2CBPA

Cucumber basic protein, a blue copper protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
AVYVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUCUMBER BASIC PROTEIN
publication title The structure of a phytocyanin, the basic blue protein from cucumber, refined at 1.8 A resolution.
pubmed doi rcsb
molecule tags Electron transport
total genus 26
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02298 Cu_bind_like Plastocyanin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2cbpA00
2IDFA 1AZRA 7PCYA 1BXVA 1AZCA 1CUOA 2GB2A 2AFNA 2BP0B 1MG2C 2Y1AA 4N8UA 1JXFA 3DTUB 4KNUA 1SFDA 3H4HA 4G72B 1NPJA 5ANHA 2OV0A 3T6XA 1ILSA 3FU9A 1UATA 1GY1A 3KW8A 3JT2A 3PAZA 1J5CA 3EH3B 2IAAC 1PLBA 2BP8A 3WIAA 2BWIA 3ABGA 1SHXA 2PPDA 2J56A 2VMJA 1NICA 5LDUA 3U25A 4NERA 1JZJA 2EIJB 1KDJA 1M56B 2ZOOA 3KW7A 3NP4A 1KCBA 3FYEB 2HZHA 4DP4X 2Q9OA 4EF3A 1BAWA 4Q89A 2UXTA 1HAWA 4CSPA 1GSKA 5D4HA 3FPYA 1W6WA 1ZV2A 1YLBB 3FT0A 4DPCX 1X9RA 3WKPA 1IBYA 5I26A 3IEAA 1GYCA 5AZUA 5B1BB 1J9RA 3OMIB 4E9TA 2FQDA 4KO7A 2MRYA 4F2EA 4DP0X 1OV8A 2ZONA 1AIZA 1JVOA 1PZCA 3PPSA 4HZ1A 3NJGA 1AS7A 1BXUA 2E86A 2CAKA 4DPAX 2UXVA 5A7EA 2DWSA 2HRHA 1OE3A 2XLLA 2QPDB 4HIPA 3ABLB 1N68A 4GXFA 4HAKA 1RKRA 4JHVA 2W88A 1QLEB 4F2FA 4BWWA 2CBPA 2TSBA 2PP8A 2B3IA 2YAMA 3CZUB 2IWKA 3CVCA 4BXSV 5B7MA 1AG6A 1PCSA 4YSAA 3NT0A 2VN3A 3FQ1A 3BQVA 2XV3A 2YAPA 4E9XA 4A2HA 3CVBA 1J5DA 1ZIBA 3FU8A 4UAHA 3L45A 1JZHA 4YSQA 5B3SB 1JERA 2A3TA 1AQ8A 5E9NA 1SF3A 4A2EA 1I53A 2QPEB 2XX0A 5I28A 3FQYA 3AG4B 2YXVA 4YSOA 5TK2A 1AZBA 3X1GA 2P80A 1T5KA 2TSAA 4YL4A 2W8CA 3OD3A 4AZUA 3EH4B 4JHUA 3ZIYA 1DYZA 1M57B 1A4BA 2BP0A 2PP7A 2DYSB 3FYIB 2VSMB 2PP9A 2JFCA 4WTQA 4AKOA 2BZCA 1NPNA 1NDTA 1OCCB 1PZAA 3QPKA 5PAZA 2H3XC 2AVFA 1RZQA 2Q5BA 3ERXA 1V10A 6PAZA 4ENZA 1AANA 4YSCA 3NJKA 3CVDA 4N4YB 4PAZA 2XX1A 1AS6A 1MDAA 1WS7A 2IDTA 2RACA 3V9CA 1V55B 4YSTA 1HAUA 1JXDA 8PAZA 1NINA 1JZGA 1A4AA 4W1TA 1FWXA 3NJHA 1AR1B 1ASQA 4UANA 2X87A 5I6KA 3EH5B 1DZ0A 1ET5A 3ASNB 4FAAB 4AX3A 4UF7C 5I6NA 5I6MA 1R1CA 1EHKB 3MX0B 1IBZA 1M9WA 2HRGA 3FU7A 1EZLA 2CUAA 2BW5A 1ZPUA 2VM4A 4A2GA 4YSRA 1GS8A 2ZXWB 2X88A 4L0PB 3CG8A 3NSCA 3X1NA 2R7EB 3TBCA 1KGYE 4P5SA 3ZDWA 2XUWA 2FQFA 3NYKA 1HFUA 1BYOA 4E9VA 2DYRB 3NJNA 3TBBA 2FT6A 3SQRA 3UAAA 4HCFA 1SFHA 2GIMA 3PAVA 5D4JA 1QHQA 2XVBA 4DP7X 1NWOA 2IDSA 2IWFA 4KNTA 4E9WA 2H5UA 3ABKB 3AW5A 1AG0A 3DKHA 3EF4A 5B1JA 1XB6A 2GSMB 3ABMB 3UGEA 2AANA 4G70B 3GXUB 3PLYA 1BXAA 1JOIA 1OF0A 4WKXA 2I7SA 3QJRB 4M4RB 2OJ1A 3GDCA 3NSYA 3FPXA 2XV0A 4E9RA 2PCYA 4KO9A 4ZK8A 2BHFA 2QDVA 3X1FA 1ZDSA 3IBOA 1B3IA 3HB3B 1NZRA 4W9ZA 5TK4A 2JXMA 2VW4A 3V9EA 3S8GB 2XXGA 1WA1X 3NJFA 4KOBA 1WA2X 1AOZA 3H4FA 3X2QB 1GS7A 2FQGA 4G7SB 3DIVA 2QDWA 1PF3A 1ID2A 3QQXA 1GS6X 3AY2A 2IWEA 3QJUB 3AZUA 1ZIAA 1OCZB 4KOCA 1L9QA 5EHFA 9PCYA 1AZNA 5F7AA 3FQ2A 3SBQA 4BXVA 1NIBA 3SBPA 2EIMB 5B7FA 2BP8B 4AI7A 2CALA 3IN2A 2WO2B 3WG7B 1IKOP 1SF5A 5I5IA 3CDZA 1L9TA 2UXFA 1E30A 2OCCB 1SNRA 2IDQA 2JKWA 1A8ZA 4HCGA 2XWZA 1E5YA 2PPEA 5I6LA 1OCOB 1PAZA 1ZDQA 2FNWA 3QJVB 3IE9A 4GP8B 3N2JA 3QJTB 1NWPA 2AZUA 3BVDB 2EILB 2NRDA 1GR7A 2VSKB 4A66A 4Q8BA 3FSWA 2DWTA 4F7KA 4FA7B 2BO0A 1FFTB 3NJJA 1OE1A 3T6WA 1JXGA 1ASPA 3NSDA 1WAEA 1BYPA 1MZYA 2FJSA 2AZAA 4NB7A 1CYXA 3OMNB 3WNJA 4A67A 4DPBX 3MBWB 1E5ZA 1ILUA 7PAZA 2FQEA 4QKTA 4E9YA 3NSFA 2PLTA 1ASOA 2PPAA 1CYWA 3UADA 2BW4A 3PXLA 3C75A 1J9SA 3N55A 3OM3B 4RH4A 4E9SA 1NIDA 3OQRA 1L9PA 2WSDA 5I5MA 3G5WA 1CC3A 1GW0A 2HX8A 2P80D 1OE2A 1SJMA 1FA4A 2XXFA 2HX9A 1PZBA 4CSZA 5I6OA 4AKPA 2IDUA 3QJQB 4NAJA 2PCFA 3X1BA 3UAEA 4HCIA 1J9QA 2J5WA 3TA4D 1NIFA 2IH8A 2DV6A 3NP3A 2YQBA 3X1EA 4BDVB 6PCYA 1TEFA 4KNSA 2FT8A 1E67A 2IH9A 2VW6A 3QJSB 3WKQA 4DP1X 3UACA 5B1KA 1JZEA 1KV7A 4JKNA 5I6PA 1ET8A 3SBRA 4DP9X 3FSVA 3AG1B 4P5RA 1KBWA 5IY5B 5B1AB 1A65A 1KCWA 3UABA 4HHWA 1AACA 2I85A 2UX7A 3D12B 1URIA 1TEGA 3ZBMA 4YSPA 5B1JC 2QT6A 2GBAA 4TXVB 1NIEA 2YAOA 4G71B 1BQKA 3AG3B 1IUZA 2UX6A 3ASOB 4PCYA 4E9QA 4M3HA 1N70A 5I5JA 4GP4B 3TU6A 3FSAA 4YSEA 1NIAA 1SDDB 3FSZA 4DP8X 1JZIA 5FC9A 1JVLA 1XMEB 1IC0A 1PNDA 3FU7B 2Y69B 1W6LA 2FTAA 3S3DB 4HHGA 1AAJA 1MG3C 2GC4C 3ZX1A 2J55A 1BQRA 4A68A 1F56A 1GY2A 1RCYA 5F7BA 1PLCA 1XB8A 2DY2A 3GYRA 2XV2A 2HXAA 1PNCA 4A2FA 1WS8A 1X9UA 1ETJA 2I7OA 1ADWA 1J9TA 4G7RB 3S3BB 2FWLB 2XYBA 1NTDA 1PY0A 2ZWNA 2YAEA 4KO6A 2GI0A 2YARA 1W8EA 4BWTA 4G7QB 1L9RA 2GC7C 2VW7A 4YVNA 3T71A 1BEXA 4YSUA 2B08A 1AZUA 4KO5A 3S3CB 2YXWA 2R7EA 2PPCA 1PLAA 2HLEB 3TASA 3WI9A 3NJIA 4DP6X 1A4CA 1KDIA 3FS9A 2N0MA 1VLXA 1V54B 2BZ7A 1RZPA 3HEIB 1WA0X 2H47C 2XU9A 4A2DA 2PPFA 3RYMA 4BK5C 1OOWA 1TKWA 4GYBA 4X4KA 1TU2A 4BWUA 2EINB 4BDVA 1AS8A 1PMYA 1JZFA 2YAQA 1A3ZA 2UXGA 1OCRB 2J57A 4YVUA 2YAHA 1KBVA 4DP5X 2HX7A 3NJLA 2CJ3A 2YAFA 4MFHA 3NJMA 2EIKB 4K9JA 2GHZA 3WNIA 3PAUA 1L9SA 4QLWA 3AG2B 5AKRA 1KYAA 5PCYA 1SHWA 3T6ZA 5AFAA 4YSSA 3S8FB 2BWDA 3JTBA 4AKQA 2VM3A 3T9WA 1CURA 2LLNA 5D4IA 1ET7A 3EHBB 3PCYA 1BQ5A 4DP2X 1L9OA 1XB3A 2WO3B 2MTAA 3OMAB 3H56A 4GP5B 1SDDA 5B7EA 2FT7A 4GY4A 4HALA 3T6VA 2CCWA 1QNIA 3CDZB 1MZZA 3IN0A 4YSDA 1E65A
