2K1MA

3d nmr structure of domain cc0 of cardiac myosin binding protein c (mybpc)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
PEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D NMR structure of domain cC0 of cardiac myosin binding protein C (MyBPC)
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Myosin-binding protein C, cardiac-type
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k1mA00
4JVUA 5E5MA 4Q6IC 3G9AB 3MNZB 4NGHH 5IFJA 3BKCH 2ZUQC 3GSRA 1LP9E 1LO0H 2VXVH 1KTRL 1A4KA 2EC9U 1AXIB 1AQKL 3DIFA 1K4CA 4X7CC 1U92B 3RWFB 2H1PL 1PG7W 4HLJA 1BAFH 1IGIH 2VDOL 1CFSB 2VL5A 3SDAB 3OX8B 4LCUB 2FEDC 3QA3B 2GJ6D 2UZIH 1JF1B 4ODSH 5EZLA 4KV5E 5CINL 1DDHA 3KPRB 5DUBA 3DYPA 4OV5B 2ZOLB 5D1QC 4X5WA 4HGWB 1F4AA 1A6ZA 2HTLD 4AMKL 4K94H 5IG7A 1RMFH 1ZA3A 3V79C 1R0AL 2A6KB 1RIHL 1IZJA 3PNWB 4PYGA 3U9UA 3WUWG 1HZHL 1MH5B 4IRJD 4G8FB 4U1HB 3QJHB 3ULUL 1RULL 3MV9B 2HYMA 3TIEA 2W07A 3DXAA 1A9BA 3QUML 1S7SA 2H8PB 1V7NL 4PYHA 1W72L 4LHUB 3VXUD 1KC5L 1RZJC 2IGFL 5ANMB 5HSFA 4OT1H 4FQLL 5LKNA 3D85D 3QUKB 4RDQF 4ZUSB 1NEZA 5SWSB 2O5ZH 2Q3ZA 5EA0L 4U6HB 1INQB 4MSWA 5FB8A 5DVKA 2VAJA 4MCZB 3RKDC 2NXZC 3H9SA 1G9EA 1BZ9A 3VXOA 3I02B 3MLZL 1ZT1A 3DV4B 4J8RA 3QUMH 3B9EA 4M7LL 4P23D 3RZWA 4P5MB 4LEXH 2VZOA 3MLVH 4LBEB 1MCPH 3PUCA 5D7JD 1CFNA 4X4XA 4GW1A 3W5NA 2AK4A 5GSVA 2NY1D 1OQXA 1XEDA 1DLFH 5F3BA 1AY1L 5B4MC 5KJRL 3KAAA 2Q86B 4FNLL 3CPLB 2DL2A 5E0QA 5E24E 3KYMB 1LK2B 4YX2L 4DVRL 1RZGB 1F4XH 1U41A 5D7JA 4FXKA 1ZS8B 1ZLWK 4XCEA 3OF6A 3DBXA 3QDJE 3DSNA 5KVGH 2FD6L 1FYTA 3VCLA 1NC2D 5IR1A 5ITBL 4G80B 1TJIH 5D1XD 4ZXBD 3D85A 3DGGA 3MRHA 3HZKA 4KUCD 5EFIB 5IW1A 3BO8A 3PL6A 2X4NA 2DI8A 1CDUA 1V7MH 3GI9L 4FN0A 4PJHB 1FBIH 1ZHBB 1RIVL 4ODXA 1TCRB 2W0LA 1NC4D 3HE7A 2GCYB 2Y5TA 1RJYB 4GRLD 4G8IB 1VB9A 2O5XH 1RHFA 5FGRA 4NUJB 1JPFA 1OF2A 1T04B 2V9TA 4LRIA 5JLZB 5KG9A 3PG2A 3QXDA 2YC1A 2OR7A 3DX6B 4PTUA 4U1IB 3VRLE 4RFOL 5DJXB 3TGXA 3G9VA 5GZOC 3JWOL 4KTEH 1IAII 4EOWL 1JZ4A 1XMWA 3PWUB 4DGIH 3IU4L 2VLKD 5J1AA 4L4TE 4PBVC 3B9KA 4G43A 1F45A 3SGDI 1J8HD 4P46B 5KW9H 4N1EA 1UADC 1FC1A 5C6WH 3VA2C 3MC0A 2MSPA 4RFEA 2CRYA 5I16A 3JZ7A 1CLOL 3GSVA 4PJXA 2OZ4A 1UWXK 3MNVA 3TH4T 4L4VE 3CDGB 2YN3A 1I4FA 5AG8A 5C0BA 1A1OB 2YZ8A 1MCHA 3MOAH 4HKBB 1WIOA 2WIMA 4FFZL 4UDTB 2C4FU 4AH2A 4AL8L 1YN6A 4X6DE 4JHZA 3BQUA 4FQ1H 2FEDD 4DAGH 1SBSL 4Z9KB 5EIIA 1ZGLM 3BPOB 4RZCA 4YQXL 3ZKXC 3FB6B 5JQHC 3MXVL 4I0PA 4JG0H 4OLZH 3D2UA 1C5DB 3OGCA 3L3DB 2Z31D 4JDVB 2X70B 3RVWD 3PGDB 3WNOA 1M05A 4Z18A 1X4ZA 4ZNCD 4YDVA 2AK1L 1CLCA 4V2BA 1WBZB 4G6JH 4FABL 3SGDH 4G6ML 1NBZB 1AXTH 4ENEC 1I8MA 1MHCB 1WZ1H 1QSFB 9CGTA 4JRYA 1A21A 1L0QA 1G9NH 4I9WE 3DMMC 4J6RH 5D72H 4LSTL 3BPNB 4JKKA 4AQ1B 4ETYA 3G08B 4NNXB 1IGYB 4Z8FH 4OKDA 5IK3B 3DHJA 3P30L 4M6MH 4DOHB 3X13B 3C5JA 3UTSD 4MA8L 4QWWC 1S7RA 1JNNL 2HKHL 2Y9RT 1PX3A 4NQEB 3VE0B 5FGBA 3EGSB 1LEIA 2C1OB 5E9DA 4GRWE 2X09A 3ARED 1CVSC 5CBAA 1HCVA 4OQTA 4OLYH 3MUGB 4LKXB 1EGJA 5DK2B 1BVLB 3TBYA 1NQBA 5IF0B 5B38B 5F97E 3EO9H 1UKQA 1LNUB 3OXRB 1FHGA 2ITCB 2W91A 1GGCL 2N56A 1ZVSA 4LASL 1K8IB 1E6OL 4OUUA 2JK5B 1M7IA 3CFKA 4OCRL 1E4JA 2VLME 4LSUL 3PHQA 5CMAB 4W4OA 4JY4B 1Q72H 5KS9A 3LKRA 3ILQC 3EJJX 1KPUA 1RUPL 1GGUA 3KLDA 1DBAL 4WUKL 4ZOAA 1OP5H 3EOTH 4ZFOL 4JRYE 4L3EA 5DJ6A 3PJSA 4HWBL 4QNPF 2BERA 5LG1A 3NPZB 3OG6B 4JR9H 2OI9B 4TQEH 4GRLC 4K7FB 4GRWF 1FN4B 4Y1AE 4HUVA 5TQ0L 3ROLA 2NY2B 3QUZB 5DWUL 3RUGF 3RA7H 4JM2A 5EWIL 1GZQB 3K7UA 1PX4A 2VR9A 4Z7VE 2D7PA 2W1NA 1MF2H 2IFFH 1K8DA 1NGZB 2E7BA 4HC1H 5KVDH 3MV7D 1I8LA 5I8CA 5F9WC 3BHBB 5E2VH 3ME0A 5JPNA 3EYFA 3QIUD 5E2JA 2VISA 2Z8RA 3OKEB 2K3TA 5ENWB 3ZKXB 5KJRH 2F53E 4J7RA 4Z0BH 3ZT6A 3FN0L 1IKNC 1EO7A 1HIMH 3LQMA 4UNTA 4Z7VF 2DTMH 4QXGH 5F7WC 2EH7L 3WS3B 1NCDL 3MCG1 4WENB 5IVNA 1EFXB 4OLVL 3NTCH 1EZVY 1CCZA 1SM3H 2NXYD 1S9XB 3VFRA 5JNYB 1X5AA 1IGFH 5IBUG 3HRPA 5IQ9A 4HUKB 1CXHA 4XVTL 4YDKH 2FGWL 2FX9H 4WDIA 4PGEA 4PJXF 5HHME 5C0CE 1NLDH 1T80A 1X5LA 5L8JB 1FLRL 1DL7H 1QYGL 4JHAL 1NFDE 3HUJB 4KPHL 4XAKE 5C09A 5JPMB 4FQ2L 5CGYD 2YEZA 4Z7UF 3UTZB 4Z0XA 1DLFL 3P0VL 1CGWA 3ARRA 3KPLA 3QUXB 2VXSL 4GRWB 4MAYD 5HTSA 1DQJA 2HT4D 5DUMH 2DJ4A 1PY4A 5EU6B 3NA9H 5SWZE 4KROC 2BRQA 5CEZE 2NCMA 2JLLA 2V17H 3HC0A 3WFDL 1ZSDA 4XB8A 3ZYIA 3RWJA 5BOZG 3BZ4A 3RQ3A 5B39B 5E2VL 2QSQA 4K7PH 3PGCB 4QHMB 3JUZA 3VJ6B 3O2WL 4U7MA 3BW9A 4F7EB 2CK0L 4NC1E 1DR9A 2CD0A 4XC3L 3BPLB 1CGTA 5HHOB 1H3UA 2IFGA 3ZE0E 3L3OB 1FGNL 4X80H 2VE6B 3ILPB 1NLDL 1FRGL 3HCVA 3HZMA 1MFNA 1G7IB 5FKPA 2R0LH 4ZDHA 1AKJA 1F11B 2VXTL 3S5LG 5ITFA 1LDPL 4U7KA 4BQ9A 3A6CH 4NN6B 4NZUH 3U4EB 4FFYL 4N0UB 2FJFB 4ORGA 2FBJL 5E94A 2V7HB 4GBXA 4NQCE 4OKVB 3INUH 1BBJA 3WDJA 3UBXI 4GMSL 1EEQA 4CW1B 5C07A 2QQKH 1IEAA 4NO2B 3QCTL 4Z95L 4M9PA 5AZ2L 3VW3H 3IDNA 2ZUQB 1MJ8L 5HGAB 1S3KH 4JGUA 3HUJF 2D7TH 1UM4H 4OI9A 2F8XC 1T6WA 5J3HD 2AV7B 3O4OB 4R9HA 1KCRL 1ZGLA 2RGSA 1RZ8B 1AD0B 3BKYH 2NY4C 3O3DB 4DGIL 3S5LB 3F6LA 3I6LD 5H94B 1IGTA 3UZVB 3GMRA 3NH7L 3TBWB 1C7SA 4K71B 3IFPA 4O2FB 2CDGA 4AENB 3RHWK 3UTPD 2Y25A 5JUEH 4PLJD 43C9A 1DANT 3O6FD 2VOTA 1UH2A 