 3MRIA 1JZ7A 1KCUH 5IIEB 5J3HD 1OGTB 3NCMA 4XCCL 3JWOH 1NFDE 1SY6H 5GGTH 3V52L 4I0PC 1UZ8B 2R4RL 4WUUD 3GRWA 3QO0A 5H2BA 2YHGA 1JWSB 5F96H 3MJ7A 3C5ZA 3WIHA 1FDLL 4KRPD 1FIGL 2VDPL 4LCWD 3GI8H 1TENA 4RDQG 3QISA 1CFTA 2ENSA 5K9OB 5CD3A 2FB4L 4GAJL 4NBZB 3S5LA 3DURB 3WXWL 5CBAB 5GZOC 2DI7A 4IRZL 3RY6A 1RFDL 1A7NH 3NN8A 3ELAT 4OLUH 4AQOA 1XGRB 1DBAH 3S88H 1JFQL 3ARGC 4LCYA 5I66B 1UWXH 2AV1B 2R0KL 2X4PA 4BK5A 5EZLA 4UDTB 4JGUA 1U3HB 1JGLH 1XIWA 3GSOA 2FL5A 3GM0A 2E3VA 4HH8A 3SKOA 5KTEL 3QXTA 3V2AR 2VIRA 2OL3H 1UM5H 2DQDH 3BHBB 4OZHE 5B39B 5D7KD 2AQ2A 4M6AA 3KPNB 2QSCH 3CAFA 1BFOA 2X9YA 2VJXA 1MJJA 1DBKH 3QIWA 5FECB 4L4VE 1I85A 1I1YA 2C1PA 1JRHL 4HHAB 4Y5YC 5C0BB 5SX4H 3I84A 4YEFA 2XZQH 3ZE2F 3C5ZD 1IVLA 1FL5B 2F5AL 5BV7H 3ARFB 2B4CC 3FTGA 3QUXC 1MHPH 1FCGA 2FZ3A 3DWTA 1MCWM 1EHLL 1J0ZA 5IROC 2NXYB 3LZFL 4KXZH 4NUGH 1RV6X 1QFWM 3V6OA 3JV6B 1AGFA 4OF7A 3HR5B 1WWWX 3MQIA 4GMTH 4QRRE 4WCYH 4LLUB 3DUUA 5F3BB 5IR1B 5C0ND 3BWUC 4XC3L 3VJ6B 1XF1A 2ITCA 2D3VA 4HIXH 4L9LB 1XR9A 4Y5XB 5EIVA 4H1LA 1QRNA 2YSSA 1ZK9A 3X12A 4DW2L 1DEEB 2EYTB 3MA7B 4K9EH 1YY8B 1I9RH 3LD8C 1CR9H 1I8LA 1JPGB 1MPAL 5D7IA 1MCBA 4JZOA 4OZFB 3C08H 3QDMB 3MUY1 2BHUA 3U30C 5JIIA 2NY4C 4H0HB 4RFNC 1FBIH 3O45B 3GKWL 5EUOF 3WNPA 3X11A 3HI1A 2YUWA 4C54A 4I3SL 3HAEA 2B39A 5SWQB 3T09A 3QIWD 2Q8BH 2L7UA 4QXUL 1PFCA 3Q1SL 3KWWB 4L3ED 3V5DA 3MLXH 3O0RL 1BZ9B 5B4MC 4DFHA 3BZEA 5DHXB 5FYLH 3HZKA 4FFVD 4Z0XA 3FQRA 4NM4L 4U6HB 3BT2H 4ISVB 3RWJA 2IAMD 2AXJA 2QL1A 2NY2B 5HSFA 1FYHB 3WBDA 1GZQA 4QRUA 4CJ1A 1NBZA 3RL1A 4KHTL 3T65B 4GS7B 5ADOL 2AXHA 3WUWB 2D0HA 4JLRA 3OWEA 3VD5A 1GHFH 3PGCB 3O2DA 3NACL 3E3QE 1WBXB 1BZ7A 3O6KH 4PS4L 3Q6GH 1GGBL 4I3GA 1ED3A 3H6JA 5SWSA 5A2IH 4I48B 3RA7H 4XBEH 2QV2A 1K3IA 3C6LB 1H3WM 4RGNB 1FFPA 1RU9L 5HI5C 5FAAA 2FATH 3S36H 4UV4H 3GBMH 2NLJA 