chains in the Genus database with same CATH superfamily
1ONQB 3M1OA 4M5SA 5CEXB 3QDAA 1VFUA 3U79A 5C97A 1AGCA 1GZQB 2DEXX 3HC4L 1IKFL 3N43F 4NN6C 1OSYA 3OTTA 1OP3H 4AJVA 2FWOA 2WP3O 4P9HH 4OZFA 1WE5A 1ZPLA 4I89A 3L1GA 3BAXA 4ZMOA 3ILQC 1QWHA 5JOPE 1VKXB 1MPAH 4DSYA 5FO9B 4XP6L 2JB5H 3N1MC 2IAAC 3CMOH 4JPWH 2BP8A 2HG5B 4BSJA 3KJ6L 1RSFA 4NKOB 5DFTA 4Z7QB 3CTTA 2CPCA 4N5EC 1LHZA 4F3FB 2OI9B 1UADC 3NP4A 1L6PA 3VFPA 2M8XA 2HFGL 4OZGB 3FO0H 1BG9A 5CLZA 4FP8H 1CXIA 4HYTB 5IQ7L 3W9EB 4NN7B 5HPMB 2B1HH 3CCHB 1N0LB 3D3VB 3L95B 1I1AB 3V6OC 5A2BA 3BISA 1BVZA 3I2CH 1GGIL 2WNXA 3HE7A 3VWJC 3LH8A 3Q8BA 2ZAHA 3V6FA 4E41A 1KLFB 1LDSA 2JTYA 5FOBB 2WXFA 1DN0A 4N0FB 4GBXA 1ECZA 4JN2A 4AV5A 2FHBA 1U3JA 3QZOA 1QFWH 1HWHB 5E6ZA 4NM4H 5CD5D 5TF1L 1QFUH 3CPUA 1MKFA 3APNA 4Z7UB 5DZAA 3V0AC 3QIUB 3MBWA 5DJCB 3RIAF 1FFNA 1KIRB 5G2NA 4EMZA 4TQEH 2WXOA 4MJ6A 2X4SB 2E6QA 4NQDB 1E90A 3WFCL 1D5MB 1OARH 2W0FB 2IV9A 2FECI 4BXSV 3PJSB 4M7JH 1PCSA 3JWNH 3BP4B 4FNLH 3BSZL 1X5XA 3K1KC 1I9EA 2FEEI 2FJUB 5B1CA 2BNRD 4AYFA 1KT2B 5G4NA 2D7MA 2DWYA 4JFEA 3MOAH 5BJTB 1XF4B 3BAEH 2RA1A 4B9GA 3PIQB 4FNTA 4TSAH 5HGHB 4WQOA 1AQ8A 5AW7B 2J6EA 4JY5L 4WHTB 3TPKA 1H15B 2YXVA 4UM9D 2QSCH 2MPVA 5E8DH 5F9OL 2KKQA 1QRKA 3EH4B 4JHUA 3L3OA 1OZTG 4K8RH 4Y2DA 3ESMA 1OXYA 5CCJA 3HJEA 2B5IC 4JREC 1ADQL 1LK2B 1TLKA 2E46A 1Z6JT 3BPNB 3DMMB 2X1PA 3BIKB 2ZX6A 3OKKB 3VA2C 2E7LA 1ZSHA 4HK3J 5F96L 2E6PA 3V0JA 4A7GA 4ZMNA 2V6HA 5C9KA 5E5UB 4GG8B 3ZHFA 4A38A 1BD2A 2NNCA 1RIVL 4L4TD 1V55B 2EZ0D 4F8TA 5L8LB 3PP3K 1U8HA 4WO4B 3ETBJ 1MFCL 4YSTA 3EH1A 1YN7A 3MV9E 1F58L 3B2PA 1P4IL 3HMWL 4OV6F 3WELA 1WC7B 2HKHH 5I9QC 3BHBA 4KZDL 3QHFH 3GSNA 3VWKC 2G4GA 4F24A 2YS4A 3PQYD 1TIUA 2C9AA 1CB4A 1FNSL 4JHBA 2H32H 1KJMA 4JPKH 4LCUA 3IU4H 1XSKA 3WEXA 4Y1TA 1P53A 1BBDH 1L5GA 1TQCB 4WCYL 4FQ2H 3MA9L 4X7TB 1MHPH 2J1XA 3I9PA 4L3EB 3SGJC 1SVCP 4Y7OC 1MFVA 4OGXH 1TO5A 2K4AA 5A1AA 1GHFL 1L6ZA 1UT1A 2HLAA 3KPNB 4K71B 4OZ4A 4Z7VF 3HB3C 3GMQA 2OMZA 1ZT7A 1S8DA 4KK9D 5DEFA 4OLWL 3BESR 1R34A 2XG5B 4BKSC 4PLOB 3BRDA 4PWJA 3VFTB 3WMSA 1F1AA 2G5BB 3FCTB 5J57B 2DDQH 4FG4A 4N8CH 4Z7OE 1JGUL 1QSFA 5JR1L 5IIEA 2OMYA 1LO4H 2APBA 3FUMA 3FFCE 3BLKA 4U1JB 1I4FB 4MVBC 2GABA 5EBGA 2D7PA 2E74C 4Y2NA 4OR1A 5IQNA 3GSWB 1J0KA 1PU0A 1MJJA 3NFNA 1NCDH 4FL4C 5EU4A 2F6AA 1GZPA 5FHAL 3QZWA 2XSKA 2YGPA 3ABMB 3AUWB 1DJXA 1YY9C 1Z9SB 1T04A 1SEBB 1XZ0A 2AEPH 5E6IB 3PXHA 4ODXA 4GG6B 5B38A 4ETYA 3UBXB 4ZK8A 4E41E 3U0PB 1QG3A 3BT0A 1MCOH 3C08L 1A6ZA 2EKSA 3FUHA 3GJEB 3F6IA 4JHZA 4XNQB 3OB0K 1DUZA 1ZE3H 1JNJA 2YLHA 2JXMA 5I16B 1NMBL 1LO5B 5DI8B 3O3AA 4WTZA 1DSFH 3BQUA 3X2QB 4M5YL 1GS7A 4PV8B 3IK2A 1A4KA 2DJUA 3MZTA 2Y23A 4MMZA 1GS6X 2DQEH 2AV1A 3R4DA 4WHYG 1AD0A 1AGCB 3KPTA 5IF0B 1U8IA 4H7VA 3LCYA 1IZJA 2ZXBA 2X0VA 4PJ8C 3HAEB 4BUGA 4O9HL 2FWOB 2ZOKA 4GI9A 4JFZH 3NCWA 4ZDHA 1H19A 2WSPA 5ES4B 5JXAL 4LRNL 4FEMA 3VMOA 2Z31C 2QZQA 1WFMA 2OSLA 2DEWX 4Z7OB 3IDNA 1V3MA 2IOMA 4UV7L 2PXYD 1QPKA 4DGYH 2BP8B 3FFCB 4KK8C 2Z34A 3US1A 3GTVA 5BQDA 3TO4A 1E30A 2ERJB 1A7PH 3BZDA 4NQEA 4PJFA 3RGVC 3P02A 1MFAL 5LXGL 4Q58C 3CXDH 4Y4HD 2P44B 4NI6A 5BZXA 1CGTA 3IRCA 4J4PD 4PWEA 5E0QA 2CO7A 4OCRH 3MBED 3BVDB 2AQSA 4NX0A 1NSNL 3VYOA 2YSSA 2JCCE 3QUML 1U33A 3V6FB 2D7TL 4E41B 2Z0BA 4IKIA 4XWOC 4YFEA 4GBXB 4QHUA 5BQ7A 2FLMA 4XZUA 3GM0A 4Q9RH 5H2BB 4WW2C 1A14H 3WV0A 5I1GL 1MW2A 5GGVL 3E9TA 5I71B 3MBWB 5LG1A 4UT9A 1FFNB 1OQOA 4FCHA 1XHHA 5D1QE 5GRVK 4AEIH 1EIBA 3ZHLA 4MJ6B 3UIYA 2PWEA 1JHLH 1JN6A 2K8QA 1J9SA 3C2AH 3PPEA 5CS7A 3A47A 3WTVA 3X3FH 2Z35A 4W81A 4HKJA 1O5DT 4EN2A 1IC5L 2DQIH 1CE1H 2J20A 1FYHB 2ZCKL 3IDXH 1OE2A 2EEXA 3SDDD 4AYFB 5D6DC 3G5YA 2CBQA 4QHKJ 3VXOA 2IDUA 3QJQB 4PJHA 4JFEB 3FRPA 6FABH 2JKTM 3RVWD 3TNNB 1KENL 4HJJH 1WG3A 4JVUA 4FKEA 5E9DA 1UM6H 4Z6AT 4BQ9A 4F8LA 1X9QA 6PCYA 4KI5C 2IH9A 4KC3B 3L3OB 5D7LE 4Y2DB 5GZND 3VYNA 4AZ8B 2WWNA 1G9NC 5JIMA 4PJ7E 4FI6A 3GS0A 3NEXA 1NAKH 3TNMA 5LG6A 4GRMA 3WJLC 2HMID 2JCCB 5EUOF 5B1AB 4HS6A 3U46A 5IY5B 4EIBA 4JFDE 5EV7A 3O4OB 1AACA 1IBGH 4XAKE 4F93B 2CNYA 3K4DA 3VXTA 4QOKE 3H9HA 4WNQA 4DW2H 5F7UA 4TXVB 1YN7B 1DO6A 3US9A 1LP9A 3BO8A 1LE9A 5AL8A 1IUZA 1UENA 3LNFA 3ZDXF 3GSNB 3TJEH 4F15B 1J5OL 4O02A 1R47A 2D7NA 1KJMB 2X6CA 3FSZA 4LCUB 2VE6A 5FUZL 4XNXH 3BKCH 2J8OA 1B6DA 2HTKD 1OAUH 4H44C 4K7PY 4JZNA 1RULL 1A7OH 4JQXA 3FAWA 4EI6A 5H8DA 3A5VA 2BINA 1RZKH 4OZ4B 3UJTL 3X17A 3GMQB 2OMZB 4MJ5B 1ZT7B 2OQJA 4PTUA 1S8DB 4AGNA 4A2FA 4DERA 3GMMA 3LB6D 4MMYB 4G7RB 4NZRL 1DVFC 5AAWC 5IIEB 4IEFA 1GJWA 5KVFH 1A6TA 2XG4B 3FMGH 5E1HB 3ZE2F 1U8LA 1L9RA 4ZS6C 2VW7A 4TUUA 4LHUB 2GBVA 4PFEA 4N8VB 1MJJB 3SE8H 3I3EA 4PJ7B 3NFNB 4PJFE 5EU4B 4RSVA 2F68X 4LP4A 3EUDA 4TLTA 3LS4H 4U7SA 2IBBA 3QZWB 2HLEB 4KJQD 5DDHA 3V9FA 2AQNA 3LIZA 1T04B 3TJHC 1XZ0B 4JFDB 3RL1A 5B38B 2H47C 3SCMA 4KTYA 2XPYA 4IYKA 1TJIL 4TTGA 2IFFL 5BMFL 4WY7L 4HUKB 3H9YA 2B0SH 3BEWA 2EKSB 3U0WL 1ZSDA 1DLFL 2NYKA 1DUZB 2DBLH 2DQCL 2OZ4H 4RX4A 1U91A 2AEQL 2JXMB 2ZG2A 4M61B 4EZLA 5DLML 2UXGA 3O3AB 4PJCA 2LLGA 5EIIA 3BQUB 3OPZL 3QIWA 5CJBA 4A7VA 4PJ9C 1RZIB 2D03L 2XI9A 3KPPA 4FQJL 2BNUA 3NN8A 4MMZB 1SJEB 