5F6IB 3DRQB 1RUAL 2X4SB 2VABA 5ADOL 1NLBL 1S9VB 4P57B 5FHBL 2PYEE 5BS0D 5D2LA 1YUHB 1P4BL 1IAKB 3DXAE 4XPBH 5DQJB 4Y5XB 1GCFA 2OZ4L 1H15A 1B0RB 2X4UA 5E6IB 5AZEL 1CE1L 4N8CH 1FFQA 4PLKD 1VENA 5DMIL 3ARBB 3HZYB 4UBDC 1QNZH 3P4MA 4RSVA 3VXUA 4L3EE 3ZYOA 1OAZL 5FYLD 2LU7A 2Z91A 4NRXA 1C5CL 2I60L 3O11B 2R2HA 1I1AC 3ZSTA 4OCYL 5GRVL 3NZ8B 5DJ2A 4HBCH 4D8PB 5EU3B 5E7FA 4W68A 5C6TL 5I1JH 2P8LA 2OMBA 1ZHNB 4WV1C 1IJ9A 4XTRD 2Q6WA 3QZWA 4D0CA 5IJVB 1KLGB 2R29L 4OZIB 4MA8H 4BKLB 3BRGC 3QDME 5MEQA 2A0LC 5I1EL 2HG5B 1J0IA 4M6ML 5M7QA 3RZCD 1HH9B 5TE7L 3L9RA 3VI4F 2Z8WC 1Q9KA 3F65A 5DFWH 1OAUL 3X11B 2VUYA 4AEIL 4XPFH 1AGBA 1IQWH 4EKXA 4OLUH 4MB5A 4I2XB 3U48A 4B0MM 3KPSE 5DFVD 1NCWL 1R3IH 3VD5A 4PUBL 2Y72A 4R4BB 5DA0B 4MNHB 4GRMA 3GRWH 3D3VA 5I2IA 3BZFA 3L3JA 4KV5F 3BVNA 4BSWB 4HIIA 1R5VB 4AM0A 4GKSB 1KYOJ 4QTHB 4Z7QE 5E56A 2AXHA 1F6FB 3P77B 3IJHB 5JDSA 3TIDA 4JDTH 2YKLH 1N7ML 2EDQA 5HHNA 3FFCE 1S5IL 1U58B 3X3GH 4NRZA 1AH1A 2AS5M 1W72A 1T0MB 3BN3B 1HN1A 3I2CH 3HC4L 3DX9B 4R0LA 1VACA 3SEPA 1YJDC 2DOCA 4LSQH 4XMLL 1L0XA 5F96H 5F89A 4MXQC 1A7OH 3DHMA 3RRQA 3PL6D 1A9EA 2Y23A 4PP2B 3ARFD 1BJMA 1Z9OA 1ZGLP 4HZLB 2VDQH 1HEZA 3NA4A 3C60D 5GJTL 4GUPA 2W9EH 3UJIH 5A2JH 1VFBA 3PWVB 4MWFA 3HZVA 4I3SH 4H1LA 4YBQC 4U1NA 4LLYB 3FO9B 5DSCB 1E4KC 1K4DA 4ZS6D 4ZSOE 5IB1B 2Z0BA 5DD0L 5FYKU 4ZAKB 4IDJL 2IEPA 2BMKA 4NPYA 3ARGD 4Y4KB 5DMJB 1RHHA 1YEHL 1EK3A 4BFIA 3OKOA 5DFVC 4ONFL 4D9LH 2R56H 4UINL 4K3DL 5J1TC 3L7FA 1XGQA 2B20A 5IW3A 2X7LB 4QYOB 3FHQA 3UJTH 1G7LB 2XTJC 3U79A 1JNHB 1FPTL 4HK3N 3QXVA 4OGAD 7FABL 1QFHA 1VFUA 1XIWB 1MY7A 3I85A 1MVUB 1EEZB 1XF3A 4CAGA 1IVLA 3RY5A 3E6HA 3AY4A 3MLSH 2DQFB 3FT4A 1ZA6B 3IDYB 3ZHDA 3MMEB 4QRUB 4LSUH 4WV1B 3IJSA 5D96C 3HMXH 4YFEA 1PSKL 4WU7A 2AP2A 4JM2D 5GS1A 1ZK9A 2M8XA 2P5WE 3I3EA 3UTTD 2UWEB 1KCKA 4PJGE 3RVWC 2KZ1B 5DJCA 5EC1A 4DW2L 4ACPA 2JELH 1I1YB 1MVFA 4DKAA 3NIDF 2BHUA 2GFBA 4JGMA 3B3IB 1QA9B 4M4PA 1KEGH 4JFPB 3VXNB 4PLKC 3WBDA 3U0PB 1U8NA 4DGVL 5C6PB 1Y0LB 1B9ZA 1M7DB 2YMXL 3MRDA 2PYEA 5T3XE 3V6FA 2IQAB 3OGOE 4L8BB 3LKSA 1F42A 3CVHL 1MI5D 2XTJE 2BOCB 3F7YA 4NM4H 3VFWA 3L1OL 3WIFA 3C5SA 4QXWA 3ARGA 2OQJB 2R0KH 2UZXB 4JY6B 1NKRA 4EI5C 3GMOA 4XPHH 1CG9A 1DQQA 2I25N 4YPGA 4LNRB 2EIEA 5ICZB 3KPMA 5EO0B 2XA8L 3EJZD 5KN5B 1OTSC 3T4AB 3CX5K 4HGMA 2D31A 3PDDA 4YBLC 1TZHA 3TT3L 4TOYL 2GW5A 2HFTA 1A22B 1VEOA 5GRUL 5D2LF 2V7NA 2NX5E 3O8XB 5B3NA 4YXKH 5D8JH 3O41B 1G9MH 5DK0B 5ERWA 5A2LH 1P7QB 2P24A 1QVOA 2PO6D 3G5YB 2PCPB 3T3ME 1QPPA 5FM5O 1IC4H 3FRPG 2JJTC 3SQBA 1MEXL 4JB9H 3BT2H 3WCYA 4K8RC 4KGLA 4MD5B 3QZWG 2VLLA 4EN3B 4ZFGL 2CO7B 3I6KA 4MDIA 4DQOH 1MCIA 3MRCA 5D4QA 2UZYB 3ULVC 2YD1A 4G6AD 4RMUA 2OBGA 3P9MB 5IV2A 1T22A 4L8DA 4QRRE 3GJFB 3FB8A 1RZIA 3JTSA 3BP5B 4R2GD 4C4KO 1MCOL 3VXPA 3T1WA 4WNQA 3D39D 2ADGA 1WGOA 5BO1H 3S36X 4WWKB 5F7YC 4M48L 2DWDB 1WK0A 1N8ZB 4JZNA 1QFWH 4P2YA 4TUKL 1IAMA 3MYZA 1I1AA 4YGVB 3S6CA 1RJZB 3MFGB 5F8RC 3LKOA 3EOBB 5T3ZE 3S9DB 2OTPA 4NNPL 2UVEA 2R8SL 4LSSL 5TGBA 1CGSL 3O6LL 2PTUA 5T3XH 1NGXB 3MRMB 2BNRD 4PJXE 4K2UL 4M5ZH 5BZWA 4JCMA 2EEAA 4TVPD 5GGVH 5BQ7B 2OL3L 2CRMA 1G7QA 2NTFA 1JWSA 3H3KA 2SEBA 2VDPL 3MJ7B 2DQTL 2AEPL 1G0DA 5LQBL 2DLTA 4F9PA 4N8CL 3S4SA 3DUSA 4OD3L 1KIRA 4JFFA 3GIZL 4YXHL 3C6LD 4HUNB 3REWA 2WWKO 4R2GC 4NHUA 4ZD3H 4HHAB 3T0EB 1AHWC 3W9DA 4QXUL 3WUWB 3AC0A 2NY6C 5D5ME 4K2UH 4HUWA 1K3IA 3HRZA 3ZE2F 4WI2A 5I9QC 3FO1B 4OLWH 5D6CA 5HYSG 4U3CA 5E8OA 3D25B 5DT1H 2B1HL 5HI3C 5IB4B 2VMFA 3RVXC 1ORQB 4OGXL 1GOGA 5E6IC 4LAJH 3WUZA 5GZND 1V3MA 2ICES 3JSSA 1JGVL 3I84A 3SKOB 4Z8FL 4M1CD 4HUWB 3DX7B 2V2TB 3LAFA 5IESL 3WUWA 3ULUD 4XX1E 1YY8A 4UNUA 2DQGL 4Y88A 4NQDA 4UOJA 4NHUB 4CU8A 3BD4A 1NAMB 1T3FB 1IQWL 3WXVL 5HGHA 3TNMA 3REWB 5TF1H 1T03L 4XP1H 2FH8A 5I76A 4RGOL 1DVFD 1OAQH 2UY7A 2EO1A 5I71B 2ZUVA 5IT2H 1DQDH 1CDHA 3VWKD 2NNAB 3VRIA 4MQTB 2NTFB 1G7QB 2P5EE 4XBPB 4YO0B 5E08L 5BZWB 3NAAH 5IGXH 3O9WB 5DFTA 1JUFB 2DQEH 1NGXA 5IIEB 1YEFH 2A2QT 3H9HA 4U2YA 1UZ6F 3AB0B 2G60L 4RMWA 3Q5OA 4Z7VB 5BVJB 3RY4A 1IGFL 1YY9C 1N8ZA 2CMRH 1TVHB 1WC7B 4BZ1H 3Q48A 3WEXA 4WWKA 5F7EH 4XVJL 2NY6D 1OPGL 2O93L 4XBEL 4RA3A 1E4XL 5HHVH 2AJZA 3K46A 5GS0D 4L8DB 1DBJL 1MELA 4UDUB 1ZE3C 4MJIB 4P5TB 4NUGL 4XPTH 3RWGB 5CZXD 5GGRY 5I30L 4G8GA 3J8F7 3SY0B 5BMFH 1JNLH 4PR5A 4UTBH 3GSNH 1DVFA 1G6VK 5CILL 1YEJL 4RRPA 4FQHA 2AJYL 3ZKMC 3CVHH 5IESH 1PLGL 43CAA 2EH8H 1ZLVH 2YA0A 1MJUL 5L2KA 2X4PB 4JO2L 4U4BA 4KY1H 1JPSH 2P24B 3KJ4B 4HUXB 2YOCA 3O41A 4HS3B 4QHUB 3BOVA 1U2CA 5DO2C 2WZPD 4UV7H 1MWAL 2BVQA 3WO4C 4R96B 3TO4D 1NCAH 1P2CA 1MIEH 5FOJA 4OF3A 5JZ7D 2P43B 4KK9C 1OP5K 1L6ZA 5EUOF 5F7LB 4K71C 5IEHA 2LV4A 4AIZB 5GIRB 4KK6D 4IIQC 1BIIB 3HMXA 3LKQB 1T2XA 4QRRA 1PSKH 1XGTA 4NYLB 2JJVA 5CAYB 3HMXL 2YPKB 6CGTA 1B2WH 5I30H 5MENA 3OBAA 4ZFGH 3T4AA 4MB3A 4MXWH 4XHQA 4JVPA 3VGGA 1FP5A 1HHJB 4M1DL 4XXDA 5HY9A 4OCRH 5I73C 2IMMA 2W38A 5EO0A 2I5YH 5I75B 4YPGB 1QSEA 5I6XB 3D9AL 3T0VA 3BDBA 2W9EL 1HINH 3GMOB 2HN7A 1E4WH 1JIBA 2G5BB 4KI5E 1KN2L 1RFDL 3MLYL 2OQJA 4KZDH 1FL6B 4ONGH 3C5SB 4KMLB 1KB9K 5D2NA 3V6OE 4OF5A 2B2XL 4YXKL 