3BFOA

Crystal structure of ig-like c2-type 2 domain of the human mucosa-associated lymphoid tissue lymphoma translocation protein 1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
85
structure length
85
Chain Sequence
SKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structure of the Ig-like C2-type 2 domain of the human Mucosa-associated lymphoid tissue lymphoma translocation protein 1.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bfoA00
4DKFH 3D85D 4M7KL 1FLRL 3CNKA 1FVCA 3U82B 1QBML 4RMVA 3NFPA 4CVXB 1EHAA 4QCIB 5DJCB 1ZGLM 5CJBA 4PY7A 4HUMB 2AI0L 4LPYA 2IPUK 1F02I 4OJFH 2BY1A 4N90E 5KN5A 3ARWA 3DETD 3VH8G 2ADFH 1AGCA 3IKCB 2BVOA 2BNRE 5ANME 5CUSH 3SGDH 3QXWA 3DYPA 2VLRD 5C6PB 1MFDH 3GFUA 1BGXL 3LD8C 2GSGB 2VZVA 3DMMB 3STBA 1IC5H 1NH6A 3T65A 2XA3A 2QQKL 4XVSL 4HUVB 3MRHB 3VWJC 2NY2C 1D5XA 3SKUD 1FAKT 1G9MH 4OGYH 1A7QL 2HLFD 4HH9A 5CGTA 5SWQB 5J11B 4FNLL 2DBJA 2R0LL 3L3GB 3FRUA 4YBLC 2CDEB 3A67L 3RHWK 4B50A 2V9QA 3MROB 1BVKB 3QFJE 4W70A 5E8EA 1BPVA 3OKNB 3C2AL 4DCQB 2VXSL 3ZKSD 2H32B 4P46D 5EOQL 6CGTA 3G5XA 4I0PD 4JDTH 2HT2D 5DO2D 5IIEB 4P4RA 3D3VD 2DQTH 3MJ8B 1QBAA 2UY7A 4PJAA 1RPQA 3GMOA 5DLMH 3PNWA 3T04D 1DBAL 4F2MA 2ZUWA 1HKLH 5JOPD 3CFDA 1FN4A 5E6YA 4F8QA 3ULVD 1EMTH 3T4AA 2HAZA 3CDCA 2DKUA 1Y6NR 5D6CB 1X6NA 3OKEA 3V5KB 4L5FL 4ZNEE 4E0RB 3REWB 1BFVH 3FJTA 3MNWA 2ENSA 3BKML 3PF2A 5AAWA 2VIRB 4HFUH 4OZIE 2O61B 3O11A 2P24A 2NCMA 1DDHB 1T0PB 5D96B 3WN5B 4EJ1C 4R0LB 1CBVL 1U8QA 2L7JA 3OG6B 3CGTA 1RZ7H 1MCCA 1WIUA 2VH5H 4LRIC 4PJ7F 1TQBB 1ZWIB 1B4JL 5DS8B 2H2SD 4NKOA 5JZ7D 2GTWA 4NBZB 4D0BB 2E9BA 3I6LD 3FB6A 5E94B 5JW4R 3MUGA 1A6WH 4UDUA 4DK3A 3OBAA 5DJ2A 4NQED 5IWLA 4Q2ZB 5SWSD 4BFIB 1QLFB 2D03L 3GMQB 4GAJL 1RUPL 2HFFB 4XPGL 1ZEAL 3T0BA 1IMHC 3RZCD 4XX1E 2VITA 4GAGL 1Q72H 3SDDD 3EO0A 3MLVL 4NT6B 3HPLB 4BQ8A 1XR9B 4HUKB 4BYHA 1CGSH 32C2B 4I0KA 3FN0H 3OKKA 5I1IL 4DUWA 3GMNA 1IGCH 3PWPA 5TF1H 4YLQT 4G6MH 3TV3H 4GS7B 5EOTB 4WENB 5C6TH 1OAYL 1MRDL 4YHIB 5IFHH 4ZDHB 5JTWA 1C16B 3VW3H 1MI5A 2EIZB 4IIQC 5IW1A 5LGKA 5F88A 1QOKA 1KTDB 5ISZB 3BZ4A 1M6OA 1U8HB 5DJ0A 5E7BA 4FRWA 1U41A 5FF6B 1UB6B 3EYOB 5DJAA 4G6KL 3V5HA 4JG0L 5FA3A 2ZG1A 2VE6B 5EUOA 3P2TA 2BK8A 4X6CF 4W6WB 3V0AC 3GMMB 4ZFGL 3IVKB 3RGVC 4LDLB 1EVUA 3QEGL 4F7TB 4IRJC 2WWMC 4MCYB 2DQDH 3OAYK 1T20A 4PRHD 3FQNA 3GMLA 4Z7OE 2D31A 3LQMA 1ND0B 1JRHH 3S5LA 3ZKNC 4JFPB 2OQJA 3AY4A 3MOAL 4L8DB 4CGTA 4Q97A 2QL1A 3BEVB 3HPJA 1CICC 1OARL 3GSVB 4NN6B 4MA1C 3F58H 4NM4H 2N56A 4LVNB 2ZCLL 4XCNA 1IBGH 3U1SH 3MRPA 1KCRL 4KK8D 2R56H 2V17L 3W81A 5C0EA 5I8EA 4MD4B 3B9AA 1EH9A 4HV8B 3CJJA 4DW2H 2DIBA 1T5WB 1I1YA 4OF7A 4QF1B 1RD6A 2EDQA 1FZOB 5IBLC 4J8RA 4BUHA 2ZOKB 3OR7B 1IEBA 4UTBH 4TOYL 2VAAB 1OAXL 2B4CL 3FT3B 1V05A 3EBAA 5F89B 3WXWL 5F7MC 4JFOB 3AS2A 5DQDH 2PYEB 4EN3C 4IMKA 2AQ3A 4Z0BH 4MB3A 1U95A 3WFBL 4LOUC 3ES6A 2BY2A 3GGWB 1L9NA 3C60B 4QGTA 2XIDA 5HVHB 4LIQL 3T3PE 3QQ9D 3D39B 2C3XA 5F1IA 1J87A 1KC5H 2OSLA 1CFTA 1BD2B 2PR4H 4O9HL 1MJUL 3EYUH 4Z7VA 4G8EB 1X7QA 5C0GA 5DQ9A 5J9PB 1PY4A 2YPVH 3NFSL 1R3HA 3PWPE 5B38A 1NGZB 5IK3A 3SN6N 2DWDA 3FFCB 1A6ZA 4NHUB 1HCFX 3ARVA 4Y8AA 4ZS6D 5J1AB 3VFGL 4OKDA 1G84A 1TIUA 4TVPL 5F7LB 4WJ5A 1MI5E 1JPTH 1REIA 3MMEB 5L8KB 1S8DB 5JXAL 4XP5L 3LS5H 5SWZD 5ALBH 5I66B 3BYYA 3OAZK 5MEOA 5C3LD 1UENA 2UV3A 2EE3A 4QRPA 1H9VA 1AD9A 3QG7H 2G9HB 5AG8A 3TEUA 3TZVD 1LD9A 5IFAL 3DX8B 4AJ0A 2JB6B 2DIJA 1WWCA 3OL2A 4PJHB 1IVLA 2VWEE 1T1YB 4FXLA 4GUPA 4ODWA 1NAMB 1NMAH 4U6VL 1IQDB 2ZG2A 4I8DA 1ZVHA 4JRXA 4YHPB 3TNNA 4OF6A 1URLA 4XWOD 5I15H 2DQCH 1S9VB 2ZPKH 4BM7A 3DBXA 4R4BB 1GZQA 5EO0B 2Y06H 1HDMB 4NCC2 4OZFG 4QOKA 4ZAKB 2VC2H 4Y16D 5EU7C 3JTSB 1JNJA 5DA0B 1IZJA 4LEOA 4QHNB 1BZ7A 1BJ1J 3C08L 1CDBA 4JJ5B 2VLLB 3ME0A 4RFEA 4PY8I 5T1KA 1YPZB 4P0DA 5J6HB 4OZFB 1FRGL 4NQCB 1F4XH 1JYWA 3LEYL 2KZ1B 1QR1A 3FAXA 4NCDA 1T80A 4JE4B 4X5XB 4GG6F 3P4MA 4Z7WA 5HYJE 4L3EB 3IGAB 5CD3B 1KCVH 2EH7L 5L7XL 2H3NB 1I1AD 1WCQA 3MV8A 1S7SB 3B8SA 2SEBB 4TRPL 12E8L 3QDMA 4Y4HB 2Z8VC 4PJ9D 5JIHA 2EYRA 4X6DA 2CKBB 2P47B 5I1KH 4G9DA 4UILH 3ARDC 4CDGC 3EYSH 2X10A 2LE9A 4Z7VE 1BQHA 1MHCB 5H2BB 4U1LB 3O2VL 1EO8H 3E8UH 3LHPL 4QRSB 5GGVY 1YNKH 4JKMA 4EOWL 4P48A 5CIPA 1P4LA 4XP4L 5C09D 3WS6C 1WBYA 4APQD 2XZCH 5CBEA 3GSOA 3QJHA 3DURB 2EYSA 1P7HL 5EO1A 1Q0YH 4QRPE 2JJVA 3HZMA 4M61B 4FQIH 4MMXC 3RL1B 2PO6C 4GKZA 1OP3H 4LL9A 4NSKA 