2AV1B 3KR3H 4HJSA 3S48A 1AD0B 4HV8A 4FQIH 5EU6E 5CINH 3WN5B 5IHUL 4YSSA 1RHHA 3OSKA 1NUNB 3CFKB 3KM2A 4P23D 4M43H 4KVCL 4ZDHB 3VI3E 2A5UA 4ANWA 1L9OA 1DANT 1BQUA 4KKPA 2VC2H 5D2NC 2RH0A 3CFQA 3IS0X 4YHNA 4NO0A 3IDNB 4U1KA 1HEJC 2VH5H 4PW9A 3O6FA 3TT3L 1VENA 3OR6A 1E4WL 2YOAA 1S7WA 1TTAA 2X6AA 3TO4B 1A66A 3AGWA 1BJ1H 2SEBA 1DBBL 1YNLH 2QV2A 4NQEB 1M7IA 4NKQB 1CU4L 2ZWYA 3K0YA 4PJFB 4K3DH 3MV7D 4MDIA 3ZVVA 3CFCL 4J3OG 3L4ZA 3STLA 5HYSA 4G72B 4HZAA 4ENEC 1HNGA 2ZICA 3OJ2C 3SOBH 1E4KC 1FCGA 1KELH 2GJZB 1BAGA 2WVUA 3JT2A 4G8GA 4NPKA 3EXLA 3FULA 2ZXGA 5TE4L 1IM3A 3W39A 2BWIA 4QHUB 3CFDA 4OF6A 4WO0A 1KTRL 4NERA 3ZYJA 2A4EA 4EIUA 3FYEB 4KPHL 2NYZA 1BAWA 3QDGD 2CGZA 3R7QA 1H3VA 5AZEL 4JFTA 3BP7A 3FPYA 3S2AA 4KRMB 4G3YH 4LL9A 4ZPVA 5DD6A 5HSFA 2X3BA 3W81A 1JN6B 3V10A 5EU6B 4P2RE 3KYKL 4JG5A 5GS1B 5AZUA 5MEND 2I9TA 2Z35B 2BY1A 2AKRA 5EORL 3Q6GH 4RGOL 4G6FD 1OB1A 1F4WH 2QHRH 2M26A 3T0ED 1II4E 5DS8A 3LRLA 5J1SC 3VI3B 3FN3A 4Y2OA 5F89A 2J43A 1NMCB 1UCBH 4R4ND 4AEFA 4JO8A 2FX8H 4BFBD 3LRHA 3VXOB 4AG4L 1FAKT 4U0RB 4R0LA 4DPAX 2WLYA 1MCPH 5J12B 5KJRH 4L5FE 5F88A 1I8UA 2CWRA 2KLRA 2VDRH 4X6DA 1QLEB 5E9DB 1M42A 3TA3C 2Q8AL 4DOHE 5FCUH 2YUVA 3ZL2A 3BD5A 3CVCA 2R9HC 3QG7L 2WPGA 4JM2D 1CVRA 1JWMA 4ELMF 5K39A 4WGWB 4FABH 4M93B 4NM8H 1KCVH 2WGXA 4JN1H 4NKDA 2WXMA 4LOFA 4GRMB 1MHCA 4MXWH 3Q2LA 3KPRA 4Z3HA 4PLJD 1JNHB 3RI5F 4ZMQA 4I0PB 4HS6B 3U46B 1RUPH 2QKIA 4U1SA 2JJVA 1UA7A 5IROD 3RVXD 3H9HB 2DMHA 5M7QA 1RUKH 1WICA 1LP9B 2XWXA 3AG4B 4P5TB 5HJ3A 1TQSA 2MCPL 3VXMA 1LE9B 4IOIA 1T5KA 3P11H 4HPOH 3LY6A 2OL3H 1IGYA 3S96A 3L9RB 4FFVC 1F8TH 3ZIYA 2EIBA 5ESQA 2BP0A 2HUHA 5BW7A 2IAMA 5DR5H 5I1EL 1AKJD 3KG5A 3NCYS 1A02N 2WBKA 4O2EA 2AI0L 1CXLA 1OIOA 4OCWH 5D1XE 3D1MC 4BK8A 4JZNB 3BDBA 6PAZA 2EDYA 4FI8A 1K5NA 1G7JA 2K7PA 4P2RB 3DI3B 4EI6B 4XMKH 4PRBB 5KBKA 1JXJA 2RCSL 3IMRA 3IAPA 2P8MA 5C7XH 3REVB 4PTUB 2PWGA 1E6JH 5AALA 4OTXH 2DOCA 4ZPTB 3GMMB 4RA0C 2AITA 1A4AA 4HK0A 3L3GA 3QZBA 4L2YA 5HY9A 3ETBF 4FAAB 1Q1JL 4UT7L 4X5RA 4IEFB 2CDGA 1JPGA 1A6TB 2HRGA 2N3JA 2OW6A 3TEXA 3L2NA 1U8LB 3BPCA 1G0YR 1MW0A 4DOHB 2KPWA 2ZYIA 3AXHA 1S7SA 4RFNC 5IBLC 2FX7L 2LOEA 4HG4J 5HVFB 1IT9H 5K1NA 3WKYA 3VXRA 4PR5A 2Y3AA 5A2FA 1T0OA 3N1PC 4IHBA 1IKFH 1BHGA 2X6VA 2IBGA 5DDHB 1HFUA 2BXZA 1TTGA 1N26A 2DKMA 3HCVA 2VDMB 3T0XA 3ZW3A 3ZZLA 2HTLD 5C0AD 3SCMB 4R90L 2GIMA 1I1YA 1DFXA 5E7BA 4L9LB 4XBPA 4R2GC 3WMPA 1ZSDB 1EA9C 4YLQT 4JRXE 4X9HA 5HYJA 1OL0A 3ABKB 1YMME 1U91B 5L8JB 2C5DC 3DKHA 1BQHB 2JNZA 4PJCB 2OXGA 5DCCA 5EIIB 4YFLI 2ZOTA 5SWZD 1HI6B 3QIWB 2A9NL 2C9QA 3KPPB 1DANU 1ZOXA 5HXMA 2APFA 5E56A 2ATKA 5GS2D 4HV8B 2AVGA 3ARFC 2AJVH 3DV6B 1GGIH 2V9QA 3PFUA 2MNUA 3PWJA 3SKMA 4W6XB 3HFML 1DEEA 1KTKE 4DKFL 2IADA 1UZ6E 1YPZA 4JGJA 4YHNB 1U3HC 4LCWA 4NO0B 4UIMA 4P3DA 1J05A 3TJPA 1A64A 2PCFB 3EOBA 4OFQA 3O6FB 5EBWA 5FK9A 4Z0BL 4RRPA 3VXSD 2DL2A 2VDOB 3P9WB 1S7WB 3DIVA 3RX7A 3P73A 1VDGA 2QDWA 2SEBB 1FJ1A 3CVHA 3HZMB 1JGEA 4QRRD 1M7IB 3QR0A 1M3JA 4BZ1L 2Q86B 4KDVA 4Y16A 4MDIB 2DMKA 1I8IB 3NAAH 3STLB 3K71A 1WISA 1FZJA 2XKSA 2DH3A 5I75B 1BM3L 3FQ2A 5DRXA 1XGPB 3BSZH 4AH2A 3O45A 3CDCA 5FO7A 2AJYL 4L1HA 2E47A 4D9QD 1HSAA 4QTHA 4X83A 3WG7B 5I5IA 3OKMA 3CFDB 4GKNB 3LRMA 3ARZA 3FRUA 3IJSB 3NIGB 4F7PA 1R5VB 1JSYA 4JY5H 1YMMB 1CQYA 3U6RA 5DD1L 5I17A 2JKWA 5F9OH 2N7BA 4DO5A 2Y22A 2JQZA 2F74A 3BP7B 3UBXG 4DUXA 3FUEA 4MHHI 1A5FL 5DD6B 4ZPVB 3QISA 5EZLA 4Z7NE 1NWPA 5D93B 4M8QA 2X1XR 2A83A 4AVIA 4UU9B 4J3OF 5SV3A 5F96H 1U6AH 2AKRB 2XTLA 4X6CA 5I19L 4W70A 1OB1B 1VA9A 3OHXA 1KJ2H 2CJSA 4LF3A 5DS8B 1SXSA 4Y2OB 5F89B 3KLQA 4JR9L 4UT6L 1P4IH 1R3KA 1JMZA 1F41A 3UZEA 4KZDH 4LEBA 3WIHH 2IV8A 3CSYB 3QDMD 3AM8C 1FNSH 1MVYA 2D4FA 5F88B 3LV3A 4FQXC 4WCYH 1OEZW 4X6DB 1F45A 2G3ZA 2EO1A 2NY4C 3MA9H 5HVGB 3C75A 3QCVL 4OZFG 3FU0A 4JZJC 1GHFH 1JWMB 2A38A 2QGBA 2ZUWA 1O5PA 4XHJC 2V3DA 4NKDB 4UZSA 1NC2D 1MHCB 3ZR5A 1GYVA 4URKA 4PS8A 4CSZA 5KG9B 2ZXCA 2BC4A 1OHQA 3LEVL 4XGZA 4K3EL 3OAWA 2QKIB 3IFLL 4CMHC 4IGBC 4HCRA 3W11D 1YYMH 2DTML 4U1SB 3JZYA 5M94B 1JGUH 5ADOL 3VU1A 2VZ3A 1CDUA 2NY6D 3A3YB 1D5IH 4IOIB 5HYJE 1IGYB 2EACA 4DESA 2WUBL 2AJZB 3QAZC 4XOCA 1IL1A 3GLEA 3BCDA 1WLHA 3FSVA 5TDOA 4B6ZA 4ALAL 1CLOL 4OZHA 1T03H 4H8HA 1KEGH 3DO4A 2P8MB 3MLXL 5C0CD 1Q72H 3V6OA 2QT6A 5E95B 4X98A 5CBAA 3VWJA 4Z7QF 4F92B 1MJ7L 3D7PA 3HE6C 5E23A 1XSIA 3QJHA 4ABWA 4N26A 5HY9B 3FO9A 3L2LA 4OSUL 1UXLA 4OZGF 1NMBH 2CDGB 1V27A 1JPGB 1FYTD 4W9EC 1QWNA 4XNMB 1W6LA 4BCXA 4M5YH 1AAJA 4H20L 5I1DA 4X9IA 5AOLA 3LDBC 2HFFA 1TVDA 5D70L 3H2WA 4TVUA 5F7BA 4M00A 3QI9D 3TEWA 5BV7C 4PR5B 2CRYA 4MSWA 1X9UA 2ZUSA 1RQ5A 2X5PA 1EMTL 3FO2A 4G9DA 2D3NA 2IC2A 5IHWA 2WBJD 1I3RA 4YDNA 2F53A 3BUTA 4WI7A 4CN1A 3HCVB 1CT8B 4Z7UF 4LRNH 4M7KL 3VXQB 2NDGA 4HT1L 1DBAL 1QA9B 1U8QA 1I1YB 2C1PA 4TM9A 5D7JC 4YWGL 5LCVH 5E7FA 3OLGA 1EO8L 3MMEA 4UV7H 5CFAA 4BWTA 2IANE 4QHNA 4LFHG 1MWOA 5HYJB 1UZ8B 4Y1AA 2ZPKL 4G6ML 4YGVA 4JQIA 3ROLA 5B3JE 3RWCA 1JI1A 4NZ8A 3EYSL 4ZSOE 5HHOA 3RVTD 4EE2A 2HVJA 2J1WA 4UTBA 1BM7A 1OW0C 2VR8A 5LXGH 3C8HA 1QSVA 1NBVL 3HNVH 3LNHA 3VFNA 4DP6X 2DWDA 3NZHL 1ZK5A 3KH3A 