3BFOA

Crystal structure of ig-like c2-type 2 domain of the human mucosa-associated lymphoid tissue lymphoma translocation protein 1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
85
structure length
85
Chain Sequence
SKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Ig-like C2-type 2 domain of the human Mucosa-associated lymphoid tissue lymphoma translocation protein 1.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 19
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bfoA00
1P9MC 5EZJB 5MP6L 2BHUA 5JMOC 3VXRA 1U9KA 3RZCC 1LEKA 3PHQB 1U3HD 3IFNH 1VDGA 4KK9D 2XZQH 4KTEH 3ZE1E 1GGTA 3QUZA 4FFWC 1U92A 4PFEA 2Y5TB 1NFKA 5EU6A 3GMOB 4PTTA 3OSKA 2C3HA 4P2QD 2MPAH 3PQYE 1HCVA 5MERA 3BD4A 4TRPH 3KPSB 2BNQD 3D3VA 4GKSA 4I77H 4ONOA 4JN1L 4S2SA 1H9VA 1T7WA 5I6XB 2EECA 4XBGA 2FX8L 5EU6E 5KSAD 3SE8H 2IH1A 3M17B 1HI6A 3D18A 3HAEA 4JQIH 4ZPTB 5LCVH 4PG2C 4B41A 4FQLL 4LDLB 1ZHNB 4BFIA 3FCTB 4P2YA 3MLUH 1I8IA 5ID1B 5F7KC 3G5VB 3M8OL 1MFBH 4YHPA 4TN9A 1WZ1L 3N1PC 4EIGB 2CD0A 4JPKL 3EIFA 4KJQC 4PLJD 4NQDB 3BKYL 3REWB 1XT5A 1KIQB 3ZTJH 4APQA 4F15C 5HYSA 4LEOB 4JY6A 3MLTA 3O6FC 4K3GA 1WFNA 4GBXD 4P5KA 3U46A 4Q9QH 4P49A 4A6YL 2D7MA 1F3DH 1OLLA 1H15B 4X98A 4OCYH 5BXFA 4UBDC 1ZLSH 1HYRC 1CXKA 4G8IA 1WBYB 5DMIH 2HMIC 4OIBA 1H8OA 1ONQA 4LSQH 5GZNC 3IS0X 1U8NB 5MENB 4L4TE 1J0YA 2ZG3A 3MJ9L 3UTTA 1N64H 3ZKSD 1Z3GL 4KJPC 1MF2L 4DGVL 5B4MC 4RRPG 2QV2A 1EV2E 2VYRE 1F00I 1CFNA 4G6JL 2R0LL 3O41B 4XHJD 3MR9B 4M61B 2Z31C 4XNUH 1QR4A 3LV3A 3T1WA 3QXAB 2JJVA 4PJ8D 4HUWB 2F54D 3PNWB 5GQBA 3EFDH 4OZGE 3VWKB 4LU5H 4PRPA 5KOMC 3QO0B 4NRXA 1YEEH 2VLJE 3E6FB 4HPOH 2LFGA 2ZSVA 1HH9B 4HEME 5C0IB 2VJXA 3UTSE 1PLGL 1IAII 3WHXB 4FFVD 1ZHLB 1N2RB 1II4E 3MLTB 4IMLB 5KSVB 3TJEH 1I3UA 3CFEA 3QXVA 1MCOH 1RUAH 3ARGB 4LPVA 4MNHA 4UNUA 3BUTA 5EOQH 4XP6L 2GT9B 1XF2B 4E0RB 2V9TA 1QFHA 5EUOA 5BMFH 1UWEH 3STZB 2ZOKB 4XP9L 4PG9A 3QJFA 4J1UA 3L1OH 1I7ZA 5F9JA 2DWEB 3BKCH 3FOMA 5CIPB 1OPGL 5FYLD 4ETQA 8FABB 1D9KC 4XMPH 4QCIB 4XWOD 3B9KC 5D7LA 3O6ML 5IVXF 5K9OA 2P5WB 3C5JA 1BD2A 3QPXL 4NQCE 4F3FB 5TF1H 2V5YA 2IQ9H 1RD6A 2QKIA 1J8HE 4NKOB 5I17B 1N0LA 4MYWB 2UWEF 1ETZB 1MCWW 4NN5C 1IGFH 3GK8L 3L7EA 1FZOB 2NY0C 4N9OB 1LP9B 4P2RD 15C8H 1RUML 4G8FB 3P4MA 1F45A 5JDSA 3T0VA 1C5BL 5D7JB 5KSBA 4QOKD 3QAZB 2AK4E 2QSQA 3CU1A 2GT9A 1XF2A 4E0RA 2VXVH 4NQCB 1UM5H 3U48A 1KBGL 4MX7A 3JVGC 4L9LC 3AREC 4KTDL 3DUUA 4HT1H 4ZXBA 1A6UH 3G5ZB 4B50A 1T22A 2R0KH 5KN5B 5EC1B 4TVPH 1EHXA 2V17H 2IFFL 3O9WB 4LCYB 4OD1L 4GS7B 3OKEA 2VZTA 1JV5A 3PL6A 3ZDYE 1XMWA 4NNPH 3BQUC 1CGWA 3QUKB 1ZOXA 4MCZA 1KULA 1QO3B 3IFNL 5KSBF 4RIRA 4KJYA 2PW2B 1A7PL 4K8RC 5E8OB 3HNVH 3DJ9A 2OL3B 4KROB 3PIQB 1KJVA 2R23B 4PRID 4PLKC 1K4DB 1LK3H 3Q5TA 4PJ9A 5CIPH 5A2JH 3B2VH 3MNZB 1W0YT 4YFLI 1K85A 4OCLC 1MAKA 2NY4C 4NQTA 2X70A 2BZDA 4M3KB 2CDEA 3R8QA 1T2JA 5D1QA 3QQ9C 5JQHC 4DTGL 2KZWA 3WFBL 1R3IH 3V52H 2AGJL 2J6EA 2K9UA 4QRQB 5DVOA 1I7UB 2AEIT 2A77L 3NCFB 3NIFE 3I6GB 4DGVH 1GAFL 1C08B 3NIGE 1FZMB 5HJ3A 3U79A 2ZNXA 5I1GL 1BBJA 5IQ7L 2R9HD 3BWAB 4MA1C 1I8MA 3UBXI 5IG7B 2D7PA 4ZAKD 5FM4A 3BN9D 1ZLSL 2DQUL 2WANA 2XA3A 1KG0A 5E6ZA 4GAGL 1PYWA 3MUGB 4R2GC 1ZEAH 1QFUH 2YHGA 4HBQA 4XP5L 1KENH 3BGFC 5E6IB 4HBCL 1T5WA 2FR4A 3SO5A 1K8DB 5EO9B 5EFIA 3D2UA 3QUYA 4OT1H 5F1IB 1VFBB 4DKEL 3IXAB 3B9KB 3SE9H 2G2RB 5D7SH 1GZQA 2AV1A 5FV1L 2FYYB 3SDCD 5CZKA 4ERSH 3KLHC 4IRZL 4RGND 2VITB 5IB5A 3QIWB 3WNLA 4J6RL 1NGQH 4RFEB 4X0KB 3LN4B 4RZCB 3ZTNL 4PRNA 1ZLVK 2ZCLL 2LABA 4K7FA 3MLUL 2WMPA 3FN9A 3K3QA 5I76B 2YBRA 2J8UB 1S5IH 1CTOA 5HVHB 2H32A 4PJ5B 2J8UA 3S4SB 3U4AA 5ANME 1BX2A 2CO6B 2I60H 4P2QB 3UJTH 5CEZH 2XWTB 5HHQB 3OKNA 5E2TL 2BSRB 1DLHB 3EJYD 4OLUL 3V6FA 1VKXA 2DTML 1MFCH 5HPMA 1IGYB 2H6PB 3NVQA 3BP5B 4I1NB 4WHYH 3FQXA 4Y4HA 2P24B 1A4JA 2X7LA 5GGSY 2EKSB 4NP4L 5DSCA 2Q7YA 2C4FU 3IFOB 2PCPA 1NMAH 5FO8B 3GGWB 2ZPKH 4GAJL 4R8WH 4XRCB 2VWEC 4D9LL 3HZVB 5SV3A 3ARSA 1IMHC 1B6DA 3DIFB 3TIDB 1G7LA 4FQIH 4XP4H 1CGUA 2DIJA 4P23D 1E4JA 4DZ8A 4Q9RH 1MEXL 2OJEA 2JIXA 5FB8B 2Q3ZA 2MOVA 3FB6A 5GS3A 3QCUH 4QWWD 4GG6F 3LD8B 4Y2DD 3SOBH 1CXIA 1A9EB 1TVDA 5IP4A 1CDIA 3SGKA 2VR4A 1C1EH 2R2HB 4HXBL 5CWSA 1CFQA 4NN7C 2XA8H 5IBTH 4P9HC 1IZKA 1PZ5B 3FQNA 3L5WB 3F7YB 4KPHL 4D0CA 5I16A 2NY7L 2AQ2A 5HDLA 2OTWA 4NO2A 1S7XA 4M93C 5E4EB 5J13C 1IGYA 2VRAA 5CP3A 4N0CC 3BHBA 1DBBL 1ZANL 5JR1H 1CLZL 3O11A 5C0EA 4YBHA 4YHNA 5DSCB 5BRZD 3QCTH 4X7EC 1HHIA 2IAND 2YR3A 5F7YC 5IB4B 1I7TB 1Q9KA 4DGIH 4HJ0D 3GSVB 3I2CL 4QXGH 4L5FL 2B1HH 3EHBC 3MXVL 5I73C 4K3DH 4M7ZC 1LO2L 1A4KB 5CGYC 3PP3K 3L3OA 5DZNA 5DEZA 1RUAL 3ZYOA 2YSSB 4CN6A 3I50L 1MHPH 1FC2D 2NY2C 4JM2D 4P4KB 1MI5B 2VE6A 1ZANH 1V7MH 4XNXH 1IC5H 3TA3A 1LO2H 5CBAB 3JV5A 4IMLA 1HNGA 3S35X 5FOBB 4F57L 4KKBC 2WBJC 2DBLH 3FOLB 1OAYH 4LSVL 4PRDA 3U7YH 4PRDB 3MRRB 1FQ9C 5EU7C 1D9KB 3C9NB 4IDJL 1F4WL 2FZ3B 4PJ7F 1ADQA 2BXZA 1R24A 4TNWF 1TFHA 1H5BC 5H94B 1BOGA 1B9ZA 4P57A 1XH3B 2ADJA 2IPKB 3NZ8B 4W6XB 5JPNB 3G6AB 1MLBB 5HI5D 3MLWH 1ACYH 3DV4A 2X41A 1SBSL 5T3XD 1BM3H 2R4SH 3BMVA 2WIIB 2P5WD 1X5GA 5DJ2A 2WQ8A 4M43H 1Z3GH 1QEWB 2VLKB 