2CBPA

Cucumber basic protein, a blue copper protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
b'AVYVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUCUMBER BASIC PROTEIN
publication title The structure of a phytocyanin, the basic blue protein from cucumber, refined at 1.8 A resolution.
pubmed doi rcsb
molecule tags Electron transport
total genus 26
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02298 Cu_bind_like Plastocyanin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2cbpA00
3H56A 4BXVA 1ADWA 2BP0B 2EINB 3AY2A 5I28A 1AS6A 2VW7A 1YLBB 3IBOA 3NJLA 4RH4A 3T6ZA 2B3IA 3N2JA 1ILUA 3QJUB 4FA7B 1JZHA 4E9TA 1TU2A 2VW6A 1CUOA 1KDIA 1PAZA 2I7OA 2JKWA 1KBWA 2XVBA 3SBRA 3UABA 1AACA 1OCZB 1L9PA 2UXGA 2BP8B 1BQ5A 1ASPA 1DYZA 1NICA 1W8EA 5FC9A 2AFNA 1GSKA 4CSPA 2XWZA 1JERA 1SHXA 2FT6A 2PCYA 4WTQA 1RZQA 1KYAA 2CJ3A 2Y1AA 4P5RA 1E67A 4P5SA 3PXLA 1J9TA 2AZUA 1TKWA 2QT6A 5TK2A 1JOIA 2IDTA 2IH8A 3ASOB 4L0PB 2X87A 1ET5A 3QJVB 3WKPA 4JHUA 2N0MA 3QJSB 2GSMB 3OM3B 1ASQA 1AG0A 5I26A 1IC0A 3T71A 6PAZA 3WNIA 1ILSA 5D4IA 3CDZA 2WO3B 4ENZA 2ZOOA 4M4RB 4YSTA 3NSCA 2HX8A 5B1KA 1V55B 2VM3A 4N4YB 1AG6A 2XXGA 5B1JA 1EHKB 4AKOA 1PLCA 2YAFA 2FTAA 2ZONA 2YAEA 3NJKA 3QJQB 4PAZA 3X1BA 1RKRA 4E9WA 1OCRB 2R7EB 2PPDA 1TEGA 2H47C 3FYEB 1BYOA 4Q89A 3NJJA 2XU9A 1ZDQA 1J5DA 2BZ7A 2HRGA 2GI0A 4NERA 4DP2X 3CVDA 1JZGA 3ABLB 1NWOA 2E86A 2BO0A 3UAEA 2WSDA 3FPXA 3EH4B 4A67A 4DPCX 1MG3C 1L9SA 1XMEB 4G72B 4EF3A 1KDJA 2BW4A 4DP8X 1PZBA 9PCYA 4E9SA 8PAZA 1R1CA 1E65A 4PCYA 1WA1X 2EIMB 3FYIB 3OQRA 3FSZA 3NT0A 1AIZA 1MZYA 7PAZA 2IAAC 4G7QB 1A65A 2MTAA 3HB3B 1VLXA 2UXVA 3UADA 1A4BA 1X9RA 1GYCA 1W6LA 5B1BB 4YSUA 1RCYA 1SFDA 4DP4X 4BDVB 1FWXA 1AAJA 1J9QA 1SF3A 2OV0A 2AANA 2OJ1A 3MBWB 3T6VA 2YAOA 1EZLA 3FU8A 3X2QB 2I7SA 1AANA 3NJGA 3AZUA 1JXGA 2FQEA 1BYPA 2NRDA 4DP1X 1MG2C 3NP4A 5I5JA 3X1NA 1PF3A 1QNIA 2IH9A 4BXSV 4HCGA 5I5IA 1GS6X 3EH5B 3FT0A 2IDSA 1NINA 3GDCA 1JVLA 4QKTA 1WA2X 4HHWA 1BEXA 2EILB 4A68A 4ZK8A 1WS7A 3C75A 3FQ2A 4KNSA 4UAHA 3UAAA 3SBPA 3ZDWA 3FU7A 3HEIB 2FT8A 1E5YA 4G70B 4HIPA 5D4JA 1JZIA 1WA0X 3ZIYA 5B7FA 4KOCA 1M56B 5I6PA 1QHQA 3FS9A 2HRHA 2HXAA 4JHVA 2DYRB 3PAUA 3FSAA 1J5CA 1BXAA 3TU6A 4YSPA 4HZ1A 1IBYA 2PPFA 3QPKA 4YSRA 4JKNA 1N68A 1NIEA 1NIDA 1JZJA 2DWTA 3ZBMA 4A2HA 2XV0A 2IDUA 3NSFA 1X9UA 2X88A 3PCYA 5PAZA 1OE3A 1PCSA 1SDDB 1GW0A 3ZX1A 3G5WA 4G71B 1AZNA 3AG1B 2ZWNA 1GR7A 2I85A 2W88A 1AQ8A 1M57B 1PY0A 2P80A 2BWIA 2QDVA 2CUAA 5B1AB 3X1FA 4DP7X 4WKXA 1PLAA 3TBCA 5I6NA 1V54B 2XV2A 2DV6A 1PNDA 4QLWA 3EF4A 2WO2B 2YAMA 1ETJA 3U25A 1SJMA 3AG2B 3BQVA 3PLYA 2GBAA 4MFHA 5AFAA 2BP0A 2BHFA 2QPDB 2UXFA 4HALA 2HZHA 2TSAA 1IKOP 2PLTA 3FQYA 2YARA 5EHFA 1ZDSA 3JTBA 2UXTA 2VMJA 2YXWA 1BQRA 3T9WA 3L45A 4HHGA 3WIAA 2JXMA 2UX6A 2RACA 3IE9A 5I5MA 1ET8A 2DYSB 2YXVA 1J9RA 1SFHA 2VM4A 3CVBA 2BP8A 2AVFA 2FWLB 2IWEA 2H5UA 3S3BB 3ABMB 4YVNA 4DP6X 2IDQA 2QPEB 2FT7A 3AW5A 5ANHA 4BWUA 3X1EA 3S3DB 1AZBA 4GP5B 3QQXA 3DIVA 1HAWA 2CALA 2XXFA 3ABGA 4A2EA 4A2FA 5AKRA 2IWKA 2XLLA 2PP8A 4AKQA 3UACA 4A2DA 1L9RA 2PPEA 4YL4A 4G7SB 4E9QA 2PPAA 2J5WA 1AR1B 4E9VA 1FA4A 2Y69B 5E9NA 1PZCA 1OCCB 4KO6A 4YSQA 5I6MA 1L9QA 2CCWA 4DP9X 2TSBA 2XV3A 5PCYA 3TA4D 4F2EA 4E9XA 1NPJA 3EHBB 4GP4B 4UF7C 3NP3A 1BXVA 2HX7A 2YAHA 3FPYA 3EH3B 2JFCA 7PCYA 2R7EA 4K9JA 1A8ZA 4M3HA 5AZUA 3IN0A 4TXVB 5F7BA 1MZZA 1ZIBA 2GIMA 1M9WA 3UGEA 2AZAA 2W8CA 1V10A 4F7KA 5IY5B 5LDUA 1MDAA 1I53A 3OMAB 4HCIA 4YSOA 1GS8A 2Q5BA 3CDZB 3T6WA 1AZCA 2PP9A 1OF0A 1PNCA 2DWSA 4A2GA 4GP8B 4YSAA 2FQFA 5D4HA 5B7EA 1XB3A 3NJFA 4YSEA 2XYBA 3OD3A 1E30A 3IEAA 2J55A 1CC3A 1CYWA 2J56A 3KW8A 3PAZA 1HAUA 2EIKB 1ZV2A 3WI9A 1CURA 1T5KA 2GC7C 2YAQA 3DTUB 1PMYA 1CYXA 1SNRA 1GS7A 4BWTA 3WKQA 2DY2A 1GY1A 1KV7A 1URIA 1ZIAA 1JVOA 3CVCA 3FSWA 4YSDA 2OCCB 2J57A 4KO7A 4NAJA 4A66A 4DP5X 3ABKB 4W1TA 2UX7A 1KCWA 1KCBA 2GHZA 1UATA 4BDVA 1JXDA 1F56A 1ID2A 2P80D 2FJSA 1N70A 3DKHA 1JXFA 4YVUA 2PP7A 1AS7A 1BAWA 5A7EA 3TBBA 1SHWA 1BQKA 4AX3A 1OCOB 1XB8A 2FNWA 5B3SB 4G7RB 2VSMB 1AZUA 2FQGA 2HX9A 1W6WA 1JZEA 4N8UA 5TK4A 1IUZA 4NB7A 4HCFA 3NSYA 3MX0B 1J9SA 1SF5A 2A3TA 4KO9A 5I6LA 3T6XA 2BWDA 3V9CA 2Q9OA 1FFTB 2QDWA 3S3CB 4KNUA 3QJRB 2YAPA 2ZXWB 4BWWA 2XX1A 3NJHA 1KBVA 3QJTB 3NJMA 1IBZA 2CBPA 1ZPUA 3CZUB 3IN2A 3N55A 2HLEB 4X4KA 1AOZA 1XB6A 4AKPA 1A4AA 3WG7B 4YSCA 5B1JC 5B7MA 2H3XC 2YQBA 1KGYE 1OE2A 2XX0A 4DP0X 6PCYA 4AI7A 3FSVA 1RZPA 3X1GA 2MRYA 2EIJB 1E5ZA 1NIAA 1OV8A 3JT2A 3CG8A 1QLEB 3ASNB 1ASOA 1DZ0A 1SDDA 1NDTA 2LLNA 3FU7B 3SQRA 2BW5A 4GYBA 1WS8A 4DPAX 3GYRA 1OE1A 3RYMA 4E9RA 3OMNB 3TASA 1A3ZA 2VW4A 1AZRA 1TEFA 3AG4B 3KW7A 4UANA 4W9ZA 2GB2A 4KOBA 2IWFA 4Q8BA 2IDFA 1L9TA 3FU9A 1BXUA 1NPNA 3H4FA 3NJIA 1PLBA 3NYKA 4BK5C 4F2FA 1NTDA 3ERXA 3FQ1A 2PCFA 3S8GB 3S8FB 1AS8A 3PPSA 2XUWA 1B3IA 1HFUA 1L9OA 2VSKB 4GY4A 1GY2A 5I6KA 1PZAA 4AZUA 4YSSA 2B08A 2VN3A 2GC4C 3SBQA 3NSDA 3GXUB 1A4CA 1NWPA 5F7AA 3OMIB 3WNJA 1NIBA 4E9YA 1NIFA 2PPCA 2BZCA 3D12B 5I6OA 3NJNA 3PAVA 3BVDB 4HAKA 4KNTA 3AG3B 1ET7A 4CSZA 3H4HA 4GXFA 1NZRA 1WAEA 1JZFA 4KO5A 4DPBX 3V9EA 1OOWA 4FAAB 2FQDA 2CAKA