3NACL 4PJXE 4OZIE 2ATKB 1ZMYA 4MDJA 1HESA 1WA0X 1JJUA 2OCFD 3MRFA 1NSNH 3AQYA 3OAYH 3EJPA 4AIOA 3QUMH 4XVUD 3WEBA 1E4XI 2EIDA 2D7TH 4HMDA 4LLDA 5TDNA 4IKKA 5KSVA 4U3HA 4C56E 1E4JA 5FYKD 4Z3JA 1IM9B 1DEEB 1ZLDA 3FXIC 4UBDC 4BDVA 4LCIH 3QEGH 2R83A 5KVMC 2CUMA 2IADB 1UD5A 4UIMB 2FRGP 2QHLA 4UQ3A 5I1GH 1J05B 3E9UA 4HIHA 5GGVH 5FK9B 1PX8A 3QXUA 3R19A 2J8UE 4K23L 5CWSB 4M7LT 4DF9A 2APSA 3VWKA 3P73B 3QJXA 3EW3B 1IGIH 3WJMA 3BZEA 4KK9C 3P30H 3WNIA 1AYRA 3CVHB 4H8PA 4WF7A 3RNQA 3US0A 5TD4A 5T1MB 3NCBB 4Y16B 3SGJA 1FO0H 2VO5A 4M02A 5DJ6A 3V4PH 5IHLB 2AP2A 3P54A 3K71B 4H2CA 4JKPL 1FZJB 4H0IA 4LLUA 4I9WE 1BVNP 1IC5H 5C08E 3ARGD 5INDA 3LSOA 1JGLL 5DRXB 2E8YA 2R1XA 2MTAA 1J8SA 4AH2B 4OI8A 3H56A 5CO1A 2JK5A 3VSTA 3LMJH 4BFEA 1UA6H 2O5YL 4Y9CA 4OF0A 4QTHB 1IQWL 3T6VA 1QNIA 2VLME 1PY4A 2Y1ZA 3FRUB 2FSEA 4F7PB 3SJVA 3QZWG 2DBJA 3U6RB 1BXVA 1A9EB 1CDCA 1CUOA 1CXFA 4GUCA 2ZQKA 2FBOJ 1JK8A 1JDAA 2ZE0A 3NJVA 2LT9A 4PBDA 4DHLA 4BZ2H 2E0PA 4BJLA 2F74B 4CC4C 5B38G 2EDJA 1VZIA 4A39A 4J3TA 4K8RC 5EZLB 4G80B 2EDKA 2RMNA 5FUCE 3QYCA 5I6XC 3QEQD 3TL5A 4M8QB 4N2CA 5JUEH 4OZHE 2A83B 1ZANL 2A9AA 3FFDB 1P5UB 4XXWC 3BGFC 3ZQ9A 5ADPL 3MXWL 3ULUL 4LF3B 4HFWB 4C56B 1T1WA 3BJLA 3HZYB 2D2CC 2H3KA 3OKNA 4MLIA 4WTZG 4E9LA 5HGDB 1AGDB 5ANMA 4ZTEA 3OJMB 4MGXA 4CVZA 4S1SH 4HS3A 4K7PX 3L3HA 2WLKA 5CU9A 2J8UB 4U6XA 2VQTA 1KYUA 4MRBA 4JGUA 4HIQA 3LV3B 4MLSA 5C9JB 2IOOA 2VLJD 1BZDA 4W9DC 5MHSD 3QIBC 5L4IA 2XZZA 4DNLA 1F4YL 1YG9A 1RULH 3WKNA 5AB2A 4F2MA 4GG6F 4FJZA 2QSTA 2NY5L 2ZJSL 3IJYA 3L7EA 3B9VA 4JFPA 4WWOA 5DRWB 1N3NB 2L7UA 3ZDYE 1AIZA 5DHMC 2C9SA 4PJ8A 2BC4B 3HRZC 4NBYB 3BWAA 3JZ7A 4NZRH 1OWWA 1Z3GL 3RWGB 2DI8A 4HOXA 1BX2B 3LZPA 2Z31A 5T5FL 4GINA 3IDJA 4YH6A 4GXFA 2N1KA 1RKRA 2NY0D 1WJ3A 4Y4HC 1R5WA 3QZMA 1ETA1 3O8XC 4WFHE 3T0AA 2ENQA 1SN0A 4Y1AE 1YEDA 4PP2B 4QRQA 4S2SA 5AYUL 3V7AG 4OT1L 2EDHA 2I07A 4HX1B 3JWOC 4GRLD 4FTDA 4GSXA 4F5CE 5TDOB 3RGVA 4ATTA 4OZHB 2P7TB 1N10A 1EVUA 4YSQA 5JHLA 3C5JA 1WWCA 3CU1A 4QXVA 1QI4A 2O6CA 4X98B 2D73A 2IFFH 5CBAB 1JHKL 3VWJB 4CJ1A 2E9IA 1TJGH 2P46B 2P80A 4WY7H 3KEDA 1P1ZB 1XAKA 1DLFH 2CXKA 3FO9B 2PP9A 4P46D 3NDYE 2VDLL 5DFWH 3KWWA 4WW2A 3B1UA 4J2QA 1X5AA 1JTTA 1VSCA 1GGUA 3MV8E 5DLMH 4RNRA 5TE6L 3W0WA 5PAZA 2IXQA 3ENEA 1V10A 3OPZH 1AANA 2AQ2A 2DM3A 4MXQD 2DQUH 2D03H 2V17H 3V95A 1TOXA 5I1DB 1EX0A 3DOSA 3ARSA 1TQUA 4FQJH 2WB1A 3TS8A 4PMFA 4WSGA 5EO0B 4MSWB 1MCBA 3ZDYB 5I8CA 3HG2A 1DN2A 3FRPG 2DQDL 3FO2B 4G9DB 5D1ZD 5JA9A 3DJSA 5CNHA 1HNYA 1YEGL 4UZUA 1MSPA 5CP7A 2K1MA 3VU2A 2EXYC 5I6NA 1JRHH 2XY1A 2VDKB 5D6DA 5IB3B 4XO5A 2OSYA 1HSBA 2DYPA 2HA1A 4QHNB 1LDPL 4QXTA 5FUOH 4ZYKB 5J9PA 4A55A 1J0IA 1E4WH 3EYQD 4Y1AB 1HXMA 5IWLC 4YGVB 4WEBL 5KBDA 3ROLB 3RWCB 3QJFB 4IRSB 3O6LH 4AM0A 5HHOB 3F85A 2HVJB 2EABA 1PVHA 4FQQA 1CU4H 3L3IA 3ZL1A 1XEUA 5C0IA 4AZUA 2YIHA 3CFCH 3VFNB 3CN0A 1KB3A 3NYKA 1BYOA 3FB5A 2B5IB 2A9BA 4JREB 3RKDD 2K9FB 2C7UB 5F9WB 2DQ6A 1AC6A 3DXAD 3GI9L 1FFPB 4NLAA 3WJLA 4MJJA 4LLDB 4XO9A 4R3SA 2D31B 3FUNA 1B4TA 2NT0A 5HD8C 1UT2A 5KANG 1O7SA 4PJIA 1FVEB 1T20A 1QRND 2EYTA 4FYTA 4OUOA 4S1DC 4EZJA 1E5BA 1FVDB 5ANME 4XB7A 3S37L 4HIHB 2B1OA 3OKYA 3DJZA 3L9BA 3MV8B 4PUBL 4WWKD 5I9QB 1J12A 1UVQA 3RTQD 3ZTJG 3VWKB 3N9GH 1EAOA 3WJMB 3BZEB 1V3JA 2VXUL 3NSYA 3RNQB 4A7GF 3VQ1C 1A1OA 4DPRA 1DQKA 2ZYSA 5KUMA 2QGCA 3KYKH 4IS6A 1OAJA 3KZ8A 1PZUB 4B9FA 3IBOA 2KQMA 1QUNB 4WU5B 1SGKA 2YPLE 3HB3B 3ZDZE 5INDB 4JPVH 4P8QA 3TCXA 2B16A 2JK5B 4CSTA 1NGYB 3ZSTA 4AG4H 2BMKB 1KJ3H 2KUTA 4U6YB 2FQGA 3I3BA 1A6AB 4F57L 3CZEA 1FUNA 3SJVB 1DVFA 5AAWA 2EP6A 1Q9LA 3BDXA 3FSOA 2VTFA 2DIJA 3IGFA 4MQ7B 2ETWA 2Q8AH 3BVTA 1JK8B 2V0AA 2H1LM 5LN4A 1JI2A 4OBRA 1T1XA 2H0JA 4MCYA 1ANUA 2E7MA 4AVJA 5AVWB 5DJAA 5J0BA 5T33L 4FMKA 4P57A 3M46A 4KDTC 1FPTL 5IW3A 5IMOB 4BXVA 4FL4B 4B9ZA 5I30L 4K94H 3WUWA 5BO0D 1HCFX 3MLRL 2CK2A 1JCKA 1RPQA 2DIAA 1JD9A 1WH0A 2QVTA 3M86A 3Q3GB 4KRLB 1H5BC 1T1WB 3OKNB 3GS7A 4HGKC 5EIIG 4E0RA 4EPSA 4Z0XA 1EJ6A 5ANMB 4CVZB 1JIBA 2MCPH 3UIZA 4HS3B 3MJGX 2XWZA 4J6RL 4DN4H 3E8UL 1I8MA 2PW1B 3QJVB 1JTPA 5I1EH 4XB3A 4PGDA 3HZ3A 5GS3A 3MTRA 3NSXA 3BPLB 3B9KA 1A9BA 2AJ3B 4HISA 4LOUD 3FSWA 1EHLH 4F2MB 4PJ9A 5ACMA 5EEVA 3IJYB 4AENB 1I8KB 1JXGA 2FX9H 2RCSH 4JFPB 3V7MA 5TGBB 1WAEA 2YPLB 3J7HA 5GGRB 3C8KA 1NCTA 5KSBA 1SMOA 3IGAB 3RWDB 5IW6A 4PJ8B 1VZHA 5FECB 3PWPE 1NJ9A 3IWVA 3FB8A 1E9OA 2GFBB 2NY3C 3BWAB 3V5HA 5CGMA 4P59L 4QKTA 1X9LA 3ECWA 1MQKH 2Z31B 3IDJB 2CIIA 5FYKU 5D2NA 4L8DA 1Q1JH 5DC0A 2BW4A 3M17B 1R5WB 3FT9A 4U3XA 5HYSG 4PQXA 3KLKA 3QO0B 1DJGA 3ATFA 4YDVA 1YEDB 3QWQB 5D55A 2FGWL 5B21A 4S2SB 5EU7C 3NFSL 4EDWL 3G5WA 5CGBA 1FV1A 2I07B 2O72A 2Y7QB 1WFNA 3KEHA 4P2QD 3WY3A 4J3SA 4WEUD 1HS6A 4XX1E 3ZYOA 4GQPH 1ZLVH 2BSBA 1EJOL 5DK0A 5LB1A 3ZHNA 2ESVD 3RGVB 1JZ3A 2XCMC 1RIHL 4AKPA 4ZMVA 3X1BA 3GNML 4LESA 5DRZA 4Z3EA 3TA4D 1SRDA 4XCFH 4UTAA 1E4KA 4KXZH 3M1BA 3BMWA 4R90H 2EVJA 4OAWA 1NGZA 2V9UA 3WKML 2FT8A 4MJ4A 4PJIE 4Y19A 2FEDD 2XQBL 3Q0HA 4PIRF 4PJFF 3IVKA 4ZAKD 4IBLT 4HUWA 2E4TA 4WKZA 3MREA 4WW2B 4KQ4H 2QV4A 4RNRB 2IXQB 1F42A 4NQVA 2B59A 4RMBA 3GI8L 4YJZL 3HMXA 4Z9KB 