3MRMB 1HK6A 3G5YA 4KK6D 2X09A 5CKGA 4KFZC 4UT7L 3MBEC 5KS9A 5EZIL 4D9LH 1DBJL 2NMSA 4RFNB 4YHKH 1C5DA 2IADB 1CLOL 4XMLL 1U8OA 1DVFC 2Z4QA 2HJKB 2YXMA 5CZVL 2I5YH 3LRGA 3BX7C 1JJUA 3UTQA 5ILTH 4U33A 4Z77B 3D0LB 1AIFB 5EIIB 2AABL 4Y4FC 1LQSR 4I0PC 3VXMB 3ARFB 1CXLA 3N1GC 2FB4H 3OJVC 5JHDE 3PXJA 5JO5A 1NLDH 3ULVL 2VLKE 4ZAKA 3KWWB 3AVEA 3MRRA 3GHEH 4Q0XH 4W6WB 5DC4B 4YDIL 1S7TB 3I3DA 5C70A 4NQCA 1JMXA 2A38A 1G9NC 2QQQA 5D6CB 2XN9A 3R4DA 4MDIB 2CR3A 4XT1C 3MUZ1 4OM0H 4CUCA 1MRDH 3DX7B 3H6JA 4KI1A 5ICYA 5KVDL 1YEGL 4J6RH 1OW0C 1WITA 1JK8A 3D87B 3EUUA 5HXMA 2GKIA 2W65B 4AEEA 3QIBC 3B3IB 5DVKA 5IMMB 4L8SB 1A6ZA 3TC9A 1S7RB 3GMNA 3I85A 2E9BA 1OVZA 4C57C 5B8CB 4O00A 3VWKC 2B5IC 4KK5D 4D0BA 1WQVT 3DVGA 3CFBA 3G08A 2E7CA 1JNJA 2JJSC 5E1HB 5HGBA 3GRWA 3BPNC 3V6ZA 3MXVH 3CVIL 2P5EE 3NN8B 2BC4B 3PWUA 1LK2B 2X4OB 3SY0B 4OZGA 1HSAA 2WLZA 1MJUH 5GJSL 4K7PL 5E5RB 2E7HA 1RK1B 4AZ8A 1ZKAA 4O9HH 1RQ5A 2R8SH 5F1KC 3GJFA 2UUDK 1CYGA 1HOCB 3LH2H 2ICWA 2F54B 1SMOA 4R3SB 4UNTA 5CP7B 3ZSSA 1SYSA 5L0QC 3JTTB 2JELL 1TVBA 2OR9L 2VAJA 5ICYB 5IGXL 5CZXC 3Q6GL 1EEZB 2EZ0C 2H8PA 4U1SA 2CK0L 2E5EA 5CJQH 1KEGL 5DRNB 1DQJA 4LPUA 3W0WA 1T03L 1P69B 2IBBA 1HQRB 5ECJE 5KOVC 3DI3B 5FGCE 1A7PH 3QUYB 1FN4A 3IDJB 2D7TL 3NAAL 5F3HA 3O2VL 3FRPA 5I75C 2YPLA 3BUYB 4NM4H 4NCC1 1GVIA 5B3JF 3DIFA 4RISH 4P2OD 3TF7C 1J05A 1KTKE 4NM8H 1YY9D 4S11A 4MQTB 2WBKA 2LTQB 4HMEA 4JCMA 3F58L 5HHPA 4OD1H 4TYUA 1QPXA 2EO1A 5GSVA 1HN1A 2BC4A 1VERA 3RZWA 1MCHA 3IDGB 3IDGA 2IANA 2PYEB 3PHQA 4KTDH 4NQDE 1HCFX 2J6EH 1T1WA 4AG4L 1IM3B 4UUJA 4YXLL 2XN9E 2AJXH 1KB5H 3CVHB 5D2LF 4P9ML 1JNLL 5L7XL 3D69A 2NW2A 1Z9OA 2EIEA 2AW2A 1IT9L 4M5YL 4OLXH 3K2MC 4ZDHA 4GXVH 4ELMF 2YZ8A 3L3GA 1DQLH 2HT4C 4OLEA 1H15A 4X98B 3S36L 4PBXA 3OF6A 4KI5D 1RHFA 2L4OA 3FRUB 3MCLH 4XPHL 4F7EB 2NXZD 4K9EC 5IK3B 3C60D 1HKLH 5I73B 1J8HB 4JKPL 4XHQA 1CICD 4L3ED 1GZPA 5F96L 4X4ME 3S36H 1W0VA 1M6OA 4HC1H 4G8GE 4X6BB 4MS8D 4PP1C 1ZS8B 1JZ4A 5C0AE 5F6IB 4U1JA 3DWTA 3A6CL 3HG1B 2IPTL 3CDYA 3TBWA 3REWA 2H32H 4TUJB 4R4BA 1MY5A 4Y4HD 1NEZG 1ES0B 2IC2A 5DS8B 3CJJA 5D1XA 3OHXB 1MUJB 3BXNA 3VXNB 1LEIA 3BT2H 3WUWB 4F33B 5D71H 2DJUA 1JGEB 2QSVA 1AHWB 5D4QA 4JZNB 1NGWA 5IWLA 2PTTB 1S7QB 5I9QC 4J3XA 1BMGA 1T89C 5DEGB 3LD8C 3X17A 3SPVB 3QXTA 1NBQA 3C8DA 4JEGB 1B3JA 4C83B 1TPXB 1U3JA 2B4CL 2OLDA 3BEWB 4MNGB 3RTQC 4OZ4A 2AXGA 5K9QG 5FDWB 2X4RB 1QFOA 1RZ8B 1LE5A 5FO7A 2W0PA 4EI5B 3HAEG 1U8HB 2PXYD 2YUZA 4RMUA 1YA5A 5FHBH 3RRQA 1MQ8A 4XXCC 1KIUA 3U4BL 3IVKA 3TBVB 4LDOB 5GGRB 2R2CA 3ARPA 3J7HA 4NJAH 3IDXL 4OF8A 5C7XH 5ICXB 3VXOA 1J5OH 3INUL 1OGAA 1A5FH 4OB5H 3RWFB 4X9HA 1BFOB 4KRMB 3GSXB 4HDIA 3RX5A 2YKLH 2YK1H 5CBAA 4TUJA 3O3EB 5E5MA 1H3PH 2XQBL 1H3VA 4PB0L 4FMFA 1FJ1B 2RHEA 2X4SB 2YPKB 5K9QI 2V5RA 1KN2L 2AJYL 3JWOL 1LD9B 1D9KA 3C9NA 3BDYL 3TO4B 5CAYB 4MA3B 3KGRA 1PKOA 1WBXB 3NACL 3GBLA 4Y0GA 4XVUD 2VLME 1CVRA 3S3JA 4LSQL 3Q48A 3DO3A 2XWBA 3BAEH 1PGRB 4AL8H 1A6WL 1R3HB 4OZFB 5I1EL 4X5LA 4ODHH 1A8JH 4UTAL 4E42A 4PJXA 2YC1B 1GIGL 4OZFG 1UZ6F 3VFNA 4PJIE 5IMKB 1YEKH 4X6CB 1KFAH 4KKAD 1WLHA 2JE8A 3SCMB 3VFSA 2FX9L 4QRRD 1A0QH 5IESH 4P5MA 3FN3A 1DQLL 4NKOA 2PYFA 5F9OH 4PB9H 4G9FA 3IJYB 1L7TH 1QFWI 2AXHA 2X4PB 5IW1B 1Q9LA 3LB6D 3HB3D 2EDHA 2CH8A 2O5YL 3B8SA 2G9HB 1WZLA 2YA0A 4FOMA 1WUNT 3KPQB 5SWZD 1IFHL 2Z31A 5BZWB 4OKVA 1AGCA 1K8IB 2DYPB 1T7XA 3O6MH 1FJ1A 1WC7A 3EYUL 4LBEB 4PRHE 4HJGB 4H1LG 3ARQA 3L5IA 3KPRA 4MA3A 1NLDL 2JIXD 2HTLC 5ESAB 5DQDH 4WW1A 5C0BD 4IRSC 4N0RA 3LQMA 4UDTB 1Q9WA 4YFDB 1RZ7H 4CNIA 2JB5L 2J5LC 3WDJA 4DKFH 4JAMB 1J8HD 5IB2B 1E4XI 3ILPB 4NOBA 3ARGC 2ADFL 4KROC 1NUNB 3SO3B 4XMLH 2IMMA 1KCVH 2IADA 4MJIE 5D7KD 1XCQB 5DZOA 2YEZA 5FM8A 2EEBA 5FKPB 1KT2A 4WGWB 2DQIH 1X6LA 1KLUB 2AK4D 3ELAT 5I1HL 2EYSB 3NFPA 1I85C 3KPLA 5C09A 1MCQA 1U8LB 2R15A 3V6ZB 1ULVA 1DUZA 2BRQA 2E6JA 4HLZH 2ITCA 4AEIL 2Z31B 4OSUL 5IJVB 1AXSA 2ADIB 4X9BA 4POYA 3ARDC 3N1MC 4FXGB 4Q2ZA 3AS1A 3PWUB 3RY6C 4BQBA 4O2EA 5IQ9A 3W9EA 3TFKD 4R96A 2QADB 4X7TA 3UZVB 3VD5A 1ACZA 2AJVL 1A9BA 1PW3A 2DLEA 3WIHL 4JFEA 5GGTL 4GW5B 1CICA 3PWJA 1YY8A 2W1NA 3ARXA 4LRNL 1AI1L 4DW2L 4PGZA 4NDMA 4N1HB 1WWCA 2EH8H 3KYNA 5ESVA 4BM7A 1HH6A 2QADC 4G9DA 3JTTA 4KMTH 1FDLH 5IG7A 4YLQT 4L5FH 2PUQT 5HPMB 4DGIL 1GGIH 2XYCA 5B21A 1T3FB 3T3MF 3SN6N 1HNFA 1BAFH 1P84K 5BZDA 2XOTA 1PQZA 4QXUL 3AC0A 1M7DA 2Y7QA 5DQ9A 1TETH 2IWGA 3PWLA 3VD7A 4JFXB 1QTYT 5JXAH 2W60B 2YBRB 2VQTA 4HJJH 1XF3A 2NY7H 1ODAA 2O5ZH 2GAZB 3QIBA 43CAB 1FL3B 3LS4L 4UT9H 4UAOC 5T3XH 5KTEH 2VO5A 1Q1JL 4CADB 4ODTL 4KDTA 2DOCA 4NGHL 2UY6A 1KJMB 3GSOB 4Z7WB 4X6DE 3EDEA 3CIQA 1DLFL 3WNPA 4R0LA 3NCJH 1IM9D 1CD1A 1H3UA 2DMBA 2R4RL 3JTSB 3T77B 1V5JA 2QJDA 3VI3E 3U4EB 3D9AL 5FYJU 4NO2B 1DFBH 4WTWA 2R56H 5LBSL 2HRPL 4RA0C 5KS9F 4HIIB 5GGVH 4LVHC 2GUOB 4D9QD 1UCTA 5KAQF 1IGIL 4ZOCA 4XPFH 5ESQB 2DYPD 5IFAL 4HD9A 4KHTL 4HZLB 3VXUB 3EO9H 3PXHA 3CFKB 5E6IC 3DYMA 5DMYA 4KXZH 1YC7A 5DD0H 3C6LC 2H1PL 1YNTA 2WWMD 3VWKA 4IDJH 3UTOA 4UV4L 3TESA 3GSUA 5KZCB 1LP9E 4I2XE 1WF5A 4HEPG 1T83A 2YMXL 2FGZA 3HZYB 5AUMB 4KRPC 1IC5L 3T0EE 4LHUD 4F9PA 2PTTA 1BHGA 3HE6D 4O5LL 