2K1MA

3d nmr structure of domain cc0 of cardiac myosin binding protein c (mybpc)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
PEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-binding protein C, cardiac-type
publication title 3D NMR structure of domain cC0 of cardiac myosin binding protein C (MyBPC)
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k1mA00
2NXZC 2BSED 3W81A 3C60C 4OCWL 4G7YH 4NUJB 5GRWA 3BDYL 2AABH 2FX8L 2H32H 3FO9B 3BZDA 3RNQB 3CMOH 2YD4A 1KCSH 3HLAB 3CZFB 4LLQA 4Z7VF 2QHLA 1P84K 1TPXC 1FYTD 1G9NL 4Z78B 4JZJC 1FNSH 2HJKA 1ETZB 4YR6A 1GRWA 3SGEI 4L9DA 1HHJA 3QO1B 6FABL 1OAXH 2AV1A 3T0BA 3WLBA 4ODWB 2OI9C 3S88L 1U8QA 5F1IA 1TVDA 4M9OA 4NRZA 3TNMB 4JKMA 1JWMB 1DL7L 2X1XR 4JM4L 1YJDL 4Y5XB 1JTTA 1M7IB 4RX4A 5FGBA 2B7DT 3B43A 1U3HA 5I8KL 2RAMA 3VD4A 3WHE0 3D3VE 3HRZB 3QUZD 5L2KA 4X6FB 5HHOB 4IRSC 1YEJL 1OAYH 4ZXBB 5IVOA 5D2LF 4YC2C 5T5FL 3BQUA 1DN0A 3NFSH 4HPOL 2VZSA 3R06B 3OSKA 2Q8BL 3DUUB 3LS4L 4IIQC 4RMVA 3HNSH 3RWHB 4IDLA 2YD8A 3P4OB 4NT6A 4P2RE 2OZ4H 4I9WD 1MEXH 3H42L 4XNZC 2NX5A 2NW2B 2Z31D 1XIWC 3BN3B 3D9AL 3MLZH 3TT3L 4L3EB 1BMGA 2QQNL 1CFVL 1CFTA 1KNOA 5GRUL 2Q1EA 4YHZH 2GJ6E 5HGDB 5SWSA 3BKYL 1IEHA 1J0KA 3H9HB 1KCRH 1J87A 2AJUH 3EGSA 4HLJA 3VXQB 5EC1B 4Q6IC 1A6WL 2BNRD 4F7EA 1MFAL 5L2JA 1LNUA 3MLYH 4R0LA 1G7JB 1XGPA 5EU4B 5ETUB 1DDHA 2DB8A 5EU6E 1R3KA 1MQKH 2ICWA 3LD8B 1I1FB 2MPAH 1CE6B 3Q1SL 5FV2A 2Q3AA 4FTVA 1KIPB 4OT1L 4MD0B 3O4OB 1QFWL 3C2SA 2CKNA 3O6FB 4MA8L 1AD0A 5ID0A 1WFTA 5HDQL 4AG4L 5KN5B 5BQ7B 5DJCB 2J2ZA 5KANI 4EEEA 2A1WH 3D39D 3ZDZF 3IRPX 3WBDA 4X83A 5A40E 2FBOJ 1NC4D 2R2EA 4BZ2L 2PTTB 1CD9B 3L3GA 2E7CA 3EDDA 4K7PL 4KJYA 2LE9A 3OGCB 3RGVC 1QFOA 4AL8L 4UILH 4U1GB 3GJEA 4X9BA 5I1KH 4E41A 3PWLB 1P2CA 1R5IB 4LU5H 3UJJH 3WEXA 4EUPG 2AJVH 4OIAA 1IFHL 3FB5A 5CJOL 5J11B 3MYJA 3RUGF 3HI1B 4ZPTB 3DROA 4OF0A 2XRAL 3PUCA 1HIML 1PG7X 1TMCB 4AEHH 4DVRL 5AD0A 2WP3T 5EBLA 2H3NB 4ONOA 2VLJB 3WJJC 4QHMA 1KPRA 5FCUL 1J8KA 2NY2B 4K7FB 1ADQA 2XV6B 2DD8L 3SCMD 1E4JA 2IJ0C 4HG4J 3VH8A 1HHKA 4UZGA 5E08H 4P5KA 5FYKD 4I13B 3DX9A 2VDMH 4Z95H 2CSPA 2PW1B 5I1EL 5E5RB 4RX4D 4OZFA 1CLZL 4YHYC 1U3HD 3ULUH 2AXFB 5FK9A 1ORQB 2X89A 5L2KD 1ES0B 3HUJA 1S7QB 2PYFB 4PY7A 2CXGA 1IVLA 1OP3K 3NCJL 4NGHH 1NGXA 1V8HA 4DGYH 1DR9A 2I26N 2P8PB 4POUB 4H1LG 3GMQB 2E7MA 4OF3A 3QDGA 1ODAA 1FGNH 5D7JC 1FZKB 4Q6YA 5GGTA 5J9PA 1IC4H 3WN5C 2ZNXA 4KROB 2NX5D 1YEKH 1MNUH 1RVFL 2ZG1A 4NN5B 5DVLA 4Y4KB 4XAKD 2C26A 5IHUH 4XVUC 2VH5L 5F88A 1ORSB 1BZ9B 4P59H 3H9YA 2I07B 2ICEA 5GRJH 1FL6B 4PJ7E 2FCBA 3ULSB 5E99H 1MIML 4O4YH 1PAMA 2P42B 3MO1B 3OX8B 4WI3A 4R4ND 5CBAB 1AGBB 1UWGL 2V5TA 4GMSH 3MRQA 2PN5A 1J88A 4RQQB 3CVHB 4HC1A 2XXMB 1YEFH 3CFJB 3T4AA 1W0VA 5F9OH 3F7RA 3MOAL 3WO3B 5CIPH 5FUCE 4YEEA 5ERWA 4R4BA 2EIDA 5SX4I 1ZVSB 1Q9KB 3QZWA 1SEBB 4LSQL 4FTVD 1SMOA 5EUKB 4F9LC 3GO1L 3L3DB 5F1KC 1JTOA 1FRGL 4U49A 3DMMC 3O3EB 2R8SL 3QEQB 3OG6B 4CJ0A 5GS3A 3O0RL 1HHIA 2YN5A 4LLVB 1DBAL 1WBZB 4CVXA 4G6FD 4O2EB 4LNVA 5F96H 3QI9B 4JO4L 1IC5H 4U3HA 2XWBB 2IFGA 5IF0B 1GIGH 4HK0B 2CIKA 5E7BA 1X5AA 5EOQH 2G60L 3FTGA 3RAJH 3V6OC 1MQ8A 3NPZB 1A7NL 1FL3B 4YHLH 4E41D 4F37F 5L7XH 4PBVC 1NUNB 5C70A 1OF2A 1V3KA 1RJYA 4UT7H 3WS6C 1J0ZA 3VW3L 3BE1H 2Z92B 3LKSB 3PNWB 1G6VK 3BHBB 4JANB 3G6JB 4OM1H 1R0AL 4N0RA 3R0MA 5FYKL 4WI6A 3E6HB 4HEME 2C3GA 3BGFB 3N1MC 3CK0H 2X1WL 2LU3A 1MFEL 4LDOB 3LDBB 1DBBL 4XWGL 3FO0L 5CD3B 5MENA 1DEDA 4PB9L 1K8DA 3ECBB 1KCLA 1JFQH 2YBRB 2XQYG 2RFXA 4G8EA 3MV9A 1K5NB 2X89D 1ZGLP 35C8L 2HLFD 4HIJA 1TVBB 3KPQB 1IGYA 4KHTL 4GKNA 1D6EB 3AY4C 1MHEA 2C7UA 3KPLB 2VR5A 1F02I 3Q6GH 3VXOB 3RWFA 3F6IA 5CBEB 4ONHB 1MCPL 2ICWJ 1HOCA 4OUUA 4QNPF 5TPWH 3CFDA 3MRBB 4P4RA 2HVKA 1KLGA 3FCTB 3LZFH 3PHSA 4X4ME 1EXUA 1XF3A 2VLKE 5FFLA 4YO0A 1BZQK 1JPTL 1QRNA 4FP8L 3F12A 4LAJH 1QYGH 2KH2B 2Y9RT 3G6JF 2EH8L 3BPLB 1QP1A 4HUNB 1I4FB 3T04D 1IZKA 5GIRB 4M1GL 3QG6B 4CL7A 1MI5A 3UX9B 1DBKH 4MQ7B 2BOCB 4LSPL 2EKJA 4XP1H 4C83A 5DSCB 4AIZB 2V2TB 1YEGH 4R7DA 5IQ7H 2G5RA 2JKXA 2NTFB 5FIEA 1QD0A 4QXUH 4JFXA 3QXAA 3T2OA 3VD9A 5DJ6A 4OZGE 1R24A 4LEXH 3RQ3A 4HCRA 3OMZA 3OKOB 4TRPL 4Z77B 4IJ3B 3RIFF 4S1DD 1G7PB 3P77B 3V4VH 4PJBA 3TESA 2ED9A 3QCVL 2YC1A 2NY1C 3KGRA 2A73A 3TA3B 3T1WA 2IMNA 2WUCH 3G5XB 4XP6L 2XNAA 2RR3A 4K3JH 5KVMC 3QNYA 4NBYB 4PRNB 5B38G 1AQKH 4DKEH 2J8UA 5I6XC 3MZTA 5C6WH 2DKUA 3RPKA 4RFNC 2VZVA 5DK0B 1YZZA 2DQFA 1QTYT 2VKWA 5JOFA 1OB1A 1VACB 1S3KL 12E8L 4HG4K 3SKOA 4Z7UB 5E1HB 3LSOB 1ADQL 1OY3B 4Y7MA 4MZ2A 3KDMA 3T0EC 3RY6C 1BOGA 2NY6D 3MX0A 3BVNA 1VCAA 3NZHL 4KC3B 5C0CA 3U2SB 2BCKA 4XNMA 4WHYH 3HMWH 4LCIH 2ZPKL 4FMKA 1E6OL 5BVJA 4QTIH 4KMTL 1BEYH 4XH2B 43CAB 3H3KA 5DUMH 5I8CA 4V1DB 1DQDL 5HDOA 1BQLL 2A9NL 4XCYA 4EQ2A 5MEND 4FQXB 4KK6D 4LLMB 4H88L 4CU7A 4D0DB 2Y5TB 3TFKC 3PWPE 4NBZB 4M7LT 5D6CB 1N5AB 1FLTX 2PYEA 4DAGL 3CPLB 5GGTL 2DRUA 1DQLL 4KK5C 3HMXH 4L8BA 1YPZE 1PLGH 1A6ZB 3OTTA 4UV7H 4GW1A 4YXHL 1JK8A 1A64A 3TVMB 3SDXE 1GXEA 4EI5D 3UDWA 1NMBL 3V6BR 4AEFA 4Z7UF 3HI5H 5D9SA 4PP2A 4HXBH 1P9MC 1ZT7B 2BNQA 3IXTB 1IBGL 4DK6A 2H41A 1H3PH 1QRND 