chains in the Genus database with same CATH superfamily
1WGVA 4CMHC 1URZA 2EINB 2V0AA 3HIZA 4KY2A 4W4OA 4LRIC 5DJ8A 2FUQA 3BPLB 4WEEA 2B3IA 3IJEB 4OCWL 1RH8A 2DQIL 2HT2D 1TU2A 4CDGC 4B9CA 2X4UB 5FOJA 5IHZB 3Q5OA 3S4SB 5D2NC 3ESPA 2QEJA 3IU4H 3QQ4B 1CD9B 3DHUA 3BO8A 5K9JL 4X9BA 4Q0XH 2ZYIA 1SXNA 3GBLA 4GSUA 5DD3L 5MP6L 2IAMD 4PRNA 1TETL 1GSKA 3MNVB 3BH4A 1DN0B 2ZX5A 3K6FA 4MS8D 1FRGL 3V0AC 4ZS6C 4AIZB 4Z7WF 4EUPB 5B1CA 5IW1A 3HHSB 1J0YA 2BJML 2WZ5A 5EWIL 2AZUA 5CO1A 1JOIA 3ASOB 5F9AC 1WBYB 1HINL 5IVNA 3NFPB 4YDVA 3KMDA 3H53A 4UQCA 2GJJA 5MEQB 1NEZG 2N0MA 3QJSB 3BUPA 5SWZE 4J6IA 2W0LA 3CTTA 2QQKL 4XHJC 1PZ5B 1UXSB 2WIIB 3QUXC 3SGJA 3VXUD 3C87A 3TEWA 5IG7A 1HHJA 3CZGA 5FHBL 3EXJA 1QO3A 1PIGA 2VLRB 4YHKL 2OSXA 4X6DA 3HZYA 1GOGA 3FN0H 1AH1A 5BUPA 1CGXA 4TQHA 3VDCA 1NCWH 1NFDE 2OMZA 5HYJA 2XOTA 4ONHB 3X13A 2Z3FA 4WUUD 4ZYKA 4MZIA 1T20B 1GOFA 5AVRB 4HIXH 2EAEA 1IAOB 1S7WA 4XXDA 1AKJA 4OVUA 1J8HD 5FO9A 2C9VA 2ZJSL 3FN3A 3JV6B 4HSAC 5CJ8A 3E1F1 3AQZA 3VWKB 3AWFA 1UD8A 4MAUL 3UBXB 5DK2A 5T1KA 1HNGA 4RMVA 4YHLL 4QWWD 2OW7A 1MVUA 3TFKD 1E4JA 4HGWB 1F4YH 4DZBB 4JPWL 5CBEA 3WLWC 3CFTA 2OI9B 3G9AB 3LMJL 4JFTA 2ZKXA 2P5EB 3KPOA 4NSKB 4MLIA 3RVUD 4ZSOE 4E41D 4XMLL 3VFNB 1AC6A 3KVDD 3FTUA 1BX2A 2NXYC 3ZDZE 4JDEA 3NT0A 2WGNB 4P4KD 1AIZA 4JGNA 4ZS7L 5AVSB 1BQLH 1F02I 3MACH 3QW9A 2J3SA 4IOSD 1HNFA 3AVEA 5JOFA 4X6CE 5DMIH 1DZBA 3VD5A 3PWUA 4GAJH 5IGXL 2UXVA 4JRYB 1LM8V 3E6HB 2JTDA 5CSBA 1TQCB 5DEFA 4DAGH 5AYTA 1E5BA 2APBA 1J7VR 2JK5A 1RIUH 2JNZA 3T77A 4XN5A 2CBOA 4N68A 1YQ2A 5KOVC 4KV5F 2WSPA 4NZJA 1U3HC 3QIWD 1WBZA 4KY1H 1SEQL 4HKJB 3IMWA 3QZOA 2NR6D 3NP4A 5I30H 1E8YA 4X5XA 5L7XL 1QTYT 3EFDL 3QWOA 4MD4B 3WKYA 1KYOJ 2CKBH 3HG2A 1QBMH 1R5VB 4N0UA 3O4LB 2RJMA 3NRQA 5JORB 1INQA 2VQ1A 3UROR 1JF1A 5HI5C 1HZKA 2MNWA 4XVOA 3K8MA 1UD2A 4UMGA 5I0XA 3F62A 4XCCL 1FH5L 5ESQA 2YQ2A 4PJ7E 5B7FA 2F74A 4LLVA 3S0PA 1BCIA 4NWUH 3VE0A 5JYLA 1A9VA 3EJCA 3HLAA 2PCPA 5GS2D 2RBLA 1Q0XL 2WUCH 3FSAA 5IROC 3BPOB 1UA6H 2UZYA 4YSPA 4ZODA 3VACA 1CMOA 1LILA 3PXHA 5HDBB 3T8VA 1NMCC 3REWB 3GJFA 1U21A 1XWVA 3BKML 3OKLA 4YXKL 2O5XL 4C56B 1A7QH 2WLJA 3GXMA 4WU5B 3SDXA 4GRWE 4QR7A 4NRXB 4TULH 4GBXA 1KPUA 4UDTB 4AXWB 1SN5A 4PY8J 1S7SB 2YWYA 3IMRA 2RH0A 1BECA 5FS5A 1G7HA 4KRPD 4OT1L 2MNUA 1DBKL 1LTXA 2D7PA 3MKGA 3R06B 3TVMA 3VI3B 1V54B 4RMQA 2EYSA 1P5VA 2BWQA 1PNDA 4Z7NE 1KGCD 2YAMA 3UTOA 2LU5A 4TL5A 2XBDA 1DQIA 1VENA 1AI1L 2I25N 4Q9CA 4LCCB 2DM4A 2R39A 3V6OE 2Y36H 3EFOB 3SYOA 1NMBL 2F7QA 4JZJB 3MV9E 3ULSB 1JPGB 3QCVH 4PI2A 3QPQD 4HOWA 3L7FA 3WTUA 4MNQA 2MKWA 2QLVB 3P30L 3Q7JA 4KXCA 3E0GA 3SPVA 3ZKXC 2QSCH 4ZI8A 2CJTA 4AVHA 1C5CL 2VM4A 2XDHA 4P5KA 3C5ZB 2E7CA 3RAJH 4YGVA 1E6JH 1MFMA 1PKQA 4Q2ZB 3IKKA 1I1YB 1FNSH 1CGVA 3SE3A 4I0CC 3QRLA 4MWFB 4XMVA 2XTSA 3O4OB 1MQKL 1TO4A 5ERWA 2Q1EA 4Q74A 4RNRB 4X98B 4YBLB 4UQ3A 2PTUA 4A2EA 1BG9A 3RNQA 3OXRA 1CWVA 1JGDB 2ATPA 1SBBA 2YN5A 1RP8A 3DGGA 3QHZL 4TUUA 1ACYH 5HGDB 4BJLA 1CF8L 2IANB 4J4PA 2VDRH 3LQAC 3RKDC 5I1GL 1UB6A 1GZHA 1FA4A 4M6OH 1W91A 2VLRD 1NCGA 2QVKA 4HBQA 2YD4A 1JVKA 4P2QE 2KS0A 5FUCC 1QKZL 3VFSA 5A2FA 2CCWA 3BZ4A 1IEBA 2QKIA 5C08B 1ZE3H 2YUZA 4Y2LA 3AADB 4IRZL 2CGRL 4LLQB 4JY4B 3WEOA 4FP8H 2QR0A 3ZHFA 5E5MA 2B20A 4ACPA 3KXFB 4W9EC 3OR6A 2P8PB 1PZDA 4OCYL 3KPSE 4Z78A 1EVUA 3GSRB 3UTSB 3ULVL 3MRDB 4JM2C 1M7UA 5F9JB 1JAEA 1ZHNB 4YZFE 5HHXH 4NPYA 1TJIH 2FECL 4XOAA 4FEMA 1KELL 4KZDL 1LQBC 5DJ6A 3DJSA 3TBYB 5AENA 3JWOL 1A0QH 3FFDB 3TEZA 5E8DH 3IDNB 4F7KA 1GYAA 4BGLA 1BHGA 4AT6B 2EDJA 5HHVL 1QBLH 2P5ED 5D7IA 4TOYL 2CO2A 1FGVH 3T2OA 4GPVA 4MA1C 2YLHA 4GP8B 1U8HA 3ISWA 4MCYA 4DGIH 4U1KB 5D7KD 2LFEA 5GZOC 1RJLA 3FL7A 3HMWL 1D5MB 4X42A 4KTGA 4J8RA 3GSNB 4CN4A 5D1QC 4M7JH 2EIKB 4F9LA 2ZAHA 1L7IH 5E9DB 1GZPA 3QRGH 3VWJB 1GS7A 1IM9B 5AOZA 3ZU8A 4JRYD 2ZQKA 4KKQA 4NKIH 1CQKA 3IFLH 5DUBA 5C09D 2VLKB 4XNDA 3MLYL 2ATAA 4PJEF 1P4BH 3VFMA 1BW8A 2P4AB 1QYGH 2R23B 2JIXB 3AS3A 4G3YH 1NH6A 1LDPH 3FQUA 1YNTB 4N0FA 5EEYA 3DRQA 4FFVC 1C8PA 3LH2H 3ZTNL 5K9OA 1UM4H 2P8MB 5GGVH 5JZ7D 1RERA 2Z6FA 4P46D 3F01A 5IESL 4OZFG 3SJVE 1BAGA 4QY8A 3D3VA 1H3PL 2K7PA 2WLYA 1AMXA 3LNHA 4LSTL 1OAKH 2NLJB 4Y1SA 3LRKA 2PO6B 4AM0B 1IC5L 2CBTA 2M83A 3EOAB 3O4LD 2XZAH 4ZUTB 4BFIA 3VMOA 2WLIB 2DQHH 4EOWH 1I1AB 1J9SA 2A3TA 1N6UA 1NJ9B 4J39A 1NQBA 5D72H 4FYTA 2NX5E 5HYSA 3WTWA 1ETB1 5T3XD 1ZVYA 4FJ6A 4PJ7F 1YEGH 3WY4A 1QFWL 2E75C 3Q8AA 4YK4C 3OX8B 2DL9A 2YD9A 3IGAA 2VR5A 4PUBL 5I8EB 3EOBA 3GZKA 2WCGA 1RMFH 1XFPA 3SKMB 3V5DB 3VXPA 3O3AA 2J43A 1ZJAA 4ADGA 3NZHL 4YSCA 4JPSA 4HG4J 1AGBB 4DFHA 4BQ6A 4LASL 1IE4A 4C56D 3L2NA 4KJQD 4AI7A 5EZOH 2ZE0A 4DESA 5C2BL 1J48A 4UI2A 4WEBL 2D31A 3JWNC 2NY6C 4YFLI 5EU4A 4PRIE 2OL3B 5FDWB 4C4UA 1MJJB 4HWNA 5JPNC 4WV1C 2X4PA 1XVSA 5EU6D 2O26U 2A0LD 4W6XB 3N1QC 5ID0B 1ZXQA 1BM3H 1HILB 2E9GA 5D7HA 2IF7A 3QI9A 2VR8A 3TP4A 4KJPD 4C83A 3OMNB 4HJ0D 4Y19E 4IM8A 2WC7A 1M6UA 4UANA 3C5JB 2JJWA 3RDJA 4AITA 3T3PF 2DPKA 5J3HD 1HZLA 5IW3A 1TJGL 4HXBL 2FDBP 5FF6A 4K7FA 3IDJA 4NQTA 3L3DA 4NKMB 5I2IA 4HS8H 3M17A 5CIPA 2CHWA 5D1ZC 2VQTA 4WI5A 1MJ7H 5FYJH 3NA9L 3GS4A 3PHOA 3IPBA 1JPFA 