3MACL 1J1XH 3LKSB 1T4KA 4C4KT 2IH1B 5GGQL 5HHQB 1FYTA 5CIPH 5DEGB 1V5JA 4MXWL 3F7RA 5CGMA 5JXEC 2DDQH 3D18A 2O5XH 4XPFL 3JV4A 3QQ4B 3I6GA 1IAIH 2YC1A 3CPLA 1F58H 4UU9B 4DKEL 4QOKE 1TVBA 3TBSA 3PGDB 4UDTB 3U4EA 2KL6A 4U1NB 1R3LA 2I9LA 4OD2A 3WIIL 4JPVL 4KMLB 3QIWD 4Z95H 4NHCH 2A0LC 3GJFK 1JYNA 2IQ9H 2PXYD 2R4RL 4JQXC 3VXSB 1LO0L 3MUHL 3ARTA 4QTHB 4JZNA 3PL6D 1BBJA 1IGYA 2B1AH 3QI9B 2AQ1A 3EYVB 4Z7WE 4R4FH 4AQOA 3PWJB 3STZB 3KPLB 1WTLA 2F8VA 5HHMB 5KVEL 3QO0A 4NJAH 3JUYA 3MV8E 5KSUB 1UZ6F 1BWWA 2NY4B 3QDME 4PJ5D 4LSQH 4MXQD 4KU1A 3N1FC 2VLJB 4PG2C 1EEZA 4KKAD 1AHWA 4DGIH 2X4UA 4L3AA 5CMAA 1K8DB 4R7DA 5T3XD 1I75A 4YGVB 1G7QA 5E99L 4TUJA 5HGDA 5LBSL 2Q76B 4OCYH 3W0WB 1U3HD 2WBWB 5T5NG 3C8KB 4GSDL 4NO2B 2ZNXA 2V7HA 2J8UA 2R2BB 1KELH 4JFQB 3WJLA 3O6FC 2EIEA 2HLAB 1U8JA 3QWQB 2ITDB 5C0RL 4I3RH 1NUFA 4E41A 3BDYL 4RAUB 1NLDL 1NCBL 3BAEH 2YUZA 4BKLB 4L8SC 5CUSL 4PR5A 2DM7A 4JO4H 3T2NH 3MGTA 1O5DT 3ULUL 2IPKB 4Q9CA 2VDPL 5F7EL 4UT7H 1FYTE 3MLTA 1MIML 2YD8A 1UH3A 5I17B 3IFLL 3D2UD 4LSSH 3RVTC 5GS0C 2V2WB 1BIHA 5IQ9A 3GMPA 4HWEL 1IARB 4RGOH 4NZRH 1VFUA 1A6AA 3O3AA 1WT5C 1NDGB 3E6HA 3QO1B 3U4BL 2VTFA 4HCRL 1MJJB 1XCTB 1OD9A 4PTTA 1RK0B 5I73C 3RTQC 3UJJL 4H8WC 1TETH 4MGXA 5FUZH 4LFHG 3DX9A 1F6FB 1C8PA 4Q0XL 4IHOB 3Q6GH 1A7PL 4RMRA 4LSRH 3ARQA 1EXUA 1HKLL 4Y88A 4HLZH 2J8OA 4MLIA 4V1DD 3G6DH 3THML 2XTJE 4XNXH 2JJSC 5BS0D 2OXHA 15C8L 4FP8L 3BKYL 2IFFL 3QZWA 5D72H 4S2SB 1INQB 5EU6A 4FQ2H 1A4JB 2W1NA 4U3XA 4JEGB 3BPCB 4EDXB 2D7OA 5EPMA 1MFAL 3LZFH 1T1XB 2FRGP 1F4AA 1B90A 1UT9A 1YYLL 4ZUVB 4AM0B 3H3PL 2J8UE 5CCKL 4XVJH 5JO5B 3V5DA 4P9HC 3AREA 5E5MB 1V8HA 3SO3B 4YHML 3F7YB 4MQTB 4XPAH 2QADD 2AGJH 5I1DB 3SKJL 1E6JH 4E41E 1F3DJ 2UUDK 3RVWD 5HGHB 2P49B 2ZWLT 2GT9B 3QA3B 3WNPA 4LLWB 1A9EB 3KPPB 1MNUH 1Z5LA 3BGAA 2VYRE 1LEKA 3TA3C 2AERT 5CSZB 3VDAA 1J1OH 1LWRA 4ZXBD 3TFKC 3S34L 5IFHL 2BX5A 4G6FB 3I6KA 1QSVA 4RMUA 1ZLUH 5B8CB 4YE4H 3B9KA 4HWZB 3UCRA 3ZE1E 1KB9K 4MS8D 3FT4A 1U3ZA 1U42A 2RAMA 2Z93A 3L9RB 1OP9A 2IGFL 3S9DB 3BP6A 5HD8C 1BAFL 5DGRA 3EOAB 3OZ9H 4XTRC 5BV7B 5D7KE 2VSDA 1DJSA 2PYFB 2WINB 5IBTH 3P30H 1R5VB 1VCAA 3FT2B 3MRLB 3MCKA 1SYVA 4L4TB 1KENL 3FTGB 4PJEB 1I7RB 1HWHB 3QEHB 5JPNB 1Z6JT 4EDWL 5SV4A 1I8LA 3SDCB 3C6LD 5GJSH 4WIQA 5D9SA 3TN0D 5EU6E 5GS2H 3AMLA 2DBLH 3NCEB 1QHPA 3G6AA 5LKNA 3VD9A 1YEGH 4NZDA 4NZTH 1DBBL 3IDNA 2R56L 4GKNA 4F7PB 3HZVA 4BSVB 5CFHA 1HINL 3SBWC 4PLNC 4J1UB 3BN3B 5KZCB 1DLFL 3UXFA 1GJIA 1MCOL 4DN4L 2X4QB 2PW2B 1HQ4B 3PQYB 1N6VA 3KYMB 1PKQB 3LOWA 4UTBL 4KWUA 3HMXL 4FQXC 5GGRA 4ZD3H 4LSVL 5DFVD 5TDNA 1TJHH 5JORA 2ZUXA 4G9FA 1D3CA 1DQTA 5F96L 3SDAC 3DX7A 3O45B 4ZPTB 1U6AH 2OLDA 4DOHE 2IBZX 4K8RH 4HG4J 3HC0B 1JE6A 5EU3A 2PR4L 2VDKL 3HG1B 3V0WH 4LHQB 5DWUL 1KULA 2DQEH 2ARJQ 4XCFL 2C4XA 5JUEH 3GSNA 1N5AA 4N8CH 5E8OA 3RX8A 1XGTA 3IFNL 1YNTB 5F71A 4RGNC 1EZVX 3AM8A 3O4LB 2E27L 2EKJA 3FN9A 5GS1A 3G6JA 3ARFB 4XP9L 2AEWA 4X8JB 5I1JL 3ZDYF 3LS5L 1XT5A 3QHZH 4GQ9L 3CDFA 1HHHA 5ALBL 3QDJA 2ESVA 1YC8A 3N1MC 5SX5H 2OZ4L 3IJHA 4O2EB 2FECI 4PJIF 1DEDA 1G7LA 4ELKB 2GK0A 2VJXA 3BO8B 4WW2C 3GSNH 1ETZB 5ADPH 3VXQA 2PCPB 4TULL 5J3HC 2VQ1B 2CDFB 1CL7I 4LRIA 3CZJA 3UTTA 1IQWH 4MAUH 1OAQL 3DARA 4JHWH 5I15L 1UZ8B 3MGAA 1MAML 4OLVH 3K80A 2XYCA 4MCZB 4D3CH 2VC2L 2NZ9C 4BQ9A 1JP5A 4KI1A 2AVGA 3WFEH 3K8MA 3E3QC 1YQVL 4GW4B 3TT3L 4QHLB 3VRLF 1LILA 1X6LA 4YK4B 1INEH 1PX4A 4EKXA 1S3KH 3O8XB 2M26A 3AS0A 2XKNB 4U1JB 3MJ7B 3SHSA 3ZO0A 4QNPE 3GSQB 4HX1A 3DXAB 4ZUWA 1LO2H 1VGEH 4DJMA 1CXLA 3QDGB 3VH8A 1IGTA 4G9FE 4OCSL 4EI5D 3WDIA 3VXRB 5CLWA 1XH3A 4NBXB 3L6FB 2HFGH 4WWKC 3M1BA 2VN7A 4IIQA 5DRNB 4GRLC 4UILL 2X70B 4M6NH 3CAFA 2RIKA 5HDBF 5GGSB 5BV7L 3EYSL 3L95A 3MUZ1 1ZSDA 2JIXB 4AH2B 3HUJF 1EO8L 1NCWH 3LMJH 1UJ3B 3CFEA 1IGMH 3BVNA 4X6EB 3OJDB 4WTWA 1JWSB 3HNTH 4DCQA 4A2MA 3RGVA 1E4WH 4XBGA 4IRJA 3G6JE 5IVZB 5FM4A 4BFBD 5FGCB 5DYOB 3TBVB 4M1DL 3PWVA 3MJ8A 3QDJE 2ESVE 5BO1H 3TYFA 1Q0YL 3WO4B 5J12B 3PIQB 4PJBA 4K3GA 4YXKH 2VDLH 5BRZA 3SJVA 5MI0C 1MAKA 3UYOD 1R24A 5I30L 5D7LA 5I1EL 5I18H 3C8DA 2PETA 1QPXA 3V5KA 1AGFB 3H2WA 1TLKA 1KB5A 3REVB 1JHLL 3OXSA 4Z77A 4JDZB 4AL8L 5IGXH 1OGAA 1BVLB 2QV2A 2DDQL 3UTTE 2O5XL 3OKDA 5T33H 1FSKB 3DETC 4LNRB 1LO5B 2WLZA 2MQ3A 1DBKH 5E9DB 1MCPL 2B2XL 4Q7DA 5D1ZA 4XNYL 2DQHH 4Y1AD 3MLZH 3MQIA 5IKCB 1KB5H 1MPAH 4WCYH 5E94A 5HHXH 4LARH 2FJGB 4OIBA 5HDOA 4XH2B 4BFIA 1VENA 