4ZUVA 4P2QE 1KJ2L 4UB0H 1NC2A 2LU3A 2D03L 3V6FB 2JJSA 2VDRL 1VA9A 4GXUM 1U8NB 4JFFE 2VDML 3S3SA 1TXKA 3BP7B 2ZSWB 3MREA 1XIWD 3CDCA 1OWRM 4JKWA 1A7BA 4YNYA 4JO2H 1DE4A 4V2CB 4I3SL 4YR6A 2VLKE 1OB1B 3L95A 2DDQH 3IJSB 4QRUA 4WV1A 4TTDD 1D7FA 4W6YB 4YJZL 3NZHL 2YSSB 2APXA 3AS0A 3CCHA 3E6HB 3NZHH 1QBAA 1BF2A 5FK9A 4KVCH 2VXQL 1EEZA 3C9NB 4ZTPH 1I3RB 2OP4H 2AJXH 2Q20A 1JNHA 3G04A 3LQAH 4QYOA 2X7LA 1MHPL 1FNSL 1ZTXL 3QEGH 1NBYA 4DEPC 3QJFA 1XGQB 4PJFB 3L7FB 4ZQKB 5IW6A 5J12B 1GOHA 5I66A 4IRZH 1TTUA 1UXSB 2VDLH 3G6JE 1QRNA 4BFIB 2DJSA 4GAGH 3KLAB 1HHGA 1RIUL 3OJ2C 4NPYB 3IYLW 5C9KA 4L3AA 2G2RA 3HA0A 4WW2F 4NQCD 3U82B 3WDIA 1T66D 3MUHL 2VQ1A 2AJXL 3FB7B 2R4SH 2JIXB 4EDXB 3VDAA 1K4DB 1NDMA 1NUNB 5HI5C 1WBXA 4XMKL 3UZQA 4U1NB 1T21B 4L1HA 4ZXBA 3PWVA 4MWFB 3HAEG 1X3DA 4RGOH 2W60A 1MFEH 5IMOA 4GUPB 1YMMD 1HEZB 2Y07H 1G9NL 2VERN 4LHUD 1WVZA 3UJJL 3HLAB 1LO5B 3BKML 3I6LE 1V3LA 4XRCB 4M3KB 2VSDA 2B1AH 5MERB 4R0LB 3SOBL 4OZHE 3C5ZC 1ED3A 4NRZB 1AGFB 5I1KH 1U58A 2ITDB 1Q9OB 4FXGB 1CICB 3JBG7 4U1KA 4F7CB 3KXFE 1FVCA 4UOW1 1EUTA 4GKSA 1EA9C 2PNDA 5HPMB 3BVNB 1QRNE 1D6VH 4JG0L 2EE9A 4P99A 4GRMB 5I2IB 2OZ4H 4R4BA 3IRPX 5INCB 3IGAA 2RR3A 4JN1L 1EFQA 1SYVB 4QXUH 4PJCF 2EDJA 1T1ZA 4K23H 2C3WA 3H9SD 3X11A 5H35A 2CGRL 2J4WH 2YUXA 4I48A 1DJSA 5F7HA 1KB5A 1A6WH 4LAQH 4XAWL 4A6YB 4MJIE 3VI4E 5BW7A 2EO9A 3O4OC 4BKLA 1WF5A 5T1LA 4OZIA 1NAML 3V5KB 1MCKA 4I18C 5HYJD 3E3QC 3VGFA 1K85A 2Q6WB 2CLVA 3IS1X 2P8LB 4LKCA 1A14H 1N4XH 5DO2D 5EU3A 3NZ8A 3WLWD 5DLML 4Y2DA 1YPZB 1AKJD 3ZHKA 3P4MB 1YEIH 1AO7B 5AWNL 3HZYA 4B53A 4O2CB 1KIPA 3CFBA 3BX7C 4GAYA 3WIIL 4CKVX 5IBLD 3MPCA 4Y5XA 3D69B 1VADB 3LS4H 5DQJA 3K8KA 4NO3B 3LS4L 4MA1C 5LCVL 2VH5H 1IAKA 1T03H 1ONQA 1JZ3A 1YUHA 3OAYH 4WUUD 4XWOD 3ZTNH 4K3HA 1QQDB 1A0QH 1OSZB 4ELKA 1FZKB 1L7IH 2ZPKH 3QCUH 5DLMH 3CX5J 1WZ1L 2XPGA 2ZWLT 1IARB 3PDOB 1K5NA 1P4LA 2CMRL 4P2RB 2EC8A 5DF0A 5AAMA 3NCYS 3CK0H 4FQIH 2CDGB 3U9PH 3IFPB 2I60H 1I9EA 2CJUL 3QI9B 1IGTB 4W4NA 5C0DB 5A3IC 2RAMA 4HDIB 1U8KB 2IGFH 1C16A 1F3JA 3PHOA 3QQ9C 5HDOA 5IEKB 4M6OH 3GSOA 2OYPA 1FFPA 2F58H 3MV8D 1EXUB 5TF1L 5HGAA 2DIAA 4LVOC 2OCFD 5HHMD 5C0CD 4X4MA 4UTAL 4GQ9H 1N64H 1TJGL 1PAMA 7FABH 3GKWH 1T20A 2CRIA 5F93C 4QWWD 1BBJB 4YHZH 2YUVA 1FORL 4BFGA 4HGKC 1G6RB 4P5KA 3VWKC 4YDIL 2V7HA 3SCMA 1IAOB 1MCPL 1F13A 3IFOB 2FJFA 3FMGL 4S1DD 3CIQA 3SKNA 3T08A 3U4EA 3U83A 2EIZA 4P4KC 3TBVA 1FFOB 3SJVE 1CU4L 1F11A 1SJXA 2AABH 2EDHA 4HC1L 4YFDB 4H88L 3LD8B 4A6YH 1PGRB 3HZMB 4WGWB 2HJKA 1YMMB 3ILPA 3Q3GA 4BH8B 4YBHA 4PJBE 3ZE1F 4KKLC 1U3YA 5HHOA 3FB5A 2D0FA 3IKKA 3TYGL 2FYYB 3QNZA 3PGFH 4F7EA 3KJ4C 1KCSH 4GW4B 4NN5B 3GSUA 4WCYH 5E2TH 1HIML 3O81A 3Q0HA 3BZ4B 5K9QG 1J9CT 1N0LA 2BX5A 3F58H 1J8KA 3S37L 2XZZA 1UB5B 5EZIL 3C6LC 1KTDB 4LP5A 4WI6A 4M02A 3QXAA 3QUXA 4N9GB 1EJOH 4XC1L 2IPTL 3DI3B 3V6ZA 1KLUB 3UTZA 2YEZB 1YN7B 2PW1B 4GAGL 3OJDB 4QHLB 3DYOA 1VEPA 4NKDB 4M1GL 2E8ZA 3VFSA 5IKCB 4PGEB 4R90L 2EE6A 1RUMH 5C2BL 2Z8SA 4XC3H 4JM4L 1IM9B 3KG5A 3TFKD 3V6ZB 5HHOD 1CGVA 4JKPL 3DJ9A 3T3PF 2DL9A 3PWPE 2WWMD 5JXED 2OTUB 5GGTH 3DUUB 5CHNA 1Q9LA 5CJOL 3FT3B 5CJ5A 3OB0K 2XA8H 4KJWC 5E2UH 1KJMA 1JMZA 1KJMB 3FOLB 1NBQA 3QCVL 4GW4A 4YHKL 3QNZB 1MJ7H 3HNTH 3DUUA 3QG7H 5JR1H 2OTUA 4YBQD 4CN1A 4R4FL 2NX5D 3Q3GB 5ANME 1RSFA 3E2HB 5JW3H 1A3RH 5FCUL 3F12B 5I8CB 2HJKB 1FC2D 1CL7H 4XHJD 1QSZA 3O9WC 5KANI 5ALBH 1GPOL 1X44A 3QUXD 3TT3H 5IHUL 1GZQA 4M6NL 4HFUL 3B9KC 5CJBA 1SM3L 2Y06L 3IFOA 1DBMH 5SV4A 3ROLB 2OK0H 1CE1H 3SCMB 4NKDA 4NZTL 3OJDA 3ARDD 4QHLA 4PJDE 4OZFA 1G6RA 4P5KB 1KLUA 4PGDA 3O2VL 3PJSB 3W9EB 4IS6B 3WIHH 4LSTH 4JREB 2D9CA 2OP4L 1WBYB 2X5PA 3HC3H 3T3MF 1JYVA 4JY4A 1R5WA 4P5TC 4E41D 5C0RH 2IC2A 3QDMD 4PIRF 5EBMA 5IBTL 5I8KL 2ED8A 1M7IB 3CFKB 4TULH 4OI8A 5JZ7C 3GSOB 5IEKA 5FCSH 3QBTB 1F3JB 1CD0A 2ITCA 4F15C 4H20H 4YBLB 2FYYA 4NBYB 2AI0H 3FB5B 5C0DA 5B38A 4WO4D 2ZUSA 1IM9D 5CKGA 3KLHD 1YMMA 3RAJL 2HTKD 5KVFL 3WFCH 1KB5H 5JA8B 1JGLH 4C59B 5FM4A 2A77H 1CLZL 2X42A 3HI5H 3JUYA 5GGQL 4P9MH 5HGDB 1FZKA 3QCTH 4ELKB 4C58B 4HQQH 2CO6B 3ESVF 1IGYA 2AEIT 5FGCB 1T20B 3WKML 3S3JA 1X4YA 4ZUUB 1KOAA 1KXVC 1RUKL 4CMHB 5JOEA 1XH3B 4XXCA 1EXUA 4Y2DB 3QUZC 4Z7OE 4P2OA 1Y6KR 4O02H 3PHOB 3FZUC 1C16B 2AABL 4G5ZL 1BFVL 4HDIA 4LHUG 1KJ2B 2CLVB 3LY6A 5E6YA 2F19L 1N7MH 5TFSL 3V5KA 3QI9A 4G6KL 4LMQE 5FYKH 1VDGA 2XY2A 4KQ3H 2NY0D 3ULUE 4F9PC 1NMCC 4I0PB 3GHEL 2XKSA 2W9LA 4A6YA 3FB6A 2B4CC 5EBGA 3N1QC 1OAQL 4I48B 2V9QA 1HNGA 4P2RA 5BVPL 3GKWL 4UDTA 5DZNA 3SDAC 5CILH 3GSNL 5J11B 1T1ZB 1F4WH 4HKBA 3K1DA 5D1ZC 4MS8D 1QQDA 1SYVA 4CVZA 1I9JH 3V0WH 2ZG2A 3CDGA 1LO3H 1VADA 3MNVB 1BGXH 3ARYA 1KCVH 4GAYB 1ZAGA 2MNUA 5I1EH 2FIRT 2HKFH 5I16B 4AIOA 4OD1H 3KHOA 4UIKL 1AO7A 3K2UL 1I3VA 2GJJA 4P46A 1CICA 4YPJA 1IM3A 1Q9OA 4FXGA 3TESA 4JZOB 5I1IH 1AGFA 1ED3B 1XGYL 3UTTE 3B9VA 4LPWA 5IBUB 3WKNA 1I3GL 5MERA 5F71A 2O5YL 1DSFL 3P0GB 3BPNC 1C5CH 3NTCL 1S7UA 4HK3J 5DJZA 3EYQD 2R69H 2YC1B 3DX6A 5KG9B 2UWEE 3SE9H 1KB5B 3O6KH 2W60B 3VRLF 1W72H 2VYRE 2WV3A 4L3CB 5ALCL 4K7PL 4ZXBB 2EE2A 2Y5TB 3AS2A 1T21A 1TCRA 1CFVL 3N85L 4EDXA 4OSUL 