4FQ2L 1P5VA 3QUZD 3C5SB 4HMCA 1PVHA 3WUWA 1A7NL 1EDQA 1UJ3B 5BQ7A 5FYJL 2DQCL 1BFTA 4JFDB 1MRCH 4H5SA 3U1SL 5IB4A 2WINB 4URTB 1FCCA 1XCTB 5IMKA 4R90L 3T0EC 4JPWH 3JWDL 7FABH 2B5IB 4KZEH 4JPIA 2WUCL 4Z76B 3W11C 5IMLA 3H9SD 4U0QB 5L2JA 3TA3B 3RUGF 1NBVL 4ODBD 3GSUB 3G5VA 2WAHA 4I9WD 1QG3A 3MUY1 5F97E 2VITA 3BRDA 1N4XH 3JV6B 3TJHC 1ZHNA 4BFIB 5FA4A 4JG1L 1A21A 3T0BA 5TDNA 3HS0A 4U1NB 2X4SA 5C6TL 2BK8A 3T2QA 1I9JL 5ISZA 2NY3C 3JVGA 4L9LA 5INCB 5IVXA 1TZHA 1SJHA 5EZLB 3SDDD 1MHEA 1G7MA 4X6DA 1CE1H 3WJJC 2XNAA 5CD5C 2K7QA 2HJLB 1NSNH 4UAOB 3VMOA 4F8TA 2XZAH 3IU4H 1ND0B 4QO1A 5DWUH 4XP4L 2DKUA 1CL7L 2CDGB 3SDAA 3V6FB 4UB0H 3SCMD 5D2LE 3KPRE 3OPZL 3L3HB 2GFBA 5IHLB 5CIPA 2FBJL 1U8MA 5I8KL 1CS6A 3DETD 4EUPA 2WIIA 1WBYA 2HJKA 3HMXL 3ZT6A 35C8H 1JL8A 2PN5A 4WEUD 3QIUB 4DZBB 5TH2B 4JFZH 4E9LA 3LQAL 4UQ2B 3MLVL 3FTGB 1CD0A 2XI9A 4TVPL 1G9EA 4N8VG 4OAWA 5CGMA 1R5VA 3MRJA 1DP0A 4IOIA 5BOPA 1U6AH 3QDMB 3G08B 1F4YH 3THML 4U1NA 4JG0H 2UZYB 3BH9B 2ZCHH 4LLUB 5JIHA 1CF8L 3S7GA 4LLYA 4NRXB 1UFUA 4RMQA 2JB6B 3TT3H 1UM6L 4LEXH 4Y16C 1EZVY 4C56A 4BKLB 1Q0YL 3MOBL 1UCBH 2VAAB 4JHAL 3H3BC 4OLWL 2ICEB 2XRAL 4HQQL 1Q9WB 35C8L 4Q6IC 1IKNC 5GGVY 4NQEB 3FQUA 1T6VN 5ENWA 3T4YA 1IILE 1MPAL 4QXTA 1BWMA 1JTPA 4WFGE 4JFFD 1NEZB 4M7LH 2APWA 1JIBA 4XP5H 4XPTH 4NFDA 5TE4L 4Y16A 5J56B 5K9OB 5L2KA 4G9FB 2P49B 3X12A 4TUKL 3EOYG 3GSVA 3BZEB 4D0BB 1I8LC 3FO1A 3SCMA 1KPUB 4ZUTA 4BQCA 1XEDA 2BRRL 3KYMA 4CMMB 2F58H 4DQOL 5ADPH 1IE5A 4R6UA 2J1KA 5I1GH 4XGZA 3U0WL 1U3HA 2W9EL 1UWEL 4F3FA 2ITCB 1WIOA 1KJVB 2R23A 1OAUH 2P8PA 3BN3B 4LVNB 1L6XA 2C7UA 2QKIB 3GHBL 3O4LA 4DTGH 4ZUUB 4ZYKA 5KSVA 4OBRA 3VDAA 3RWCA 3E0GA 4QF1B 1FYTE 3NCBB 5H2BB 2HTKC 3ARWA 1FFOA 3AY4C 3W81A 1NC4D 3S5LG 3OKDB 1ZT7A 2XN9B 1YDPB 1WWAX 4OQTL 3LCYA 5ETUA 2VXQH 1TJGH 5GIRA 5HYFA 1NCWL 3H9SA 3O3BB 3RVXD 3MLXH 3FB8B 4NNXA 1KJ3H 1IGTB 3NIDF 1NAMA 2P5EB 4JAMA 3SKOA 5IROA 3L3DB 5HYSG 4KV5E 4F58H 4LKCA 4U7MA 2IFFH 1MF2H 3ZT5A 1DBAL 2M8XA 2WSKA 1VEOA 4Z6AT 2R0KL 4JFEE 4XVSH 1T5XB 3NFNB 4G6FD 1WFTA 4X4MA 1XF3B 1QVOB 2HVJB 5FEBA 1KJ2B 3L9RA 3RWGB 4ZNEE 2Y07L 4HK3J 2Q7NA 4GXUN 5ID0B 3S37H 3QIBB 3MRFB 3FMGL 4FXKB 1HSAB 4WJ5A 2CIKB 3DROA 2CUMA 3WFEL 1M05A 4NRYB 5I30H 3SDCA 2IPUG 5TPWL 2Y5EA 2H32B 1RK0A 1IGFL 1SEBA 2DLIA 2Y9RT 4FP8L 3K81A 5HHOD 4JFPA 5DRZB 3V0AC 2QEJA 2F54E 3OAZH 4XNYH 1NCAH 3WMSA 1U58A 4PJDE 3RPIA 1OTTC 2ZUXA 5I8CA 5GS0H 4C56D 1E28A 3LY6A 2XZZA 4LQ1A 1JZ3A 5JHDB 1UA6H 2PO6B 2BDNL 2ADFH 2DIBA 1ZHKB 5FYLE 1KPRB 1FVDB 1WWWX 3FO9A 3T65A 1OPGH 4NQDD 4MAUL 4XCYB 5EO9A 1HYSC 1U8QA 4XMKH 1CD9B 3F12B 4PP1D 3V8CA 3KPSE 4U6YA 4IJ3B 5LKNA 2EEDA 3LN5B 4RSVA 3MUGA 3RNQA 1JPFA 2PTVA 1V3KA 5I1JL 1M6OB 4YBQD 4MXWL 4G80B 4WHDA 5J11C 4MAUH 4DVRH 3C5ZC 5FYJE 3AS3A 2JKXA 1PZUB 4QHUB 2ATPA 3MSPA 3O2DH 4JPVH 3DRQA 4G42A 4HWEL 4I48B 5CJ8A 4X9GA 3W0WE 4AIZA 1IKNA 2OL3L 4QTIH 4WW2B 2QQKL 3RJDA 1AP2B 1SJEB 4L3EE 2HJLA 1NUGA 4M6NH 4G3YL 2DB8A 2I07B 2GYSA 4Y8AA 3U36B 5A1AA 5JIPA 3KPSA 1MJJA 3LHPH 1V7NL 4YEEA 4YUEL 2DI9A 4ZQKB 5B3NA 5AYQA 5J1TC 3GMOA 4V2BA 2IFGA 5CEXB 5L6YH 5D7LE 1X9QA 1F3JA 4JGUA 4GKNB 4ODHL 4XH2B 2IBZY 4MGXA 2EYRA 5GRUL 3CAFA 2C9AA 1BJ8A 3LSOB 3VD4A 3TIDA 4QOKB 3NH7L 1JPFB 4QOKA 3QEUB 3MGTB 1CDCA 3WIIL 3QEUA 4G8GB 5FO8A 3T0AA 3REVA 2ZSVB 1KTDA 3EOBB 2DI8A 4GAFB 1BD2E 3GIVB 3WIIH 4HKBB 2R1XB 1I7RA 5CD3B 3PNWA 1R0AH 5K93A 2VLRE 3LHPL 3TJHD 2GW5A 2OQJA 4NQDA 4JFOA 4OCXH 4ODXA 2AJZA 4O51B 4U1IB 5CZXD 1ZVSA 2VLJB 2V2TB 3IDXH 1EO8L 3E6HB 5GGQL 4YWGH 3BO8B 1TNMA 1N6VA 2MWCA 3VG9B 4N0FB 1LO3H 1D6VH 4UIKL 1EEQA 2R0WH 1MELA 4YUEH 1R3HA 4OZFA 4Q97A 3MRHA 4PJFF 1Q94A 2X89D 5FK9B 1HHIB 3O6LH 4U1MA 5JW4Q 1UH4A 2M26A 1MQKH 1U8NA 1BD2B 1I1AC 1FGNL 3LPWA 4KK5C 3U0WH 1CCZA 4PJAF 4TRPL 1EHLL 2D03L 3RHWK 3VWKD 1J7VR 2JTDA 3HE6C 4HWZB 4Z7VE 4GSDH 3MV8B 5JUEH 4LVNC 4JKKA 2BXYA 4WFED 4JO4H 4NUGL 1GPOH 4TUKH 4OAWB 3GIVA 4LLWA 4LLWB 1J0KA 4R26H 2OI9C 5GSRB 3HAEH 4ZTOH 3P0GB 1NFIA 1F11B 3P9WB 4ZSOA 2OK0L 1A6VH 1HH9A 5C0IA 1Z5LB 2V5SA 2CDFB 3FB5B 2Y36H 5E8EA 3SO3C 2BVEA 3ALXA 2LQRA 5TDPB 4JHAH 5DYOB 4EXKA 3CC5B 1T2QH 2VC2H 1IJ9A 1LO3L 4ZS6C 3QDAA 4XCNA 1UEYA 2CKNA 3FMGH 5HVFB 3VH8A 1L9NA 3AUVA 3MRMA 5D5MF 5DJ2B 1A6WH 2OI9B 4QNPF 3QUXC 5E8PB 1G7JB 4HK0B 4GXVL 5BJTB 4DZBA 4XVSL 2EDWA 2C3XA 2RR3A 1S7SA 1TCMA 3K2UH 3VFOA 1D6EB 1TQBC 3S5LA 2VIRA 1B0WA 4P4RB 3VMPA 4NCC2 2CJUL 2MMXA 4AM0A 3UTQB 2LTQC 4P9MH 1FO0A 2ERJB 4R4ND 1CG9A 1AE6L 2FEDD 4MCZB 2CRIA 5J1AA 4KMLB 5KG9A 1DCLA 4U1KB 4WO4B 2GITB 1YEDB 3PWLB 1MREH 1S9XA 3P9MB 4PRHB 1A6TB 4PR5A 3VFUB 4NPYA 2WWKO 4FRWA 4X6DF 3ZSTA 1HEZA 3PWPE 4JFFA 5GISL 3G5ZA 5ETUB 1FSKB 4HS8H 2F53D 1YDPA 1TPXC 4MDJA 5GZOC 4P2OB 4ZO9A 1BJMA 2J12B 1S7TA 4XC3L 3FO0L 4LASL 1NC4B 1FIGH 2PXYA 3KPMA 3ULUE 1C08A 3KYNB 2R1YB 3ALPA 4JHBA 4KDVA 5ESVB 4TTGA 2C3GA 1QLFB 4BFGA 4Y4FB 2XG4A 4F2MA 1P6AB 1S7SB 5LAXA 3TH2T 4X6FA 5I74B 3QUMB 4G43A 2GI7A 4MD0A 4FQXA 4F9LA 5EOCH 2YD7A 3ZLQC 1KCUL 1GC1H 4H0IA 1B2WH 1QRNE 3LS5L 1YPZA 4FNLH 4CMMA 4LPXA 5SWZE 4TULH 2RIKA 2HFTA 3R1GL 2Z91B 4UILL 1IL1A 2PYEA 3CFCL 3H3KA 4F8QA 3KPTA 4XBEL 1GXEA 