1FIGH 4N0FA 1JGDA 3MRLB 1R3HB 2WWKO 3BKCH 2VAAB 2I25N 1YNKL 4HC1L 5GHWH 3NCMA 4DN3L 2SEBA 4ZSOE 3UCRA 5JOEA 1BFVH 5GZND 2JF1A 3BEWA 5T1MA 2H6PB 2FL5A 4UDTA 2IH3A 2VDOH 4LMQE 1DANT 4TNVK 1GPOL 1I1YA 1OAKL 4M3KB 1MI5D 3MV01 4X4ZA 1N2RA 1GZQB 3V0VA 4PPTA 1E4KC 2X4NA 3GKWL 3NIFE 3GBLA 1GZPA 2CLZA 3BKML 5H37G 1T1ZA 1XGUB 3ULVF 1RZFL 2OTWA 1ZT1B 3GHBH 4RSVA 4RRPG 5E70A 4ZQKB 1A4KA 3OR7B 3GJFA 2VDLL 1QKZH 3O6MH 2G9HA 3LQAC 3UO1H 1CDBA 2LVEA 3E3QC 2R56H 4M61A 3QHFH 1J18A 4HUVA 5C0AA 3H9ZA 4D3CL 1FGVH 4NJAH 1RZGB 3LEYH 3DHJA 1TZHA 5DRNB 5K59E 2IQ9L 4FG6D 4BELD 2ARWA 3CFEA 3BRFA 3TIEA 1L6XA 4YDIL 4XGZB 3IYLW 4WUUE 3G6DL 4JN1H 1UB5A 2GSIB 2W9EL 2ARJA 3TCLB 4M5ZH 4DKFL 3OKEB 2NY4B 3A0OA 2GEEA 2CDEA 4HX1A 5ICXA 2ESVE 4PV9A 4P9ML 4R2GB 5C0CD 2DM4A 4Z0BH 2JCCA 2QJDA 5E7FA 3NTCH 1A1NB 5EOTA 2B2XH 3B9KC 1MCSA 3TO4D 4UIMB 3VXTA 4X4YA 1BX2A 3U1SL 4FFZL 4O9HL 5GS0L 1ZA3A 3MJ9H 2J6EA 2QV2A 5IVZA 4L8DB 2PYED 3MJGX 4WV1A 4GRWB 1D5BB 2XYCA 3OPZH 1S5HA 3MLRH 4OCYL 2ZUQC 3SO3C 3ZKQD 1FAKT 3GSOB 2XWJB 1WT5A 4U1KB 3RHWK 3HZKB 3NACH 2I9LA 1SYVB 2NY5L 5EWIH 3UJIH 4OLVH 2HT2D 4PGCB 3EJZC 4PY8I 2YPKA 5H2BA 2BNQD 4AENA 4YWGH 3KG5A 4XVTH 3G5YB 3ARZA 3L5IA 5D96B 5IK3A 2JELH 3GI9L 5LGKA 3HE7B 1YPZB 32C2A 3UTSB 1M7XA 3WXWL 1NEZG 1PEWA 2CLRA 4LRNH 3SDXB 4HJ0D 3DO7A 3MR9B 3MGAA 1MJ8H 2DDQH 4U1JB 5JW3H 4AZ8A 2OK0L 1A6TB 4ERSL 4Y5YB 3MXVH 4HCRL 4GBXB 4Z7NF 5ISZB 1I7TA 1T2QL 1N4XL 4M1CD 5D2LA 5FYLE 4NUJA 4FA8A 3QRGL 4QRUA 1D5IH 5EA0H 1LK3H 3FO9A 3RNQA 4ZOAA 5GRXG 4GRWF 4KKBD 3H2WA 5BVPH 1IARB 3CZFA 2BFVH 1SHMA 2ADIB 4MXVE 2F5BL 2XG5A 4CN1A 2YKLH 4Y4FA 4Z78A 3MLWL 1ETZA 2E9IA 3QO1A 1S7RB 5E2WH 1EO8L 5KANG 4GS7C 4ODWA 1KCVH 4FQ1L 4JEGB 1T7VA 1NGZB 4PLKC 3TNMA 1YPZF 1FQ9C 2YHGA 5I75C 1JWMA 1Q8MA 1XH3B 4NQDB 4Y5XA 1M7IA 1JGLL 4P57B 2FNBA 3WNNA 4MJIB 3HRZA 5H94B 4X6FA 3P9MB 4QHLB 5HHOA 1XGQB 4ZXBA 3BYTA 3K8KA 3DBXA 4NRYB 2ZOKB 2X44D 5E03A 4ZUVB 2EECA 5GGVH 1FORL 3R06A 3DUUA 4KRLB 2NYYD 3P40A 4WUUB 3RWHA 1FG2B 3P4OA 4R8WH 5IW6A 1RIHL 4DK3A 2QBWA 3HR5B 5HD8C 4TULL 5KVEH 3L3KA 5DJYA 3MROA 5C0NC 3KPRE 4S0SD 1HN1A 1JNNL 3G5VB 4M93C 2VQTA 5FM4A 4D9QD 1HSBA 5E8PB 4LSSH 3DLQR 3QFJB 5HGDA 5MEQB 3WDJA 1BWMA 1LO3L 3H9HA 4IEFB 5LCVL 4YX2H 1CDGA 1I3GL 4S10A 3VXQA 5EC1A 1IM9D 4HIEB 5I8EB 5MERB 2XZAH 5GS2D 2C3VB 4EXKA 1G7JA 4OLUL 5EU4A 3AVEA 5ETUA 4YBHA 3GMLB 2B1HL 1I1FA 3D85D 1Q0YH 1CE6A 2R2BB 1KIPA 4Y16B 4MD0A 1FAIH 3DJ9A 1A5FL 3ARDB 3NBNA 3N06B 3QDHA 4DKDC 5BQ7A 5KN5A 5DJCA 3TH2T 3EFDL 3HI6L 1I1AC 5A2KH 1FE8L 5C8JB 5DC9B 2PTTA 2V9TA 4KH2A 2X4SB 3OGCA 5C0JB 3EJYC 2X1PA 3B6SB 1NFDB 1U8OB 1BWWA 4WRLA 2DQCH 4LLUB 4PJGA 3PWLA 1NAKL 4ZTOH 1R5IA 5HI3D 1KSRA 5DTFB 3T1FB 3HI1A 4ZPTA 4HKZB 3HAEB 1G9NC 3S96B 4Y4FD 5JXEA 1INEL 4RMTA 3BN9C 2VLJA 1EHLL 4BQBA 4NCDA 1KJ2H 4S1RH 5M95B 4K7FA 5LG1A 2ATPB 1X5FA 2LU4A 3VXRD 1IGCL 3KJ6H 4WFFE 3W2DH 4KVNH 4S1SH 1YJDC 1MRCL 5D70H 2PW1A 3RPIB 4U4BA 2AXFA 1ORQA 2HFGL 3ORJA 1D9KB 2ORBL 1QSFB 3WLWC 1ES0A 5HHOD 1S7QA 3HZMB 3IDUA 1ZLVH 2PYFA 2X4PB 1J1XL 2AAVA 3TEUA 2J6EL 2YD9A 4H5SA 1B88A 1CVRA 4YUEL 1NFDF 3PP3K 4MNQE 5DF0A 2DJ4A 1QZ1A 2C4FT 2LTQB 2CR3A 2VXTH 2P8PA 5FYJU 4TNWF 3GMQA 3ARFB 4ZO8A 3O9WB 1F11B 1FZKA 3LEXB 2PO6B 3KNBB 4JFDB 5D1XC 3TPKA 1HINL 3KLAB 5ITFA 2FWOB 4Y4KA 1A7RL 4KKAD 3ETBF 1F3JB 4P3WA 3GFUA 1KC5H 1ORSA 2A9MH 2QSTA 2R4RL 4L8CB 5EH1A 2I07A 4MXWL 1RUAL 5D1ZC 1FL6A 3BPNC 3ULSA 3O45B 1NMCC 3QEGL 1WAAF 4TSAL 3MO1A 3OX8A 3RZWA 4OM0H 5CBAA 1FFNA 4JDTH 5J8OA 3WHXB 1QBAA 4RQQA 3CVHA 3CFJA 2XZZA 1OLLA 1BREA 4FRWA 4IDJH 3DURB 1YEEH 1T0MB 1BAFL 3MCLH 4WWKC 2R0WL 5JHDE 1Q9KA 1T4KA 4M6NL 1CFNB 4LCWB 1SEBA 2GSGB 2GJ6A 5EUKA 3V5KB 3ELAT 2ZCLH 3L3DA 1S7VB 4J2XA 1FNHA 1IGTB 2YMXH 3O3EA 4MQXD 4E9LA 1SBSL 1MY5A 1XGTA 2XA3A 5B3NA 1WEJL 1NCCH 4ZAKB 3I6LD 5L0QB 3WSQH 1WBZA 2FBJH 4ZFFB 4O2EA 5EU6A 1DQQB 1JGVL 1S78D 3QI9A 2BY0A 2D03L 2VDKL 2XWBA 5IF0A 3H3PH 4HK0A 2FB4L 1IEBB 4KK9D 3IKKA 4L4VE 2YEZB 4KK8D 5F8QC 4Q58C 3F6LA 1IAIM 1FL3A 1JRHH 4LPWA 3SDYL 3D25B 2Z92A 1T03L 3LKSA 3JVGC 3PNWA 2AV7A 1WGOA 4HKXB 4JANA 5AWNH 3G6JA 3V52L 2Z8RA 2BDNH 4OGXL 2ZOLB 2VLJD 3E6HA 3NIGE 1T21B 1JZ6A 4L3CB 2DAVA 2NY2D 5SWZE 3QUZC 2Z35B 3TH3T 4P5MB 4RMUA 4N0YH 3ZKXB 2DTMH 1IGJA 5CD3A 1RUKL 5ILTL 1D6VH 3TH4T 4JKPL 3BP7B 1TNNA 1BGXL 4KJQD 1UWXK 3ZHLA 3AREC 2YBRA 1VFBB 1VFMA 4YHML 1K5NA 5HHME 5C6TL 3K4DA 1TVBA 1MJ7H 3I3EA 3KPQA 3GIVB 1FCGA 5J13B 2E6PA 3KPLA 5AEAA 2UZIH 3VXOA 5CBEA 4ONHA 3DX6B 1UZ8B 5J57B 3MRBA 4GAGH 4HUUB 1SM3H 3ZL4H 1Q72H 1A14H 2CMRH 3FCTA 3L5XH 3SE8H 3MLXL 3O8XB 3GJFK 4UOW0 3D3VD 4KROD 1E27B 3UBXI 4Y4KD 1TJIH 3I50H 1DE4B 1KN2L 1I4FA 1FL5A 5LGHH 1EFQA 1G0XA 4MNQB 5GIRA 4BH7B 2XTJE 1TETH 3FZUD 3BMWA 2EC9U 3QG6A 4MQ7A 2BOCA 2PUQT 3UYRL 2UY6A 2V6HA 5EU5B 1YNLH 5DMIL 3NVQA 2V2TA 2CJUH 4J3WA 2YS4A 3QG7L 1QQDB 1WWWX 2NTFA 3BISA 1M4KA 2FATL 1C12B 1B0GA 4MA7L 2CDFB 4PJ5E 2PNDA 2GJ6D 3OKOA 4JO1L 4Z77A 4TVPH 2DWDB 1G7PA 2IBZY 3P77A 1MF2L 3GNMH 1UJTA 4PGDB 4QOKB 3TA3A 5K9JL 5HVGB 5EU6D 5DVOA 3QI9D 4I3SH 1IC7L 5JHDB 4PRNA 3NOIA 1PSKH 5E2UH 1X9QA 1K4DB 3NPSB 3V4PL 