2VQTA 3RTQD 3GRWH 1P2CB 2D31B 2F58L 3IDYB 4OZIE 4MAYA 3U0TA 5I16A 2X09A 4LKXA 4LLWA 1DDHA 2AJZB 3OB8A 4AZ8A 4LLMA 4BZ2L 1S5HA 4DTGH 4KTDL 5F9JA 4PRAA 5CHNB 1MRFH 5KS9A 3IF1A 3T4AA 3EFDH 3KR3L 1P7KB 3BPNB 3UTTB 1NMCC 3OKNA 2HT3D 4PJXE 2P4AB 2YD4A 1D5IL 5I8EA 4KTEL 1P5VA 2YPKB 5HYJB 4Y19E 5EUOA 1IAIM 4OF8A 5F88B 3OXSA 2FECL 5C9JA 3P11H 4NQSB 3SE9H 1T1YB 5B38A 3DX9A 1IAOB 4AEHL 4RGMB 2CD0A 3B9KA 4CUCA 3SDXB 4PJIF 1T83A 2R29H 3C8KB 4GAGL 1BX2A 4LF3B 3RY5A 5MERA 5DUMH 3DETC 2UV3A 1NUNB 1U8IA 4XH2A 4JDTL 4M1DL 3S3JA 2A9NL 1FV1B 2OQJB 1FLRH 4LSQL 4B5EA 1K4DA 2WBJD 3KJ4B 1I3VA 1A6VH 1S8DA 4G9DA 4MAYD 3RKDD 4PJ9D 4OJFH 4G6JL 2P47B 3D1MC 4UT6H 1Q9LB 5D4QA 5F93C 3TNNA 3KPLB 3UO1L 4YHPB 5IFAH 4N0RA 1NMAH 3MBXL 3W9DB 3QDGA 2R1XB 2D7TL 4HT1H 2YN5A 4KQ3L 3DX7B 1L0XA 1H3XA 2OTWA 1ZAGA 2O93L 1DEDA 1U8QB 1LP9E 4DCQA 1NBYA 3DROB 1INEH 3OKMA 3SQOH 2MQCA 3BFOA 3GBNH 3OKDA 4KJPD 1R0AL 1QA9B 4NDMA 2XZAH 1J1XH 1NEUA 1XH3A 2CRMA 3TA3A 1YY9C 2BNRE 1LQSR 5MENE 1AXTL 3FMGL 2Z35A 1J0KA 3B9KD 3GSVA 5CSZA 3DX8B 1SVCP 2YK1L 4AJ0A 1KIPA 4HX1A 1V3KA 1PY9A 5C0JB 5ISZD 4YXHL 2APTA 5I1GL 2C4FT 1RZ7L 1JN6A 1WBZA 2W07A 4D3CH 4P3CH 1FVDA 5DJZA 3QUML 2DQTH 5IQ7H 3C5JA 3CSPA 1YQVL 3S3PA 5J12C 3BP6B 4JFHE 3U7WH 3WO4C 2O5XH 1CFVH 2VLRA 4J4PA 5HYQB 5HGDA 3QYCA 1B4JL 1U8KB 2YOCA 1JV5B 1C1EH 1QLFA 4JN2A 5CLWA 1G9NC 4QOKD 2YC1A 1MCFA 4XP5L 5F89B 1V3LA 5C09B 1U8HA 1LNUB 3BP4A 3CDFA 4DKAA 4GW1A 4P3WA 3OBAA 5K9JL 3LVEA 2DQJL 4OV6F 1LO4L 3CFEA 1KLGA 3S37X 4IOFD 3F7VA 4MCZB 4MS8C 1QSVA 4PGBA 3MMEA 4HWEH 3TPUB 4QRQA 3K2MC 4Q9RL 3OXRB 35C8H 1W0VA 4PP1D 4FQJH 4DN4H 4EI5B 3TN0A 2HAZA 1H3VA 3G9AB 2X4UA 3TA3D 3DX6B 4P5TB 1N64H 5D93C 1ZVSA 5HBBA 5KW9L 3FRUA 5FYKD 3U4EB 3MROA 2YZ1A 3BN9C 3DUSB 5MI0C 1T04B 5I2IB 2CGRL 3OB0K 4MX7B 4N8VB 1NGWB 5AEAA 1EEZA 2G5BA 1RI8A 4O2CB 4HKBA 