2OXHA

The soxyz complex of paracoccus pantotrophus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
ADDAKPRVKVPSSAKAGETVTVKALISHKMESGQRKDADGKLIPRSIINRFTCELNGVNVVDVAIDPAVSTNPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
total genus 19
structure length 107
sequence length 107
chains with identical sequence C, E, Z
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08770 SoxZ Sulphur oxidation protein SoxZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oxhA00
1DDHB 4TULH 4OD2A 2X89A 4BKLB 4F9LC 4ZO7A 5E6ZA 2K1MA 3DGGA 4GO6B 1MFEH 4H0GA 1TQCB 4H1LA 4GOSA 1T1YB 1AHWB 1IFHL 3MRCB 4EI6B 3WIHH 4BZ2H 1CFBA 5CEZL 2VIRB 5CZKA 4WY7H 3NCYS 4Z18A 2A38A 3FFCD 3L9RB 1DDHA 2EXWD 3KPPB 1MIML 4HS6B 4MJ2A 4BKLA 4YX2H 3KR3L 1KB5H 1KTLB 25C8L 1U58A 4G80B 1AHWA 4H26B 1CTNA 4EI6A 1EO7A 1S5IL 2C3XA 3CK0L 4LCIH 3SN6N 2W9DH 4Q0XL 3IDNA 3BHBB 3TT3L 2WLZA 5KTEL 3O6FB 3H42L 5JOPD 2VIRA 5E4IA 4Q9RH 4MJ6B 1X5FA 3LRGA 3L9RA 1YJDC 2VZ3A 2Q3AA 1XT5A 2K3TA 4YLQT 4HS6A 4G80A 5EOCL 4HG4K 4U7KA 1KJMB 4H26A 2QHLA 4BYHA 3DPBA 3ET9F 1ZMYA 4XXCC 5A40E 3BHBA 1E4JA 3SE8L 5HI4D 2OZ4H 4L3AA 4H25B 1G6RH 3RWIB 4Y88A 1KJVB 4MJ6A 4MS8C 4M3JA 1DBAH 1IARB 3GK8L 1JYWA 5EC1A 1YC8A 4NQSB 4G6FB 4KRNA 6FABL 4DN3L 4UQ2A 5KVDH 3RBSA 3LIZL 3ZKMC 2P24B 3TBVB 3TH2T 1KJMA 5J0BA 4YDIH 1IZJA 1J8KA 3OR7B 4LGSB 4H25A 2B1AH 3RWIA 1KJVA 3SGKC 3OPZH 3BN3B 3CU1A 1CFTB 3GSVB 5EBGA 4WFFE 1YN6B 2EH7H 1NGYB 1EHNA 3LAFA 1ERNA 2ED7A 4M7LH 4OFYA 2P24A 1UZ6F 4X6BA 3TBVA 1BM3L 1R3HB 5E2UL 1AQDA 3OR7A 4HMDA 4O2CB 2VXTH 5IHUL 1MH5B 1NC2D 2AJXH 2AXJA 4YXLL 3QXAA 1CFTA 3GSVA 3D3VD 3CLFL 2G5RA 4MQTB 1YN6A 3T3PE 5JW3L 4BSJA 1NGYA 3EYUH 4I18B 1MJ7L 3M45A 3MLYL 1R3HA 1F02I 5DC4B 4XPGH 1MCDA 3A6CH 4O2CA 5T33H 1MH5A 3LKOA 5HYJB 5L6YH 5L2JA 2FJFB 5LKNA 3WFCH 4DGYL 4R26H 5IMMB 1I1RA 3KPSD 2F5AL 5ESQB 5DJYA 1UXSB 4I18A 3GEWB 4YDVB 3KG5A 1X5LA 5GGRB 2L7UA 4X8JB 3WFEH 5TGBB 5KANG 3S34H 2MPAL 5B8CB 5HYJA 2W9LA 3J7HA 4OD1L 4K3HA 3WIIL 5DD1L 4PRPE 2JCCB 4L8CB 4X6CF 5HYEA 2EE6A 1JJUA 4QT5B 3B8YA 3GI8H 4JRXE 5ESQA 5HPMB 4Z7OF 2D03L 2VOTA 1P9MA 4NN7C 1NCDL 3OX8B 4LBEB 4YDVA 3CFIC 4XNMA 1CI5A 2Q7YB 3H9ZA 5T3ZE 4HUWB 4DGIL 1KIQB 1MCJA 5TGBA 4JFOB 3O2DL 5B8CA 4UAOC 3O2DA 1DJSA 2E9WA 2NQCA 5FYLD 2B1HL 4L8CA 2BNQE 1S7RB 3O9WD 1LO0L 4IEFB 3NAAH 4ELMF 2IPUG 5HPMA 3MUGB 3RHWK 1KCSH 3OX8A 4LBEA 1A2YB 1HIMH 3QT2A 3MNZB 2VDPH 2Q7YA 3AY4C 1IGTB 3SDCC 1JV5B 3UTSA 1MCIA 4OCSL 4BJLA 4X9FA 4AENB 3Q1SH 4JFOA 3U9PH 1UEYA 3QIWB 5E4EC 4TSBH 1XEDA 3FAWA 2F53D 3VI3F 1C1EL 4J23A 5TFSL 5DHVA 3WV0A 1QTYT 1U6AL 4O51B 3ARGB 3MUGA 4U1MB 4QHKJ 4QRRE 1A2YA 4GUPB 3MNZA 2DL9A 1IGTA 1JV5A 3KS0J 2VLLB 5JQ6L 4AENA 5TH2B 4ZFZB 3QIWA 5J6HB 3QP3A 3VXSD 2YD9A 3HNTL 4PY7A 3B6SB 2PUQT 5J6GB 1I8LA 4O51A 3ARGA 3BD3A 4GUPA 1LDPH 1NPUA 3RZCB 5EORL 5FYLH 2VLLA 1YEFL 3QUZC 5TH2A 4ZFZA 3VD5A 3EO9H 1IJ9A 1RZ7H 2AK4D 5J6HA 3KLSA 5ACZB 4G6JL 1BVKB 1LO4L 4HXBH 1AKJD 3B6SA 3WXWL 2NY5H 1GIGL 3HB3C 4LIQE 5J6GA 2XWJB 5AYUL 3HE6D 3G9VA 3JWDH 3O6LH 1K8DB 3NIFE 4GRLD 4N8CL 2KPNA 4FN0A 3SOBL 4AQOA 3FRPG 3RZCA 3BPLB 1ROWA 2NY4D 3NACL 2DBLH 4WEMB 4OGZA 3FN0L 1Q72H 3N06B 1G7JB 5ACZA 1BVKA 1TITA 1BIHA 4QHUB 3C2SA 4AZ8A 1K4DB 4Z7UB 3QWOB 3G08A 2OI9C 2ZUQC 4NFBA 1K8DA 2GJJA 2ICCA 4K71C 4J3VA 3PL6B 5T1LD 1FCGA 3BD4A 3G5VB 4PR5A 5FGBC 1J05B 3O4LD 2HYMA 2KH2B 1G7JA 2RIKA 5L88H 5T3XE 2ZNXA 4QHUA 5E00B 1K4DA 4KKBD 4UOW0 5CGYD 3QWOA 4PIRF 5J11C 3CFBB 5C0BD 3RVUD 1I3GL 3F6IA 3PL6A 1LGVA 4O02H 3TP4A 1T0MB 2DYPB 3ROOA 4YDKH 3G5VA 1SBSH 3S5LB 1J05A 4ZTOL 2IMMA 3LZFH 2UUDH 1L7TL 4WO4D 1RIVL 1ZLSH 4MQXD 3QBTB 4MJ4A 1I7TB 2DJSA 5E00A 4OZHF 4NQED 1CGWA 3CFBA 2XTJE 5DK2B 3SDDB 4MDJB 1HK6A 1OCWL 1T0MA 1YMME 5JHLL 2DYPA 4IJ3C 3S5LA 3MLPA 3DRQB 2FIRT 2J8UA 4WI2A 4J3OC 4ODHL 1MOEA 4X9GA 4X9BA 4M6NL 5IVZB 4HT1L 5KS9F 3OKLB 2OJZL 1NCWH 3LH2H 5DK2A 3SDDA 4MDJA 2BSRB 1ACZA 5I1DB 4PRHD 4TPRH 5IW1B 1XIWB 1N4XH 3P9WB 3O3UN 3RVXC 2HRLA 4U0RC 3DRQA 2NY0D 4EBQL 1G7LB 1WIUA 5ID0A 5E08L 1NBZB 1J87A 2PCPB 5IVZA 1EEQA 2EICA 2IBZX 4XI5C 2FX9L 3OKLA 1QLEH 5EO1B 1C8PA 1LP9B 4APQD 4LSTH 3K3QA 2BNRD 2BSRA 2ATKA 3ARZA 1XIWA 1AQKH 2QQKH 3WNNA 1ACYH 1EK3A 1NCBH 4V1DE 1BWMA 1DN2A 2Z31B 4Y4KC 1J8HB 1INDL 1NBZA 2PCPA 4O4YH 1CD8A 1IKFL 1KC5H 2VDLL 1LP9A 4D3CH 5HD8C 5EDXA 4HWEH 2EEAA 4JZJB 3S5LG 1MCEA 4U1GB 1X5JA 2AI0H 3JV4B 2Z31A 4LLMB 5I0ZA 3LB6C 4EN3C 4HCRH 4N9OB 5DMIH 3IJHB 3NTCH 2DMBA 3DLQR 3VDAA 4YAQA 1A7OL 4UINL 4HFUL 1CTOA 1FGNL 4JZJA 1SJEB 4NRZB 3JV4A 4UTBH 3VWJD 3HZMA 4LLMA 3KYNB 4L8SA 3BQUD 1TJGH 5JW5B 3VD4A 3QWRA 2BP3A 2IADB 4YBQC 1F4WH 4JFFE 2R8SH 2FD6L 3IJHA 1RAMA 3HNVH 2VDRL 2IANB 1F3DH 5FYJE 1DP0A 1GGTA 3GMQB 3HNSL 1SJEA 1WFTA 1WZ1H 3VGBA 1YY9D 3GNMH 3MJ7B 1JI2A 4X8XA 3V5KB 4G8GA 3KYNA 3MBEB 5JW5A 2P42B 1SVZA 3O8XC 3CVHL 4F9PC 5KZCB 2IADA 2FO1A 2ZUUA 4ZNEE 5EU5B 4P5TD 1YDPB 4P48A 1HOCB 5DUML 2IANA 1CCZA 4NQCE 1K9TA 1UVQB 2AABL 3QEHA 3GMQA 1CXKA 5T5FL 2NY1D 3SCMD 3I6LE 2DQEL 5IFAH 1YYLL 1ZANH 3C2AL 4A2LA 1AH1A 3AS3A 3MJ7A 3A6OA 4KHXL 3OB8A 3WS6C 2ZSWB 2VLKB 3V5KA 3MBEA 4ZTPH 4HIJA 2W60B 5D1XD 