4G8IA 1YECL 2CRZA 2R0ZH 2MSPA 4YUEH 2HLFC 2Z0BA 3TYGH 2F5BH 5C0CD 4R26L 1WC7A 2QSVA 4NT6A 2Z92B 1XR9A 2EIDA 4LSQL 4N9GA 4ZOCA 4JHBA 3O0RL 4KHXH 4NQVA 5D1QD 2VLKD 3HAEB 3EJJX 4DGIL 2BDNL 3UTSE 2NY7H 2IMNA 4S0SD 2HT2C 3MRBA 4YHIA 3HC3H 3DVGB 5DO2C 3B3IB 3S6CA 4P2QB 3ABZA 4CJ0A 4BZ2H 2IAMB 1U8IA 1DUYB 5SX4I 1MVUB 5ISZA 3ULVC 5I1AB 1A2YA 2X4PA 5K9JL 1H3GA 4Y5YC 4M7JH 1KELL 1FVEA 1JHTA 2YHGA 3EOBA 3N1PC 5C1MB 1OGTB 5HHVH 3MV9A 3RPKA 3IVKA 5IMMB 2VB5A 4GJTB 4X5WA 4PJXB 4PJBE 5DMKA 4PJGA 5DD0H 3JV6B 1J8HD 1EBAA 2HFTA 3OGCB 4FTVD 4JZOB 3SJVE 5BRZE 5IHZA 2F5AL 3DECA 3EDDA 5D7LE 1EEQA 3FONB 1YN6B 1ZS8A 5ITBH 2H2SC 4JFPA 2DLTA 3O2WH 5D5ME 5JZ7C 3SCMD 1ZMYA 1CE1H 2IG2H 4JLRA 2NY1D 5JW4Q 1FC1A 5ETUB 1OGAE 1CDUA 3LIZL 3MOBH 4L9LA 1I7TB 1NL0L 4LSSL 1DEEB 5I75C 2BXZA 4QXUH 5DC9B 5ITFA 2R29H 4RGOL 1YJDC 4G80B 4OGZA 1I9JH 3RZCC 1FZOA 3SDDC 4IRSD 3W9EA 4WV1C 1BF2A 2H8PB 1P1ZB 3FT3A 2Y1VA 4CL7A 3O9WB 1IAKA 1TZHA 4HJJH 3KS0H 2X44D 4OM1H 5F7KC 2X05A 3NAAL 3Q6GL 4R3SA 3D0LA 1XIWD 5GGUB 4HUWA 4PGDB 1VGKA 1QRNB 4M7ZB 4PJFA 3EW3B 1BD2A 2BRRL 5IF0B 4N8VG 4JG1L 4XVTH 5KTEH 1LE9A 4M1CC 1WITA 1EHXA 3VWJB 4PGJA 4JAMB 3MRMA 1KLFA 3LRHA 4HIIB 5I76B 2L4OA 4YBLB 3UZQA 3QWOB 1CZ8H 1UB5B 5C0BA 3G08A 3QUMA 5I6XB 3LN4A 4AK1A 4F33A 1E4KC 1A5FL 1F42A 1M05A 1AXSB 3LH2L 1MHEB 1JCKA 5D7JA 1L9MA 3PHOB 5EBWA 4Q9QH 1P7KA 5C0IA 2VL5A 2PO6A 5IHLB 2MCG1 3WFHB 4JFDE 3UROR 1U8PB 1UADC 2R0WH 1X44A 1E6JL 1ORQA 5EZLA 3MV9E 3RBSA 5JHDD 5E6IC 4NOBA 3FO0H 3QUMH 1II4E 1QFPA 2EKSA 4PJGE 4KUZH 1VEPA 1UQSA 1LK2B 1JWMB 2ICWB 4XGZA 1EHNA 5IB5A 1CDCA 2YN3A 5DI8B 5GRUH 4OKVB 3M8OL 4B41A 1A1NA 4ELMB 2ZP0T 3S96B 4R90H 1T3FB 3C5JB 5B3NA 4H0GA 4OZFA 3TBWA 4DQOH 4ALAH 3QQ9C 3Q2CA 4LLYB 4D0DA 2WW8A 1A9BA 2VR5A 2Q6WB 1CGUA 3CLFH 3EYQC 2CXKA 5ICYA 4MJIB 4XCYA 2LAAA 3OZ9L 2YPLB 2EXYD 3VD5A 2CKNA 4HT1L 1NC2A 5AD0A 4KZEH 1DLHA 3BP4A 1WBZB 5HI3D 1OAKL 1JNNL 4ZS6C 1L0YA 3FOMB 4GBXD 1CFQA 2DLHA 4PJFE 4PS4H 4OZFH 5INDB 3ALXA 1QZ1A 3F7PC 2XQBL 4OFYD 3U46B 4J4PD 3ALWA 3NCYP 1MHCA 2BVUA 2HJFB 1CVSC 5H2BA 3FQTA 5FUCE 5GJSL 3EOTH 2UZIH 4U1KA 3QULA 1JGEA 3TZVC 1ZHNB 2LU3A 3OQ3B 4K3EL 5C0BE 4MDJA 4NZTL 1SQ2N 2YA0A 3VJ6B 5JMRA 3A6BH 4WO4B 5FKAB 1JTPA 3DURA 2DD8L 4L8SA 2FSEB 5D7IE 5JDSA 4TTDD 5IB4B 5IW6A 1YEKH 3VGFA 2AEQH 4L4VD 3T08A 4MWFB 5GZND 4X9FA 1TQCC 4XWOC 3IXAB 4Z78A 5KG9A 1MSPA 1KJ2B 4X7CC 4ZD3L 4O5LH 4LLVB 4JRYA 3UTQB 1RI8A 3BRDA 3NTCH 1GOGA 2Y23A 3OAUL 5KS9A 1U6AL 3LKSA 2IH1A 3G5ZA 4Z7UB 4XP6H 2ZSWA 4S1QL 2V2TA 2IANB 4N90D 2OTUB 1CICB 5CJOL 1LVEA 4MA1B 4O4YH 3V6FB 2VISB 3L3DB 5HDQH 4UU9A 5DRZB 2XN9B 2Y36L 4N8CL 2BNRD 1I1AC 1PD6A 4ETQA 4HAGA 4F15C 5MENB 3MCG1 1N3NB 4YHKH 2IPTH 3RWDB 4PJ9C 4D9QE 3ARYA 4X99B 4CJ1A 3RDTB 1AIFA 4LCUB 1WCBA 3UBXI 5E8DL 2HN7B 3KLAA 2E7LA 2G2RA 2FH6A 1UCBH 3OB0K 4WDIB 4TUOA 5DMIH 2N7BA 2Y25A 3FQWA 1FL5A 3RVUD 2JJSA 4EN3B 3U0TB 1C7SA 3TT1L 4BFGA 1DTUA 4F9PC 5KSUA 4PREA 5I8CB 1P7QB 1FHGA 2DKMA 3GSNL 2AJYL 5EOCL 3QFJD 4H8WH 4PJCF 5ADPL 3DLQR 3U9PL 4LPXA 4GMTL 3X3FH 4APQC 1RUQH 2VXTH 3EZ8A 1OQOA 4I48B 4JHWL 1JWUB 2P8PB 1NFIA 1RZJH 1H3XA 1ZT7B 3SE4C 4YAQA 1P69B 4OLVL 3OPZH 3DO7B 3IETB 2V5SA 4U0RB 4GW1B 5KJRL 4NGHH 5EFIB 1L6XA 2Q7YA 4UUJA 2CO6B 4I3GA 5JQ6H 1BF8A 3H0TB 1E27B 4MQ7B 4NO2A 1EFXA 5ACMA 3WFEL 1MHPL 1CFNB 2DTSA 1AQKH 1QTYT 2Y72A 1S3KL 4ZTPL 3EJZD 3KPQB 1S7QA 3VMNA 4LKXA 1K2DA 2CIIB 1KYOJ 1JI2A 3RBGA 2YD5A 4BKLA 5ALCL 1UM5L 4X9BA 3HB3D 1TZGH 1FZMB 3HMWL 2A38A 4XC3H 4LRNL 5K9QI 2DM4A 3OSKA 4JRYE 3TPUB 4I5BA 4FXKA 3RIFF 3Q5OA 1LDSA 2F53A 4EQ3A 5KS9E 2DKSA 4PRNA 4UQ3B 3QIWC 2ED8A 1S7XA 5TE6H 5FHBL 5EU4B 2AK4B 4M00A 3PL6C 2OP4H 4XNMB 2JF1A 4HJGA 1ZT4B 3IJSB 2NLJA 4LMQE 1X5AA 3NIFE 2R2EA 4XT1C 2WWKO 3ZHKA 3K7UA 3CMOH 2YD9A 2UZYB 1MIEL 4OQ1A 1OPGL 3MX0A 3X3GL 4BUGA 4MXQC 1OM3H 4NO5B 2E7HA 5D8JH 1TITA 3I9GH 1DE4B 4KKAC 2NY5C 3IDJA 5DFTA 2DAVA 4HFWB 5TE7H 4OLUH 3MLYL 4HIXL 4IS6A 3MYJB 2HG5B 1AI1H 1MEXH 1FORL 2H41A 2QQLL 1X5KA 4LSUH 3HCVB 2W65A 1BMGA 4NPYA 2HT4D 4CMMB 5LQBH 5D70L 4X4ZA 5I18L 3GMRB 4OLZL 5F9AC 1JN6B 4M62H 1U3HC 1ITBB 2X6MA 3FFDB 3ARDB 4OCXL 5IVOA 3BI9X 3GBLA 1A4JA 1J86A 1KJ3L 2J6EL 1KJ2L 4YDJB 4OT1H 3BPCA 1T2XA 5CGYD 2FZ3A 5JW3H 5T33L 1RJLB 3E0GA 1ZANL 1U8LB 2M8XA 5D2NB 5BOZG 1I7UB 5C07A 4GRWB 3OWEA 5A1AA 5FK9B 2GEEA 3I84A 1EEYB 4M6AA 3RNKB 1I7ZB 3TNMB 3QBTB 4RMSA 2KQNA 1GGIL 4KQ3H 1S7UB 1KB5L 1QSEE 