2K1MA

3d nmr structure of domain cc0 of cardiac myosin binding protein c (mybpc)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
PEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Myosin-binding protein C, cardiac-type
publication title 3D NMR structure of domain cC0 of cardiac myosin binding protein C (MyBPC)
rcsb
source organism Homo sapiens
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k1mA00
3BQUA 4RFNC 4XVSH 1RI8A 4AENB 3PDGA 3CVHL 4G42B 4QHNB 1NL0H 4FQCL 2XT1B 5J57B 1M05A 3BZ4A 1MCHA 3EYOA 3VXME 4Z95H 3L5XL 5JW3L 1DFBH 3WDHA 4H8WC 4EI5C 2AK1H 15C8L 3JUZA 4KMTL 5C71A 1KEGH 4NT6B 3MRMA 2WBWB 1FV1A 5E08L 1JPGA 1QSED 3RL1B 4E42A 4LSRL 1LVEA 2Q7YA 5E7BA 1BJ1H 3IJYA 3B9KB 4OF7A 2VJXA 5EC1B 3LDBC 1P7KB 3WFCH 2VISA 4R8WL 4XRCB 3MRNB 43C9A 4IMLA 3E6HB 4U05A 2J3SA 4ZSOE 1MCDA 4LHJB 4YHKH 1FPTL 1NPUA 4WI7A 2VDQL 4F9LC 3HCVA 3E2HC 1AQKH 1J12A 2PF6A 3UTPD 5JLZB 1Y0LA 1OTSC 4YEFA 2DI7A 3O6LH 3CMGA 2VABA 2NY3C 4Q9CA 3DV6A 3E8UH 2Z8SA 1KJ3L 1SBSH 3LZFL 4WGWB 1AI1H 1FGVH 4HFWA 3FT2B 1BQUA 3HB3D 1J9CT 2VDNL 1JZ7A 2DYPD 3RWCA 1ZEAL 3PGFH 4NQSA 3U9UA 1N6QL 1G7QB 1LEKB 4ZOCA 3WO4C 1BAFH 4JM2C 3L3IB 4BELD 2BCKB 3WN5C 2G75B 4TULL 1EHAA 3BFOA 5FYKH 1DJSA 2YK1H 5GGTL 5GISL 5JXEA 5KN5A 1DBMH 2OK0L 3L95B 1MJ8L 4WRLA 4XPBH 1EEUA 5HHPA 3OAUH 2R15A 4ISVB 5E8NA 1A1NA 3MODL 3ARUA 3ET9F 4JM2F 4DTGL 1JV5A 1MHHA 1CDUA 2AGJL 2NZIA 3S5LB 1JJUA 3VA2C 1KPUB 1FAIH 4NDMA 1QFHA 4QRPA 4OZGA 1MAML 2YWZA 3GSNA 3O3EB 5ICXB 2RFXA 4K71C 2W0FA 3AAZB 3B5TA 3STBA 5BVJA 5DRXB 2C4FT 2X1XR 2EKSA 5I0DA 2NY4D 1NGWA 3QDJD 3OKLA 4YO0B 4XVTL 1TETH 1U8HA 1S7WA 1DVFD 4NNPL 1ED3B 5ANMA 5E2UH 3NFPA 1JGLH 5D1QC 4TQEL 3F7QA 4MXQC 5FECB 4HXAL 4GAFB 3TFKD 3QSKB 4QGTA 2K9UA 1ZLVH 3UPRA 5F9WB 1JK8A 4N0UB 4PBVC 1M71A 4YFEA 5ID0B 1L7IL 4H0HB 5GS1B 2VXVL 4JHWL 3B5HA 3KPQA 1IGTA 3QUZD 3ZTNL 4HX1B 5HDOA 1HQRB 5SWZA 3L3DA 1A7PH 3QIBC 4FFWC 4XNUL 3IGAB 4FQCH 2W60A 1RVFL 3C09B 3UTTD 3VXMA 3L5XH 3I02B 1R3LB 2ZOLB 3Q6FB 3INUH 3NIGF 4KMTH 15C8H 3C8DA 3ZDZF 4OCSL 1K6QL 5DO2C 3FB5B 3RIFK 4MMZC 1HILA 3IDUA 5ETUA 4GRWB 4JFEB 1GZPA 1GHFH 1OW0C 3RP1A 1JGVL 4X5LA 3MNVA 1SBBA 2E27L 1IBGL 1JZ4A 5FKAA 4MJ5A 1HDMB 2BRRH 3OQ3B 3PP3H 5B3JF 1OSZA 4DQOL 4WW2F 4EDXA 2BFVL 1FPTH 2KZWA 2D7NA 3U0PB 4HJ0D 2WWKO 1JNLH 3D18A 5J6GB 3OJ2C 4WFGD 1PZ5B 2CMRL 4U1IA 4LQ1A 1MI5B 4LLMA 3RQ3A 3TIEB 1G9NH 3NZHL 4BSVA 1NQBA 1NFIA 1XAUA 4QT5B 5LG1A 3IFPA 5D2LB 5TE7H 1U3HA 1DQTA 2PO6C 1N5AA 3UTZB 2I9TA 4I5BA 4ZAKA 5E2VL 4EEEA 4HDIA 2BY0A 5EDXA 1JF5A 4R2GB 4TULH 2PW1A 3NZ8B 3KHOA 1OPGL 3QO0A 1XF5A 1ZHNB 4ODBD 1FG2A 1KGCE 1ITCA 3QRGH 3VXTB 3MLWL 3MODH 3CSYA 3SKOB 1NCWL 1A64A 1WISA 1AO7D 2BP3A 1PX3A 5C6WH 5FGRA 1G7MB 4Y19D 1IGJA 3DMMA 4MQXD 2NY0C 4BZ1L 2Z31C 1OT1A 4RAUB 3S3JA 3HI5L 3BQUD 3RZCC 3MLVL 3MRCB 4N1CA 3NIFF 2JLLA 4TTDD 4HF5L 3C08L 3BZ4B 1I7TB 3H3PL 1D9KC 4Y2DC 1J1PH 4R3SA 2RB8A 3O8XA 4NNPH 4PJXA 5E00A 4C54A 1FV1B 1JPGB 4LVOC 5DEFA 3WEXB 3BWUC 4J6RL 3MYZA 2Q7YB 3W82A 4NBZB 1WC7A 3VE0B 1H15A 4HUXB 1L7IH 4PY7A 3WIFA 3LRHA 4PLKC 1QSFB 43C9B 1URLA 2IPTH 3B2UC 4QXGH 3ZTNH 4K3HA 3IF1A 2CGRH 4LLUA 3HC0A 1V7NH 2IFGA 5E56A 3NTCL 4LGPB 4WIQA 1CGSL 3O6FC 3BI9X 3OG4B 4EVNB 1RVFH 3FO9B 2JKXA 5CAYB 4D0CB 3LEVL 2YPVL 2VABB 4PD4J 3DV6B 5L2KD 1B0GB 1ZKAA 3HG1E 1CK0L 4M8VA 2X9YA 3GSWB 3QNYA 1DUZB 1RZ7L 1Z9SA 5IKCB 4HV8A 1QA9A 1K6QH 4OCWL 1MWAA 3QJHB 4JCLA 5D7IF 2R0KH 4M9OA 1P69B 4Y4HB 4YIQB 3BHBA 4WI3A 4KI1A 5JXED 4OLEA 3MBEC 1JGVH 1CFTB 5M94B 5HHPB 3D69B 4HUKB 1CDGA 4HW6A 4DQOH 1PG7H 3DVIA 4JZJB 4OB5L 1UJ3A 2JJSA 4LDEB 2X1PA 2FRGP 3CFEA 4AM0A 3G6JF 4X4XB 4QOKE 1LO3H 4L4VE 1R3KB 3OX8A 4IDLA 1ND0A 4Y16A 5BVJB 5C2BL 1FO0B 1OTTC 3LS5L 1DE4B 3RNKB 2LTQC 5E2VH 5B38B 1TPXB 5IQ9A 3OKLB 3DECA 2FX8L 1NFDB 1U8HB 2DQIL 1BF8A 3VFGH 1A6ZA 4YWGL 3TP4A 2J8OA 2Z93B 3HS0A 2X41A 1S5IH 3MLWH 3EO1A 2OXGA 1GH7A 4G8EB 5CBEA 1TJIL 3C5ZA 3I6GA 4Y5XA 3IETA 2WSKA 3HI5H 1I9JH 4TYUA 1I3RB 2VZTA 4P3DA 5AYQA 1BBJA 4Q2ZA 3L3DB 2Q8BL 4RZCA 4POYA 1TJGL 5F9OL 3B9EA 3UDWC 3VXMD 3NCYP 4PJAB 1HKFA 4RISL 5HPOA 3MV9E 3HAEH 1CN4A 3NIGE 3MXWL 3UBXI 5F7FA 4N8PA 3IU4L 4X7EC 2XWBA 3ZDZE 3SCMD 2BNUA 5CGYD 1U8OA 5F7HA 1Z6JT 4XBEL 1LEGA 2F9BT 4J6RH 2E6PA 2IMNA 3K8KA 2ZJSL 1IAIL 2NX5E 2HYMA 3TNMA 4EI5A 4UUJB 2NY1B 3MNVB 4WI4A 4XHJC 4MJ5B 2BNQE 1IGFL 1OSZB 5EIIA 3O11A 3RFZC 5TPWL 3NTCH 4OZFA 4X7TB 3D18B 1CGSH 1T1YA 4XHQA 1S9WB 1JNNH 1OSPL 1S8DA 1J8HB 4LLMB 4MXWL 1CT8A 2DTSA 4GKOA 4BSVB 1CK0H 2P43B 1V3LA 1DQJA 3IFPB 1RZ7H 4F9LA 3GSOA 4PGEA 1S7QA 1V3KA 4OCWH 3TN0C 4PJFF 3WNMA 1H8OA 2CUIA 1PQZA 5SWQA 3T2NL 4LRNL 3G04A 2IAMD 1I7ZA 4HLZH 1FNGA 1LP9F 2PW1B 2VH5L 2YKLL 4NQVA 1GC1H 3QO1B 1HQ4B 2GAZA 1XF5B 5DD0L 4FQJL 4U33A 3QUYB 1GIGH 1FYHB 4JM2A 3CSYB 3WN5A 4QHLB 5CSZA 3VD7A 3HR5A 4LSVH 3A6BH 2X09A 3U2SA 3DMMD 3UEZA 1C1EH 4N9OB 1GL4B 2ADFH 5FUOL 4M1DL 4HWZA 4AYFA 1IVLA 5LVEA 4NO0A 5GGRA 1EHNA 3LS5H 1RJLA 2ZSVB 4I77L 3C6LB 4KC3B 1XR9B 3OPZL 2FX8H 3GHEL 3GO1H 4H0GA 3QDMB 4DVRL 1Z3GL 5LKNA 5DFWH 3PJSB 1MRCH 4OBRA 1FLRL 1F45A 3O8XD 4OQTA 3P0YL 2QTEA 3WLBA 4YWGH 4KKLC 5E00B 