1HEZB 2AK1L 1S78D 4OLWH 3ARFD 1J0JA 1BJ8A 1HKFA 1XR9B 1P1ZB 1FORH 1Z3GH 5FYJU 2FH8A 4XTRC 1S7XB 3UJTH 3QR2A 3RWGA 2OL3H 2PXYC 3GFUA 1Z0NA 1GC1C 1GGIL 2ENYA 2ZSWA 2VLKA 4E41E 4P46B 4U6YA 3VFRB 1UENA 2W60A 3OAYH 3NA4A 3X11B 1HEZA 2J2ZA 3DV6A 5B4MC 1XR9A 1P1ZA 3DXAE 1S7XA 4TTDD 1SY6H 3IRPX 4HIHB 5E5MB 1IL1B 1LDSA 5FYKL 1UM5L 1AGDB 1NKRA 4YXHL 4IRJD 1QHPA 1KELL 2D7TL 4LVOB 4P46A 4Y4HA 3LKQB 3UYPA 1I4FA 5CLTA 3QG6A 3WN5B 4LPYA 4XPTH 1IMHC 1ZK9A 5D71L 4DUXA 3FQUA 4OCLC 1ZA6B 1AJ7L 1OP3K 4HIHA 4RFOL 1IL1A 5E5MA 1MHHA 3BXNA 3KLHD 1AGDA 1A7PL 2EE2A 3KPLB 3GUTB 3LKQA 4UT7L 4OZIE 1OGTA 2ID5A 5H2BB 4YHKH 2X4TA 3BEVB 3BH9B 3VRIB 5BRZB 2NXYD 5GJSH 1MNUL 4HWBL 4NC2B 4HWBA 3VFPB 1ZA6A 3OQ3B 2WUBH 2NY2D 4R4NC 1DEEB 3BE1L 4OTXH 3T09A 3MREB 2RFXB 3IDXL 5IROA 3RJDA 3QQ9C 4MCZB 4OF7A 5E2VL 3S4SB 1OAQH 2WUCL 5I75C 2YD3A 2VQ1B 4ZSOB 2ZUSA 4PP2A 3VMPA 4PD4K 3G5YA 3TEUA 5H2BA 5AZ2H 1IAOB 3BEVA 3VRIA 3BT2H 4S1RH 2VISB 3VFPA 2DWEB 3OKDB 5EO9B 4AMKH 1DEEA 2WV3A 1OAUH 5E2TH 5IMOB 3MREA 2H32H 4GBXB 3S9DB 1R3IH 4MCZA 3HRZB 3S4SA 5TPWL 2VQ1A 4ZSOA 3VG0L 1XR8A 1IAOA 1X4ZA 1X6NA 3N85H 3KXFE 3I6GA 2DWEA 3OKDA 4HQQH 5EO9A 3HMWH 4QHLB 2P45B 2YK1H 4U05A 4TVPL 5IMOA 5IB4B 1CLCA 4RX4A 2XQBH 4GBXA 3Q3GB 4BQ6A 1ITCA 3LQAC 2HRPH 1JPSL 4JN1L 2A9ML 2R29H 4KJQD 4WU7B 4FQ2L 1A7NL 2GFBB 2BY0A 3MXVH 4JPWH 4L4VE 1VGEH 2Q7NA 3DSNA 4F7EB 3WFBL 5JW4Q 3MXWH 5TF0A 5INDB 4QHLA 4L9LB 4O2EB 1UCTA 4QWWC 3FRUA 3BGFC 4JO4L 5IB4A 1A6VL 3QUYD 4HFWA 3Q3GA 4KRPC 1WC7B 1SJVA 2NY3B 5F3BB 4GXUN 4MB4A 4WU7A 2GFBA 3MLTB 1VACB 3L95B 4HJJL 2R9HD 5GRZA 2P8PB 1YEJH 2AEWA 3ARPA 4L9LA 4O2EA 1FDLH 3QI9B 3S4SG 1OLLA 1R6VA 1MCNA 4KROD 1OAKL 2XQYG 3W9EA 5F3BA 2DLFH 5ADOH 5DA4A 3MLTA 1VACA 1QVOB 2DD8L 1NQBA 2UVFA 4JY5L 4NZUH 3WL9A 5FHBL 4YHOL 2P8PA 4M4RA 4OZGE 4PJAE 2H2PD 2CR6A 4WFFD 3QI9A 1MI5E 3IU4H 3T0AA 4OKDA 2XG5A 5D7SL 2Y4SA 4KK8C 4OIBA 4GMSH 5IB1B 3QH3B 4UV4L 4OI9A 1QVOA 3S36H 2OLDA 5CGMA 4P2OD 1SHMA 3ARUA 1IEAB 4U6XB 4UB0H 3MLXH 4JHWL 3NOIA 1FBIL 1MRDL 1U3HB 3MCKB 3DO7B 4S2SB 5LCVH 4WHDA 3UC0H 5IB5B 1OM3H 1RZJH 5IESL 3SDXB 3QH3A 3VRLF 3A6BH 5IQ9B 1A6UL 1GSMA 5CP3H 1P4LA 1P4IH 3BP4B 4U1KB 2YSSB 4A6YH 2Z8WC 4LDLB 1IEAA 4U6XA 4YHLH 1MCOH 3CNKA 4DTGL 3DO7A 3IETB 5FUCE 3MRPB 2YRPA 4S2SA 2FLBT 2Y9RT 2Q87A 5DT1L 4X5WA 4AG4H 4AQ1B 3SDXA 5IQ9A 4Y4FB 3U9UA 1P7QB 4P57B 4HS8H 3JUZA 3SDAC 4PGBB 3BP4A 4U1KA 4D9RE 2J8UF 2YSSA 4JHAL 1WAAA 1Y18B 2I07B 1KNOB 4PRPD 1NCCH 3IETA 3MRPA 1J9CT 2B7DT 4JRXD 5MENB 1JFQL 4EIGB 5HYSG 3F65A 5DR5L 1LVEA 1Z9MA 1X4YA 5T3ZD 4PGBA 3WKMH 1R3KB 4YQXH 1FLRH 5DJDB 4K9EH 4FTVB 3BOVA 3IGAB 3STZB 4D9LL 1KNOA 1A02N 5CSGA 2VKXA 2BNQD 2MCPL 3ARBB 3ULUE 4PJIB 3M8OH 2ZG1A 1RZKH 3VXUE 5MENA 1EIBA 3BVNA 2LQRA 3ZE1E 1OGAB 5FUOL 3EAKA 2RR3A 3QDJB 1R3KA 5FB8A 1FL3B 1KYOJ 4LVNB 4FTVA 4TOYH 1RU9L 3E6FB 2CDFB 3ARBA 4PJIA 3M1BB 5HGBB 5FK9A 3ZDYF 1GXEA 3LD8B 4KQ4L 5SV3A 3P0GB 2XZCL 2QR0B 2X7LA 4QRRD 4EI5C 4ZMAT 3QXWA 4N0YH 1OGAA 1FH5H 3QDJA 1FL3A 5EU6B 2KZ1B 2R1XB 3E6FA 2AJSH 2CDFA 4FZ8H 4XMKH 2YKLH 3WUWB 4DUWA 3N1FC 3FQNB 4AIZB 3RTQB 2ZSVB 5I8OL 5HGBA 4KHTH 4CN4A 1J18A 3MJ9L 4GAGL 1RZFL 2QR0A 3MJ9A 1JTPA 5T3ZH 1DBBL 4XPAL 1HDMA 2DRUA 3BGAA 1VFAA 4WGVB 5D72L 5C0EB 4GLRH 2VQTA 1ZKAA 5EU6A 2V5YA 1YQ2A 2R1XA 2QTEA 5DJXB 5BV7B 2EDXA 4ORGB 1BFOB 3FQNA 3RTQA 2ZSVA 5E7FA 3LQMA 4OLZL 2V2XA 3ZDXE 3MRIB 4PLJC 3KPOB 3U7AA 5KVEL 4JQIH 2YWZA 4QXGH 5C0EA 2F8VA 5GGUA 1KN2L 1G9NC 3FN9A 5BV7L 4ERSL 5DJXA 1NL0H 4ORGA 1ZT7B 1BFOA 4QOKD 3OAUH 4GW5B 5DQJB 1NSNL 1KSRA 4ZQKB 4WWKC 3S96B 1EJOL 3HR5B 3MRIA 5BMFL 1PX4A 2CXGA 3GSWA 3KPOA 3EFFB 4U1SB 4RMTA 1OTSC 4G6AC 3PXJA 2AW2A 1ZT7A 5T3XD 4XP9H 4GW5A 5DQJA 4KK9D 3LKPB 3MUJA 3S96A 3HR5A 4Z7VE 3EFFA 1I8KB 4U1SA 1CGVA 4MNHB 3UROR 1R3JA 4ORZC 4OI8A 3QIUC 1CXIA 3H0TB 3LRSA 4Z5RB 3WUWG 1D9KC 4PB9H 4LIQH 2XXCB 3FFDB 5IV2A 3C5SB 5BS0E 4HAFA 4ONGH 4H88L 1DCLA 3S37L 3LKPA 4R0LB 3HI1A 2XTJD 4NKDA 1I8KA 2V17L 5KVGH 4J3UA 4TNWK 1WBYB 1YMMD 3H0TA 5F1KC 1S5HB 1KIPB 3K4AA 4Z5RA 3BP6B 3FFDA 3BRGC 3LMJH 3C5SA 1ZVSB 1JI1A 2EIZB 2IALB 5I15L 3F12B 3QIBD 2EO9A 4R0LA 2CIKB 1NDGB 3IKCB 2QSVA 5I1JH 5CJXC 5IP4A 1A14H 1S5HA 2DKSA 1KIPA 3SKNB 5ERWB 1QZ1A 5T3XH 1RPQA 1WLHA 3W0WE 1I7UB 3NABL 4IM8A 1KXVC 4Z7NF 1ZVSA 2WW8A 2EIZA 2IALA 1DR9A 2EXWC 4GQ9L 1EFQA 3TCLB 3H3KA 4RDQF 3MOBL 1KEGL 5I17B 2XXMB 2CIKA 1NDGA 3IKCA 5BQ7B 4BA8A 1BOGB 1VEPA 1MFCL 3VCLB 3ARTA 3SKNA 5ERWA 4V1DD 1KEML 3ZZ1A 4C54A 4KDTA 1I7UA 5HHOB 3MA9H 3ULUF 4OZ4B 3RKDD 3WXVH 3ZL4H 1GGYA 3MC0A 5SX4I 7FABL 3HC4H 1BQHB 1P7KB 4U49A 3C87A 5I17A 5LXGH 5BQ7A 1BOGA 4W4OA 3SKJL 5EZOH 2ICES 1CK0L 5C0AB 5B38B 5HYIA 3VCLA 2J8OA 5HI4C 5T1DL 2NYYD 4YFDB 4HH9B 1PG7X 5HHOA 1JNLL 3MYZA 43CAB 1BFVL 1OW0C 1VPOH 1W72B 5DD0L 5DF0A 1BQHA 1NAMB 3QEUA 1P7KA 1MAMH 2VSCA 1JZ8A 3V5HB 2W0KA 4JR9H 1J1OL 2VWEE 2YPKB 1Y0LB 5C0AA 2FBJL 5B38A 4NZTL 5JR1L 5EC2B 1DLFL 1TZIB 4U7SA 3FHAA 4WTWA 5TQ2L 4FFYH 4ZFGL 4PJ9D 4HH9A 2XZAL 1CIDA 2PTUA 2GK0B 3CFJB 4N1EA 1W72L 1CFVL 2WIIB 3NFNB 1PKOA 43CAA 35C8H 1W72A 4JFDE 4JFFD 1NAML 1NAMA 1QHOA 4JJHA 1FPTH 5FYJD 1DUYA 3WS3B 