1FBIH 5DK0A 4XCFH 4BUHA 1CCZA 4Q0XH 1VACA 1W72B 4YDVB 5GZOC 2V2XB 4Z7UA 3LSOA 2B5IC 3UTTE 3ARPA 1RURL 3G6AB 4RAHA 4PJEB 4KVCL 5DJ2B 1AXSB 5HTSA 1QSEB 4MNGE 1WVZA 4PREB 3U2SA 4P49A 5DHVH 4R3SB 1S7XA 2GIYA 4LLDB 3OJVC 5DJXB 1WJ3A 2X42A 4IRJD 3THMH 4W81A 4XH2A 1OM3L 1KEGL 4OCWH 4PJ8C 1MFCH 5E6ID 43CAA 5CINH 3BDYH 3B9AA 4EBQL 4V1DA 1CTOA 2P8MB 5HHVH 3S98A 5IMLB 2EDOA 1KCKA 4JLRB 3BQUC 4FQXA 1EEZB 4LLMA 4D0DA 2Y5TA 5T5NG 5D6CA 3ARBB 1G7QB 2VB5A 4X6BA 1MOEA 3ME0A 1DUZB 3EUUA 2I60H 4QGYA 5LWYL 1A6ZA 6FABH 1PBYA 1RZJL 3TVMA 3GDBA 3S88H 4YFEA 4RGNC 3BP4B 3C60B 4X7EC 3GM0A 1HWHB 4YBQC 4N0CD 4OCSH 2UWEE 4JM4H 5HHPB 2R1XB 1ZT7A 4HBQA 5E8NB 3IXTA 3ZKNC 4PJEF 1JPSL 4HKBB 1PX4A 1R3HA 1N8ZB 4RZCB 2VAAA 3CVHL 1TPXB 5BZDB 4Z8FL 5ENWB 4R0LC 2H6PA 1YEJH 4JZJB 4XXDB 3U0WL 3IFLL 3QUXC 1VGEL 5CUSH 4I4WB 5HVFB 1MJUL 1GZQA 3LS4H 4X4MA 1HYSD 3QWOA 5EC2B 1UACL 3U82B 1JNLH 1XGUA 3PQYB 3FKUS 3WXVL 1XGYH 1ZT1A 3I02B 4JREB 5KW9L 2J1KA 3H42H 4ZQKA 1K6QL 3OR7A 4HWNA 5C0BE 3C2AL 2BC4A 3D9AH 1IL1B 4KUZH 1J10A 3ABZA 1EHNA 4C56E 1A3QA 3MLSH 1LMKA 4NHCL 2KL6A 1AKJB 3F7PC 4IRSB 1JNHB 4Y1AE 5BS0B 3BKYH 3PDGA 2UVEA 2HFTA 1RZGA 4HXAH 2XA8L 1KV3A 3FQUB 3TA3D 1H3WM 3EHBD 1GOHA 4M9PA 5DRNA 3N85L 3GBML 1A6WH 3TP4A 3WD5L 1ZS8B 1JIBA 2E8ZA 5E0QA 1KPVB 1QVOB 1BBDL 4XGZA 1FNAA 3DGGB 5CZVL 4MJ5B 5DD6B 5FDYA 3Q1SH 1I8MB 1T22B 1BM3L 2GSIA 1C5BL 2MQ0A 5IFJB 5E2VL 4MA8H 5CZXC 5JHLH 5HDQH 1A6UL 4P2OC 4AG4H 4ZOEA 3ARGD 3IJHB 4I3RH 2CIIB 5JQ6L 1ZHKB 1INDL 1JMXA 4MCYB 4WEMB 5C2BL 4K7PH 3TGXA 3S36L 1A1NA 5ESAA 1NGPL 2PETA 1GGBH 3PXJA 4UIMA 4DGIH 4GG6B 4V1DD 1AH1A 2F74B 5CP3A 2OMNA 5GGRY 1YQ2A 4FQXD 1I1CA 1H3TA 4A6YH 1JRHI 1URLA 5CJOH 4JGUA 4FXKB 4XCEB 4LDLB 1DEEB 4KTDL 4DVRH 1D5BA 1PW3A 5DRZB 2NLJB 1A7PL 3TVMD 4X99B 5DLML 1AI1L 3GSOA 2XWJA 1NJ9B 1Z9MA 4U1KA 3DWTA 2DD8H 3HZKA 1QEWB 2NXYC 4HJGA 4PGCA 5C9JB 3WFBL 2OJZH 3G5YA 2ZG2A 5I1EH 2GK2A 3B9EA 3HE7A 1YPZA 1F6FB 1KJMB 1CU4L 4HAGA 1I9RL 4R26H 3SDXA 5I18L 1H9VA 5HGHB 2RGSA 4BA8A 5DR5L 4U1JA 4CAGA 2W0KA 3RWEB 1A6TA 1KJ3L 4Y5YA 4GG6F 4GBXA 5ISZA 5BZWB 4XP5L 4CMMB 2F15A 3GKZA 4PBXA 3TBYB 4WHYG 5JDJA 5IEKB 1NFIA 3L3OB 1RVFH 4ZFGL 2FECI 1NBYA 1AO7E 4ZD3H 3PP4L 1E6JL 1SJHB 1MHHA 2VH5H 4U6TA 3STZB 2QKIB 2ADIA 4NFCA 1MLCB 4G8IB 1MIMH 4NZTL 1MFBL 2WLZA 5TGBB 3O3UN 3GK8H 1NCNA 3MC0A 1IRAY 3C09C 4WDIB 5MEPB 1UWGH 1S7RA 1MCFA 3CH8A 4G9DB 4N8CH 2H2PD 3MOAH 3V79C 4RFEB 1NGZA 3VGEA 4C56B 3WN5B 2ADGB 1JI1A 2NY0D 1O0VA 1XH3A 2KZ1B 4NQDA 4BQ9A 3C8DA 1BJ8A 4P57A 2O93L 2NY4D 4MJIA 4DN4L 3P9MA 4QHLA 1GL4B 2W9DH 1DBAH 1XGQA 2KDGA 4OFDA 1U8MB 4R2GD 4XAWL 3B83A 2O5YL 3QIUC 4NRYA 2ZOKA 1HNGA 3A6BL 3MLUL 2LFGA 5DUPL 3RTQA 2NTSP 4NQEE 4WUUA 3MV11 2IPUG 1OP9A 3F58L 1A7NH 5GS0C 3L95B 3HR5A 4NUGL 3SDDC 5DWUL 3ZHKA 1OGAB 4MGXA 3DMMB 1EO5A 3G5VA 1V3MA 3CC5B 1M1SA 5SX5K 1KXTB 2D9CA 4KZDL 1JF1B 5E8PA 2IF7A 2HT3D 3QFJA 3WDHA 4DGVL 5FYKH 4K23L 5E5UB 4ESKA 3BX7C 3T0WA 5DZLA 4JB9L 3CDGB 1IGFL 5HI5D 4LQFL 5I8EA 2ENYA 1TZIB 1MFEH 2NY5C 5BJTB 2C3VA 2X4TB 3K2MC 5EZIL 1U92B 1OARH 3GMLA 3FO0H 4F7PB 1G7MB 4YNYB 4KJPD 2R2BA 3TT1L 4Y16A 4H0HB 4U1LB 3HE7D 3L9RB 3VG9C 3ARDA 3A67H 4G6JL 4HUXB 3N1PC 4HZAA 3P9WB 5DDHB 5C8JA 5IBTL 4GBXD 5ISZD 4X98B 3JXAA 1P4BL 2WMPA 3K80A 2C3WA 1YMME 2X4SA 1T6VN 5C0JA 2VDPL 4GXUM 1G6RH 4U31A 4NQCB 3IDYC 3B6SA 1NFDA 4LASH 1U8OA 3FRPA 4D0CB 4LLUA 2OP4L 2EKSB 4HWEL 3DV4B 4LIQH 4AJ0A 3SJVE 4FG6C 3S4SB 1FH5H 5DTFA 4OB5L 3VI3F 1EZVY 4PJHB 4HKZA 3HAEA 4M1GH 5C0RL 4KI5F 3FL7A 3S96A 3DGCR 3NFPB 4PRDB 1ZGLM 5D4QA 1QBLL 3RIFK 4CKVX 2W0PA 4N8PA 2ATPA 1WAAA 5B38B 3V5DB 4G9FE 3QUMH 3I75B 2BJML 3AS0A 4TRPH 2MSPA 3ES6B 5I1GL 4BQCA 4KAQL 1FZOB 1D9KA 3FB6B 1QSFA 4OZIE 2IAMC 3HZMA 3MUZ1 1AFVL 3K8MA 4GAJL 1JZ3A 3ZYOA 1JMZA 2X4PA 3WIHA 1JVKA 5DC4B 3T09A 4NQSB 3OJ2C 3RTQD 1T1WB 4WUUD 5T3XE 3VWKB 3ARFA 2OCFD 4XWOD 3RBSA 1SY6A 5HVHC 3O9WA 2VXVH 5FOJA 1F11A 1F8TL 3LEXA 3KNBA 2PO6A 4JFDA 1BJ1J 2WBJD 1AR2A 4PTTA 3VFVB 1S3KH 1UB6B 12E8H 3KLAA 3QT2A 4L9LC 4LEOB 4PJHF 3S5LG 3SHSA 4EIZC 2FWOA 3MTRA 1AY1L 4ODBD 1RUQL 5JXAL 3UDWC 1F3JA 1Z3GL 4L8CA 3Q6FB 3NZHH 2NY1B 5I1AB 3O45A 1WWBX 4M6OH 1CT8B 5DD5H 5ADPH 2EO1A 4N1CA 4MYWB 4OZFH 1NH6A 3MODH 4DFHA 3MRHB 1G0YR 3WHXA 1PVHA 4WTXA 1RIVH 5AZEL 1DQDH 5HYIA 1BQLH 2A9NH 3DURA 4HIIB 4UDUB 1YQVH 1L7IL 1CFNA 2B4CC 4LCWA 4POYA 4H88H 5IW3A 2A0LC 2GSGA 4Y2DB 1PZUB 4Y16D 3V5KA 4M1CC 3T0EB 1S7VA 3U83A 3ARDD 3BSZL 5EB9A 1IGTA 3UBXG 4IRZH 2GJZB 4XPAL 4ZAKA 5EZLB 5DMYA 4GXVL 4YXHH 3OKYA 3PGFL 5GSVB 4ZFFA 2H1PL 1NGWB 1NMBH 3O6LL 1BHGA 5TF0A 4QEGA 5C08B 1IEBA 5T1LB 2YEZA 3K0WA 2QQKH 1YY9C 1YNKH 1MAJA 4HC1H 4DN3H 4JFFB 3D25A 2FSEB 5IR1B 1UQSA 1YNTB 1KENL 4BK4A 1GPOH 1OAKH 1CDIA 5DQDH 4NOBA 2ZOLA 3DX7B 4LHQB 3GKWH 3O3AB 1T21A 2O5XL 3BKMH 1KBGH 3MA7B 5I73B 3TBWB 2Z35A 2BSTA 2ZUYA 4LAQH 4P5MA 2VDLH 2EYSA 3BT2L 3BP7A 5AAWA 3L1OH 4HPYL 2NYYC 1RY7B 4MX7B 1B4RA 3GSRA 5DMGD 1MCRA 3PL6D 4LSRH 2VERN 4G6KH 4P46B 2N4IA 4ZG1A 2ADFL 1TQBC 3GIVA 3MACL 3ZSSA 4R9HA 3DX6A 1UZ8A 3BGMB 1LILA 4HUUA 4CGTA 3D0VB 4YDIH 3ARFD 1PDKA 3O9WD 1JYXA 1F4YL 4XPGL 1J1PL 