2G9HA 4X5QA 4XH2A 4FN0A 3DOSB 2WNKA 1N0XL 2VDNB 3MCG1 3MRJB 4XPTL 1G5AA 1SXNA 5EC2A 3KCPA 4L5FL 4ODUA 4NOBA 5B1JC 3SSGA 2BOCA 3SYCA 3WE6A 3VTMA 2PO6D 1XAUA 3H9SD 2B7DT 4WK4B 2WQVA 3MRQA 5C0ND 4EO5A 2EIEA 5CP7B 2AK4A 4KQ0A 3UC2A 1EDQA 3HFMH 4GQZA 4M7LL 3H2PA 2FZ3A 5DVOA 2Q87A 2LVCA 4DP8X 4LVNC 5I18H 4DGVL 2HH0L 4YHPA 3OLDA 4QXTB 4Z0BH 5J9PB 4YDLC 1MFBH 3ARUA 4Q56A 2GVYA 3MUZ1 2I5YH 2X9ZA 1F56A 3NPSB 1RJZA 2DKSA 2VDML 5JOFB 4AM0B 2X1QA 4X4XA 1PW3A 3QQ9C 1SHMA 3LZQA 5HI4C 3WBDA 5FFLA 1BMGA 3TA3A 1Z5LA 5C0IB 5TDPA 5IMKA 3EAKA 1J9CT 3FB5B 5F7WC 4GUOA 5D7HA 3G7TA 1BM3H 4PJHF 1AKPA 1ZLWK 1SY6L 2A0LD 4CKVX 4PJDA 1OALA 2XN2A 4X2UA 5EIQA 1S5HA 4J3OD 4O00A 3PDGA 4LNVA 2JJSC 2E7BA 1W15A 4RSYA 4PJIB 1MW3A 1KLUA 1T20B 2DKUA 4H40A 4LEEA 4WFEE 5KZCB 4OI7A 3NH7H 2O5NA 1PIGA 2YXWA 1Z3RA 1OP5K 5C6PB 1YECL 1KCLA 1UVQB 1UGKA 3NJIA 3EH2A 1OTSD 4ODVL 1REIA 2ADGA 3FTWA 1QASA 3CXHK 3HHSA 3SDCC 1A5FH 1KXVC 3MRIB 1A1OB 4WTXA 2OP4L 4JFOA 1YZZA 3G9VA 2BH0A 3K5SA 4LQFL 4XCCL 5I19H 1HHGB 4RMVA 1TU2A 1QSED 3L3DA 2EE2A 1JPTL 1LP9F 2VMCA 1RJLB 4TVPL 2ALWA 5SWSE 1YJDH 4LP8A 3B6SB 2I69A 2X4UA 3C5ZC 3IJHA 4MCNA 1A8JH 2YAHA 4QRFA 3DO3A 4NUJB 3GC3A 3RWIB 3D25A 4OKVA 2DIBA 2EADA 2IH3A 4L9DA 5KBLA 2ZUQC 3LX9A 3HBPA 2VR6A 2GUOA 1FZMB 1E42A 2NT1A 3HVNA 4P05A 2VM3A 4ZZKA 4MCYB 1E3XA 3PCYA 5DJAB 2YJLA 4P57B 3F5WA 4QGTA 5HGAA 2IQ9L 3ULVE 2VMDA 1Y07A 1ZT4A 4OV5A 3WUWB 3DSFH 1G9ML 1MIML 2Q76A 3QARA 2HPTA 1DFBL 3D39E 1U41A 1KSRA 3LEVH 4K3EH 1LEIA 3U6XS 1RJYB 3E8VA 3SGDI 1SMAA 2W0LA 1I3UA 3AB0C 5T5NG 5ADOH 4POZC 4Z0XB 3RJQB 4F9LC 3PWNB 5C0JB 1ODUA 5TJWK 3O6MH 2AFNA 4G9FE 2MWCA 1I8MB 2IALA 3TVMD 4KNUA 4WWID 5FYKL 4DEPB 4Z76B 3IFPA 4IKNA 4PGDB 5CBEB 4LMQE 4MCZB 1I8AA 1IBDA 1A9BB 5C0DA 1CBVH 3C12A 5IKCA 4BE6A 2OMBA 1CLOH 3CFBB 4H8WC 1LQBC 1KCSL 3GRGA 4PJ9B 1ACZA 3D3VD 3T2NL 2LGNA 1I1AD 4AY0A 1NOFA 1RPKA 3MLXH 4N85A 4Y7MA 3MUJA 5KSBB 3CZGA 3ARFA 3KXFD 4RRPG 5SWSB 3UX9B 2BOBA 3NQIA 5IW6B 3TBTA 1SYVA 4MRCA 2LQRA 4NKMA 5IVXA 1XF2B 2Q9OA 4Q89A 1E9OB 3I02A 3V5HB 1JZ6A 1JTOA 4TKWA 4Z7WA 1JE6A 2VDQH 3C6LC 4PJCF 1FFOA 5D2NB 4L8DB 1U3HA 1X9RA 3UTTA 2WLZA 3EADA 1XSOA 4YDVB 4RLDA 2P8LA 1TLMA 5HDQH 3SD5A 1ZGLM 1FV1B 3MRDB 4OCYH 1XGUA 1JGVL 3GZOA 4KO7A 3GPSA 4FFYA 4DP0X 3MRMA 5GRZA 4OGAD 1WK0A 4LIQL 4UIKL 1EMTH 3QE5A 43C9A 2FJGA 1UD2A 3GSXB 4XMUA 2CAKA 5A7EA 4DK5A 5DRZB 1QEWA 1SJHA 3ESNA 5I8OL 4M7KH 2F1BA 3T4AC 2HT3C 3EBIA 5KSUA 1EQWA 3TEUA 1DBAH 3M1BB 1EXGA 4F2FA 4OAWB 2ZX5A 1NGZB 1EO8H 4I1PA 1NAMA 1HQRA 4Y19B 4G9FB 3ZRCC 1N5AA 4FHBD 1IGFH 2QQLL 4G6MH 5F7YC 1OD7A 4HUWB 4V1DE 4WRLA 2BSTA 1GIGL 2ILLA 4MS6A 4MZIA 5KN5B 3L4UA 4I3RL 1J5DA 1VERA 1ZIBA 2B59B 3D9AL 3II2A 4NQVB 2VN6A 4XH2B 4ZQKA 2DEYX 4I5BA 4GUPB 1K6QL 3DMMD 4GSQA 2R8SL 4PWIA 2VDPL 5EC2B 4ZT1A 4CBPA 4GLRH 4ODUB 2QPEB 5JZ7C 1BOGB 1M7DA 1IGMH 4YSOA 5ID1B 3VSQA 3GKZA 4ONHA 4XXCC 2TSAA 3D69A 2DM7A 3NIGF 2AK4B 2VXQA 3GSUA 4WO4D 2FZ3B 3KYOA 3NCJL 1MRFL 3IU3A 1XBDA 4HJ0D 2ZP0T 3PNWA 2EDNA 4NDMB 1VIWA 2EEBA 1OAQL 1FL5A 4K23H 3VG0L 1ACXA 1OTUC 2LU7A 2TRYA 3MFGB 4JCWA 4Q2ZA 3PG2A 4PW4A 5EOTA 5F3BB 3AM8A 4TVSa 1G84A 1RJZB 3K7UA 4FQXA 4L3ED 1S7XA 4X4XB 2ADJA 3TFKD 3TA3B 1Z5LB 4N2NA 5J6GA 3HNSL 5IMKB 3N42B 3FAXA 4JZJA 3ZKNC 4KKRA 4JKPH 2L3BA 5DLLA 1UZ6F 3G6JE 3MJ8A 5C7ZA 2UYLA 3CZKA 1JGLH 1G9EA 1U93A 4BGDA 1PZ5B 3GBEA 2BSEA 3PHSA 5SWQA 3O2WL 4PJDB 5JQ6H 3POCA 2O5YH 1S5HB 3ZE0F 1BCIA 2R69L 4WI3A 4X6DF 1Z32X 3EYVA 4IGBA 1C7TA 3GLZA 2RFXA 3NSCA 4KKBD 5L9DH 4IDLA 4C55A 2X7LB 4HXBL 5DEZA 1QFWI 1QQDB 2HT2C 4PY7A 1NPUA 4L1DA 2NSQA 4ZD3L 4IBSA 3TIEA 4X7DC 1AO7E 1S7RA 15C8L 2OTPA 3HHSB 1NMAH 1RZ8A 1ZANH 3DGCR 4JFOB 1RMFL 2CKBA 5ADPH 3MXWH 3PFQA 3ULUH 3D34A 1TU2B 4OFYD 5C2BH 3QNFA 3L3DB 4KNTA 4NUQA 5EA0L 2GBTA 3QUZC 4CSSA 5C8JB 4ZUWA 2BNQE 1BLNB 4KGLA 1AG0A 1QBMH 1M2VA 2ZXEB 2X4UB 3IJHB 4HFUH 4Z7WE 3HE6A 4MHHG 3D25B 3GXUB 4LE8A 3HR5B 5J11C 3LKQB 4JFFE 4JFUA 4MASA 3RVUD 1BMWA 1RIUL 2CU9A 2GUOB 4XZ4A 2EVGA 1K85A 4G6AD 1F4YH 4NBZB 1E3ZA 2ZJSH 2NY5H 3OAZH 3FT4A 2DWEA 2R23B 3S5ZA 1UHVA 1GH7A 5HGAB 3F5WB 3FQUA 4LP5A 2BNRA 3WJJC 2Y7LA 3BKYL 1ES0A 4XPFL 4OV5B 1JGDA 5D9SB 4HJGA 5C3TA 2CJTA 1UG9A 4UNUA 4L4VE 1XF5A 1IBHA 5T5FH 4OCXL 1WHOA 3FFCD 3K2IA 5D7JA 2QKSA 4R2GB 2XTJE 3GZKA 2NNAB 2Q3ZA 2DQJL 2XWTB 4LSDA 4XNBA 5TPWH 4AIEA 4PRIA 3IFPB 3IGKA 4OT1H 3VXUE 3OC5A 4M1CC 4TOYL 1AO7B 3MNZB 4KUZL 2GAZB 3MCLL 3P3YA 4IW4C 4PTTA 5IKCB 2R0ZL 4L8SC 3INOA 4I3GA 1OW0A 4FNUA 4DFHA 4JHAL 2HFTA 3K1DA 4LASL 4AE1A 3T4YB 5LGHL 4BINA 3HE7D 2NZ9D 5F6HJ 4WJ5B 4E41D 3ARFB 3V4VL 2AMUA 1IGCL 2BOBB 1IGJA 3I74A 4NKMB 4GBXD 1J48A 1U58B 3IFOB 3SDAC 3ZUNC 3WS6C 5IVXB 3SE4C 1SQMA 3DOIA 1PAZA 4Z7WB 2XWBB 3DX1A 1U92A 5DZNA 5T5NF 3D06A 1FFOB 4JFFB 5HJGA 4U05A 2VDLH 3BKML 3UTTB 4RZCA 4BA0A 4ABUA 5TE6H 2VSKB 1SBSL 3OMZA 1I3GL 1CFBA 3TURA 1OLZA 1FDLL 3TESA 3RL2A 1FHNA 1OE1A 3VD3A 4OGYL 3H2QA 1MRCL 1ASPA 2F54A 4KITB 3WTXA 1R4XA 4PSRA 2IPTH 1TQBC 3MRPA 1UD6A 3DJRA 3WNJA 2DQDH 5ID0B 1IFGA 2NY2D 2FJGB 43C9B 2Z4QA 3FH8A 3MC0A 4TUJA 4ZODA 2KBGA 4G6KL 1YEGH 5EFIA 3MRKB 4GQ9H 1QEWB 1SJHB 2E3VA 4FQ1H 3PGDA 4HKZA 