2CA4A 1H5BA 2EH7L 3C5ZD 4BK4A 4KVCH 4JFDB 3GLZA 1ZS2A 2V9TA 5ITBL 5KBKA 3EYVB 5L88L 1ZLDA 3FO9A 1ETZA 2C9UA 2BZCA 3FT3A 5K1VA 2COVD 3PAVA 1F4AA 5F71A 1QUNB 3WMPA 1LK2A 1ET7A 1XF2A 4Z76B 5IJBC 3KLDA 3FZUD 1QWUA 2I32A 3O2WL 3L08A 1R3KA 3IJYA 1E9OB 2AJSH 3CU7A 2IAND 1AS6A 2E5EA 1AD9A 2H26B 5EOCH 3AXIA 3EJSA 1E4KC 3T6ZA 4D8OA 2RA1A 2HUEA 2EDQA 5LAXA 2W9EH 3DUSA 2R1XB 2AK4D 2W07B 1X5IA 2ZWKA 3QORC 4OCXL 4Y5XB 2LHAA 1DJYA 1OTTC 5JDSA 1DLHA 2VDOH 3TIDA 4PP1D 3OHXC 3S35X 3IXAA 4NZ8A 2LTQC 4RFNB 1URLA 5C08D 4NLAA 1Q72H 1NCBL 3L3IA 4JRXD 1N8ZA 4QAMB 2AQNA 2CBMA 1J10A 2VMEA 5BPPA 2R83A 4J2XA 2A9ML 4PJFF 2RHEA 3HZMB 1IGFL 2QT6A 4IBYA 4M61B 2AEQH 3I50H 4FQJH 3IDYB 3TBWA 3QQNA 2QMJA 4Y2OB 5BO0D 1WBXB 5JR1H 3N91A 5C0AE 4YE4L 4BE5A 5IV2B 4IBVA 2DQGL 2IVFC 4NNXA 3T4AC 1JGUL 5TE7L 3ZPDA 5I26A 2DTML 5EIIA 4MJHA 5HY9B 1FBIL 2Q7YB 1RY7B 1RK1B 4J6RH 4PV9B 4BCXA 4IIQB 3HC0B 1BZ9B 2Z1PA 1IGIH 1GHFL 3MRIB 2ED8A 4M4RB 3U9WA 2GIXA 4YSTA 5FGBC 4RZCB 3UPRA 1V55B 3MLVL 4O4YH 5EEUA 2P5WA 2YD3A 4GAAA 4QRUB 4FI6A 3KJ6H 1DEEB 1W72H 1EHKB 2ADJA 4Z7OB 4CADB 3G6AA 5KYXB 2QGEA 4LF3B 1MREH 3BKCH 4L05A 4MJ6B 3MOBH 5E23A 3LZRA 2ZP8A 4BZYA 1ZA6A 2DW5A 1TEGA 1IM9D 3MR9B 1UYWH 4JFYA 3D7PA 2BZ7A 5FK9B 2X05A 4DP2X 2C8NA 1LMKA 1FL3A 3ARFC 3BT2L 2JIXD 3T0EB 1SN2A 4MDRA 3PL6A 4XNXL 2E86A 5J11C 3KDMA 3A6BH 2R0WH 4NHCH 2R9HD 3KYNA 3GMMA 1XMEB 3TA3C 2EP6A 1KDJA 4PPTA 3DVGA 4R4BA 2DKUA 1N3NB 4NFDA 3VO0A 5ALCL 2FJGA 2NY0B 3CFBB 1ZLSL 3RVWD 4MQTB 4BFBD 3OQRA 1F4WH 1JWSB 1BREA 1XH3A 5FB8B 1RUQH 2GHWB 2IAAC 4OI7A 4IW4C 2COQA 1CXFA 4PTUB 1I1AD 4LIQL 4Z77A 5J7CC 4P9ML 3RVTC 2X5PA 4WW1A 4GH7B 5TDNA 5ISZE 1X9RA 1GYCA 3KHQA 4R7DB 3ZYIA 3CFJA 5I1EL 5BZWB 4RFOH 4QNPF 3RP1A 1SFDA 1T2QL 2OV0A 2OJ1A 2WAHA 3B2UD 4GKNB 4DN3L 3GTVA 3L95B 4EAEA 3MV7B 4N0YH 3DI2B 3RWEB 1BGXL 3BN9C 2ZD0A 5I1KL 3ARDA 3F58H 2XFGB 1PQZA 4JW3A 1VJSA 1R3LB 4ZAKA 1V05A 1XGPB 4G80B 2NW3A 3VXRD 3GBEA 4LLYA 1HHKB 3QGVA 1EJ8A 1FFPA 1CFNB 1LO3L 3I75B 1AGEB 1FZJA 4Z5RA 4PREA 2HKHL 3NK4A 1NINA 3MA9H 4G1MB 1ZV9A 2XKSA 1LWHA 5I8CB 3CSBA 4OTXL 5DD0H 2VXVH 2HH0H 4YBHA 3AGVA 3IE4A 5LO7A 3SDCC 4OQ1A 3LKPA 4NT6B 4HUVA 1DUYB 1H19A 1NLBH 5CU5A 3GUTB 1V7MH 1XAUA 1TVBB 1UH4A 5KBMA 4ELMF 2XWJB 3MCLL 1DP0A 1JPST 2ZOTA 4TKWA 3GMOA 2X4OA 1EZVX 5FLVA 2KT6A 1BXAA 4PBWD 4GG6B 1R19A 3BAJA 4OCSH 5DQ9A 4QRSB 3FB8B 4R4FL 3HNTL 3S36H 5I19H 3QXVA 1Y0LA 4MB1A 5E4OA 1IAIM 2XN9A 3OKKB 4PJ9A 4ZT1A 1SPDA 4HK0A 5SWQA 4UQ9A 4YXLH 3HHRB 4NQEE 2XWXA 5PAZA 4KK9C 3DSFH 1IVTA 3L4YA 3TJPA 1K8IB 3L6FA 4S1RH 3MLRL 1XR8A 5AW6B 2KH2B 4RA0C 1MCSA 3RBSA 2VDMB 3OWRA 4EDXA 4AMKH 4YDJA 1M57B 1OTSD 2F5BL 2X1PA 3BEVB 1HEJC 5H4YA 3GB7A 4B50A 2FJUB 3ARQA 3D18B 3DIFB 3RWDB 5I6NA 3IAPA 4ZMXA 5L2KA 2VXTH 4QYAA 3T4YB 1FLRL 4HWBH 1AXIB 3SHSA 1W0YT 1XEDA 1YEKH 4HZAA 4KQ3H 3NEEA 2FD6H 3V4UH 4BZ2H 4PP2A 2YPLB 3BP4A 3CQQA 1XH1A 4TVUA 5KYUB 4LVNC 2YZ8A 3WLBB 1AKJD 2BSCA 1QFUL 4XPTL 3L5JA 5CN3A 1YEIL 4FS0A 1S7VB 1THAA 1U8MB 2ODHA 5CNHA 1QPXA 4HV8B 5HJDA 3AMKA 5EHFA 4LPWA 1OB1A 3DTXB 1I9IH 2Q8BL 2YXWA 2GBTA 4U1LA 3CSTA 35C8H 1F1DA 1CK0L 4URKA 3BMWA 5D70L 2IPTH 1XHHA 2UX6A 3IE9A 1FZKA 3LRSB 1HQ4B 3L3OA 1BEYL 4LKCA 4EBQH 5FW7A 1J9RA 4I88A 2H2SD 3D05A 4U7KA 4NFBA 3CVBA 4HETA 4Z7VB 1HJCA 1K5WA 3IMSA 5IEHA 4EKXA 1J11A 4XP6L 2QSTA 1ZT1B 2OYLA 5FFLA 4HUWB 4YX2H 3GXPA 4ZMLA 3I3DA 2PW2A 4N90D 4UNVA 4HJJH 4JQIH 4JO3L 3VXSB 4OB5H 1KPVA 3WU1A 1JFQL 1MCIA 1YNKL 3KL0A 5D2NB 3BYTA 5KN5A 2WVSA 3UC0H 4TVPL 3ZUCA 3BX7C 1X5JA 3TYGL 4E36A 4G6JH 4YXHL 1RZKH 2IQ9L 3GZPA 5CUSL 1XR9A 1MI5E 2OTWA 4O2CB 5DMJB 5TF1L 4R26L 3VFVA 5CEZH 1E42A 4MCNA 4YHIA 2QQNL 2ZKMX 5C0IB 5JOPE 1YUHA 2QPFA 3DWTA 3L17A 3BRGC 4L4VB 4AQEA 4CNIA 4QJ4B 1F2QA 4YDLC 2XZZA 2I07A 3GFUA 4CC4C 3FSOA 3NP3A 4B97A 2AI0H 4PJCB 3GLEA 3VFWB 3JSSA 5L0QC 3PP3K 4QXGH 3MROA 4L8SC 3QUXB 3BZFB 4Q14A 4F7EA 3SE8H 2ZOWA 3AITA 3MGAA 3ESVF 3T0ED 5JQIB 4QGYA 3SGDH 15C8L 4ZUVA 4XNZB 2C4XA 1I4FB 4HLJA 4P5TC 4U1MB 3ATEA 1MDAA 4MA3B 4BCYA 4RBPK 2FO1A 3H3PL 3OBAA 4GG8B 1QX1A 5EC2A 1MXGA 4R90L 4TVPE 3T6WA 1NUDA 5J8OA 4HF5L 2DIAA 1BAFL 1MFBH 1IX2A 2Z1KA 3T65A 2NY0D 1GYUA 2Z31A 4CGUB 4N6RA 3EYFA 3G08B 1Z9MA 4MA7H 1YC7A 3H7BB 4UDUA 1N8OE 1NUNB 5DDHA 5I15H 3N42F 1TTFA 2OMUB 2IOMA 3MRPA 2GBUA 1N19A 1DSFL 4P5MB 3OAZK 5H35B 3FMGH 1OSYA 3FAXA 3HI5L 3N43B 1B2WL 2GTWA 3DROB 1L0XA 2VDQL 3I9AA 1NEPA 2C34A 2ZXBA 2KBGA 4BDVA 1KIQB 1U8NA 2FJSA 2R4RH 1HYSC 3P9WB 1NCIA 2PKDA 5FKAA 4UM8B 4DQOH 2NXYB 1XGQB 3WMSA 5HHQB 1AS7A 3OSKA 4DK6A 3RUGE 5DSCA 3Q2CA 3IU4L 3QJXA 4OJAA 3UIYA 2FNWA 1HI6A 2WNWA 1M6OA 3J07A 4G7RB 2HP4A 4Q0XL 3SKNA 2HX9A 5LCVH 2ITFA 3MO1A 3O0LA 1JZEA 5BZDB 3ARYA 1ZKAA 3AAZA 1ES0A 3ARVA 3VXUE 1NCCL 5CFAA 5C0CA 4Q9RL 4UQBA 5CJQL 4P9HL 5JW5B 3QFDA 2BS9A 1WZKA 3SYCA 1T89C 2BWDA 1I7RA 2CKBA 2VRKA 4HS3A 2P3YA 4FXTA 4LARL 3APDA 1MFEH 1O7DC 5C3TA 3TESA 4LGRB 2ZXWB 3RG1C 1U3HB 4OGXH 2ZOKB 3ZGHA 2MJWA 5MEPA 1W8OA 3HS0B 2BHYA 3U9UA 1ZPUA 3TPKA 4WUUE 1VPOH 4XC3H 5T5FH 2VZSA 4X4KA 5BRPA 3OMZA 4M8RA 1AOZA 1XB6A 2CLZB 1J8HE 2XG4A 3P4OB 2EICA 3QQ3A 1QSEB 4GMSH 3FN0L 2AV7A 4FXKC 5F0LB 5DR5H 