1OCWH 2MCPH 5FDWB 5FECA 1PZ5A 3MRNB 1B0WA 4KJQC 5ICXA 3PG2A 1UH2A 4WFHE 2R0ZL 3BUTA 4OF8A 1OB1A 3MLXL 1T7VA 4YUEL 3JTTA 3QCUH 4ZUTA 1F8TL 5FKPB 4K94H 1A7NH 1N2RB 1I85A 1MFNA 1A9EA 3RL2A 1B2WH 4ISVB 4KHXL 4OI8A 3G5YB 5C08A 1Z2KA 2F53E 5CSZA 4EIGB 4WI3A 4F7EA 4EVNA 2NY7L 3VFSB 5C2UB 3ET9F 2NW3A 1Q94B 3A6OA 3MRCB 3DRTB 3P77A 1T1WA 4NUGH 1YEHH 3KR3L 4XCCH 4X4XB 5ELIA 2O26U 1IAIM 3WCYA 5T1LB 4Z6AT 4XBPA 4EZMA 3S7GA 1U8KA 3HI1A 3QT2A 4NKQB 5KSAB 1NBYB 3UMTA 1RY7B 4TNVF 1JVKA 1PFCA 4FXGA 1MQKH 3NCJH 1MCBA 2NR6C 1QSFB 4WW2A 3BW9A 4CNIA 3FO2B 3PWPD 4F7CB 1OT2A 1UG9A 4MLSA 1HHJB 3RP1A 5LWYL 1R5VA 5BJTA 3L3JA 4KI5F 4LLMB 5EDXA 5E08H 2D0GA 5DD0L 2RFXB 1FBIH 1CXFA 1MI5D 5DC0A 2HH0H 1N0XH 4L4TA 4JQIH 5DRWB 1MLBB 1I7RA 1HXMB 1CLOH 4PV9B 3RWJB 5C0DB 3QEHA 4KQ4H 1NUGA 2CPCA 4LCIH 4I2XB 3W5MA 5IUSA 2EEBA 3EDJA 4DVRH 5HVFB 3BH8A 4G8GE 5IVNA 2A73B 4HUXA 2QADC 2PNDA 1NGYB 1XR8A 3VMPA 2HA1A 5EO9A 1H15B 3GIVB 2W59A 5FA4B 5IR1B 4KFZC 5C07E 2QTEA 1I9JL 4J1UA 3RVWC 3VGEA 3MNZB 1D9KB 3QNYB 3Q1SH 1I9RH 1XCQA 1RZFL 2X4QA 3O6FB 1HQ4A 1KG0B 4MQXD 4NRXA 3GSRA 2YXFA 3OXRB 1R0AH 4DUVA 4JKLA 3U7YL 4HJJL 4ZXBC 3VU2A 3V6ZB 2XZAH 4WHTA 1HIMH 5A2LH 5KSBA 5IBUG 4C55A 4XB7A 4GG8A 2HRPL 2Z91B 1A1OB 3ZDXF 2ZCHH 3OKYA 1B6UA 5D2LB 1N59A 4MS8C 3PABB 4XVTL 5KTEL 2BSTA 5GGSY 1F97A 3P4NA 1LP9A 3PP4L 5CLTA 1P2CB 2P5WA 3CIQA 3J8F7 5C08E 5IT2H 2Q8AL 4X9GA 4KMTL 3ZKXB 2EZ0C 5IQ7H 4GLRI 1U8MA 1E6OH 5E03A 5FM5O 1LE5B 5DEZA 1JPFB 3BE1H 1FVDB 2B7DT 3O6LH 1V3KA 2J8HA 3KYNB 4HGKC 2PTVA 3NFNA 4CMHC 2GJJA 2XWBB 3NACL 5CP7B 3RTQB 1FFNB 5I73B 4O02L 3MRQB 8FABB 2G75A 4MVBD 2DQIL 3V95A 1NPUA 2IALB 2WK2A 4ODUA 2WQRA 3CUPA 2R0WL 3TN0C 1T0MB 3RIFK 3VWKD 4ELKA 5D71L 3V79C 2YPKA 3U30C 2JJUA 1ETZA 3STLB 2Y7QB 5KANI 2VQ1A 4ODXB 2CDFA 2D4FA 1NCAH 4FG6D 2F54B 4NRZA 1UZ8A 3JWOH 2CH8A 3TGXA 5HVGB 4QRPD 4UINH 3OGOE 3E3QE 1KJVB 2P8MB 3LEXA 5KAQF 5DFVC 2C7UB 5FYKL 4P57B 2ERJC 2CK0H 1KT2B 3Q6FB 1K4CB 2JB5H 3MNVB 2ID5A 2HJKB 4YWGL 3OKMB 5GRWA 4LAQH 2GTZB 2NW2A 3BZEB 3P9MB 4OD1L 4JRXD 1TCRA 4HBCL 5GQBA 3GSQA 5I8OH 1FZKB 2HTLD 2WANA 3B83A 4HQQH 2NZIA 3W82A 4QOKD 1IAOA 4DVBB 5KSBE 5E8NA 5DR5L 4KDVA 4QYOB 1BFSA 3MJGX 4ORGB 5KVDH 5T1KD 5E5UB 2R39A 3EYFB 3TA3B 2X70A 3QCTL 4PS4L 4YHOL 1KTLB 1RURL 5GGSA 4OZ4A 3TJHC 1OAZL 1TNMA 2JIXA 1KIPA 4IDLA 4Z0XB 1LP9E 2NTFA 2P5WE 2UZIL 3MV8D 2YA1A 4P2OC 3RWGB 3QDMD 4IOIA 1YA5A 2R23B 2CO7B 2X4OA 4ORZC 4PGBB 2I9TA 3FO1B 1KLUA 4NFBA 3PWLB 1MLCA 1SBSL 2X1WL 4PRDB 3UTZA 1I8MA 5IM7B 4PJ7B 2GFBB 3PJSA 3VXPA 4D0CA 4H25B 5J56B 4O5LL 4M1GL 2P45B 3DX6B 5F7HA 4ZPVB 4FQHA 1JUFB 3KYOB 4LGSB 3QRGH 1AGFA 1M71B 4YIQA 1QO3B 3K8KA 1OSZB 1KTKE 1AD0A 4LCWB 1N7MH 2ARWA 4Z5RA 1RFDH 5F9WC 4CBPA 2BNQA 1BVLA 4N0CC 4W4OA 3RU8H 3U7WH 4U7SA 3WYRA 4CW1B 1IC1A 2EDJA 1RZGB 4K71C 2ORBH 4H88L 1RUKL 1NMCC 3DV4B 5LCVL 1PX3A 1BBDH 2OTPA 3RRQA 1H8OA 4TNVK 1PLGH 3KHQA 4ERSL 2GJZB 1B0RA 4AIZA 2ICEB 3SPVB 3KXFB 5F3BB 4ZTOH 1A22B 4EI5C 3ZSTA 3U6RA 2KKQA 1FYTD 4FQXB 1UCBL 3EO1B 5GS0L 4Z7OF 2RQ8A 3TO2B 1DL7H 1ADQA 4OSUH 4WTZG 5HJ3B 4NQSA 1SJHB 2P1YA 1BX2A 4Y4FA 2DTML 3SDAB 1OWWA 1WVZA 1XZ0B 5FCUH 3ARGA 3HE7B 5FO9A 1DN2A 2EDTA 4P59L 4H8WL 5CZXC 3MRRA 3GJFB 1IGJA 4X6CB 1I3RA 2E8ZA 3ELAT 2D2OA 2VXTL 4QRUB 4P2QA 5CKAA 1QLRB 4PRBA 4AQ1B 4WU7B 1QEWA 3VA6A 4FQLH 4HEME 4BZYA 3IU3A 3RWCB 2EE2A 4RGNB 2I24N 1J1PH 1ADQH 1G9NH 4LU5L 1E0OB 3GHBL 2OX5A 3ROOB 4L8CB 5JQ6L 3FB8A 4NUJA 2DOCA 3KYKL 4UB0L 2XTJD 3SDXA 2RJMA 4MHHI 5E6IA 2P7TB 4WI4A 1QVOB 2H1PH 4U6TA 3VXUB 4ODHH 2NY6D 2I25N 3U9UA 3CFBA 4HWBL 4XCEA 1SJEB 1WBXA 5DDHA 1BIIA 2P5EB 3MJ6A 3O3BB 3GNML 1Y6KR 3MGOA 5EZJA 5AUMB 4H1LB 5HI5C 3I6LE 4P9HL 1AH1A 5C71A 4Y19B 3KPNB 3MUY1 3MR9A 4RGMC 2BNQE 1Q9LB 2OP4L 3EDKA 4E41D 3GI9L 3MV7A 4WGWB 3ULSB 5GRYA 4KROD 1T0NB 4X80L 1YYMH 2NY3D 1RIVH 1H5BA 4NRYA 5C7XL 4RIRB 3BSZH 3O81A 3IFPB 4NWUH 5KW9L 4P4KB 5CKGA 3LSOB 4MJ2A 3I9GL 5D1QC 4ENED 1IM3B 4ZOBA 3O9WA 4OLUL 2MQ0A 4X7DC 1J0ZA 1WEJH 2CGRH 3HNVH 5GHWL 1S9WB 1P4BH 1MEXL 3S35X 1JGDB 1PG7L 2OJEB 3VGHA 3E1F1 1QRNA 3PGFH 5DJDA 1FAIH 1L4IA 3IS1X 3JVGC 4M8QB 4UOW1 4WWKB 3BIKB 1HILB 1MCNA 3SGDI 2MPAH 3RQ3A 4LSTH 1N8ZB 4K3DH 4PBWD 5KSVB 2B39A 4N8VA 2Y6SD 5D7KD 2GSIB 4IMLB 3JUZA 3KPRB 5ILTL 4P3CL 5JHLH 1Q1JH 1CD1B 1RIUL 1ZLWH 5I16B 3GO1L 5L9DL 1C5DA 4BK5A 3SDXE 1WAAA 5ID0A 3B2UD 3ILPB 2G60L 4KQ3L 2MCPL 1JGVL 2OL3B 4PG9B 5EU6D 1GGBH 1ZXQA 