1CR9H 3X3GH 1A7OL 3GM8A 3OJMB 4FMFA 4I0KA 3RVVC 1E4XH 4YXHL 4OM0L 1KCVL 5DRWA 1G9ML 3HFMH 2RHEA 4HIEB 3FQWA 1EGJH 4PY7B 1OD9A 5D1QA 3WIFB 3T0VA 1I8IB 2AJSH 4LLUB 3O4LA 4HMCA 3I3BA 3QUML 3C8HA 1NCBH 5D70H 3WFHA 4WW1B 4MSWB 3CAFA 4U6VH 2OTWB 4GXUN 2BVOB 1QLRA 2V7NB 4KVCH 1DDHB 3TO2B 2ESVE 4RISH 3MXWH 1BD2B 4F2MB 3VJ6A 3OJVC 1CXKA 3QIBA 4WVRA 5EC2B 5D7IE 1MWAB 1AP2B 2H2SC 3I9GL 4OFIA 4FQHB 1CQYA 4YDIL 2VLMD 1EO8L 2CRMA 1GJIA 3MRJA 5JHDB 3TO4B 2BNQA 3T3MF 3U4AA 3WFBH 3HE7B 4NBYB 4RQQB 4HC1H 1U8LB 3CFIC 5KW9L 2P8LA 4YDKL 1U8IA 2WZPD 4ODSL 1LO5A 1OW0A 4NIKB 3CFEB 2E7CA 3K1KC 2DBLL 3ZE1F 2VNCA 3LVEA 4MXWH 3E3QC 5F3HB 4P3CH 1BVZA 2AK4B 4KWUA 3U7WL 4XMLH 4PB9L 4Y16D 2OZ4H 3O6KL 1AD9B 5ICZA 1X3DA 3RY6C 5D1XB 3VXPB 3VRLF 4M6OH 2LV4A 2VH5H 5DJ6A 1YY8B 3RBSA 5KJRL 1P4BL 3L3KB 4O4YH 1HEZA 2F15A 2EXWD 1KGCD 5CKGA 2PO6A 4G7YL 4JN2A 5BV7B 4NRYA 2LU4A 3OL2A 2VDPL 3KPNB 3FONA 1BWMA 3OXRA 1OB1A 3C5ZD 1UB5A 1FL5A 4XP1L 3GRWH 3I6GB 4JFFB 3LPFA 2W92A 3IETB 2F8OA 1FDLH 1X5JA 2ZUXA 4NZJA 4LLQA 2X89D 3BE1L 4HUUA 1TZIA 3M1BA 3FQRB 2Q3AA 3OPZH 2Z31A 4I1NB 4DVRH 1Z3GH 3O4OB 3CVHA 3RZCA 3TPUB 3FO1A 4KTEL 1QLFB 5JO5A 4M61B 1D9KA 4Z6AT 4Y2DA 4YXHH 5IBLC 2O61B 3Q3GA 3ZT6A 4G80B 1G9MH 3UTOA 3FQNA 5FB8B 1SYSA 5DEGA 4EI5B 1L0XA 3AS3A 4M7KH 2UWEF 3S5LG 5EIIB 3QUMH 4EUPH 2BSED 2P24A 3QISA 5D7SL 5C0IA 5IF0A 3LDBB 3JTTB 4LMQI 3GEWB 5IG7A 4ZTPL 1C12A 1A1MA 2ESVA 5C0FA 2DQDL 2GFBB 2VXUL 2B1HH 1BQLL 3HG1D 4ZS6D 2DIJA 1DQJB 5J11C 2Y9RT 2GJZA 2R0ZL 4OZIA 3O6FA 4PJFE 1WBYA 4CDHA 1OTSD 4M5YL 1PQZB 3CFKA 3I9GH 3QJFA 4YDIH 3BKCL 4NQVB 2YEZA 1VFMA 3OKYA 2DQTH 4ORZC 4M9PA 4HAFA 4AL8H 1HSBA 4JM2D 1I85A 1FN4A 5GGTA 1A3RL 1CXHA 5C92A 3TVMB 4X6DF 3BDYL 4ODSH 3FO2A 2EEBA 4J8RA 1UKSA 3MBEA 1DBKH 2R0LL 1G7LB 2XZQL 2MWCA 3UJIL 4QOKD 4F7MA 2J88H 4L4VD 5IB2A 3IU3B 3EJZC 4HWZB 1C5DA 4NO0D 4PJ9C 2XN9E 4Y7MA 5E4IA 3JVGC 3WNPA 4ZD3L 2I5YH 1NDMA 1Q1JH 5KJRH 4RWHA 2EXYC 4XZUA 4HK0A 1T03L 5BRZE 1TITA 1A3LH 4MNGE 3MSPA 1YC8A 3V52L 5IFHL 5EZOL 4CJ0A 5KANI 5DR5H 3AREC 4XGZA 1IKNC 4XP1H 4EOWH 5D1QD 2O93L 3GBNL 2YD6A 1FORH 4MXQD 2QQKL 5EOTA 5L9DH 1AGBA 3D0LA 3GSUB 5ITFA 2FZ3A 4XPAL 4KDTC 1FBIL 5DHVA 4X4MA 1IEAB 5A2FA 2V5YA 1GAFL 3TV3L 3R4DA 2G5RA 4RNRB 5FYJH 1TDQA 5DFVC 3IT8D 3HC4H 5EOCJ 3MV9D 1RHHB 3OR6A 4HS8H 4W4OC 3U7YL 4H5SA 2R9HD 3GHBL 5EG6C 5D7LE 3P4OA 3OR7A 5D2NC 3UDWA 1MFAL 4JVWA 5HVHC 2NX5D 1T21A 2JJVA 4IRJD 3UJTL 3HZKB 4OF5A 1YEHH 1ZT4A 1HYRC 3DVNB 4OTXL 2RJMA 3OKDA 3OKKA 3S34H 2MTPA 3T3ME 2BNQD 2IBZY 2Y5TB 5DO2D 4AEIL 3F5WB 5FK9A 2P8LB 3X3FL 2A6KB 3S36L 2IGFL 3DGCR 5D7SH 3QCUL 4EN3C 2NZ9C 2HFEA 4ZFOB 4WU5A 4HBCL 3FRPG 4ZTPH 2VAJA 3CC5B 3ZE1E 3ZMRA 4JKLA 5EUOF 4JR9H 4P5TB 5I74C 2VXUH 4ELMB 5CSGA 1WWBX 2KQMA 1W72H 2CKBL 2R0ZH 4KY1H 4J3WA 3NABH 4KKBC 3V4PL 5ICZB 3VRLE 1U8PB 4H1LH 1NC4D 4WNQB 3BKCH 3E3QE 3FQXA 3GMPB 3DNKA 3QULB 4UB0H 1HEZB 4NKIL 3U4EA 1SY6L 4JFDE 3TN0A 2X4RA 3U48A 4ZXBC 4ZPVA 2VRAA 4L29A 3VWKC 3QUXB 3IVKB 4HKJB 1OB1B 4KDWA 4MCYA 5D71H 4KQ4L 5CIPB 1UB5B 1FL5B 4X8JA 1BFOA 2QKIA 3VFTA 4LLQB 4NCC2 4FQ2L 4N5UA 3HRPA 4QRRE 3OF6A 4G7VL 4HUUB 1U93A 1TZIB 2BK8A 2HA1A 3ZKNC 4CRPA 2V2XA 2NY0D 1G0DA 3VFNA 3DX8A 1E28B 3GJEA 4DCQA 2K3TA 1I9RH 2P5EE 1OAKL 3LHPL 1KTLA 4XP5L 2E6QA 5BRZA 4UDUA 4MNGA 5IW1A 1D9KD 3VRJA 5IFHH 4Y2DD 4M48H 1U8JB 3W39B 1LO4L 3UMTA 5DUPH 5J4MA 5T1KD 3KPSE 2BXZA 4JG0H 1F8TL 3GBNH 4KRPB 5EN2B 5EBLA 2UWEE 3LKSA 1YEDB 2QQKH 2VZSA 4A6YH 2OS7A 3MOAL 4J3OC 3TA3C 1D6EA 1FBIH 1KJVA 2C4XA 5IF0B 2NTSP 5I1GH 1JWUB 5F1SA 2ILLA 2F5BH 4TRPL 5IG7B 4PLKD 5IQ7H 3B2UD 1MF2H 2ESVD 1PDKA 3DBXA 3HNVL 1FYTB 3NFSL 3D2UD 4KGLA 3GHBH 4HKBA 4DGVL 5B38G 5D7LA 5IBUG 4OZIB 3O6FD 1CLCA 1BM3H 3W0WB 5C09E 1MFAH 1HKLH 3RWGA 2VXTH 1TVDA 3CFKB 4KJWC 3GIVA 2W0PA 3UJTH 4OTXH 1JYXA 5B39G 4K9EL 3QEGL 2YD3A 5E95B 3BRGC 4KV5F 4NCC1 4YHIB 4ZPTB 3EYUL 4GG6A 2IGFH 4N8VB 4UT6L 3KPTA 4WEBL 2X4QA 3QCUH 1H5BC 1MCCA 4G43B 4TVPL 1IQDB 4HBCH 2W0KA 2EH8L 3EBAA 1YPZF 4KJQC 3UTSB 4HJGA 3DROA 4PRAB 2E7HA 3EO9H 2I26N 5DQJB 2CKBH 3MTRA 3V4PH 1QZ1A 2YZ8A 5M95B 2HKFL 5BOPA 3BPOC 3O6ML 5INCB 1IGCL 4PY8I 4OQ1A 3O3BB 4MAYB 2PXYC 5JNYB 1OTTD 1Q9LA 4UTAH 1RZJC 2OMNA 2GCYA 1N59B 3RY6A 1FC1A 1IAIM 2VN4A 3SKNA 5LWYH 5C0JA 1S7RB 1JPST 2H1PH 5HGAA 2AS5M 2WIIB 3GUTA 3QHFL 1LE5B 8FABB 4KQ4H 3N0PB 3LS4L 4NBXB 5I1HL 4JFPA 1BJMA 3U0WL 3D0LB 4QRRA 5C0AA 3DXAE 2FZ3B 4P99A 4NC2B 4DAGH 1WEJL 4LCCB 2NXZD 1XGRB 5EU4B 2W59A 1U8NA 4XB8A 4NKOA 1OVZA 2JK5B 3VFUA 5AAMA 1OAKH 3FB7B 4GMSH 5FIEA 5J7CC 3S37H 4FQ1H 3RX7A 3SDCB 4IS6B 4JGUA 5E5MB 1RZ8B 1LO4H 4JDVA 4JO4H 3TH2T 1RULH 1R3HB 3VMPA 1T21B 2KQNA 4G9DA 1ZT4B 4XAKE 4DN3H 3OKKB 5JW4Q 1I1RA 3BWAA 4K2UL 3N50A 2F74B 2UWEA 1KLGB 5D5MF 5DD3H 3SGEI 3IFOA 4UIKH 3NPZB 1IC1A 4MWFB 4NSKB 4WU5B 2BJML 4Z9KB 2BOCA 1NGYB 5EUOE 2J4WL 1FNSL 3F7YA 4XHJD 1QNZH 5MENE 3HNVH 4ZFZB 2AJVH 2FECI 4DGVH 4MLSA 4BFBD 5DT1L 3BYYA 3EOAA 4M6NL 3PIQB 3BRDA 4TUJA 2K1MA 1MUJA 1J1OL 3KLAA 4PUBL 4U1JB 1CDYA 3C6SA 1OWWA 4IOFC 4K9EH 1INDH 1V7ML 3GMQA 2X4UA 3QEGH 2ADJA 3FFDB 1MCKA 3TN0D 2X4RB 2J8UF 1BREA 1XIWC 4UT6H 4WEBH 