1NCWL 3CBRA 3JVGC 2XVGA 2DYPA 2QVTA 4J4PD 4S2SB 1QLEH 2F18A 4IYKA 4L5FH 4P2RA 4NPKA 3ZMRA 4BQ9A 1NFKA 2YJLA 2FAUA 2XQYK 3KS0H 3X11A 5HVFB 2I26N 3OB8A 4HIXL 2F53A 3B9KC 3G5VA 2W81C 4LMQE 1NMAH 4E41E 3LKRA 2VC2B 4GKZA 2F68X 3HG3A 2KDYA 2JB5L 4BH8B 2AJYH 4FQLH 3LTVA 2YPLD 2VITA 4XZUA 4NHUA 1FZMB 2GB2A 1DQQA 4GQQA 5IJDC 3NJIA 2NTFA 2G75A 1F4YL 5D2LF 1BVKB 2I5YH 3ERXA 5AKTA 2H0JA 5I1AB 1OT2A 4KHTH 3LS5H 3U48A 5E8EA 4PV1C 1NBVH 4XO4A 4NN7C 2DLTA 3LV3B 1HFUA 3B8SA 5DD1L 5HYFA 1WD8A 5CD5C 3I6KA 4ODUB 4H7VA 3ZK0A 5K39B 2GJPA 2N7BA 1GMIA 3MACL 1IL1A 4DFIA 3WNJA 1IBBA 3LN4B 4KVPA 4XN1A 2PPCA 5EBLB 5I6OA 2DQCH 4Z95H 5DMIL 5C0JA 1OD9A 2OXGB 1G7QB 2BIMA 5J13C 2HJFA 3HTLX 3RDTC 3VXSD 1PLGH 1MWAH 1UD3A 3V9EA 2FQDA 4RDQF 2L7JA 1PG7X 5I9QB 3MBEB 4HT1L 4I7ZC 3GRBA 5DEGA 2O5ZL 1ADWA 4YHOH 2B1HL 4JN1L 1MHHB 4RH4A 1EMTL 1FIEA 1PS3A 2APVA 3MNWA 4NQVA 3QJUB 2MPVA 2FR4B 1OT1A 4KDWA 3ZIMA 4GSDH 4HK3N 2VW6A 5TGBB 2AQPA 5EU3A 4N86A 4QIRA 1FDLH 5DJYB 1X5XA 3MJ6A 4JEGB 2BY0A 3O3DA 2X4QB 1DJGA 5F6HI 3VG9C 5J6GB 1S6NA 3TNMA 3UCQA 2OTUB 4HS6B 4MXQD 6FABH 2P24B 1JF6A 2CKBL 4ICWA 3TCLA 1QBML 3WXVL 4L4VD 3V0HA 3KLAB 4V1DA 1T0NB 1MNUH 2G0KA 2DICA 1L6PA 1M7XA 1OAJA 3ES6A 1S9KC 2EEAA 1AQKH 1FQ9C 3VUAA 1FO0B 2CK0H 4HIJA 4K5OA 4S1DC 1YMMB 4XHJD 4G8EB 3QUXD 3EZ8A 3LPFA 1KC5H 2H0PA 5E8PB 4G9DA 1G1OA 2CM5A 2GITB 3FOMB 1MCOL 4GT7A 4KKPA 5LG1A 3BPCB 3OJDB 1ASQA 1IC0A 2B59A 4PG9A 2WUCL 1HXKA 1UENA 2ZT9C 1ZRUA 4KKLD 1G1KA 6PAZA 2CGZA 3W3BA 4EI5C 1A4JA 1XF4A 2VZ3A 1JWUA 3NAAL 4JZOA 3TF4A 1UCBL 2ZOOA 3KGSA 2HT3C 1KGCE 2W92A 1DBML 4TQIA 1BQHA 2CO7B 4PG2C 1LO5A 4UU9B 2X10A 3C2AH 1ZPLA 5IR1B 4JM2B 4I5BA 3ILDA 4M5ZH 2YAFA 3QDMB 2FTAA 3ESMA 4LCYB 3UYRL 1CU4H 1F6LL 1RURL 1CB4A 2GI7A 3FW6A 2B39A 4ZFZA 1DE4B 1JPSH 4EKJA 3WN5C 1UWXK 3X14B 4QRTA 4MA1B 4RBPH 4Y16A 3FUJA 3ET9F 2ZF8A 1U92B 3PIQB 2VC2H 1EJOH 2WTOA 2NXYD 4NNYB 5C0RL 2FVNA 1ZV5A 2GAZA 1IARB 3SDDC 3WTTA 1YEDA 5AZ2H 2XWRA 2IJ0C 3L3KB 2ZCZA 2ED9A 3QARA 8PAZA 5D1QB 1MDTA 2DZEA 1FHNA 3SKUD 3ZDYE 1USQA 5CP3H 3ZW3A 3FSZA 3FT2B 1WHPA 4K94C 5FOBB 2IMMA 3RAJL 4I0PB 3OAZH 1N12A 5I17B 2G3ZA 2Y25A 2VLRE 4Y9GA 1BG1A 5DS1A 4Y4KC 3IDIA 3ZTJH 2UV3A 2AEOA 2DEYX 1MCDA 3FO2A 1U8CB 3KD4A 4LPTA 3K6NA 1W6LA 4KUZL 5B1BB 4CU7A 3GO1H 1U3HD 5KSUB 4AQ1C 2PW1B 1MIMH 4UILL 1WTGT 1C9SA 1I8IB 1NKRA 4BIKA 1JSYA 4K07A 2OR8A 1YAIA 4XE0A 4NZUH 4TM9A 3VD9A 4EZJA 4XMUA 1UG9A 4WWKA 3ZZQA 1G1YA 1IKNC 1M2VA 5FA4A 2PXYA 4AGQA 1MG2C 4B96A 1T2XA 4E9LA 2ARJQ 1KG0A 5HI5D 1MH5A 4OUUA 4OLZL 1HOCB 3QWNA 2VRQA 1U3NA 3QAZC 4U4BA 3IF1B 4RMRA 2GW5A 3BJ91 1QA9B 1ZXKA 3TN0A 4W9CC 4DO4A 1UA3A 3KYAA 1BEXA 3EAKA 5AVZB 3RL2A 5F7DB 1R75A 3CNKA 4ALAH 4CKQA 5DC9B 4ZPTB 1BLNA 2P5EE 3KLSA 1IAKA 4YK4B 4J3WA 4D9RD 4J5VA 5E1GA 2Z4TA 1MCRA 5D7KE 5IROD 4F8TA 5DGQA 1ZS8B 5HHXL 5F3HB 3ZIYA 1A3LL 1TJIL 2WUBH 1F2XK 3BSGA 3ZQ9A 1R34A 2WQVA 4YIQB 1C12B 2AXGB 3APCA 2P8LA 3QJHB 1S3KH 3Q1SH 4KKBC 2DYRB 5E8DL 1ZWIB 2CO1A 3QNFA 4IHOA 3QWRA 3W9EB 3U36A 4NAQA 5HHPA 1QBLL 4OIIH 1FGVL 4JRYE 3UDWA 3MRBB 2ZUUA 5C09E 2LU3A 1JZJA 2DWTA 4PJAA 5FM5O 5IREA 3S2CA 1GPOL 3OKDA 4JANA 1LE5A 3CWGA 1MJ8H 2FJHA 2H4EA 3MLWH 4OBRA 2BSSA 1H6TA 3VMNA 1N64L 3TLRA 2AJ3A 5F44A 4HLEA 4ERSH 4M7JL 5JXAL 4G71B 3VGHA 1CYGA 3U0WH 5D7JB 1Y6MR 2V7HA 1L7IL 6TAAA 3FCBA 5KUMA 4WO4C 1TCRB 3KYMA 3QUMB 1B6UA 5AZEL 4YMPA 3P77A 3MRLA 4G9FB 4N20A 5DHYA 5C0DA 2PWHA 1P4BL 2G3XA 1QZNA 3KWVA 2LQRA 4JE4B 4OIAA 3MBED 2Y4SA 5HGHA 3FQ4A 3V5HA 3DX1A 3O4LE 3HCVA 3ZMNA 1FSKB 1Z9SA 3KPPA 3LH2L 5D1ZB 3ZMEA 3K6DA 2BVQB 2G9KA 3SYPA 5GJSH 5GGVL 4RMUA 4FN0A 3D39B 1BQRA 5JIKA 2ZOLA 2H45A 3L45A 4LLMB 5T3XE 1W2KT 1CZ8L 2JXMA 2ZXAA 5KSBF 1NM9A 1GZQA 4HUNB 4P8QA 4Y9CA 4DVBB 4M8QB 3MNZB 4BYHA 2BIHA 4KHXH 4FNQA 3QNZA 3I6GB 2DWYA 4F5CE 2X0WA 2DQHL 4PEEA 1A7PH 4EOWL 2PTTB 2R8SH 4F20A 5D72L 1T0MA 1PTZA 2HFTA 3F05A 2GT9A 3P4MA 1YMMD 2JB6A 1IC4L 5C97A 1AXSA 4C56E 2NYKA 3RKDD 3RFZB 1OAQH 1YEGL 3RNKB 3FTGA 1WFOA 5BVJA 1NCAL 5CBAA 3QORB 2QVMA 5DJZA 3EDJA 1FNHA 2R2BB 3KM2A 3SBWC 2NY1C 4I18A 1TZOA 1LJMA 1RMFL 5T3ZD 4A6YH 2X4SB 1N6VA 3CFKB 3TNNA 4E9QA 5EU6E 2MCG1 1XF5A 1U42A 3QG6A 1QR4A 3ARXA 3RKPA 2LTQB 3VFTA 3VI3E 5AD0A 1E4HA 4WDIB 3ULUC 1JBJA 1OCCB 1KGUA 2Y07L 4LLWB 4N0CC 3UTQB 1L9QA 3MGOB 3NBNA 1SVZA 5EZOL 4AW4A 4N5EC 2D3VA 1MFCH 4TUOA 3U2SB 1ANUA 2V17L 4JDZA 4JM2D 2F7PA 4GFTB 3QDMD 3UC2A 1FN4A 4CMMB 3B2DC 3EO1B 3IKCA 3T4AB 1W72A 4Y1TA 1TTGA 5MENE 5KW9L 3CPUA 3IN0A 1EBPA 3NQIA 5GRUH 1Q38A 3VRIB 4FQQB 4A7TA 4QXTB 4MDIA 5I0DA 2APTA 3MDJA 1SHMA 1MELA 5EUOB 4XPGL 1FL6B 4XOCA 5GZOD 2WXGA 1YEHL 4H8QA 1Q90A 1E27A 2Y6TE 1AZCA 2N1KA 4BGDA 5BOZG 2QHRL 5D1QD 1S9XA 3PDDA 3OG4B 1XGUB 3ZDYF 2G9HB 2ZAGA 2N01B 1CC3A 3RI5F 2IANE 2V8MA 1FIGH 3JWNH 4KVCL 2VNCA 2WXIA 3FCTA 1YPZB 2FCBA 4Y5YC 5SWSD 4I0PD 4NGHL 2QSVA 4IK7A 1J8RA 3VI4A 4JPVH 1T03H 3ARFB 2AK4E 2A5UA 4L2LA 3BUIA 4PJ9D 4YO0A 4FFVD 3UZVA 5HPMB 3K4AA 4EMZA 3ZHDA 4JY6B 3OLDA 1NUGA 3GSNL 2CHXA 4HEME 1LDSA 3P4LA 3TA3B 2OP4L 4B27A 2PR4L 2VIRA 1CD8A 1OTUC 5C08E 1WITA 4W1TA 3GZOA 2GHZA 1E5UI 4L1HA 4HKBA 4JRXE 4U6YB 1S7QA 3B34A 3S34H 4M4PA 4H40A 