4L1DA 4LP5A 4ODUA 3WS3A 3MR9B 5D2LE 5BMFH 2RHEA 2E6PA 4S11A 3KLSA 4D9RE 5IGXL 1W72L 4YHZH 4BQCA 5JUEH 1JHTB 3ILQD 4OT1H 1KPRA 1GIGL 3QI9B 4Z77B 3H3BC 5AWNL 2WBJC 3NIDE 3UTZB 2KPNA 1VADB 1GZPA 2ZPKH 2DLHA 2QADC 2Q7YA 4PJ9C 2JE8A 1XF5A 3VRLE 4GBXA 5J1TC 3NGBB 5JW4Q 2GW5A 1YPZB 2PUQT 6FABL 5GIRA 4JZJC 5L8KB 2X4NB 4WUUE 3DGCR 4HSQA 3B3IA 1J9CT 6CGTA 2EXYD 5BQ7A 2DKMA 3CSGA 2P46B 1J7VR 1HDMA 1XGPA 4MA7L 1JWUA 4XXDB 4LCWE 3WFBH 2F19L 2FIRT 3BH9A 2Q20A 3DO7B 2VLJA 4K55A 4XPFH 3ZLQC 1KGCD 2P8PB 1MJ7L 1Q38A 1UJ3B 1HI6A 4M62L 4YHYC 4J6RH 5E2VH 1RUQH 1EJOH 1IQWL 1VFBA 4GXUN 1JPTL 4NC1C 3VE0A 1EERB 4GRMB 3UYPA 3EYOA 5IMMA 5F21B 1YEJL 4ZNCD 4JZNB 3UXFA 3DV4B 5EOCH 3QUYD 4NC2B 5I0DA 4XP6H 2FJFB 3MLRH 3S96A 3QNXA 1NL0L 4XPTH 3D18A 4XPGL 4OF0A 3C60C 1DBJL 4WV1A 4P0DA 5EPMB 3NFNB 4GBXD 5HDOA 4WW2B 5BVJB 2IWGA 4XNQA 1NC4D 4BZYA 1N4XH 2A6IB 3HS0A 1X5KA 3P9LA 1I7RA 2GTZA 3OKLB 4M02A 1JZ8A 1FAKT 2DMCA 1FAIH 4NQTA 2VDKL 5TFSL 2ZSWA 4WFFE 4N5EC 1EZVY 2VITB 4OBRA 3RNKA 2DJSA 3E8UL 1R3HB 4P99A 4X8JA 5E4EB 3IDMB 1D6EA 4M5YL 4QY8B 4Z7QE 3HUJF 4Y1AD 1GOFA 4RMWA 2ZUVA 4OM0L 4GKZB 3MYZA 4U2YA 3D0LA 3W0WE 1IL1A 2A6JB 4OCSL 1NUDA 5E2TL 4XPAH 4I4WB 5IKCA 2IQ9L 2QLVB 1RZIB 2NX5B 2DICA 4U6XA 4RMRA 5ALCL 5JOFA 4UQ2B 1K5NA 1XZ0B 5I8CB 4RZCA 5SX5H 3RJQB 1KJ2A 2HTKD 3FT4A 4TUKH 4PTUB 5GRJH 2NNAA 1X5FA 3V7AG 1RZKH 4PJHF 3QDJA 3NTCH 5T1MB 1K8DA 1T22B 4IIQB 4R4ND 5DEGB 3CUPA 4NN6C 1RHFA 4PJAE 4KZDL 1H3PL 1NAMH 4WU7B 3QEQD 4G43A 3CFJA 3GK8L 2H3NA 1NANI 4GG6F 3LN9A 2EE3A 4NSKA 5A3ID 1FN4B 3WN5A 5EA0H 2I24N 4X99B 5D1XA 4GG8A 4MB5A 1OQOA 3FT3B 4QCIB 2QHRH 3MNWA 1ZA3A 2R0WH 4CBPA 4L3EE 3VXPA 1AH1A 3U36A 4C56E 3NFPA 3UJTH 4LMQI 3T0AA 2ESVD 4YDLC 2EXYC 4JQXC 4FMKA 2C9AA 1MF2L 5J1AB 4TUJA 2UY6A 3GMNB 1A3LL 1T2XA 2PXYA 4K71C 5KJRH 4Q6IB 1U8OB 5L2KB 5ITFB 5F6IB 1A7BA 