5IEKB 4YHLL 1JIBA 3T1FA 1U8KB 3MRRB 4NYLB 3MC0A 4P4KB 3H0TA 3F58L 4MCYB 5E8OB 5GRVK 2QKIB 1ORSB 2NQCA 4XC3L 4IHOA 4UV7H 2BSSA 1KCRL 3DETC 4D0DB 2AJYL 2B8OT 2DLFL 2XN9D 2HKFH 2M26A 4OFPA 4OZHB 4HUVA 4GW5A 2CPCA 2XRAL 5FHBL 5ISZB 2DS4A 3KXFB 3S88L 3VFNB 4JRXE 4HCRL 3TBYA 3DX8B 2EO9A 3GJEB 3F7RA 4JPKH 1CLOL 3QR2A 1Q38A 4PJ9A 1KTLB 3MNZA 5BRZD 3JVGA 4UQ2A 5IW1B 2QLVB 4UNTA 3VRJB 3W11C 1QSEB 5E5UB 3OZ9H 1RZKH 5DMKA 5E6YA 4Y5VB 4GG8B 4KKLD 1CQKA 1W0VB 3LKSB 1IT9L 5FGBA 5FDWA 3RVVD 3BO8A 1D6EB 1BMGA 2M1KA 1KJVB 5ALBL 3AREA 1C08B 1IKNA 2B4CC 1WEJH 3D25A 4I3GA 2Y7QA 1HK6A 1F4WL 4EUPA 1CF8H 3UBXA 4DKEL 2AXGB 4PRBB 4KDTA 4HKBB 5D7LD 1NGQL 2PR4L 3HRZB 4QY8A 1ZT7B 3O45A 3DVGA 3MXVH 3MJ8B 2DYPB 3RWGB 3V7AG 3LIZH 4K9EC 1D5MB 4W4OA 2NCMA 1CDJA 4P49A 3Q5OA 4KV5E 2BX5A 5D2NA 4CKVX 4NC0B 5EOQH 4ZUWA 2H2SD 5EBMB 3VXSE 4PRPE 3MLSL 1K8DA 2FECL 2X4QB 9CGTA 4JFZL 4V1DE 3V6FA 2BJMH 1P5UA 1MRFL 1N6VA 5EUOA 2J4WH 4PRHE 4WCYH 1NUFA 5FYLL 4OLYH 4APQB 4Z0BH 1H0DB 4FQLH 1VADA 5MEQA 5EULV 5ILTL 3ESUF 1UGNA 4EN3A 1PLGL 5BO1H 2DQGL 4HPYL 2VAAA 2ZCKL 5AYUL 3NCYS 4G8IA 3H7LA 5F89B 1I7UA 1RK0B 5EU6E 4DOHE 5JQ6L 2MQCA 3QDJB 1MJJB 4JKMA 4PUBH 5IFJA 2FHFA 3JUYA 3KLSA 4TOYL 1RUML 3GI9L 1A4JA 4JFDD 3ILQC 3VGBA 2E7LC 1PY4A 2V9QA 3FRUB 4ALAL 3CH1B 4MJ4A 4PP2A 1JHTA 3SKNB 5C0JB 4YHLH 2YUZA 3HLAB 5T3ZH 5F6HI 4MD4A 5CD3B 4PR5A 5HHOE 1ACZA 3F58H 1F4YL 1UJTA 2R23A 4JFPB 3SDXF 1NMAL 4HIIB 2Q8AL 3GB7B 3QUZB 4QRRD 5C0AB 3VWKA 4LSUL 2WQ8A 4NHCL 4UDTA 4QWWD 3LQZA 3S7GA 1Q9OA 5T1DL 3S88H 2UYLA 2BNRB 1CFSA 3RTQC 4HCRH 2WUBL 2EZ0D 3O0RL 2P5ED 2ATPB 3VFUB 1N0LA 1DQMH 5FGSA 3V0AC 3CFBA 4H26B 1EAPA 3QCTL 1KIPA 4NN7C 4QRQB 2ERJC 3PWLA 4JDVB 5FV1L 4RBPK 4NQEE 2AABL 1M4KA 1FRGH 3KPSD 4C56B 2IBGA 5KZCD 1FVEB 4G8GE 4LDLB 5T33L 3BWAB 3H9YA 1DANT 3IJHB 1NDGA 5I73C 1FAKT 3VH8A 3RL2B 2NLJB 1IT9H 3EIFA 5D5ME 1A6WH 4LKCB 3RUGA 5IBLD 2DDQL 5K9KB 4L1HA 5IMMA 3IFOB 1OCWL 4LMQE 2A1WL 4HWBL 1U91A 1NGXA 4WHTB 4X5XA 1ZHKA 1NANI 5D6DC 3F7YB 5CEYA 3ECBA 4DKEH 4FZ8L 4R90L 3TA3A 3RVXC 3CMOL 1WZ1H 4UINL 2WUCH 3VFVA 1EAJA 2AEPH 5C09D 1A02N 1C16A 4TUJB 1T89C 32C2A 1F11A 4NRXB 3RDTC 3SGEH 5HI5C 2AW2A 2H3NB 4DKDC 5HSFA 1G7HB 1PX4A 4R26H 5LAXA 1EEYA 2ADJB 2J8UE 2W9LA 4P5KA 4IJ3B 5C0BA 4PJHF 3VXSA 2P47B 3MLSH 5DQDL 5HDQL 2APTA 5EB9A 1AFVL 5HHNB 2K7QA 4PRHA 4S1SH 3BPNB 1MH5A 3QG6B 5KOMC 1U2HA 2ICEA 5FYLH 3TPKA 3O2WL 1AD0B 2JJUA 3BMVA 1H5BA 4HPYH 2ZCKH 3MV7E 2X70B 2IQ9L 2EDOA 2QSQA 4XNYH 2YRPA 3Q1SH 3ILPB 5JQ6H 1CD8A 4KHXL 4YUEL 1WWWX 4HT1L 1XCTA 3DWTA 2H8PA 1D5BA 5TQ0L 3P9LA 1IZJA 1KYOK 4TOYH 1RFDL 2CDFA 2E9BA 3MJ6A 4PJ9B 4OLZL 4XMKH 5MHSD 2LU7A 4MQ7B 3BX7C 2Z91A 3VGDA 1MNUL 3ARBD 3AS1A 3S36X 4MMXC 4Z7WB 5CS7A 5IM7A 2IH1A 5EORL 5HHOA 5DMKB 1BQHG 4NO5B 3I3EA 2PXYA 3SDAB 1AKJD 1X5GA 4PV9A 2BDNL 1J87A 3DOSA 2G2RA 3P73B 2JCCB 1NMAH 2Q8AH 5C7XL 5FV2A 3DXAD 5GRVL 1ACYL 1VKXA 1KCSL 1CDIA 4LSUH 2HT3C 4NHCH 3AREB 3IDNB 3ARQA 4YGAB 1FIEA 3D25B 1S3KL 4OCRL 5T1DH 4FNLH 1T83C 5C0DA 1ZLUK 1BGXH 2WUBH 3EW3B 3N1MC 2Z35B 2BVYA 4K7FA 4O5LL 4WO4C 2DD8L 1G6RB 4PJGB 1UA6L 5FCUL 5F1IA 2AV1A 2A6JB 4NQEA 3Q6GH 4R4BA 4C59B 4XAKD 3TJEL 4S1QH 2F53A 5BZDA 3NIDE 4QRTB 3IDXL 4RFOL 5GQBA 5INDA 1SJHA 4F15C 3TT1L 2L7UA 1B6UA 2PNDA 4NWTH 5D8JL 4U6YA 4HWBH 4X9FA 1ZSDA 2FX9H 3LN5A 4MB3A 4OLVH 3NCMA 2GSGA 3VXQA 2FX7H 5EBWB 5MEND 5IVXA 2QHLA 4PRIB 5JOFB 3R1GL 1VFBA 4FZ8H 4GW1A 4TVPE 4LPXA 4EN3D 3MV01 2NZ9D 1MLBA 2BC4A 3CMOH 4NZUH 4PLOB 4QNPF 4UINH 2VAAB 5CEZL 4PTTA 4BSJA 3BW9A 3KJ4C 4PJIA 1I7UB 4LCWB 4WI8A 4F80A 1QYGH 2ARJB 4CL7A 4OT1L 2P8MA 1FL6A 3ZKXC 4URTB 3LN4A 2JELL 1VB9A 3L6FB 4BKLA 2NR6C 1A4JB 4OD1L 3OKMA 4KKBD 2HFGH 2EDNA 3R8QA 5L88L 4N9GA 1JHTB 4ZQKB 5CJ5A 2FSEB 4ONOA 1SY6A 1AFVH 2CD0A 3D87B 3I85A 5IEHA 1YNLH 3VFMA 4NM8L 3K0WA 4MJ6B 2YN3A 4WHYH 4ZODA 4X99A 2R23B 3HUJF 4XBPA 3U7AA 3U4BL 3O2WH 4ZXBD 3QQ4A 2VUOA 3KR3L 1XIWA 5JOPE 4MDJA 1MREH 1BJ8A 1F3RB 35C8L 3VWKD 2XPGA 3MV7A 1MSPA 2IQ9H 4KZEL 4UTBL 1Q9OB 4KHXH 3F7VA 4YUEH 5DK0B 3PDDA 1UZ6E 3EDJA 4JRXD 3WIHL 4ONFL 4OF6A 5TQ0H 4XH2B 2YUVA 1RFDH 2J5LC 3CFBB 3UX9B 4OLZH 5EU5A 4GBXC 2W91A 1EAPB 3CXDL 1IM9A 3ZKND 3ARZA 3SCMB 1OARH 1T4KA 4M7LL 3IS1X 2Q3ZA 4ONGH 2Q7NA 3ARDB 1ZTXL 4WTWA 4XPHL 4N8VG 1ZWIB 3GI8L 1OGAB 2IANA 2E9WA 5H94A 3RUGB 1ACYH 3L9RB 4ZSOB 5IVNA 4G3YL 1U91B 3WXWH 3TBVA 3TCLA 1S3KH 4NN6C 2D9QB 3QB7C 3VFPA 5E03A 3TA3D 1CICC 3BVNB 4OUOA 1OAYH 1G84A 4PJEA 1SEQH 1TVBA 3IDGA 4QHMA 3P9MB 4CMHC 2AJXL 5I8CB 4YHOH 3ROLA 1F11B 2MCPL 4LL9A 4LCUA 1UA6H 5GZOC 3PV6A 2A6IA 2BVTA 3GKZA 3GSXB 3TJEH 5EO9B 4JHBA 4Q6IB 5LAXB 1EEYB 2QQQA 4Z5RB 1YQ2A 1MIML 4PJHE 5EZJA 4P5KB 4I2XB 2VKXA 4MA3B 3VXSD 4BQCA 2YWYA 4PRPD 4KJWD 5D8JH 2Z92B 3GIZH 2V5RA 4V1DD 4Z7VF 2OJZH 3IJSA 4PRHD 1TCRA 3LKPA 3FAXA 1BX2A 2ICEB 2OL3L 1XF2A 3O2VL 1DQLH 5I30L 2G60L 1R0AL 3DX9A 1ZMYA 3MZTA 3LEYH 1KJ2H 3KYAA 4NZRH 5CEZH 2ZG3A 1CGUA 3VXNA 1DQQB 1S7TA 3D5OF 5EU6D 2YA2A 1HXMB 1S78C 3B6SA 4GAGH 4P2QA 4F7PB 4QO1A 4OT1H 5B22A 4JREB 2EEDA 3K3QA 4HIXL 4D9LL 1I1AB 1XCTB 3WD5L 3VD9A 4LPTA 1D5BB 4OKVA 2APFA 2LFGA 1EDQA 3OHXA 3S98A 