2PO6D 4JG1H 4JFDD 3O8XA 4D0BB 5I74C 2W9EH 3TN0B 1E27A 1QHPA 1P4IL 1WT5C 4DKFH 1DE4A 1G7IB 3ALWA 2FX9H 1MCKA 4L1HA 1U8KB 4MNQA 2B1AH 4BH7A 5IQ9B 3BEVB 4DTGL 2HTLC 1MCNA 2IPTL 1GHFL 1L4IA 5EU5A 4FFWD 1L0XA 4XMLL 3U1SH 3KPRD 3OB8A 3C5ZD 4O9HH 1QQDA 2HA1A 1Q1JH 1C12A 5CFHA 3EO1B 1L7TH 2CDFA 1E4XL 3QEHB 4LCWD 5CLWA 1U41A 4CMHC 5A2LH 5FKPB 5T33H 5F9AC 4PR5B 3ZZ1A 2DWDA 4NM8H 3SGKA 1HQ4B 1CBVL 4R4FH 3VGBA 1J5OH 4ZAKD 4OCYH 2DQUH 1GGTA 3NAAL 5HI3C 4QOKA 3WFHB 3ARTA 2A6KB 5KSUB 1JZ7A 3B9KB 3KYAA 4YPJA 5JHDA 5H8DA 1HZHL 1ZE3C 1K4DA 2VISA 3LB6C 2J5LC 3K7UA 3V7MA 4ZYKB 1W72A 4P4KC 4YDVA 2V2XA 4ORGB 2IANE 1T2JA 1BQHG 3MV8B 4LKCB 4A2LA 1MHPH 3G6AA 3IJYB 3HFMH 3QQ4B 3LAFA 4PJEA 4X7TB 3K2UL 5DJ2A 3LHPL 2FEDC 4PREA 3SO3B 2OK0H 4XNXL 3D6GA 3RVWD 3CMGA 1NSNL 4R3SA 2R23B 1FDLH 3BI9X 4LLDA 3VDBA 3G08B 5DJXA 4XT1C 4DUXA 5TE7L 1ZHBB 4JKLA 4ZXBC 1EMTL 4YPGA 2P8MA 2VZUA 5F97E 5IMLA 4MWFB 3WIHL 5ALBH 2IADA 5ESVB 4JFHE 1EEZA 1F90H 2F5BH 3ARBA 3GMPB 1G7QA 1SY6L 1K9TA 4W6XB 5EO1B 3DARA 3MLWH 2F53B 2P24A 1DUZA 1HKLH 5KAQG 1CDUA 1KGCD 5BV7B 2QADD 1EO8H 4KKAC 4WFFD 3P73B 4P2CG 4QLRA 5ANMB 4O51A 3BP4A 3N1QC 5C09B 2OSLB 3C60A 4ENED 3BIAX 4OI8A 1AHWC 1F4XL 1J11A 4YDKH 5HHPA 2R1XA 2F19H 5E8NA 5IHZB 2D0FA 4BZ1L 1JGLH 4HKBA 4I18C 4NIKB 1WCQA 1YEIH 1ZTXL 4LKXB 4RZCA 1ZANL 3PGCB 4F9PC 5BZDA 5ENWA 1Q94B 4JZJA 4MNQD 3IDIB 3LD8C 4S1QH 4XXDA 3RVVD 4I4WA 5D1QB 1FORH 5AG9A 3O6FC 5D7SL 5EC2A 1PFCA 3IFPB 4FQHB 4L4TE 5J89A 3H0TB 3PQYA 3UTPE 4I1NB 5GGQL 4GSDL 1RMFH 1T1YB 2A77H 4S2SB 1JNNH 3MUGB 3VFGH 1VB9A 2DQTL 2ZG3A 1R3JA 2J88L 1AKJA 4WI5A 3OXSB 1L9NA 4IRSA 4U1GC 5JMRA 5IB5A 5BS0A 4K94L 5GGRB 1LO3H 4OI9A 1T66D 2ZUSA 1RIUH 1DQJA 4LNRA 3SKMB 1B4JL 2OR9L 3DRQB 3EYQD 1FYHB 1UWXH 4QOKD 3FQUA 2NR6D 3IDMB 3ROOB 5CD5C 4IIQA 3SE9H 2BNUB 1ZS8A 5J11C 4IS6B 4R90H 4PJ5A 3RNKA 5JHDD 3VA2C 4HIXL 1F42A 1CS6A 4OLUH 1KPVA 1KFAL 1QVOA 5IFHH 1A9EB 1DFBH 3Q3GB 4NSKB 5JXEC 3DGGA 4MJ5A 5DD6A 1UKSA 5J06A 1IAIL 1T22A 5DT1L 4UBDD 4J1UB 4DCQB 3MXWL 1A5FH 5DMJB 5KSAB 5IFJA 1A6AB 5AYQA 4CU8A 3FMGH 3VRIB 2AK1L 4AEIL 3IJHA 3HI6H 3GJFH 3SKUD 5INDB 1CICC 2CIIA 4F7TB 1ZHKA 2MHAA 1VEOA 4FFVD 1MCCA 4G7VL 1FE8H 4KZEL 4MCYA 4WW2B 3ZE0F 1AQDB 5IESH 4N0UB 1Z9SA 2NZ9C 4L4VD 1C5DB 3OAUH 25C8H 5IW6B 2F54B 5F89B 1NCBL 3CSYB 4GG6A 1RSFA 3UTTA 4M6ML 3WIIL 3ILQC 2NCMA 2F74A 1OWWA 1I3UA 1CDCA 1XR8B 4HMEA 1UM5H 3GM8A 1S9YB 4NQVB 3JWDL 4XCEA 2BY1A 3AGVA 2W59A 3ARBD 1I1AB 1DEEA 1QBML 1TLKA 2Z8SA 5DRZA 1G84A 2D9QB 3LPGA 4KROC 3GB7B 4NN5C 4MA3B 4Y4KC 4X99A 5KZCB 3UC0L 3O6KL 1NJ9A 2D31B 3GEWB 1I9JL 4P23C 5DEFB 1IGCH 3C60D 3REVB 1A8JH 1B0RA 3B8SA 3FZUC 4PJAB 5T3ZD 5C9JA 5HHMD 4TNWK 2EDHA 3RX8A 3D2UB 3OG4B 1KJMA 4EVNB 2HFGH 5D93B 4WW2F 1YY8B 4XBEH 4ZODA 3VCLB 2VDRH 5HGHA 4I3GA 4FQIL 3WJJA 4OIBA 1F3DJ 3RWEA 5IIEB 3LS5L 2VJXA 4HUWB 4YUEH 1P7QB 5BZWA 4UT9L 1XF4B 1CGWA 4CMMA 5J1AB 4P0DA 3RU8L 2QLVB 4KV5F 4H0IA 3ZTJH 1OOAA 3PQYD 3KAAA 3TBYA 2M2DA 1EAPB 5DA4A 5IEKA 4JRWA 1S9KC 3L3OA 1UJ3B 1A7RH 4N5EC 2DQDL 5GS2H 3QI9C 4YDJA 4W4NA 2VUOA 2LVCA 2QKIA 5EBWB 1AKJD 1RUAH 4IRSD 1FPTH 1MLCA 4G8IA 5CEZL 1EERB 3W9EB 5BS0D 3QEGH 5TGBA 4TSAH 1K85A 1W72L 4JN2B 3F7QA 4WDIA 3RGHA 5MEPA 4Z5RB 1WWCA 4PJAF 3BPOC 4G9DA 5A2IH 1U93B 1KEMH 4P5TB 4PJ5D 5FAAA 3KPMB 4RFEA 5D1XB 4C56A 3WN5A 2ADGA 1BAFH 3DSFL 1OP5K 4OF7A 2R0WH 1XIWD 4Y1AA 3N9GH 3PWJB 4K9EL 3VRJA 3D39E 5TQ0L 2WWKT 3JV6A 3LDBC 1WEJH 2X10A 3TZVB 2EYTB 1U8MA 4N5UA 1PY9A 1QFWM 2IBGA 4XC3L 4GG8B 4W4OC 1LO2L 4YZFE 1OAUL 3Q5TA 4XPTL 4X6CB 5AZ2L 3IAGC 2BHZA 1NBVL 5A43C 1H3UA 5F7EL 1RPQA 3AS3A 3L95A 3BUYB 4YE4L 3UTTD 5GGSB 5I0ZA 4G80B 3SDYH 4F9LA 1OGAA 2VN7A 3A6CH 1ZSDB 3DMMA 1ED3B 3CC5A 4FN0A 5JR1L 1J0JA 4JPKH 4N0CC 1JF1A 5F21B 4F3FB 2V5MA 5T3ZL 2VC2H 2GHWB 2F58L 2VL5B 3BAEL 1IQWH 2XQBH 2QR0B 2AK4B 4K71B 3BPLC 1Q9WB 3SE3C 3CDGA 1NCDH 4ELKB 3RGVD 5FHBH 5GGVY 1TZIA 2OX5A 2WQRA 4XPHL 5BJTA 2X4TA 5I0DA 3V5HB 3W39B 1INQA 3V6OA 5JOPE 4O2FB 1U92A 4I77L 3QIWB 5L2KE 1RUKH 1SEQL 3EYVB 3TLRA 4JKPH 3WS6A 5IFAL 1G7MA 1BGXH 3IAQA 1CDHA 3IETB 4HAFA 4KRPC 4YNYA 4U1LA 5HDBE 1DSFH 2P48B 3L9RA 4MAYC 4RA3A 1QOKA 5AYUL 4HUXA 1TVHB 2Y7QB 4X6CF 2AEIT 2NW3B 5DDHA 3QCTH 4OKVB 2EYRB 4X98A 1FVCB 4IJ3C 2HRPL 5C6PB 4JGJA 4XAKE 2PKDA 2DIBA 3C08H 2FO4B 3MLXH 4NQCA 4RGNE 2C1PB 1LP9B 3OKKB 4D0CA 3TA3C 4KWUA 5H35B 1U3YA 2EKSA 5SWSE 2R1YB 3AREB 5T1DL 3NIDF 1KN2H 4EUPH 3S4SA 4M48H 2R0KH 2VQ1B 4PJHA 4WTWA 1SJVA 3AY4A 1LEKB 3CH1B 5D7LB 3NFPA 4PRDA 1G7LB 4KTEH 3R1GL 3EYUH 5A16A 5DMIH 2EE3A 5B38A 5D7JD 3HE6B 2FATH 3V5DA 4C56D 5BCAA 5JUEL 5HY9B 2EE9A 1XF1A 4MA7H 4PJXB 5F7NC 3I75A 2X6MA 2M26A 4Y1AD 5FYJH 1CTNA 3DYOA 4XVUD 3ES6A 4WI4A 5K9QI 3LEVH 5HPMA 3FB6A 3DNKA 3MV7B 4ONGL 3DV6B 5K9JH 3ULVC 2IFFH 1IC7H 4E41E 4NQSA 1LP9F 4QTHB 4H1LH 2WAHA 3O2WL 3BESR 1A21A 2JJTA 1UB6A 4LEOA 1UZ6F 1OCWH 3TVMC 3WFZA 1OGAD 3DMMD 1J12A 4NWTH 5CIPB 3Q6FA 2BXYA 3ULUF 2HH0L 2AJYH 5I1AA 4X5LA 4HH9B 1LDPL 1CT8A 1PYWB 2Q20A 3DVGA 3F7YB 4CVWA 2EDQA 5C92A 1OSPL 3MRHA 2KQMA 4KI5D 4PJXF 1CD1B 3B2UD 4TSBH 4NM4L 5DMKB 2D2OA 5DVMA 4QRSB 4UDUA 2LAGB 4HIIA 3AS1A 