2IBZY 1MHCA 3AXLA 3H9SB 2B1HL 3V0WL 5TQ0H 3DIFB 1AGEA 4RFEA 1HOCA 4Z76B 4OD3H 4JRWA 3HFML 4GAFB 3ZE1F 2FEEI 2SEBB 2YPLA 4R26L 4ZO8A 4HUVA 2MNUA 5J6GB 4MLIA 1S9WA 4WI5A 1FVCB 5EBLB 2MOVA 3D3VD 4TUOA 1G6VK 2IALB 2IPKB 4F8QA 3S4SB 4H1LG 2MCPL 4NM8H 1A5FL 1A4JB 4PJFE 5FDYA 4PTTB 5DVMA 1F45A 3SOBL 2MTPA 1NCWL 3RBSA 4OSUH 4XPHH 5D1XD 4CADA 1A47A 3FO9A 4JG0L 1S9XA 2JELL 1E27B 1C16B 5FUZL 1DSFL 3CFBA 3B8SA 1FGVL 3PWPD 4OLYH 5FO9A 4N5UA 3HAEG 2VMFA 1FL6B 1XT5A 1KLFA 4MNGE 4U1GC 1VENA 2PXYD 4FXKB 4OZHA 5IQ9A 5DLML 1EJ6A 2C26A 2Z8SA 2ZP0T 1DBBH 1IRAY 4IRSA 1M6OB 1T1ZA 4YHLL 1A6ZB 3BGFB 5E6IC 3MJ6A 3ZE2E 4K7PL 3HG1B 1SHMA 1VHPA 3VWKA 2EDWA 4PYGA 1CGSL 3BO8B 3VXSB 2X05A 4ZAKB 3QAZB 1I4FA 2HTKC 3WS6A 2D0FA 3SE4A 5DRWB 2V2TB 4NWTH 3UTSB 1FNSH 4R4NC 4CDGC 4QF1B 2NY0B 1ACYH 4HQQH 4HMDA 4MD5B 4PJBF 4L4TB 1OCWL 4QRRA 1ZHBA 1A6WL 1S7XA 5BOZG 1T3FB 3IKCA 2A9ML 4QHNB 5DRNB 2IADB 3MGOB 4FQLL 3BQUA 4EOWL 1KEMH 4O9HH 2F5BH 4M1GH 2P5EB 1I7TA 5AUMB 3MLZH 3VI4F 1G0XA 1JPSL 1B4RA 4OLZL 1M7DB 2PO6A 5C6TH 3ARDB 4FQ2L 5I1JL 4YFDB 1CDCA 4GFTB 1QFUL 4JFPB 3EO0B 3BD4A 3WNLA 4JRXA 5KG9B 4P2QA 2HLFC 1XFPA 4HW6A 5EUKA 1I9IL 1XCTB 2UUDK 4ZDHA 2XNAB 3P77B 4IRSD 1MFNA 2H32A 1J0JA 3MV9D 5EIQA 12E8H 4HKZB 4O4YH 3U7YL 2VABB 1T7XA 4XNMB 1UM6H 3F8UB 4NC1E 5A16B 2HG5A 4WEBL 5CEZH 2EKSB 1CT8B 2CRYA 5JTWA 4M7LL 4AL8H 3EDDA 4U1JA 5B38G 2CUIA 3NA9H 4O02H 1RIVH 1NCAL 3X14B 1T0MB 3GSWB 5FKAA 1YJDH 5CBEA 4JFXB 1QSFB 2YD9A 3V4UL 2JIXA 3E2HB 2WIIA 3KNBB 5EC2B 3KYKH 2AXFA 4DAGL 4XVSL 3FB6A 3GMOA 1H8OA 1D9KD 4J23A 4M48H 2OL3B 1X7QA 3BQUD 4U49A 1UWEH 5L9DL 3BUTA 5T1KA 1U6AH 3BJLA 1IEHA 3CC5B 3CK0L 3I50H 5HGBA 5B8CB 4APQB 2GJ6A 3KPRE 4UT9L 1B6DA 4LBEB 1OP5H 1FNEA 3M07A 3RPIB 3WNKA 4WO4A 1YEGL 2EH8H 3OAZK 1IMHC 2W59A 4KU1A 1DQJB 1VPOL 3PGDA 5CUSL 5IEKA 4JRXD 4G6KL 1DE4A 