2N7AA 2O5XH 2VERN 3BEVA 3O8XB 4LHQB 5GIRB 2DM7A 4L8DA 2BVOA 3S88L 3KPPA 2BNUA 4P99A 2YWYA 4X6EB 2EDFA 2FO4A 5C0BA 1IQDA 1AQKL 1F6LL 2Z0BA 4L3EA 3DECA 3SDDA 1SYSB 3QHZL 2NY2B 1XFPA 1P9MA 2CSPA 5F72S 3ZKNC 4PRIB 4YDKH 4ZUVB 5DRWA 3C8KB 2BVTA 4MSWA 4JFZL 2EC9U 3MRPA 4QHNA 3PWNB 5E2WH 1UXSB 1A7QH 1HKFA 1T1ZA 1WZMA 4Y19E 2V7NB 2AV7B 2J6EL 1NL0H 3K8MA 1URLA 3DSFL 5I1IH 1KGCD 3RP1A 5AAWA 3OXSB 4MZ3A 4POZC 1QBLL 3LKRA 3QXWA 3TVMC 4KTYA 4F7PB 4ONFL 5CINL 4EUPG 5IIEA 1TTUA 1CQKA 1GSMA 1NANI 3MRLB 2FB4L 1MSPA 5TDOA 3SBWC 2CMRH 4LP4A 1KB9K 4XBEH 1P7QD 2R4RH 5T1KB 2FH8A 2ED9A 5JW5B 3LB6C 1J0IA 1KJ3L 5E4EC 3FQRA 1WBXA 2GK2A 2YD2A 4MB4A 4UOJA 1FVEB 5BV7H 2XV6B 5IEKA 1X5JA 4X6DB 3BSZL 4D9RE 1W0WA 4FG6D 4KKAC 4PGDB 4Z7QE 2AS5M 4IOFC 5MEOA 1JZ2A 4LP5A 3TA3C 5ABDE 4HUUB 2O5ZL 1YECL 4UOW1 4ELMA 3QP3A 4U2ZA 3QFJD 2RFXB 3GKZA 5D72H 3SDCC 1KCRL 4U6XB 3VXSA 1V3LA 4NQUA 1OD9A 4LGPB 3IVKB 4HZAA 1J1PH 2DD8H 3VXUE 1N4XL 3FO2B 4PV8A 2DQTH 1TVHB 3EYOA 3L3KA 3ARBA 5DEFB 5F7WC 4X4YA 4HDIB 4Z7NF 4C56E 1T1XA 4QT5A 4YXKL 1V7ML 4Z78A 2R9HC 4M62H 1AP2A 2H9GA 1IEBB 2X44D 1JNNH 1AI1H 4U3HA 4O5LH 4PYHA 4XAKD 3H0TA 1JHTA 3RGVD 3SDAD 4LSUH 3U30B 4XAKE 3PWVA 1MNUL 3ECBB 1RZJH 3VRLE 4I48A 2HLAB 3KPSD 3SGEI 4XB7A 5D93B 4JZNA 3C5ZD 3OGOE 2FHCA 4JZJA 4H8WC 4KQ4L 3IDYC 3QQ9D 3HI6L 4OCNC 3TT1L 1E27A 1Z6JT 2XY1A 3GMRB 2HFGH 2IPKA 4XWGH 1T7ZA 1QBMH 4OI7A 4OIAA 2YPVL 3RKPA 4LCCC 1NBYA 3ZYZA 4N8CL 1YJDC 4QRUA 2AEPL 1NDMB 1PKQB 5I66B 1F4YL 4ENEC 3MX0A 1U42A 3WBDA 3QHZH 2KUTA 3QULA 3QQ3B 1N0XH 5T1LD 4PV8B 4UT6L 3WN5B 3X12B 3LKOA 3WN5A 5EIVA 5J06A 3CFKA 5FGBA 3BGFB 3BQUD 2R0ZL 3BOVA 4YHPB 4DUXA 2DMCA 4Y4HC 3BPLC 5DD6A 5ID1A 4OI9A 5DD6B 1JGVH 2OJEB 5FOBA 3P30H 32C2A 3C60A 2XXMB 4ENED 1A6TA 4PR5B 1JZ5A 1TLKA 5L2KE 3MLYL 1QA9A 2Y36L 3WS6A 4JFDE 4EZMA 3FT2B 1SJVA 4LGRB 5EG6C 2CGRL 1ZGLP 5IROC 2AJUL 1UB5B 3MODL 4K23H 2DJSA 3MYZA 5CP3H 4GW5A 4AMKH 3G6JF 1NMAL 2NY3B 4O58H 3LS5H 3IJHB 1EAJA 1YN7B 5I1CL 1DDHA 1UZ8B 3SGKC 4JFDA 3UO1L 3WJJA 12E8L 5DJDB 4IEFB 1G1CA 1K9TA 1HHKB 4NGHH 5E8PA 3CCHB 4S1QH 2HT4D 1WVZA 4G7VL 3VI4F 1IAIL 5C6TH 5FK9A 2PR4H 2PYFB 1KT2B 1F4WH 3QYCA 4M3JA 2P5WA 1BAFL 4XPGH 5D7LB 3GSWB 4LCIL 2VR9A 2X1QA 5EU3B 4LASH 1HILB 4PB9L 1M7DB 1BFOA 3P0YH 1QPPA 3MCG1 5E08L 4GG6A 2IH3B 1DTUA 1MCCA 3T2NL 3P11H 2AK4A 5TQ2H 2HTKD 3HFML 3I50H 3VFPA 5DK2A 5GRJL 5DHVH 4J3TA 3MBEB 3VFTA 3W0WD 5DDHA 1A7BA 1OAXL 1RZJC 1CQYA 2NPLX 1MJ8L 3TA3D 4NT6B 4Z8FL 3MLZH 5JXEA 5JNYA 2B1HL 4P2OC 3H9SB 1CICB 4TSBL 4I13B 1F5WA 5DVLA 4Y1AB 5A16B 3WDIA 4XCCL 4Y1AE 1AGEA 4UQ3B 4IMKC 5EC1A 2Q86B 2KZ1B 4I0KA 3ISWA 2DQUH 1NPUA 2BHYA 4U1HA 2FGWH 2J88H 1S7WA 3WIHH 1AO7D 2Y23A 3SDYH 4M5ZL 3TZVB 4P4RA 1XGUA 2NXYB 3PGCB 3V0VA 5FYKU 3F7VA 4BZYA 3L3IB 5AWNL 5EU3A 1FYTD 4PJ8C 4UV7L 4NYLB 3AAZB 5BJTA 4FFZH 4L8BB 4F7MA 2Z31D 1RZKH 4Z95H 5E2UL 3KPLB 5FAAA 5F9WB 4OFVA 3CLFL 3EO9L 3PL6C 4Z7VA 4RA3A 1YNTB 4P3CH 4P5TB 3SDXE 4Z7WF 2D7NA 4Y16D 3RVUD 4GS7C 4Q9RL 4G6KL 1IGIH 1AFVL 4HHAB 1B4RA 4N1EA 4YHLH 2X6MA 2Q87A 4NHUA 1YN6B 2VSDA 5GJTH 4WENB 4HWEH 1A1MA 4CNIB 1UC6A 2JCCE 3O2DL 4PRPE 5IB2A 4KKLD 4LARH 5LGHL 1VENA 5CJOH 4JQVC 1TJHL 5DK0A 2UVEA 5D1QC 4NNPL 5GHWH 5EBMB 1LHZA 1Y18B 4PREB 5KVEL 2HLFC 1EBAA 4GQ9H 4I5BB 1I3GH 3OR7A 1DBMH 3PQYD 4MLIA 4MMXC 2A74A 5DRWB 1A22B 4ZUVA 1BFVL 2PO6A 3LVEA 1RHHB 3ARZA 5MEND 5FXCH 1YPZB 3QDHA 5ESQA 5C2BH 4RMRA 3SCMC 4PLNC 3IKCB 2NNAA 3DTXA 5E94B 1ZV5A 4EQ2A 2F53E 4ELKA 1OGAD 1FL5A 2GJ6E 4LVOB 4I18C 5GXBB 4LSSH 1LE9B 4LSPL 4Z18A 4JFXA 2DN7A 5HHPB 3CMGA 5EBGA 5FO9A 4C54A 4NWUL 1OT1A 4YK4B 1DR9A 5DJCA 5I1EH 1NGXB 3F5WA 3SDDC 1X5LA 5DJXB 3LN4A 2CIKA 4RZCA 2ATPB 3ARRA 4LOUD 3GO1L 1YQ2A 1RJYB 3WKNA 5INCA 4YHZL 5IT2L 2YRPA 1YEKL 1QNZH 4CADA 1IT9H 3QFDA 1IM3A 1U36A 4R4BB 1J1OH 3P4NB 4UTAH 1INEL 3OKNB 4WI3A 3U9PH 2XQBH 4PB0H 1Y6MR 3FT4A 1TVBB 3K74B 5C8JB 1TXKA 1U2HA 3MNWA 1B88A 1VPOH 3C2AH 4ELMB 5KSAB 3NGBC 4QY8B 1ZHKA 4H8WH 5IVNA 5HVHC 3SQOH 2PO6D 4MHHI 3GBNH 4PJFA 5KVFH 1PQZB 3F58H 3C08H 5HDQL 2A77H 2Q76B 3LKQA 1KC5L 5EOQL 3WNOA 1QFWL 1ZS8A 3WO3B 2CLVB 1IGJB 1WAAE 3OAUL 2YK1L 1A4KA 3N1QC 2D7TH 3NAAH 4EI5A 4R4NC 5CSBA 2XFXA 3BP4B 3PGDA 1J5OL 1J86A 2Q8AL 4HULB 2B4CH 3MNVA 3GSQA 4YIQB 2X4NB 2ITDB 4LHUB 4QTIL 1A47A 1NCNA 1T03H 2VDLH 3ETBF 3JBG7 3RL1B 3LIZH 5FM5M 2GHWB 3QUXD 3FT2A 4M7KH 1T0NA 1H0DA 4XC1L 4AIZB 1RU9H 2V2TA 1AD9A 4HIXL 4YNYB 3SGDI 5I8EB 5SX5H 1ZSDA 3GBMH 4IRJB 1G9ML 3C6LD 1VEMA 1QLEH 4ZS6D 2P8MB 1FHGA 2NW2B 3I02A 3UEZA 2G75B 5MI0C 5JQ6H 3V79C 2JLLA 3VGBA 5L0QB 3KYOA 1CDJA 2G60L 4DQOH 4V2CB 4BSVA 3FKUS 1VPOL 1A3RL 1CD8A 1P7QB 5T1KD 5BRZE 1T1YA 1AHWC 3SDXA 4N0CD 1CLYH 4Y4KC 5AG8A 1I9EA 4IIQA 3LSOA 4IIQB 1OGTB 3WD5L 4HIJB 3TVMB 3TH3T 1MCRA 1K6QH 2ORBL 4PJDB 4A6YH 3L3KB 5GS0L 1HE7A 4YEFA 2BFVL 5HDBE 4PJGE 2NY5C 1MCPL 5BZWA 3LKPA 1XGQA 2JJWA 1JI2A 4D0DA 1J8KA 5K59F 1JHKH 2WIMA 1D3CA 3MBEA 2APTA 2BNQE 4IMKA 5KVDH 4MQXD 3FONA 4X8JB 2HFFB 3RJQB 3V8OA 3E6FA 2VDQL 3ES6A 1H0DB 2PNDA 4ZNEA 5DTFA 3PABB 4JG0L 3I02B 1YJDH 2B2XL 4NHCH 2I07A 4ZXBB 2VR5A 3PHOB 4LCWD 1G7MB 4I4WA 3CXHK 4S1RL 3ULVH 2YN5A 1OHQA 4YHOL 