4L5FH 1E0OB 4MD5A 4KUCD 4Y2DA 4F7CB 3T0EA 3JWOC 2IG2H 2EDKA 4WI2A 3PG2A 2UZXB 2GJZA 5EZLA 3QDGE 3ZE1E 5GSVA 1NGWA 2Q6WB 1CIDA 4QY8A 4RBPH 4PJ8B 2Y6SC 2A6JB 5JW5B 1FHGA 5C08A 2E27L 1IKNA 2EDEA 4NJ9L 1J0YA 5T1LA 4ZUSA 5DRXB 4Y8AA 5T5NF 4YFLF 5F44A 5GQBA 4JFFA 1CR9L 2FSEA 5IR1A 1YMHB 3UZQA 5EO0B 1YNTA 3BKJL 1LWRA 4P2QB 2ZKHL 3DX7A 2BVQB 1ZHNB 1CL7H 3O3AA 3OAYK 4WEBH 3MA7A 2A6IB 5SX5H 5B39G 2DQGH 3TBWA 4AY0A 4M8VA 4U1SB 1JE6A 3KYNB 1BIIA 5FA4B 4Q9RL 4HS8H 4G8GB 4XP4L 3DXAB 1BFOB 4JY6B 1ND0B 4D2NA 3LN5B 5C0GB 2RJMA 4MX7A 4L29B 4N8VG 5EUOE 2NY7L 2R4SL 3HG1E 4QRQB 2HKFH 1P4LB 4P99A 4P46A 1AXTL 3DRTB 2XA8H 1EIBA 1E4KA 3LKRB 3OR6B 2R15A 5I8OH 1JYVA 4G9FA 3BZ4B 4HQQL 1GJIA 3O2VL 1IEAB 3MLVL 3BGMA 3D0VA 5HI4C 4GOSA 5CZVH 4M7ZC 4NKOB 1WK0A 2VNCA 4I2XE 4YQXH 1VPOH 2MFNA 1XGRB 4D0BA 1G9MH 4HGMA 3TN0A 4CDHA 3K74B 1UADC 4MHHI 3FHQA 5E2VH 3U79A 1G7IA 3HPLB 1U8KA 3OWEA 1HDMB 5B8CC 3QQ9C 2NY1D 4FS0A 4NQED 5IQ9A 4KJPC 2AJXL 5C2BH 3BEVA 3V6FB 3S36H 3HE7C 2EH7L 4Z7QE 1N5YH 5DI8B 1NGPH 1HKFA 5MI0B 4OD2B 1RFDL 4AMKL 1GAFL 3MV9E 2B39A 1REIA 1M6OB 3EO1A 2QSCH 3GMNB 4GBXC 3QEHA 2P46B 5FKPA 3VFOB 2OBGA 4P2OB 4HS6B 3T0ED 3T3PF 4OLEA 4PR5A 5I19L 1HYRC 1FNGB 4G3YH 1NDGB 1RUPL 1OAQL 1UGNA 1EEQA 4J4PC 5C9KA 4G5ZL 3WFHA 3VFPB 5IBUG 5KSUA 3LMJH 3B9KA 3ROLB 3BZEB 4MJ4A 3N1GC 2DI8A 3QR2A 5E95B 2YPVL 2AS5M 1T5XB 5C08D 3RIAF 4JHWL 1EO7A 2FEEL 5T1LD 2X1QA 1FVEB 4ZYKA 5IB3B 4ORGA 4XHQA 3MV8A 4NKDB 3TFKD 1CU4H 1MI5E 1I9RH 1I7UA 4JFFD 3QUYB 3RKDC 3IJYA 5I18H 3FQRB 2R29H 4KK5D 3VD3A 1CGTA 3E1F1 1B6DA 4Z7OE 3ZMRA 3L3JB 2R23A 2FO1A 2DMBA 2MCPL 1FNLA 3G08A 2Z8VC 3GGWA 3X14B 5F7FA 4K2UH 2GCYB 5CSGA 4PB0L 3VRLE 1DQTA 3QFDB 3QIBB 2DLGA 1ZHBA 4XHJC 4OZFG 4ZFGH 3DIFB 4HWZB 5DEZA 2Y25A 1A7OL 4PJBE 1QG3A 5ESVA 4XX1E 4OTXH 4Y19B 2DMCA 3GMPA 5LQBH 5EO1A 1MFBH 1GGYA 5C0IB 4P46D 2DTSA 3MZGB 2XZQH 3EJJX 2DLEA 4G9FD 1U2HA 3P73A 3PF2A 3JWNC 1QFPA 1F4AA 3GSUB 1IGIH 5C09A 4BSJA 2ZCHH 2OSLA 4JQVC 3W0WB 1I8IB 3QXWA 4GW4B 1R3IL 4JHAL 1B2WH 2VLRE 3HG1B 5IHZA 1A6VH 3TN0D 3EDFA 1Q9OA 2H45A 1PKOA 4LVOB 1SJEA 2Q7YA 3KYMA 3PGCA 2Y07L 4JDVB 2EICA 3IDIA 4R97C 3C09B 4LSTH 4QRPE 5D8JH 5CMAB 2CKBH 4G8FB 4OF8A 4NBXB 5D1QA 3MLUH 4Y16C 4OQTH 3U0TB 4I2XB 1Q0XL 2YD1A 1FC1A 1OT2A 1S7SB 4X8XA 4PS4H 3IFPA 4XP9L 1EBAA 2HWZL 3BIKB 3H0TA 3CFIC 2XN9E 3QZWG 2EDDA 4NUGH 1UVQB 3VGDA 2Q7NA 5KOVC 4OAWA 4M4RA 4FXGA 3KS0J 4S2SA 3QPQC 3MUGA 4K8RD 3CFCL 3OXSA 4KZDH 1CF8H 4XCCL 3GIZH 2YA0A 1EA9C 4K23H 4NNXB 1CZ8L 5GGRA 1I3VA 1MRFL 1T04B 3QIUB 3QWRA 3SKMA 3DRQA 4JB9H 1IGFH 3IDMA 3KXFE 4M62L 3ROOA 3GRWA 4LPXA 3LOWA 2BNUA 3B9KD 4XBPB 1G0DA 1IM3B 2WQ8A 4M7JL 4IS6A 3S35X 3JBG7 1W0WB 1N6QL 2UY7A 1A9EA 4B0MM 15C8H 3Q3GA 4NSKA 5FHAL 3VGAB 3MV8D 4J1UA 4DCQA 2VR4A 5KSAA 1PX3A 1A6AA 4GT7A 4BUGA 3GI8L 2XQYK 4G6JH 2R69L 5INDA 5HSFA 1NKRA 4F7TA 4FFYH 3TF7C 4WW2A 4O5LH 1AQDA 2C4XA 2YUXA 4N0UA 3BH9B 5HVWA 1A2YA 1P4BH 1C5DA 5IJKC 2VDPH 2G75B 1D9KC 2N7AA 1MCHA 4FQJH 1U8LB 1X6NA 2F54A 2R2CA 1C1EL 2K9UA 3CSYA 3EJZD 4MJ6B 4U2ZA 5F89A 1I9IH 3F65A 1ACYH 5C0AE 4JPVL 4UV4L 1LO4L 1XR8A 3OB0K 4NC1C 1S9YA 3INUH 4NQVA 1A3LL 2RBLA 4OCRL 3I3BA 3S9DB 1I1AA 4ETYA 4P9HL 2PO6C 2ZSWB 1KELH 5D6DA 3GB7A 5D7IB 4HJJL 3DETC 4JM2B 1QBLH 1HHGB 4MA3A 3V4UH 4FABL 1CL7I 1Y18B 2D31A 3O11B 5IGXL 4PJ9C 1KN4H 3REVA 4YBLC 1DCLA 2D0HA 4GKOA 3HB3D 5JNYB 3BWUC 3S5LB 3KR3L 4BYHA 5I1GH 1RJCA 2WP3O 3D2UA 3QBTB 3MBXL 4EVNA 1YY8A 4PLJC 1N0LA 2JCCE 3AFLA 4QXGL 5KTEL 1AFVH 2GAZB 4GAJH 5CP3H 5EZJB 3VCLA 3U7YL 4G42B 3B4NA 4S11A 4XVSL 5IIEA 3T2NH 4HUWA 4KHXH 1P7QA 1XF4A 4LOUC 4K8RL 2VLRB 4PLOB 4PLKD 2E3VA 5GJSH 1F8TH 1EAPA 4JR9L 4TSCL 4ORZC 4D9QE 4Z7OF 5L0QC 3BRGC 1T1XB 4WENB 1UJ3A 1RUQH 3PXHA 1YN6B 4QRPB 4Z7VE 1XCQB 4U1MB 1S9XB 3U9PL 2P5WB 2IAMB 5D7IF 2YUVA 5EBWA 4JM2F 2Q8AL 1H5BC 5LGJB 4EKXA 3CXHJ 3KWWB 5DURD 1OSZB 3QWRD 4JN2A 3QDAA 5KVDL 3WFEL 1ZT4B 5TE4L 4Z5RA 3MRDB 1ZV5A 1IKFL 5HVHB 1U93A 4P5TA 5AZEH 4JFPB 1AE6H 3KPMA 5ESQA 5L88H 5D1XA 5HD8D 3V8CA 1N0XL 2YN3A 1L7IH 4Q9BA 3HC4L 3PWJA 2DLTA 3B5HA 1GOGA 5KSAD 1U8JB 3MA9L 5BXFB 3E8UH 2GI7A 3KXFB 2OZ4A 2APWA 4XPAH 4F57H 5D2LE 2EYTA 5F7KC 2ZJSL 1FO0H 1XR9B 5TE6L 4F58H 2H1PH 4GG8A 2N7BA 3SQOH 1QA9B 5BOZG 4X6CA 2AEPL 4L4JA 2EDXA 4PG2A 5CJXA 2F54D 1U8PB 4QWWC 2DQJL 3RL1B 3AB0C 4WTZG 3BUYA 4WWKA 3LH2L 3NABL 5K9KA 5BV7L 5J13C 1P6AB 1GOFA 4G80A 1ZSDA 5IM7B 3U7WH 1ED3A 3JWDC 1UH3A 1TFHA 2XPGA 1YYLL 4F3FA 1I1AD 5C07B 3TC9A 3O8XC 5K9QG 2VL5A 3MRGB 3F8UB 5BRZE 4NN6B 1Q9WA 5KZCD 2HKHH 1CE1L 4ELKA 1H3XA 5B3JF 1UM4L 1JN6B 4YXLL 4N90D 1MAMH 3ET9F 3EJYD 4K3DL 3CJJA 4PYHA 1NAMH 2CQVA 4MDIB 3V5HA 3W39A 4JFHD 4O2FA 2Z9TA 4GMTH 2DWEA 3BT2H 3QIWA 3QPXL 3EYVA 2FHCA 3H7LA 2VYRE 3IETA 3RI5K 4F15B 4OZ4B 5IB2B 2IEPA 4RFOH 4OBRA 1UA6H 3U9UA 4Y2OA 3IU4L 2GUOB 4OGYL 3ZHDA 4PUBL 2AJSH 5JIKA 2DQEH 3ZDZE 1TVHA 3BN9D 3QAZB 2Y7QA 5IVXB 4JQIL 5GJTH 5HJ3B 2NW3A 4HFUL 4OKVA 5A3ID 1P7QD 4O02L 1FVCA 3MNWB 3IRZA 4XPBH 3FO1B 5IB4B 2VMFA 4KFZC 4J3XA 3SGKC 1GGCH 4L3EE 2D7TL 1F4YH 2FO4A 3QJHA 4XPGH 1KJ2B 2FGWL 4HDIB 7FABL 5H35A 3EYSL 3GRWL 1RULL 2R1YA 3AREA 