3GDBA 4P2QD 3K4DA 5D1QA 2DLGA 5BV7B 1JHKH 4YEEA 4XP1L 2I07A 3QBTB 1AIFB 3HI5L 4DGYH 1S7RA 3BEWB 4Y0GA 3CDGB 4NO2A 4QHMA 3VFSB 1OOAA 5BXFB 4DQOL 4XBGB 1GPOL 4YH6A 4Z7VA 1F4HA 1JL8A 2BDNL 3ARUA 3BKCL 4V1DB 4PRNB 5DD0H 5HYSA 4O5LL 4S1SH 4W4OA 3WSQH 3VGAC 3VI3F 4G6MH 3O8XB 4YO0B 1LEKB 1BAFH 1NGZA 1ZHNA 2J6EH 3BIAX 4HIEA 3AAZB 5TE7H 2NY3D 1ORSA 4LVHC 1MCQA 2HFEA 1MLCA 4LSPH 5E8NA 5C0GA 5DI8A 3LQAC 5EU4A 3TT1L 4PJIE 3T0EA 1KBGL 3UROR 2B8OT 2R0ZH 4Z8FL 1WC7A 4F58H 4LRIA 5T1KD 4LHQB 1TETL 4LASH 1HHGA 3TBWB 3GMRA 5FGCE 3H3KA 1YEDB 2E7HA 2A77H 2LABA 4HS3A 3BP7A 3VD3A 3MODH 4YHOL 5F3HA 2LE9A 5LQBH 5HHOA 5JW3H 1QNZH 5J9PA 3BYYA 4TSBH 3MV7D 4OQTL 3UYRL 2L0DA 1DVFB 2YWYA 5DVNA 5ANME 4G80A 3S35L 4M3KB 1JTPA 3MA9H 3JWDC 3FN0L 1A4KB 3R1GL 5AG8A 3HA0A 3L6FB 4I0PA 2HKHH 2ID5A 1RZ8A 4H8WC 5LGKA 4JREC 5T1DH 2KKQA 2DD8H 1Y18A 4YX2H 2O61A 1LGVA 1LP9A 3HNVL 3EYQD 1EO7A 2BMKA 3HNTH 1DLHA 3E6HA 3RNQA 4FABL 3VXUA 4R7NA 1XCQA 1MUJA 1GJIA 1W0WB 4G6AD 4GKNA 4XCNA 5CZKA 4I2XA 5TH2B 4MQTB 5AYUH 3MJ8A 5MENA 2VDLL 4FQXB 5I19H 1S3KH 2N1KA 2NY5L 3CVHH 3MRGA 4I1NB 1P4BH 1T66D 3RGVD 5HJ3A 3PXHA 1D9KC 5H94B 3ARGA 3U9UA 2ARJB 3EBAA 4HPOL 3NIFF 3HC0B 2CIKB 4ZODA 2Q86A 1LO3L 4PUBH 5HHOD 3ULVC 1RJZB 3O2WH 4NHCH 3WL9A 4UTBH 5B3JF 2Q8AH 1MFBL 2ZNXA 4K3EL 2QQNL 1MFDL 2F54E 4X7FC 1X9QA 5FM8A 2OX5A 3LEYL 1LD9A 5GJTH 4QHLA 1OARH 4ZOBA 1U92B 4U4BA 3LY6A 5F9DC 4K94C 3EO1B 3KYNB 3JZ7A 1ETZB 4O51B 5IFHL 5EZOL 4S1QL 1L7IL 2EE9A 4Y5YA 4QXWA 4IBLT 1MNUL 3QPQD 4L8SA 4MNHA 4RRPA 5F7MC 5IOPB 4OM1H 4PJ8C 2H45A 4XCYA 3MRQA 2CDEB 3RZCD 3OR6A 2BVQB 2WWMC 1QYGL 4GT7A 3VXUD 5A2FA 5IROA 3TO2A 3FFCD 5FM5O 4QXTB 4KC3B 5E2WH 1CGYA 4RQQB 4YC2C 5I6XC 3CH8A 1NLDL 4S0SD 3IFLL 1FZKA 2FD6L 4U6YB 5I1LB 3TF7C 1X5ZA 4NQED 4BZ1H 4UTAH 4FTVE 5GGUB 1G6RH 1GC1H 1P7HL 5E08L 4PJCF 3MV8E 3QPXL 1G0DA 