3KLHC 5KSUB 3R0NA 3SKJL 5AD0B 3TV8A 3VMNA 4JFED 2WBXA 3FTZA 3LTVA 2M1KA 2ORBL 4JE4B 5ALBL 1NAMB 1LDPH 1HQRB 3BC9A 1XR9A 5DYOA 4WEBH 3RWHA 1KGCE 3B83A 1RZ7L 1HTYA 1JHTA 2Y1VA 2P47B 4Y2DD 5A2JH 4IBYA 5J56B 1B0GA 4LFHD 3TX4A 4ZQKB 3OKOA 1NDGA 2EC8A 4I5BB 4KWUA 3SDXA 1UEMA 1X7TA 2B2XL 1GPOH 1W0WA 2CDEB 1M7DB 5BUGA 2FLRT 4XXWA 1B2YA 1S7TB 1NH6A 4ONHB 5C71A 1BD2D 3D69B 3HW7A 2LU4A 2CLRB 2DS4A 3IDGB 4HVBA 5B3JF 3GSUB 4X4ME 5J3HD 2N7AA 3HHRB 1JPEA 3IU3B 4RBPK 4D3CL 1ZHKB 1PFCA 2DI9A 3PNWB 3S37H 1DDHA 2L4OA 2OYMA 1ORQB 2VKXA 2GCYA 4PUBH 2P8PA 1KPVB 4Q2ZB 2EE0A 3QUYB 2VRAA 3G5VA 1YDPB 2AGJH 2VXUH 1QX1A 1S7XB 5KOMC 4YSPA 2ADJB 3O3BA 4O2FB 3CIAA 4X6CF 2GBAA 4UMSA 3T04D 3QIBA 3QAQA 3GMLA 4NZTH 3N04A 5J6GB 1YNKH 1A7QL 3EGDA 3NZSA 5AWNH 2V2TB 1X6NA 2QL1A 3GSOA 4E9QA 4PP1D 3F64A 5IEHB 3TU6A 1CMOA 2UYLB 4HEMA 2ODIA 3RVVC 4DK6A 5CMAA 5CD3A 4WGKA 3WHXA 2D3JA 2Y69B 2UWEA 1XXDC 3HRZA 1RUAL 2OYLA 3EYVB 4IK6A 4IGBB 1QSFD 2QELA 4F57H 4YFLF 2V2XA 1GY2A 2J2ZA 1MAKA 3LH2H 4NWUL 1WP6A 1HOCA 3EJYC 4Y4HA 3IGLA 2XN9E 3EYFA 4ZX3A 3O8XA 1KNOA 1J9TA 4PRIE 3WTUA 5FGRA 3T09A 5GS0L 2VB5A 5DVPA 2D8KA 1S7RB 2V7NA 4U49A 3QAZB 5D7KE 3S97C 1FPTH 1RK7A 4OGZA 4Q97A 4YDKH 4R9HA 1KTLA 5KYWA 1TTRA 2CKBB 7FABL 2FATH 4ZUUB 1GL4B 5FO8A 1OGPA 4JFDD 4Y5XC 3MLRH 4G7QB 5AYTA 2GC7C 4QRSB 5FO2A 2GTWB 1XH2A 4ZUWB 2H3NA 1M2VB 2UZXA 3KS0H 4KGJA 1ZHNA 4MQSB 4KKZA 2V33A 4J6RH 5HP5A 1PLGH 4EN3B 1XD0A 1A4CA 4RGNE 1CFVL 2DLFH 1XDTT 2W9DL 3HC2A 3LHAA 1RZPA 3BQUD 4OZHF 4AYID 5F7MC 4PJEE 3DETC 4B41A 2OJZL 4GAAA 3WNOA 5I0ZA 3IF1A 4LVEA 3LDBB 4MNQA 1OSPL 2C4FU 1NLDL 1GGCL 3VFUA 1KMGA 1MY5A 3FQUB 3MNDA 4R4FL 4FULA 1JGDB 3IXAB 5ABAA 4HJGB 1IC1A 4KK5C 4DZBB 3HG0A 4QTFA 4FKHA 1HZLA 1N2RA 1E8ZA 2EDQA 2EVFA 5J6HB 1KY7A 2EIKB 3P4LA 4BYHA 3JWNE 1C5DA 2F1EA 3QHTC 4JRYE 3UZQA 2BS9A 4Y0GA 4JLRA 1ZLUH 3HPLA 1KLGA 4AOFA 4QKXB 3DUHA 2AJUH 4N6RA 2ADYA 2XN9B 3CBKB 1BIIA 3TO4D 4OLEA 2FGWH 4PRIB 1BOYA 3P40A 2HJKA 5IWLA 3MUGB 1BQ5A 4NQED 4HUMB 2WQUA 1XTLA 2ED8A 2C26A 1DCEA 1RIHH 3W56A 5BNXD 2VXTH 3GNMH 3HLAA 3INUH 3WDJA 4LB8A 4HIJA 2GB2A 3KVDD 4BQ6A 4EZMA 2V5YA 3WKMH 1VFOA 2MH4A 5ANHA 2W95A 1Q9OA 1ZLEA 1OOAA 4RZCB 1TCRB 5KTEL 1E4XL 1R3IH 2I25N 3B43A 3LEXA 3RL2B 4PGBA 3MBXL 1T5WA 3HG5A 1CGSL 1EVTC 2K3TA 1N0XH 2YPVL 2Z93A 3Q13A 4JO2L 1X7QA 4XPTH 3REWB 1ZWIA 3M7OA 1HYSC 2UXTA 4NNXA 5EFIB 4GFXA 4JY6A 4RVBA 5CEYA 4KHTH 5BS0A 5D4HA 3DUUA 4HKZB 4AQ1B 2JLLA 2V5MA 4Z95L 1AJ7L 3P0GB 1DLHA 4JRYB 4DGVH 1ZLSL 5ACZA 2Y5QA 1CS6A 1XCQA 2HH0H 4OH2A 4PI2A 3EGXA 3G6AA 1XR9B 2MOVA 3RWHB 5IMMB 1IO4C 1U21A 2WK2A 4RAVA 5E9DD 3WUWG 4BELD 1NLBL 2MRYA 1UQSA 1JHTB 1OP4A 4PRHE 4AQZA 4RAHA 1B0GB 2ROXA 4HZ1A 4DVBA 5JW4Q 1NDGB 2E7HA 4FFZH 3QXVA 1OE3A 2VITB 3ME0A 3EOTH 3OG4B 1W0WB 2G5RA 4KDTA 4JB9L 4I0PD 1SY6H 1XR8B 2A73A 3FOMA 2NY7H 4H0GA 4NPJA 4BWWA 3BGFB 4QRTB 5HDBB 1KBBA 2YMOA 4X80H 2HWZH 2P5WE 5B7MA 1USQA 3FUJA 1H5BA 4P5TD 4AIZB 4GT7A 2P3YA 1DDHB 2KHAA 1FVCA 2YA2A 3JTTA 3MJ6A 1E6OH 4X8GA 3JV6A 1T4KA 4AVHA 1AQKL 5HGBA 5I73C 1M71A 4XCNB 3G5VB 1OZUA 1T7VA 3EBAA 4ODVH 4R7NA 5EBMA 1PX4A 3MRLA 3MUY1 3CXHJ 2X70A 4RFEB 2H32B 1UKSA 5JIKA 2FYVA 2OP4H 3QIBB 3GMLB 4P2RD 3RWJA 1AZBA 3EGDB 2YN3A 2UY6B 4MNQE 4U3SA 3ZKSD 4XCCH 2VWEE 1JG9A 2Y1YA 3S2CA 2V8MA 3RPIA 1XGRB 5JHBA 4XPAL 2PP7A 4HC1H 1JPTH 5FXCH 2VLLA 4TVPH 1DQJB 2CHWA 5I66A 5LBVA 4HUVA 3MTXA 5CMAB 4JFHE 1ACCA 2G75A 3WHXB 3ZKMC 2UWEB 3QRFM 1A3RL 1KF9B 3JYBA 3HRZB 5SX4H 2CXGA 4E2OA 3BN9D 4ENZA 3D0VA 2RQ8A 3BGMA 3CVDA 3I75A 4C4KT 3L4VA 5IQLA 2V2XB 2IDTA 3NG5A 4XE5B 35C8H 4JDEA 4HKBA 3N1GC 4LRIC 2WANA 2MCG1 4G42A 3G5ZA 1B3JA 4KKLD 3S88L 3O8XB 4G1MB 4NNYB 8PAZA 3GFUA 1KNOB 3MRHA 4PRHB 2Z92A 4RDBA 1FWXA 4UUJA 4JPIB 2PYEE 5BZZA 2B77A 5AYQA 5CF3A 4Y5YC 2V7NB 1DZ0A 4KJPD 1U8NA 2NUTA 1W16A 1KTLB 3U1PA 5I6MA 1G9MH 1YNTA 5E2UL 1MIMH 5JHDA 5E2JA 5L2KA 1DFBH 4B3VA 3AWEA 1KEML 2QSQA 3UCQA 2QVFB 4OD1L 2CDFA 3QNZA 4CU6A 1B0RB 3SCMD 2G3NA 1XH1A 2P5WB 3U4KA 2X05A 1Y1UA 4QMEA 2UZXB 1EBAA 3LRSA 1UACL 2EE3A 4FJ6A 3TBCA 3N6YA 5FYKH 5KAQG 4RX4D 1CZ8L 2DYRB 4XNAA 2XA8L 3AWGA 5EF2A 1AGFA 3QFJA 4V11A 3QIWD 1ML0A 2OZ4A 1KCSH 4KMTL 4MNQB 3T2NH 3VFUB 3PL6C 2G2RA 3U7YH 2EUWA 3UL4A 5DJ2A 1LMIA 3FCUB 4FQLH 5B1JA 1EGJA 1F6LL 5ETUA 1N2RB 2X6BA 4KHXL 3CSPA 4NC1C 4WW2F 1TTUA 5I0DA 4S1RL 4ZFFA 4HHAA 4LLWA 5DMGD 4NO0D 4PV9A 5AVVB 3UGXA 1IEAA 3O6FD 3WLBB 4JLRB 3HPLB 1KLGB 4JFQA 4N6RB 4MNGE 3DV4A 1IV8A 1CF8L 5FHBL 5GGRY 4ZS7H 2K70A 2ZG1A 1N64H 2HJKB 1E2ZA 1YSOA 1YEIL 2VZSA 4IBVA 1IAMA 2PYEB 1KV3A 4KXDA 4P2OC 5FGSA 4LSRH 5JHMA 1OGAE 2EECA 2YBRB 3MO1A 1A6UL 4LIQH 5FDWB 1YN6B 3KHOA 5D71L 2KQNA 4UIKH 5I8KL 3H4FA 3CIQA 1UD8A 4X7SL 1CPUA 2A6IA 4JW3A 4M62L 5T1LA 4KY1H 3VD7A 3HZKA 5CCHE 3ZUCA 4TF4A 1N6QH 5AKTA 4F91B 4C47A 4HIJB 3CFIC 1IM3D 2OMVA 4HQQH 1OCZB 1OT2A 4XP9H 4ATWA 3G6DL 3QUXC 1A0QH 4E42A 2JJSA 3SB3A 2JKLA 1F90H 2QQLH 4C4KO 2NX5A 5BUPA 3BX7C 3GMNA 4ZXBB 3NGBC 4V2CB 5KWYC 4KI5F 4TSCL 1GIGH 1NL0H 4WI8A 43CAB 3VJ6B 1FBIL 2WZ5A 3D9AH 3SYQA 3IBEA 3KM1A 1K3IA 3LEXB 1J8HA 3JT0A 3P3RA 4PGBB 3OGCA 5ABZA 4FFWC 5IEKA 5KVDL 2BPBA 4NI3A 4TRPH 3UYRL 