2Z8VC 1AGEB 1IT9L 5INCA 4MCYA 4R6UA 3BO8B 3PL6B 2I07B 4F58L 4HEPG 1RZFL 3MLZH 3HZKB 3DGGB 2FNBA 1HHGB 4M8VA 1CFBA 5DRWB 1FVCB 1UXSA 4F7CA 3LH2H 5I66B 3SDXE 1Y6NR 4U1KB 1FYTB 3VCLB 3QWQB 4ZQKA 3QJFB 3DBXB 2ITDA 1NBYB 1UJ3C 4XCEB 5J9PB 4KHTL 4LSVH 1G6RL 1KG0B 5D7JB 3O9WD 4XRCA 1RZGA 2IANE 3C9NA 1MCSA 2Q86A 1UCBL 1Y6MR 3S37H 3EOYG 5F3BB 1WZMA 1JGEA 2R2BB 4MYWB 4TN9A 2AK4B 3CNKA 4YR6B 4BUGA 4M1DH 1CFNB 4X4XB 4DK6A 1R0AH 3LOWA 1RJCA 1EMTH 3GUTB 1WBXB 3BDYL 4K3EH 5DVNA 3WNKA 5ITBH 2ZSWA 5GGTL 4GG6B 3AFLA 1T7VA 2W0PA 1QBML 1YEKH 1J86A 1AR2A 4LSDA 5LGKA 3RGVC 1LE5A 3B6SA 5GRUH 3VXOB 1YYLH 2G2RB 5L9DL 4MCZA 1G9NC 4QRRD 3KLAA 4KK6C 1NC2B 2WBWB 3VH8A 1INQA 4MSWB 3ULVH 3CFIC 4ODUA 5D2NB 2XACC 4BSJA 1UM4L 3NCMA 2D7TL 5CFHA 4YC2C 3QUKA 2AJVL 1EMTL 1INEL 1MFEL 5BV7C 5T3ZD 5ISZD 4OJFL 1I3RA 5T3ZL 4XXDB 5HY9B 1HHJA 4OQTL 5C70A 3MV9A 4ENED 5MENB 5FK9B 2VQUA 5JXAH 3KR3H 3IDGA 5EPMA 1BIIA 1NH6A 3LKQA 4N0CD 1UM6H 1FG9C 5GIRA 4AIZA 2HMIC 3CJJA 4PJ9D 4JCLA 4EBQL 1BF8A 5IEHB 1DE4B 5IG7B 1DFBH 1GOFA 5DJAA 2R0LL 4JO4H 4X5WB 2ZNXA 5EA0H 3BP7A 4AJ0A 4HLZH 4HS3A 1NGPH 4QHUA 3HUJE 4OLZL 4GBXD 5IHUH 1ZVHA 1JRHI 4XNZB 3OX8A 4P4KA 2VL5B 4MVBD 4EVNB 3SO5A 2OJZH 43CAB 2RBLA 4GT7A 4PLOB 5A2IH 4ZUVB 1YY9D 4TTDC 1MQ8A 4FQHB 3BPOC 4KKAD 3EJYC 1DVFB 2APTA 2ZNWA 4GXVL 4NBXB 1A47A 2ZG3A 4EDWL 1QFUL 4NZJA 2G5BA 2HN7B 4XP6L 2WM0A 3BPLC 5F72S 5E1AA 3KGRA 2NY0C 4UDUA 4P59H 3MNZA 4RFNC 1NSNH 1I75A 4NWTH 5CLTA 1T89C 3MRJA 2R0KL 4XMPL 2ZCHH 1FLRH 4NCC2 2YPKA 2F8OA 2UUDK 3WEXB 1RQ5A 3TPUB 4PJAF 1OP3H 5J12C 4Z7VA 5BVJA 2BY0A 3RL2B 4FABH 5KZCB 3EO0A 3OKMA 1P2CB 3RVXD 1QSED 3H9HB 1CBVH 2EXWD 1VFAB 5GRZA 5L7XL 3O9WA 5CIPH 3S7GA 4HUXA 4XBPA 2QHRL 2P5ED 1JGDA 1QLEL 5I74B 4CRPA 4OZ4B 3SQOH 4O02L 5CJXC 2JF1A 4LF3B 2J4WL 3OKKA 3BKJL 3DARA 4UQ3B 3H9SE 3RDTD 1WEJL 3RX8A 3TNMB 4TPRH 4Z7UE 4PR5B 2HJFB 4J12A 3SY0A 2VDNH 3LZFL 4HIXL 4JN1H 4NFCA 2YPVH 3CAFA 4L5FL 3DX7A 3UDWA 4P5TA 2V2TA 1MPAH 2BSTA 4BK4A 2LE9A 4OCXL 2J12B 3QSKB 3GJFH 1HQRA 4LQFH 1LHZA 1UA6L 4IDLA 4KRMB 1N3NA 2DWEA 2Z93B 1PY9A 2VLRE 4PJ5B 2PTVA 5FYJE 5J0BA 2RHEA 3TEUA 2F19H 2R56L 1WC7A 3ZDXF 1TVHA 3TZVC 3V9FA 1MRDH 5I1KL 1S9YB 1JPSL 2W65B 2ATKA 5FECA 2EIBA 3MLXH 3HKFA 3WJJC 2B8OT 1X7QA 3HRZB 2Q76A 4PRPB 3LQAC 3S34L 1E28B 1P84K 4YO0A 1RUPH 4NKQB 3U2SB 1IGMH 1OGAD 3VRIB 3S88H 1OAUH 1XIWC 4PRDB 1MFAH 1RPQA 4WFGE 3V52L 1FSKC 1U8PA 4U33A 5I76B 4H26A 2IBZY 5CZXC 1TQCC 1OLZA 2C26A 3TA3C 2DLHA 1J1PH 1NAMA 1OPGH 5IVZA 1TIUA 2SEBB 3U2SA 4O9HL 4NQDB 5F9WB 1SY6H 3RP1A 5BQ7A 1YY8B 4PRPA 3RUGE 3ZYJA 5D7SL 4UNVA 1X7QB 2LTQB 3SKOA 3WFHA 3ZDXE 3ZE2E 4ELMB 2OXHA 5D5MF 4U31A 2ATKB 5FECB 2W65A 2NY2D 4HT1L 3M17B 2HKHH 4OI7A 1JNNH 4O5LL 1ORQA 4OD1L 3MV8E 4JDTL 4Z78A 3T2NL 3D25A 4PJ5A 3R1GL 1JVKA 3EKCA 3CK0L 5E8OB 5SX4I 2DWEB 2Z93A 5D6CB 2Q7YA 1HQRB 3JTSB 4Z76B 3FO1A 3FB8B 3B4NA 3EDJA 3P9MA 5IV2B 1G7JB 3HNVL 4Q0XH 4LRIC 3W9DB 3GBNL 4HHAA 1P7HL 4MDIB 3UBXG 1A2YA 1EGJH 3I6KB 5DRXA 4EN3A 2HJFA 2YXFA 4MD5A 1TJHL 1VFMA 2P4AB 1KIRB 1NCTA 1D9KD 4JFFB 4UQ3A 1XAUA 3OKKB 3DUSB 3NVQA 4OZ4A 3G5YA 1DTUA 4KQ3L 1JWSB 2BJML 4JFOA 1JGDB 5CINH 3GI8H 3VA6A 4MVBC 1VFAA 1UKSA 3O8XA 5KSBA 3OKMB 3GKZA 1PFCA 1RV6X 3LKOB 1MREH 3RL2A 1T66C 1KENL 3ARUA 4G3YH 3RU8H 1WLHA 4ZOCA 3TPUA 3BP4B 4PB9H 1MIMH 4OLVH 2EXWC 4HG4J 5J8OA 3BP5A 4CDGC 1RZIB 4UAOC 1T22B 5ICZA 4CUCA 2HLFD 5E1AB 4JY6A 2GSIB 3BH9B 4M43H 3ARGB 2VLLB 4NN6C 4HJJH 1RZKL 4K8RH 3GI9H 2DDQL 3O6ML 3CVHB 4L8BA 2IQAA 1F6AA 4C54A 4EVNA 1MCNA 4P4KB 2PCPA 4NC1C 3UBXB 1P7QA 3C8HA 3N0PB 1JZ2A 3JWOH 5DK0A 5L7XH 2GFBB 1FSKB 4OF0A 2IBGA 3ULVL 2V7NB 3PWPD 2AQ3A 5DJAB 1H3GA 1MJUH 1JTPA 1J5OH 5HYSA 1WCBA 3UC0L 2IPTH 5GS1B 5BZDB 4K8RL 3KYAA 1B4JH 4L8SC 3IDGB 5EPMB 5C0RL 2OXGA 3QB7C 1II4E 2DQFA 3RDTC 3L3GA 4YWGL 3MLYH 1KNOB 5DUML 2DLEA 2V5RA 2VXSH 1XIWA 5TF0A 5CJQL 1ZLVK 5KN5A 5F7FA 4LNRA 3V6OC 1IC4L 1VCAA 3OQ3B 4S1QL 4FFVD 2KQMA 3MLVL 1TETH 3KYKH 3WIFB 3Q1SH 1OGAB 3F7YB 4PJGF 4ODUB 2AW2A 1OAKH 3VH8B 1QLFA 1HWHB 3LIZH 5DGRA 4H88H 1M7DA 1A3RL 5FCUH 3B6SB 4RCAA 3U0PA 1LE5B 1X5HA 4LPVA 1KT2A 2EICA 1QA9A 3B3IA 2BHZA 3WE6A 1F4XL 4FMKA 4PJ9A 4GG6A 4XCFH 1I1YA 3QG7L 5JR1L 1GXEA 4OFPA 5DSCA 1F5WA 1ZTXH 3GUTA 3Q6GL 4LSRH 2KZWA 1KBGH 4XNYH 2XRAH 1VFBB 3TJEH 1JGEB 2CUMA 1GL4B 3BAEL 3KR3L 2R2BA 1L9NA 4C57C 5SWSD 3MMEA 4GH7B 1A7QL 3WLWC 3FT4B 5F89B 4AEIH 5BRZA 4N1HB 1VACB 4GBXC 3VXRD 1G7LA 1T0MA 1KG0A 4GSDH 1DQLL 5J9PA 1OOAA 3L5JA 3QEQE 4MAUH 3P3YA 5E99H 3OKOB 5DRWA 3EAKA 4DFHA 1JGUH 5GS0C 3P77A 1RHHB 4QTHA 4D94A 1N4XL 1R5VA 4HIIB 3HR5A 3P73A 3SBWC 5JQ6L 5D7LA 2BMKB 3L3JB 5CCKL 4MNHA 4OCYH 2I07A 4MCYB 3BE1L 5C0ND 1D5IL 5IB1A 1CGYA 1AGEA 5DMYA 4U0RB 2HJLA 5CGTA 1BWMA 5BS0B 3FO9A 4U3XA 4LLYA 1EVTC 1Z9LA 2BY1A 3HZVB 1Q9KB 4R97B 2UWEF 5FF6B 4L3CA 5CP3A 1KEMH 3B8SA 2VLKB 4JHWL 1XT5A 4XCYA 4L4VD 3SE8L 4EUPH 2KH2B 2F5AH 2DD8L 3BESR 4ZG1A 4Z7QF 1ULVA 5DJZB 3TWCL 1S7UB 1YECH 3LVEA 2HH0H 1FH5L 4D0CB 4S10A 1U9KA 1URLA 4XWGL 4JZOA 2R2HB 2AGJH 3O11A 1IM3B 1HHHA 3CMOH 4L9LB 1NC4B 3N1GC 4X6BA 1NMAL 5JDSB 3C2SA 4IIQB 4F9LA 3NFSH 4XAWH 4FOMA 3BZFB 