5DD3H 1FH5H 2P7TA 1U93B 5IFJB 1CLZH 4QRPE 2QQLH 5D2LA 2OTPA 4UQ3B 4I3RL 3LSOB 1ZT1B 4KMTH 5MEQA 1YYML 3KG5A 3PL6C 1G7LA 2ESVE 1QVOA 2VXSL 5D7JB 3BVNA 5GRUL 3CZJA 1RIUH 4UZGA 3DVNA 3Q5YA 4KI1A 4ZTPL 3RX8A 2HTLD 3FZUC 1C7SA 4ZO9A 4PREA 1HSAB 4Z9KB 1FZJB 1OAUL 1YNKH 4PJEE 4HGMA 1U0QA 1RZJL 1U42A 1KB5A 3AY4C 4ZFOB 1HH9A 1IC7H 1NEZB 3BAEH 3ROOB 1BQHG 5GSVA 4F9LC 1DQLH 4X4ME 5D2NA 1HEZA 3V4PH 5GPRA 2VUOA 1OW0A 2D7NA 4EDXB 5IHUH 2BC4B 4QKXB 2YXMA 5HHVH 5GJSH 4QYOA 1DQML 3SDCD 4JAMA 4L9DA 3EYQC 5IBTL 4H88H 1U3HC 3X13B 5L7XL 1NUFA 3D3VE 2BY0A 2BJMH 1TVHA 1H3UA 1U91B 1UADC 2YD3A 3B9AA 4JG1L 3IB4A 4ZNEA 4LCIL 3H3PH 3UP1A 2AABH 2EECA 3VCLA 5F1NB 1CFQA 1VFOA 1T66C 3PV6B 4NO3B 4HJJL 1OAXL 5FA3A 3MBED 3O4LA 4PGEB 3ZTJG 4A6YH 2ORBH 4U31A 3MTRA 3BKJH 4HEME 2O5ZH 1KUMA 1BREA 1V7NL 4K3JL 3MLWL 3MCLH 5KVGH 4UNTA 3ARFC 4D0CA 3EGSB 4Z95H 4U0RB 1IKFL 4YE4H 5KAQF 1AJ7L 1RUKH 3L3JB 2UZXB 3BRFA 2E5EA 5E5MA 1R5IA 5DEFA 2WINA 4MVBC 5HYFA 3Q5TA 1EK3A 2DQHH 4JFYA 1MIEL 5GGVY 3EDEA 1J0IA 3CSYB 4AM0B 1J8HA 2XPGB 4M7KL 1S7QB 4KROD 5C0FB 1PAMA 3PNWB 4X9GA 3LN5A 3ORJA 5IUSA 2NY7H 2MHAA 3MOBL 2JF1A 2JTDA 4L9LC 4OUOA 2KUTA 4E41A 4JKLA 3V6ZB 2AJ3B 4NFDA 3VMNA 1N7MH 3REVA 1FQ9C 4HIJB 3WUZA 3IFNL 4JFFA 4BM7A 3PWVA 3MXWH 3RZCC 3MRHB 4YR6B 1G7QB 2YPVH 3BPLC 3O9WB 4P59H 2WBKA 2J8HA 3W0WA 4UT7H 4XNYH 1EGJH 5AAWA 2G5RA 1N5YL 3TH4T 5ID0B 3F58L 4L8DB 3BXNA 2M1KA 1F6AB 1R3IL 1LDPL 4LOUD 1FZMA 1KEGH 4PRIB 3NCEB 2BVEA 3PJSA 3O4LD 2NW3B 1C12A 1ZLVK 3V4VH 1CGUA 1UQSA 4LSDA 1Q0YL 4WHTA 5LAXA 4Z78A 2DLTA 1XGTA 1JHLL 4LGRB 5IB1B 4NT6A 5IK3B 4HWBL 2A38A 2B4CH 3W11D 2FWOB 3LB6D 3LQMA 3VXRE 2HTLC 2IMMA 3QUZD 1FFQA 5GGVH 3BP5B 1J8HD 3KPSE 4ELMB 3MV9E 1A14H 3H9HA 5F7HA 3BSZH 2ATKB 1CFSA 4HS8H 4E41D 5F96L 2BSTA 5DMIL 5IVOA 2IJ0C 5GSRB 1PY4A 4OGYL 3O3EB 3VWJA 4YQXL 5GGQL 3GI8L 