4Y88A 1LO4H 4JFDA 12E8H 1N70A 1EHLH 3PWJA 1FAKT 4TV3A 2NUTA 1DVFC 4KRNA 1NCDH 1J1OL 1F45A 2NZ9D 3C08H 4JFFB 1NAMH 4LBEB 4YNYB 5J12C 1PZ3A 3FCSA 1HK6A 2A6DA 2VDOL 2ARJA 3HFFA 1AZUA 1OAYH 3HZKA 4UTAH 3PJSB 1Q72L 2ORBL 1UQSA 2V3FA 3OAUH 5FGRA 3EJUA 4Y4HA 2ESVB 5FO8B 1SF5A 2C9QA 1NFIB 3VRJB 4XMKL 4F91B 5DHEA 5M95B 3GMPA 2R1XA 3FQWB 3WAJA 1YHPA 4FNSA 3VFGH 2XT1B 3OKEB 1BJ8A 2YD0A 5LBSL 3ARSA 3UG4A 2J1ZA 3MRKA 3HAEH 1KBVA 3NRFA 2BIPA 1H3XA 2VLLA 3ZRFC 4BKSC 2XWCA 3FTYA 25C8H 1YC8A 5F9DC 5D8JH 1KLUA 2VABA 5F1IB 5CZVH 3LKOA 1EO5A 1NL0H 4IU2A 2Q7NA 5B1JC 1XBRA 4DW2H 1RPKA 3BH8A 3Q48A 1OE2A 4Y0GA 4G8FB 2AXFB 3VFRA 5B39G 2JKTM 2VDPB 5ABZA 4PRAA 2OMXA 4OFYA 2WIMA 5ICUA 3UYPB 1HDMB 4X8CA 4L48A 4UIKH 1MREL 2FIRT 3BKCL 4PJHA 3V0VB 4PJIF 5D7JD 3ARWA 2WVTA 3FB6B 3JWDC 4R7LA 4Z0XA 2C1PA 1WS8A 1T7YA 1KOAA 3B1TA 4MVBC 4JFPA 1HZHH 2OL3L 1X44A 1T80A 4G8GB 4LHUB 3M1CA 5TPWH 5CGYD 1ZK5A 3U46A 2ZIDA 5DTFA 3LS4H 4N2LA 3RWGA 1WP6A 4LL4A 1RJCA 5F7EH 5D1ZD 4NHCL 3OF6D 1L9TA 1P4LB 4HWBA 5AW4B 4BK5C 4FI8A 4I9WD 4BZ2A 3BESR 3S8GB 1YUKB 3WS6C 1DQVA 4G8IA 3S8FB 2QKSA 3CFDB 1I9RL 4F8OA 2XUWA 4C54A 2QHLA 5I6KA 1PZAA 4FTVA 4HKZA 4TUJB 4B9ZA 4RGNB 4KI1A 2J4WH 4I89A 2AK1H 4W81A 4XNUH 1ESOA 1F4WL 1NWPA 2J71A 2IOIA 1JPTL 1RUQL 4YJZL 4QJ5B 4GW1B 2CCVA 4PJGB 3GINA 5EOCJ 2N4IA 5MERB 3CZLA 5I1DB 3D12B 3NJNA 1KTKE 3VXRE 1PX8A 2Z8VC 5DK0A 1IC1A 5AYUL 5GHWH 4XP5H 1JZFA 3LKNB 5SX4I 4A7VA 2Y22A 5CKAA 4M62H 3QORD 4J27A 4XGZB 5I18L 1X5AA 4N0YL 1OTTD 4ETQA 4KK8D 4UT6H 5ESVB 4G7VH 2HPOA 3QEHA 2FBRA 2WMPA 3F58L 2GTQA 3GNML 3PV7A 2JKWA 1IBHA 4PJDA 5EO0A 2C9SA 4OF8A 3QJFA 1QVOA 1A6TB 1LEKA 8FABB 4XXWC 1CD1B 3PWVB 4HIQA 5JXED 1W8EA 4X7TB 5FC9A 3RB5A 3MXWH 5J1AB 1MCLA 3NCXA 4CRPA 3MA9L 4D0BB 3BIBX 1J18A 3WGUB 2DQUL 3RY4A 3INOA 1JV5A 1T21B 5DD0L 5DEJA 2HH0L 3SY0B 4IKKA 5DQDL 5TE6H 1Y18A 4JPIB 4D8PB 4RQQB 5D5MB 1SLUA 2V7NA 2F5AH 3HBPA 4DEWA 2MHAB 4NZDA 3GSQA 4QO1A 2G30A 4JPQA 2EUVA 1AG0A 5C0CD 3NIGF 1WWBX 2RCSL 1ZOXA 2DEWX 2WZPA 1NDMB 1HKFA 3GM0A 2EXWC 4N2KA 5DD6B 4OZGB 3K4ZA 1S8DB 3S36L 2ITCB 3O6MH 5IFHH 4NIKB 5AUMA 3NCWA 5EA0L 3UCRA 5IHBA 4KGJA 3L1OL 5FV1L 4BZ1A 4YXLL 5LGKA 4KKAD 1T0PB 1DJXA 4MJIB 1FG2A 5C71A 3DX6B 4ZO7A 5IF0A 3DSFL 5L0QB 4JG1H 2NDGA 2M8XA 3QXWA 5TDOB 4S1RL 4EN3B 3D2UB 4L8SB 5CF3A 4DOHE 3ZDXB 3LKQB 5EFIA 1T3FA 3MKKA 5F93C 3ARFD 3NJKA 1OCRB 5HHOA 1O6SB 4UMSA 3GKWH 4NQQA 5KVDH 3FOLB 4QHMB 4GNKB 4P5TB 2E8ZA 4QPEA 5AAMA 3ZT7A 5JHAA 4Z8FL 3WFHB 4HWBL 3TA3D 1YEKL 2Y7NA 4KQ3L 2FD6L 3V4UL 1NEZB 1OGAA 2VAJA 4EZLA 2CDFB 3LPGA 3HUJF 3B9EA 4XMWA 1I1FB 3EH4B 1UJ3A 3FT1A 4QGTA 2H1XA 3CZKA 5AW8B 2HFFB 4N90E 4Y4FA 2QVIA 4ANVA 4JFFD 1N59B 4H25B 4MHHG 4WW2F 3RWIA 3VH8A 1D5BB 4PU2A 2IPTL 4WHTB 3SE4C 3G04A 4M1GL 2XXCB 5I1LB 5DUJA 5DZOA 1HXMB 2P7TA 5ENWA 3S5LB 2IFFH 5E4IA 1MFNA 2ESVD 3HBZA 4PJBA 4YX2L 3TTYA 2DJMA 5JA9A 5LCVA 4G7QB 2EVGA 1DQJB 1CE6A 2MTAA 1AZVA 2W9DL 2A9BA 3SGKC 4HJJL 2WK2A 3AREC 4JQIL 3LPWA 3WFBH 1A1NB 4XBEH 5EBWA 1CL7I 4OB5L 4UIMA 4UZSA 5SV3A 3D07A 1WCBB 1OAZH 1AAJA 3K81A 4K3JH 3SCMC 4PWEA 3CFUA 3MBWB 4MAYC 2F08A 3F00A 4Z7OE 2I9TB 3UC0L 1QSFB 2JJTA 2V3DA 3LN9A 5I75C 5HDRA 3RX9A 2F7OA 3VCLB 5IQ7H 5FAAA 5T5FA 2MOVA 4AL8H 1PF3A 1Q1JL 5JYMA 5CEZL 3DTDA 1E9QB 1DHKA 3R0NA 1QEWB 3O6LH 1GS6X 2WY3B 4D0DB 1UT2A 1UZ6E 3FQTB 4G6AC 4IMLA 3DETC 3QBTB 4DEUA 2WJ5A 1HCFX 1N7ML 4LOUC 2AI0L 2P5PA 4W6WB 5HBBA 1IAIH 2Y7QA 4J3OF 3AT0A 1ZGLB 1DCEA 4QXGL 3WS3A 2NPLX 3H0TA 4G70B 5F8QC 5D4JA 3SE8L 3UERA 4G8GD 4TSCH 3VFUB 5CEYB 1C7SA 3DX8B 3E2HC 4PWKA 2J88H 4V1DD 3C9NB 3VD3A 2FZ3B 4ENEC 5EDSA 5IFAH 1XQ4A 3HA0A 3FQXA 2Y7OA 1U9KA 1HH6A 2B8OT 3IFPA 4UUJB 3RIAF 4JHWL 5IJCC 1IO4C 4KK9D 4U1NB 4ATTA 4DKEH 2W60B 3RY6C 4XOEA 3SDXE 6CGTA 4A2HA 1ZTXL 4RGND 4JJHA 2XBTA 5IBUG 1G6RA 3D8MA 4MA7L 2X88A 4JMNA 5I15L 2C1OB 4XNMA 4HFWA 1RUAH 5TJWK 1KGXA 2AMUA 4HJUA 2BVOA 2QDVA 5B4MC 4DP7X 4I3GA 3FMGL 4Y2DA 3F65A 2DV6A 2ALAA 3KH3A 1QRNA 4NQCB 3MRCB 2B2XH 4DP8X 2VDML 3TFBA 4LLDB 5FM4A 4AVIA 3RGHA 2A1WH 3PLYA 4N2IA 5CCJA 3DX9A 3GGWA 3H2PA 1MWAA 2UXFA 4ODTH 1OO2A 2HZHA 2OX5A 4X0KA 3SKOB 4DQOL 3WYRA 5K59F 5DJDB 4XE5B 3RTQA 4UV4H 2WTPA 4H5SA 2ZSVA 4LSPL 3FRUB 5EN2A 4MMZC 4OD2B 3DJ9A 3MCKA 1ZTXE 4HJ1A 3B2VH 2R56H 5J13B 2MCAA 3RDTB 3IDMB 5JPMC 4QYOA 1XGTA 4JNXA 1KIQA 1FFOA 4GG6E 1DUZB 3D6GA 4Z7UB 1OSZB 5KG9A 5JIQA 2G0LA 5DUMH 5GGSA 1R5WB 2A6KB 4A2FA 2FEDD 4OI8A 3BVNA 4I2XA 4PRHA 5AKRA 3TJEH 4B6ZA 2VL5B 5C8JB 1DEDA 4QRFA 4HEPA 3SKJL 1CIUA 5CMAB 4XC3L 4BQ8A 1ORQA 4X6DF 1TUPA 3VG9B 1GCFA 4ZDHA 3M45A 2D7TL 1CICC 4KO6A 4PWGA 3QHTC 2J8UF 3PGFL 4GKOA 4CW1B 1S5IH 3SY6A 4MGXA 3RIFF 1P5UB 3WJLC 1E7VA 3EYSH 1UZGA 2YPLE 4D3CH 4DP9X 2X70B 4L5FL 1HKLH 2DLFL 2FHFA 2VZOA 4EN3D 3D2UD 5BRZB 3MYJB 1R46A 1NPJA 1FJ1B 4QCIA 4PJ5B 1KTLB 4DIXA 3VFOA 1FGNH 4TPRH 4W9GC 2G3NA 3FPYA 3RZCA 1NC2A 5HGBB 3S4SG 4P5TD 1PZSA 3L3HB 2ROYA 1YEJH 3PV6A 4M3HA 1YY8B 1M71A 4GI8A 4EI5B 4ZX4A 3BWZA 3WHXB 3TN0D 2QPSA 2BXZA 3AQYA 4K3GA 1LE9B 3WXWH 3W0WB 3GSOB 2K1MA 5E2WH 4TQEL 4EUPG 2I5YL 2DWDA 1ZT7B 1JRHI 2JI1A 4LSVL 2JCWA 3QFJB 3BGMB 3LS5L 4KHTL 5HHNB 5INDB 1Z9PA 2Q5BA 