1UWXK 4LPVA 4OD1H 2AEWA 3U82B 3KPLA 4WTXA 4P5MA 3JV0A 1H3VA 1T2QL 4QCIA 3L3HA 2IH1B 5HHOD 1XGYL 4F33B 4MA1C 2PXYD 4PV9B 3LB6D 3PWPA 2E7LA 5KAQF 3U4BH 2G2RB 4I18C 4HPOL 4QRSB 3V5KB 4OUUB 1FNEB 2CDGB 1VKXB 2XTJB 4HGKC 3OAZH 2HTKC 4LASL 5KSVA 4KZEH 4YPJA 1FCCA 1C5CH 5IB5A 3VI4F 5BW7C 5I1LA 4CN1A 1I8KA 2I25N 3WIHH 5HYSB 5JDJA 3TYFB 1EIBA 1MVUB 3CK0L 2HRPL 4M1GL 1E4WH 3IFLL 3JWDH 2PN5A 3MRBB 4W4NA 3RTQA 5IMLA 5F1IB 4NQED 3NAAH 3BH9A 4GXVL 1S7XA 2F53B 4G8GD 4GAYA 2WINA 1ZT1B 4XPHH 1G7PB 3NMEA 3V6ZA 3GI8H 5INDB 2UZIL 2XFXA 1AQDB 2ZCHL 5D72L 1UB6A 1WWCA 4G3YH 4LLDA 1ZLWK 4M4RA 1GXEA 1IAKA 4AEHL 3VXQB 4D3CL 4OAWB 3VGHA 2VL5B 4QEGA 5IMKA 5F3BA 5CHNB 4QNPE 1RZGB 5FYLE 4EXPX 1YEJH 1RV6X 2CLVB 2XV6B 5D6DA 4PJIB 3RWJA 1VEOA 3AXLA 3RY4A 4HUWA 4G8FA 3MJGX 1P84J 4Z7UF 1AR2A 3CVIL 1DUYA 3SHSA 4BKLB 4RBPH 4N1HB 3NA9H 4LEOB 3OKMB 4PJHA 5F21B 5C70A 4N9GB 1T89A 3BZEA 3P11L 3RDTA 4J23A 3VW3L 2APXA 5DUMH 1QQDA 1UZ8A 3HUJE 1S7UB 4OI9A 4X99B 2ZUQC 2BY3A 2DQJH 3O2VH 5I30H 3E1F1 1XIWB 4F8QA 1S7SA 4I3SH 4L3EB 3OKNA 3RA7L 3VFSB 4GUPA 1WAAA 4J3TA 3WKNA 4JHZA 5JW4N 1ADQA 4NHUA 1BZ9A 5FCSH 3DETD 4D9LH 5B4MC 5KTEH 1JTOA 3EYFB 1G7IB 1NSNL 1CG9B 2OQJB 2HN7A 1EERB 1FZJA 1MHPL 4U1KB 3SGKC 3NCBB 4LHUA 5E8PB 2Y06L 2DB8A 4HG4J 1OQXA 3T8XB 3S3PA 4Y8DC 3ARFC 4GAJH 4HPOH 4QXTB 5CJOL 2R1WA 3GMLA 4XP6L 3C60B 5DRNA 3W11D 3DUSB 4YHYB 5GGSA 4AIOA 4J1UB 1LK3H 2B5IC 4TNVK 3AC0A 1HHJB 3SPVA 4OM1L 4K23L 5KVEL 1LQSR 3OJDA 5FO8B 2Y07H 4LNRA 2FEEI 3P77A 3CK0H 5ACMA 2HRPH 2V2WA 4PJEB 3HE6C 5I1EH 4QHMB 3IFLH 1SYVB 1RZFH 3QI9C 4KROB 1CBVL 5DVLA 1T83A 3HMWL 3PV6B 1U6AL 1XF3A 3AU1B 4WO4A 1F3JA 1FFNA 4PJCF 1J0IA 2UZIH 5T1MB 1H9VA 2WWMD 2ZCHH 1S9KC 4Z7VE 3PV7A 1NCTA 4AEHH 4KRMB 2NY6B 3LKPB 1T04B 3OKEA 2WBJB 2NPLX 2ITCA 4X0KB 4YBLC 3V8OA 4UNVA 2G5BA 4TVPD 2NY5H 4QOKB 4X5WA 3T0EE 3DX9B 1NBYA 1ZLUH 2D7TH 3RX5A 4K3GA 3OAYK 4RMSA 1JWMA 1L4IA 2WK2A 2BHYA 3B6SB 4MAUL 4P2QB 1BEYL 5FFLA 4NUJB 4N5EC 4ONHA 5EUKA 4WU7B 1JGEA 2PUQT 3H9SA 3MRDA 1KPVB 2HMIC 4M43L 2DI8A 5IW6A 3WYRA 5ESAB 2W65A 3N9GL 1VA9A 2OXHA 3KPLB 3MLUH 3S97C 2BVQB 4FMKA 3VW3H 2KH2B 3BKYH 4P2OC 2VLRA 3BKMH 3LKOA 3H42H 4A2MA 3RAJL 3PWPB 3QP3A 1JL8A 3CD4A 4WY7L 3PG2A 3RA7H 1I1YA 3MNWA 3VI4E 3PGCB 4MLIA 5I1LB 1T5XA 1KT2A 1T1WA 3KPRE 4WUKL 5E9DE 5FUZL 3MUGB 3RVUC 3FHQA 1T6WA 2CO7B 3MV9B 1MHPH 4PYGA 2NW3A 1KB5H 4JFXA 4OD2A 5DK3A 1TLKA 2BSTB 4MJIB 2Y06H 1ZVSA 3RTQB 3BGMA 2NW2A 1YMHB 3BYTA 1S7XB 2WINB 5GRYA 4AMKL 2NX5B 1TXKA 2EDEA 4GBXA 1MIEL 3TF7C 4NN7B 2BY1A 2ERJB 5CJOH 5C0GA 4WW2B 3SKJH 3FMGL 5GS0L 1WCBA 2FEEL 4N90E 4TNWK 5HY9B 4OIBA 1FJ1A 5DVNA 3GFUA 4OM1H 5KVEH 1HE7A 2AKRA 2FNBA 3O2DL 3QIUC 1INQA 5C86A 3B3IA 4DZ8A 2W07A 3VD3A 3QYCA 1RD6A 4E5XB 1WFOA 4E41E 3AXLB 4LFHD 1P2CA 2EC9T 1NC4B 1CICA 1KCUH 3HZVB 5DD6A 3SN6N 5CEZE 4JQVC 5K9QI 1DUYB 1Y6MR 3QFJE 3DX6A 4LSDA 4A2LA 1PYWA 4HGWA 1KN2L 5F7DA 2GYSA 2IPKB 3RDTB 5HI5D 5KG9B 2DLHA 1Q94A 3RI5K 5ID1A 3IDMB 3RWDB 12E8H 1LILA 3WFDL 2VLKE 3OKNB 4M6ML 3K74B 4GUPB 5LBSL 1R5WB 4OLUH 1BZ9B 4OJFH 4DGIH 1JI1A 1C7TA 3VXOB 1ES0B 1RJZB 2W9EH 2GSIA 3SDDC 3PGDA 1BJ1J 1FFPB 2A83B 1WV7T 5I75B 2LVCA 3GMMB 4G9FE 3TEUA 4LHUB 4U6XA 5DURB 3CLFL 1L7TL 4L8BB 2WP3O 4QRUB 4NZTL 4XBGA 5AUMB 5LCVH 3RAJH 4YQXL 5T1KB 1MFNA 1QOKA 4P2RE 4WY7H 1PG7W 4Z7QF 4C55A 1IAMA 1VSCA 2P8PA 3VRIA 4C83B 3RNQB 3LEXA 5CJ8A 1EBAA 4I18A 3SPVB 3EZJB 3KPRA 5E9DA 4WUKH 1EFXD 5FUZH 2DTML 3UTQB 1IC7L 1KBGH 1UADC 4NQTA 2HT3D 3UZQA 5ESVB 4DUXA 2V2WB 4N0FA 3MA9L 3D2UB 4C58B 4KKNA 1PKOA 5TFSH 5BW7A 5J9PB 4X6CF 5E8EB 2ZUWA 2R29L 3SDYL 5DD1H 3RZWA 3U9PL 5F1NA 1XF3B 1X5HA 4MNQB 5EH1A 4AMKH 1UACH 4WO4B 4EZMA 4PJCE 3SQOH 3GGWA 3ZYZA 4GKZA 3SOBH 3U30C 4MCZA 3FMGH 4YHMH 1CFQA 5GS0H 3C5JA 1CI5A 1OLZA 2R2EB 4JDZB 3DURA 2GK2A 4TSCH 5HHME 4BSWB 2ITCB 4F15B 3G6JB 4P23B 5BVPL 1YEGH 1KIRB 4NKMB 5DRZB 3TBTB 3O2DH 2EYTB 4NN5C 4L8DB 3GSRB 2N56A 2C3HA 4HWEL 4JRYE 4NFDA 5FYLD 4MD0B 2XIDA 3DRTB 1JYWA 4E41A 4IMKC 4XXDA 3V5DB 2ED7A 3MUY1 2ZG2A 1A1OA 3EOBA 3H9SB 2A73B 3MRDB 2V17L 1IGIH 1R3JB 3QFJA 5GXBB 4HD9A 3ULVL 2FATL 1N3NA 3DV4A 1KN2H 4AT6A 5GGVL 1GPOH 5H2BB 4QF1A 5JDSA 4JAMB 3FOLB 4EKXA 1QBLH 2VQTA 2VLRB 2UY6A 2YPLB 5KSBB 2YS4A 2NR6D 1ZLWH 5HHQA 2AJ3B 4KH2A 1FZKA 3CZFB 1JE6A 2C3XA 3REVA 3MJ9L 4OI7A 4LSQL 5IBTL 3V6OE 4HS6B 4M6MH 1CFVL 3VFOA 2DWEB 3CFDA 1A6AB 4KXZH 3MR9A 4MA7H 5CP7A 1U8QA 2Z9TA 4JHAH 5GRUH 2NXZB 4PJDA 5HI4C 3U0TB 1QFUL 2IC2A 2NW3B 1FL3A 4W68A 3EAKA 4JFXB 2HFFA 3CFCL 3QEQB 1QTYT 3VA6A 5IFAH 2NW2B 1RZIA 1A3QA 1TTGA 3KPMB 3PWVB 4GBXB 5L2JB 2HT2C 3SGKA 4NKDA 2XNAA 4X9IA 4XVUD 4P2RA 5IIEA 2HT4D 4JO3L 5GS0C 3QZWG 4NJAL 2AJZB 5E8DH 5B3NA 1FLTX 1JHKL 5JHLL 1C5BH 2Y6SC 4J3SA 2W38A 5F96H 3ARFA 3FAWA 3SO3C 4MQSB 4Z7NF 1T20B 4HKZA 2AKRB 4NQDA 1IC7H 4J7RA 1JUFA 1INQB 3MA9H 2ITDB 1MEXH 1UWEL 1LGVA 2JB6A 3I2CL 1WCQA 4PJFB 2AXFA 3S3SA 1UVQA 3L3JB 1AGDA 3MV8D 1HOCA 2R29H 3SDYH 3U9PH 1CICB 4U0QB 1LP9B 1MHEA 1X44A 4PJCA 3HE6A 5EWIH 3QI9A 3VDAA 4CMHB 2XKNB 1TQCB 3DRQA 3V4VL 4HAGA 5F7DB 1Z0NA 4CADB 1CIDA 3RKDD 3QDGB 1Q94B 2HAZA 4Q9RH 2D31A 3EYQD 5ID1B 4I8DA 