1U8LB 3L5HA 3RY6C 4WHCA 2YPVL 1KULA 4CVZB 5GJTH 4P57A 4I2XA 1AGBB 1W0WA 2X4SA 3GEWB 3LEVH 4WI9A 4P46C 4HWZA 3WKMH 5FFLA 3DRQA 3L9RB 3W2DH 3U1SL 3OL2A 1DBJH 1JPST 4XP9L 2HG5A 3TA3D 3MACH 3T2NH 3D3VD 3PGFL 5CS7A 5MEQB 1QLEH 4Y4HD 4YHMH 3OZ9L 4EI6B 3TBWA 3GMRB 4HT1H 4O00A 1YEEL 5IJVA 4FZEL 5DVMA 1J12A 1KJ2A 2CXGA 1ZHNA 3O3DA 1AD0A 4M03A 1PZ5B 4A6YL 2Q8AL 4K3JH 4KC3B 2G60H 3VGAB 4D8PA 4P2OB 5DJ2B 3QIBC 4XP5L 2ICCA 2BSSB 4PFEA 4NRXB 1XH3A 1CXLA 3IAQA 4OSUH 4LU5L 2HKFL 3JXAA 4PJGB 2EDKA 1VGKA 1A0QL 3IDIB 4ZUUA 2XY1A 1DQDL 5C07B 4CW1A 1H15B 2JB5H 3QFJD 4YHZL 4JG1H 5D2LB 1BD2E 1F8TH 3QUYC 4FRWA 4S11A 4KI5F 4MAYC 5HGDA 5L8KB 2VLMD 2ARWA 2H3NA 2D4FA 4LIQL 3ULVD 4P3CH 2R0ZL 4RMVA 3RI5F 1AKJB 5FYJH 3SGKC 1J0ZA 1EV2E 1WT5C 5B38G 3HCVB 3GZKA 3QQ9D 5D7IF 3FN9A 2VE6A 1JZ6A 5A2KH 2GYSA 2YXMA 5H94A 4DW2H 3FL7A 2AQ2A 4FTVE 3RWCA 5C7XL 1T2QH 1GPOH 4OTXH 1KCUH 5HVHC 2D03H 1FNSH 1I8KB 3BW9B 2AV7A 4KKCC 4QHMA 3VJ6A 5FXCH 4KKBC 1WAAF 3RWJB 1L7TH 1F3DJ 4PJ8A 5EBMB 5LAXB 3DVIA 5I15L 1R5WB 3IDNB 4MJ6B 1NCDH 1X5YA 1WBYA 4KJWD 2V5SA 4IS6A 4ZO9A 3KPLB 2WP3T 3W9EA 3SO3C 2IBZX 4PGDB 3AM8A 2YR3A 4OZFB 4UT9H 5KAQG 3G6DL 5JPMA 4OKVA 4WFEE 2VZSA 1BQLH 3V4UH 3LS5L 4ORGB 4E41E 3RVTD 3QPXL 3B2UD 4RGNB 2H32H 5ITFB 5GGRA 5GXBB 4Y4FA 1MNUL 2C4XA 5FKPB 3TC9A 2H2PC 3F12A 3VFRB 1S9XA 3NACH 4HS8L 3IT8D 3L3OA 3R8QA 3NABH 3OG4B 4UQ2A 5SWQA 5D71L 2EDLA 5B3JE 3RHWF 3AS1A 4PJAB 5DMKB 3H2WA 4ZOEA 5F7UA 4MAYA 4P23C 3WNNA 3S3PA 3FOLA 4HMDA 1IAIM 4XAKD 5B39A 4HJJL 3CLFL 3FT3A 1Q9LB 1ZSDB 2EDEA 5CHNB 2J5LC 2BZDA 3AUVA 5H37G 5F8QC 2ZKHL 3O2DA 2IJ0C 5EU6A 5GS1C 2E3VA 4J3UA 3THMH 3WIHL 4JFXB 1DQJB 4NZUL 3JV4B 5MEOA 3EYFB 4M7JH 3GHBH 5SWZB 3VI3E 3GBLA 5D93B 1IM9A 5E2WL 4Z0XB 1RZ7L 2AK4E 5C09B 3EDFA 1P5VA 3STBA 1MIML 3GSXA 4JM2B 5IKCA 4WDIB 2X9XA 3VFSB 5GHWL 1FN4A 5D2NC 3EYUH 4PJ5E 1YN7A 2PW1A 4NC2B 2PO6A 3AAZB 4FFWD 4L3EB 4N9GA 4ODHL 5D9SA 1MCCA 3QXAB 5F9OH 1YNLL 1P84J 3RGVD 2ZCHL 3LKRB 1EFXA 1KTDA 1OM3L 3HNTL 5CMAA 1UB5A 4D0BA 2A38A 2NY3D 4X7EC 2R39A 2YWYA 4H1LG 4LLAA 5F7NC 1C7TA 2XRAL 3GSUB 3ELAT 1T83A 4NZTH 1H8OA 1JTOA 3OKEA 2E8YA 3QUZD 2VISB 3H0TA 4OCLC 5ENWA 4DKFL 3TBYB 4RWYL 4BH8A 3B9DA 4LKXA 4HBQA 1KN4H 4OFKA 5JPNB 3BHBA 4HEME 5E9DB 4W70A 3HS0B 1NUDA 1LEIB 2NY3B 1MUJB 5K59F 4M9OA 4DVBA 35C8L 5FUOL 5MP6L 1JHTB 4OGXH 1FFOA 2EIZB 3NCEB 3TBVB 3SKNB 3C5JB 4YK4C 4WEMB 4HUVB 1IAOA 4K7FA 2V5YA 5IK3A 4HKXB 2ZCLH 4HXBL 1I7RA 2N4IA 1QKZL 2EEBA 4GRWH 3OWEA 4JRYB 3TLRA 2NY0B 3OR6B 1MCQA 3MOAL 2VLRD 1QSFA 3E6FA 3VWJA 2JK5A 1FFPB 1K8IA 1WBZA 1JGVH 1IC1A 1ZVSB 4PS4L 3QIUC 1JI2A 3WSQH 1LNUA 3OXRA 1U8KA 2H2SD 5FGSA 1FQ9C 3EDEA 1BVLA 4QLRA 3MCLH 2AGJL 4JDVA 2EXYD 3MUGA 3L3DA 5DK2A 5CBAB 1C5DA 3D2UB 5DT1L 1AFVL 2NY2C 4NNPH 4JR9L 1K5NB 1P4LB 3PDOA 1S7RB 2XPGB 3BQUB 3FMGH 2NYYC 3KNBB 3QXUA 1JNLL 3X13A 4OBSA 2A9NH 3CLEL 1OSZA 2X05A 2FB4H 3MACL 1ONQB 3SHSA 4ALAH 4NNXA 3GM0A 4GKNB 4NO3A 2VTFA 3QIBA 3D69A 1E4XH 2CR6A 4HIXH 4PBXA 1TVDA 4LCCC 4MA3B 3CFBB 2I9TA 2HRPL 3GSVB 1KIPB 4PJXB 1NBVL 4O2CA 2IAND 4PY8J 5F7EL 2EDRA 4Y8DC 4ZPVB 4HWEL 1MHCA 3P9WB 1YPZA 1NBZA 5JW4Q 4LARH 2IF7A 3ALXA 3O0RH 3X3FH 3OAZH 2NY5H 4XPGL 3FCTB 4LKCB 1KSRA 3R06A 5F1KC 4GMTL 4YDVB 3PGDA 5DJXA 3FT2A 3ARPA 5T1LB 2Y1VA 3QXDB 4PTUB 1LO4H 1IZKA 4P3CL 5EU6E 3TN0C 3PQYE 4RZCB 2ZCKH 2EH8L 4G8IA 5EIIB 1OTSD 1RJYA 2XWTB 3P0YL 3Q2CA 1AI1H 1JE6A 4LCIL 4PJCE 4JDZB 5H35B 4QHKI 4AH2B 3HE7B 3T0BA 1TQCB 1F8TL 2YPLB 3BIKA 4Y4HC 1ZHBA 1IAIL 1KUMA 4J4PD 5C0BB 4POZD 3S37X 1I4FB 3IGAB 1OAYL 2C3GA 5IW1B 4JPKL 5HPMA 3SE9L 1QYGH 4JHAH 1YEIL 1JHKL 4JANA 2BK8A 1YC8A 2W9DL 4IBLT 4RFEB 2VRAA 4M6NH 2QQQA 2AKRA 1OTUD 5TE4H 4MLIA 3B9KB 4G43B 3CH8A 3KJ6H 1CL7I 5J1AB 2CRZA 4ZODA 5EC2A 1ZS8A 4HMCA 4ERSL 3MODH 4AIXA 4PJDB 4Z77A 4P23A 3S97C 3KYMA 1LO5A 3JVGA 1REIA 3HLAA 4X80L 1KN2H 3QCUL 3ZLQC 4EIGB 1S78D 4OZGF 1UB6B 5JLZA 1JPFB 4NUJA 5GS0L 2QADD 1HHIB 5IMOB 3BSZH 5LXGL 4PPTA 1YEGL 2CUIA 1QFWI 2GCYA 1G0XA 4H0HB 5C07E 1DN0A 2X1XR 4LBEA 4ODXB 4OZGE 5L8LB 3LD8C 1NDMB 3B5GA 2DBLL 4XNXL 1P9MC 4H8WH 2JIXA 4CNIA 1MRFL 2XQBL 1FO0H 4PJHA 3LV3A 3FB7A 1BQUA 1HYSC 2UVFA 2VQ1B 4P5TD 3U7AA 5C8JA 2X4NB 4KAQH 2HTLC 1ZT1B 5EIQA 5EFIA 3P11L 2Q8BH 1Z6JT 1RMFL 1BZ9B 3ULUC 3H9SB 3MX0A 5D6DA 1Y18B 4ZFFB 4V1DD 4KPHH 4GS7C 4G80A 1QRNB 4U6HA 5SWSA 1NEZB 4ZUSA 1U3JA 4LPXA 4A2LA 2XFXA 5IW6B 1J10A 4PJFA 5C0NC 8CGTA 1OW0C 1LK3L 3C60A 2FJGB 2NY7L 2XQBH 5E4IA 4FXKB 1S7SB 2H8PA 3G04B 3DXAB 1LK2A 4Y19D 3TIEB 4LCWB 5DD3H 4QTIH 4KZDL 2BSED 4U1HA 2YSSA 1MFDL 2V5MA 3CCHB 5AZ2H 3EFDL 1MH5A 2E27H 4P2CG 1MEXH 3WS6C 3C08L 2I26N 3L95B 1OB1A 5GSVB 15C8H 2A6KA 1ZT7B 2EDNA 4GW1B 4QHKJ 2D0GA 4YNYB 1A6ZB 1UCBH 1P53A 4HGWA 3MREB 4G8GE 5D8JL 3KPRA 2APVA 5GGQH 3A6CL 5IHLB 3HE7C 2BY3A 3I02A 3QA3A 5KVGL 4NWUL 3SDAA 1EAPA 3AY4C 4KDTC 5EOQH 3CVIH 2VDLL 1K4CB 1A5FH 2APFA 1RVFH 4WTXA 5FYJD 3TVMC 1IKFL 1FL6A 4ZS7L 3RZCC 3PV7A 5SWSE 4IJ3C 5ANMA 3GSRB 3WSQL 2IWGA 1QSEB 1UZ8B 4AY0A 5IFJB 3DSFL 4P9HH 5D7LE 5E1HB 4AYFA 2VXQH 5E5MB 5IMLA 4K94C 2CIIB 3QJHA 4UZGA 1PBYA 4RFNB 2QR0B 5F44A 1XGTB 1BM3H 3QEQD 3BAEH 4NYLA 