1NOFA 1NBVL 3VQ2C 3VXSE 2BVEA 1TENA 1AQMA 3IEAA 5IB4A 5LAPA 1WUZA 1A1OA 2XNAB 3QWRD 4N2CA 3RPIB 2YN3A 2SEBB 3STZA 4RISH 5KVEE 3GIVA 1SDYA 5CP3A 3WN5B 5BXFB 2DQCL 4X5LA 4HQQL 4Z95L 2ICES 2Y7SA 4D94A 3EIFA 3LD8B 2ATKB 4ODVL 4B9PA 2MFNA 1J8KA 2V5SA 2VXQL 3FSWA 4QXUH 1MWAL 1RJZB 2HN7A 5KVMC 3II3A 3SDDB 1EZSA 3PDOB 2UWEB 4NAJA 4NUQA 4JG9A 1AR1C 1T6VN 2ZCKH 3ZL4L 5J6HB 1SM3L 4L4VE 5AW3B 1JYWA 1QSFD 4ATWA 3BKYH 1Z1WA 5JDJA 1QP1A 3C6SA 3GBNH 4JZNB 4PJCE 1O0VA 2VZTA 5B3JE 3NCJH 4X5WB 3TBBA 2H3KA 4ZOCA 5E1AA 4FQHA 1C16A 3KLQA 2VYRE 2VSMB 3PQYB 5FO7B 1JN6A 1Z9LA 5IP4A 1JGEB 4Y4KB 3QDGB 1KFAH 6FABL 2F8XC 2DQDH 2VXSH 3D85A 3US9A 3QYNA 1MNUL 4X7FC 1EIBA 4AQ1B 4DGWC 4N87A 4JR9H 4L8CA 5EOTB 4CAGA 4MMXA 2A83B 3SZKC 2KUTA 4PGZA 3P40A 2Q9OA 4QOKB 1YYLL 2XX1A 4JL1A 4HK3J 3QJTB 3H9ZA 3OPUA 1IBZA 1MCKA 1WWAX 5E5LA 3TCXA 2VXUL 3CZUB 2JLPA 4LSQH 2BMKB 1QFWM 1GYWA 2EQDA 1UH3A 2WB7A 3O2VH 5EN3A 3KS0J 4XPFH 3UEZA 1U8PA 2ZP9A 5JIHA 3UPAA 3KPMB 3QAZB 5E2JA 2BOCB 4N3TA 1T66C 2YQBA 3SDXF 5KS9A 4OZFB 4M7LT 4HCRH 1K85A 3ESNA 2OSLB 4IKLA 4ZO6A 3S7GA 1UVQB 1CF1A 3N85H 2DD8H 3C2AL 1WD9A 1A64A 1G94A 1U8LB 2YC1A 1PGRB 4N2FA 3ZL1A 3FTZA 4M5ZL 3WGVB 1SDDA 2AC0A 3BXNA 4ISVB 2FX7L 4TNVK 2KLTA 4MNHA 4WWOA 5IOKA 4Q6IC 5EU5B 2NW2A 4NQCD 5ETUB 1JPSL 5K69A 2VW4A 4ZUSB 4AG4H 3EJZC 3KW7A 4PJXA 3BUQA 4I1NB 1KJ2B 2V9RA 1G7IA 2X9YA 4F58H 2KC0A 2IGFH 2VC2L 3KVQA 3RL1A 1CDIA 5FYLH 5CD5D 5LGJA 1ACCA 3ZZLA 5H94A 3LIZH 3OWEA 1N2RB 3ETTA 5GGUB 3TOPA 4P99A 2EC9U 1GJUA 2VSKB 3WJJC 4B7LA 5CAYB 3NPSB 5IHLB 3TBVB 1RJYA 2GC4C 3KG5A 5K9KB 1RZFH 3WY2A 3GXUB 4E42B 3SE9H 1S7RA 3V5KA 4CVWA 5D6DC 4NJAL 1V7NH 1FC2D 4LEBA 3RDTD 4FFTA 4X4XB 4X7SH 1OGSA 1D5RA 2VR7A 3G6DH 3PHQA 3TIEA 1GAFH 1CJYA 4R96A 4UM9A 5CR8A 5JUEH 3C6LC 1AD0A 3ZHLA 2OMTB 1N5AA 4HAKA 1F00I 1L7TH 2FIKB 3ROOA 3D4ZA 2R29H 1H8LA 2VLJA 3P3SA 3U7WL 4JHBA 3GO1L 4PRBB 4TNFA 4LHQB 4QRPA 2XHNA 3H56A 3QZWA 2BP0B 4O00A 3CZFB 1E3ZA 4JB9L 3KWXA 1Q9OB 3IBOA 3I2CL 3NJLA 3LZLA 4L4TB 5C07A 4HOZA 3QUZC 3LRLA 2WBJC 2XKNA 4H88H 2C5DC 4D9RE 3KNBA 2JWYA 4LRNL 1WF5A 1JNLH 5DLMH 4A38A 1X4ZA 2ZKHH 2EVIA 4A6YA 4NO0A 5GGQH 5D1XA 3HE7C 5IVXB 4RFEA 5F97E 4M5YH 2HWZH 4RWHA 4S1DD 4JG5A 3IDGB 3SDAA 1RZQA 4PJ5D 3EO9H 3EKCA 4OCRH 1G7MB 1KB5B 5B21A 4AC4A 3PXLA 4WNQB 5FGCE 4X80H 1ZSDB 3VW3H 4JHZA 4DF9A 1ET5A 1OW0C 1INDH 2LR4A 1QTPA 3O8XA 4FZEH 3X12A 4M6MH 4OGYH 4MB3A 2VWEC 4U7MA 4F80A 2ZTBA 2GSMB 3GS0A 1ICTA 3BW9B 3SODB 3W0WD 2AEIT 5JO5B 3Q1SL 4O5LH 5D7IF 3BUYB 2YRLA 4IRJC 2EDXA 4DEPC 3FUFA 3LQAL 3QFJD 4XPAH 5ICZA 5DI8B 1B6DA 1K4CA 4MD5A 3T2NH 2GJ6B 4HDIB 3CDZA 2UY7B 2O6DA 3H9SB 5MHSD 1U93B 1AE6H 5B1KA 5B38A 4H8WC 5T3ZL 1MJ8L 1X9QA 4OIBA 1KGWA 1VESA 4YAQA 2YJQA 4K23H 3UAFA 1CLOH 5E1QA 4FHJA 1EAOA 4OZFH 1CT8A 4W4NA 2B4CC 4Z7WB 2R7EB 4APQA 3VD4A 4R7VA 1FF5A 3L7EA 4XBGB 1B9ZA 5AVTB 3L5XL 1A6AA 3WIFA 1FAIL 3SDDD 2GI0A 4WV1A 4NQSB 3S37L 4POYA 5IOPA 5JPNA 2E7LA 2B14A 3ABLB 2ZWSA 4ZMZA 2YEQA 2BY3A 4AEIH 4NZTL 1AXTL 3ILEA 5I24A 4EI6A 2BZDA 2E6PA 2J21A 2XJLA 1YMME 2W95A 3TZVA 4B9IA 4Y5YB 1ZJBA 1NBZA 1AHWC 2PWFA 4UOW0 5IB1A 3PQYD 2AVGA 3Q6FA 5FFGA 1KLFB 4Q7DA 3QDGD 2CRIA 1WFIA 3GTTA 4NKDA 3K2UH 3Q2VA 4KHXL 1NAMA 2GJRA 5T3ZE 4AYDC 4U4IA 1A7PL 4XP4H 4G8AC 1TQUA 2PYFB 2R8SL 3VJ6B 4HUCA 5E6SB 4ZOEA 4UTAA 1LO2L 4FHBD 4FTVD 1MNNA 3QEQB 4WU7B 4X4YB 5EEVA 2HCZX 1WAAE 2F1AA 4QOKD 1U8OB 3TEYA 1SLVA 1TTRA 1VADA 4EQ3A 5J12B 3QDME 4UQEA 1B0IA 4XCEB 3AZUA 3K5SA 3HAEA 3UAJA 3QNXB 4S1SH 1OF2A 4AQAB 3WO4B 2D3NA 3U30C 4TUKH 3VXOB 2C26A 2YKKA 1E4KA 4M7KL 4GW5B 4PJFA 5ANMB 2Z65C 1MFCL 5IK3B 1KXTB 4F37F 3FT0A 3ALXA 1CFMA 2XFXB 4ZUWA 4HOMA 2OQJA 4JKWA 3L2LA 3EYQC 3O0RH 3OHXA 4B9JA 3PS6A 5C3IA 4KKBD 4CC1A 2X4TA 1JCVA 4NN6C 1WFUA 2BRRL 3CPLA 2WBXA 1ODAA 2AV1B 4IHBA 3BE1H 4L9LA 5DZNA 4M9OA 4Z7QF 5GRUL 3MLTB 1DL7H 1AQHA 1I8KA 2EE0A 3FS9A 3MGTB 1I85A 3H85A 4ANKA 4H26B 5SWSE 2F1EA 1OPGH 4IS6A 3NOIA 1SOQA 3HR5A 1GCYA 1XD0A 4O51B 1WTLA 4CMMA 4PY8I 4FXGC 2R2HB 3EO1A 1EH9A 4KGLA 1ZHLA 4P2YA 3NIDF 2YA1A 5GS0D 1YRKA 5DJCA 5F1OB 1RUML 4XPHH 5I1CH 5G5DB 4XAWH 3VYNA 2PABA 3HB3C 1TCMA 3DYOA 2XPGA 1BMZA 1M1XB 4HW6A 4RDBA 1DQMH 2I85A 1X6LA 2CUAA 5J4MA 3J7HA 3BT0A 2OJEA 3RPBA 2VOTA 1ADQA 4KVNL 5DHVH 3MAWA 4JKPH 4JQVA 5KSAC 1KXVC 4OZHA 5IB2A 3BDBA 3FNKA 4FG6D 3M6DA 3L4UA 2LVEA 3S34L 4BFJA 4L4TD 3MLXH 3QUML 1E28B 2DI7A 1FFNA 2KKQA 4ZFOA 3UJJH 5AWNH 2YARA 1VCAA 3LNEA 1BOYA 3SGEI 3WE1A 3NZ8B 3C08L 4BKTC 2F6AA 3F7PC 2JCCA 1NAML 4AYFB 2BFVH 1G0XA 4UT6A 5FDYA 2G5BA 3GM8A 5T33L 4WI6A 1UKSA 1OWRM 2AXHA 5JLZA 3MXVL 2DMKA 3STLB 3G5YA 1ONQA 1EERB 4LQFH 4F33B 4XP9H 4LLUB 1UM6H 3OAUL 4WKZA 1VGEL 2ID5A 3EGDB 5TF0A 4DUWA 5C0EB 3U0PA 1CGSL 3KJ4C 1AZBA 2W0PA 4LLAA 1U4EA 1II4E 1NGPL 3OKOA 1JHKL 1NANH 1H15B 1UASA 2JQZA 2NCMA 2ZX9A 4KK5C 2ISDA 4HUKB 2PP8A 5BS0B 3ULUD 1JK9B 4JGJA 1L9RA 4N2EA 4N0CD 4WZ9A 1M05B 1K5NB 25C8L 2NQCA 2PYEB 3WIHL 1YY9C 5D8JL 4NQDA 5CZVL 1AKPA 3GI8H 5HI3C 1PEZA 1F6AB 1SJEB 1VERA 4DW2L 2GJ6D 1CFQB 4U1SB 1J1XH 1MCQA 4O2EA 3KWUA 3L1GA 5I6MA 3H9SD 3ZSTA 4N2GA 4I3SH 1L6ZA 2WZ6A 5CR1A 5A2BA 3MJ7A 4KU1A 1FVDB 4F57H 2TSBA 