5GGQL 1OP3H 2WANA 2EKJA 3L5WA 3T0ED 1DL7H 2YC1B 3B9KC 2XA8L 4BH8B 1KNOA 4HWEH 1N0XL 2J8HA 4L8SB 2OL3A 3UYRL 4XI5C 3KNBB 1WUNT 2WLYA 4DK3A 5HYSG 3HZYB 1KF9B 1DN0A 5C0RL 3HMXH 1RU9H 4ODVH 3TESA 4U1HA 2V17H 3DIFA 2AAVA 1NCAL 5C08A 3RHWF 2FATH 2YXMA 4PJBA 5GJTL 2WLZA 1S78D 1XR8A 2GJ6E 1DBAL 3P4LA 3QIWD 1JZ2A 5M7QA 3HAEB 4I0PD 5E6IB 2HJFB 2W9DH 5F9AC 3EGSB 4KK5D 4PG2C 1J11A 3JV4A 4LLAA 3PXJA 3FN9A 1JBJA 3G6AA 4Z7QE 4LSQH 5IBTH 4O2FA 4P2OA 1ZLSH 1CFVH 3AFLA 3EO0B 3WKML 2P8PB 1P4IL 3ULSA 4Z77B 1S9YB 3OB0H 5LJYH 4RSVA 3WV0A 4U2ZA 2PW2B 2YA0A 2D0GA 3KPRD 5E9DD 4PJ7B 4EBQH 4HQQH 4LAQH 3U46B 2HTKD 2IEPA 4N0FB 2F54E 1MHCB 5K59F 1QFWM 2HJLA 3CFCH 1H3PL 2WIMA 4ZUSB 4X6CE 1D7FA 1LK2B 3IS0X 3GSQB 4HUMB 2XXCB 3CJJA 4NM4L 3ROOB 3RJDA 1B6DA 4WUUE 5IHLB 3GNMH 3PHOA 3PQYE 4B53A 4J3VA 1GOHA 4NQCA 4JO3H 1BZ7B 1FO0L 3C2AH 3LRSA 4NJAH 4N90D 3DURB 4WHDA 1DLHA 4WTZG 4X8XA 5JHLH 1A4KA 1DQDL 1VFAA 2J6EH 2V9RA 2VLJE 4MHHG 1AIFB 1FHGA 4JY6A 1DR9A 2D0HA 3FKUS 4P59L 2FO4A 5C9JB 4OFDA 5ADOL 5J13B 5F9WC 3MLTB 4L8CB 2CJUL 3MOBH 1VGKA 4KI5F 5GS1C 4R7DA 4E41D 4XXDB 4TNVF 4PJ5E 4KHTH 3TWCL 5HHXH 5CEZD 4GKNA 2CDEA 4OF0A 3ULVC 2RCSL 1QR1A 4PV8B 1QRNA 2N7AA 3QHZL 3C09C 1REIA 1LEIB 2EDTA 5DTFB 3S35H 4PRDB 3FTGB 5DHYA 4V2CB 4B50A 1J05A 1HHGA 1PGRB 2DQEL 3KJ6H 4JQVA 4YFLI 4ZTOH 1Q9WA 1M7DA 2X4NA 1I3UA 1YECL 5GHWL 5D96B 5JTWA 4ZFFA 5KVGH 2HH0L 2XA8H 4KRNA 2VLKD 4PRNA 5KBNC 1N0XH 4MXVF 2MPAL 1DBBL 3BP4A 5C0CE 3VFOB 3TZVD 1MQKH 4JLRA 3QUKA 1A6TA 2GI7A 3ZO0A 5C0RH 4JGMA 4XMPL 2VQ1B 1U8QB 2IFFL 2HJKA 3WDIA 1JTPA 4ZG1A 5HYFA 2ZZUT 4PJDB 2D4DA 2H32A 3MUJA 4L3CB 4GRWF 5I8KL 4G9FD 3VWJA 3VGAB 2GJ6A 3FN0L 1TTUA 3H7BA 2FH6A 5D9SA 3MLZH 2GUOA 2XKUA 5HGBB 3BDBA 3WL9B 4LLYB 3EYSL 3LKNB 1A9EA 3SDDA 1I8LC 3MLRL 1BIIA 1WIPA 5I9QB 3KPSB 4NKDB 4P2RD 4O2CB 2Q6WB 5IESH 4EI6B 4XNMA 2YPKA 3B9VA 4R2GC 3MRHA 4YPGB 5T1LD 3ARFD 5D2LF 2UY7A 2LABA 1KFAH 4Z7NE 3D3VA 3PWJB 2VZUA 4JJHA 4OLWL 4OSUH 3LH2H 1D3CA 4NQDB 3ULUL 5JXAL 2F54A 3MRKB 4UV4H 1Q72L 4XCEA 3H6JA 4IRZL 4Y5YB 3KLHC 1BFVL 1FGNH 5IHZB 1RIVL 2AXFB 4LCYB 2GTZB 5KVDH 1IARB 5L7XL 3RU8H 4CGTA 5DA0B 4WFEE 3C5SA 2APVA 5GSVA 1F4XH 4NM4H 4Y4FD 1MHEB 3GSNH 4FQIL 2ZPKH 2L0DA 1ZANL 3HE6D 4J3XA 2DLGA 3QI9D 3V95A 4FABL 1MCPH 1X5AA 3JTSA 5HYJE 3MLYH 4X6DB 4LIQL 3REWA 5JIPA 5HHMD 1NMCB 1SJEA 2VLJA 1CLZH 3K8MA 2DAVA 5L6YL 1KNOB 4JRYD 3KYOB 4B5EA 2CJUH 4XNZB 4KJPD 1WBXB 2BRQA 4PJ5A 4TNWF 5IW3A 3W9DB 3EDDA 3TBWA 3TWCH 4YBLB 4CNIB 5JOEA 3RGVC 5IR1A 4F7CA 4BUGA 1U92B 1FNHA 1ZAGA 1QD0A 2VDKH 4TUKL 4TSAL 3WIIL 3DIFB 1ZOXA 5C08B 3HZMA 1J10A 4HK3N 4LK4A 1XR8B 4WDIA 3BPLB 4N5ED 4X4ZA 4XPFL 1UCBH 3DSNA 2DQEH 4X4YB 2VWEC 3IFNH 1D6VL 2CK0H 2HMID 3SQBA 2X4PA 2ZKHL 1CFNA 1YECH 5CJQL 1KTDB 3HNTL 4KK8D 2B20A 4XCFH 1AKJB 3V0VA 4XCNB 2EEAA 1MWAL 4Y4HC 3RWFA 1OGTB 2MPAH 5GIRA 4P2OD 3C87A 2AJUL 2EDBA 1GZQB 5BQ7B 2DQUL 3NCCB 3ULSB 4ZUUA 4OGXH 4X98A 3U83A 6CGTA 4KKAD 3RI5F 1QO3A 3L3GB 4RGND 4JZJC 1CDBA 3T2QA 3E6FB 1F3DH 3GKWL 3MUHL 5ADPH 5K59E 3AMLA 4JPWL 4OV5A 2HJLB 4JM4L 3X11A 4BFIA 2GK0A 1N4XH 1Y18A 3HPLA 3UO1L 3JV6B 5JW5A 2VUYA 3MLRH 2YN5A 5KOVC 3ZYOA 4Z78A 4PS4H 1TPXC 6FABH 4JANB 5AD0A 2R1YA 3LRSB 5ITBL 4OZGF 3RPKA 3I75A 3LN9A 3MMEA 4X80H 5C07A 1QBAA 1AHWB 1A4KB 4KU1A 1F2QA 3PL6D 3VFWA 1W8NA 4UIMA 3N1QC 3PABB 3SKMB 3PWUA 4OLWH 1YJDH 1VESA 5MENB 3ULUH 1MOEA 1NFDF 5JXAH 3I6KB 2QQNL 1DSFL 5MERA 2D3VA 4IRZH 3UCRA 4D9RE 5I1CH 3FZUD 4TUOB 2QSVA 4W6YB 3MRPB 4G6AD 4PREA 3QIUD 3I50L 1YDPA 1FC2D 3BXNA 3KS0H 3CUPB 4N0UE 1QRNB 4HH9A 1TIUA 2IADA 4FABH 2VDOL 5HPMB 4MDIA 1XCQA 2EIZA 5HYJA 3BUYA 4WI6A 4Z0XB 1RURH 4G6FB 2QJDA 4LOUC 3ULVE 3BD5A 5DJZB 3MRFA 4LPWA 2X4NB 1T80A 4QHNA 4F7TB 4O51A 1TENA 1VHPA 3QQ3B 3Q0HA 1IQWL 2HVJB 2BVPB 4MXVE 5E70A 4CU8A 1YEEL 1TQBB 4O58L 5GRXG 2Q87A 2VE6B 2NY1C 1SEBB 1A6TB 1EEZB 3QXVA 4NT6A 1ZGLM 3S8WA 2GKIA 2YR3A 3MCLL 3B9KA 1SVZA 1H3TA 2HJKB 2PYFB 3QXDB 5EC1A 4GRWE 4JRXB 4JFEE 1FIGL 4KK6D 1P7KA 2H32B 3WIIH 2QHRL 4XRCA 3VWJB 2GJ6D 4YXKL 3E6HA 3ZZ1A 1KB9J 1MFDH 4Z76B 3ARRA 1OTUC 3K46A 1D6VH 3G5ZA 1A9EB 3KDMB 5JLZA 2FR4B 1BIIB 5CJQH 1RJYA 1I3GH 3HNTH 5DK2A 1XMWA 1MI5E 2JJTC 4K94H 1MWAH 2DM2A 3FT2A 2DQUH 2EYSB 5D2LE 1AR1C 1E6OH 3QUYC 3QAZB 1G7QA 1LEKA 4PG2A 3ARGB 3L3IA 2BCKA 4HJJL 4WFFE 2G75A 1W8OA 2XWJB 4LQFH 2F54D 1Z0MA 3L95A 3O9WD 1KELL 5D7KE 3UROR 2HRLA 4PLJC 4JM4H 1ZGLA 2FYYB 5IB3B 2XQBL 4ZFGL 2PTTB 4ISVA 1OAQH 5EA0L 3V9FA 3AB0B 3ULUF 3C5SB 1UXWB 4KPHL 1DTUA 5ACZA 4FTVB 3ARPA 3UO1H 4WUUD 3S5LA 1T1XB 1W72B 2KL6A 3PQYD 1KPUA 5IJKC 3C6LC 4H1LB 3O3EA 5FA3B 5ICXA 5ITBH 1II4E 3REWB 2HKHH 3KLDA 5DRXA 4N0CC 5CUSL 4OQTL 4NUGH 1NLDH 2VLJD 1YYLL 1YPZB 2XZCL 1ED3A 2QQNH 2KBGA 4JRWA 4PJ5D 2O5YL 4PJXF 3TBWB 1TTFA 5FECA 5DC4B 2EICA 3T4YB 5EU6B 1E6JH 4E0RB 3CU1A 3L7FB 4DVBB 3I50H 1WVZA 2PTVA 3RVWD 1I1CA 4N0UA 4UBDC 5TDPB 5I19H 5GS1A 3UYPA 3BGAA 4H20L 2R0WL 1QSFE 1CD9B 3A0OA 3IDIB 5GJSH 3RWIA 4U3HA 5I2IB 3FOMB 4YFLF 5HDBF 4LLWB 3QWRA 2ZP0T 5DJ0A 3IGAA 5D7JB 1EK3A 4U31A 3D85B 4ZS7L 4Y1AB 1UXSB 2JIXD 5DZOA 4JEGB 1R3LA 1YEEH 2X2YA 2Z4QB 3H3BC 3I02A 5C0CD 1T5WA 