2OR9H 4LLAA 1Q9OA 2QR0B 5MI0B 2NY1C 3D85B 3X13B 6FABH 3BYTA 4Z7VF 3QPQD 3VFRA 2ADJB 4EI6A 4OLXL 4RDQF 3DUUB 1X5XA 1C5CH 4M48L 4GG6B 1BFTA 4OBSA 3PDOA 4QHKJ 5HXMA 4IRSC 3P0YH 1K3IA 3SEPA 5GJTH 1G1CA 2E9WA 3GB7A 1CQKA 4M6ML 3ARED 4Y89A 1S5IH 4XPBH 4XCCL 2YZ8A 1A6VH 4P23A 3UPRA 5FGRA 3MV7E 1OD7A 4WEMB 4U1GC 2VLRB 1XIWC 3BEWB 3MREA 5E2TH 1OTSD 3QH3A 5I71B 2ZUSA 4HK0A 4F9PA 2X4SB 4MA3A 4RFOH 4YEFA 2Q6WA 5BZDB 2AJXH 1MQKL 4HS8L 4F7MA 5TQ2L 2FR4A 2CMRL 3L3KA 1TENA 3CCHB 4MMZC 1FDLH 1MRFH 3AS3A 1GGYA 2ICWJ 4HKZA 3W9DA 5L6YL 5EWIH 3QG6A 1FBIL 3SE4A 1KBGL 3B9KD 2PTTB 1N0XL 1ZA6B 4JQIL 4OFKA 4XNZC 2ENYA 5INDA 5HYQB 1L7IL 3CFJA 1JF5A 4P46B 3QXVA 5JOFA 4I0PB 2A9ML 3D3VB 1KACB 4JM2A 5GS2D 4DVRL 2X5PA 3PV6B 1F45A 2B20A 3CU1A 3EZJB 3FO9B 5HHPA 4Z7WF 1ZE3C 4WO4A 1T6VN 4PJEF 1PW3A 1I9RL 3BMWA 3Q1SL 4WI9A 4FHBD 2Y5TB 1FIEA 4Y5XC 4HSQA 5FYLH 5E70A 5EH1A 2WUCH 1R0AL 5FM5M 1WAAE 4X9IA 1QFUH 1KN4H 4LLVA 3RUGA 3ROLB 4Z7NE 3UTQA 4G43A 1Q0XH 1HIML 5FB8B 4PTUA 5FOBA 2E7BA 4K8RD 3GIZH 3T3MF 1FIGL 4UBDD 2FX8L 1I4FB 1FG2B 5E4EB 5CJQH 5IHUH 3UX9B 2HFEB 4U3CA 1QKZH 3NZ8B 4J3TA 1UYWH 2VISA 4TNWK 1CE6A 1YNLL 3LQAC 4JPWH 2FX7L 4G3YH 2XN9A 1JRHI 4NQEB 1KYOK 1RJZA 1YEDA 5SWSB 5FFLA 3IDGB 3WFCH 2EXYC 2OI9C 3RAJL 1X5FA 3MRKB 3BE1L 2F19L 4MNGB 1VEOA 4G9FD 5HI3C 3O6LL 3IF1B 3ZYOA 4KKLD 3RZCB 3D69B 4KJYB 3RDTA 2NPLX 4JB9H 1NUDA 4RSVA 4WFFE 1NGQL 4GBXC 4WV1B 2NMSA 4UT6L 5CD5D 3HZKB 2CLRA 2XZQL 1Q9WB 3RFZC 4PP2A 4J4PC 2ITCA 4QY8A 1HHGB 2M2DA 1RUMH 5AEAA 4DZ8B 1HXYB 4KTEH 2FB4L 1JGUL 5F3HA 5HGAB 3ECBA 4YHNB 4YHLH 3FQRB 4LHUG 3IU4L 4QXTB 5TGBA 5CEXB 4RWYH 4MD5A 4LHJB 4UQ2B 4BSWA 3GSUB 1NCAL 1U58B 2OL3L 2X4NA 3QDJD 3HZYA 1T89C 2ESVD 4JR9H 5IW3A 5GZNC 2CRIA 1YEJH 2VXQL 4GW1A 1CDJA 4FQJH 5E2JA 5BXFA 1DQLL 4FZEL 4URTB 2CK0L 3H0TA 4JN1L 4W6YB 3WUWG 1OWRM 1UWXH 4PRHB 4J3SA 2EEAA 2JB5L 4LCCA 3MFGB 2EE6A 4F57H 1C1EL 3LS4H 1G0XA 1RZKH 2XRAH 4LAQL 1S5HA 5K33A 3QQ3B 3F5WA 3OHXA 3SGEH 3T2OA 3UTTD 5F70A 3KPMB 3Q3GB 5TDOA 1ES0B 1KLGA 4HQQL 3TH4T 4G7VH 3ILQD 3RUGE 3BKJH 3L7EB 3TPUA 1T5XB 1KEMH 4YQXL 3BP7A 2WP3O 3BGMB 5KVDL 4F58L 4ZUUB 4NWTL 4P9ML 2BXYA 3FMGH 5EBMA 4HKBB 1QQDA 2AK4A 2LAGB 3T0XA 3LQZA 2VERN 3UZEA 1MOEA 3BQUA 4WRLA 1FG9C 4FFVD 2A1WH 4NC1C 1TMCB 1VDGA 2DQUH 5JPMB 3CC5B 4M5YL 3R0NA 3TH2T 4AENA 1DBMH 1X5ZA 4OUUA 3MCLH 5L2KA 3MLWH 1K6QH 1HN1A 4OTXH 5D7SL 1DSFL 5MP6H 2FGWH 3L1OH 1I8KA 5DMJB 1Q8MA 3LCYA 1SM3H 1I1FB 3KJ4B 5IV2A 1RK1A 3HCVA 1ZGLB 1DQJB 3ULVL 3QIUA 2EH8H 4K2UL 3GMRA 4ZODA 1JN6A 7FABH 1G1YA 5GIRB 5SWZB 4X4YA 4O00A 4BH7B 3CX2A 1RFDL 4XMKL 2H26B 4N0UA 3RGVD 3WEXB 3ZE1F 2GJ6B 4YBQC 2EDDA 4UI2A 3U7WL 3RPIB 2WWMD 4I9WE 3KS0J 4C59B 3EJZC 3TZVB 2R2CA 3CMGA 4X83A 1BZ9A 4QWWD 2E6JA 5T5FH 3ZKND 3HB3C 5BRZD 3SJVD 1HSBA 4YZFE 2JCCB 5D7LD 5I0DA 4HWNA 4JVPA 3VRJA 4G6JH 3I3DA 4X6FB 5DJ8A 2W9DH 1GC1H 4M3KB 4HIEA 1WUNT 1TQCB 4FS0A 4V2CB 1CI5A 2FWOB 4YHZL 1G9MC 3IYLW 1OGAD 2FJFB 3OX8B 1R3KA 1N6QL 4HK3J 4Y16B 3WLBA 2BCKB 1YJDL 5IG7B 1I8IB 4ODSH 1WJ3A 5FKPA 1WK0A 5B22A 1N4XH 4KTYA 3CZFB 3QEQA 3QUKA 3WIFB 5IOPB 1XAUA 2VDNL 5B3JE 1AGDA 5DQJB 5TH2B 5D1ZD 4PBXA 1G7MA 2GAZA 3P9LA 3MRCA 2IBBA 3T1FB 5L8JB 3I75B 4PFEA 3ZT6A 4KAQL 1I1AB 4X7EC 4Y4KB 3V7MA 5MERA 4F15B 4Y2DC 4MA7H 1J5OL 2WIIB 5T1LA 3BXNB 1ADQL 5ENWA 1KJMA 4PJ9B 5ICZB 1V3MA 1N64H 4U1IA 2AV1B 2AJZB 5EIQA 1IAII 5I2IB 1AQDA 3DROB 2C1PB 3L5XL 3TN0A 1JZ2A 3NPZB 3D5OF 4NN7C 3IAPA 4DK6A 1ZTXL 3AUVA 5L2KE 2KZWA 2W0LA 2UZXB 4DFHA 5DD6A 4PV8A 5E1HB 2EDHA 2BSSB 3B5HA 1MHHB 1FFOA 4NOFA 5CGYC 2DMBA 5CEYA 1PVHA 2X7LB 3VFTB 3QAZC 2VDRL 1NBZA 1MWAA 1NMBH 4JREC 2XZZA 3QNXA 1OP3K 5MHSE 1CIDA 1Z9LA 4Z76B 3TBYA 1SHMA 1U3JA 5DRWA 5C09B 4LPWA 5J4MA 4KUCD 3RWJA 1EVTC 3RX5A 4APQB 4BSJA 1D5MA 5ISZD 1FNSH 5H94B 4RRPG 3QXUA 2ATPB 1A4KA 3S4SG 4GMSL 3DTXB 4N0UE 3TCLB 2BNUA 3M45A 3ZYIA 1YEEH 1WZMA 4OZHA 4JY6A 3CX5J 3MV9D 3S4SB 1OF2B 4U49A 1AFVL 1JNHA 2AJ3A 1RIVL 5IVXA 1PZUB 1MWAH 4YPGB 3BKCH 4KTDH 3TIDB 3WNKA 4X4MA 5DUBB 4NWUL 1HYSD 4QXGH 5C8JA 3U2SB 2MHAB 3LRSB 4WI5A 1AC0A 2CGRL 2XFXA 4L3CB 2J3SA 1CL7L 1P4BL 5LAXA 5KOVC 1PAMA 2DMCA 35C8L 5DJYA 1S7WB 3D9AL 2VO5A 3QXAA 5BCAA 2RBLA 3WE6A 2Z91A 3CXDH 3CSGA 2IADA 5F1KC 4KVCH 4LGPB 5B39G 4C54A 1ZHLB 3QEQE 3QIWB 1Y0LA 2DN7A 1UCTA 4P2OA 4PJIB 2PXYB 2WAHA 2J4WL 4RNRB 4KC3B 3GBMH 1BFOB 1U93A 4I4WA 5IEHB 5F9JB 2CLVB 1EAPB 1S7VA 1JPFA 1ZOXA 5D1XC 3TH3T 4KZDH 