4F2EA 1BQUA 2FUTA 2WXFA 3RWJA 5E4EC 4I9WE 3WUZA 4JFEA 3JBG7 3V52L 1JK8A 1TKWB 3JTSB 1DBJH 4RZKA 2JFCA 5CEXB 5DRNA 1HZHL 1A8ZA 4PR5A 5TPWL 4LDOB 4ZFFB 4GXUN 2AMGA 3HR6A 3LS4L 2Y6SC 4PW9A 1Z66A 4G6KH 1GC1C 2GIMA 4Y5VA 4OF5A 4YGAB 4JPKL 2NT1A 2QZQA 1XCQA 2I69A 5F7EL 1BOGB 5SWZB 3SDCA 4XB7A 5IY5B 2DLHA 2EDYA 3O3EB 3QISA 3HPLA 5I1JH 1KWGA 1MY7A 3UTPD 1B88A 3QNYA 3EJTA 4M7LH 4OD3H 5IMOA 4APXA 3T1FB 4ZMVA 3V79C 3F6LA 1B0GB 2D0HA 1OM3H 4OJYA 4P05A 1TFPA 5LDSA 2J4WL 4XNYL 2AK1L 3BVWA 4YHZL 2DWEB 2WTRB 4JFZL 4FQXA 4LEXH 1LP9F 3D25B 4ZXBC 1KJVB 3P9MB 2YAQA 1N10A 1H8NA 3QEQD 3NTCL 3JWDH 3GPEA 1RZGA 4NRYB 3HJ0A 4CU8A 3PWPB 3PGCB 1GJIA 4YSDA 1R6VA 2IADB 3VXTA 4ZFOL 1IV8A 2LFGA 1BJ1H 1EAPA 1OAUH 3A67H 3F7KA 3L9RA 4NI6A 1A7OH 1KV3A 4ZPVA 1H6FA 3FU6A 3SB3A 3L48A 2HT2C 2WWKO 2DBLL 4HWZB 2ITDA 3NN8A 2EDWA 3C09B 1CXEA 1WZ1H 1U58B 2H3NB 1NPUA 4YVUA 3PJNA 4W9KC 3P0YH 1BAWA 3I02A 2IAMC 1OCOB 4FG4A 5B3SB 4FG2A 4MS8C 3GMLB 5DUPH 3H6AA 2BNRA 3NH7L 1KN4H 4F3FA 5ICYA 2YPVH 3EOYG 4AH2B 5BV7C 2EKSB 5CILH 5C0CE 5E5RB 4G42A 1T83C 4KK6D 1MSPA 3MX0B 5HDOA 5EUOE 4HKXB 2D03L 2XWDA 3L4ZA 2JKIS 2M2DA 3EFFB 1LNUA 3VD7A 3O3BA 5CGMA 2Q3XA 2B1OA 4NUPA 4XR8C 3MTXA 3BH9B 4MAYB 4PFEA 1BWWA 3WL9A 1A7BA 4X6CB 5TE6L 3TBSB 3EUUA 1BVNP 2R2EB 1LK3H 1LEGB 4FA8A 4MD0B 2AEPH 5A3IC 5I75B 3BP7B 5GSRB 3U1PA 2EACA 1XCTB 3NSJA 3L3JA 5C0BA 3KYKH 4PJEB 4NP9A 1YPZE 3X3FL 2E9BA 2CKNA 1U8JB 1MHCB 1MIEL 2ZKYA 2FECI 1TXKA 3TM6A 1VZGA 3D33A 3O6ML 3D69B 1DBBL 3DURA 5IFHL 3V4VH 2VLMD 3IFOB 3FXIC 1U41A 4G5ZL 2AAAA 1OK0A 1NSNL 4E0RB 3O9WB 3EBGA 4JG1L 5C92A 3ZHNA 1RZ8B 3MRFB 4FMVA 4TVSa 4XWGH 1G7JA 3HN5A 3OLGA 1IKFL 2ADFH 2LLNA 1YEFL 3E2HB 4DZ8A 3QUYA 3QK0A 5I71C 3D0LB 2ADGA 4QWWC 3GJEA 1KMGA 1JD7A 2G2RA 5GRJH 2MOQA 4R9HA 4OZIA 1OD7A 4M00A 4JE0A 3KWTA 4HX1B 2BNUB 3LY6A 4QRRA 1CFSB 1MHPL 2CR6A 4PJ7B 5FHAL 1UZ8B 1Q0EA 3RVUC 4P3DA 5LHDA 2W65B 5F9OH 2ESVE 4XCFH 4B9FA 3G5XB 4X8JA 3WMQA 2BSTB 1QAWA 4HHAB 3RY5A 2MSPA 2F61A 3MJ9H 3MOQA 2A6IA 3CMOL 3M7FB 4JLRB 1L9OA 2G5UA 2J12B 1GY2A 3D30A 5DRZB 4AZUA 4N2NA 4YSSA 2FB4H 4P3WA 4DGVH 1G4MA 3GWJA 5D9SB 4MJ4A 4IRSB 2IFFL 2X6CA 4XNQA 2HFGL 1NIBA 2X4RA 4QTFA 4OCWH 4TSBL 3MYZA 1RHHB 4L29A 2BSRB 3WEMA 3WFBL 4CKVX 2X89D 43CAA 2QBWA 1N59A 4PB0H 4XBEL 3FRPB 1K2DA 3COOA 1EANA 1P6WA 1EO8L 2PTVA 3P0VH 4RGOL 5BS0D 5C0GB 3IPEA 1MUJB 5DD3H 5MP6H 1RUKL 1TETH 4AENB 5KAQF 2PYED 4N5UA 3CN2A 3LPPA 1FRGH 4MMZB 3T3PB 3EZJB 5EZLB 4GXVL 5I0YA 1I8MB 5E70A 2XTLA 4JFUA 3WE6A 1JZHA 3QH3B 2CDEA 2I7OA 3MV9B 5JPMB 2A9NL 4JVPA 2VISA 4G8GE 3NUKA 4GW4B 5ABDE 2Q0ZX 4N8VB 1L9PA 2F58H 3O6FC 1KB3A 4V1DE 1S9VB 4MBRA 3OZLA 2ENPA 5DJAB 3I9IA 5IZ7A 2BHZA 3W57A 1JERA 2Y1VA 1K8DB 4P2OA 2CJ3A 1FNFA 4PLKD 4AEHH 5FHBH 2QGDA 1EFXB 2DQTH 1T1YA 5D7LA 3L9EA 5AAPA 3IJHA 1KTDB 5E24E 4RGNE 3RWCB 3HPJA 2EXWD 4TSCL 3EHBC 4OF6A 3V6BR 4IIZA 4UOW1 1S5HB 2J88L 4B5ZA 5IFAL 2ENQA 4L3CA 2GFBA 1CTNA 3DJRA 1AIFA 1CICB 1T89A 3SPCA 4GKLA 2HKFH 3B8YA 2WLZA 1ND0A 1IGYA 2Z93A 3Q3GA 1Y6KR 4TNGA 1WZAA 4OD1L 4P23B 2C7UA 3TEXA 3VA6A 3BZEB 2HJLA 2ZJSH 4Y8AA 4ENZA 2GIYA 2HX8A 4K71C 4EVNA 4F8LA 4P2QB 3MODH 2VM3A 2QFRA 3QDJB 3T8XB 3KPLA 4YHLH 1OQXA 1P4IL 4FHKA 4RRPM 4MQ7B 1DVYA 1PLCA 2HLAB 1RUAL 3V0JA 4FXKA 4AW7A 3JUYA 4H20L 3JVGA 3KBHE 3X1BA 1RKRA 3OKYA 3P4NA 3AJ7A 2YGQA 2IALA 4XXCC 3LMJH 3PWPD 4RAUA 1MCBA 2F1BA 5D2LA 4NKOA 1F1AA 2HRGA 2F8IA 4GQ9H 1Q9LB 4Y1AA 2B2XL 2KI6A 3EYOA 1Q4NX 1YQVL 1JTTA 3B9KA 3VQMA 4U3SA 1ID5I 2A1WL 3BUTA 1IJ9A 2WOYA 2J1WA 3T0BA 2AGJL 3FCGA 4HUXB 5IKCA 4ODTL 1IC7H 2WN3A 5FV2A 3PGDA 3OXSA 1RU9H 5BW7C 2D7OA 4EF3A 1L4IA 5EIVA 1J86A 4EIGB 1JIBA 4F2MA 5D5ME 3CFCH 1Z7JA 4LKXA 4TTGA 4EZMA 4PCYA 1PDKA 1SOKA 3VXNA 2C3WA 2GPZA 1BVLB 3FQRB 4PIRF 3B2VL 2R56L 1UFUA 7PAZA 1TLMA 2AERT 3II1A 4WTZG 1MCWW 4FLHA 4OZGE 4OFVA 4WVRA 3MUJA 1BFOA 1SY6L 1D5ZB 1WSST 4I3RH 4MAYD 1BVNT 4I0KA 2LT9A 2H9GB 2K70A 2YO3A 4F7PA 1A4BA 4PI0A 4HZLB 3WTYA 4GRWH 4YSUA 1NOLA 2NDFA 3TJEL 5IJVA 1F58H 4N28A 3EFDH 3S96A 3T6VA 1N0XH 4X5QA 3WEXA 2VERN 5F1SA 3ZDXE 4UM9D 2Q76B 4D0CA 1PZ2A 2WXPA 3ARBB 4G43B 2QELA 4EIZC 1SMDA 4WENB 5IEKA 1E4WH 2YSSA 3NABL 4N9GB 4HJIA 1LEIB 2OPCA 5GRWA 1DR9A 5KBNC 4X6EB 4RMWA 5DLLA 4NXKA 2O93L 3DETD 3Q8CA 3MJ8B 4XCCH 3E9UA 4LOUD 4MDJB 1FH5H 5ITFA 4IMKC 3SD5A 3UIZA 4D3CL 3KH4A 2IG2H 1HSBA 2BIOA 3O9WD 4FFZL 1Q94B 4HCRA 1JP5A 5AOJA 3Q05A 3WUWB 4KKRA 1JDDA 4ZK8A 1FGNL 4TPRL 3UAAA 4ENED 4PJ8A 4XNBA 4WQOA 5D1XD 4NBYB 4EZKA 1K4DA 3D9AL 3T2PA 1L5GB 4YXKH 5HJ3A 5INCA 2F54B 3VXQB 2WXNA 3WXWL 1NGYB 1QHQA 4FQ1H 1KACB 2DQMA 5E2WL 5DQJB 4J3XA 1NA8A 5EG6C 4PRDB 3L4CA 3TPUB 3QPKA 4OT1H 3AS2A 1DBKH 3PG2A 3O8XD 2KZBA 2WYZA 5CLTA 3IFNH 1N68A 4ZMOA 3FDWA 1LD9B 5F89A 3AU0A 3DPBB 5BVPH 1OLLA 3EADA 2Y7MA 1O7VA 4IRSD 3LIZA 2P48B 3SN6N 1Y7VA 1AI1H 3IDXL 1QSFE 4Q6IB 3VRLF 2I27N 2X4NB 1D5IL 4TNWF 4AVKA 5IIEA 1NMBH 1VACB 3JV5A 3NA4A 4PTTA 3P73A 4GLRI 2X12A 4PG2A 2V2WA 1AGCA 3VXMA 2X6BA 5FLUA 3RFZC 3NEXA 4QXUL 5DF0A 5DVOA 2EEFA 2IFGA 1CS6A 2K3TA 3REVB 5GIRB 1C5CH 5JZ7C 1O7DE 3AMLA 3JXAA 5DJ0A 4ELMB 2R29A 4P46C 3BKYL 4UTCA 1K3ZA 3GBNL 3VU2A 3RGVA 3ZRSA 4OVVA 