4QRRB 3JV5A 3PNWA 1KPVB 1W2KT 1RZKC 1T0NA 4PRHD 1ZA3B 5J89A 2DKSA 1T89A 3WYRA 5E8PB 3RY6A 2HA1A 3OSKA 3PP4L 2L7JA 4R96A 2ZOLA 2QHLA 3UEZA 1X6LA 2BVQB 5DUBB 3BDXA 4OV5A 4RWHA 3LEXB 3D39E 2O5YH 1X5KA 2DM3A 4RISL 5EZLB 1JF1A 4YDJB 4TYUA 2X4PA 5L2KB 1EEYA 1CFSA 4KK8D 1SBSH 4M93C 4KK9D 4R7NB 3QEHB 1U92A 1YEFL 1UACH 2IAMC 4AEHH 4N0YH 3W5MA 4DZ8B 3SKJL 2MOVA 2ZKHH 1K2DA 4Z7WE 1L7IL 1A4KB 1CZ8H 3HN3A 2V9RA 4ZXBC 4BZ2H 4TVPE 1KCVL 4G8GB 2HT2D 4P49A 2P7TB 3V7MA 3RWGA 3V52H 4GS7B 4MJIA 2ID5A 1P4BH 2JB5L 3WIIH 3TV3L 3PDGA 1F90H 2AJZB 2VDPH 1J0KA 5M95B 4KTYA 1J1OL 2DLGA 1GYAA 1T1YA 5K9KA 4FHBD 3HNVH 2V2WB 4LVOB 3IVKB 2FL5B 4K3JL 1P4IH 3CU7A 3GHEH 3VD7A 4G7YH 4YIQA 1JUFA 5IIEA 5I6XC 1WISA 3VXMB 3C09B 5FUZH 3HFML 1UA6H 3KPNB 2NNAA 2XN9A 1MY5A 3O0RL 1BVZA 6FABH 4F57H 2YUZA 4L5FH 3IAGC 1TJGH 2GQHA 1KXQE 5HGHB 3DETC 1T3FA 4MXWL 3GM8A 3KS0J 3QHZL 1QKZH 2XTLA 3BGMB 3MBEC 3FO0L 3IXTB 4I3RL 1CICD 3REVB 2EKSA 2J5LB 1CDJA 2BXZA 4YXLH 4F7TB 5ACMA 1HXMA 1FPTH 4HZAA 1HE7A 1HKLL 3MRQB 4IRSA 1ZV5A 2P5EB 4ZFOB 3RGVB 1IGML 4PG9A 4MNGE 2G75A 4JRWA 2E7MA 2LTQC 2J7LA 1LMKA 1N5AB 2BCKA 2MMXA 5IB4A 1P69B 5I1DA 4L9LC 2QQLL 4F3FA 3MBXH 1A7PH 1YNTA 3MA9L 5EZJA 3RWHA 3MLRL 4YC2B 1AFVH 1NFDF 3GJEB 1O7VA 3N50A 1FO0L 4QHNA 5HHXH 3FAWA 1SBBA 5AG9A 3DURB 4JFZL 5DD1H 3T0EA 2CR3A 2YZ1A 4CMMB 3L6FB 3V5HB 1NL0L 3F6IA 5F7DA 4CU6A 1FE8L 1SJEA 3MGTA 1EFXD 1FGVH 1JTTA 5HYJB 1T1XA 3FONA 3E3QE 3S4SB 5A16B 2DMBA 2HFFB 2YD6A 1FV1B 3QPQC 3MJ7A 4XPAL 4M7LH 5JW5B 3ARBC 4X7FC 3MRMA 2P8MA 3WD5L 5TGBB 1LE9A 3RWIB 3EOBA 4FTVD 1RJZA 1T2JA 4X7SL 1I1AB 4YGVA 4Z5RB 3CFJA 4JZNB 1DANU 3KPRE 1F97A 3ROOA 2X4OB 3DROA 2E9BA 3VFPB 1LD9B 1RK1B 4I4WA 3PWJA 2DWDA 3NAAL 5IGXL 4MQXC 2W9DH 2X44D 4IMLB 4N8VA 1J18A 4PGJA 2ADGB 3QAZC 4WNQB 1UENA 3VXPB 3FQRA 5L0QB 1BGXL 4HUUB 5I18H 3GJFA 5D1XC 1JP5A 3DX8A 4ISVB 4K07A 2KL6A 3WN5B 3O6FC 2R4RH 4LL9A 4PRPE 3MRCB 3RUGA 2J6EL 5DYOB 4OUOA 3VFUA 1BFSA 3LKPA 2DYPA 2F54D 3LKNA 3EBAA 5KTEH 3DECA 4AEEA 5JIIA 1MFCL 2G5RA 2MHAA 3HE6D 3TJEL 4EI5A 4QNPE 3B9AA 3FKUS 3SCMC 1EHNA 5CJOH 1MAKA 4YWGH 4AT6A 5MHSE 3AU1B 1QVOB 3D18B 5C0AD 4MHHI 5TJWK 4TVSa 5D2LE 2ICWA 4KQ4L 4PGBA 4HJGA 5ERWB 5D7JC 2VDMH 2Z35B 2CDEA 3WHXA 4YUEL 4XVTH 4PV9A 1KIQA 4H1LH 1KTLB 3SDYL 1SYSA 4OFYD 2F5BH 4ZYKA 2VUOA 5GHWH 1RUML 5C2BH 1TZHB 4KTEL 4R4NC 1EO5A 5C3TA 4JPWH 3GGWA 12E8L 1SQ2N 2O5ZL 2AJSH 2D31B 1MCWW 4F15B 4JFFD 1H3VA 1GGTA 2Y7QA 3W0WA 2IH1B 1DEEB 2YRZA 2DTML 4QXGL 1EJOL 1QLRB 3KPMB 4XC1H 1CG9B 1DQQB 1CGXA 3CFCH 4Z7WF 1D9KB 1P7KA 3F62A 1X4XA 2NYYD 3MNWB 3PP3K 4E42B 2AEWA 4ODTL 2YPLD 3QRGL 2HLAB 4V1DB 1CDIA 3QUYD 4Y2OA 3VFWB 2BOCA 1C12A 4NQXA 1V7ML 3KPTA 5D1ZD 4X5LA 1GJIA 1WEJH 3LKSB 1PEZA 4IRJC 4WGVB 3IDJB 2PYEB 3MRDB 2XQYK 1Y0LA 4YZFF 3TZVD 4EN3D 4JFPA 1UM5H 3VXNA 2OS7A 4M7KL 4POYA 3KPSB 1HDMA 3KYOA 4JO1L 4MD0B 3WFBL 5DJCB 5EC1B 2UWEA 1L4IA 2WSKA 3SOBH 4TUJA 2GITB 4WU7B 4H5SB 5HBBA 3MBED 2FZ3B 1ZA6A 4WW2C 3G6AB 2HLFC 3SKMA 2DAVA 1GC1H 1G7MA 4JFEE 1XF3B 3GO1H 4NHCH 1MVUA 3MRLB 3QEUA 5HVWA 4F37K 5CEZH 1BBDL 3M07A 2QADB 1NFIB 1KEML 5D96B 1S7XA 3DVNB 5ICXA 1YPZF 4D9QE 2UY6A 3LRGA 5DJDB 4D9RE 4M3JA 5L0QC 1EHAA 5ETUA 5F9OL 4UT6L 4BZ1L 2JIXD 3FTGA 3MLTA 3S96A 3SDXA 3ARFA 3WN5C 1NUFA 3HC4H 3IKCB 4POZC 4RAVA 2Z31C 4Y4KA 4QY8B 1N2RA 4ZAKA 1T1WA 1SMOA 4IRZL 5DMIH 4PV8A 4ZUTA 3CFEA 4M4RA 1TTGA 3VWKB 2J1KA 5J6GB 2R1YA 1PVHA 2ARJQ 2IQ9L 1JF5A 5IT2L 4PJAE 1DQLH 2PXYD 3VFNB 4QGYA 4H1LB 3BWAB 2GY5A 1UVQB 4PG2A 4XNQB 1BBDH 5LJYH 2VIRB 1A6AB 5ESQA 1QRND 3VG9C 4BELD 3S35X 2J2ZA 4HSQA 4PRHA 3VG0L 3RNQB 1T5WB 4HZLA 3STLA 4PP2A 3ZKMD 1A9EB 5CUSH 2HVJB 1J11A 1MJJA 1MHHA 2VH5L 3DX9A 5JUEL 1W72B 5JHDD 4HH9A 4FZ8L 3LDBB 3NIFE 1NGYB 3ARBD 3R1GH 4MQXD 1EH9A 5DC4B 1BD2D 1IKFH 5EWIH 3CMOL 5HHNB 3OB8A 4MJID 5DEFB 2J8UE 2B1HH 3TIDB 4G5ZH 3IJHA 5FO7B 3LQZB 5ELIA 4AM0B 2EDDA 4J4PA 4WW2A 5T1DL 4BSWA 1BOGA 3HPLB 3ULVE 2F74A 3MRPA 3D3VB 1BEYH 1QRKA 3TWCH 3EYOA 2G9HB 2D7NA 1V3JA 7CGTA 3K2UH 1RU9L 3GBMH 1WWBX 3CXHK 3LRSA 4JJ5B 3BEWB 4OM0L 3CU1A 4KJYA 4LLDA 3U1SH 4Q9RL 1HH9A 3CDYA 3JWDH 2RJMA 4I3RH 3DO3A 5FDWB 5H8DA 4X9IA 4D0DB 2QSCL 5CKAA 4HPYL 5I75C 1M4KA 4PB9L 1T4KA 4S1SL 3ALWA 4X7TA 4K9EC 4WUUE 3UYOD 1W0VB 3G6JF 1FVEA 1FNHA 1KLGA 4FQQA 4OB5L 2UV3A 4NKOA 4XNMA 3QZWB 4XH2A 3WFCL 1G7PA 5DQ9B 4HKJB 2IADB 2VZUA 2WLZA 4G9FE 4LCWE 1J5OL 5J06A 3NN8A 1R3HB 3MRKB 1UXWB 4O51A 1FYTD 2Z91B 1TMCB 5JIKA 3VXUB 5C0JA 4OZFG 2XZAL 3ARBA 5FYJL 4HAFA 2OR8A 3QUMA 4XWGH 1B0RA 2X4UB 5E6IA 4KKCD 4WRLA 4HV8A 2AJUL 3MCKB 4L4JA 2NW3A 1TJHH 2FSEB 4HWBH 3OKNB 2AJYH 1Q8MA 3OHXB 4NNYA 3T0XA 1X5ZA 1S9VA 2VABB 4MZ2A 1YYMH 5T1LD 3AMLA 2EYRB 1BX2B 4LHJB 4TSBL 3C8KB 3NFNB 2DIJA 43C9B 5EH1A 5F1IB 1GAFL 1MCRA 5HJ3B 4FQXC 2R1XA 5AD0A 2RCSL 2VKXA 4MS8C 4O2FA 4AENA 1IKNA 1AC6A 4KHXL 4CN6A 4PRNB 4LFHD 1XGYH 3S5LA 1ES0A 3OAYK 1LDPH 4LNVA 2XNAB 4QRQA 1RZ8A 3PV6B 1L6XA 2FO1A 1ZGLB 4PLJC 3UAJC 5FOBA 3U30B 5TE4L 4G9FA 4CVXB 3L3HB 4DVRH 4YX2H 1RY7B 2AXFB 3UO1H 4KMTH 2BVPB 4Q7DA 4HFWA 4U6VH 3ULUF 4S1QH 2YUWA 1IEAB 4NO2A 2ZUWA 4EBQH 3UTQB 1KPRB 5E8EB 3ZZ1A 4H0GA 3O2WH 4X83A 