1FJ1A 1DVFB 1ZV5A 4HDIA 3HC4L 4PLOB 4PJ5B 5JHLL 5IEKB 5DJ6A 1KXVC 2X89A 4L8BB 1BD2D 3WIHL 3AAZA 1F90H 4AT6A 1GRWA 4HF5H 4MNHB 1KPRB 4JFYB 2Q1EA 1R5IB 1KIRA 4GXUM 4U05A 5C0BD 1F4YH 4Z7QE 5AAMA 3WL9B 3KLDA 5HDLA 2V9RA 1XMWA 3QFDB 1U3HB 2XA8H 4JPIA 3MV01 2XQYK 2OK0H 5D7JD 3V4VL 4WY7L 2F54A 2BSRA 1MREH 1XGPB 3NPSC 4HS6B 3B6SA 1KCUH 2PO6D 5GJTL 3G6JF 5E8PA 1NEZB 3RNQA 4U1SA 1CQYA 3AY4C 1Z9OA 4ZO8A 3FL7A 1NGXA 3CFIC 2JK5B 4OZHE 2XACC 4OM0L 5D6DA 4ZFOB 5K9KA 3B43A 5ABDE 2YK1L 2FX9H 3LN5A 3OKMA 5IVXE 4YXLL 2R8SL 2B0SH 4U1HB 4X4ME 5E1AB 4F8TA 2BJML 1HH6B 2CRMA 4LSPH 4ELMF 1ZHBA 3D2UB 1VKXA 1CD0A 1AP2A 2A0LD 5DVOA 1CFVH 2NYYD 3QXDB 4DVBA 4JFEB 4NC0B 4D9QD 5AZEL 3PHQA 4LBEA 3WNOA 3HNSL 4IMKC 1U91A 3S37X 4YDKH 1WFUA 2C4FT 2GIYA 4ZYKA 4EXKA 1WGOA 2EC9T 5I19H 5CINL 5ESQA 2Z4QA 3OKOB 1AY1L 1A1MA 4D94A 1IFHH 3KPSA 4Z0XA 2QKIA 2J88H 2GW5A 1CFSA 4PYGA 4JDVA 3C09C 3T0VA 4JPKL 4OCRL 3VWKC 1RJYB 1NC2D 4EBQH 2F74B 4PGBA 5CWSB 5GSVA 3LKPA 3C6SA 4V1DB 4TSAH 5A43C 4HPOL 4XPTH 3T2PA 3BP5B 5BS0B 3I02A 2KPNA 3R8BB 4NQXA 1FL3A 2BVTA 4FG6C 4QRTA 2WUCL 4H25A 5C0AA 3VA2C 1QFUL 1AO7A 2Q86A 3UYPA 3VFVB 1MF2L 2JTDA 4IDJH 1YY8B 1JPSL 2DQGL 3QCVH 1CTOA 1NANH 1QO3A 2ICCA 3LKQB 4LCWA 1S9XA 4HZLB 4BQBA 4HLJA 4W6XB 1NFDA 4RFNB 5CJQL 2APVA 1FE8L 2XWJA 2Q20A 1ED3A 1VFBA 1QKZL 3GBNH 2W9EL 3DV4A 4JPWL 1CLCA 2QADB 4G3YL 4XPHL 1T1ZB 1ZLUK 2HTLC 1TJIH 5BW7A 4WUKH 3H7LA 4JRYD 5F3BA 3WBDA 3MA7B 4JANA 1XF3A 3NN8A 4EUPB 5DSCB 1CLZL 4Z7UF 2Z31A 4Q58C 2ZG3A 4MXVE 5JMOC 2ATKB 2H9GA 3R1GL 4LKCB 4ZXBB 5D5MF 5CHNB 2UVFA 2JELH 1ZLVH 4AG4L 2YSSA 2UWEB 5J1SC 4JY5H 5DHYA 3DGGA 3HE7A 4WTZA 5T1MB 2F58H 4YHLL 3BIAX 1X3DA 1TXKA 2NY5L 1BEYH 3HR5B 3V52L 4BZ1H 4RWYL 4YJZL 3R06B 5T3XL 3S88H 3O41A 3LPFA 4C56A 3VFWB 4OFIA 3LPWA 1RULH 4FTVA 4QRRA 4PB9H 2J12B 4OGXH 3KPOB 4X6BB 1YEJL 2X2YA 3KPSE 2MQCA 3SKOA 5HHMD 4DAGL 3BFOA 1FNAA 1GAFL 2BVPA 4U7MA 1U92B 3U0WL 3FCTA 1DANT 4JKPL 1R5WB 4F57L 5CAYB 2NX5B 3SKMA 3WD5L 1JFQH 3LS4L 2X9WA 1RUAL 3I2CH 2XRAL 3UBXG 4A6YB 1WIPA 2UYLB 2AK1L 4MA8L 3G5VB 1MJ8H 3C6LB 1FV1A 4OV5B 1X5IA 1GOFA 4IRSA 4QHKI 3K0WA 3PUCA 5C0AE 3UBXB 1AO7E 1A3LL 1B0GB 2J2ZA 1LNUA 4JO2L 2WBJA 4LGRB 1MRCH 4ONFL 1T22A 2FBJH 5CILH 2QSTA 1HHKB 4OFDA 1EFXD 3H9SB 4DN3H 4Y19A 4FABL 5E4IA 3CLEL 3KPNA 3N06B 3IT8D 4D8PB 1QG3A 1L7TL 1NFDE 4U1MB 1J05B 2A6KA 4WFHD 5A2JH 2ERJB 4JFFA 2R2HA 1T0NA 1LMKA 2A1WL 5DUMH 2VLKE 4JO3H 1B3JA 1NGWB 4FMFA 2P48B 5MEQB 5F9OL 2AEPH 1H8NA 2CRYA 3BPOC 5GGTA 5JDJA 3MCLL 3NMEA 5CEZD 3MLWL 1K6QL 5SX5K 4AMKH 1UXSA 2F53D 2ICWI 4PJGF 1OLZA 4FFYH 4OTXL 3KNBA 4HW6A 3DWTA 1D5BB 4OF5A 1DUZB 3S35H 4I18A 1V7NH 3FQUA 2E6QA 4M5ZH 3W39B 4GKSB 1I9IL 5TQ0H 3ZYJA 2EEDA 2GKIA 4Y7MA 4F9LA 1NBVH 3K74B 3DUSB 5IB2B 4M8QA 1X4YA 3DV6A 4KH2A 4M6OH 5K9QG 5C2BL 5DRXB 1HEZA 2YWYA 3MRJA 2XTJC 4HXAH 3FQXB 1VFMA 4FQCH 3P0VH 4LVEA 3ARUA 5HHOA 4JHAH 5GGTH 5HBBA 4C56E 2O5ZH 3Q0HA 1AHWC 4CADA 2AJVL 1MFEH 4ONHA 5DEFB 3A0OA 4FTVE 2NY6C 4XBEL 4QRRE 2DL9A 5DVKA 2CQVA 3NVQA 5ECJE 1RHHA 4LFHD 1LDPH 5C9JB 5ACZA 1HZHH 1G6RA 2YD4A 1R3JB 1ZA3B 2W9DL 3A6CL 2MFNA 5IMLB 4G8FB 4PJFF 1OAUH 3WJLC 1AGEB 3D25B 3PGCB 3H7BB 4PGCA 3GK8H 3X13A 3UJIH 4G6AD 4OIIH 3INUH 5EIIA 3VXMA 1TVHA 1RAMA 2V6HA 4KROC 4ODSL 1N4XL 1KV3A 4GG6A 5C07D 2NY3C 2A6DA 4MX7A 3BRFA 2XICA 4HKJB 1UWEL 3NCYS 5DUPL 1WZ1H 1VSCA 1Y18A 4PJ8A 1S78D 3UJTL 4HPYH 5C86A 3VXNB 1ZVSA 1HK6A 3HE6A 4N1CA 4ENEC 1G6RH 3X12B 1NMCB 5D7IF 3EFFB 4K23H 1PQZA 1H3VA 2E6PA 4MA7L 1CR9H 3DVNB 5AZ2H 4JFFE 3JSSA 3AGVA 1KGCE 3SY0B 4EI5B 4HKXB 2COQA 1YN7A 2HKFH 4KV5E 1JPGB 4P5TA 2X4SA 5EC1B 3BT2H 3HI5L 4FQ1L 1JBJA 4MJ5A 2AS5M 2K9UA 1F2XK 4GRMA 2J1KA 4LCYA 5C08D 1KCKA 4QT5B 4J6RH 5T1DL 1JZ3A 2Y6SC 1YDPB 4GXVL 1E4XL 1EIBA 1E28B 1BOGA 1NMBL 4BA8A 3ZHDA 1T89A 3GUTB 4ZQKB 3MBEA 2Y4SA 4U6XB 4KK9D 5L88L 4K7FA 4HAFA 3VFUA 4XNQB 2AJSL 4ZFFB 1U8OA 1IGFH 4P2YA 1X4XA 1JMXA 4PGEB 4RMWA 5HHOE 1J10A 4K55A 4IRZL 3ZE0F 3L5JA 2YEZB 2I07B 1JYXA 1YEEL 1AXTL 4OGAD 43C9B 2Z35B 3QUZA 4PP1D 1RMFH 2P8LA 3M17A 1F11A 1FNGB 3QPQC 4LF3B 1HQRA 4L4TD 4HC1L 4MYWB 5E00B 4WW1B 5T3ZH 5EZIH 2PW1B 3SDCD 3AFLA 3ROLA 2R69H 3WHXB 5ESVA 3UC0L 3AREC 4O2FA 1BJMA 1AGBB 3D0VB 3CH1A 2AABH 3VXME 1U9KA 1QNZL 4KVCL 4G7YH 1OTSC 1T03L 1A6UH 2HFEA 1XGRB 4Y1AB 43CAB 5KZCD 1FO0A 5DJXB 3F6LA 4O2CA 2YBRA 4RGMB 2IJ0C 4Z8FH 3RWEA 3EJYD 5L8LB 3MRFA 3SKNB 1ONQB 3IDGA 4U31A 4X7SH 3GKZA 