2VWEE 3G6DL 4ZUUB 1B0WA 3MJ9A 3TO4C 4H8WH 3HE7C 2OSLB 3B8YA 2APBA 4A6YB 3X13A 2FB4L 2RR3A 3ZE2F 5AZ2L 4OV5B 4OZFH 4ZFOL 1HDMA 4GLRI 3X11B 4OGAC 1A6UH 3T65B 1KPRB 4JPVL 3PNWB 1Q0YH 1LD9B 2D2OA 3LKQB 2NXYD 4XNQB 3NBNA 1RIUL 2NY7L 3X14B 3HPLB 1J8KA 5J6GA 3LPGA 2DICA 5JW5B 1L0QA 3O3DB 1T22B 5D1XC 4Z78B 3TIEA 1A0QL 4CW1B 4QRPE 1K3IA 3TIDA 3MACL 1DBJH 2ZSWB 5C07B 4FXKA 2AV7B 5I1IH 2HT2D 1FFOB 1TVHB 5BV7C 5F44A 4Q0XH 1M6OB 2GTWB 5GS0D 5AZEL 4HJJH 3SJVA 1NFDE 2LVEA 5C8JB 2F58L 1KELH 5ANME 5IMOB 2XQBH 4P57B 4ZFGH 5EA0H 4WFED 3SKOA 4PREB 1UG9A 5JQHC 1P7QA 3MLXL 5BZWB 1G7MA 4KVNL 1I9EA 1ZE3C 2A38A 4GQPH 1GOFA 4R4FH 4RMUA 3DUHA 2IADB 2P42B 5I76A 3HAEG 3CLEL 3TH4T 1XCQB 2EIZB 3CPLB 3FB8B 3FRPA 5HYJD 4TN9A 1DLFL 3MRCA 3NACH 1M7XA 3DSFL 5J6HB 5EFIB 5SWZE 3MRFB 3QFDA 4OQTH 4FFVC 1NCUA 1YYLH 1I7TA 4O51B 5FF6A 1JZ6A 5DMYA 3QQNA 5L8JB 2BVUA 2YD5A 4P9ML 4R0LB 2YXFA 5I66B 1AY1L 4BQ6A 2DQHL 3LPWA 2ZUUA 4UILL 4JFQB 3M8OL 3WEXA 1KN4H 3F7PC 4D94A 3R06B 3B9KD 4ELKB 1F2XK 1ZA3B 5EU3A 5T3XL 2VIRB 5HVGB 3VE0A 4HUXA 4HULB 1MJ7L 4X7CC 4H20H 3VMOA 5F9DC 1QSFA 2R0WH 3RGVA 1BBDH 3ZTJH 2H2PC 2OJEB 1JGDB 3G5ZB 2EC9U 1IGYB 3QNZB 4O9HL 4EXKA 4EVNA 3FO9A 4HLZG 1RJYB 4JZNB 5DK2B 4D0CA 5CMAB 5DF0A 3RIAK 4M1CC 2BMKA 5DGRA 1A5FH 1B0GA 2HLAA 3RVTD 1EBPA 3GSWA 4XNXH 1DUZA 3G6DH 1ZK9A 5IKCA 5DLMH 1R5IA 4K3DH 4PGDB 4IOSD 3QJHA 3BEVA 3DX7A 5I18L 4S0SD 5L8LB 3WFEL 4Y4HA 2QEJA 4YIQA 3TVMC 4GQ9H 5JW4R 3D1MC 1IC4H 1IGML 3PP4L 1XGPB 1CFTA 3D69A 1ZGLB 4UT7L 4QYOB 3KYKH 1IEBB 3LKRB 3ULUE 2FGWH 4JZJA 5EO0B 5CLWA 5ACZB 1RIUH 2NY7H 5ESQA 3WXVH 1R5VB 4X4XA 1P7HL 5IGXL 4M6AA 5A43C 1HINL 1R3KA 3MACH 5TQ2L 4X7SH 1XGTB 5E2JA 1T0NB 4IOIB 4AIZB 1FO0A 1VFOA 1J18A 1DE4A 3RNKA 5B38A 4JO1L 5DJCA 5AZEH 1NFDA 4LIQE 5BXFB 1LNUB 3QDME 1QEWB 5I6XB 4KI5D 2F58H 3CSBA 4PJXE 4FFZL 4D9RD 5B8CB 2Z93A 5B39A 1OF2B 4RMRA 2AEQH 4KTDL 1AJ7L 5A2LH 4JFYB 5DMIH 1FNFA 4O00A 4G8EA 1N5YL 4ZNCD 4CAGA 1INEH 2VQUA 3UJJL 2ZCLH 3BEWB 3RWIB 5HDBE 1I3RA 1TNNA 3WUWB 5D1ZC 3ULVD 3DSFH 3ZLQC 1KXVC 3CVHH 4F3FB 3QWRD 1HHIB 5DJ0B 1YQVL 1T66D 4LSTL 2E8YA 2YSSA 4L1DA 2HVKB 4PJAA 3SDXB 4DN4L 5JW3H 4Z7OF 1NGZB 1BD2E 1T5WB 4XPTL 4IRSB 3EZ8A 3GK8L 5E08H 5GZND 5J3HD 3CSPA 4LSRH 1BVKB 4YBQC 2AXJA 3X13B 1KEML 2NY2B 4JFED 4LSSL 3ZE2E 4U1SB 4DKAA 4UUJA 4R8WH 3MA7A 1VEMA 2CUHA 5C2UB 4P5TC 1JVKA 1ZGLP 5DVOA 3MZGB 4PIRF 3K2UL 2P5WB 2VDQH 3PUCA 4X7TA 5EO1B 3NN8B 3VDBA 1S9WA 1MI5D 1J8HA 1HNGA 1QP1A 3CCHB 3VG0L 4AY0A 1L6ZA 3SE4C 3TIDB 1KJ3H 3LZFH 4U1GB 4ELMF 1I9IL 2AK4E 2VDNH 4FXKB 1ZEAH 4HMEA 4JCMA 1N6QH 4WFHE 2NYYD 4U6HB 4WFFD 2JJTA 4RCAA 5F7LB 3SJVB 3WFEH 4R2GD 3ZKMD 3A6OA 2F8XC 5GISH 1JNHB 3PP4H 5GGTH 3QO1A 3QUXC 2OK0H 3BH8B 1MJ8H 1HQ4A 5D7KD 5HTSA 3QUYA 4CVXB 4JG1L 3E0GA 2O5XL 4QHLA 4DTGH 1D5IL 4DUWA 2AGJH 4M03A 1P7QB 4S0TD 4HIJB 3KLHD 3N1FC 5I76B 5IGXH 4OCYL 4JFFE 1HINH 1MAMH 5FUCC 5SX5K 4HFUL 2D03L 3NH7L 2VDML 1RUPL 5TH2A 3QFDB 4LNVA 3SGDI 5SWSB 2ZSVA 2Z8WC 5FM5O 5IJKA 3C6LA 1JZ8A 1XR9A 5FF6B 5ICYB 3JBG7 4XVTH 3QDMA 5FXCH 5FO9B 3PJSA 1WIOA 4G6KL 3ZSTA 4I48B 4KRPC 4TQEH 4HXAH 1OWRM 1F90L 2CK2A 1AJ7H 4BK4A 1EV2E 2X9WA 3I84A 1KXTB 5EU3B 4HIEA 2R2CA 5MEOA 2VXVH 4JHWH 4YE4L 5DHVH 1QSFD 1I8IA 3RGVB 3UJJH 1QLEL 3BIBX 4G5ZL 3F6IA 1IAII 3P0GB 4F7EA 4WW1A 4MSWA 1K3ZA 4KK9C 1IMHC 4XNUH 1YQVH 4O2EA 2OTWA 5IV2A 5I1DB 1K2DB 2ATKB 2BVOA 1KG0B 2V7NA 5CCKL 1DDHA 3DJ9A 3TO2A 4DN4H 5E94B 3VXRB 2BMKB 2HLAB 1UKTA 1BD2A 1GGTA 1JPFB 3WCYA 4F2MA 1CFBA 2HTLD 3B9AA 4OCSH 1R5IB 4XPTH 5EC2A 5DZLA 4OZIF 4QHUA 4GSDL 3BEVB 3DX7B 3QG7L 1I85C 4GH7B 3W5MA 1AP2A 4FQHA 1I75A 3JV5A 1KEMH 2EYRB 4LSSH 1OP9A 1EFXB 2E27H 1IBGH 5JHDA 3TO4A 5CZXD 3G5YB 2D0FA 4L5FL 3HE7A 4RQQA 4QHKI 1U8LA 2BFVH 4OF8A 5F93C 5T5FL 2AQ3A 5ESQB 4UAOC 1AE6L 4U7SA 2CMRH 4NC1C 4ZNEA 3MGOB 2YD9A 4XTRD 1QKZL 4QRPD 3VG0H 3NZHH 4M5ZL 1YC7A 5F3HA 4MAYC 3ZT5A 2AK4A 1I9IH 3UAJC 1L9MA 3DGGA 5I15L 1AD9A 5BS0B 1UQSB 5IBUB 5D1XA 3VXPA 3G08B 1NEZG 5DJCB 3RY5A 1M1SA 1ODAA 4R4NC 3G9VA 1YY8A 3FCTB 1OPGH 2E6JA 3L3KA 5B39B 1UM6L 1NCWH 2O5XH 1D5IH 2SEBB 3KPNA 3IDYB 2WV3A 2VXQL 1MCLA 3EJJX 4LCCC 1HWHB 4JFFA 1A2YB 3NCJL 4BZ1H 3F65A 3WBDA 1V8HA 4HFUH 5CKAA 2D03H 3MRLA 3NH7H 3O4LE 1YMMB 3MLVH 4NQXB 1MFBL 4ZOEA 5SWZD 1OP5K 4PY8J 4HF5H 1AGCB 3C08H 1JF1B 3SDCC 3FQRA 3H3PH 2YSSB 2LAGB 1XH3B 4Z7OE 3V4UL 4G6KH 4UMGA 4AIXA 4L9LB 4LOUD 1RIHL 3ZYJA 2H6PA 3TPUA 4M7ZB 1NKRA 1QLFA 4M00A 4M61A 1F6AB 1MLCB 5C0EB 4IM8A 2O61A 1J1XL 4G80A 4PJ8C 2IH3B 1MRDL 4NPYA 4L9DA 4K3EL 5FB8A 2NY1D 1I8MA 1P84K 3MA7B 5I1KL 5TDNA 4LAJH 1CGWA 3MLPA 4H1LG 3KPOA 3JTTA 5GSRA 4ZOAA 5CCKH 5HGDA 3LEVH 2YPVH 2GFBA 2JE8A 5LGJB 4U3XA 2V5TA 4ELME 5J12B 2X4SB 2ZNXA 1QFOA 5HGHB 1LO2L 1U3HD 2V2TA 4FXGB 2I9LA 2P49B 4ZAKD 4S11A 1K4DA 4Y8AA 3L1OL 3BP7B 4HHAA 4P4KC 1QSVA 1AR1D 3QUYD 3AS2A 2X6MA 2UUDK 3ULUD 1JRHI 5C0ND 4OB5H 3QRFM 3TVMA 1O7SA 2CIKB 1T2JA 3MV8B 4KKCD 4BH7B 1G7LA 1VACB 1FE8L 1MPAL 4HG4K 5CJBA 1T7XA 4PLJD 1UFUA 5DQ9B 1LHZA 3ZT7A 3IU3A 4POZD 2ZWLT 1F13A 5C2BH 5A2IH 5TH2B 5DWUL 2E5EA 5I15H 4IIQB 3C6LD 2FIKB 4OZHF 2DQIH 3QDMD 4L4JA 4DKFL 3MCKA 4JFOB 1NCDL 