1A1OB 4JRYB 1IT9L 1F6AA 1JPST 2ZCKL 3RUGE 4M1DH 2VQ1A 3WLWD 5KVFL 5F71A 1HSAA 1CWVA 3RZCB 4M7LH 3RX7A 1S7TB 1TQBB 1LEKA 1JHLL 3CH1A 4L4TD 5D7LA 5IW1B 1G7LA 3GSXB 4W68A 5CEYB 3MBEC 5I15H 4U7MA 1TTGA 1RZ8B 4P5TD 3CD4A 3O3BA 3HCVB 3HE6A 5D1XD 4OLYH 1U6AH 4WGVB 2CUMA 3VG0L 5HY9A 5TDNB 3RA7L 4PJXA 1E4XH 1EJ6A 4LP4A 4X7SH 4ZDHB 3QQNA 4AIOA 5L9DH 5IVXF 3DVNB 1U36A 4J3VA 2VRAA 5FGRA 3SDAC 4LSUL 4WU7B 5C86A 3EOBB 3DV6A 1X5JA 3NAAH 3T08A 3TYGL 4Y4HC 1DBML 1QFUL 4QTHA 1E28B 4KGLA 4ODTL 3DHMA 3GBNL 4NZUH 5FYLH 4NKIH 4WWKD 1XEDA 1BJMA 1DLHA 4FQQB 3CLFH 4OIIL 4JZNB 2CO7B 3BO8B 4CN6A 3ZTJG 2VLJE 3ZT6A 4CUCA 3ZLQC 4RWYL 3K2UH 5CIPA 3BGAA 4HH9A 4ZUWB 1PYWA 3F7YA 3FT3A 4NCC1 3STBA 3CIQA 1CD1A 4DOHB 1K3ZA 2AABL 3QHZL 2EDRA 2J5LB 4OLWL 5DMKA 2VQUA 2ICCA 1OTTC 1OAZH 4XMPH 4HWBL 4QRSA 3AAZB 4P4KB 3UJTL 3IS0X 3QIWD 1CLYL 3VFMB 2V5YA 4F7CA 4RIRB 1NC2A 5BRZB 4U6XB 1AJ7L 4JREC 4MSWA 4MHHG 1JL8A 3FRUB 2MKLC 1OAXL 5DJ8B 3PGDB 2X1OA 3H6JA 5CILL 2Q6WA 3CXHK 3QCUH 3S35H 3WHE1 2QHRL 4PJ8A 3VWJC 1S8DB 2A6JA 5JW5A 4DW2H 1NLBH 1F4XH 5EN2A 2OQJB 2XT1B 3EW3B 1MFDL 1I75A 4BZ1H 5DRXA 1ZTXH 3V7AE 5E4EB 4X6DB 3ARED 3NCEB 4UTBL 4ODSL 1HQRB 1YMHA 5KAQF 1NLDL 1OAYL 2BSRA 5EO0A 1Y6NR 2FJGB 5D7LD 4P2QA 1G9EA 2BVQA 1ZHNA 4PRHB 4YHNB 3HNSL 4JVUA 4I48B 4HK3J 2A6IA 1X5KA 1HH9B 2OZ4L 5CZKA 1AHWB 3KYNA 4YHKL 3HE6D 2H26B 5FA4A 4UT6H 3RUGB 3T0AA 3UAJC 4PTUB 2APVA 1VFUA 3MLZL 4G8GA 4I18B 3DXAA 4UOJA 3QEQE 2BVOB 1EV2E 1TCRB 1ND0A 2DQTH 2J88H 3LN5A 5C0GA 5C0FB 2ILLA 4ZS6C 1KTRL 4L29A 4YHZL 2RHEA 4K94H 4QRQA 4EOWL 3QUXA 3BIBX 1P4LA 2QSQA 2AJUL 1B4JH 2OR9H 3DRTA 3LKRA 5FYKU 3OR6A 1FIEA 3J7HA 3E6FA 3BZ4A 1IEAA 4QNPE 3MLYL 4LPTA 4HIXH 1NGQH 4PRPE 1MQKL 1ULVA 2MPAL 4X6DF 1TZGL 4NKOA 2MQ3A 5DT1H 4WW1B 1XGRA 3G6JE 4NKMB 2JIXB 1V3LA 2ITCB 2J3SA 4AEIH 3RWIB 3HPLA 4HZLA 4WFEE 5IMMB 4FZ8H 4BK5A 4K55A 3VFRB 3I2CH 5ACZB 1QLEH 3N0PB 2APXA 3V6FA 4KDTC 4X9FA 3DOSA 4LMQI 5DI8A 2VITB 5B21A 2E7LC 2Q86B 5I1KL 4OD2A 1X5ZA 3WIIH 9CGTA 1RAMA 2HFEB 4IMKC 1M6OA 5GZOD 3VD7A 3GMNA 3UJJL 2AJVL 1PG7W 4P2OA 4HS6A 1NC2D 4MAUH 4UQ2B 1CICB 4AEHL 3OKMB 4U2YA 5BOPA 3NGBB 3GMRB 4NO0B 1NDGA 4XXCC 3M1BB 1XZ0B 1CQYA 5L8KB 5ADOH 3KPSE 3WE6B 2FZ3B 3CCHB 5JOPD 1OQOA 3NZ8A 5CSBA 3EOTH 3ALPA 3O6KH 3UC0H 3ROLA 5HYFA 3BZEA 2EE6A 4PJ8D 3S3JA 5FUZL 1CGSH 4LVNB 2DLIA 1T5XA 1EBPA 2Q3ZA 2DI7A 4Z95L 3BQUD 1I3RB 1FVEA 4OFVA 5HHQB 5IB3A 2BRRL 4NKDA 3HNVL 4PP1C 5JA9A 2ERJB 5HXMA 3FQRA 4YJZL 4EI6B 4P2QD 3L3JA 3T77A 3OL2A 3RU8H 4P23B 4RGND 2YZ1A 3MOQA 3X14A 1PZ5B 4WHDA 2GCYA 2YUZA 4YBQD 1IC4L 3HMXA 5SWSD 3QFDA 3QIBA 1YEHL 2X2YA 1YECH 1MNUL 3ZKND 4HWZA 4X5XB 5EU7E 2DQDH 4BM7A 4Y88A 3OAZH 3EO9H 4KQ4H 3UEZA 4Y19A 3O2DA 5E99L 4O4YL 4ODXB 3B8YA 3QUXD 3TBVA 5C0IA 2VXSH 4L8SB 3H9SB 4B7IA 3I6GA 3B9VA 4Z7UE 4E42B 3BRDA 5DUBB 5CJBA 4LQ1A 3W0WA 2VABB 1I8IA 3DSFH 3WNKA 4GW4A 3SOBL 3WNMA 5EUOA 2YD3A 5DS8B 4X6EB 1GH7A 3HG1A 4N1HB 3TJEH 4K9EH 1E4XI 4KI5C 5JZ7C 3EYOA 3FAXA 4H8WH 1CVSC 1N7MH 3B2UC 2CD0A 4CNIB 5CCKH 3OKLB 1ZEAL 4WFHE 4JDVA 4WHTB 5F9JB 1D5XB 1NUGA 3QQ3B 1KACB 4AEEA 1DZBA 5CMAA 5ITBL 4PRPB 1KB5H 3WS3B 3M8OH 4G8FA 3B9DA 4V1DE 1OAUH 3QXVA 3FB7B 3BPOB 3U0TA 4I2XA 3F5WB 3T0DA 5FO7B 1GIGL 2IH1B 5AZ2H 1S7SA 2X4UB 3UZEA 3ULVE 1YN7B 3BIKA 3QO0B 4J23A 3RAJL 3FFCB 3BDBA 5L7XL 3MFFB 3OAYH 1CD8A 1T2XA 1UVQA 4PY8J 3VXMB 3R4DA 4DZ8B 3GMOB 5CZXD 1SYSB 2ZUUA 2GY7B 4P2OD 4OM1L 1TNMA 1GC1C 3CX2A 3ARSA 5SWQA 2F58H 4NNXA 5F1SA 1QLFB 3K4ZA 1T04A 2GTZB 3QIUA 4JO2H 5DVNA 3WFCL 1OD9A 1FN4B 4K3EL 1JV5B 3CK0L 2ARJQ 4XBPA 5GISL 1IM3A 1QLRB 4JCLA 3FOLB 2WUBL 1W0WA 3QYCA 1SEQH 3SDDA 5CP7B 5IFAH 2DM7A 1E4WL 1FYTB 4OZHB 1A1MB 1TCMA 3I9GH 3QDGD 3KPSB 1H8OA 2Y72A 5AYUH 2GITB 2WINB 3L3IA 1EVTC 3K46A 3MJ9A 4PIRF 4HS3B 4A6YB 3BH9A 5JPMB 4V2BA 5TPWL 2ED8A 2HRPH 3VA6A 1J1OL 3LZFL 2D4DA 2UUDH 2NXYD 1U8LA 4MJ6A 3QIBD 3KPNA 1N6UA 4J3TA 4KRPB 5T1DH 2W0LA 4IOIB 4MAYB 4Y19D 5K9OB 5J7CC 3AC0A 3HTLX 3VWKC 3DVFA 3WFDL 4MB4A 4X9IA 2O61B 3KPPB 3NN8B 3W11C 1DBKL 2JJTC 5EPMB 4XP1L 3LPWA 1WICA 4HGWB 5FUCC 4JM2A 4DZBB 1ZLUH 4OCMC 1YEGL 5IQ7L 2VO5A 2YPLB 3IF1B 1Y18A 1EGJH 3O11A 4XNUL 3OZ9H 5JUEH 5INCA 4UU9A 2Z31B 1R5WB 3RWDB 3W0WD 5JNYA 4OZHF 5DJZB 4Z7WB 1T20B 3VXUB 1TITA 2CRYA 4KY1H 3HG1D 3S5LA 3U30B 5IKCB 2VKXA 3QULB 5DO2C 2M1KA 5JPNA 4KDWA 2GAZA 5E00B 5HYJE 4G42A 3RX5A 1F00I 1FCCA 2WUCL 4Z7NE 3LQMA 2MQCA 2V9RA 3IGAB 4LFHD 2COQA 4Y2DC 4JJ5B 3WMSA 3ESUF 5DXWA 4DKEL 4UINL 2VLRA 4Q74A 3RL2B 5LBSH 3O2WH 5E1AB 5I1HH 3ZDXF 4KPHL 3V6ZB 1H8NA 2EIBA 4QHUB 3B5GA 4GRWE 2BP3A 1IAII 2R1WB 1X4YA 3VXSB 1YN6A 4QRPA 4BQ8A 1XCQA 4U1MA 1S9XA 2FHFA 2P5WA 2IAMA 1BPVA 2ZZUT 3WL9B 4TOYL 1IKNC 4OLZL 5LGJA 2X4QA 3QIUD 4XZUB 1OSZA 4JCMA 1OSPH 2XN9A 1MCWW 1ZT4A 1YEDB 5J3HC 4G43B 3MRDA 3MV9D 4Z7WF 4ZS7L 5DUML 4JFPA 3VXPB 3LIZH 2EZ0C 4DUWA 3MRFB 5GS0D 3UTSE 4L9LA 5FM8A 4TUKL 1QHOA 2CH8A 3SDDD 4NNPH 5I17B 2E7HA 1ZLWK 5I73C 1AC6A 5I1CH 3WNPA 1U8JA 5ISZE 5BXFA 3HMXL 3KXFA 5IV2B 3IDXH 1PLGL 3LQZB 2AEQH 5D2NB 3M07A 5DJ0B 1A7QH 3WLBB 5C2UB 1I85C 4U3CA 3SCMB 1FG9C 5F1IB 1CFSA 3O2DL 1T83C 1QA9A 1BOYA 5B39B 