2YPKA 1Y0LA 3QFJE 1IVLA 4K7PY 1I3UA 3MBXH 4FQ1L 2GT9B 5EC2A 1TZIA 3X13B 2G2RB 1DBJL 4L4TE 1E6OL 2GK0A 1X5HA 3RWEB 3TNNB 2WIIA 3NFNA 4OJFH 1G9MC 1KENL 5DD3H 1LK2A 4WEUD 4NQCD 1FJ1B 3WS3A 1MELA 4QTIH 1RV6X 3HLAB 2VLJE 3PUCA 3I6LD 1OAXH 2GT9A 3U4AA 3X13A 1LD9B 2P44B 4J8RB 4K3EL 2ADFL 3RHWF 1I7RB 2G2RA 2R4RH 4B50A 4F58H 4X80L 3ULSB 1QYGH 3RWEA 4OF3A 3TNNA 2VH5L 3VXNB 3BP7B 4XCCL 1AXTL 4YBHA 1FJ1A 4L1DA 2YPLB 5B38G 4ZODA 1V5JA 4LRIC 3HLAA 1JHTB 3LV3A 4XMPH 4HBCL 1LD9A 4J8RA 5C0CB 1I7RA 3FQRB 2D7MA 4E41D 5HDOA 4NO2A 5J12B 3ULSA 3MV01 5I1EL 5FYJH 4DKFH 3VXNA 3BP7A 3LN5B 3DXAD 2YPLA 1MWAH 1JHTA 1WEJH 2H2SD 3BD5A 4Z9KB 5C9JB 1DVFC 3FQRA 2EDLA 5DD6B 3MNWB 5D2LE 2YBRB 4BUHA 3IFNH 1K6QL 3BSZH 2P46B 3O9WC 4F9LA 3LN5A 3NIGF 3GO1L 1MRFL 3N1PC 2BRQA 4HGKC 2NY5C 4HHAB 4GKNB 3JWDC 3FN3A 3CVIH 4LK4A 5C9JA 3MRQA 4LLVB 5DD6A 3MNWA 4FXGB 2YBRA 4KI5E 4Y7MA 5SWSB 4UT6L 1CFNB 4NO5B 5JNYA 3SDXF 4WU5B 1FQ9C 4RZCB 3U79A 2X4UB 2APWA 4GRWF 1T04B 1PQZB 2ZCLL 4HHAA 1WAAF 5JIPA 4GKNA 4QY8B 4TSCL 3CFDB 4MNGB 4LLVA 1YJDL 5SWSA 3GZKA 4NO5A 1XCTA 3GBLA 4Y1AB 4WU5A 4RZCA 5C71A 3OXRB 4OCNC 3E3QE 2H3NB 5EN2B 1T04A 4BELD 4DZ8B 4BSWB 5GS3A 4QY8A 3CFDA 4PJ7B 4XXCA 1ZV5A 1U42A 4J6RH 2VN7A 3TIDB 4U7MA 1JWSB 2KDGA 4DAGH 4D0BB 4MX7B 1XGYH 3B5HA 4Y1AA 2CK0H 2MQCA 3OXRA 3C9NB 4JDTH 2CMRH 3HE6C 4MNQA 1QBLH 2H3NA 2UY6A 5EN2A 3V8CA 4Q6YA 4ACPA 5AD0B 1UM6H 4GRLC 3KXFD 1ZHNB 4BSWA 3KDMB 3QUXD 5I1GL 2DQGL 4PJ7A 2NY4C 3TIDA 1JWSA 3SGKA 4M62H 2YOCA 4MX7A 4HAGA 1WQVT 2X4OA 5K9QI 2ZG3A 3C9NA 3PF2A 4Y19B 4WUKL 1V05A 4L4VD 3CMOL 5TE6H 5MI0C 1MFAL 5AD0A 1MAKA 2FDBP 1ZHNA 4CVXB 3KDMA 2EXYD 5F7DB 3D18B 4G3YL 4PJBE 5I9QB 5K93A 4CW1B 1DQDL 2AS5M 4CBPA 1U8IB 4K2UL 4N9GA 4PJCB 1HINL 1KB9J 1Q0XH 4F8QA 2PKDA 3T65B 3LEXB 5L9DH 5CGYC 2OJEB 4ZUWB 2RBLA 5I0DA 1P69B 4ZUVB 4MAYD 4CNIB 1S7SB 5F7DA 3C09C 4NNPL 2ICWJ 3D18A 1XMWA 2CRMA 2C1PA 5GZOD 2QQNH 4CW1A 3V52L 2XQYK 3UDWA 4WO4C 1U8IA 3G04B 1E6JL 3MYJB 4MQXC 1RIHH 4PJCA 3T65A 3HC0B 2OJEA 2PTVA 5FIEA 3V7MA 2O93L 2VC2H 2MTPA 4NN7B 4ZUVA 4CNIA 1S7SA 2ED8A 3TYGL 1MI5D 4HMCA 4N5ED 1A64A 1PG7H 3G04A 3EOTL 3MYJA 2I9TB 5DJ0B 3MLUL 3RJQB 3HC0A 2E6JA 5D7IE 4X9IA 4NKIH 4FA8A 2ZKHL 4NWTH 1T89A 3S3JA 3ZHKA 1KLFA 1JPST 1AY1H 2CJUH 4NZJA 2NY0C 4KMLB 2MWCA 3BUTA 5E4EB 4M43H 2CSPA 4NRYA 3DURB 3RVVD 5GS1B 3HR6A 1CXLA 2I9TA 5DJ0A 5AG8A 3H3BC 5HHMB 3RIFF 1GRWA 1KPVB 3ETBF 3SDYH 4X7CC 5IBTL 1BWWA 4L3EE 3BW9A 4APQC 3P9MB 4K94H 1NDMA 1B0WA 5I1LB 3AY4A 4ZO6A 1HSBB 5IB3B 1VA9A 5D2LF 3D39E 4OM0H 1YYMH 2X44D 4ISVB 3ZTJG 3THML 3DURA 1NANH 1CDHA 4TVSa 1YY8B 5EOQH 3KHOA 4NO3A 5DLML 4KTDL 1KPVA 4X7FC 2VXVL 4D9RD 4M7ZB 3UZEA 1J0KA 1FSKC 3SGDI 5I1LA 1HSBA 3UP1A 1ZAGA 2ICWB 3RDTD 5IB3A 3DSFL 3QUZB 3A0OA 4ISVA 3TLRA 3AS0A 3TF7C 1IC1A 3TFKC 1MHPH 1QKZH 1YY8A 3GSNB 1ODAA 4IMLB 2R15A 3VXMB 5HGAA 4C83B 2OTWB 5C1MB 4OCXL 1ORQB 1KCUL 2GJ6A 2ICWA 3QUZA 3HFMH 1U8OB 1CE6B 1TETL 3VWJC 4DW2L 4PJGB 3CGTA 3BQUC 4M1CD 1ULVA 1N3NB 3VXUD 1QSEB 3CXHJ 3GSNL 5I2IA 5GGQL 3GSNA 3VXMA 4LVHC 3U4BH 5F6HI 3OKMB 4JG1L 4K3DH 5BZDB 3TO4D 4C83A 1EEUA 1UM4H 2Q8BL 1ORQA 4XPBH 3N1MC 4XHJD 5F3HB 3IU3B 4OQTH 2YXFA 3HMXH 1YY9C 3B3IB 3BEWB 4PB0L 5FFLA 5MERB 2HG5A 2L7JA 4PJGA 4Y16C 3QO0B 4S1SH 5DMKB 1N3NA 1QSEA 3MLSH 1I9IH 2FATL 1S8DB 4P5TC 1J0YA 3OKMA 3DVIA 5BZDA 5J11B 4UDUB 3MPCA 4HS3B 2NY1C 3SCMC 5F3HA 4L5FL 3IU3A 5E2JA 3B3IA 4U3HA 3BEWA 5FGBA 2KL6A 2DAVA 3GRWH 2AQ2A 3CXDL 3BH8B 3QO0A 5DMKA 5J89A 1FZMB 1TPXC 1IAIM 1QO3B 3F5WB 3GBNH 5D1XC 1PBYA 1S8DA 1S78C 3D2UB 3ARFC 3S8WA 1IEBB 4EUPB 4M5YH 4UDUA 4HS3A 3EW3B 1ZLWK 4LU5L 2BX5A 1M1SA 5DJZA 4NDMB 1V7NL 4OLVH 4IJ3B 1SYSB 2BOBB 4YK4C 3BH8A 3S98A 1FZMA 1TTGA 3F5WA 4GMTH 2NY7H 3ARXA 1IM9D 4G6KL 3D2UA 1IEBA 3D69B 4EUPA 2EE9A 2I9LB 3ZE2E 3GMMB 2VXQH 3EYOB 4G9FE 2DQHL 4NBYB 4NDMA 1IAIL 3KPNB 1SYSA 4H0IA 4IRJC 4D8PB 4WFEE 5HHQB 1F3JB 3MRDB 4M48H 3U30C 3W5MA 3IYLW 2J4WL 1Z9LA 1I1AB 2I9LA 4CJ0A 3GMMA 3OGCB 3S35L 2K9UA 3EYOA 2FRGP 2JIXB 3R06A 5HYQB 1IC7H 2H8PA 5HYJE 1A7RH 3KPNA 1EZVY 3EDJA 4D8PA 1KLGA 1JVKA 2D9QB 4Y4KB 5HHQA 1F3JA 3V6OC 2HKHL 3MRDA 5D7IF 3P0VL 2DQTL 5IKCB 4C56B 5IB2B 1KG0B 2JIXA 3UYRL 5HYQA 1NUFA 2NY2C 2G60H 4XP1H 5BS0D 1NCAL 5EH1A 2ADIB 3BAEL 5BZWB 4S0TD 2JCCE 4Y4KA 1LK3L 2OX5A 1BOYA 4CUCA 3VH8B 4BZ1L 2C9AA 3OKEA 5DK3A 4FP8H 3RGVD 3K46A 3QPXL 4EN3B 3VXQB 3LS5H 4EUPG 4JREC 3P3YA 4NN6C 5E99H 2X4NB 2W91A 4NYLA 4C56A 4WUUB 5IKCA 1F4AA 3ZKQD 4MAUL 3ECBB 5K9JH 2K7PA 4KPHH 5GS0L 1KG0A 4WVRA 5IB2A 1F42A 4Q6IC 4JB9L 3DOSA 2ICWI 2IQAB 1JZ4A 2ADIA 5BZWA 5JXEC 5KBNC 2YN5A 3FMGL 3GM8A 3SGJA 5I74C 4P2RB 2GUOB 3VH8A 2X10A 2Z4QB 1CF8L 4EN3A 3VXQA 4XPFL 2ED9A 1RVFH 3ECBA 3Q6GH 4LNVA 3W0WD 3OJVC 5KSBF 4KVCH 3ZE0F 1OSPH 1BD2B 2GSIB 2IQAA 4Q97A 1HI6B 4P2RA 1PW3A 2GUOA 3O8XB 2Z4QA 1RMFL 4KJQC 5B39A 1MJJA 1KYOK 5C0ND 1XCQB 5F7EL 5FM5O 1A3RH 3QG7H 1RURL 3ARWA 2G9HB 4IHOB 3T1WA 4ELKA 3QRGH 1QNZH 3MRKB 3QUYC 3O8XA 4WEBH 3V0WL 4F9PA 1KCLA 1FLTX 4U3XA 1FIGL 2VDKL 2O5ZL 2IMNA 4DVRH 2R9HC 1RZJC 3F7YB 1EO8L 3RQ3A 1IBGL 2IAMD 2PXYB 1YEIH 3MMEB 2G9HA 4IHOA 5IR1A 4WI5A 3V0VB 1T2QH 2EDYA 