1IKOP 4G7VH 4I13B 4NAMA 3WFDH 2R8SH 1QOKA 4HF5L 1X7QB 3SDCA 1KXVA 4A2MA 1ICTA 4GFTB 4TTDC 2OCCB 4OB5L 2CMRL 3OX8B 3CN3A 1EFXA 1ZWIB 4PJIF 2VUKA 3STZB 4BFJA 1A8ZA 3IKKA 4JY6B 3UEQA 3MNVA 5CEYB 2YEZA 4U3CA 5LWYH 1PBYA 3IE9A 3NCJH 3FBQA 3L6FA 2IGLA 3ULVL 4B95C 3DGDA 4OCMC 3BE1L 3C5ZA 4CGTA 1OAQH 1MREL 2IPKA 2EXWD 3EGXB 3VG0H 3U36A 4GPVA 1SYSA 2Z4TA 4RAVB 3T3PE 4JGNA 1BYPA 1UQSB 1WBXA 3QH3B 1MNUL 2Z65C 4NB7A 1KOAA 5DMJB 2H1PL 1OGAB 1R3HA 4HETA 4L3AA 4ZW5A 1T66C 2WCGA 5KVFE 4UILL 4DVBB 5C0RH 2XKNB 2FQEA 3B5GA 2ZWZA 4QF1A 3ME0B 3MR9A 2VAJA 4QRPE 3CHXA 1P5VA 3PWVA 1KJVB 4IRJC 3OKLB 2WINB 4FKKA 1DVXA 5L2KE 4G59C 3BFOA 4HKXA 2OI9C 4FFTA 1H5BB 4OJFL 1E0OB 4ZMXA 5JYLA 4HK3N 3VXMD 3QWOA 5SWZA 1Z2KA 3PGCA 4NN7C 1FVCB 1SJMA 1KC5L 1U8JA 3JTTB 1NUFA 3JV6B 1T4KB 4HXBH 4Q9CA 4IBZA 1M71B 1QLRA 3D2TA 3K0WA 4ZD3H 1IJNA 3FU5A 4FNQA 2R1WB 3DA0A 15C8H 3QFJE 3IWUA 2WKLA 5T3XD 2ATAA 3EYOB 3VAEA 1NCHA 1JYNA 5DO8A 3WL9A 1BW8A 2VLRA 4U3SB 4N90D 1TEFA 2DMCA 3OF6A 2A9ML 3QIUC 2Q2LA 5EA0H 5I66B 3MODL 3B8SA 1JZEA 2JV6A 2G75B 2QPSA 3CLEL 4JFSA 5HHNB 3VXSA 4JDTL 1LM8V 3L5WA 1LWRA 4DEUA 1J1XH 4HGMA 3D0VB 1W72A 4ZJ9A 3C6LA 4FHJA 1YEKH 4P2CG 1KN4L 1RIUH 3W38A 4HKBB 4WHYH 3T3PB 4FTVA 4Y4FC 3ZBMA 4G42B 3G5ZB 5F9JA 2B15A 1NFDA 5DC9B 1XH3A 4DGIL 4YPGA 1LK3L 3VM7A 3AT8A 3FUKA 3ASWA 2VQ1A 4UUJB 1KG0A 5HVHB 5KSBF 3VXRD 1N70A 5AVYB 1WAAA 2ALAA 1E40A 1SDDB 2NUTB 3BKYH 2C1OA 2Z8RA 1YEJL 1YNTB 3RPKA 5JHDB 3SKNA 4IU2A 3DUSB 1MELA 2CDFB 2Z7UA 3QNZB 4BZYA 3BXNA 1KWKA 3Q5OA 1B6UA 4J3UA 1ECYA 3QCUL 3ZXAC 1PTZA 1LWHA 5HYJD 2XFGB 4KKAC 2ZKHL 4D8PB 1ZVYA 3BPNC 2BVEA 3TH4T 3AADB 4XMWA 4ZNEA 1OWRM 1AGFB 2CLVA 3QFJB 1F6FB 3L48A 4KUZH 3MCLH 4NBXB 2ZCHL 2R0ZH 5JXED 3IPEA 5FYJE 2FUQA 3U30B 1MJ8H 4JHAH 4Z77A 4PYHA 4ALAC 2G2RB 1LO0L 4FA8A 4LASH 3F8UB 1HIMH 2V5SA 1G6RL 3BIBX 1VAHA 1Q0EA 1CLZL 5AOJA 3V4VH 1IGCH 1CDGA 4CNIA 2WLHA 1PLAA 3SIKA 1Y1DA 4XXCA 3ZKXB 5DVNA 1XWVA 1MAJA 4HHAB 4Q9QL 3QQ4A 5KYXB 4LVNB 1IEAB 3H3KA 1VLXA 2BZ7A 3C09C 5EOCL 3UTZA 3BKMH 4XMPL 4K71C 3KPQA 5BZWB 1P84K 1SBSH 1MHHA 1NOLA 2VC2B 2WSKA 1J87A 1EFQA 2X9YA 5DMKB 4RISH 5KAQF 1R0AH 3CX5K 2W94A 4OGYH 1MRCH 1NC2A 2ITEA 3MO1B 1UOVA 4Y16D 2FE0A 2OMNA 2YMXL 3MAWA 1JPST 2BVOA 4QTIL 1FNGA 2F15A 4WWNA 1AZZC 3LZLA 1TSHA 4G6KH 4N2BA 2AV7B 3NJMA 2AERT 3B3IB 3HZKB 2GHZA 1Q4NX 2DD8H 2H45A 4HIXL 5LLIC 3SKJH 1U9KA 3AG2B 3BH4A 3GXNA 2OMVB 1F3RB 3BSZA 1SBBA 5ALBH 5D72L 4E42B 5EU3A 2LLNA 3QNYA 3EDKA 2V7HA 5I1KL 4DP2X 4BUHA 4JO5A 4PJ6A 1Q8MA 3N42F 3POHA 4LSPL 1RZ7H 1KULA 4NHUA 1QNZL 1YYCA 5B4MC 5E6IC 2C9VA 4N0CC 4EJ1C 5IEKB 3S34L 1MCNA 3VTAA 2FD6L 4PJDF 3AABA 4OD3H 2B2XH 4MZ3A 4XC1L 3NRQA 4HLEA 5ICZA 1ADQA 1EFXB 4JO1L 3UAJC 1F00I 4LCCC 4C56D 1OANA 3VRLE 2HRPL 2YEZB 1JUFB 3D09A 4FG6D 3QUZA 3BEVA 4LNRA 3L6FB 1U8OB 4D3CH 2AQ3A 4JO3L 5E1AA 3ECBB 5C6WH 2OR7A 3C5ZB 3BJ91 5E1IA 2PABA 4H1LH 5AVTB 2IPKB 3B2UC 4ETQA 3APDA 3U36B 2NYYD 1PZ3A 2Z91B 3WTYA 5LGJB 1WBXB 1QBLL 1ZXQA 1KGIA 2XPGA 3WFZA 5CR8A 2P48B 3EFFB 1R3HB 4F9PC 1GC1L 1BVLB 3V0VA 1ID5I 2VDRB 2OW7A 3FONB 1A7QH 3AFLA 4KQ3L 4JPSA 2JQMA 3QXWA 3RE0A 1CE6A 4TS6A 1W6WA 3MR9B 3WJJA 1P5VB 3HI6H 3PWVB 1CXEA 4F8PA 4ACPA 4JKKA 3FB7B 1IBYA 3G04A 3HKFA 4J1UB 4JMNA 3MLSL 1RUAH 1X7SA 1G1CA 3RDJA 3ILQD 3BUBA 4E9TA 3AB0B 1LO2L 5F97E 3KPSE 4J12A 1MCCA 3TYFA 1OV8A 2EDTA 2ZONA 3AAZB 3PGCB 4NUMA 4FQCL 1SDYA 1BWWA 5KJ4A 1PZCA 4QHLB 4J5VA 5GS0H 1BXUA 3KMDA 4ZFGL 4N5ED 5GGTL 5JORB 2XLLA 4R4BB 4CKQA 3LN4A 3LHPL 1RJCA 4L8SA 3WL9B 7FABH 2VLRB 3AY4C 3CN2A 1A9VA 2P9RA 3DSNA 2NZIA 1E8XA 4RWYH 2GJJA 5FGCE 3FQ1A 3WNNA 3VWJD 2XV3A 4JKMA 4IBQA 2PNDA 3BP5B 4JY4B 1NQBA 3I6LE 4AITA 4NO5A 3SDAA 3WS6A 4U1NA 3SE4A 3NABH 3PJLA 4JHWL 2H2PC 2GJRA 1BMZA 1AGEB 3C6LB 2WCPA 3HG1E 1HL5A 3UTQA 1PJ9A 3F58L 1CFVH 1YY8B 4P9MH 2CCLA 4FTVB 2AQRA 5F9JB 2W38A 4G8AC 3FQYA 4R5XA 3JVFC 2OJZH 4GIPD 3MRBA 2W8CA 3CZJA 5L6YL 1GGCH 1MWAL 5BOZG 2R0WH 5IVXF 2NY5C 3BAIA 2C1OB 4HWNA 1GCFA 3D4GA 4HBCL 5DHVH 1X4ZA 1PG7L 2JSFA 2PWFA 4Z7WF 3T1WA 3U6XA 2F53D 4IU2B 1XGQB 2CLZB 3GUTB 4PRPE 2E76C 4L8BA 4ZMLA 3BXNB 1URLA 4OF5A 2M2DA 3KBFA 5K9JL 4IRZH 3T4AB 5I1AB 1WFTA 4Q7DA 2WWOA 3DO7A 4MCMA 3D87B 4Y1AD 4J3OH 1AXSA 5I1LA 1OO2A 4W1TA 3U4BH 1E8YA 1CWVA 4IJ3C 5HHOD 4LQ1A 2F19L 2BDNH 3AGVA 4O02L 4LPWA 3FU7A 5KSVB 1QPXA 3HBQA 3UJIH 1Z9PA 2ISDA 2P5EE 2A6JB 3OV6A 4H8VA 4NPYB 1KYOK 2OYKA 1DE4A 3MXVL 1FCCA 3HNTL 3OR7A 1G7MA 4CNIB 5D1QC 5JPNC 2MQCA 4LDLB 4MD5B 1DJSA 1IAOA 2UUDH 3MJ7A 3QUMA 3QQ4B 3FUDA 5GRVL 5C0BA 3MJ9H 2CH8A 3HG1B 4LSQL 4JFYA 5AOIA 4OFKA 3KPQB 4ICXA 3VWKD 1MHHB 5ITFA 1RD6A 5H94A 1A25A 2RR3A 1NWOA 2QFRA 1CGSH 3MUHL 4WNSA 2YPVH 2W07A 4JO2H 1A22B 4P9HL 1G94A 2FH6A 2LLLA 2O1AA 2YD6A 1FNGB 1ZY9A 1DUYA 5HHXL 3HB3D 4HWBL 1ZV5A 2AANA 4PG9A 3L5JA 1KIUA 1MXDA 4PRPB 2J4WL 2BCKA 4GW5B 1BXAA 2MHAB 4JPWL 1I9RH 3KNBA 4QWWC 2WOYA 4BCZA 4Z95H 1AJ7H 1H6EA 4N20A 1FC2D 3A4EA 1PYWA 4I87A 1PZSA 5I1IH 2VZOA 5EU3B 1WWBX 3DURA 3QNYB 3SJVD 4DT2A 3TGXA 3VD9A 4DQOH 5A2CA 4W9ZA 5DWUH 5TK4A 4FP8L 1JZ4A 2B1HL 4AYMC 2BCMA 4MVBD 1WA1X 3ECQA 4WUUE 2P1YA 3MRNA 4KOBA 4GMTL 3LXBA 2EDRA 1E2VA 4W9GC 