5IB3A 5E1AA 4ETQB 5T3XE 5D7LD 3FOMB 3HA0A 5C0RH 4XXDA 3RGVB 3QA3B 4ACPA 1OB1B 5DD5H 5C0AB 4LIQL 1AD0A 4NC2B 3GBML 3BZEA 4BH7B 1EA9C 4ORGA 4HIXH 5L2JB 6FABH 4XNZB 3VFSB 3FT3A 1EJOH 5K9JL 2Z93A 1S9YB 5B8CA 3EYQC 2HYMA 5C08E 3C60B 3MFGB 4XZUB 4MXQD 4H25B 4PGEB 5FYLH 1B6UA 5HHNB 5BVPL 2E9IA 5ISZD 4XZUA 4MMZC 3UC0L 4EN3A 4NPYB 4JLRA 4MAYD 2ZZUT 4L3CB 3OF6D 1KEGH 5IVXB 3Q6GH 5BCAA 1BM3L 1QOKA 2R4SL 4ZOEA 1PJ9A 1M7XA 4RMVA 4JFOB 3MV11 2DQHL 4RGNB 5A2IH 3KLHD 3QNYB 2EDTA 1WBZB 3VFGH 2QQNH 4PJXE 2MCPH 4JDZA 2ZKHL 3CNKA 1NCUA 1KIRA 3BPCA 4JFED 5ERWB 5TGBB 2F54A 5JLZB 4WFEE 3TYGL 1N64L 5E95B 4MJIB 1WT5A 2DDQL 2JK5B 5JOFA 1DJSA 2AJSL 5K9KB 4K94C 1RI8A 2E8YA 2YA1A 4RNRA 5GRXG 4N5EC 1PSKL 1M7IA 4NYLA 2I26N 3QXDA 2CO7B 3A6CH 3QXDB 4PRIA 1FV1B 2C4FT 3HE6A 4Z7WE 4DGYH 1CI5A 3PG2A 4OGYL 5C09B 4YBQC 2WBWB 4Y19B 2HAZA 5CMAA 4K2UH 3TZVC 5ITFA 1KYOK 2UWEA 4IBLT 2NY4D 4LEXL 1IAKA 4ZSOB 4RQQB 3PP4H 3H9YA 4EDWL 1FG9C 3BP6B 3UTSB 1YEJL 1H5BA 3AROA 1HHGB 3P0YL 5F7DB 5CEYB 4M7JH 4K8RD 1KCLA 1RJLA 4NJ9L 4ZUWB 5A2LH 3HPLA 3V6BR 2QHRH 4JFPB 1TCRB 4MDJB 4JN1H 2N7BA 2W0LA 2X4UA 1NDGB 1FFOB 3V7AE 3QB7C 1KPVA 5DD3L 1EEZA 3SE3C 4P59H 1JPTH 5KANG 2J5LB 3SOBL 3I75A 4PREA 4X5WB 3FB7B 1CGYA 1YEHH 3T65B 2FHBA 1KPUA 4ZUTB 4M1GL 2BNQA 4RBPH 1S5HB 3W39A 4OV5B 2Y7QB 1XGUB 4JM2A 3MROA 4WU7A 3DX6B 4NUJA 1BIIA 2OX5A 1CL7H 1YQVL 1IEAB 5D7IF 5C0CB 1KJ2A 3L9RB 3RWGA 1QR1A 2DAVA 4NP4H 1LO5B 4CW1B 1I4FB 1G7IB 5A3ID 3MV01 3DYPA 3VXRD 3EOAB 4OZFH 1JRHH 1JN6A 3GMMA 4OIIH 1F4XH 3D5OF 2E7LA 1T1XB 4NKQB 4DK3A 4QRTA 2ZJSH 4WI6A 3RNKA 3MZTA 4WCYH 5EUOE 4K3EH 3BE1H 2E27L 2GIYA 3RVXC 5J4MA 3VW3H 1OW0A 3WUWG 3B9KD 2F5AH 4ODWB 1HZHH 5DRNA 1WFUA 2H8PB 4JQXA 1D9KD 5C07E 5J6GA 2BJML 4GRLA 2WUCH 3OB8A 2MCG1 3O8XC 3U83A 1NGQL 2WNGA 4HUUA 5D1XC 4CVUA 5GJSH 5I18L 2XTJC 1M71A 2A74B 3RAJL 2MFNA 1B4JL 5KSUA 3DO7B 1MCEA 4HKXB 2B39A 1FFQA 1A3LL 4Y8DC 3U7WL 4PS4H 1R3JA 2IGFL 2DMKA 5D5MB 3TV3L 4F9LC 1QQDB 2J8UF 4CDHA 4G8GD 4Z9KB 1LO5A 3TBVA 4HBCH 2MHAA 1AKJD 4ZPVA 4L3AA 4GLRI 5F9WC 1R3LA 3BYYA 3BJ91 3T0EB 1WICA 3IDYB 1VFOA 4PS4L 1MCDA 4N0YL 4E41B 4ZFFA 2F5AL 1HWHB 4ZFFB 2AJSH 3QCVL 4CBPA 4FQCL 1RUKH 1JWSB 3OHXA 2PYED 2A9MH 5C86A 3HKFA 5A2FA 4X99A 3BFOA 4XCEB 3DHJA 4J4PC 3UPRB 5LJYH 1BOGB 4P5KB 3GRWH 5IKCB 3WFBH 1LGVA 4YQXL 5MENA 3AMKA 2UZIL 3DV4B 4KJPD 5F8QC 3G6JA 4O2CB 1FVDA 3QDME 2W0FA 1CICC 1VFAB 1Q9OB 1DEEB 3QDJB 2VZ1A 1UZ8A 2ZSWA 3GHEL 4YFEA 4DFIA 3O4LE 2HMID 4YXHH 2NXZC 3Q5OA 4Z76A 4UBDD 2EIZA 4ZNCD 1J8HA 4KI5C 2R56L 1C1EL 3MA7A 4U6XA 3VXSB 1NDMA 1VFMA 3G5XA 5FUZL 5KANI 4KK8D 3VCLA 3QQ4A 4G8GA 4CVWA 1NGPL 3KLSA 4WHTB 5C08D 3EZJB 3TYFA 3IJSB 4WI4A 4TSAL 1IGMH 5T1DH 4JLRB 2F53A 3NPSB 3O3AB 1JGVL 3QUYD 5H8DA 5BO1L 1AY1L 1U8PA 3BKJH 4MJ4A 1DBJH 1BF2A 4HKJB 1EMTL 3GI8L 5CEZL 1WC7B 4JREC 4RWYH 4TPRL 3ZDXE 3PWVB 3VFWA 2W91A 1PAMA 5JW5A 2AEQH 3H0TB 4OZHF 3KYKH 3WLWC 2B0SH 1OP9A 2OQJB 2OTWB 4K07A 4ZS7L 1MIEH 1YJDL 4ONHB 3GI9H 1P1ZA 3ZDZF 5KSAC 2J7LA 5IKCA 4N8CH 4JHWL 2GFBB 3ZZ1A 1ZT4B 3BW9B 4JKMA 3LQZA 2FEEL 5AAMA 5CD5D 1ED3B 3QIWC 5I15L 4YDKL 3A67L 3KPOA 3VH8B 3HZKB 3VRLF 1S7XB 1XH3A 5IBLC 1RZIB 3HI6H 3KPNA 1G7JA 4HK0A 5DUPH 3FFCB 1FZKB 4DGYL 5LAXB 3TIEA 3LEXA 1X4YA 2A83B 1KXQE 4A6YB 1KYOJ 4LSUL 2H2SD 2ICWI 4OFKA 3Q6FB 3E1F1 1R5WA 4C4KT 2WM0A 4JRXA 4ERSL 5GGTH 5JIKA 3RUGE 1YC8A 2OXGA 3O3AA 1QSFE 3WN5C 4ZYKB 2VTFA 3P77B 1FP5A 1EGJL 1S9XB 3KXFD 1YEDA 2P5ED 1OTSD 4LBEA 5DK3A 3TBSB 2LV4A 1J1PL 1SY6A 5BMFL 5DO2D 5I9QB 4IRJC 1ADQH 4AQ1B 5JZ7D 5JR1L 2D9CA 5EOCL 3DRTB 4GAYB 4DCQA 1A14H 4NHUB 1I8KB 1QLRA 3GSNL 2W59A 3TO4C 5FECB 4P46D 3QUZC 4LLDA 1CN4A 4GG8B 1RZIA 1F3RB 3HE7C 1KB5B 3IT8D 4KVCL 2UYLB 1LDPH 3IS1X 1JGDB 4M1DL 4M4RA 1ZMYA 1DANT 1QACA 3VFNB 3BSZH 2DLFH 3TO2B 1KEMH 1VHPA 3M1BB 1NEUA 1REIA 1E6JL 4MSWB 3VD9A 3F7RA 2V5TA 1T04A 2ED8A 1OL0A 2WWMC 4PY8J 3DVGB 4NQSA 5BZDB 3HR5A 2R2BB 5BVPH 1O7SA 2ATKA 2A73A 3H9HB 4NQVA 1BD2D 4L8CB 3C6SA 1NUDA 4WW2F 3D25A 4LLVB 1JF5A 1MLCB 3NBNA 5D2NE 5I1KH 5LGKA 5JW4R 2EE3A 3KPRB 5L88L 1IGML 2HP4A 1V3MA 4JFFB 5T1DL 5I19L 1A7QL 4NT6A 1A7RL 4Q9BA 5D2LB 5E00A 5DUBA 1KJMA 3KPPB 4JKLA 4BZ1H 1QNZL 4HUXB 3GSNB 2Z8SA 2VXUH 1T89A 1FE8L 4OFIA 1EAPB 3HNSH 1UEMA 2HT3C 4DVBB 2FO1A 5B38A 2KQNA 4L4VA 4RNRB 1CR9H 4HIIA 2BVPA 4KK6C 4DAGH 3QUMA 2FL5B 1UADC 4HPYL 4ORZC 4U7SA 4X6FB 2N4IA 2ORBH 3QPXH 4CU7A 4U49A 1H3XA 3EYSL 4PRPD 1U8LA 2E9JA 3C5ZB 3C8HA 3OR6A 2H2PD 4ELKB 3C5ZA 3LEVL 5D7SL 3ULUC 5DJXA 8CGTA 4G43B 4LRIC 3QIUC 4TUOA 4PJ9B 4CW1A 3WJLC 4FQCH 3L1OL 3MPCA 5H35B 4G7YL 5C0CA 5JQ6L 4M7LT 1G84A 3WD5H 1N7MH 4L4TB 4XVJH 2ITDA 3U0TA 5L88H 1V3JA 4Z0BL 4NKIL 3GJFH 1BJ1J 4YAQB 3WFHA 5I1KL 5DJ6A 4LEOA 1CK0L 1PG7H 3VXRB 5MENE 4P2OA 2C3VB 2FWOB 4Q58C 4HK3N 1A5FL 4B7IA 1GL4B 4MX7B 5JHLL 4NJAL 3Q5YA 3OB0K 2IG2H 5ICZA 3MUHL 4NDMB 1W0WB 2K7PA 5CGYD 2I25N 5KN5A 1U58B 4PBVC 5F93C 3PJSA 1QFWM 4Z7NE 2FIKB 2I24N 2VLRD 2WINA 3IU3B 4YBLB 1P2CA 4JY4A 2ED7A 2DQJL 4KJWC 1RZ8A 4OLZH 1FH5L 3ARDD 5TFSH 2R0WL 3QHFL 4G6JH 1K8DA 4JPIB 4XX1E 4JRYD 1ZWIA 4D3CL 3OR6B 1RIVH 1BVKB 3HAEB 3EO0B 3P0VL 3UDWA 4H8WL 3NA9L 3OGCB 3VMNA 