3VXUE 1QHPA 3MOQA 5IVXB 4LPTA 4ODBD 4EXKA 3QDGD 4GBXB 4L9DA 3MJ9H 5E94B 1C5BH 3DSFH 1BD2A 4HJ0D 4P9HL 4QGTA 5T3ZH 5DDHA 2DF3A 4FQXD 1DBBH 3CZFA 3BD3A 4N0UA 5KW9L 3TO2B 2AJUH 3V0VB 3ZO0A 3P40A 4LGRB 1FNFA 1INEH 2DQCL 4ZDHB 3ZE0F 1G7IA 1KEGL 1EEUA 3DETD 4AG4H 3NH7H 5DHVA 4L29B 4WWID 1DBML 5IB2A 5KS9E 1FZMA 1KACB 2D7MA 4X6CA 4LGSB 1Z5LA 1IFHL 2EKJA 1UEYA 1UCTA 2FJHB 3C6SB 4XVUC 2BNUB 1KC5H 4QRPB 3BMVA 2FECL 2VZ1A 2A74B 4HXAL 4QF1B 3PGCA 2HTKC 4ODTH 3VU2A 4LVHB 5FAAA 5JW3L 4FQ1L 4DAGL 4XZUA 4DQOL 2GUOB 4HCRH 3TVMD 5DI8B 3HC0B 3SE8H 3ETBF 1LWRA 3BIBX 3JTTA 4OJFH 1HK6A 2XOTA 4NN7B 1ETZA 1LGVA 2KKQA 4BYHA 5D6DC 3I9GH 4M00A 5GGTA 5DJ0A 5ICYB 3HUJA 1MLBA 2VWEC 1IC5L 3GMNA 4PRID 2XV6B 1BZ7B 1K3ZA 5JTWA 3RZCA 2X40A 1ZANH 2RFXB 5F3HB 3N06B 4LSSH 3QR2A 1Z0MA 1ADQA 3NIGF 1JGLL 3V0AC 3BJLA 4JRXA 5I8OH 4KZEL 5IQ9B 4XVUD 2D7QA 5ESAB 4ZFZB 5K9OB 5J7CC 5F88A 5JNYA 1QEWB 3LS5H 3S36L 2M26A 1UM5L 2VITB 1A7NH 4G42B 5J57B 4X9FA 2PXYA 3IXAA 4FZ8H 3WS3A 3FQXA 2NPLX 3LHPL 3EYSH 5JHLL 4LQFL 4NC0B 3M1BB 1ITCA 4ELMF 3OPZL 1U8MA 2RB8A 2QKIA 2A1WL 4XP6H 4JPIA 1IRAY 4I2XE 4PY7B 4E41A 5T1KB 2MTPA 5C09D 4EUPA 5J1SC 1RZJH 4PTTB 3EYVB 3S35L 3TZVA 5F21B 4GG6E 3RIAF 4TPRL 3ZKQD 5B8CC 3MA7B 4YHOL 4CJ1A 4LP4A 4KRPB 1EO8H 4UBDD 3BPCA 3BKJH 4QXTB 3EDDA 2AK1H 1K8DB 1NGZA 2ADJB 1JGUL 4IRJA 4OV6F 5J6HB 4LVNB 2JE8A 5TPWL 4JQXA 3QUZA 4MA7L 3MBEA 2X4RA 3QIBD 5CZKA 4CU7A 4TVPL 1DUZB 2CKBA 3RVUC 3CDFA 5DJ6B 2JB6B 4OF6A 5FKAA 3LN4A 4YFLI 3KYKL 1MLCA 3C5ZD 2NX5B 1KPUB 3BRFA 5I19H 4OLUL 5KS9B 3ZTNL 2DN7A 4QRPD 5EOTB 3PHQB 5DUPL 5D5MA 4HWBA 4WJ5A 5L2JA 1FJ1B 5B3JF 1UQSB 4OUUB 2XWBA 3S88L 2BDNH 4J6RL 5EOCL 3ARDC 4LU5H 4UTAH 3BMWA 3S34H 3C5ZA 2DQGH 4XCCH 1MCFA 2ZG1A 1ACYH 4PJ7A 4X98A 5IF0A 5J56B 2ESVB 4CN4A 4XP5H 3UYRL 5IROC 1AXTL 5KSAD 2Y6SD 4G6MH 4RGMC 1XF1A 3PWLB 1H5BA 5DVOA 4NWUH 2C1OA 3CXHJ 3EGSA 3GMMA 3VWJD 3VE0A 4HC1A 4TVPH 2H1PH 4NQEA 3FQWA 4S0SD 2O61A 2VXUH 1SY6A 5H2BB 5FYKE 5DWUH 4FQCL 1A64A 2CJUH 4HK0A 3OAUL 2GT9A 5ID1B 2F54B 1NUGA 3BP6A 2NY5L 3G5XA 4PJEB 4XPGH 4Y1AA 1JV5A 3G08A 3UMTA 5HYEA 3V0WL 3QNXB 1XCTB 1XGUB 3O45A 1DBAH 4F2MA 5M94B 2VDNL 3DO7A 5DK3A 4XPAH 4NT6B 1MSPA 3EFFA 4LLQA 3SE3C 1I8MB 5FV1L 4OAWB 3R0MA 1X5JA 5CZVH 3TFKC 25C8H 4MNGA 5K9JL 3I6GA 1A7RL 4NJ9L 3OAUH 3CLEH 5CSBA 5IVXF 3EO9L 2PW2A 5D7IE 1MWAH 2FX7H 5BV7B 3DV6A 1M05B 3G5VB 4K3DH 2X70A 4G9DA 4U49A 1N26A 3OGCB 4HD9A 1KENH 1JRHL 2WIIB 3W11D 1ACZA 4TSAL 4LIQH 4KROD 1XR8A 2FX8L 4TSAH 3W82A 4XTRC 3DPBA 3QULB 2NZ9D 1QG3A 5BW7C 5DD0H 3WV0A 3WHE1 4LLWA 3EOTL 4FNLH 1YN6B 4V1DE 4Y5XC 1E6JH 1JK8B 5DA4A 3V4UL 3CX2A 4K8RD 3V4VL 4M43L 5E03A 3MRIA 2CUHA 4YDIH 4XGZA 1UH4A 4RGNE 1A1OA 2E7CA 4JRYD 3D87B 1MPAL 3VMNA 4LASH 3PABA 5KTEL 1QO3A 2DQIH 2VDQL 1JN6A 4O4YH 1XF4B 1WV7T 1MFBL 1A6TB 4NJAH 5JIPA 4ELME 1YQVL 3KPRD 1OL0A 3CXDH 4XWOC 4FQPA 3KJ6L 4WHTB 3MV7E 1EHXA 2OR9L 4PJBF 4KHTH 3ZE1E 1T2QL 2DM4A 5I1AB 1U8HB 2GTWB 1NGPL 3HE6C 3PWUA 1G9ML 2CLZA 2NR6C 1A3LL 4FQLH 2NY1B 4X0KA 1V5JA 4U1IA 3BQUD 4HF5L 1BLNB 3FHAA 4Y19A 1T04A 1OF2B 1V7NH 3LEYL 1U36A 5KSUB 1J1XL 4TULL 4WHYG 3EDKA 4FQJL 5F9JA 4KVCL 4HKZB 1KF9B 1N6QH 1BFTA 1MI5A 2DQIL 1TITA 4DKDC 4X6DB 4BJLA 2W59A 3ECBB 4WFHE 4DK3A 4P2QA 3PIQA 4U1GB 5EUOA 4JFYB 5I17A 3DTXA 3LN5B 3ZYZA 4HF5H 3MRHB 3D85B 2P47B 1T7ZA 5HVHB 3C60C 4NRYA 3L3KA 1HSAB 4QOKA 1FO0B 2PYFA 3U7WH 4YE4L 5IR1B 4MXQD 2A6IA 4NCDA 1B6UA 1TVBB 1KCRH 2H41A 5I0DA 4CL7A 3QDMB 1OAKL 4B50A 3NCFB 1PG7L 4RISH 3VFMA 3VXQB 1D6EA 2BNQA 4R3SB 1I7TA 5CEZD 3CPLA 4J1UB 4L4TD 3MJ8B 5IP4A 2APWA 2FEEL 5E8DH 4JFEB 2XG4A 3F7PC 4GKZA 4P3DA 1UM6L 5IFHH 4OF8A 3TYFA 3BWUC 3GO1L 5D7KE 4NDMB 3OKLB 1Q9WA 2IPKA 4AQOA 3LRHA 3NOIA 1XFPA 3CLFH 1VESA 2K9UA 5C9JB 1B4JL 4P5MA 4KKAC 4MJ4A 3X14A 2NY7H 1CLZH 4WW1A 2AJ3A 2EDYA 5JQ6H 3DV4A 4J8RB 4KWUA 1TENA 3SDDB 1NCCH 3KYNB 3F7VB 1IQDA 3F5WB 1U95A 3ES6B 2R1WA 5FB8B 1TJIL 4K3GA 5FGBC 1RVFL 1A02N 1BFOA 1DP0A 3BIAX 1RUQH 3IF1B 1BQHG 4JQIH 2GAZA 4RX4A 3S4SG 1S7TA 1GC1C 2I9LA 4JFED 1ZANL 3I75A 3K0WA 1FL5A 4LHUA 4L8SA 4OZGA 4GAJH 4X6CF 1D5XB 2CXKA 3FO2B 1TQBC 2BRRL 1A9BB 4N0CC 4APQD 1FNAA 4JFQA 3VFTA 3LPFA 4FP8H 4QRSB 4JFDB 4AZ8A 4G8FA 2NXYC 5E95B 4ZPTB 2QQKL 3TBSB 2FBOJ 3R4DA 4JN2A 1AGCA 4Y5VB 3U9UB 4TSCL 4F37F 3GFUA 4OF7A 4RMSA 1IGCL 5CD3A 4OM0H 5CBEA 8FABA 4L4TA 3DRTA 1QFUH 5TDNB 3P4NB 1J8HB 2XZCH 1IILE 4M61B 2MFNA 3A6BL 2R4SL 1UACL 4AEHL 1DDHB 4LSQL 4KJQD 1AP2A 5K9QI 1LDSA 3DGCR 3HI5L 2E9WA 1F3RB 4LCUA 5DHYB 1N6UA 1MHEB 4UV4H 1A6VL 2OL3A 3RAJH 1ZT4B 3UTSE 4CADA 1HKFA 3RWFA 3BGAA 3LPGA 2FO4B 3DIFB 3MUJA 5KVEL 3ARSA 4BFEA 1MAML 3L5WA 1QSEE 5JO5A 1OGTB 4KJPC 1IGCH 5DC9B 3GIVB 4KKBD 3GSQB 4I18A 3MJGX 3QQ3B 3H6JA 3DXAD 4KK8C 2KPNA 1CDGA 1TLKA 2ERJB 1NCWH 1R3IL 3O3BB 1GC1L 2ICWI 4OFVA 5IFAL 4UTBL 1AE6L 1OW0A 5JHDE 4EDWH 4MHHG 1FZJA 4RRPG 1XR9B 4XPFL 2WP3O 4YFLF 5FYLE 1Q0YH 3BISA 3ZTJG 1NDGB 5INDA 4P4RB 4UT7L 3ILQD 4LCYA 1PDKA 2QJDA 3IU3B 2F53A 4Q9QL 3CFDB 4OCWH 5AUMB 2NZIA 4QT5B 4UU9A 2ATPB 3PHSA 3JVGC 5FO8A 1E27A 3JV6A 1EDQA 5B21A 5C0AA 5HYQB 5IVOA 3ZT7A 3ARZA 4LSPL 5T1MB 2Z31B 4N90D 5HYFA 