3QO1A 3WS6A 3DX9B 1W8NA 3MRKA 3VH8G 5DMGD 1JPTH 2J8HA 5KN5B 1CDUA 4KROC 1INEH 1X5YA 4YFEA 1AP2B 3BIBX 3F7YA 4OGYL 4ETQB 4XMLL 1JZ2A 2PXYA 1FNSH 5B22A 3RWJA 3MMEA 1GC1L 1RJCA 4DFHA 4OCRH 2H2PC 2DIBA 3V0VA 5DJAB 1IAII 3DX9A 2P8LA 1N6UA 2QEJA 2GY7B 3ARVA 3PE9A 5KN5A 5FO9B 4DK6A 2NZ9D 4XX1G 5ITBH 3HCVB 3VFTB 2ZUWA 1U2HA 3MRNB 3QFJD 4JGMA 4Z7UE 1WICA 2R39A 4KUCF 3BZEB 4HD9A 1UWEH 4JM4H 1AP2A 5EZJB 4C55A 4GG6F 5HDBF 4ETQA 4FQJH 4P2OC 3T0EE 5CGTA 4L4TD 4JO3H 5CSZA 4MMZC 5DJAA 3L3GB 5CILL 4K9EC 2ZUTA 1MLCB 3I3DA 1ITBB 1CGXA 3CFKB 3HCVA 4M4PA 3MRNA 2VLJD 3EYSL 1MREH 1Q8MA 3VXTB 1RZKC 4GKSB 4LMQE 4HWZA 4WHYG 3QCVH 5C09E 2JELL 2PW1B 1KN4L 3H7LA 4FZEL 1YNLH 4LLAA 3TGXA 4PJCF 4KV5E 4BQBA 3L3GA 2L0DA 1MFNA 1EHLL 1ZHKB 1MLCA 3RIAK 3CFKA 5I75B 4NO0D 4WI9A 1RUPH 2LVEA 4F7PB 2HT3D 3PP4H 3R1GL 3VXTA 3KLDA 4QRSB 2VRAA 4GKSA 3SEPA 1ZTXL 3QUKB 4N5UA 2N7AA 4DOHB 1NLDL 1TJHL 5M94B 1TZGH 3EGSB 2MCG1 3AAZB 3B5TA 5J7CC 3ILPB 2P5EE 2IFFL 1O7VA 2H9GB 1DBKH 1GOFA 2QSCL 3AREB 3HG1E 1NMAL 4QLRA 5T5NG 2Z93A 1OD7A 4F7PA 3QPQD 4PJDF 3QUKA 1LEKB 4MCYB 1NGPH 5E6IB 3MRBB 3EGSA 1DQML 3AAZA 2VLRB 4Q9BA 1A21A 3IDMB 4Z7QE 4DJMA 2H9GA 3HPJB 2FR4B 5DJ6B 3EOBB 1W0VB 2XT1B 3AREA 4DGVL 5I8KL 3FOLB 1ZHBB 1BQSA 1F90L 1LEKA 4ZAKD 4MCYA 1GPOL 1LP9E 3PIQB 5T1KA 2A9NH 5E6IA 2SEBB 3MRBA 4D2NA 2VLRA 4XC3H 4FQQB 3IDMA 4KI5D 1FC2D 5LBSH 4DCQB 5JUEH 2FR4A 3HPJA 5DJ6A 3BGFB 2EDTA 1EEYB 1T20B 3BZ4B 1JUFB 1J8HE 3EOBA 1TFHA 3UTOA 1BBJB 1W0VA 3P9LA 4ONOA 3L3JA 3LQAL 4KRPB 2PR4L 1XH3B 5DZLA 3IFLH 3BKYL 1LEIA 3BMVA 4J7RA 2SEBA 2ESVE 3RNQA 2IG2H 4OBSA 3CZFB 4YH6A 5E1HB 4DCQA 3NZ8B 4BK4A 2BK8A 4P3CL 4R8WH 4MSWB 3FAXA 1EEYA 1T20A 3BZ4A 3GI9L 4M7JH 4RGNB 3X3FH 4PLKD 1BBJA 2OK0L 4K23L 1P4BL 4JPIB 4RRPG 1XH3A 1QBMH 4I2XB 5DZNA 3QHTC 4GAFB 1OAZL 5LGHH 3Q5OA 2P43B 3CZFA 4P3WA 3NZ8A 2J6EL 2OXGA 4MSWA 4X6EB 3C6LD 2J6EA 1YEKH 2VAAB 2R0WH 3HE7D 4OD3H 3WEXB 4P2QB 4LSDA 5FGCB 2BRRL 4I2XA 2IANE 1HWGB 1CQKA 3PGDB 4D9QE 3I2CL 3WFDH 2CGRL 4PJGF 2JK5A 5F89B 1TQBC 4TNWF 1FFRA 4XP5L 3MV8B 4HEPG 4XAWL 4X6EA 1C5DA 4PGEB 4QNPE 1CIUA 2VAAA 5C3TA 3WEXA 5EWIH 4P2QA 3RWDB 4LLDB 1GL4B 4YC2C 4PPTA 3TZVC 5D5MB 3ILQD 5DUPL 2AJUL 1JN6B 2ENSA 2LU4A 3EZ8A 5F89A 5HVGB 2DI7A 3B9KD 3T4YB 4UTAL 3MV8A 2QADD 2VLKE 4JRYB 4PGEA 5DDHA 4R96A 5EIQA 5TDNB 1UG9A 4KK9C 3WD5H 3G9AB 3V7AG 5GIRB 3TVMB 3RWDA 4LLDA 1MY7A 2IC2A 4NZRL 1C08B 1KFAH 4EZMA 5J57B 5D5MA 1JN6A 4HPOL 4WI8A 3P11H 2YMXH 4XC1L 1BZ9B 4HKZB 1OTTC 3WFZA 3T4YA 5ILTH 3G6AB 5FYKE 4WI4A 4JRYA 15C8H 2XV6B 4RGMB 3TV3H 5TDNA 3A67L 3UO1L 4GAYB 5F1OB 4WTXA 5GIRA 2W92A 2Y07H 3CDFA 3TVMA 1AGEB 1J88A 4XWGH 3BZFB 4P0DA 1MFDH 4LL9A 3SDAA 1OSZB 1OLZA 4RNRB 5BCAA 4HKZA 3U7WL 4F33B 4P9MH 4KK6D 2O5XL 3QJFA 3G6AA 4LSVH 3AROA 1WCQA 1ZXQA 3QIBC 3DJ9A 4GAYA 3SKOB 4I0PD 1AGEA 3OZ9H 1R5WB 1HKLL 2MKLC 3EDFA 5F9JB 1OSZA 5TF1L 4RNRA 3FB5B 4F33A 2VSDA 4HIXL 3CSYB 3Q48A 2BOCB 4DQOH 2A0LD 2LU3A 2WBKA 2W0PA 3SKOA 1BPVA 2ZUVA 1R5WA 4L3ED 5KAQF 2R4SH 1CLZH 2WQRA 1S9YA 5BRZE 5F9JA 1Z0MA 1PSKL 1CYGA 1B2WL 3BPOC 5IFHH 2APVA 3D39D 1JGDA 3OKKB 5SWZA 3FB5A 3RVTD 4HXAH 5CSBA 3CSYA 4XNXL 2JTDA 5CD5D 1U8MB 5F93C 5TDPB 3T8XB 2BOCA 5E70A 4IDJL 1Q9WA 3QSKB 1FZJB 4EI5A 3OF6D 3RA7H 4JFHE 5C08E 1H3PL 4GXVL 2OYPA 1UKQA 4Q9QH 3OKKA 1NCUA 2NYYC 1KTRL 5C7XH 1UXWA 5FXCH 4UNUA 4JGUA 2NX5B 3D6GA 3VA2C 1DSFL 1SEBB 1U8MA 4C58B 5CCKL 5TDPA 3T8XA 5GSRB 1O7SA 1RHFA 4YEEA 3EJJX 3BDYL 4XVUD 3LHPH 1I85C 3CSGA 4U2ZA 4K3JH 3KPRB 3HZKB 2Y6SD 3L5XH 1FYTE 1JYVA 4PJ9C 3VGGA 5DO2D 3UZVB 4GH7B 1CD0A 4W68A 1A6PA 5DSCB 1OWWA 3I75B 5GSRA 3MV9E 3KYKH 4WWKB 4ZNCD 2HWZL 4PGCB 4MZ2A 3V6BR 2PNDA 1WF5A 2BJMH 3KYOB 1WFOA 3KPRA 3O6FD 4QRPA 1G9NL 4M9PA 2DF3A 5ECJE 2XA8H 4PBXA 2P8MB 3LPGA 4RA0C 2XZQL 1QQDB 4POUB 1AC0A 1EEZB 3D9AL 5DSCA 3MCG1 3I75A 2CRYA 4WWKA 2OTUB 4PGCA 3DETD 3FZUD 5HHVL 1MFEL 1KB5B 5EB9A 2BERA 1MIMH 4LGRB 3WIHL 1D9KB 4JAMA 3WIHA 3NFSL 4KJWD 2JE8A 1ZWIA 1RZ8B 4NJAH 2P8MA 25C8H 1T3FA 2DDQL 1EEZA 3V6FA 2FJGB 4WY7L 1S9WB 4Q0XH 3H42H 4YX2L 1KB5L 2LE9A 1KB5A 1OPGH 2B0SH 4LCIL 1D9KA 2W9DL 4KVNH 1RZ8A 3BFOA 3OAYK 5C07B 1F00I 3FB6B 3P0YL 2E7CA 1G6RB 1PAMA 2FJGA 4J4PD 4NHCL 1S9WA 3HUJB 5CWSB 3MRRB 3SE8H 3WIFA 4G9FD 4PGJA 2H2SC 4Y2OA 5ISZA 3T0DA 4PJEE 2OMNA 2X1XR 1OHQA 4LGPB 4WFED 4DN3H 5IVXB 5C07A 2OZ4L 3FB6A 1G6RL 1JMZA 3PJSB 2OZ4A 4EJ1C 1G6RA 3CCHB 4RQQB 3SKUD 1IM3B 1PG7W 2CUIA 2V9RA 3HUJA 4JM2F 1DBAL 5FKPB 2H6PB 2NMSA 3MRRA 4DEPC 3O2WL 2EYTB 2JLLA 2EEBA 1HNGA 5CJXA 3T3MF 5KVDL 4LCCC 4Z0BL 5HYJD 2ADJB 4QYOB 4WHTB 4CGTA 1UKTA 2AXHA 5IVXA 3NH7L 3ALWA 3PJSA 4U4BA 4RQQA 3OPZL 1IM3A 1NBQA 4ZXBD 4S1DD 2O26U 4MA7L 2H6PA 3J8F7 2EYTA 4PJHB 2V9TA 3ZT6A 4BQ8A 4M7LL 4YXLH 3T1FA 3FB7B 3QEGL 3CLFH 3ZKND 2ADJA 4QYOA 4WHTA 4Y2DD 1DQLL 4C59B 2VXTL 2EEDA 4Z7WB 2HN7A 1G1YA 1DL7H 2AJXL 5IQ7H 4UILH 1U0QA 1EX0A 1TZHB 5DEZA 2UWEB 2AGJH 4PJHA 1XGTB 3EYUL 1M7XA 5F7YC 3T0WA 3D0VB 5E95B 4FTVE 4NQVB 1AIFB 4MVBD 2IH3B 4F57L 4XPGL 2X42A 3UJJH 3A6CL 3CSBA 2LAGB 5L6YL 1OW0A 3PWUA 2BFVL 4GXUM 2RHEA 1TZHA 3CDGB 5D2NC 2GAZB 3WFCL 3VGDA 2UWEA 4Q58C 1XGTA 2MPAH 4OD1H 2CIIB 