4TRPL 5B22A 5E9DE 2DL2A 4GRLB 3QCVL 5C2UB 3U0WL 5JPNB 1XEDA 3SDCC 4NNPH 1RIHH 1I8MA 3L3KB 1DLFH 1VACB 4S1RH 3IDYC 3SGDH 2NY6B 2X42A 1OM3L 2CO6B 2DBLH 3SPVA 1X4YA 1CE6A 5JLZB 1IGYA 3ZE1E 4FZ8L 4G8GD 1Q9OA 3KYOA 3QFJD 2V5MA 3S88L 3ULVE 4J8RA 5IVNA 5E2UL 2I9LA 3KPQA 4GJTB 4UOW0 4H26A 3TT3L 1JGLL 2VNCA 2H1PH 1VFMA 3DSFH 2ADGA 4N0CD 1X3DA 2ADIB 3V7MA 4KHXH 1OTUD 5HHXH 1VEPA 4PJFA 1ZLSH 3G5XB 3A6CH 3GMLB 4JY4B 1B9ZA 2QSCL 3WYRA 4FHBD 1M05B 2XT1B 4FG6D 5E8PB 4U7MA 2LTQB 2E7BA 3OJDA 5CFHA 5CD5C 2XZQL 5KSBF 4LRNH 3VG0L 3VWJD 1BD2B 1J1OH 2DJUA 5GHWH 5IJKA 1EHAA 5IMKB 3D87B 4ODHL 3HMXA 4NWUL 1ND0A 1MHPL 5M95B 1KYOJ 4MNGA 2M26A 3TESA 5F1KC 3TNMA 4D9LL 3KYMB 4GMTL 2PF6A 2W0FB 2ZOKA 3FRPA 4NRZA 5INDB 1NAMB 2IH1B 2XN9D 1WAAF 2Z92B 4F80A 5F9WB 1T1WB 3UCRA 1HSBA 1JGVL 2DMKA 4P57B 4Y8DC 4HIXL 4EBQL 4RWYL 2OSLB 3TFKC 3I75A 1MCKA 1CG9B 2OP4L 3O6LL 5ERWA 4KQ4L 1U58B 3D69B 4NQXA 2BVPA 5K9KB 1I9RL 3MACH 1S9VB 4MD4B 4N90D 2JCCF 1FBIL 3L95A 3OR7B 2FRGP 2X7LA 3VFUB 4LDEB 3QFDA 2AJUL 5EU6B 1L0YA 1TZIA 1QKZH 3FQUA 4FQHB 3D25A 2A1WL 1NGQH 1AO7B 3GSNA 3QUZC 4WUKH 3VFOB 3EFFA 3DOSA 2UYLA 1F90H 4ZUTB 3KLHD 4E5XA 2R1YA 2XTJB 4PB0H 4M8VA 4BSVA 4XNUL 4WRLA 5LGHH 5CWSA 5T3XD 4CMHB 4HUXB 3FCTA 3S8WA 3HI6H 3U46A 5C2BH 5JA8B 4DVRH 2F8OA 3BT2L 2X4SB 4CVWA 4RISL 2ENYA 4JFOA 4LVEA 1LE9B 2B2XH 3MYJA 1TJGH 2EEAA 5EBGA 4XVJH 3B43A 3MOAH 2VC2L 1OT1A 4HFWA 5SWZD 1KELH 5F7NC 1GHFL 1U95A 5DJAB 1CBVH 3RJDA 4DGIL 4O2EB 5D7SL 1CICC 2H9GA 1ZLWH 4ODWB 1RD6A 2W92A 4ODXB 1FHGA 4XBEL 1QSED 4L3CB 1DR9A 3QJHA 2VLLB 4KWUA 2Y1VA 2DLEA 1JJUA 3C60A 2CKBH 1ZE3C 3UPRB 3IDJB 3GRWL 2AJXL 2J8UA 4JM2B 4PRPD 4P2OA 3WIHL 5FO8B 2R2EA 2Y4SA 5FA4A 4M9PA 4PJ5A 5ICYB 3N1MC 4TN9A 2VSDA 3D85B 1QACA 4NGHL 1MRFL 3EFDL 5F1SA 1D6VL 4M5ZL 5FDWB 1FO0H 5GS0D 5CZVH 4RMVA 2VN7A 3V6FB 4FG6C 3QUKB 