1T6WA 4K9EL 2DWDB 3WIHA 2HVJA 4J3WA 1MFDH 3QNXA 4JHZA 5T1KA 1YEFH 3QT2A 3W5NA 3BPOC 4I0CC 4JQXC 4QNPE 3SKMB 3ARFD 4FTVE 4K7PH 4KROD 4X99B 1QZ1A 5B39B 3ECBA 2F8OA 3RKDC 2AJZB 1FAKT 2FECI 3DBXA 4U1IA 5M7QA 4LLMA 4YHMH 4KU1A 1DN0A 1NKOA 1JGLH 4Z8FH 1NCBL 3MOAL 4HC1L 3OX8B 2E8ZA 4RMWA 4NWUH 5EO0A 2EYRB 5DA4A 4HIHA 4MD5B 4NO3B 3OKMA 5TQ2L 3P4OA 4NO3A 1LVEA 4H88L 2VC2L 4JM2F 5FGSA 1C12B 4PJDA 3T2NH 1MCWM 4MVBD 3GO1H 1JF1A 4F7CB 2X4PA 4ZPTA 4M61A 4OTXL 3TGXA 4Z7UA 2OL3H 2OK0H 3M17A 1JMZA 3O2DA 1A7RH 4DFHA 1JNLH 5BS0B 5L7XH 3WFZA 3UTTD 4J12A 1YMMD 4XNMA 4BSWA 2AJXL 4R26L 4S1DD 2OZ4L 2W07A 1E4XH 5DD1L 3ZHLA 1HIML 4M8QB 5C2BL 1RZGB 2F9BT 1JGEA 3SGEH 5C0JA 4TPRH 3BDBA 4DKDC 5IMOB 4L9LB 2VLJA 3GEWB 4ZXBC 3GI8H 1VGEH 3DMMB 1EHLH 4PJ7B 4RGNC 1ZT4A 3BW9A 3O2WH 3DXAE 4LF3A 2MPAL 4WW2C 4LF3B 5D9SB 3DX8A 4W70A 1G9MH 5BW7C 5C0AD 1P4IL 4G8IB 5GRZA 1KB9J 4NBZB 1CE6B 4YZFE 2X4QA 1E6JH 2V2XA 1AQDB 2IPUK 5L2KD 5FOJA 5KVGL 2E9WA 5FUOH 2YC1A 2Z35A 3P3YA 4ZAKC 2FD6H 4FQQB 4WUUB 5JPMB 4D94A 3HZMB 2H26B 1I8IB 5T5FL 4MWFB 1N0XL 2E7BA 3Q6FA 1IZJA 1F4HA 2XTJE 1ZXQA 4KAQL 5KG9B 4DEPB 3QO0A 3QULB 4JM4H 2GEEA 2YWZA 4OLZL 2RBLA 1NFDA 4D0DB 5ICXA 5E8EB 5ITBH 1KELL 4UV7H 1WIUA 3N85L 1AO7B 1C7TA 3MV9D 5HGAA 3VG0L 3MV9E 3AS0A 4KQ4H 5HGGS 1K4CA 4PLKD 1MHHA 5I2IB 4CVXB 1N2RA 2A0LC 3HC0B 3DX8B 3U30C 3R0NA 2GJJA 1ONQB 5FYKL 3G9VA 4D9RD 4XCNB 4HG4K 1U3YA 1ROWA 3KYOB 5E1AB 1N7ML 3DI2B 3JWNC 5EZOH 4GUPB 1QEWA 2VLKA 1U8MB 2Y25A 5E08H 4G6ML 5JA9A 3HUJE 4U1MB 3WJLA 1MVUB 3BKYH 4MD0B 2EYSA 1UXWA 4U7KA 5D7IE 4RGMC 5GRJH 3LEVH 1CFSA 3DUSA 4Y4KB 2B2XH 4NHCL 3QG6B 3RBGA 4MS8C 5E8OA 4HAFA 5GS1B 1BF8A 1IGCH 5F88A 2ATKB 1FYTA 5LCVL 2Z8WC 3VI4E 4DAGL 4B5EA 3VXPA 4NQSB 5CLWA 3BH9A 5AYUH 3ROLA 3IDIA 1AO7A 5IVXE 4FMKA 4OKVB 4XPGL 5TQ0H 1X3DA 1RURL 2IALB 2PETA 2P4AB 4I77L 4YPGB 4Z0XB 3H3PH 4X9FA 1F4XL 1RK1A 1JRHL 2CLZA 4WWKD 4ZXBD 2AI0H 3B8YA 3VGFA 2BFVH 3BVNA 2LE9A 3HLAA 12E8H 1AC6A 2I5YL 1TZIA 4LAQL 3DUHA 5ISZE 1Q72H 1T66C 4ZOBA 4LLDB 1E28B 1RFDL 2BNRB 3M1BA 1ZK9A 4DK6A 5DVNA 2F19H 3RPIB 3CZFB 3IRPX 2P24A 1WCBB 4F7TB 2UYLA 2CKBB 4M1GH 4WO4D 3FO1B 5KS9B 3BISA 4PPTA 4FP8H 4ORGB 1A6ZB 1D6EA 2F74A 4OLWH 2XTJB 3BPOB 4BH8A 5F1IA 5DLML 4P59L 5C6WH 3WFEH 2YPLB 3UROR 4WU7B 3VRIA 3RWDB 2OSLA 5FO9B 4YIQA 3VFTB 3AM8C 3MREA 4LSVH 3K0WA 4JFQB 2VKWA 4K7FB 4KVCH 1LO4H 1XZ0B 2CLZB 2VWEE 4N0YH 2BVQB 4WFFD 4QF1A 4EDWH 1UVQB 5F44A 1RZFH 2B7DT 4R96B 1HXYB 1JUFA 1N6QL 2CIIA 3IDMA 5DQJA 5LQBL 2EZ0D 3D2UD 1JHLL 4MDIA 2BNUB 4UU9A 2BVOB 3SDDB 2MKWA 3SBWA 3PWPB 3OR7B 3T77A 1KLGA 3L3DA 5EO0B 1LMKA 4AY0A 4K3JH 4ODWA 3ARTA 4HFUH 3MJ7B 3MNWB 3Q3GB 1MJ8H 5DXWA 1XCTA 4LVOC 5B4MD 1F2QA 3FQXB 2WZPD 1HWGB 3QDJE 2P7TB 3ZO0A 4N8VA 4UINL 1KOAA 1XGTA 3U4EA 1KENL 2AK1L 2IAMB 4Z0BH 4GAGH 2X9YA 5J11B 4OBSA 3HC4L 5C9JB 3OKLB 4GRWB 4RMSA 1G6VK 4TUOB 1BIIB 2X4RA 4KJWD 5D72L 5IQ7H 5GGSB 3OKYA 4DN4L 1KIPA 1F90L 3MV9B 5IJKC 2DQTL 2UUDH 3LDBB 2EDRA 1CLCA 4OCSL 4WHTA 1JTOA 1BQLH 2ZKHH 5D1QB 3MLRL 4GT7A 1WGOA 1V05A 4L9DA 5J7CC 3L95B 1FIGL 3SY0A 1R3IL 3QIBD 1T4KB 1VGKA 5F9AC 3QIWA 1NGWB 1BX2B 2ZG2A 4X4ZA 4V1DB 1RIUL 1AD9B 1K5NA 4K7PY 4YNYA 5J13B 1E6OL 3OKKB 3UO1H 5I76A 1BFSA 5I8OH 4TVPD 1DQTA 5SWQA 5L8JB 2WQRA 3KYKL 2FIKA 1WT5C 4MNQD 2EDQA 5I1DA 1KPVB 3F8UB 2EDXA 3MXWL 4GRLB 2FO4B 5C0BB 2LU4A 4G8EA 1XF5A 4BZ1L 3BI9X 4PJFB 1TNNA 2P5WE 4XCYA 1S8DB 1BIHA 3BMWA 3FO9B 1DEEA 3DSFH 2H2PC 4WIQA 4HIEA 1MVFA 1P4BL 3T0DA 5GS1C 1NGPH 3MA7B 2BX5A 5BS0D 1A4JB 1OGAB 2X7LB 5DD3H 5T3ZD 2IMNA 2FCBA 1WIPA 3K8KA 3BQUB 5JOPE 1Y0LB 5INDA 3CSBA 3QZWG 4CDGC 1HI6B 3D18B 4HS6A 1MIMH 3RIAK 1OAQH 1XR9A 1A6UL 3MLSL 5I1IL 4WWKB 4YXHL 1W72A 5AUMA 1WK0A 4Y5VB 3D3VD 4G6KH 3MYJA 3DPBA 5JTWA 5E70A 3DYOA 4QT5B 4HGWB 2Y06H 2H1PH 2X1XR 3BJLA 4LK4A 1CDHA 1HQ4A 1HXMB 1HQ4B 1J87A 4U0RC 1P4BH 3R06B 4IRZH 3WXWL 1KIRB 3CC5A 1Z0NA 3N06B 1SM3L 1A1OA 5K33A 3LKNA 4J3VA 1I8KA 3MO1B 3V0WL 5J6GB 2XZCH 3G6AA 4YHIB 2YUWA 3SHSA 2IQ9L 3O4OC 3MLPA 2WBJD 2ICCA 4Y16B 5DR5H 4I0PA 3VH8G 1B2WL 4LLQB 4PD4J 3MC0A 4X6CF 3S96A 3RZCB 2WK2A 3RDTB 3BD3A 3OG4B 3RU8H 4XCCH 5T3ZH 1RIHL 4JM2C 3L3OB 5J0BA 3MV7E 4P3DB 1YYLL 1Y0LA 4ODTH 4EN3C 3WSQH 5INDB 1CFNB 1I1AB 2DM3A 1RULH 1XAUA 4HCRA 4JFHE 4OF6A 2IF7A 1FFPB 4BQ6A 4GG6B 43C9B 4LLUA 4NZRH 5HVGB 1RU9L 4NO5A 3UZQA 2EXWC 3ZE0F 4IRJD 5HGDA 2AK1H 5DO2C 3HLAB 3KYAA 1BBDH 3NCEB 1GGIL 4HGMA 3O11B 4QXTB 4R90H 4F15B 5C0EB 5DTFB 5HYJA 4RAUB 1EVTC 3T4YB 3I3EA 4G9FD 5FF6A 1S78C 2DJ4A 5FF6B 4G7VH 2ENYA 3T8XA 3PHOA 3DVNB 1Q9KB 2R0LH 2VQ1B 3ESVF 3UMTA 2YZ1A 1I7ZB 5F9JB 2H2SC 1NBZB 3DURA 3BPNB 1IBGL 2C3WA 4Y2DC 2L0DA 4PJCF 3SQOL 1F02I 4K55A 4QCIA 4AJ0A 3PGCA 1L9MA 4YK4C 1EHAA 2CLRA 1NMCC 3CGTA 3PGFL 1AXTH 2FJGA 4IOIB 4Z5RA 1UH2A 4YX2H 1EFXD 1AGDB 5GSRA 3HN3A 1T66D 4L3CA 4OCYL 1G6RH 1GGCH 1G9NL 3QEHB 3QIWD 2G5BA 2Y6SC 2VDQH 1YMHB 1IL1B 2D2OA 1KNOA 4YHZH 5IT2H 3ROLB 3P4MB 3V4VH 3E8UH 4GMTH 5DDHB 3S3SA 3RGHA 1YPZE 1ZE3C 4UU9B 1EO7A 1S7VA 2QQKH 3ARDB 4MA7L 1K4CB 5GGVL 3NCYP 3VJ6A 1HINH 3WNKA 2APFA 4W81A 3U0PA 4XVTL 2I9LB 3ZDXF 5E0QA 4X4XB 5DHVB 3ROOA 3MCKA 4F7TA 3SJVD 1J10A 4LAQH 