3WIIH 5DD1H 2OR7A 5BOPA 3QDJE 2DLHA 1UWXH 3D0VA 2HFGH 3LKRA 5EUOB 3QIWD 1VFMA 2GJZB 2WP3T 4MD4B 3LVEA 4NQVA 1FNGB 1AIFA 4AEIH 2Z8RA 2IH3A 4M1GH 3CFEA 5I30H 3WFEL 4KTEH 3MLZL 2X4PB 1HHKB 2YHGA 4ZUTA 4WNQB 3CDGA 4FFZH 4ODUB 2GAZA 1GZQA 5GHWL 4DGIH 2BVOB 1WK0A 1G7PB 3O2DH 1V8HA 2CIIA 2EXYC 2FX8L 2B1HH 5EUOA 4NQDE 1E28B 2GJZA 4MD4A 1LO0H 1FNGA 1NC2A 3MCLH 1DANT 4X6FA 1EBAA 1G9ML 3VMOA 1CDJA 2X4PA 3D3VA 1HHKA 3RPKA 2FLRT 3CFCH 4WNQA 3KPSB 4ODUA 1IGCH 4OCSH 2BVOA 1G7PA 4XVJH 3RZCD 4MAYC 5JORB 5JOEA 1C1EH 5TFSH 1E28A 4K94C 5GZOC 3QA3B 4AT6B 1I9JH 2PO6D 3UJIH 3Q1SL 3HC3H 1U92B 1C16B 5E03A 4TSBL 3KPSA 3LN9A 2FB4L 4I4WB 4LLQB 5JQ6H 4LRIA 3IDGA 3FO2B 1X44A 1NFDB 2VL5B 5JORA 4HUUB 1FZOA 1JTTA 2A1WH 1UADC 2EIEA 1DVFB 3MJ8B 4AT6A 4LLYB 4N5EC 1LO3L 2JJTA 1PEWA 1U92A 1C16A 3RI5K 4TQEL 4HGWB 3NCJH 1E4WL 1YEFH 4I4WA 4LLQA 2X4QB 5BJTB 3LN4B 1RUAL 3EJYD 3FO2A 1NFDA 4HUUA 2NZIA 1DVFA 1J0ZA 2AXFB 1GIGH 3MJ8A 4JKPL 4LLYA 5D6DA 5FYLL 5AYUH 1GJIA 4PGDA 3VMNA 1RZ7L 3O9WA 3ARYA 3VI4E 4LRNL 4N8CH 5D93C 4HGWA 3K2UL 5D5MF 4HXBL 3NACH 2X4QA 2NY5L 5BJTA 2WWMD 3LN4A 1NFKA 3JWDL 1DE4A 2DYPD 3O6LL 4KFZC 5D70L 4PJEF 3V2AR 4OZFB 3ULVL 5FUCC 4NN5C 1TVBB 4LKXB 2DBLL 3P40A 4M6MH 4KMTH 2JB5L 4ZPVB 3LRHA 3SDDD 1BECA 1X4XA 1SJHB 2P5ED 3B9DA 4AY0A 4OZFA 3RDTC 1QLFB 4HZAA 1YN7B 4I77H 1OARL 2AK4B 1TVBA 4LKXA 1U8HA 4LAQL 1JIBA 1I3GH 5L2KB 1AKJB 2Y36H 3MLVH 3C60B 4ZPVA 1TVHB 3HE6B 2XACC 1QLRB 2OBGA 2V7NB 4YZFE 5A2IH 4MGXA 4GRLB 1SJHA 1XIWD 5L8JB 1QLFA 1RIVH 1MJ8H 1CFSB 1YN7A 1RUQH 4FS0A 4O02L 3ULUC 2AK4A 1ZLVH 4OF6A 4YDKL 4CMHB 4M1CC 3OL2A 4KGLA 2DMKA 3FO1B 5L2KA 1AKJA 3LZFL 4HJGB 3KS0H 4WTZA 1TVHA 3HE6A 1ZLSL 5JHLH 5MI0B 1QLRA 2V7NA 3TO4C 5CBEB 1UYWH 4GRLA 3NA9L 1UJ3C 3QNZB 1BP3B 4XHJC 4IRSB 2XI9A 1UB5B 1CFSA 1PKQB 2D0GA 2F54B 1J8HD 4QKXB 4MLIA 2DMCA 3FO1A 4JG0L 1OQOA 4LF3B 1D5MB 3O11B 4HUKB 4EVNB 2VE6B 3PWJB 4PRBA 3QNZA 1PZ5B 3VFMB 4OZFG 4EBQH 1H3TA 4IRSA 3N50A 5T1LA 1UB5A 3SE9L 4B7LA 1PKQA 2F54A 4TPRL 5F21B 2JJSC 2EDRA 5F9DC 1BQLH 1JL8A 4GKZB 4LF3A 1D5MA 3SKMB 1Q38A 5C0BA 4EVNA 2VE6A 2CLRB 2VDQH 1PZ5A 1TCMA 3OXSB 3LKSA 5KJRL 1INDH 4A2MA 4LSTL 3QHFH 4P59H 4NRXB 3WNKA 5AG9A 2WAHA 4HV8B 4Z77B 1AQKL 2QQKL 2WK2A 4P5KB 1DEDA 4WO4A 2YD7A 2DTSA 3KJ6L 5AWNH 4GKZA 2IAND 4PV9A 1RQ5A 3ZHDA 3SKMA 4D9QD 4YJZL 4O4YL 2GK2A 4ODVH 1KC5L 4PRHB 4D3CL 3T2QA 4NRXA 3RUGA 5HVFB 1VCAA 5F9OH 2APFA 2NY0B 2OR9L 3DV4B 3RY4A 4P5KA 4XGZB 3W82A 2AI0L 4NCDA 4MHHI 4UINH 4NBZB 1DBML 1FN4A 1E4XL 5B3JF 2OQJB 5F7HA 4PRHA 2C1OB 2ZCHH 2DIAA 1U8JB 2VLKD 2FX7L 2VZSA 3DV4A 3GMLB 2VDRH 1HZHH 4XGZA 4UTBL 1OD9A 2CO7B 1TJGL 2F5BL 3HNSH 1HHJB 2YPLE 3ZYJA 1BVLB 4G8EB 2R8SL 4ODBD 3O3EB 4APQA 2OQJA 3CSPA 2NPLX 3HNVL 3NCMA 4YDLC 4YXKL 4NWUL 2C1OA 5C0CE 4YHMH 5FYKD 1U8JA 4P46D 3NN8B 1DN0B 3GMLA 3GNML 5DFVD 3RGVC 1NC4D 1HHJA 5EBWA 5LWYL 1G7MB 2DQEH 1YYLH 2BHUA 1BVLA 4G8EA 4I5BB 4TSAL 5FM5M 1EPFA 3O3EA 4UIKL 1I9RH 5FECA 3REVB 5L0QB 4PBWD 1DUZB 1FO0B 1B4JL 2OL3B 3VWJB 2WSKA 2AK1H 3NN8A 5IFAL 1DN0A 1ZANL 3DVGB 1RK0B 1RJYB 4ZTPL 1CL7L 2W0LA 4LVHB 4KQ3H 1GGIH 4I5BA 4OLWL 2VZ1A 3REVA 3ROLA 1FORL 5F8QC 3TO2B 2OL3L 3UTZB 2OL3A 3VWJA 2WWKO 4Y16B 3DVGA 3BQUA 3T2OA 1RK0A 1BQUA 4QHNB 1G7QB 1RJYA 5B3NA 4RFNC 2DQDH 5BRZD 4OLUL 1QFPA 5FYKH 1UM5H 1TMCB 4YXHH 2E7HA 3TO2A 2NY1B 4I0KA 4RIRA 4BH8B 1X5IA 4MNGE 1SY6L 3QCUL 1SY6A 1BMGA 3UYOD 2P1YA 4Y16A 1SM3L 2XNAB 1ZVHA 5D71H 1FCCA 1TPXB 4Y1AE 4QHNA 1G7QA 4P5TA 2WINA 4PJHF 1NJ9B 3FQWB 4JFHD 1TTFA 4NM8H 3LS4L 4MDIB 4XNYL 5IWLC 2IAMC 4XPTL 3SCMA 3SHSA 4PJ7E 4BH8A 2G75B 3VA6A 1K3ZA 4Y0GA 4GBXD 4YK4B 2XNAA 5DMGC 4HIIB 3WDHA 4HWBH 1CG9B 2BMKA 4GAJH 5D1XA 2VWEC 4XRCA 1NJ9A 3FQWA 2YD8A 3MFGB 4MWFB 3S97C 1O5DT 4YHZH 3RIAF 4F15B 1I75A 5KSAB 3QNXB 4XP4L 1U91B 1FYTD 1MUJB 1EA9C 1IGIH 5DHXB 3G6JF 3W11D 2G75A 3O4LE 4N0CD 4N0UB 4YHYB 4IRJB 2VAJA 2WUBL 1D5XB 3MV9D 4HIIA 4K07A 4N0RA 2NZ9C 3F7RA 2EDFA 3WDJA 4Y19E 1WV7T 2VDNH 3VFNB 2H32B 4KRMB 3U30B 4MWFA 1OAQL 1MQ8A 1W0YT 5HVHC 1E4XI 1U91A 2FIKA 1MUJA 4K8RC 4S1RL 1FG2B 4N0UA 3CX2A 1JGUH 1QEWB 3B5GA 4IRJA 5TPWH 3VG0H 4B0MM 2ZJSL 1D5XA 4IIQC 2NY3D 1P5UA 5EBLB 2CO6B 5E2TL 4DZBB 3VFNA 2H32A 5EA0H 2I5YH 2B2XL 2C5DC 2R0ZH 4WFGE 1D3CA 2NW2A 2Q1EA 3F7VB 4JO1H 2FHFA 1ONQB 2APBA 4FQLL 2NY2B 5CZXD 2MQ3A 3QI9D 3SE3C 3N85L 1FG2A 4H8WC 4JN1H 1URLA 2A9MH 3GIVB 4HQQL 3HMWL 4FQ2H 1A7NH 3TPUA 2YK1L 4TNVK 3ZT7A 5EBLA 4PJXB 4CMMB 4ELMB 3U4EA 2XQBL 2HT3C 3AMKA 3WFBH 4DZBA 2X40A 2DN7A 4JREB 4NN6B 3RY6C 3KPMA 2UY7A 2HRPL 1T22B 2R29L 4N8PA 2OR8A 3I9GH 1ONQA 1N7MH 3MXVL 4JPWL 1VGEL 2EDEA 5GGSA 3VDBA 3GIVA 4KKCD 1A1MB 3IDUA 5JDJA 2R2CA 2EYSA 4HJJH 4PJXA 4CMMA 1MHEA 2DICA 4KH2A 4PFEA 3ZDZF 3QPQC 5L7XL 5TDOB 1CXEA 4XCFL 1RK1B 3MO1A 3JVGC 4OIIL 1U3HD 1AFVL 3LEYH 3DUUA 1OAKH 3TJEH 1YEJL 1A1MA 5JXEA 5F96L 3N9GH 2IEPA 1BGXH 5HHME 2J5LC 5FHBH 3WYRA 4NGHH 3WHE0 2P5WE 1YUHB 4YHOH 4ZAKC 3D85D 3PQYB 5TDOA 2DLFL 5ADOL 5HI3D 4KI5C 1UQSB 2YC1B 3C8KB 4D94A 1ZOXA 3BKJH 5D7SH 2WZPD 4C57C 1MCPL 3IU4L 3E6HB 4Y4FD 1P7QD 3G5XB 1YUHA 3MLWH 1A9BB 1AD9B 3PQYA 2ZZUT 1MRDH 4GMSL 4NFCA 1Q1JH 1AGCA 1OY3B 