3FB7A 4S10A 1P5UA 3IDXH 5IB3B 5J13C 4PJCB 1VPOH 3IF1A 5J6GB 3L3IA 5C0CB 4JO1L 4YDVA 3T4YA 3QHFH 5D2LF 3B9KC 4LLQB 3L5WB 3CFKA 5D1QB 3O6KH 5C0JB 5CBAB 5KS9F 4PB0L 2FO4B 4HF5L 2QSCL 4NP4H 4DZ8A 1NSNL 1FO0H 1HH9A 5HY9B 1P4IL 3DSFH 2OTWA 1YEIH 1IL1B 1H3TA 3LV3B 1CDGA 3T0EA 3NIFF 4OLYH 2VDOL 4UT9H 3TP4A 5I9QB 1TPXC 1FZJB 5T3ZE 5DMGD 4LHUA 4R97C 2CLZA 4XXDA 1T04A 2VR9A 2C9AA 3IFOB 4P5KA 1X4ZA 1GZPB 1I8LC 3GSWA 2VZTA 2H6PA 1J8HB 1DQDH 4OCWH 2VABB 4K8RC 1KIQB 4UBDC 3N0PB 3WUWA 1DR9A 1ZAGA 3SCMB 2B0SL 4JKKA 3C5ZA 3L7FB 1Z9MA 3KJ6L 2NY1B 2IMMA 5IROA 3PDGA 2VUOA 1M4KA 4OB5H 4A2LA 1LO3H 4LLUB 1FL6B 3O3UN 4X7TA 3SQOH 1MJ7L 3BGMA 2ZJSH 5IFJA 4KKLC 4XAWH 4Y2DA 5FAAA 3CVHB 3EFDH 4HUUA 4Q6IA 4RCAA 3S8WA 3MOQA 4PRPA 2NXYC 1SYSA 4NC1E 5CD5C 5LJYH 2DQJL 1QUNA 4FZ8L 3OJVC 3O8XD 3TO4C 5GRJH 5EU5A 2B5IB 3MYZA 3NA4A 1UH4A 3H9HA 5BQ7B 4DGYH 4HIJB 1CT8A 4OZGA 3LKOB 4Y8DC 1FFPB 5JOEA 1QA9A 3O6ML 3AM8C 3DO3A 1T83A 5C0FA 1FGVL 5GS1C 1UA6H 5IJVB 2OJZL 1P5VA 4NO3B 1CXEA 3W11D 1J0JA 5C0ND 5LGHH 5KVFL 2JIXD 1WWAX 4MJ6B 2XXCB 5DTFA 4IDJL 5JIPA 1T21A 5L2JB 4OUOA 4XNZB 1CTNA 5GIRA 4JQVA 2DQFA 4WNQA 3T0EE 1NDMA 1Q9KB 2A6JB 3OMZA 3RPIA 1S7TB 4NKDB 4UOJA 1FNFA 1JTTA 3WXVH 3ZTNH 4KK6D 2FHBA 3SE9L 5BVJB 3JWDH 4O51A 2QBWA 5I1HH 1TJIL 5JHDB 25C8H 4CVZB 4WUKL 4Y5VB 3ILQC 3VXOA 5LGJA 2G5BA 4PRAB 4GO6B 4QHUA 4HK3N 1XF5A 3MXVL 3BWAB 1KCLA 4Y5XB 2HWZH 3ZDZE 4IJ3C 2BNQD 2FJFA 2A6IB 3OKLA 2BCKA 1UXWA 3CX5K 2ZSVB 3BZFB 2AXFB 4FFVC 4PJDB 5IOPA 2F58L 3S98A 2C1OB 4N1HB 5IESL 3JV5A 4R7NB 3ZL4L 5D1XA 3JWNC 1A6TA 1G7JA 3LVEA 1D5ZB 4BZ1L 2A9NH 5KVGL 5TH2A 1KNOB 2E5EA 3DMMC 1RULL 3KPTA 4PRPE 3VFPB 3T1FA 5DGQA 3I75A 2GITB 3WKML 4E5XA 5INCA 4Y4KA 3VE0B 2OI9B 1QFWH 1K5NB 2W07A 1D6EA 2DJ4A 1F4WH 3LKRA 1D6VH 4M1CD 1G7IA 4Y4FD 3P4OB 3O2DA 1DCLA 2C1PA 4OZGE 3ARGD 3T8XB 3BHBA 3RJDA 5HHNB 4XWGH 1J12A 3ZMRA 4LLDA 2YKLL 4WUUB 5E7FA 1TTFA 3MFFA 4PJAE 4LPCA 1MJ8L 1MUJB 5D93C 4WU5B 4KJPC 4JGJA 2W0FB 4P2QD 3MZTA 5JNYA 4JZJA 4MD0B 2Q8BL 1P6FA 4QHMB 3WS3A 1GVIA 3SGKA 2BHZA 4QWWC 3MODL 1T7WA 5CJXA 5HPMB 5F1OB 2WP3T 4LMQI 4KPHH 4DN3L 1BQLL 3O2DH 3VD3A 2JJWA 3CXHK 1IILE 3DTXA 5E6ID 4L4VB 2HJLB 1QFOA 4MDIA 4RRPA 1RHFA 5IB1B 2X4TA 3S4SA 5D96C 4WW2F 3K1DA 5DUML 2AV7B 3K46A 2RCSH 4E42A 1GYAA 3CVHL 1W72B 1K8IA 2AEPL 4F3FA 1C12B 2ADIB 2GCYB 3BUYB 4RAVA 4ACPA 4AMKL 5D1ZC 4FFYL 3C9NA 1M7IA 4MJ4A 3G04A 2AXJA 1S7WA 2BNRB 5ANMB 1ZGLP 3QIBA 2VSCA 3IDMA 1EGJA 3MV7D 4UV7H 4MB4A 3V7AG 3EYQD 4M6OL 4QTIH 5JA8B 3CDYA 1A7OH 1H0DB 4K7PY 3TBTA 3SE8H 3VWKA 5DVNA 5TFSH 4FQCL 3ORJA 5IEHA 5B39A 1CLYL 4JHAL 4K3HA 2CLVA 4Q9RL 2BHUA 4HIHB 3O9WD 3QJFB 4GS7C 5HTSA 3WO3B 5I1LA 4R8WH 1DVFA 1K4DB 1HI6B 1MFBL 2BP3A 1G7HB 1QRND 3QFJB 5JLZA 2BFVH 1EGJH 2D7TL 2A74B 4HS3A 2VZ1A 4J23A 5KSBF 1HZHL 3CU7A 1JL8A 5A2FA 5EUOE 1K85A 4HGMA 1GL4B 3HI6H 4X98B 3UO1L 3GK8L 4P3DA 1Z3GL 3INUL 1QLEL 1YMHA 5GRVK 4NNYB 1LP9F 4NNPH 3HS0A 1BLNB 4HGWB 4NZJA 5E2UL 4DZBB 1BJ1H 4XB8A 3P73B 3TIEA 1XGPA 3CK0H 3VFOA 3V0VB 4M4PA 1KPUA 4OZIB 1HYSC 2R1YB 4CDHA 2LABA 4KDWA 2Z8SA 3H42L 5IMOA 1G6RL 2C3HA 2BMKB 1I3GH 1PSKL 2XPGB 1N5YL 5DJZA 4NN6C 1CR9L 4LVNC 1IC4H 3CSYA 4L9LC 4ZFOA 4UIMA 1FVCB 5FO7A 3NFPB 3F12A 5A16A 2WUBL 3W2DL 3LQAL 4PY7B 2DM2A 2VXUH 4NQDA 3HUJA 4JFZH 2IQAA 1SEBA 1KEGL 4TPRH 3FB5A 4ONGL 3MJ9L 5KN5B 4L1DA 1KSRA 4XRCA 4JFEA 1IC7L 1UACL 2BVOB 3L3OB 3TVMA 3S37H 4P23D 4JCLA 2YMXH 1ACYH 5F97E 3C60C 4WFFD 5HVHC 3SE3C 4OD3L 3VG0L 1IEAA 1RU9H 3T65B 4YO0A 2I26N 1UEMA 5I1CH 5FUCC 1D5XB 2YPLD 1AKJB 1ORSB 3FOLA 1KFAL 2HKHH 4HH9B 4G5ZH 1DN0A 1FNHA 2DYPA 4J12A 1RMFL 4NN7B 3NZHL 4DGVH 3SOBH 1VACA 2EYTA 1TZIA 1QYGH 4YNYB 1NAKH 5E8EB 5FYLD 5D7JC 3MV11 3ZE2E 4M7LL 2VXVL 1EHLH 3VXTA 2NY0D 5AYQA 3NA9H 4P4RB 5F21B 3QUXB 4JM2D 3QAZB 2JKXA 1GHFL 1F6LL 2R69L 3C5SA 1LO4H 3BJLA 3GMOB 1UKTA 3PNWB 4JFHE 5MEPA 3ULVF 4F2MB 1W72L 4GXUN 2AABL 3CFDB 1XGYH 1FN4B 1UWGH 1T2JA 1GIGH 5GRZA 3T4AB 4JRXE 4WO4D 3EO9L 3OKEB 3MNWB 1ZLSH 3GSXA 3O11B 2P24B 4KDTC 4Z8FL 1ROWA 4X7SL 3MRDB 2FJHA 3IDXL 5ESAB 3BZDA 1U8QB 5EZOH 5F6HJ 2NYYC 5K59E 4K9EH 3ARZA 1YMMA 4FQQA 2C3WA 4JY4B 5BZWA 3QUYA 3SGJA 1QSZA 1DP0A 2GTWB 4NQDE 3O3EA 3HUJE 3EGSA 3FB6B 4M02A 2X9YA 5EORL 4UDUB 4N0YH 2AJUL 4Y2OA 2XN9D 3DSFL 5DJ2B 3Q5TA 2GUOB 5F6IB 1OSPL 4X6DE 5BMFL 1KCSL 4TUKH 3RDTD 3EO0B 1N26A 4DKFL 3MA9H 2R0KH 3OKKB 2ADGA 4PGZA 3GMNB 3PWPB 1Q38A 3MUJA 1A47A 4UTAH 