2DL2A 1QBML 4U1LB 3ARYA 3SE8L 1Z2KA 3CCHA 3DVIA 4MB5A 3T0WA 4RWHA 4FQJL 3KYMB 1FN4B 4GUPA 3GIZH 3UJJH 4DN3L 4GSDL 3QWQB 4RDQG 1FV1A 4LCUB 3H3PL 1AJ7L 3VXME 1MI5D 4UT9L 5DQDL 4FABL 2HRLA 4GMSL 1QO3A 5KVEH 4W4NA 1NFDF 2QSCL 1G7IA 1JNNL 4HJJL 5EO1A 2G2RA 3KHOA 1I8LA 4Z7UF 5FCUL 4BFEA 1GC1C 3TBWB 3QI9B 4R2GD 1EHNA 3TBYB 1B4JH 3BH8A 2ZUSA 4YHYB 5JDSB 1JPGA 1Y18A 1SY6H 2D0FA 2FX7H 1ZTXL 1OAKH 4ZFGL 3O6KL 3WS6C 4ONGH 4Y1AD 2QQNL 3HPLB 1R0AL 5EU5A 3G6JB 3U2SA 4LSRL 1YNLL 1JZ8A 1RZKL 2X4UB 3QWOB 4LGSB 2BSED 4N9GB 3GMNB 2CRZA 1KG0B 4HV8A 3ULVD 1Z9SA 1JPSH 3RI5F 4QHMB 4EOWH 3W5MA 1OARL 1KIPB 3A0OA 5F7HA 3NFPB 5K9JH 1J11A 3HCVB 1IEAA 1UKSA 5DJCB 5EPMB 5FDYA 3TLRA 1INEH 1IAKB 4LHUA 5ITBL 3ZYJA 4WWKA 1JZ6A 3MROB 4M03A 1IC4H 4WFGD 3Q1SH 4RMTA 3TEUA 5F7EL 1D5IL 3VXQB 5DJ0B 2QLVB 4Z78B 5FB8A 2X70B 5CINH 1U93A 1BJ1H 3HPJA 1TJGL 1VEPA 3MRNA 5DS8A 1MAJA 5HBBA 1QRNA 3KAAA 1MFNA 4NKDA 4RX4A 5FHBL 2ARJQ 3UAJC 5CWSB 3BIAX 1RMFH 2V6HA 5DC9B 4NBXB 3W0WB 1CU4H 3WE6A 1MWAL 3MMEB 3I6LD 3B6SA 3FT4B 2EKSA 4L3EB 5C71A 1OTUC 1X5YA 4KY1L 2G75A 2YUVA 5DUML 5AZEL 3PWPA 4JFFE 4F7EA 2QHRL 1M71B 4Q7DA 3BP5A 3PQYB 4JVWA 5BVJB 4BZ2L 2GUOA 3O6FA 5JHDA 5D70H 3L3GB 5IMLB 3SQBA 5C3TA 2VZUA 4NKMB 3B9EA 2AAVA 3D39A 4FQJH 3WS3A 2MJWA 5C08B 3ME0A 2VDRH 3WKMH 3PV7A 2R2EB 3ZKXB 4LARL 3V5HB 1CDGA 3MJ8B 2BSTB 4O58L 2HKFL 1RZGA 5ELIA 4HWBL 3MV9A 3UPAA 3CK0H 1BQHG 1NCAL 3A6BH 4DUVA 1W2KT 2ICES 2XQYG 4YGAB 3RKDD 1MPAH 4TQEH 4PV9B 3TO4A 3GDBA 3CX5J 4LCCB 4UI2A 2NR6D 1T0NB 2CXKA 3OTTA 3DGGA 4M9OA 4NQXA 5FV2A 1QLRB 3ARGA 4MNHB 4NC1C 2HKHH 1FVCB 4XAWH 3BGMB 3VRJB 1I1CA 2QL1A 3BO8A 4HUNB 4J23A 3P0VH 4YO0A 4UT6H 2M1KA 5IEHB 4JO3H 4MD5A 4AL8L 3OXRA 3O6FB 3QRGH 1D5XB 2CKBL 5IF0B 1CZ8L 2EDKA 3LEXB 1JF1B 2EC9T 1DBKL 4PRBA 3JSSA 1VB9A 2ZCKH 1TJIL 3LKQB 1XGQB 1G6RA 3EOBA 3FCTA 2HFGL 4PGEA 3TNNB 3JWOH 3GKWH 3LKOB 5HDBF 3HZVA 3RVTC 2Q6WB 2P45B 2IQAB 1UWGH 1DUZB 5IHBA 3CSGA 4KUZH 5I8KH 2VLRB 1NGZA 4TOYL 2JJUA 1BZ9B 1U8JA 3CDCA 4HJGA 4OCWH 3WHXA 4XNZC 1RIVL 3AREA 3IXTB 4JVUA 2ADGB 4M00A 1UWGL 1YMMA 4H1LA 4MJ5A 5DWUL 3P9LA 5B39A 5E9DA 4ZFZB 3H2WA 3P9LB 1UACH 3ZHKA 4R9HA 5C09D 1J1OL 1P1ZB 1UQSB 5D5ME 4JZJB 5DUBB 2XNAB 4ONGL 1KTRL 4LHUG 1Q94B 1ZLVH 4AIOA 2YD1A 3QIUD 2Q86A 1KCSL 4GBXC 3TP4A 4UQ3A 5F71A 3I84A 1F42A 3WCYA 1NEZA 1BGXL 5KVMC 1S7RA 2C4XA 1FNFA 2QQLH 4OUUA 1FNLA 5L8KB 4KZDL 4PLJC 3TN0A 5F7UA 4HPYH 3RWJA 4WFHD 4PRBB 5L9DH 4LSPH 3EW3B 3FQWB 2FJGB 1LDSA 3B4NA 1B0GA 2Q6WA 3B83A 2GTWB 1PG7X 5I1LB 4AMKL 2A73B 4PJIF 5J1SC 4G7YH 4F37F 4ZAKB 1MCSA 3DV6A 1TENA 5E2VL 1L0XA 1RV6X 4K8RH 3MLYH 3QDMA 4X7CC 1MFAH 3X3GH 5J3HD 2KL6A 1MLCA 2I27N 4JQVA 3GJFB 4U0RB 2VQUA 3HI5L 2JJTC 1GPOL 2OXHA 4O2FA 1A9BB 1CLYL 3MRKA 1YPZF 5CHNA 4FFWD 2R0ZH 4KZDH 4ONFH 3I6GA 1S7UB 4Y7MA 1PG7W 1SEQL 1FO0H 5CGTA 5DJDA 2FHFA 4PGCA 4LKCB 3ARDA 3MLSH 2D4FA 4JREB 1J1XH 5AZ2H 1I1FA 1GCFA 4NN7B 3O4LD 1S7WB 4XP1H 1EEUA 3D85B 4K71B 2EXYD 4M5YH 1JWUB 3QA3A 4OLXL 5E2WL 3MJ7A 5CJXA 1FL6B 4JGMA 5E6IA 3LKSA 3B9VA 4LCUA 4YPJA 3C5JB 2V9RA 1KEML 3ABZA 1OSZB 5TE6H 2GJ6A 4WU5A 2VDLL 4Y4KD 3VXUA 3G9AB 2EH7H 3QEHA 4KJYB 3P77A 3FQTB 3MV7A 3MV7B 4LQFL 4JVPA 5F89B 2VDML 3UBXA 4FQ1L 2G5RA 4G80A 3D25B 5LXGL 4ZUUA 5DK2B 3O3UN 2FGWL 1C5CH 3HG1D 3EDJA 5GPRA 1JPGB 3FFDA 2DBJA 3C08L 1RUPH 3QRFM 1FPTL 4NSKA 4XCFH 3RQ3A 3O2VH 3BKMH 3O45B 4FZEL 1FVEA 2OYPA 5IEKB 1F2XK 3GSNA 4AYFA 3RVWD 3RIFK 4YHKL 5TE7H 2K1MA 3P4NA 1Z0MA 4I5BA 1X5FA 2XPGA 1NSNL 4Q9CA 3D85A 4U1SB 1Y6NR 1YNLH 4L4VD 4H0GA 1KACB 2V7HA 4NZRL 5HHVL 3GHBH 5IW6B 4ZFOA 5JZ7C 1C7SA 1P5UA 4HCRL 1E4WH 4KZEL 1OAKL 5DFWH 2AV7A 4FZ8L 3EO0A 2NY1C 3OKLA 1OGAE 2PO6C 4XGZB 4A2MA 3FHAA 5IIEB 4F57H 4EEEA 4K94H 2W60A 2DWDA 1UJTA 4M6OL 1T1WB 3N0PB 3GM8A 1K2DA 4I18B 3T3ME 5IBUB 3MA9L 5TDNB 3JWOC 3RVVD 3WL9B 4GKZB 4CU6A 3QI9D 3WLWD 7FABL 4JPWL 2R1XA 4PP2B 4Z0XA 1DL7H 4IRSA 1CFQB 4V1DA 1H5BB 1CVSC 2BOBB 3GZKA 3BZFB 5C0BE 1U91B 5DJYA 2DKSA 2XWJB 3HE7A 4OZHB 3OKKA 4KMQA 4BELD 4XCEA 4G9DB 2W0FB 5DUPL 1E27B 1TZGH 2C3VA 2FWOA 4XMKL 3GIZL 5IBLD 1SVCP 1UCBL 4J8RB 3PJSB 3FB8A 4NNXB 4HUVB 2ILLA 1AH1A 1PYWB 3EGSA 3V4PL 5FM5O 1NAMH 4PTTB 4MJID 1DUYB 5IB1B 1FCGA 4GRLD 2YRZA 2PCPB 1J1XL 2L7UA 1U6AL 4X7DC 1KSRA 1ORSB 5ANMB 5ANMA 2FLBT 2HT2C 5J9PA 2J3SA 3UTZB 1W72B 2J8UE 3FTGA 2E6QA 4P3CL 3LQAH 1MCBA 3GJEB 4X9IA 3W9DA 4HS6B 1C16B 4NFBA 3QUYC 3DLQR 2A6KA 5GGRY 2HLFD 3OXSA 2HJFA 2VXSL 3HS0B 2WUBH 1RJYA 6CGTA 5D1QD 3S37L 4B0MM 4J4PD 4XPFL 1MFAL 2IANB 2H45A 4E41A 5I74C 1QYGH 4KK8C 4YFLF 5EZLA 5MI0B 3O9WC 5DHYA 4X8XA 1A6VL 3S6CA 4N68A 3VXNA 5DJAB 1ES0A 5JXEC 1QFPA 1TITA 3LQZB 1MI5E 5MEOB 2DKMA 4AIXA 1IVLA 2C1PA 1JRHI 5E9DE 3QG7H 1SBSH 1KF9B 2VABB 1YMME 2GSIA 4MD4B 2A0LD 2ESVE 2QQLL 3PL6D 3QDJA 2XIDA 2X4QB 3BIKB 1VFAA 4OGXL 1GHFL 1SQ2N 4Z7OF 3OBAA 4HWBA 3VCLB 3MLRH 1CXHA 2O5YH 3CDGA 3CZJA 1I7TA 1F97A 4Q74A 3E3QE 4WEBL 4WY7H 1RUKL 2Z93B 2ARJB 2BCKA 5KBNC 3SGJC 4OGXH 2DI7A 2RCSL 3QQ4B 1AGCB 1K8IA 2DYPA 1TETL 3QQ3A 3RTQA 32C2B 5IJKA 4HS8L 4MZ2A 4WUKH 3HZYA 4P4KA 2PW1B 1RJZA 2EYTB 3KXFB 2HFEB 2ESVB 4LCIH 3AU1A 3QWRA 5E9DB 4ZUSA 3ULVE 2F5BL 4P2RA 