4G8EA 4XCNB 3VXSA 5E5UB 3MROB 2FLBT 2VB5A 4FQIL 5IMKB 4I13B 3MBXL 1IEBB 4UUJB 1C08B 3O3EB 3P9LA 5BJTA 3B8YA 3SGJC 5I1HL 1KFAL 3LCYA 4S1SH 1OAZH 4HPYH 5GRYA 5I8EA 4YHML 1U8OA 4F7PB 3OF6D 2VXVL 1RAMA 4NO0D 5JOPE 1J0HA 1TNNA 4QOKE 2D9QB 5CEYB 1PKQB 2CIKB 3QDJA 3D9AH 4OD3H 2YD3A 1AJ7H 4O58H 3UJTL 1HSBA 2H9GA 4CDHA 3RGHA 4Z0BL 1YYML 2P5WA 3E0GA 4E9LA 4PJDF 3AROA 1R3KA 3MRNB 3UP1A 1U3HB 3ARVA 4A2MA 4PRPD 4LCWD 5CJXA 2FH6A 3PE9A 2ZZUT 3VXRA 2WQ8A 5IQ7H 3LDBC 2L4OA 1S5HB 1BECA 4HIHA 3UTSB 1LEGB 2ZCKL 4GXUN 1GIGH 5EDXA 2DMKA 2VZVA 2X41A 4S1RH 1LO4L 3QIWA 4K55A 3Q6FA 1ZWIB 2BFVL 2FX7L 2WUCH 5C0AE 4IOSD 4Z6AT 5TQ0H 4LGPB 1LO0L 2IMNA 5BCAA 3P11H 5LWYL 3VDCA 3U46B 1CXIA 1IGJB 1R3LA 5HDLA 4NKMA 5B22A 2X4TB 3HE6A 3MJ9L 4PB0L 1S7QB 4MA1B 3TNNB 4I5BA 3LB6C 1EPFA 3MUZ1 1G9MC 1UKTA 2ENSA 3I2CL 4BUHA 5GRJL 1T5XA 2HFEB 5EO9B 1KCSL 3KXFA 1A3LH 4KRPC 3FQUB 3RI5K 5CIPA 1WUNT 2GY7B 4FFWC 3BGFC 3OAZK 5TDOB 3QXWA 5C0BE 5T1DH 1FYHB 3X12A 5E70A 4TOYH 2XKUA 1XGPB 5E8NA 3UTTB 3MO1A 3GMPA 3CZJA 3ORJA 5F1NB 5FYJU 3TN0A 1D5ZA 3QEGL 2P44B 2VDKH 1YMHB 3PQYB 5CEXB 3J7HA 1PG7X 3QDGE 1CFQB 3D0LA 4Q6IA 5ACZA 5DD6A 1J05B 3RX5A 1R24A 2WUBH 1BM3L 4KRLB 1PKOA 2C9AA 1F02I 5I8KH 1CF8H 5DEZA 1M1SA 1I1RA 4JKPH 4NP4L 2M2DA 4S2SB 3QFJB 5ILTL 4NQSA 2IANA 3UPRA 4PJEF 3HPJA 2F8VA 3AXLA 4JB9L 2CLRB 3JWNC 2XWJA 3O2VH 5T3XD 5DS8A 4BH7B 4BQBA 3VFOB 1FAIH 1K6QH 4DGVH 4YHYB 3DMMB 1JBJA 5C0FA 4HX1A 3RPKA 2OK0L 4EEEA 4D9RD 1Q94A 1RURL 5IMMA 1F4HA 3QG6B 3WJLA 2DQJH 4NO0A 5DMGC 3AREC 1CR9L 1J88A 5GGSA 5I74C 3VDBA 3TBTA 2EZ0D 3AGVA 3A6BH 3FFDB 4IMKC 5JXAL 3HG1E 3TO4A 4NJAL 1VSCA 2PN5A 3SE4C 1QOKA 2ZUYA 4UI2A 4J2XA 3UX9B 1CXEA 3KPPA 1M6OA 4JQXC 1OVZA 2EYSA 3QCVH 1U8JA 3U0WL 2GJ6B 3C6LB 3IFLH 3EFDH 2XKNB 5IOPB 1YDPA 2JCCB 1QTYT 2PKDA 3T0ED 1DUYB 3AREA 5BS0E 2VLRA 4D3CH 4HPOH 5CSZB 3CSBA 2OJEB 5D7IA 1ZOXA 5KS9F 2GTZB 5MENE 5EOQL 1MNUH 2X89D 1W8OA 4FTVB 1PYWA 4H25B 4U6XB 5F6HJ 1YQ2A 4TUKH 4JQIL 1VKXA 1J87A 5FUCC 2EDWA 2HH0L 4L3ED 4IOFC 5E4EB 3T1FA 5DRZB 2NXZD 1HILA 1H8NA 2BVYA 3U36A 1N59A 2N7AA 3TV3H 3HI1B 4JQVA 1MCOH 5L88L 2GI7A 2VAAB 4UIMA 2BOBA 3GMQA 1LEKB 2O5XL 3ZSSA 1FVDB 1HI6A 3VI3F 3BGFB 4PRIA 5C0EB 3DVGA 1OWWA 1QSVA 1P6FA 4YAQA 3BUTA 5IB5A 4MNQB 2JJSC 1RIVH 3DNKA 3TCLA 3G5ZA 4LFHG 4P9ML 1NPUA 4X5XA 1OAXL 3BQUC 4GFTB 1IL1A 4JLRB 2VXTH 1GZPA 2Y36L 3U6RA 2R23B 4U1JB 2Z4QA 4KJPD 5HHQA 3WLBA 3EOAB 1UWGL 1INDH 2QQNL 2BNRE 3MR9B 3RL1B 2WINA 2EE3A 4WY7L 3FN3A 4APQB 1ADQH 1CFTA 3BI9X 4MNQD 1OT1A 3HI6L 3MRGA 5EG6C 4OLXH 4J3VA 4GSDL 1Z3GL 1AHWB 5EO1A 2DB8A 4FQXA 4NZRH 3HB3C 4PUBH 2JCCF 4QRPE 2A73A 4G7VL 3K81A 4UT6H 4LCCA 4NZDA 2A6JA 3T4YB 1Q0YL 2FHFA 5EU7C 5L6YL 4EZMA 1FYTE 2K7PA 4R8WH 1RK0B 4RX4D 4HS6A 4WUUA 5I1GL 4YHYC 3L3IA 3X17A 3LSOA 4R7DA 1ZHLA 32C2B 1Q1JL 1T7YA 1HYRC 3CSYB 3FOMA 4JFZH 2IQ9H 4Y5YB 1HWGB 4PRBB 5IM7A 1A7OL 3QUXC 5LBSH 1LILA 3H9YA 4RAUB 5FYKD 1EBAA 4GKOA 1KXTB 4MQSB 5I1JL 1LP9A 5HI4C 1U2HA 3VRJA 4BQ6A 1QR1B 1RD6A 3H9ZA 4Z7WB 1V3KA 3OZ9H 2QV2A 2PTTB 5HD8C 3GSNB 1I1FB 3KPOA 5ADPL 1YJDL 2WWMC 5JXEC 4PJ8D 3K2MC 1U93B 4MGXA 1NEUA 5CGMA 3GMLA 3BUYA 2XXCB 4OT1L 3TF7C 1OAYH 3QQ4B 3GRWL 3FO0H 1G0YR 3O3AB 4U05A 4NSKB 3DMMD 3MRFB 1SY6L 4PGCA 1AQDB 2OSLB 1Z9MA 3CUPA 4F80A 2WBJA 4Y7MA 1Q0XH 4Y16B 1AO7D 4JG1L 5LCVH 1FE8H 3NCCB 1JPGB 4CMHC 3UXFA 2WAHA 3TYGH 1QP1A 3PXJA 1H3PL 3MZTA 1P6AB 3ZDZF 1P1ZB 1WICA 2VLJB 2EEDA 3VFVB 1E6JL 2GJZB 4HIEA 4R97C 2BSRB 3L5IA 3SDDC 1A4JA 3SGEH 3D3VE 3V5DA 4XNUL 3VFGH 2P5WD 1YEHH 1HXYA 2X1QA 1XF2B 1CLYL 1A14L 3NIFF 2A6DA 4J3SA 3RWEA 3H7BB 4LMQI 3HG1B 4F7MA 1AQKH 5TH2B 3RWDB 1BZQK 4I0KA 2R15A 2BVOA 1H3PH 2NY4B 1SJHB 4GQPH 1OD7A 1E4WL 1ND0A 1QBBA 4IOIB 1YC7A 2H6PB 5E00B 5GQBA 3VXTA 3FFCB 4JAMA 4NGHL 2E27L 2CKBL 1HOCB 1UH3A 4M6AA 2ADFH 3QISA 3QO1A 1DSFH 4PB0H 2IG2L 5F96L 2FLRT 1S8DB 1JF6A 5JW4N 2QTEA 2DI7A 1U8IB 3T65B 3QUYA 3T2QA 3KWWA 3L5XH 4I0CC 3C87A 3CSPA 4I77L 4HAGA 1FGNH 3MFFB 1AGDA 3KPQB 4KUZH 4PRIE 3QQNA 1S7VB 3T65A 3EUUA 5C0IA 1U8IA 2W0KA 4GW5B 3VGHA 3IETB 4NQVA 1S8DA 4E0RA 4WFHD 1MRCL 3QWOA 5IQ7L 3N85H 1JPTH 1MJ8H 2B4CH 1P7QD 2WBKA 1AY1H 3KDMA 2R4RL 2R2EA 1NSNL 4X99B 3P4LA 5J13B 2VLJE 2AXGA 2IH3A 4U1SB 5EU4B 1MAJA 1SJHA 4DZBA 3PWNB 4GRLA 3RWDA 4XI5D 3CGTA 5TH2A 3SPVA 4LLUA 4WFED 3RWEB 4TUOB 5C08A 4K9EL 2VWEE 2K1MA 2OJZL 2D0HA 2YD9A 3EYUL 5EBWB 1UWEL 3W39A 1KJ2H 4UB0L 2X10A 1NGQL 4GJTB 1TTFA 4MJ5A 2BSRA 2GJZA 2X1WL 3NFPB 5GRXG 2EIDA 1NANH 5D1XA 4N5EC 4JO4L 4L8CA 3NCBB 1RZ7H 5D7KD 4LAQL 2Y36H 4XB7A 2FIKA 5EUKB 2VZ3A 1NMBL 3U4BL 2C4FT 1AD9B 2P8PB 1G7HB 4MD4A 1MFDH 1VPOH 2HVKB 4WU5A 3U7YL 4HIJB 1JWMB 1X5XA 5FHBH 5LVEA 3EZ8A 1OM3H 4LLMA 5MI0C 1FG2A 5HI5D 4PGCB 3WFDH 3QNYA 1CD1A 2OL3H 3O8XD 4M93B 5BXFB 2BY2A 4IM8A 4JPVH 2DRUA 3RTQC 2Z92A 4NM8L 1PEWA 3OR7B 1B0GB 2YBRB 1UC6A 1D5MA 2D3VA 1OQOA 4XBGB 4E5XA 2GEEA 1I7ZA 4POUB 4U6YB 4M8QB 3SDCB 3MCLL 1I1FA 3MRBA 2PTTA 4R4ND 4R26L 4G6KH 5FYKL 2Q87A 2AK4D 3ULSB 2EYTA 4LEOA 3V6BR 1FIGH 3BKYL 2NQCA 3D6GA 3GDBA 3O4LA 4RAUA 1BJ8A 5T5NF 5CUSL 4PJ5D 4DKEL 4KRNA 1BQHB 3RVTC 1B6DA 2X89A 5DRNA 4N0UE 3V7AG 1J1OH