1Q9KB 4JDTL 3T0EB 4N0CD 4Y5VC 2DF3A 3QNXB 1UM4L 3CX5J 1D5ZA 4WV1B 3QT2A 4MQTB 1LDPL 1TJIH 2X4OA 3UZEA 4K8RL 1EJOL 4JJ5B 3UYOD 5MEOB 3NCJH 3G5VB 4NWUL 3GSUA 3ZKSD 5T3XE 4F7EB 3VXUB 5GGUB 3HTLX 1IEAA 3QIWB 2Q8BH 1TJGH 5F9OH 4EJ1C 4I0PB 4O2EB 4RNRA 3DYOA 3HB3C 1OLLA 5IV2B 3J7HA 1RHFA 4JZOA 3V4UH 1RHHA 2APWA 2VC2L 1BD2D 5D1ZA 1GYAA 3IU4H 5FOJA 1Z9OA 2XA3A 1TCMA 4OZIE 5GS3A 4R7NB 3W0WE 4XBEH 4QHUB 5TDOB 1B90A 1YNKL 5BOZG 2ZJSH 1IAIH 2CR6A 3HZKA 2D7MA 4LU5L 3DVNA 4ACPA 1U95A 4K3EH 2O5ZL 3MRQB 1EMTL 4FZEL 1NUNB 3TO4D 1JPSL 5I1KH 1NCCL 1MY7A 2Y5TA 1BQHA 1IGFH 4APQC 2DM4A 3F5WA 3HE7D 2A6KA 4JY4A 4YNYA 3STZB 5TPWH 4JKKA 4H25B 4GG6F 4ZFOA 5GRJL 3QCVL 3CC5A 1OSPH 2AP2A 4P5TA 3LY6A 4OGAD 3UTSE 3HI6L 4ELMA 2NY4C 4LGRB 2AK4D 4LEXL 1CWVA 5DJAB 1CL7I 1K4CA 3PDOA 1JYNA 3DGGB 4WFHD 1DVFC 1U8PA 4NC1E 5D1XD 5DS8A 4WNQA 3T2NH 4LRNH 4U7MA 1JRHL 3SE4A 3MJ7B 3RIAF 2YKLH 2VZ3A 3OV6A 3L1OH 3GMPA 1YUHA 4P0DA 3QULA 4FQJH 4YBHA 5DD0H 2DOCA 1TNMA 5MI0C 5FO7A 1HH6B 1N2RB 3QUZC 1KJ2B 2VLLB 3QUXA 4Z7UB 1G7JB 3IVKA 2R2BB 4HKJA 4IDJL 5EU7C 1MPAH 5CIPA 4JFFD 1SQ2N 3N06B 5KANG 5FUOH 3MRLB 4M1DH 3DYMA 5GRWA 4DW2L 4YC2B 5DWUH 4X4ME 4I77H 3B5GA 2A0LD 4OV6F 3L7EB 3GHEH 4DKFH 2CIIA 1NCDH 4JDTH 1FLRH 4JE4B 1E28A 3P0YH 5DYOA 2H6PB 1WK0A 2MFNA 5DZNA 3S4SB 1A7OH 1UM4H 2K7PA 4PBWD 4X83A 2C3WA 5F6HJ 3W39A 1U8JA 4OM0H 1FZOA 1KCVH 1LDPH 2XQYK 4K8RH 5EPMB 1EJOH 4NPYB 4ORGB 4EI5D 5IWLA 1I8MB 2GEEA 2BVEA 2R8SL 4HJ0C 5EN2A 3DARA 1YEDA 4NWUH 4NOBA 2FLRT 2A6DB 5TDNB 1NBZB 1JWUA 3KPOB 1R6VA 5GSRB 7FABL 5HGDB 4V2BA 4XPGL 5F72S 5ERWB 2H2PD 1IL1B 1FYTA 1OHQA 1YN7B 5J89A 2V7HB 4AQ1B 2V2TB 3W0WA 2I9LB 1RUQL 5T1LB 4IJ3C 3D39A 1YNKH 4M1CD 2NY3D 5IHUL 1K5NB 3U1SL 1K4DB 4HWNA 1EO8H 4HHAB 5D4QA 3RWEB 2X4TB 3BPNC 1XZ0B 5KW9H 1EO7A 4YHIA 4ZPTA 1K8IB 3IXTB 4N8VA 4YDKH 4GRLB 3RIFF 4WGVB 1IILE 3T2PA 4G43A 1CL7L 2HG5B 1IQDA 2LAAA 5GRJH 5HYQB 4Y4FB 3EFFA 2WNGA 2DBLH 3ISWA 3WUWG 5A40E 3UTSA 2XZAL 3JWOC 2R1XA 4PRAA 5A3IC 5D93B 5DUBA 4AG4L 5DQJA 3U7WH 3N85L 4PB9H 3O6KH 3TCXA 3ARYA 4YHNB 5KSAB 3B83A 2M8XA 4OZHE 1YN6B 5INCA 5ISZE 1JRHH 1BZQK 3KXFE 2F8VA 3O3BA 4JFHE 2X05A 2J1KA 3MCKB 4MAYA 4B0MM 1P4BH 4OIIL 2GITA 3SDAC 2OR9L 5JNYA 4G7YH 1UWGL 1N59A 5FGBC 1S7RA 2VDPH 3G5XB 1D5ZB 1RZJL 2XWTA 3AVEA 4K8RC 1NC2A 2WWKT 2WIIA 3G9AB 2OYPA 1LE5A 8FABA 2X4OB 4WJ5B 4N8CL 5HVFB 5FA4B 4U3CA 2DLEA 3O4LD 2JCCF 3MUZ1 1ETZB 2R4SL 3ZHDA 1P6FA 2VTFA 4DGYL 1I7RB 1WLHA 2A2QT 3BE1H 1CLYL 3GMRB 4LCCA 4HMDA 3KG5A 3WJJC 1C7SA 1QRKA 5E2TL 1XGRA 5EU4A 1HHHB 1XGUB 3UTPE 5DD5L 4JZOB 1WFTA 2JK5A 2OR8A 1E0OB 5D1ZB 3FB7A 4TSBL 1KULA 1A14L 1EXUB 3QIBD 4FFWD 4KTEH 2R69L 3ZE0F 3SDCA 4IS6A 4CVWA 2YD4A 4GW4B 2VDRL 5E5MA 1RZ8A 4HZLB 1R3HA 4LCIL 4WWID 1Q8MA 3V5HB 4EQ3A 1EZVX 3T77B 1U95B 4RGNB 4X6BB 3FQUB 3OBAA 2F74A 1GGCL 3F12B 2FBJL 1BQHB 5MEPB 5JPMB 3FB6A 1KLGA 2L7JA 2QADB 1I4FA 3GMNA 4JY4B 4YBQD 4YNYB 4GG6E 3T2OA 4PJ8A 1ZLVK 4MWFA 4NSKA 5LGKA 2N4IA 2NTFB 4Y88A 4MYWB 4BFGA 4ESKA 1NGYA 4L4TA 4NNXB 4WEMB 1CXLA 2DQDH 5KS9A 4XPGH 4BZYA 1BQLH 1UH4A 1NFKA 1ZHBB 1CE6B 2QV2A 4ZFZA 2EDQA 4XB7A 5CZVL 4W81A 1K4CB 3PDOB 4S2SB 3UC0L 1H3WM 2KKQA 3PIQA 4M5YH 5DS8B 2H41A 2EIEA 3PL6B 1CGYA 5J1SC 4U1JA 3W2DL 1YUHB 5CBAB 1KJMA 3FFDA 2PO6D 2FLBT 3FO0L 2DJUA 5FO7B 1A3RH 4ZO6A 3BDYH 5IEKA 2ICWB 1U8KA 5I1JL 3MRRA 3UPCA 3QUXD 4NYLA 4D8PB 2R0LH 1F00I 4P4KA 2XZQH 5E8OA 4YR6A 3UJIH 5CP3A 1ORSA 4HIHA 2VSDA 4DWHA 3PP3K 4D0DA 4UU9B 5ECJE 1IC5L 5C0AE 1EPFA 1NCNA 2N1KA 4OZHA 5EU7E 4ZD3H 1NBQA 5ISZA 3SCMC 1UEYA 2Z31D 3QPQC 3KXFA 3DTXB 5CGYC 2BNRE 2CIIB 1S5HB 3OKOB 4PG9B 4RAVB 3RZCD 1BOGB 2X5PA 3ARDC 3AROA 2OR9H 5DYOB 1JP5A 5GS2H 1T03H 3MFFA 4UOW0 2DMKA 3V52H 4R97B 4CMMB 1RZJH 3RBGA 3IAPA 1FZOB 5EZOH 1QSEA 1IFHL 2B2XL 5GPRA 4C56E 2VXSL 4KAQL 4Y5VA 4GG8A 4KRPD 2FHBA 1W0VA 1X5LA 3CH8A 4AK1A 5IHBA 5T3XD 2E7BA 4XPAH 1KSRA 3RUGF 4F58L 1C08A 1WZKA 1GGUA 1GAFH 3TV3H 2JB5L 1KB5B 3NGBB 4U4BA 5E2TH 2X7LA 2B4CL 3HHRB 2C5DC 2AXGA 5I0ZA 4PRBA 3U7YH 3ALWA 2AEIT 4Q6IC 1A14H 5I17B 3HRZA 5H37H 2R69H 3W0WD 1ZT7A 5LQBL 2VDRH 3MJ8A 3ZDXF 3D39B 4WWKB 2DYPA 3OXSA 3LQAL 1D5MA 4HXBL 1TZHA 3NFNB 3ORJA 1GGCH 2FBJH 5CLTA 4AEIH 5I16B 1QBML 3Q5TA 3X3FH 4PGCB 5EBMA 3S36H 1T1ZB 4N1EA 5F9JB 3OGOE 3MBED 1GOGA 3FFCB 3EFFB 4WUUB 5FM5M 3UTSD 4APQA 1H0DA 4JREC 1BOYA 1G0YR 1I1AC 2R1XB 4RGMB 4FQXB 2XACC 5DUBB 5CZVH 4P46B 4UAOB 2F19L 3R0MA 4XVSL 5F89A 4X9BA 2ICWJ 1RK0A 4MX7A 5F7KC 5H35B 2ZOKB 1KIQA 1L6XA 1MJJA 2MJWA 3QDJA 3M17A 4Z95L 4NKIH 2GITB 5JA8B 1SY6H 1DVFA 2ZUSA 3FO0H 3FRUA 4LHQB 3CH1A 3LD8B 1J88A 4YHPB 1V05A 2AK1L 1KEGL 1ZV5A 2XWTB 4Z7WE 2XTJC 3HLAA 1NC2B 5CD3A 1Z9LA 4P2YA 1ULVA 5E1AB 3MCG1 2PCPA 3WFCL 2JCCE 3P4NB 4HIIA 3GB7A 2E7MA 3U79A 3QUZA 5I71B 4FQ2H 1CD1A 1EJ6A 3HNSL 4G7VH 4TPRL 3HKFA 5DJDA 4YHKL 1J5OL 2MKWA 4MJ2A 1AQKL 2BNRA 4WHCA 2YRLA 3UTTA 3ZL4L 2ATPA 3O6LL 4YX2L 3LHPH 4LLVB 3E8UL 3ZE0E 2IMMA 4XP5H 5K33A 4H26A 5C0CB 3SDCD 1AI1L 1FGVL 1CS6A 2C4FU 4QRQA 3BGFB 4PP1C 4PJGE 3ARTA 3WHXB 1FVDA 1BAFL 4C56A 1FVEA 2VXSH 4KAQH 1F8TH 3VI3E 3IJHA 1OAUL 4KTYA 1A9BB 5FYKL 2DI9A 2YK1L 4QXUL 1DBML 