3HI5L 4HXBL 4NJ9H 1OGTB 4P46C 3RL1A 1H3PL 4FZEH 1OPGL 3TWCH 2Y06H 2YZ8A 2Y4SA 5JQHC 3U4EA 2WBKA 5GHWL 4U6YB 2IALB 5IM7A 4R7NB 1EFXB 4N8VB 2VDOL 3BKJH 4RGOL 2WWMC 1Z5LA 4P9HC 2B0SL 5C07A 2ZKHH 2BZDA 3MRGA 4F33B 4LARH 2NQCA 3F7VB 3TN0C 4MLSA 3X13B 3NFNB 2R39A 4NQDE 2DQHH 4HBCH 1LDSA 1JN6A 3QDJE 4MDIA 1WFOA 1CGVA 1QKZL 3HA0A 3O6ML 4MJIE 4WJ5B 3UO1L 5F7YC 2R56L 2EEDA 3QHFL 4XMKL 4OZ4A 5IB2A 1PG7L 3GSNA 1ITCA 2NY7H 2R4SH 5F6HI 1G6RB 2GUOA 1FGVL 3LEYL 4NQUA 5IVXA 1J86A 5HJ3A 4K8RC 2BVTA 3MNWA 3FN0H 4M43L 3FO1A 2VLRD 5IB4A 5IG7B 5F7LB 5GRVL 4F2MB 2VR9A 5CSZB 4JN1L 4GQ9H 4HDIA 4M5ZL 3QFJE 5L6YL 3ALXA 4B7LA 2QQLH 5HYJB 1MCOL 3MMEB 3BYYA 4QRPD 4OKDA 1CQKA 1UM6H 2IAMD 4OCLC 2MMXA 3QUMB 3RZCA 4YIQB 1S7TA 4Z0BL 4MCZB 4PJDB 2AJXH 2BERA 5IW1A 3GSXA 1P53A 5CEYA 3OB0H 2XN9D 2B2XL 4QKXB 3GJEB 5CGYC 4M7ZB 5D72H 3RVUD 4PLNC 1BLNB 3HCVA 2JB5L 4DWHA 5TDNA 4Z7VA 3MJ9L 1DQML 1CD0A 3KLHD 2DKSA 2DMKA 1HNFA 1MCJA 4ZDHA 4NYLB 3RIAK 5KS9B 5KG9B 4JAMB 4HEPG 3KHOA 1U42A 3SKJH 1KYOJ 5B8CB 3KXFD 4JG0L 1DUYB 1OAQH 3MLRL 5TFSH 4WU7A 2QQQA 3EOBA 5I1DB 1NFDE 2FJHA 4TQEH 3J8F7 2O5ZL 5EWIL 4IHOB 4KQ3L 4OLVL 5E8DH 1E28A 2VDQL 4TTGA 2EIZB 3QB7C 4JFEB 2YWYA 5BV7C 4FQQA 4QXWA 2A0LD 4JZNA 3BO8A 5EO9B 4PJDF 3HB3C 5JW3L 4Q9QH 4HMCA 2APBA 5C07D 4ZMAT 1WAAE 3MXVL 4ZUWA 1MREH 2WIIB 3HRPA 5DD0H 2MCPH 3HLAA 2YRPA 4RAVB 1A3RH 5E56A 2JE8A 3P2TA 2I9TB 1VERA 1D5IL 5C0AD 2FR4B 1LK3L 4DJMA 3S37X 4AK1A 5KS9F 4P4KA 1YY9D 1QSFE 5BVPL 5F88B 5D1QC 3VFMA 5JW4R 2BFVL 4ETQB 3LKNB 4MXQC 3VGHA 2VZTA 5FOBB 1DN2A 4XVJL 5M7QA 4RIRA 3IFNL 5BRZA 4EDXB 4U6XA 2YKLL 5HHXH 3X17A 5DD1L 4NC1E 5EOCJ 3QDJB 3FRUA 5DJ8A 1QO3B 3PGDA 1CXHA 1N64H 3QA3B 1KXVC 1KCVL 4JFDE 5CEXB 5J0BA 2CUHA 3CXDH 2AQ1A 1S8DA 4YAQB 4OUOA 4J3SA 4OD3H 3P4LA 4ALAH 3QZWB 4C4KO 1CGUA 2OQJA 5KJRH 2IBBA 3KPTA 5F7DB 1JZ4A 5EOCL 2DBLH 1EH9A 2A74B 1HQRA 2Y07H 3DI2B 4X4XB 5DVKA 2ATKB 2JJVA 2NW2A 3V0AC 5FECB 2FJGA 3EDEA 1A22B 4ZTPH 4C58B 3JSSA 4L3EA 4PRHA 5GGVL 4YHNA 4JVPA 1OT1A 1Q0XH 3IJSB 3ZDYF 1J8HB 5BO1L 5KSAC 4R8WL 4LCWE 1HH9A 3U6RB 3S34L 5TF1H 1AHWA 2IPUK 1LEGB 5KVEL 2H26A 3RUGA 4WW2C 4WNQB 4I18A 4FXLA 5CHNB 2BVOA 4XRCB 1TCRA 2F5AL 4HH8A 5C0FA 2KKQA 4F9PA 1NCWH 4LSSL 1MSPA 3MJ8B 4R97B 5FUOH 5MEOB 1MRFH 4WU5B 4U1IB 2B4CL 1A4JB 4YX2L 2HTLD 1C16B 3MRKB 3O6FA 4M7JH 4HUMB 3KS0H 3B2VL 4OGAC 3RJQB 1N6QH 2XI9A 3CSPA 5MENB 1Q0YL 3AXLB 4OCNC 1KB9J 3GHEH 3MUHL 5D6DC 2G2RB 4ODUB 2BY2A 3DUHA 4WW1A 3U7AA 1FAIL 4KJWC 4NKMA 4PGZA 4FQCL 2JIXA 1CXEA 1LGVA 2ITCA 1R6VA 2OL3H 3RWIA 1IE5A 4P3CH 2R69H 2WBWB 3I85A 5GRVK 3QUKB 1MHEB 4X8JB 2Q87A 5IMMA 2EXWC 3QJFB 4EI5B 3VFRA 5ACZA 4P4RB 1UWEL 4NDMB 3GSNL 4LSVL 2VITA 5D93C 2Q86A 1C1EH 2DN7A 3LB6D 2H3NA 2DQCL 2HFEA 1X5YA 4P4KD 5A3IC 1NCUA 4UV4H 2DIJA 4XB7A 1A3LH 1KGCE 4OCRH 4CRPA 3QXTA 1MPAH 4NZDA 5BRZD 4UQ2A 1TTFA 1CICA 3OKMA 2FEDD 1KTLB 3LQAH 3GMRA 4NO0A 4ZFOB 1C7TA 4C83B 1PQZB 1XZ0A 1UJ3C 1ZXQA 4YHOH 2OLDA 4BSWB 3WE6A 2FZ3A 1Q38A 3WNOA 5DK2B 3KJ6L 3EZJB 3W2DL 4YGAB 3FRPG 2V17L 4JKWA 4JFXB 4KVNL 4ZXBD 4GXUN 4HLZG 4XC1H 5T3XH 1R24B 5D70L 1PGRB 2R0ZH 3KR3H 1I3RA 3P0VH 5HHQA 4K7PX 1DVFC 4LF3B 3ARUA 4P5TC 2YC1B 3VJ6B 2B20A 3CAFA 3U7YH 4EI6A 4LVEA 1LO5B 3ARRA 3VMNA 4D8PB 4LHUB 5DJAB 4L3ED 4PRHD 5KOMC 5D5MB 4P23A 1BZ9A 3D69B 1FFPB 4N9GB 4PJ9B 1RUMH 4YBLB 4DFIA 1U8IB 3X11B 1K3IA 1PZ5A 1OB1B 4JR9H 2Q76B 4TSCH 5DQ9B 3TZVC 4YGVB 1RZKH 5IT2H 2A38A 2MWCA 1AGBA 3PJSB 3QDME 1MCLA 4RISH 1KC5L 2A9ML 3U9PH 4D9RD 8FABB 3Q0HA 4QOKE 4PG2C 5C0CB 5I2IB 5CJXC 4ODXA 1KCUL 4ELMB 1ZVSA 4L8SA 3H9SA 3RRQA 5TE4H 5IBLC 5CEZE 4JDTL 4U1HB 3O6FD 3HS0B 3TO4B 4QHKJ 1J7VR 1FLRH 1IKFH 2EDWA 4LPYA 3QEQA 4WCYH 5F3BB 4E42A 5EULV 5EZOH 1QR4A 5DUBA 4IDJL 4B50A 2DIAA 4LLVA 4PG9B 2VABA 3MCLL 4PJEE 5DS8A 4X6EA 2HMIC 4GRLC 2DM2A 3HC4H 4NN7C 2YA2A 1QSEE 2ZCLL 3HHRB 4K71C 2JIXD 3RP1A 2YMXL 4UNUA 4UNTA 4CNIA 3OKLA 1H5BB 2K3TA 1CXLA 5D5MF 3ZE2F 4WHTA 3KJ4C 3OQ3B 5F9JA 2ZJSH 5ID1B 1BVLB 3QIWC 5KBNC 1MWAH 3ILPB 2AW2A 4JPIB 5E2JA 2MCG1 4PRPA 3WIFB 4X7FC 2I5YH 3WS3A 5CD5D 5TQ2L 3FB7A 3F5WA 3H3PL 3BHBA 2X4UA 2X40A 4TVPD 1F2QA 1YN7A 4PP2B 3QO0A 2BNQB 2NY3C 5JXED 3FFCA 4NQXB 1JRHL 4XNYH 3MFFA 3NABH 4WY7L 2BVPB 3D87B 2SEBB 1D5MB 3VXMA 3WUWB 3MRJB 5T1MB 4DZ8A 4ELMF 3G9AB 1V7MH 2J8OA 3GMOA 1SYSA 1FNEB 1YYLH 2ZNWA 1CICD 2BDNL 3S6CA 2AKRB 1QLFA 2FHBA 2X4NB 1WZ1H 4NO0D 4Q97A 3BMVA 2GTZA 4W4OA 2NZ9D 3ECBA 2CK0H 5T3ZE 2GK0B 1FN4A 5F7MC 3Q2CA 1CE1H 4P48A 1JV5A 3CLEL 1UM4H 2EXYD 1QLRA 3FOLA 1A4KB 5JIIA 4N0YL 3AB0B 2DTML 1EJOL 1D6EA 3ILQD 1CLCA 1D6VL 5CP7A 2FX7L 3Q5OA 5IP4A 3ULUC 2VXQH 3ARWA 3JV5A 1ZVYA 1FYTA 3S7GA 3IU4H 4OZHA 1A1MA 3X3FL 5JLZB 1P5VA 4PUBH 3KPSA 4NCC2 4UUJB 3JV0A 3HE6C 4KMLB 2YR3A 2GITA 3PQYE 2WINA 4HFUH 1QBBA 4P2YA 2UZIL 5KSVB 3IFOB 3SE3A 4HS3A 4PJCB 4A6YA 4P23D 1SM3L 1TQCC 1Q72L 1A14L 2CMRL 3L5XL 4OV5B 2D7TH 3SE8L 1EX0A 4D9LH 4ODVH 1H15B 2V2WB 2FGWH 2VLME 5J6HB 5DSCA 3EYSH 3I50L 3UYOD 2DF3A 4AIZA 5BS0E 3JUZA 1IT9H 3OKDB 1OW0C 2ZCKH 4IOIA 1KB9K 4MAYA 4FQLL 5K9OA 1Y6MR 4MDJB 5KVFH 2O61A 1JHLH 5EPMA 5JDSB 3H9SD 3KPOB 5EOTB 4HGWA 2H9GB 3UTQB 4DZBA 