1N2RA 4HKXB 5DWUL 1UQSA 2YC1A 3C8KA 5D7LB 3PG2A 5IGXH 4NHUB 1EAPB 4PLKC 4PLOB 2YD2A 3E3QC 3ZSSA 2HJLB 1M7IB 3E6HA 1JGLL 5LCVL 2VMFA 3G5XA 2HJKB 5DEGB 3UC0L 1OM3L 4MXQD 3VWKC 1F11B 1RZJL 4DTGH 1QSFE 4FTVD 4HKXA 4LVEA 3QXUA 3Q6FB 4RMUA 5JHDB 5CP3A 5D7LA 5DT1H 5C0IB 3ARBD 4AEHL 4A6YL 5KOMC 4A6YA 1D5IL 1MCOL 1A3LL 2ZP0T 3HE7C 2HJLA 1M7IA 4PRNB 2HJKA 5DEGA 5JDSB 4R4FH 5A2LH 1F11A 3QDJD 1BAFH 4P2OB 3Q6FA 5TJWK 1WWAX 5JHDA 4V2BA 5C0IA 4FQXB 1J1XH 1C12B 1JNNH 4HC1H 2BVYA 4CN1A 5DR5H 4HUXB 4PRIE 4JY6B 4UIMB 5FDYA 3RU8H 5LGKA 1CE1L 5C8JB 5KW9H 1H3UA 5JDSA 3VXPB 4HUNB 4MD5A 4O9HL 3AB0B 3ILQC 5CJOH 2FYYB 4MB5A 4NQDD 4P2OA 2APXA 1U95B 4N1HB 3EIFA 1T1WB 3B9KC 3WKML 4FQXA 3RTQD 1CLYL 1BF8A 2QADC 4YQXL 5J13C 4U3CA 4M7LT 4JJ5B 1H0DB 1KJ2B 4HUXA 4JY6A 1C5BL 5FUOH 2NTSP 1UCBH 5KS9B 1JTOA 1RZKL 3VXPA 1G0YR 4LDEB 2EZ0D 1RU9H 3OB0H 1RFDH 3CMGA 3WNPA 2FYYA 3GSOB 1U95A 2R1WB 4PRPB 1QFWH 4N0FB 1N64L 1J11A 3CU7A 4JJ5A 1H0DA 1KJ2L 4TOYL 5DVMA 4NKQB 2MJWA 1KJ2A 5ALCH 3EHBD 3VU2A 4JFYA 5EOCJ 1QRNB 4HSQA 4Z8FH 4RGOL 4ZD3H 5KS9A 3KGRA 3L7EB 2UZIH 1EERB 2D3VA 3RUGF 1X7QA 3GSOA 1QPXA 4N0YL 1N0LA 5ANMB 4KK6C 2R1WA 1FH5L 4PRPA 1XGUB 4N0FA 2BNQB 4IMKC 4Z76B 1KBGL 2AJSL 4FZ8L 4XMKL 1ZA3B 2A6IB 5I1AB 3WNMA 4ALAH 4I0PC 1QRNA 4ZOCA 3ESVF 3KJ4C 4KHTL 4KXZH 2Q86B 1Q9LB 2AV1B 3L7EA 1WVZA 5T3ZL 4G7YL 4X7DC 1N5YH 2EDQA 5ID1A 1N59B 5DUBB 5ANMA 3U6RB 1RIUH 4OLZH 1VENA 1XGUA 2EKSA 2BNQA 4Z76A 2GQHA 2QV2A 4H1LB 1A22B 2A6IA 5I1AA 3V95A 3HPLB 1JZ5A 4MQ7A 1KN2H 1E0OB 2Q86A 1Q9LA 2AV1A 4C56E 5FGSA 5D4QA 5EFIB 3ZKXB 5BV7H 4ERSH 3QB7C 1N59A 3DECA 5DUBA 4JZNB 2F15A 4QXGL 2E8YA 2XICA 1FG9C 2FCBA 1EJOH 1MJUL 5CD5C 4ZS7H 4HIEB 1U58B 4KRLB 3HPLA 3OAUL 4KU1A 4QRRA 5EZLA 3IDNB 1A4JB 4WUUE 5EFIA 4U1HB 3NCCB 4JZNA 4MA8L 3R0NA 4P9HH 3DYPA 4XB8A 4HIEA 4MZ3A 4P2RE 5FM4A 5F9WB 3DYOA 3RVWD 5AAMA 4XVUC 1A5FL 1A4JA 4U1HA 3FT2B 1XGPB 1J7VR 1NAKL 2YR3A 2Y6SC 4H88H 1BFSA 2AVGA 1FFNB 1TQBB 1BD2E 5DO2C 5GGVH 2EC9U 1CDBA 3CH1B 3OV6A 5EC1B 3WO3B 4PB9L 4UQ2B 2NXZD 4LIQL 2BSTB 9CGTA 4KKAD 2C3VB 1H3GA 1AE6L 1IILE 4FABL 2ZUXA 5A2JH 4ONHB 4PJ8D 1J1PL 1Y6MR 5D1ZC 4YC2B 2F8XC 4JVPA 3FT2A 1XGPA 3TZVB 2HKFH 3O6FC 4Z0XB 3GSQB 5KVGL 3MRGB 5I15H 1FFNA 1EGJL 4L9DA 2VXUH 1EGJA 3GHEL 1MFBH 2WIMA 3AXLB 3CH1A 5D7JC 4H1LG 1XF3B 4YIQB 2BSTA 1KTKE 2C3VA 3LMJL 4QRUB 4X6BB 5K9KB 1EXUB 1INQA 4ONHA 2MFNA 3DETC 3FZUC 1AQDB 5IJVB 2DTMH 2FECI 3IDJB 4I3SH 3NABH 3TZVA 1X9QA 4Z0XA 5I1JL 3GSQA 3MRGA 5E8OB 3QXAB 3NCEB 3NIDF 4KJWC 4K3GA 1KEGH 1EMTH 5T3XL 3R4DA 3AXLA 4HDIB 1GVIA 1J5OH 1XF3A 3IT8D 4YIQA 1RZIB 1RI8A 4QRUA 5K9KA 2X6MA 1EXUA 2E8ZA 1KEMH 3OJDB 5JIIA 4GFTB 5IJVA 3IDJA 4F8TA 3LKOB 5L2JB 5E8OA 3V5DB 5B21A 4HDIA 3I3BA 1KGCD 2IPTL 43C9A 2DQIH 3SKJH 3BISA 5DJYB 1RZIA 3MA9L 3MGTB 4J4PC 3V6ZB 3ZL4L 1CU4H 3HC4L 3BN9D 3OJDA 4UBDC 1F13A 2N7BA 1YMMA 1JNLH 5GISH 1TJIL 1XZ0A 1BFVH 2GY5A 5HDLA 1YPZF 3V5DA 1PYWA 4XCYB 1P84J 4GLRI 3MGTA 3U83A 2FBJH 5CHNB 3V6ZA 4XNMB 1VPOL 2AV7B 5TQ2H 2D7NA 4F7CB 4JPKH 1FGVL 4MA3B 4ZFGH 5CFHA 2XZAH 4JR9L 3BPOB 3DWTA 3EDKA 1W72H 4O00A 4V1DB 1NAMH 4CADB 4XCYA 4FFYL 6CGTA 3DBXA 1WBZB 1S7WB 5CHNA 4ZXBC 2LAAA 1U8NB 1NEZA 2YPLD 35C8L 2J3SA 2AV7A 2GW5A 4F7CA 3UTSB 3K81A 4MA3A 4LCWB 1A1NB 4EOWL 1FNAA 5ALBL 8FABA 3STLB 4DOHE 3DI3B 5C0CD 1LWRA 5B8CC 4V1DA 1KOAA 1OB1B 2VDOL 4Y2DC 1FVCA 4ZS6D 3MBXL 3NZHH 4CADA 2NR6C 2V2WB 4OFKA 3STBA 5DHVB 3EDEA 4PJXF 1WBZA 1S7WA 3KLAB 2DB8A 5FA4B 1AGFB 3BO8B 1U8NA 3GHBH 2XFXB 5SWQB 1E4KC 3IJYB 4K3EH 1WFUA 3HN3A 2QSQA 4LCWA 1A1NA 3JV0A 2F8OA 3STLA 4PS4H 2VL4A 4X80H 5JTWA 4GS7C 2VLRE 1OB1A 5ICXB 2V2WA 3VGFA 4KKNA 4PY7B 4XCCH 5DTFB 2C3GA 1AXTH 2R4RL 3U1SL 2BDNL 5I19H 4JFFB 3KLAA 5FA4A 1AGFA 1QYGL 3BO8A 2XFXA 4HBCH 2ORBL 5SWQA 3IJYA 3VFSA 4X83A 1I85A 3MOAH 3VFVB 1T03H 2DM4A 3QIWC 1GHFL 4Z78A 5ICXA 1K3IA 2QHRH 3C08L 5DTFA 2JF1A 3FCTB 2IGFL 5HXMA 4JFFA 4ESKA 5DC9B 5FYJL 4DKFL 4EKXA 1F4YL 3V7AE 3WO4C 5I18L 3ARDB 5E2WL 5DURB 3VFVA 1WEJL 4MS8D 2Z91A 2ITCB 3FCTA 4Y1AD 5BOZG 4KZDL 4RGNE 3BJ91 4ZNEA 3G08B 3B83A 3IFNL 4YGVB 1ZLUK 3BSZL 3ARDA 4RAUB 4I2XE 3FHQA 4M1DH 5HTSA 4PR5B 1JNJA 3EDDA 1GCFA 5FV1L 3DRTA 5T1MB 4QOKE 2PO6C 1AI1H 3QQ3B 2ITCA 5HDQH 4I0CC 1P2CB 1E27B 4YGVA 4OLEA 3PDDA 1OP5H 4P2QE 1CGTA 3IXTB 4TSCH 5FGCE 4NKOB 1L0XA 4RAUA 3ROOB 4GRMA 5T1MA 5C92A 3MV7B 3QQ3A 1VKXB 4M02A 1XGQA 3DMMD 1P2CA 3BKMH 3C5ZC 4XNQB 1E27A 4Y19D 4EIZC 3IXTA 2C4FU 3OAZK 4NKOA 4F7TB 2DLGA 1HQ4B 3T0EC 2W9EH 2VR5A 2J8UB 1CBVH 1PY9A 2D7PA 1T5XB 4LKCA 3FTGB 3GJFB 5J1AB 1YNKH 3T3PF 1AXIB 3MV7A 1VKXA 2DIJA 1HCVA 2H1PL 3RX7A 4OZIB 4XNQA 2E9IA 4DAGL 5FAAA 3MODH 2DQGH 4F7TA 4WFGD 2CK0L 5CD3B 1FFOB 1HQ4A 2CMRL 4JDTL 1UM6L 4RAHA 1T5XA 3FTGA 3GJFA 3EKCA 5J1AA 5ID0B 3X12B 3ZYZA 3ZYIA 2PW2B 4OZIA 4M62L 1H3WM 3GSRA 4KAQH 2ATKB 3NVQA 5CD3A 3QHZH 1FFOA 3P2TA 5TE6L 1KPRB 1DQDH 3RRQA 3U0WH 5D1QC 1HINH 3GMPB 3RY5A 4M5ZL 2IWGA 3X12A 4LSRL 4OSUH 2PW2A 4DVBB 3ABZA 1HQRB 5D2NB 5IG7B 3KYMB 4NNPH 4XBEL 1Q0XL 5LVEA 3RWFB 3NCFB 3KXFB 3WSQH 1XIWC 1KPRA 5GRUH 3DGCR 3ZTJH 1E6JH 5FA3B 3GMPA 4LARH 4JFEB 3TH3T 2AEPH 1B0RA 4DVBA 4YAQB 