4JO1L 1MQKH 1MCHA 1JTPA 1FVEA 2ZCHH 1FV1B 3FH7A 3WIAA 3QXAA 4FADA 4LSSL 4YR6B 1X5KA 1AGDA 1WE5A 1Z0NA 4JK0D 3B56A 2JKSA 3QHZH 3H2WA 4XBPB 4HIIA 1KULA 1FZOB 4ETYA 3TZVD 4CSSA 4H8VA 5ANHA 1FNLA 2CLVA 3T2QA 1EFXD 4MYPA 3KBFA 3B3BA 3ZTDC 5FECB 1BWMA 3QUZB 2CALA 2XCMC 4PSPA 2WBJB 1TO5A 2QSQA 2WWOA 1QKZH 2IWKA 4FQ2L 5CHNB 3V6FA 4DERA 1CICD 4WI2A 5EIIG 3D0VA 4X7EC 4LSQL 3H3BC 5CSGA 5DJ2B 3UO8B 2APWA 2CGRH 4G7SB 4IRZH 2NYYC 4ADJA 2H6PA 1IZJA 3DDFA 1BD2A 1YMHB 3IJSA 4KJQC 2WVUA 3NFSL 3T1WA 4P23D 5E95B 5HYQB 2X38A 4OCYH 3ULVH 1KYUA 4HCRL 4WFFD 4F7TA 5G4OA 3U4EB 3LNDA 1OP4A 1HE7A 4P2QD 1T4WA 5IVZA 3QDJD 3IU3A 1XXDC 1IQDA 2F8OA 3FC8A 3PNRB 5F1NB 1V3MA 3JV4A 4KZDH 2XV3A 4WNJA 4QRQA 2ARWA 4E9XA 3K6SB 2VB5A 3AU1B 3JWOH 3E8VA 5HDBF 1XT5A 5EH1A 3T0AA 2C3GA 3LN5A 5HHVH 3W39B 4TOYH 5IMLB 2V2TB 1DCLA 3DECA 1J12A 4IRJB 3QA3B 3CSYA 4XH2A 1YN7A 3K1KC 5BJTA 5I23A 5J3HC 3AT9A 4KX9A 4F92B 4AG4L 5EEWA 1DO5A 1JUFB 3HMWH 3V55A 3ORJA 1FNEB 2H6UA 1XGRB 4Z7UE 2R0ZH 3GHPA 5FYLL 5ID1A 2LV4A 5A16B 2EADA 1EJ6A 3CCHA 4JDVA 2IPKA 1KB9K 1OF0A 3C5ZC 1DVTA 1UB5A 2EIDA 4NCC1 4YSEA 1RZFL 3MLYH 3NIFF 4X0NA 1IGJB 1IGTB 3B3IB 5L6YL 1AQDB 1T5WA 3VI4E 3CD4A 1RZ7H 3WJMA 5EORH 4RETB 1PCXA 4GQRA 1KWKA 3B2MA 3ZTNH 1YN6A 1GGTA 3FZUC 4K9EC 2I9LA 4GAYB 3GXTA 1JF5A 4AV5A 1KV7A 1URIA 2R29L 1EXHA 1JVOA 1ZHBB 1X7QA 5ILTH 4MZ2A 3DUHA 4KO7A 4L18A 2A74A 2X0VA 1H3PH 4ZOBA 4LSTH 5F1KC 5F88A 4OW6A 3F7VB 5KWYC 5C6TH 1BLIA 4WO4A 5HSFA 5KSBA 1AHWB 1HCYA 4PV8A 1KCSH 3ARBD 4PJ5E 3DVNB 4HJEA 3F7YA 3LSOA 4R0LA 2JJSC 2A7BA 1N18A 1T7VA 2GJZB 3TH4T 1JNLL 5DLML 5EO9B 1XB8A 2QGBA 2QMKA 5AOIA 2FRGP 5GGQL 3ARGB 4U0RC 4Q6YA 2IH1A 3ZQWA 1M7IB 4M5YL 3W0WE 2Z91B 3PWLB 2GUOB 4K94L 2VSDA 2CWRA 3QFJE 3N42B 5DMGD 3OKNB 3T6XA 3NZHH 1UXWA 4X80L 3VW3L 2QADB 4I4WB 1SOXA 3V4LA 4MMYA 1QUPA 1FNGB 3N0AA 3SPIA 1HS6A 1UOLA 3QJRB 4FZEL 4FKHA 4LASH 1UKQA 5MHSE 3IJ8A 2BC4B 4XCNB 2X7LA 1F18A 2FJFB 2F54D 5C2BH 5CJOH 2E7BA 3QZLA 4WEBH 1INEH 1QLRA 3CZSA 4O5LL 2HLEB 3U30B 2KLRA 3I9PA 4DH2A 4PJAF 1B4RA 4AKPA 3MFFB 2CMRL 4LB8A 3IK2A 3LXUX 3H3KA 1W80A 3WKNA 5E2VL 2YMTA 3RWFB 2XX0A 2CIKB 2FO4A 1GW6A 2DLIA 1TYRA 1AE6L 2J2ZB 2UWEE 2HTLD 2LOEA 3GMQB 2FH8A 3GIZL 2NNAB 4WUKH 4K23L 2GK0B 4U31A 5CP7A 3CXDH 3MV8A 1QWHA 4GI6A 5DMKB 1TJGH 2IH3A 3EJZD 3Q5YA 4KRLB 4XO3A 1BM7A 2KERA 4FZ8H 2XRAH 3GYRA 4TN9A 1CLCA 3LQZB 4KX7A 3RIKA 3PQYE 1TQSA 2TRYA 3QZBA 3NA9H 3QDGE 1NCUA 3CH8A 4JL2A 4BFFA 4QT5A 4WLCA 4W9ZA 3VSVA 2V5MA 2D2CC 4AEIL 5BOJA 5DHVA 4J3OC 1KEGL 4U1IB 5IMKA 1N26A 4K8RC 3J8F7 3PF2A 5FKPB 3AROA 5L88H 2YQ3A 1JZ2A 1DVXA 4FTVE 3N0PB 2E6JA 3OGCB 4UZUA 5I73C 3KCPA 3LQMA 4QOKE 3KBPA 1W0WA 1KJ2L 1ZK9A 4H2CA 2DIBA 1I7UB 4FJZA 2HLFD 5HP5A 1MCNA 3KZ8A 3TTSA 3B7YA 5H37G 3G6JA 2V2XB 3GT6A 5KSAB 3CHXA 1AYOA 4PRPA 2ZOUA 1ZHKB 2B4CH 1PL3A 2A4EA 2UYLA 3B2UC 3HRZC 4OCXH 3QUZD 3OGOE 2WBJD 3UTZA 1F5WA 2ZUVA 2Q8AL 2RQ8A 4LCWB 2HRPL 3EXLA 5IB5B 3EDEA 5I28A 2H32B 3QXDB 3MA7B 4TRPH 1U91B 1ACZA 3Q13A 3AM8C 4LPYA 5KAQG 1C5BL 4GRMB 3MZTA 1ED3A 1CGUA 4BSWA 4KXBA 4PN6A 2UZXB 1BQSA 1EHNA 2A9MH 1KDIA 3UABA 1C08B 3DYPA 4ODBD 4TUKL 3SO3C 2NY7H 1OCZB 5F7HA 1YSOA 4LDCA 1DYZA 4JN2A 5GZND 3KJ4B 4YE4H 1DVFA 2WWKT 3GHBH 4JFOA 1JGUH 2DTMH 3TT3L 3IXTA 2D9CA 1FBIH 3BCDA 3NEOA 2YBRA 2Y1AA 3EG9A 3O45A 2IQAA 1BPVA 1N4XH 4WI7A 2BNRD 4OM0H 1WT5A 4IRJD 1SXBA 4QTHA 4OAWA 1XZ0A 3OV6A 4FFWC 5T8IA 3BE1L 3A21A 4V33A 1DL7L 2CUIA 1KB5L 1DSYA 1SEBB 2BFGA 4IOIA 2VM9A 2IC2A 3L3GA 1RK0A 5E8OA 4YFEA 1SBSH 4M6NH 2FL5A 1SXSA 3NESA 5C0BD 2ZP0T 5TH2B 3ULUL 3SGJC 3DBSA 2WO3B 1KIUB 2WYTA 4L8BB 1MI5B 1F11B 3NG5A 4IU3B 4B9GA 3AABA 4ODHH 4N4YB 3VI4F 1OTSC 3BT2H 3BUDA 5I1CL 5B1JA 3SE6A 4XAWL 4XNXH 5HHOE 5C2UB 4YHNB 1MKFA 1DQML 5KOMC 2EYRA 4TMPA 3L4VA 1R9FA 4ZMQA 5IUCA 5HGAB 3CN1A 5IVXE 4JFXB 5ALCH 5I66A 2DH3A 4ORZC 3RLSA 4ELKB 5D6CB 5MEOB 1VGKA 1SUHA 1X5YA 4X83A 3QUYD 4Y5XC 2LAGB 1MVYA 3OKMB 3UJJL 5IW6A 4G72B 3BFWA 5AWNL 1JYNA 2C3VB 3CIAA 1I8AA 4KPHH 4L3EB 3PNWB 5DJXA 3F5WB 4P9MH 4DKFH 4U1HA 5K1NA 1VFBB 5FYJU 2BFVL 2OMWA 3WIIH 3ARGD 2NCEA 5ES4B 4A7SA 1D9KB 4M43L 5I1EH 3ULUE 4BK5A 3FYIB 1CLYL 4U2ZA 3Q8BA 1T2QH 2E59A 2D7QA 5H8DA 2BIQA 4XP9L 2X3AA 3IDYC 2BVPB 4LVEA 1SUJA 1BGXH 3CIQA 4OGAD 5I1KH 4UT7H 4X9IA 2YPVA 1EXUB 3HE6D 2GJ6E 1XO8A 2QADD 1TEYA 1M7DB 3MTRA 3H9SE 1A1MA 1S9YB 4KMTH 4KH9A 2XN2A 1LO3H 4NXSA 3TV8A 4PIBA 3ZYJA 3JZYA 5I16A 2IAMB 2YHGA 4XRCB 1ORSA 2ED6A 4IBUA 1HXYA 4MNGB 3QQDA 1UT9A 4IIQC 2HKHH 2RFXA 4ZOAA 3K6IA 3UTTA 4Z7WE 3A4EA 2IXQB 4BQBA 1ZA3B 3L81A 1UGNA 4X6FA 3V6ZB 3KWWA 5I6XB 1J1XL 4AUYA 3BWUF 4U49A 3QYCA 2XZCH 2H32H 3Q06A 1HHIA 4OLVH 4OV5B 1SYVA 3EYQD 3WTVA 3GS7A 4FLQA 4PJHF 3D87B 4JG0H 4M8VA 1NBCA 5C7XL 2I60L 4AV4A 4QKTA 3K46A 2IBZY 3V4VA 4CILA 1LWRA 3BHBA 3CHPA 4AEFA 1YECL 4A68A 4OQTL 3UTPE 1ROCA 1DBJL 1DQDH 2YPKB 3FU7A 4YLCA 3UZQB 3FB7A 3GRWL 1DFXA 1F42A 3BIKB 5GS1B 5IJKC 3CFEA 3EH2A 5CINL 1JV2A 3DGDA 4O2FB 5DYOA 5F6IC 2MCMA 4FQCH 5DRWB 1BP3B 1IBFA 4JHVA 4XOBA 3E38A 1A47A 4LGPB 3MLRH 1OOAA 4JFQB 5EPMB 4ZTOL 3TCTA 2DH2A 2XWBB 1P9MC 2JKNA 1ZVSB 3V4PB 2NY0C 4HU8A 4PVNA 2Q3AA 3QEQE 3MLUL 4M7LL