5I1KL 3HE6A 3OG6B 4NPYB 3QO1B 3AU1B 2HT4D 2GITA 5I71B 2W60B 4Y2DB 2DQIH 3B9EA 3BISA 3LKSB 1KTDA 4JFDD 4P5KB 3RKPA 3LEXA 3FFCE 3TYGL 2QQKL 2IAND 3F7YA 3SE9L 2OJZL 4M7ZC 5FYJE 3KPPB 3D5OF 1GYAA 4OUUA 5AZ2H 2PYFB 4NQEE 2WLYA 3EDKA 2R29L 3T04D 2BSSA 3ZO0A 1OB1B 1N2RA 3BGMB 2X41A 1G9NH 2P24B 4OI7A 4JY6B 4X6DA 5DR5H 4ZTOH 5CP7A 4UINH 3WFZA 1FLRL 1BQHB 4NJAL 4NUJA 2H8PB 4X4YB 2R1WB 5IEHA 1OAQH 4U1MB 1WFUA 1OF2B 3QG6A 4LGSB 4WHYH 4EI6B 2I9TA 2D2OA 3VG9B 1G9ML 1KNOB 4KGJA 1OPGH 3JSSA 4MD0B 2GT9A 4F3FA 4YXKH 4OJFL 2WLZA 2X9WA 4PJ5D 5IF0A 5BCAA 4NN5B 2EKJA 1S9YB 2PW2B 4PJDB 5CEYA 4G5ZL 4YAQB 1F4XH 4YFLF 4UUJA 3FO2A 3QNYA 1HHKB 1AGDB 1X5HA 2W38A 2Z31A 3PP3H 1YEKH 4QHKI 1INQB 5F70A 1BOGA 3OGCA 4GRWF 3GNMH 1YNLL 2HYMA 3PABB 5HTSA 2Q6WB 4JQXA 4NRYB 3P4MB 1MI5B 4GLRI 4Q2ZA 1B0RB 3WNNA 4GLRH 1U3JA 4JFZH 3SE3A 1TQBC 3HRZA 3T1FB 1II4E 4G3YH 4RRPG 1GXEA 1J1XL 3QNZB 1EA9C 3WFDH 4WJ5A 2CDGA 5E0QA 4NCC1 1ZWIB 3MFFA 4R4FL 1FRGH 1VKXB 1RULL 4JRYD 1C7TA 4AG4H 4MA3A 4KPHH 1JI2A 3QCUH 2BHZA 1CF8H 2OR7A 3UPCA 3LKQA 2DQTL 5DSCA 1HYSC 4M61A 4WGVB 2BVOB 2COQA 4P2RD 3CPLB 4G42A 5J6HA 3U7WL 2APXA 3FN3A 1HHIA 1CFVL 4PJ7B 3MCKA 4L1HA 4TTDD 5FUCC 4RX4A 4G8IB 4WIQA 4QRSA 4S1DD 1U8LA 3MZGB 2J12B 2HLAA 3GSRA 1NFDB 3L9RA 4R96B 2GCYB 2E7LC 3FT2B 1OGAE 4LLQA 1YMME 1KG0A 3WHE1 1U2CA 4MQ7A 2Z31D 3ME0A 4GQ9H 4KV5F 3BH8A 2AJYH 4LIQE 1S9WB 3FFDA 5CLTA 1L7TH 4ODTL 5BO1H 1EXUB 2DWDA 1BM3L 2MPAH 3O2DL 1S7VA 4XB7A 35C8L 5HGHA 3X3FL 1K3ZA 4Q9QH 4FQJL 3FB8A 4ZUVA 4DN4L 4IIQC 4QRTB 1MY5A 5AAMA 2W9EL 5GS1B 3GSQB 5D70H 4XAKD 3BDYL 5GS2D 4OD2A 4Z7WE 4Y4KB 3CXHJ 2BHYA 4WFEE 3B8YA 5DJ8B 1CFNB 4GXUM 2VZVA 2BY1A 2Y5TA 3DYPA 3I6GA 4XBPB 5TDOA 3RIAK 2Y5EA 2JK5B 2APBA 3WE6B 2Q76B 5KZCB 3A6BH 4I9WD 1LEIB 4NKMA 4TQEL 4MNQD 3QIBD 3MO1A 2C3VB 4YFEA 3HHRB 3V8CA 3PHQB 1ES0B 4RX4D 4F33A