5HHMD 3IDYC 2DJ4A 2P5WD 4AL8H 1EHAA 1HQRA 5D2NA 4L4VB 4QRTB 4DKAA 2QL1A 2A6JB 1RIHL 3KYMA 3M07A 4LLUB 4MA1B 5IG7A 4KK5C 1JYXA 4HUVB 3RWFA 1MY5A 3TYGH 2M2DA 3KXFA 4M8VA 4OLYH 3D48R 2VC2L 3HZMB 3EOTH 4L8SB 5FA3A 4P4RB 5E9DE 3VD9A 4JFEA 2CLVA 3OKOA 3S36X 4LPXA 1PG7L 1L9NA 4L4VA 4QRTA 2A6JA 4LLUA 4HUVA 4XNUH 1EAJA 3ZHLA 4U2YA 3B2VH 3UCRA 3CH8A 3CLEL 4MAYB 4U1GC 5EUKA 4G8GB 2XY2A 5FKAB 4P4RA 4R9HA 1XAUA 1QOKA 2NX5E 3CVHB 5K59E 3VXMD 4RFEA 4M43L 1EDQA 1CR9H 4J1UB 3QEHB 1QFUL 4X6DE 1QSFD 3I02A 4POZD 1JP5A 5KG9B 3SDYL 4MAYA 3KPRE 3PV6A 4K94L 2NLJB 5FKAA 5H35B 4HIJB 3CVHA 1J12A 1NGXB 4OM0L 1LHZA 3O4OC 2VXVH 1YYML 3NIFF 4P5MB 4J1UA 3RWGB 5EOQL 1HCFX 5KG9A 3QEQB 4GW4A 3LSOB 4XBGB 5GPRA 4RWYH 4QTHB 1YECL 2NLJA 2GHWB 4U6YB 5F7NC 3RP1A 5CEYB 5H35A 1EO5A 1NGXA 4PRID 3DV6B 2BNUA 4KTYA 4L29B 1ETZA 4P5MA 5D93B 1MHPL 1QKZL 1KCUH 3GGWB 2HFTA 1Q94B 4L4JA 1T0PB 4DW2H 5IT2L 5ADPL 3QEQA 3VGAB 3LSOA 4XBGA 5EOTA 4M7KH 4WENB 4QTHA 3GSNH 5LAXB 5DVKA 5GGQH 4NN5B 5CEYA 1QPPA 4Y4HB 2M26A 1I4FB 3HFML 3QG6B 4L29A 2Q8BH 3ZTNL 3VJ6A 1MLBB 3FQUB 3GGWA 1Q94A 5E24E 4LLWB 4PB0H 2M1KA 3KHQA 1MHHB 3BXNB 3HAEB 2BCKA 3RDTB 5LAXA 5ICYB 2MQ0A 3LKNB 4P46C 4PUBH 3T4AB 5JMOC 4M61B 5C07E 2IQ9L 3HMXL 4HZLB 3HMXA 5DFVC 1OGTB 4YGAB 2X70B 4Y5VC 2X4TB 4JM2C 2XKSA 3HUJE 5BVPL 2YUZA 1MLBA 3MLSL 4AEFA 4LLWA 5C2BH 4J3WA 3ESUF 3RX8A 3CXDH 3HAEA 1NGQH 1VFUA 3RDTA 2HMID 5ICYA 3LKNA 2MMXA 2C3WA 3T4AA 3QDME 3UTPE 5IVXE 4M61A 1IGFL 3EJZD 4HZLA 4PP2B 3VXUB 3G5YB 2X70A 4G5ZH 3GRWL 1R5IA 2EECA 2VZOA 3GRWA 3WN5C 4LU5H 3ARQA 1I1AD 1V7NH 3TO4B 5IK3B 2JIXD 1UJ3B 1QFOA 2YD5A 3ULUL 2NNAB 4M03A 1DTUA 3QUMB 4ENED 4G6KH 4Y4KD 4EUPH 5M7QA 1PJ9A 3VXUA 5MP6L 1XR8B 4G43A 1TNMA 4YE4H 3FO0L 5GRVK 2QSTA 4C56D 2DQHH 4GMTL 2NY7L 3I6GB 2CKBB 3TO4A 5KVFH 5HD8D 5IK3A 1A3QA 5GS0D 1UJ3A 1JGEA 1HWHB 1OTUD 3BPNC 3QUML 3UAJD 3OTTA 2NNAA 3WHXB 3QUMA 1QA9A 5D8JH 4Z7WE 2J4WH 5IEKB 1QR1A 5CKAA 4WUUD 1LE5B 3QCTL 3K1DA 4W6XB 2CKBL 2UWEE 2CKBA 5D7KE 3HAEG 1BVZA 4J3XA 2O5YH 2J88H 3H6JA 1MPAL 3FRUB 3DX8A 4HFWB 4PJFE 2D4DA 2CR3A 2FL5A 2HKHH 3IAPA 3WHXA 5KVMC 4GBXC 5C6PB 3P0VH 4RDQG 2JJSA 4P2RD 4YO0B 1U3ZA 1A7RL 5IEKA 4ZDHB 3D25B 3UYRH 1LE5A 3IFPB 1UC6A 3EFDH 4OKVB 5DJ2B 3CC5A 1NANI 3BAEH 1GAFH 2YUVA 1LK3H 1BD2D 3W11C 2GSGB 5EUOE 1MRCH 4BZ1H 4N0CC 1JWUA 3W9EB 4JVUA 3O8XD 4YO0A 2V5RA 3GMOA 5EO0B 1W8OA 5DK0A 5GS0H 4ZDHA 3D25A 1AO7B 3WL9B 3IFPA 4JB9H 4OKVA 4FP8L 5DJ2A 5DZOA 2R2BB 3LS5L 3VD3A 4B5EA 2GSGA 3MRLB 5K9JL 3QFDB 1WIPA 5JW4M 4QEGA 1GGUA 2KQNA 4XPFH 4RWHA 2D0HA 5EO0A 2DQCH 1WBXB 4Z7VB 2EKJA 1AO7A 5I1KH 1BIIB 2R0KH 2R2BA 1B0GB 5AUMB 4DKEH 3BKCH 3MRLA 5CZXC 3Q6GL 1IAKB 3QFDA 1I1FB 3QI9C 4MLSA 5EIIB 5BS0B 3SBWC 4NZDA 1BF2A 4BH7B 2HJFB 2GI7A 5FGRA 1WBXA 4O58H 5DMJB 4Z7VA 1P4LB 1BIIA 3MR9B 5MEOB 5L8KB 4WW2F 4L8BB 5DD5H 2Y72A 2VUOA 1IC4L 2GITB 1B0GA 2JJUA 1T1XB 1NFDE 5AUMA 5F71A 4HGMA 4Y8DC 3I50H 3O6KL 5GJTL 1IAKA 1I1FA 3V0WH 5BS0A 5EIIA 1A3RL 2YEZB 3QG7L 1ZEAH 4KKCC 4LCYB 3RAJH 1JHLL 1FIGH 4X5WB 4BH7A 2HJFA 1Z9OA 2WBJD 3QRGL 3B43A 3PABB 1WWBX 3U9UB 4WHYH 1IBGH 4GRWB 1UWGH 3MR9A 5MEOA 4WEBL 1DQJB 4L8BA 2HT2D 4JDVB 2GITA 1T1XA 2F19H 4HW6A 2HH0H 2FH6A 4PRAA 4ZPTA 5LQBL 1U3HC 3ULVE 2C4FT 1YEIL 2YEZA 4LCYA 4FQIH 1T2QL 3PABA 4JFQB 4OGYH 4XMLH 4LSSH 5F72S 4LSUL 1GC1H 4MXVE 4RFNB 5LGJB 1PD6A 1DQJA 5IJKC 1INEL 4JDVA 2BVUA 3VXRB 1SMOA 1VFBB 1U8LB 5HI3C 1F4HA 4R4ND 1YZZA 1U8PB 5BW7C 1FNSL 4P3DB 4OZIF 4P4KB 5CZVL 3TT1H 3K0WA 4OCRL 2IFGA 2Y5TB 3BVNB 2VLME 1T21B 4JFQA 1T6VN 4Y4FC 2V6HA 1A7QL 3EO1B 5LGJA 2AAVA 5FB8B 5ITBL 1JWMB 3VXRA 3RFZC 1VFBA 1U8LA 2GIYA 2IAMB 4FHBD 1IEHA 3VFGH 3U82B 1QG3A 1U8PA 2IPUK 5FK9B 4P3DA 4WCYL 4P4KA 4OCYH 2GTWA 2P4AB 4GSDH 4JO3L 4N1CA 3JZ7A 2X7LB 3ARED 2Y5TA 1T21A 3GDBA 5L2KE 5I66B 3EO1A 4MXQC 1IAMA 5E6ID 2NY6C 1JWMA 2AERT 5IWLA 2VLRD 1MREL 2IAMA 1NMCC 1EHLH 2E6QA 5F88B 3CAFA 3ARBC 3QCVL 3U7YL 1UACH 2A6DB 4JFDB 2DLEA 2P49B 1M71B 1YNLL 3BPCB 3EYVA 1HDMB 3ZO0A 4FNLL 1VFAB 1NLDH 1OP9A 5I66A 3BZDA 4OGAD 3WJJC 4QF1B 1IE5A 1W2KT 5GZND 2IFFH 1UWXK 3PP4L 5HVHB 4L4TB 4B41A 3FKUS 5F88A 5EU3B 2ZPKL 1TZGL 2F54E 4NC0B 1YNTA 4LQFH 2V2XB 2A6DA 4JFDA 3LDBB 1M71A 3SE4C 4KRPD 3BPCA 1RULL 3H2WA 4AEEA 3MGAA 2KZWA 3G6DH 5EZIH 4P23C 1DQMH 3QFJA 4QF1A 5DGRA 4OF8A 5GGUB 3GBMH 1ZGLP 1TXKA 1Z2KA 3FQTB 3TA3B 4L4TA 4K8RL 2XN9E 4FFVD 1NGPL 5EU3A 4LCUA 2VZTA 4DGVH 5E8DL 4RGND 2EYRB 3ZLQC 4RAVB 3GSWB 1F90H 4IIQA 1K4CA 1GPOH 4HF5L 5C2UB 4NO0B 5TE7H 1I1YB 1GGBH 2VJXA 2EZ0C 1QBAA 4PREB 1FE8H 3TA3A 3FQTA 3TYFB 2B4CH 4KY1H 2MOVA 4H8WL 4LPWA 2PR4H 4JGJA 1UH4A 4XC3L 2EYRA 5LBSL 4RAVA 3BKYH 5JUEL 3UX9B 4P2QD 3EHBC 4CAGA 1MF2H 4NO0A 1R3JB 3LRSB 1I1YA 4OZGF 1BJ1J 3RY6A 4KWUA 4PJAF 3V4UL 4PREA 3IFLL 4P3CH 3TYFA 1KIUA 3H7BB 2RGSA 5D2LB 5IV2B 3MV8D 4K23H 5DEFB 2IG2L 3HI1B 1CN4A 1FL5B 4NKDB 3W81A 4P9HC 5HPOA 1UKSA 5I6XC 3F6LA 1AGBB 4M7JL 1KCVH 1OAZH 3X3FL 2J5LB 4BM7A 5A3ID 3TIEB 1P84K 4NNXA 3H7BA 5D2LA 1IGML 2E27L 3JVGA 5DEFA 2AEQH 1WT5C 1HYSD 1B90A 1FL5A 1MSPA 1ADQH 3MSPA 3TVMD 1HH9B 3I2CH 4U6VH 1AGBA 2ZUYA 2CGRH 4UNTA 5AZEH 3HZVA 5JPNB 3TBSB 4FFWD 