5I1CH 3QK0A 3W1ZA 1V05A 2P5EB 3VVVA 4PCTA 4JB9H 1HKLL 5TH2A 1YY9D 5ICZB 5F1IA 3QRBA 4KOCA 1OPOA 1U95B 1ZS8B 5D2LA 5IJVA 5F70A 2XZCH 4G6JL 3OLIA 3WGVB 1Z0MA 1X5IA 4LBEA 5ISZA 3QUZB 3RHWK 5D96C 1WT5C 3IJEB 5DEGA 3I84A 3FQXA 5E1AB 2DM2A 4ZX4A 1I82A 4HJ1A 4TQEL 3AQDA 3Q6FA 1DBKL 1JRHI 4YHLL 3WN5C 4AI7A 3T0WA 1A1MA 1GYWA 4M8UA 4M6NL 1GRWA 2RAMA 4M7JL 1RAMA 2WWMC 2WVVA 4FNLL 3A23A 2IDQA 3V0VB 3QYMA 3QR1A 5DJ8A 4CGUB 4OM0L 1SOSA 3OJVC 1E5YA 3ZTNH 2ICEC 2YPLD 3MA7A 3VXPA 5IB4B 4XPAH 3MOAL 3N2JA 4PJ8D 3BAEL 4Q9BA 3G04B 1DQMH 3N85L 3DARA 1IEBA 2BO0A 3DECA 2Z31D 5DO2D 3ALWA 4DGWC 3QWRD 1JFQH 2B4CL 2PYFB 3KYMA 3GB7A 3ARYA 3QB7C 3MLZL 4UTCA 3TYFB 3DHUA 3S88H 4KK8D 1EANA 2XETA 3TEZA 5A2AA 1M05A 2JKNA 2AXWA 1E5ZA 3SYAA 1ILUA 3T3ME 4WZ9A 3D2UB 2EKJA 2A6DA 4A6YA 3LN4B 3RGVD 2WV3A 3VGBA 2PPAA 4E5XA 3NCXA 2VCOA 4L8SB 5E2UH 3BLBA 4PWKA 3HS8A 3LXAA 3OM3B 3UFIA 3BOVA 3DSNB 2GYSA 1RZGB 3EJQA 5DQ9A 5LBSH 4X4YA 2HKHL 3QHFL 3RY4A 1XFPA 2P80D 2ICCA 2QBWA 3HZVA 4JPKL 5E2TL 1UACH 4XWOD 4NO5B 1BBDL 4U1NB 4PJAA 1P4LA 1OT4A 4NXKA 1CZ8H 2AS5M 2X12A 4OGXL 4M6OH 5G4MA 2XA8H 5GS1C 3UTQB 1M1SA 3K2MC 5CIPH 3B7TA 1A6WH 3WSQL 3GD1C 3S35H 5KS9E 4OF7A 4MJIA 3OB8A 3MRBB 1I8LC 2GI7A 1YC7A 4KMTH 4UI2A 2MEJB 1W91A 1AHWB 3ZT5A 4A63A 4ZOCA 5FLUA 5IZ7A 4S0SD 4I77L 5F7NC 3CH8A 1FH5L 2DZEA 1ND0B 2DDQL 4N8CL 4L8BB 4KHXH 1UEYA 4WI0A 4BA8A 4S1RH 5BO1L 1C5CH 4Y4KB 3QHZH 5CN3A 5DMIL 5CEZD 3DO7B 1Y6KR 4F80A 4M93C 3RUGA 1AXSB 5I1LB 5FHBH 1UM4L 2FO4A 3AG3B 1JPSL 3LNIA 3M88A 5GSVA 3ASOB 4XPHL 1L3WA 3T3MB 1NIAA 1MI5A 5GGSB 4XNYH 2AEPL 1ZT1A 4KI5D 1A6UH 1JVLA 1EDHA 2OMUA 3FU7B 5D71H 3QJZA 5I8KH 3PV6B 4FYSA 4HHGA 4FI7A 3J27A 3R8QA 3LZFH 4JBSA 4X7SH 4M62H 2GC4C 1CYGA 3UO1H 4APQC 1DE4B 2QGEA 1I7ZB 1PLCA 1PNCA 3ATEA 5DUJA 3G6DH 3O11A 1BEYH 3GO1L 3CWGA 3VTTA 1IAOB 3VE0A 3MJ7B 3QUMB 1NKOA 1ZHLB 5C0BB 1T4WA 4NRZA 1ZJBA 4GXVH 2HPOA 4B5ZA 5D5ME 4U1MA 1FBIH 3Q2NA 4B60A 2DQEL 4C4UA 3VD0A 4R8WH 5H94B 1QFOA 1TETL 3SDXF 3GM8A 1PGRB 1KGJA 4QHMA 4ES9A 5KVDH 3UYRH 3A6BL 2DLIA 1B9KA 1T83C 2J71A 2W07B 3EHBC 4HF5H 4KO5A 5HDBF 2XWRA 3BVXA 5EZIH 4OB5H 4CMMA 4H0LC 3VMPA 1O6VA 2YD8A 3L4XA 3DBXA 1DUYB 1BZQK 5IV2A 3B7RL 3T8XA 2JWYA 4ELDA 4KMQA 7TAAA 2N0MA 3SYPA 2X0WA 3ULVH 4A2DA 3BE1H 4OZFH 3JV0A 1TKWA 1PYWB 3O4LA 1P4BH 5CCGE 4KXZI 1DVFD 1T0PB 3DURB 4M1GL 4RMTA 4GKZA 1PMYA 1RFDH 1NCCL 1MNUH 3CQPA 4LRIA 2H1PH 4ZS6D 1G6VK 1HHKB 3S0PA 3X13B 5KSAC 3F04A 3MRNB 3SE6A 3AT9A 3QCTH 1MVUA 4Y5YA 4HBQA 4JFXA 4L9LC 2UWEF 2YKKA 3RWFA 3S3PA 4EUPA 4MD4A 5PCYA 5JIPA 3TJHD 2W9LA 4GIOA 2Z64C 2H2SC 3S7GA 4Y5XB 2ZD0A 1XL6A 3AU1A 3O81A 3L4CA 4K2UL 5D2LB 5IJVB 3QSKB 3CLFH 3PV7A 4LBEB 4OJFH 3TN0C 5D1XC 2NUPA 2TRHA 2VOTA 5DEGB 1UWXK 1C1EL 1DQDL 1HH9A 2MSPA 4OLYH 4PJAE 2G2NA 5D5MB 4B9YA 3CUPA 4ZO9A 5B7EA 4GY4A 1AVAA 4B50A 4HJTA 4JFVA 2GJ6A 2X09A 1TEYA 3Q1EA 2YUZA 5BZDB 5CFHA 4MJIE 1D5ZA 2WVVB 2DQIL 4PJ9D 3ROOB 4NO3B 5ISZB 1EERB 3O0RH 3IDXL 3H42H 3TPUA 3ELQA 3NVQA 3H6AA 4AMKL 3BD4A 3VXPB 3PL6A 1UJ3C 1HN1A 2OV0A 4MA8L 4KROC 5G5DB 6FABL 4YO0B 1LLAA 3CLEH 5BXFA 2FNBA 4HJJL 5BRZA 4MMXB 3WIAA 1UM6L 1F3DJ 3GB7B 5ESAA 2MMXA 2X53A 3TP4A 3VGFA 1JZJA 1RH8A 3KW7A 5F3HA 2AQQA 2HZHA 32C2A 4Q52A 4LO9A 2J6EH 1PDKB 2WTOA 1D2PA 3Q06A 1MCDA 1NDMA 2A6DB 3FBKA 4P2OA 3R18A 1CLYL 3FN0L 1FORH 1IAKA 1F18A 2D9CA 3SKOB 3QA3A 1PKQE 4LGPB 3V0FA 4F7CA 4LSVH 2OMXA 1DJYA 2Y5TA 1P69B 4TYUA 5CJ8A 1OGTA 2R2HA 3EFOA 4JG1L 4X5WA 4APXB 2VL4A 4DW2L 4ENED 4FLSA 1G9MC 1XCXA 1J9RA 4R5VA 4X4YB 4Z5RA 1RL1A 5DQJA 2NW2B 2L7EA 3TJEL 3T1FB 4DFIA 3HZVB 4BSVA 2XACC 4D2NA 4Y19D 5INCB 3BKCL 4PJAB 5A7BA 2UZYA 2ZKHH 1P4LB 3IE4A 1OAUL 3BUYA 4YZFF 4IQHA 1F1GA 5AAMC 1A7OL 1IC7H 3TYGH 4ISVA 1UCTA 2QPDB 3AS2A 2Q1EA 2I26N 5EPMA 1RZKL 3GSNH 2ZCHH 1FZKA 1WIUA 2RGSA 3O3UN 4MJIB 4NKIL 3K74B 2B3IA 2IF7A 2YAMA 2VR7A 1LO0H 2HN7B 2VN3A 3ZJAA 4QNPF 3BQVA 1G6RH 1XQ4A 4H25A 4YUEH 3JQOB 2AK4D 2M83A 4YEFA 3D5OF 3AUVA 4Q6IB 1AHKA 3F7VA 5KVFL 4WI0B 5C07A 3B5TA 4I18C 1ZCRA 2X2IA 3C60C 5SX5K 4GJTB 4MXVE 4Z18A 3VYPA 2X6MA 2AAAA 4Z7AA 5EOCH 4XMPH 3VFMB 4UQIM 5I28A 1ONQA 5TK2A 3SE8L 3X1GA 4J3BA 1P84J 1AE6L 5CEXA 2K9UA 2KZ1B 5HPOA 1AQHA 2A6KA 3OWEA 5GSRB 3LS4L 4D8OA 3CX5J 4JANA 1DYZA 5ILTL 1MI5B 3TA3D 4NQXB 5MI0C 1ZT1B 1QBBA 3CC5A 4U4BA 1RVFL 2OMUB 3EJZC 1EEUA 2R9HD 3QPKA 4QTIH 2H3XC 4XO3A 5T3ZL 4BZ1A 1VKXA 3EO0B 2WQSA 2NXYC 2OX5B 4RRPM 3IB4A 2XX1A 5GGQL 2DL9A 2X9WA 4HIXH 1KCUL 1AIFB 4RESB 5HTSA 4PU2A 4IRJA 4PREB 2DBLL 1QPPA 2N01B 1UH4A 2BY3A 4X7EC 4PBWD 5D72H 3MJWA 3ULSB 2ICWI 1WDAA 1ASQA 2X4TA 5HHME 1SN2A 3KL3A 4ZTOL 3PJNA 3IMWA 5I1KH 4L2LA 5K1JA 4W6YB 4DCQB 5I73B 4U1MB 4FFVD 3L95A 1ZTXL 3CSTA 4QHMB 4TNGA 2FD6H 5I0XA 5TE7H 5D7IE 3DX6A 3PP3H 5JO5B 5EO1B 4CMMB 4JO1H 2CO1A 3VACA 3SO3B 2VC2L 1KPUB 5IV2B 2COQA 4KJWC 1KN2L 5FCSH 2HRPH 3QIUA 1X5MA 3ZL4L 4AV4A 2HFEB 1RY7B 2E9JA 2ROYA 3CV5A 1CJYA 2WY3B 4I1NB 4JO3H 1KXTA 1U2CA 1TKWB 3ZO0A 4DTGH 5KUKA 2X4SA 2ZKXA 3O4LB 4NQDA 5EIVA 5KYYA 1D6VL 4UT6A 3MLVL 2WXIA 2BXYA 4GKZB 4NP4L 5EF0A 3U48A 3KL0A 2W0FA 1FIGL 2H5UA 1S78D 5DUPH 2ZUTA 1QBLH 3VB9A 4K3JH 5KVEH 4Y4FA 1K72A 3PJSA 4N2EA