1YNLL 4M7KL 4BQ6A 1T5WB 4RDQG 2YPLA 3IF1A 1I1RA 2CGRH 3QEQD 3QDMB 2FLRT 2Z31A 3RA7H 1R5WA 3RWDA 3S37H 5DJZA 4I0KA 4Z7WA 3VXUA 1W0YT 2JTDA 1M05B 3G5XA 4N5ED 1CK0L 5IMKB 4HMDA 5IKCA 2FDBP 4TVPL 5C0DB 2JB6B 3QULA 2DS4A 1OP3H 4PJCF 3GNML 5GSRB 3C9NB 4O2CB 3VI4F 1IM9B 3T3MF 4X80L 4GG6E 4PRPD 3IGAA 3MBEB 2I9LB 3MPCA 4JJ5A 5E2UL 1UKTA 3RL2A 2YPKB 2CDGB 3D85B 1FBIL 2BVYA 3GBNH 5E1AA 4Q0XL 3V6ZA 5C3LD 4OIIH 4OSUH 2FH6A 5I71B 2PF6A 3VXMD 3WDIA 2R1WA 4WFED 5TDOB 3VXSA 1A7BA 1NMAL 1I9EA 1T89A 4WHCA 1UFUA 3SDAB 1CI5A 3T0XA 5EBMB 2FX8H 2W38A 2XIDA 3FQXB 3WL9A 2NZIA 4Y4HB 4XZUA 4F8QA 5LXGL 4U6HB 5I1IL 1N5AA 1G1YA 4G43A 4I0PC 1G9NH 4PGEB 3CPLA 1MFCL 2X70B 4QRUB 2P5EE 5CINL 3QHZH 4ONFL 4OLWH 3VXPA 5HHVL 1NBQA 2ED7A 1ACZA 3MRFA 4HWBH 3UJTH 1CLYH 5I17A 2OMBA 5DYOB 4LLWB 4Y4FB 3JTSB 1AJ7H 3IS1X 3KPSD 1DL7H 3NCBB 5IV2A 1YJDH 2I60L 5F6IB 3LQZA 4JDZB 5D2NA 3MRLA 1VESA 1ZOXA 5DJ0A 5I8KH 5CILH 3ZKSD 3SCMA 5J12B 3VXRB 1AIFB 2QHRH 2L7UA 5E8EB 5B39A 2VSCA 2F9BT 4OCSL 3S97C 3BD4A 5T5FH 1OGTA 1BF8A 1MFDH 4HPOH 4KRPD 2Q8BH 2XTJC 2OR8A 2OYPA 4UTBH 1HWGB 4U6YA 5E4IA 2IALA 4ODSH 4R7NA 4MAYD 1EFXA 1NLDH 4N8VA 8CGTA 2JJUA 3UTZB 3DBXB 5E6ZA 5CUSL 5B22A 3TT3H 4F33A 3F7VA 2QQNH 1CFVH 3X13A 5FKAB 1RK0B 1KJVB 4POZC 4LLAA 5GRUH 1JNLL 2HFFB 1VFOA 3NFNA 3VWJB 1XGYL 2YPLD 1EK3A 4YHKH 2E6QA 2A83B 3ZT5A 5JTWA 3L3KB 4NZJA 3MJ7B 3MROB 4X7CC 5DJYB 4Z0XB 4WO4C 4NP4L 1NFKA 4ISVB 4KUZL 5FDWB 4WJ5A 3W82A 3VXUD 4BFEA 1W8OA 1MFAH 3MLSL 4UIKL 4LP5A 5HYSG 3PE9A 1HSBB 1YYML 3SE4C 1BQUA 1F13A 1G6RA 5MI0C 4EOWH 2V5RA 1MCEA 4HXAL 4OT1H 2J4WL 1QFWH 2CUIA 4HT1L 3TCLA 3OKEA 4DVBB 1BP3B 2CLVB 2VL4A 4EUPB 3MGOB 5KSBB 2KZWA 1OGAE 5IG7A 4PFEA 1T7XA 4F2MA 1TZGH 5CSZA 3DVIA 3UP1A 4BZ2H 1F4WL 4WFHD 4AL8H 3VXSD 2XKUA 5JHLL 5HYJA 3MMEA 2EDNA 3VI3E 4I3RL 1JGEB 3FFDB 4KI5E 4O58L 2ZUWA 1RD6A 3RVTC 3QUMA 4YIQA 1AGFB 1MIEL 4MCZA 4PJDA 3ULVD 4FMFA 3REWB 3V6OE 1IFHH 4L8DA 2XRAH 1T6WA 1HIMH 2P8LB 1GGBL 3QUYC 4DGIL 3CZJA 3KVQA 1S9VB 1BLNA 1EEUA 2XZCL 4PJGB 2QTEA 1X5XA 3BFOA 3EOYG 4UMGA 4H20L 5FCUH 2V9QA 4A6YL 4UB0L 1SYVA 4LK4A 4NYLA 4H1LB 1UXSB 5KS9A 5EIIB 5IOPB 4JAMA 5KG9A 3QIBC 4QT5B 5B8CA 1DUYA 3RVXC 5KSBF 2P5EB 1CLZH 5BMFL 4NQCE 5C7XL 5I1DA 2AXJA 3SBWA 3UTSA 4XI5C 1R5VB 4NFBA 4IHOA 3WJLC 5KVGL 2K7QA 5FUZH 1JP5A 3MR9A 2B8OT 3VFUB 5M94B 3NCJH 4CN4A 2OJZL 2EIZA 3CUPB 4PJHE 1I8KB 4WFGE 4JFEA 2BRRH 4LPUA 3HNVH 5HGAB 5A1AA 3C8KB 5HGGS 4R26L 5EO9A 1P7HL 1A02N 5CKGA 3CFBB 3HPJB 1LE5B 1EFXD 1JI2A 1BD2E 2PXYB 4H5SB 4CADB 4J4PA 3C6SB 1UT9A 3U4AA 2WIIA 5GXBB 4PJGF 2DOCA 4RAVA 4LVOC 2WNGA 1IJ9A 2Y6SD 2OJEB 4KGJA 5GS1C 2I9TA 2NPLX 1YEHH 5ITFB 5CLTA 3D3VB 2FR4A 3SGJA 5FM5O 1T3FB 3C6LB 2YD5A 3ARQA 4ZD3L 1LE9B 1SVZA 2PCPB 4ETQA 3LKNA 3K81A 5FOBA 4J6RL 1JHTB 3RWGB 2N1KA 4EDXA 1S7UB 1WITA 4WVRA 2VLLB 3GK8L 4P2RB 4LSQH 1FFNB 1ZLWH 3QDJA 3GO1H 3KLSA 1QO3A 1PKQE 1FRGH 3QA3A 4HHAB 2WM0A 4PD4J 4N8CL 2R8SH 4F37K 5CEXA 1JWUB 1TJGL 5H94A 3O0RH 4YAQA 1T4KB 3SOBH 3OHXB 3ULVL 2GJ6B 3T65B 4JO4H 3SY0B 1RU9L 4ZUVA 5F7DA 2P44B 4IOFC 1FG2A 5HYJD 1XGTB 2G60H 2A74A 1ZEAH 2W07A 4NRXB 2W9DL 2OXHA 4X4XA 1NBZB 2ATKA 1X4XA 4HW6A 5EU6B 3VGAC 5ITBH 3VW3H 5FECA 1T0PB 5FA3B 4JFYB 3IJSA 1OTSC 1J8HA 3VU2A 4TUJB 3LN4B 1WZKA 4OJFL 1NGYB 4JQVA 2XXCB 4Y5VC 5HI4D 1R0AH 1L6ZA 3U6RA 5MEQA 1LEGA 3T0EE 1BVZA 1MELA 4XPFL 4HIHB 5HGBB 2J8HA 4WNQA 2DL2A 5FXCH 5CHNA 4XRCA 2BVEA 2JJSC 4HIEA 5MERA 4GFTB 2AV7B 1K4CB 1WIOA 4PRIE 1DBBH 3OJMB 1JCKA 3MRNB 4HWUA 4XWGH 3MJ8A 3QQ9D 4HK3N 5MEOA 4PB9H 3WFCH 2AGJL 2P49B 4WU5A 4U1IA 5C08E 1A4JA 4QYOB 3TO2B 4AM0B 4IRJB 4K3EH 3NCYS 1C16A 3JWOL 1X6LA 3MRKA 3UTSD 5E6IB 1ZWIB 5GISH 35C8H 2WUBH 5GPRA 3SN6N 2EDFA 4KHTH 1IGJB 1OARL 5E5MB 2X9WA 4JFFE 3AXLA 2G2RA 4ODUA 4JFED 5GGSY 2X7LB 4JM2C 1MCPH 1BBJB 1E4WH 4KRMB 3A67L 4ODHL 5I30L 1JPTH 3QUKA 4FP8H 4X8JA 4J4PD 3QJFA 2EH8H 4EI5A 4NDMA 3T1FA 1J1OH 1G6RL 3QSKB 2HAZA 4LASL 1HCFX 4LSPH 3EYFB 5IEHB 4EQ3A 4LIQL 1BD2B 1FH5L 1FL5B 1EUTA 3RKDD 3MFGB 2YA1A 3WFDH 4PYGA 4LGSB 2Z93B 4GKZB 1KTLA 3B3IB 2HTKC 1HI6B 4ZFOA 4NQDD 1PQZA 3VDAA 2WZPD 3QDJD 3TPUB 4BSWA 4FQ2L 3RPIA 5IJKA 4MJID 3TBSB 1EHAA 3E3QE 4XNUH 5DK2A 2RCSL 1XF2B 4PGBB 1JZ5A 1B0GB 3QCVH 4S0TD 4XHJD 5E24E 3QUML 4PJ7B 4XP6H 3S4SG 4PJIE 5ABDE 4LF3A 4CVZB 1PKQB 3RVUC 3VJ6A 4D94A 3DUSB 3U0PB 1WFNA 3KLHC 1LO5A 4D8PA 1ADQH 4LHUA 1SVCP 4UAOC 5DJAA 5D5MA 1QFWI 4UINH 1W8NA 3D69A 1J8HD 1FFPA 3K8LA 4N9GA 4PJ9A 5K33A 1DANU 4JFQB 1U8IA 1UH2A 2VXVL 3X11A 3QFJD 4X9GA 4KPHH 2Q76A 1Q9LB 3HZVB 5DQ9A 2BVUA 4YGVA 1GGUA 3C5JB 2AVGA 2ZPKH 3CVIL 4RGMB 1FFRA 1E6OH 3V95A 4NC2B 4MJ2A 4KMTH 3PJSA 5D71L 3ARGB 2HT4D 8FABA 3T8XB 5I2IA 4TOYH 4OLZH 4M6OL 1S7XB 1T0MA 3C8HA 5DD5L 5ADPL 4ELMA 4PRBB 3MODL 3FO2B 4TN9A 4DAGH 2VZOA 4U1HA 3HS0A 3TO4A 4KMQA 4PJ7F 4ZS7H 5GGTH 1DQLH 3NCCB 1RIVL 4X0KB 5F3BA 3MV8E 1JHKL 4TUKH 4PG9A 4YHIB 1YQVL 4PRIB 2CKBB 5FB8B 1WWAX 4WTZA 1DQQA 3QPQD 4NN6C 4EIGB 2YD2A 2NNAB 4X6BB 5E94B 1WCBB 3OV6A 1OVZA 4ZO6A 4IRZL 1H5BA 1XCTB 1IBGH 2UVFA 5ID1A 4APQC 1BVLA 3SO5A 3ILPA 2D4FA 1WC7B 4JPIA 3WIFA 4TTDC 4F15C 3O2DH 4NFDA 3VE0B 2KBGA