4XAWH 3TIEA 4PD4J 2Q6WA 4R3SB 4WI7A 3U0PB 4TUJA 4NBXB 5MEPB 3WFDL 4P49A 2ZCKL 1CDIA 1BBDH 3GMRB 4UV7L 2IF7A 5JQHC 1PFCA 3PP3H 1HH9A 5ITFB 3MGOB 5JPNA 5EWIL 3VWKB 3TBSA 4UTAH 2G5BA 4R3SA 3U0PA 5MEPA 4GKOA 3GMRA 1M4KA 4NZRH 4LPTA 3JTTA 4JDZB 3IJSB 1MCWW 5ITFA 3MGOA 3RVWC 2CPCA 3VWKA 3LPWA 4TYUA 4CVZB 1GYAA 1KFAL 1ZLVK 4S0SD 1KXQE 3QEUB 2YMXL 2NXZC 4JDZA 3DVFA 4KKAC 3ZE1F 4R7DB 1MCBA 3IJSA 3HE7A 4W4OC 2AJ3B 3TV3L 2MHAA 1T2XA 4PJ8C 1BEYH 3VG9B 2AP2A 1MCSA 2O5XH 4CVZA 2V5MA 4R90H 2AJZB 4JLRB 4NOBA 5E9DD 1EFXB 2I27N 2EDHA 5ELIA 5J13B 4P9ML 1DUYB 1HKLH 4R7DA 4LSVL 2AJ3A 2DQUL 2UYLB 3NBNA 3O3DB 1UZ6E 4HIXH 4QXTB 4IS6B 4PJBA 2AJZA 4JLRA 1A6AA 1EFXA 2NX5D 2R56L 2B20A 5F7FA 3D5OF 3HI6L 1LK2B 3EUUA 4M8QB 4ODTH 1ZT4A 5FDWB 5I1CL 4PLJD 3H9YA 4I3GA 4M6AA 3GIZH 3EYFA 2UYLA 3O3DA 4OUOA 3TBTB 4QXTA 3U2SB 4FQCH 3KPRD 4IS6A 4XNXH 2HFEB 4K7PX 5FUZH 1MVFA 3EBAA 4FOMA 3IKKA 5IFHL 3ZDXF 3E8UL 4IDJH 1VADA 4M8QA 4HXAL 2XZZA 2F58H 4WWKD 5FDWA 4GXVH 5D7IB 5IW3A 5TQ0H 3BN9C 2GYSA 3KJ4B 1NLBH 2OM5A 2R2EB 3LV3B 5KOVC 1C7SA 1BREA 4M00A 5JIKA 3RWHB 3TBTA 5AEAA 3U2SA 3BESR 1OTSD 2HFEA 1I1CA 4X4ME 1DSFH 4I48B 4NO2B 3RA7L 4OB5H 1DFBL 3VW3H 3H8NA 1BQHG 2BY3A 5CCKH 2X1PA 4IMKA 2GCYA 1KCKA 5C7XL 2F9BT 4X6CE 3CPLB 4W81A 1MQKL 5D7IA 1JK8B 4Z7OE 4L3EB 2R2EA 3RWHA 3HI5H 3MV11 2XTLA 3D39B 2VQUA 1D9KD 4I48A 3LHPL 4X0KB 4K3JL 2HWZH 1HN1A 5F6HJ 4FXKB 3K8LA 4Z7VF 3CPLA 5EU7E 4HLZG 4WDIB 4OFPA 4Y5XC 3L5IA 1ZVYA 4ELME 3O0RH 1JK8A 3TN0D 1T1ZA 4L3EA 1YQVH 5DRNB 5FHAL 3CDCA 3KYKL 3MRQB 2ZWLT 4F80A 1JPGB 2Z0BA 5KSBB 4AJ0A 5K9QG 2A6KB 3D39A 4NM4H 1TTUA 4ZS6C 4X0KA 2BJML 5C07D 5JNYB 4U1JB 4KZEL 2OP4L 2CDEB 4FXKA 5FEBA 3VI3E 4WDIA 4M93C 2P48B 5HHVH 3D87B 2XA8L 4WIQA 3SJVB 3RL2B 5DRNA 2D31B 4R6UA 3OF6A 3NFSH 1JPGA 5ENWB 5HY9B 2HLFD 5KSBA 1TDQA 2A6KA 4L8DA 2DDQH 3UTPD 3QDMD 1XCTB 4U1JA 1TIUA 2CDEA 5EBMB 4NJAL 3SJVA 1LQSR 2DJUA 3CD4A 4XT1C 3GKWH 4IOSD 3RL2A 1T1YA 3QULB 2D31A 3MRCA 3PWPB 4JQVC 5D1ZB 2PETA 3PQYE 5ENWA 5HY9A 1P6AB 1LILA 3P0YH 5CIPB 4JVWA 4NHCH 1OPGL 4YR6B 1EHXA 5D7JB 4F2MB 3KPPA 2B0SL 4MNQB 4KVNL 2CH8A 1U3YA 5EBMA 1KTLA 3PWLB 3QULA 1FVEB 2C4XA 3PWPA 1Y6KR 5D1ZA 1U8KB 1FNEB 3O6FA 1S3KH 5D7LE 5CIPA 2X4OB 4TRPL 3WDIA 4E9LA 4X98B 4YR6A 5D7JA 4F2MA 4R2GD 1CLOH 3O2WH 4OCWH 4P99A 3MLRH 3PWLA 3PWNB 3K8KA 1WZMA 4Z0BH 4XB7A 5D7KD 4GG6B 1FVEA 1U8KA 3NH7H 1H8OA 1SQ2N 1FNEA 3UZQA 4C4KT 5JHDE 3CJJA 3JXAA 4N9GB 4X98A 4MA7H 1S7UB 4NQSA 3ISWA 3PWNA 4Q7DA 1W0WB 1VERA 3QEGH 4GG6A 2VDMH 1DQLH 4G9FB 4ZFOB 2C1PB 3F7PC 3E1F1 5DVLA 3O2VH 2WWKT 4KJPD 3DMMC 4KKBC 4XVSH 3SGEH 4EQ2A 1S7UA 3RVUC 4J4PA 4MYWB 4OZHE 1W0WA 3KYAA 1DL7L 5IQ7L 4UILL 4G9FA 4JEGB 4ZFOL 4NP4H 4BFGA 3VFWB 4WW1B 4F57H 4ZFOA 5I9QC 2AGJL 2FGWL 2BFVH 3UDWC 3X3GH 4YPGB 1L9MA 3UJJL 4ZXBB 1HXYB 4WV1C 1HHIB 5KS9E 1FAIL 4PJDB 2KKQA 3C5JB 4Z6AT 3VFWA 4WW1A 2VZVA 4UAOB 3MLZH 2FJFA 4NRYB 4JQXC 4Y2DB 2IBBA 2HFGL 3QZWB 4TUKH 1NMBL 4JKLA 4YPGA 5GHWH 5IMMA 2YRLA 5FV2A 1U9KA 2HLAB 5EG6C 4AEIL 1ED3B 4M1GL 5I30L 1VHPA 1UXSA 4KTEL 4ZXBA 3BW9B 1HXYA 1QRNE 2FX8H 1HHIA 1NDMB 3UPCA 1F4XL 2ICEB 4PJDA 4EDWH 1T89C 3SDCB 5GGRA 2XYCA 2HP4A 3C5JA 5IW6B 4FFZL 4X8JA 5IM7B 1DVFD 3UMTA 1G9MH 4GS7B 5F44A 5ANME 3ORJA 4OM1H 2FHCA 4BQCA 4Y2DA 2JCCA 4PY8I 3QZWA 4NO3B 3RX5A 5ETUB 2HLAA 2LU7A 3MCLL 4QT5A 1ED3A 4R7NB 3H9SB 2DKMA 1E4KA 2ICEA 3CFCL 1WSST 2Z9TA 3SDCA 2E3VA 2XG4A 5IW6A 1IGCL 4HUWA 5IM7A 1KIQA 3FRPA 3ULVD 4XVJL 2VN4A 4K7PH 4X7EC 1TVDA 3RGHA 5GS1C 2FB4H 1S7RA 2VABB 5ETUA 5HGAB 1I9JL 4R7NA 3WNOA 3UJIL 3H9SA 3HC3L 5CJQL 3WO4B 2X2YA 2GJ6B 1F58H 4UUJB 4M6OH 1LO3H 4KI5F 5CEZE 3TWCH 1LMKA 3V4PH 4TQEH 5I2IB 2A1WL 4RCAA 1E4WH 3DHJA 2VLMD 2VABA 3FQXB 2QBWA 2QQLL 2E7LC 1RUAH 1CVSC 1F2XK 4U1MA 1L7IH 4M7ZC 4NC1E 3NCJL 4UUJA 2QLVB 4JKPH 3L1OH 4QO1A 4LASH 2HG5B 1JZ7A 1AR1D 4LRNH 3QZWG 1X5KA 1JE6A 3LPFA 1X5ZA 2PO6B 3K2UH 5KANI 3SQBA 5L2KD 3FQXA 5CEXB 3G5ZB 1SEQH 2OI9B 2ZUQB 3C60D 1IQWL 2W1NA 4JPVL 4K71B 4ODSH 5D70H 2XRAL 3PGFL 4NFDA 3ULVH 4G6MH 4M9OA 4POZC 5TE4L 1EUTA 4M3KB 2JB5H 2PO6A 4JCMA 5CEXA 3C5ZB 4XCNB 1PGRB 5DVNA 3G5ZA 2XWJA 2V9QA 4OZFH 4W6YB 1CICD 4M6ML 4KMTL 2OMBA 5DJZB 2X9WA 1OARH 3T0EB 4IRSD 1MCRA 2Q8AL 2F54D 4LAQH 3WFHB 2OSLB 1NUGA 2XWBB 4I77L 2BC4B 3FB8B 1F97A 4N90E 3C5ZA 4JO2H 4XCNA 4Z7UA 5GRJH 1K2DB 3DUSB 2Y36L 4PJBF 1EH9A 3MLVL 5C09B 3P4MB 4YWGH 3T0EA 4LEXH 4WI6A 5JOFB 2XN9D 1WTGT 2M8XA 4MXWL 3GJEB 3WFHA 2OSLA 2WQ8A 2XWBA 3U48A 1MJ8L 4NUGL 1RUQL 5IOPB 2BC4A 3FB8A 3NA9H 3OB0K 4TTDC 1K2DA 1NEUA 3DUSA 3R06B 3P77B 2H8PB 5C09A 3P4MA 5FCSH 4HJ0D 5JOFA 4ONFH 4U0RB 5FCUL 2P5EB 2H45A 1KLGB 1UYWL 2XOTA 3GJEA 5ABDE 2MNUA 5D1QB 4JG0H 2AKRB 5GGSY 5J1SC 1HYRC 5E0QA 5JZ7D 5IOPA 3HG1B 5A43C 4QXUL 1I7TA 4RA3A 2YXMA 1J0IA 3SE9H 1KJ3H 2AJYH 3P77A 1IC5L 4H0HB 3KLHC 2P5EA 1WJ3A 3MACH 1T7VA 3W9DB 4W6WB 2HMIC 5D1QA 1FAKT 2IBZY 2AKRA 1UA6L 3OKEB 1EZVX 3EJZC 3AS1A 3HG1A 4NYLB 3IDYB 3ZSTA 3H3PH 2NXYC 2EC8A 1I1AC 5KJRH 4B53A 1BQLL 5DC0A 2RCSL 5I1DA 1F8TL 1LE9B 4S1QL 5IW1A 4RMSA 3W9DA 2VDQL 1OWRM 4ENEC 1G7LA 3KJ6H 1X5XA 3QHFL 4P59L 1D5BB 2BVPB 5EO1A 5DQDL 4ETYA 2X1QA 4Q2ZB