1YMMB 2ZJSL 3CXDL 4K71C 3ES6B 4HFUL 1BZ9A 1U8JB 3I2CH 4MQ7A 4QXGL 5E4IA 5EN2B 4WI8A 5ADPL 4JKWA 1DDHB 2XTJD 4OF3A 4QGYA 3D6GA 2FJFB 5D1XD 4DW2H 5CCKH 4J1UB 3L3HA 3O8XD 2WUBL 1M4KA 4V1DD 1MFEH 5JOEA 5ADOL 2CDGA 5CUSH 4LMQE 1ZLUH 3GMPA 1QHOA 2F8VA 2Y72A 4HIJA 3TVMA 4UIMB 3BE1L 3RWJB 3VW3L 3AFLA 1RPQA 5GGUA 1BECA 5GGUB 3KNBA 4LPYA 4GMTL 4OCRL 4Y5YC 5FUOL 3WXWH 1J88A 4WHCA 3MGTA 1J0ZA 3MV8A 1QRKA 1Q0YH 4FQQA 2GITA 1V7NH 3QXUA 4PJ5E 4JGJA 4KHTH 3VRIB 3I6LE 5J1AB 3WO4C 1JWMA 3HR5B 1X6NA 3QR2A 3VI3F 3ZL4H 4EBQH 2Q8BL 4KKNA 2HRPH 5D7JA 4DOHE 3S8WA 3CK0L 4CU8A 5ADOH 1OSPL 1UVQA 5D9SA 5H2BA 3FL7A 2NCMA 3CFIC 2NW3A 1DL7L 4N0FA 3NIGF 1U8KB 1X4ZA 5CCKL 2BHZA 4HGKC 4O2FB 2O5XL 2WLYA 5EULV 1MLBA 3CMOH 2W9DL 2KBGA 4PGCB 5JOFB 2AQ1A 4XPAH 1Q1JH 4EVNA 5T3XL 3V4UH 4F9PC 2NTSP 1FL6A 5L2KB 2XICA 5E2VH 4KKCC 3G5YB 3UTSD 2H26A 5E24E 4NO0A 1MNUH 3UZEA 3QO1A 2XG5A 2IAMA 4NJ9H 4ODUA 3DSNA 1WAAA 5SWSB 2E3VA 3B9KA 4QHKJ 2YPLD 1BQSA 4HF5H 5JORB 3VXUD 5HHVH 4Y5VC 1D5MA 5I1AB 1QSED 4CVZA 1FNGB 3H7BA 3N1FC 1INQB 1FNGA 3H7BB 2NYYC 4XI5C 4GBXA 4C55A 4L4TA 4R7DA 4KXZI 4UMGA 4FZ8H 2IALA 1F8TH 3MRIB 1S9WB 1WBZA 1CIDA 1OQOA 4HCRH 4JN2A 2IEPA 1U8IB 3UBXB 3SEPA 3NACH 5HTSA 1IC4L 5SX4I 5AD0A 4DKAA 3FJTA 1DQQB 3NMEA 4X7TB 5F7DA 5CEYA 1HEZB 3LZFL 4G8FA 2CDEB 4Z7QF 5EUKB 3U82B 4LNRB 3GMQB 1TCRA 3PWJB 4MAYC 4QRQA 1H3PL 4EVNB 4JFEB 1OARH 1NCCL 4MXQC 3BWAA 4GRMB 4FQ1H 3OAYH 3VWJA 4TOYH 5MEPA 4NNYB 1ZGLB 5DRXA 1JPSL 5BRZA 4U1LA 2JJSA 2OR7A 1ZGLA 5C7XL 3RWHB 4WTXA 1RUPL 3IRZA 3M07A 5SWZA 2DQCH 5F1NB 5HI4C 3VWJD 1A7NH 2MCPL 2VIRB 5TE6L 4GH7B 5IFJB 2GY5A 5ACMA 1XGPB 3RNQB 2GCYA 3MLXL 1N6QH 1QQDA 1N5AB 4PJBA 5B3JE 2V7NA 5I71C 4EI6A 3VXTB 5GSVB 4PJEA 1P53A 4S1SH 3QUXA 3ULUD 2ZUYA 3ZTJG 2BP3A 1VACA 3PIQA 3MRIA 4OQ1A 3HNVL 4Y2DA 1KCVL 4M48L 4X0KA 3IDMB 1QBAA 1HXYA 3X13B 1CK0H 1PG7L 2XN9D 1KIQA 1P4IH 4NQCD 3LMJL 2XWJA 2ICWB 3HE7B 4OZHA 4X6EA 4YGVB 1CBVL 2IPTH 3L5XH 4I9WE 5I8CB 2YOCA 4ZQKA 4Q6IB 2IAMD 4MA8H 1NLBL 4W68A 5LBSH 4NRZA 5D71L 2DM4A 4MNGA 5CBEB 2IH1B 5I71B 4J2XA 3HI5H 5IEHA 3IAGC 3STBA 2OZ4H 4IOSD 4XPTL 5SV4A 3V9FA 3MGOB 5GGSA 3X14A 1A3RH 4L8SC 4XPHH 2VXTH 4CGTA 2X4NA 4PJ8B 3LS4H 3OL2A 3E8UL 5DI8B 1E4WL 4JFHD 3AXLB 2VXUL 5C0JB 3OKOB 5AYUL 4KRLB 2NLJB 5DGQA 1FFRA 3O4OB 4PRNB 4RDQF 4MNQB 4OGZA 3G6JE 4M7KL 1LEGA 2D9QB 1D5ZB 2EO9A 5T3ZE 2HWZL 2R2HA 4XMPL 4UDUB 4C58B 2DLTA 5ACZB 4FFYL 4OD3L 5HDOA 2X5PA 2GSIB 4MD4A 3HE7D 1BLNB 4RAVA 5EOCJ 2XKNA 2B4CC 2Y1VA 4P46C 3TO4D 3R8BB 3BDYH 4I0PB 4U4BA 1F3JB 4D8PB 3KPNB 1AO7E 3FRUA 3ALWA 3P4OB 3PQYA 3V95A 1RZKC 3HZMA 3Q2CA 4QY8A 3DURB 1QSFB 4NM4L 2R29L 4TTDC 5IR1A 3S36X 4OCWL 2ZCKL 4XC1H 3DXAA 3O3DA 1OTSC 4OZGF 3L7FB 4GRWF 3BZDA 3CX2A 3ILQD 2VXQL 3P73A 1CXFA 3IDNB 4Y5XA 1CG9B 3K8LA 2P47B 4UT7H 4NZUH 1A02N 3QRGL 5IVZA 1HSBB 2AJVH 4D3CH 4S10A 3BZ4A 1BQHA 3MRQB 1YEEL 3BZ4B 2ESVA 1CTNA 2ADGA 3AMLA 3KJ4B 5GRVK 2JELH 2OR9H 5CS7A 1TJIH 7CGTA 5B39G 4PJ7A 4ZG1A 1ZSDB 4PJ9D 1MUJA 3BXNB 1XIWD 2EDOA 5HYSB 2Z92B 3K1DA 3K4AA 4LOUC 5HHXH 3U46B 2GSGA 1XF5B 2VXTL 3CX5K 5TF0A 3QAZC 3VA6A 5IGXH 3MRHB 1N5YL 2YD5A 2I9TA 3OZ9H 1Q0XH 2ADJB 3NZ8A 2W65A 2ID5A 1KTLA 5BVJA 5IF0A 4N0UB 4LLAA 1GJIA 3OXRB 3QDJD 2OTUB 4RAHA 4K8RL 4XBGB 3UYOD 4O02H 4DKFL 4XNQA 5F1SA 2FIRT 5IHZA 3QPQD 1EERB 4JY5L 5FCSH 5C09E 1FLRL 4U3CA 3ZYIA 4QHKI 4HMDA 1T04B 1X5ZA 4GQ9L 5TQ0L 1CFSB 5CD3A 5EA0L 3CH1B 5I17A 2ZUVA 1GH7A 5CJ5A 3A67H 4RBPK 1MFBL 1UH3A 4KKLC 2VUOA 1ZA6A 2A6DB 2BNRD 3P9MA 4OGAD 1I75A 4Q2ZB 3L7EB 5ACLA 4MCYB 3C87A 2AKRB 4ZS7H 4XNYL 2Q8BH 5IOPB 4MHHG 2AEQL 4TNVK 4EI5D 2B1AH 3HC0A 4AEHH 5D93C 1BFVH 4HG4J 2FX9H 5IESL 2GQHA 4ODSH 3STZA 5EUOB 4PJXB 5EZOL 3ROOB 2D31B 5I30L 2RB8A 2WBJB 2D31A 3FQUB 4LFHG 4J7RA 3L3IA 4AG4H 1DSFL 5GHWL 3QDGE 3QEQA 2DICA 3IKKA 8FABA 1G9NH 5B38B 1T2XA 3TZVA 1GGCL 4Q0XL 2A83A 2FBJH 1EXUA 2UZXB 4Y5XC 5AWNH 4JFDD 3TIEB 4QHNB 1NCBH 2BVYA 3MOAH 3GMPB 1JTTA 1JGLL 3ZKXC 1MAML 4PY8I 1D5IH 5HHOE 1R5WB 3LPGA 1I1AD 1TQBB 2XKSA 4BUGA 2AABH 4M7ZB 2NNAB 3DTXB 4PJGA 3RVUC 3QUXB 2IH3A 2BVUA 3RWCB 4LSRH 1UGNA 4W6YB 3LEYL 1AR1D 4P48A 2VKXA 3MZGB 3QI9A 4JN2B 3VXQA 3ZKMC 1CT8A 2XACC 3RNKB 4Z95L 5E2UH 1NC2B 2F5BH 2FX7L 5GRUH 1YEIH 4M43L 3U7YL 4OZGB 4M93B 4GKOA 4QHLB 1BZ7A 2V5MA 4PJCA 5DJ8A 3U9UA 3GSOA 3OG6B 5F7MC 4GJTB 4YDJB 3BP7B 1KB5A 4S0TD 1WFOA 4GG8A 4WV1A 5GS0C 3NTCH 3RBSA 2X4TA 3VFVB 3DMMD 1NBZA 2QSCH 5CBEA 4BK4A 3L3JB 4GKSB 1HHHA 1RUQL 2DBLL 2AJ3B 2QBWA 5D7JC 4RFOL 3PWNA 5MEPB 2GTZB 2PR4L 1L6ZA 3AAZA 1IM9B 4QHMA 3AM8A 2AV1B 3MQIA 4M9PA 4TVPE 1CFTA 5DMKB 2MSPA 3CFDA 5IW3A 5EOTB 1BVKA 1MHPL 3G6DH 1UWXH 3MRFA 1CIUA 4BFBD 1FFNA 3DGCR 2JCCA 4GMSH 3QUML 4WUUD 3TCXA 5F3BB 3QEGL 4CVZB 3VFPB 3TN0C 3IDIB 3MODH 4K23L 4PJFE 4OFYD 2NTFB 5D70L 1DQDH 3L5JA 5E6YA 3ZL4L 5C9KA 4DN3H 5DT1L 1QRNB 2HH0H 2LAGB 2FATL 3MRNB 4NSKB 2NX5A 1MCJA 1YY8B 3TBYA 5HSFA 3EDKA 2YPLE 5A16A 1L0YA 5KSAA 3EDFA 4OUOA 1CD1B 2Y06L 1DLHA 3O3BA 1UJ3A 2ZCHL 4KC3B 5BQ7B 3QFJA 1MJJB 1I1FB 1UWXK 3E2HB 3MACL 2KQMA 3LOWA 4WEMB 2WV3A 4ZSOE 1GOHA 1P7HL 4O4YH 4NNYA 4HKXA 5CJBA 5IBUG 3DO7A 1EIBA 3D9AH 1DUYA 1D5BB 3QJHA 5SWZB