2EDHA 2NLJA 2VZ1A 5D2NE 3RL2A 1QVOB 3FB6B 3GMNB 4LKCA 1I4FB 3ESVF 3MOAH 1E4KC 5K9KA 3OAUL 2J12B 4F58H 4PJ8B 4WHTA 2UZXB 2NXYB 4TRPH 4L4TB 4Y4KB 2PTUA 2B4CH 4UI2A 2XG4A 5KS9B 5TE4L 4PRIE 5IVXF 3NFSH 1FAIL 3K4AA 1S7VB 2YUWA 2G9HB 5DDHB 4GXUM 4GRMA 2ADGB 4LCWE 4PJIF 4NRXA 1PKQB 2H3NA 2Y23A 4HXBH 4WHYG 1OM3L 2BERA 1TETL 4FS0A 1G7HA 1KJMB 1X4XA 1NLBL 2IALA 1UKQA 2PYEB 4OIAA 4U2YA 3EYUH 1F6FB 5BJTA 4KJYA 4TVPH 1CGVA 5HHNA 3BAEL 4P4KD 5JIKA 4BK5A 3ZKQD 2EH8H 1XT5A 4YR6B 1KTKE 3QG6A 4LRIC 5TF1L 4HIHB 1AD0A 1ADQL 3OF6D 1W2KT 1HHKA 5KAQG 3TM6A 4RFEA 2BOBB 2F19H 2X70A 2YHGA 1AXSB 3R8BB 4X9GA 3ILPA 3O6MH 5ISZD 1IGCH 3KXFD 1A7PL 4JFHD 5CJXA 4Z8FL 1K9TA 3BZFA 1T7VA 3MFFB 3INUL 4MQ7A 4NO2A 2IBZX 3C60C 4Z7WA 1X6NA 1JMZA 4YHYC 5JMRA 4KUZL 3QHFH 3K1DA 3DO7B 4DEPB 1JTTA 4ODXB 4NO5A 3SDAA 1H8SA 1IKFL 3LSOB 4LGSB 3LS4H 1GHFL 3P73A 5I1HH 1ZVYA 2JCCA 1OGAE 4PTUB 1LDSA 3C9NB 3HN3A 4NQUA 5DJXB 3U0WH 1F02I 4GKSB 3RUGE 1PEWA 2DLIA 2BRRL 5F88B 3FQTB 3HNSH 3IDNA 4TPRH 2PETA 4YAQB 4KROC 1U58A 4ZS6C 4MVBC 1J5OH 2X7LB 1JNLL 5FGCB 4HKXA 3L3OA 3QWOB 4CVZB 3ZL4H 1GGYA 2Z35A 4YX2H 1FH5L 1G9NL 3CNKA 5L2KA 2YUXA 5CSBA 3ZDXE 3WJJA 1T0MB 3LQAC 4PJEF 2Q86A 1G6RA 1NEUA 3WE6B 3OXSB 4PJGA 5TE7L 4NP4L 1DEEA 1JN6B 2A6JA 1TZHB 4QRTA 5FM4A 4K2UH 2H9GB 2NY6C 5ENWB 1OAUH 3NIDF 2PKDA 2D7QA 2WBJC 4QXUH 3GJFA 3D6GA 4I2XE 5C0BE 1HZHL 3HI1B 3ARVA 3QRGL 1ORQB 1NAMA 4U1NB 1HIML 4LKXB 1FNSH 5EBWA 1A22B 5TE4H 4APQD 4PRIA 5GGRY 5JOFA 4J12A 4OF3A 3VU2A 4YH6A 1N64L 2M2DA 5DT1H 4GS7B 3MROB 4M6NH 3U36A 2EE2A 1H3UA 4IEFB 4LCWA 4MX7B 2ARJA 3BD4A 2QR0B 3NPSB 3N1GC 1KIQB 2NY4B 1J1OH 1OM3H 4AQOA 3S4SG 3L6FA 3M17B 3TLRA 1V7MH 1J1PL 3EYVA 1NLBH 1DVFB 4Y0GA 1B4JL 4MNHA 4ZQKA 2DWDB 2FSEA 3QXAA 4ZUTB 1IM3A 4M93C 2CLRA 3BAEH 4MJ6A 5MI0B 5E4EB 1IE5A 3UP1A 5TF1H 4NNYA 4XC3H 4X6EA 2RAMA 2PCPB 3MRGB 1KCRH 3RWHB 4ZUVA 1ADQH 1J0JA 2AJYH 4OCLC 5C0AD 1CD1B 2IPTL 2YD7A 4QXGL 2DLFH 2XTJE 4NO3B 2CGRL 4JVUA 4PGJA 2OTPA 1V7NL 2DJ4A 2X1OA 5DJDB 3WNKA 2R9HC 2XRAH 5FHBH 5DK0A 2BNRD 4HS3B 4Z8FH 5IB4A 1UZ6F 4XH2A 4FP8L 3UTTB 1PBYA 4U1MB 1BFTA 1CLOH 1Z5LA 4IRJC 2C1OB 2DKSA 4AH2A 5ACLA 1GGBL 3SCMA 2B1AL 5J8OA 4WW2C 4KUZH 2C1PB 2OI9B 1FVDB 2R0KL 4C56D 2DMCA 4Q58C 2F53E 3ARDA 2CQVA 1F5WA 1IKFH 1ZWIA 3V7MA 1OGAA 2VLME 1DN2A 3NA4A 2IQAB 1C8PA 1E27B 3L9RA 4ZSOA 5ALBH 1U8MB 1PG7L 2C7UB 3QH3A 1F4WH 5IVXE 3CDYA 1LO3L 3BVNA 1F42A 1FH5H 2OBGA 1NGQH 2PR4H 1JGUL 5FKPA 5HDLA 3P9MA 4GRMB 5I8CA 4PJIE 1T7WA 4NP4H 1HH9A 1K85A 3SE8L 3GSXA 5EO9A 1J0HA 4Q6IA 2IAMA 2VMFA 1A21A 4Z5RA 2ENYA 2IALB 3VFGL 1X5YA 4I2XA 2AXHA 1ZA6A 1HZHH 3C8KB 4MA3A 4LBEB 2Z92A 3BIKA 3CXHJ 4JFZH 3DHJA 1S5IL 5BJTB 4KJYB 1KB9K 2FWOA 1MRFH 3BD3A 4RA3A 3QZWA 3TYGL 1HIMH 2B7DT 3CFJB 1AO7B 3WS6C 1HI6B 2H45A 1U3ZA 5DFTA 4Y19B 1X5KA 3SE3C 3NOIA 5ILTH 1BVLB 4L3EE 1N64H 1PLGH 1J86A 2DQGH 1E4XI 1HHKB 1I9JL 5AYUH 5IVZB 1TJHL 3BQUB 4RFEB 1DQQA 1M7IA 5I75C 3EOYG 1WAAF 1BQSA 1HXMA 4F7PA 1JPTL 4TVSa 1I1AA 4FOMA 1M05B 5A3ID 3EJZD 3EYOB 1QACA 4ETQA 3BZFB 5FAAA 1RUMH 3GI9H 1EFQA 4PJ9D 1B4JH 1P9MC 1ONQA 1QPPA 4NO2B 4ALAH 2B0SL 4XCCL 1BECA 3MRMB 3IB4A 5DC9B 4E42B 4JQXC 3IJYB 4F33A 1F4YH 2EXYD 3SDAD 3DI3B 2VISB 4QRSA 2IANE 3MREA 3KVQA 4K8RD 4OUUA 1FNEA 3CGTA 4YK4C 2CDGA 4IMLB 3V5KA 3WUZA 1WSST 3ARED 4XWGL 5T5NF 2X42A 1MVFA 1U58B 5IJVA 2V6HA 3HCVB 2VO5A 4HKXB 3L3OB 1Y0LB 1G9NC 5HYSA 1JNNL 3O0RH 4FP8H 3TYFA 1MVUA 1CTOA 5L2KB 4PJEE 1T6VN 3QCTH 4HFWB 5DFVD 4QTHA 2Q86B 1GGBH 5L0QB 3RWCB 1CE1L 2B1AH 4NQSB 3MRBA 3U9UB 1DEEB 1FP5A 5JA9A 2AABH 2CR3A 1AGFA 1ZT1A 5T33H 4RRPG 1G7PA 5KN5B 1GC1L 4P23C 1PD6A 3GJFB 2W0LA 1AQDA 5JPNA 2DDQH 1OCWH 5E8NB 1GIGL 1A1NB 1D5XA 2A1WH 1NAMB 5TE6L 2CKNA 4BM7A 4OAWA 1JV5B 1MHHB 1S9XA 1U9KA 4LSVL 3MX0A 4PRID 3A6BL 2VL5A 1WZLA 4R90H 1E4KA 5CHNA 2EC8A 2LE9A 5I1AA 4NDMB 4QRPB 4OZGB 3GSNB 1C1EL 1JGUH 1RZGA 4F9PC 2ADFL 3U36B 2RFXB 2CLVA 4LCWD 2W0FB 3T1WA 4JO2L 4P2QE 2EKSB 4LVHC 4CDGC 3SE8H 1NGWB 3BZDA 1ZVHA 3GO1L 4CU6A 1S7WB 2E9IA 2GIYA 3EYVB 3V8CA 5HBBA 1MRCL 4LEOA 5ANMB 4MNHB 3NFPB 1CR9L 5DQDH 3X3GL 3QXAB 2EDXA 5HDQH 1IM3B 2CLRB 1E4XL 3TYGH 4ZMAT 5KSBF 1S7UA 3UPRB 1JK8B 3HFML 2FH8A 4NNYB 4X6EB 3PWPE 1M71B 4WTZA 3C2SA 3VG9B 1EGJL 4ZUVB 3KPQB 4L3EA 1IGTB 2EE9A 2NXZC 5ABDE 2AJSL 4POUB 3VFSA 1IEHA 1TJHH 4FG6C 5D70L 1NCBL 2X89A 4S10A 5SWZB 4LRIA 1JPTH 4U6VL 3S96A 4HT1H 2W60B 5IB4B 4M62L 3VXMB 3EYFA 4OI8A 4KVCL 1G7IA 3P30L 1CG9A 1Z5LB 2OQJA 3F62A 5DI8A 4AH2B 4ODHL 4U1KA 4B41A 4I0CC 1LE9A 4OZ4A 5E8PA 2B0SH 1MNUH 3QPQD 4XCCH 4MJIE 4OD3L 2YD2A 1R24A 2Y1VA 5EORH 3T8XA 1WFNA 3ARDD 1HILB 5ETUB 2BDNH 1GZPB 1OGAD 1QBBA 5C7XH 4QXTA 3C60A 5FKAB 5B3JE 1KCSH 3AS0A 3DUSA 3WFBL 4EDXB 1WT5C 4HC1L 4XWGH 5FYKE 4J1UA 1T0PB 4OCRH 3ZHLA 3QH3B 1HHJA 4YFDB 3T0AA 4U1IB 5FO8A 3DHMA 4KUCF 2I27N 4O5LH 1J0YA 4P3CL 3HG1A 1NFIB 4UQ3A 1SYVA 5FKPB 1EVUA 4M3KB 2DD8H 5EIQA 4XMLL 1TQCC 2X40A 2OZ4L 1CE1H 4X7DC 1U3HB 5K9JL 1N5AB 1HH9B 5FCUH 2I9TB 4I5BB 4ZAKB 5E24E 4M6OL 2CXKA 3AU1A 1KTRL 4HDIB 1NANH 2IAMB 3IDXH 4RFOH 2W1NA 5FEBA 3TT1H 3QO0B 5T1MA 4O4YL 5C0BD 1ZA6B 1FG2B 1QFWI 3BIKB 4L8SC 2FWOB