4XZUA 4NZUH 2J5LB 5H35A 3SDYH 3KWWA 1TFHA 1BQSA 3E6FA 4GQPH 3U0PA 2Y07H 3DVIA 1MI5B 1U92A 4H5SA 3UPAA 5IW1B 2C4FU 4OJFL 2NX5A 2L0DA 4YDIH 2EC9U 3BZ4B 2ADFL 5DJ0B 1QBBA 1OHQA 4I9WD 3V5HB 3GM0A 4HMEA 5GGVH 3TJEH 1IGIH 1MFDL 2RR3A 1S7RB 3UBXA 2FBOJ 4ZSOA 1IC5L 4LDOB 1EO5A 3PWNB 3SQOL 4KK5D 5HGBA 4FFWD 3DOSA 1HHKA 3H9SA 4KJQD 2QJDA 4XAWL 4LPVA 3FQNB 3GMLB 1G9ML 4OGYL 3T77B 5TE4H 3VCLA 2D31B 5IMKA 2NNAA 3S5LB 7CGTA 2OQJB 1R3IH 3SDXF 1XEDA 1TJGH 4KY1H 5E2WH 3HPJB 3EKCA 4XCNB 3GZKA 3MRPB 5AWNH 4JDTL 3MO1A 3OJMB 4P2RA 2R1XA 3NBNA 2DQTL 1YMME 3P9WB 1I1YB 2QEJA 5DLML 4E9LA 5HYJB 1ZHKA 4J8RB 1JGLH 2E7LC 1IEBB 1RZJC 2AK4D 3ZT7A 5LGHL 1EMTL 1M7DA 5FOJA 3DUSA 3IXTA 2EDOA 1AR1D 3BQUD 2NR6D 1BFVL 1U95B 3ES6B 4HFUL 1A7RH 4LPUA 2NY4C 3MRIA 3VGDA 3PHSA 4ODTH 5F1IB 2OSLB 5L2KD 1CFTB 4KRPD 1UVQA 1MCQA 5EIVA 1XGQB 5FGBC 4M9OA 1HHIA 1RZ7L 4Z7VB 3U36A 3H9ZA 2VH5L 5C0GB 5DQ9B 3WXVL 5E95B 5FO8B 3F8UB 1R3HB 4WI2A 1YUHB 5B38B 5IK3B 2BVYA 1DZBA 5MHSD 25C8L 1A6ZB 1F3DH 3QIUD 3V6BR 2GHWB 4WJ5B 1JF6A 3V4PH 5EUKA 4OIAA 1O0VA 1A6WL 2HWZL 5EBLA 1RZ8A 5MEOB 1OTTD 1G0DA 1A7BA 4QRPB 1AD9B 1EBPA 4M03A 3L3HA 3OJ2C 3VG9C 4WEBH 1Q72L 2Q7NA 4AEHH 3D6GA 4MAYA 3IRPX 1IKFH 1CGSL 2JCCF 4PLKD 3F7VB 3FN0L 4UIKH 4UV4H 1IGCL 1JV5A 5M7QA 3HN3A 4ZSOE 5TF1L 5DHVB 4G6ML 3TV3L 1G7PB 3RWFA 2Z8WC 5C6TL 2QLVB 1DANU 2FL5A 3VXNA 2VOTA 4GUPB 4ODWB 3VW3L 1BP3B 3TNNB 4MNQA 3QNZA 1QFWL 3DBXB 1GZQB 4M7KH 1WAAF 1FLRH 2V5YA 4QOKB 1F4WL 1QBMH 1TVDA 4X8XA 4LEOB 4Z7NF 1BZ7B 2DB8A 4RFEB 2EZ0D 1IM9A 1UFUA 5J89A 3QEQD 4NN5B 3RKPA 2YD1A 1JPST 4XWGL 1BECA 5TF0A 4P2RE 1W0VA 1QR1B 4RZCA 3P11H 3P4MB 4Z7WB 2DQDL 3LKNA 4RQQB 1LEGA 2O5YH 1PYWA 3MV8B 4L9DA 4JN2B 4PRIA 4HMCA 3QDMB 4J3VA 5T1LD 1ITCA 1JRHL 4ZQKA 2XWTA 1BGXH 1HOCA 2EYRB 4KPHL 3ARBA 4ZFFA 5DVLA 2CIKB 1A0QH 3F58L 5ID1A 4NM4L 4XVSH 1IBGL 4PYHA 3U1SL 3V2AR 2V7NA 1BQHB 5DURD 3VI3E 4FNLH 2R0LH 5B21A 1ZT1A 4DW2L 3WV0A 4G6AC 1FNGA 3A67H 4LF3A 4R2GD 4K94C 3MZGB 1UC6A 2CXGA 2R1WA 5CIPB 3O3DA 1P4LB 1PDKA 4LVOC 3C2AH 2VXSH 5EOQH 5DQDL 5CBEB 2BZDA 5K93A 3GSOB 1S78C 4Z0BL 3QJHB 2EYSB 5EO1B 2BOCA 3P0GB 1DBAH 1KC5L 3HZMB 3TO4A 3EYUL 4QTIL 4GKZB 5HI4C 1A7OL 1SJVA 2YPVL 4NSKB 3RWHA 3BKMH 1T4KB 1I85C 1CGWA 1FYTB 3WHE0 5C92A 3D18B 3JV4B 1JPTL 3I6GB 5J6GA 1SJXA 4MNQE 3CPLB 4WEUD 3TJHD 2FEEL 1TVBB 3BPOB 1JIBA 3L5WA 4N0FA 3RUGF 3TBSB 3U4EB 3QG7L 2WSKA 4OD2B 3RJQB 4KK9C 2EECA 4YR6A 4P2OD 4K3JH 3HTLX 5GZOC 4JZNB 5K9OA 1BBJB 1IGYB 3HI6L 1AE6H 4HHAB 2D03H 4OGAC 3DNKA 4GAJH 5JW4M 1RUPH 3LV3A 1NMAL 1MCRA 1ZEAH 4PP1C 3QO0B 1JF1A 4GAGH 4PRIE 2XTJB 3T0DA 3MLVH 2DQCL 2ZPKL 3CK0L 2Y06L 1EEZB 2X89D 1F6AB 1AHWB 2X4UB 2CR6A 4CVXA 5CMAB 2NY6B 1OAYH 4QCIA 1GZPA 5DJCA 3SDCC 4TUJB 4P5MB 5E56A 4QGYA 1F4XL 1IKNC 5GRXG 4N0CD 1IC4L 5HGDB 1DQQB 2PKDA 1KCVL 4ZFZB 3IKCA 2V7HB 1IT9H 2J8UB 3D1MC 2F54D 2AXGB 3OF6A 1U8JB 3EJYC 2VZ3A 4E41B 2GSGA 3DMMA 4RWHA 4LLUA 2AP2A 4KROB 5I1KL 1MCWM 4J3OC 1JNLH 4HUVA 3MRHA 4WWID 1AJ7H 2DLGA 1OTUC 4PR5B 4KKNA 4YZFF 5SWQA 3L3GA 3MGTB 3ZYZA 1WWWX 2CDEA 3E8UL 3V4UH 1YNKL 3IJYB 5BQ7A 3MROA 1BVKA 3MLTB 5E5RB 1F2QA 1OARH 1JZ7A 5CZXD 1HWGB 3OKNA 4KKCD 2ZCLH 4KHTH 4G5ZL 2H32A 2XZCL 4MZ3A 1LGVA 1GGTA 3D48R 2V17H 3AB0C 5IQ9B 5IIEA 1FFPA 3GMPB 2YS4A 2VKXA 1ZLWK 4OLEA 1A6AB 3O3AB 5IJVA 3ARFC 3E6HB 3B9DA 3WFDH 3JWOC 4PTTB 3UDWA 5B3JF 5DMGC 1OAXH 2B4CH 2MNUA 1EHLL 4MJ6A 3WXWH 4FQIL 3KPSD 5C3TA 2D7QA 5D6CA 4TN9A 3DX9B 3ARRA 4E0RA 3REWA 1J1XL 3WFBH 2VIRA 2O61A 1EXUB 1MCEA 3FZUD 1DDHA 1XGYL 1UWGL 4GOSA 2H32H 4Y0GA 3WN5A 1Q9KA 4R0LA 3IDYB 1S7TA 1FFRA 1MJUH 1IAIL 4NKDA 5DD1H 1UJTA 1F58L 3QZWB 3NFSH 1WQVT 1ZWIA 3F65A 3DIFB 5EU6B 3BX7C 5DS8A 5HI5D 3ZKMD 4K07A 3C2SA 5C0AD 1AO7D 1QRKA 4Y5VA 4XI5D 4D0BA 4Z95L 5EPMB 2WLYA 4NHCL 4FFZH 4TVPH 4M8VA 3QRFM 1OY3B 2IQ9L 3ZLQC 5JXAH 4XP5H 1FLTX 2B1AL 4LCWD 4Q2ZA 5A40E 4R4FL 1QLFA 1JHKH 3GMQA 2HFFA 3LDBC 2D7NA 3HAEG 3H6JA 4NJAL 2N1KA 2CJUH 3QEUB 3V5DB 3O8XC 3AREB 3WNNA 3HPLA 3KGRA 5IFAH 32C2A 4DOHB 5EOTA 1D5ZA 4ZDHA 3W5NA 2NXZD 1C16A 2CD0A 4U6VH 4EQ2A 2F15A 2Z31D 3TLRA 2F8OA 2HMIC 2EIZA 5EB9A 1Z5LB 1CD8A 1KTDA 3W11C 4OCYL 5J13B 5C0NC 1U8HA 2UWEF 3KDMB 2I27N 4ZG1A 3SDYL 2VLME 4AYFA 5FF6A 1UB6A 3EYOA 3C08H 1EDQA 2FGZA 3HE7D 5F7YC 2VE6A 1FRGH 4XAKD 3LEYH 3KLHD 1G0YR 4I3RL 3FT4B 3GMMA 4WUUA 1KTRL 2Z93B 4F7TA 3BAEL 4C56D 4H26B 2D3VA 3VGAB 1CS6A 4MCYA 2EH7H 4MD0A 4QRRD 5GGVL 1IGIL 4KK6C 4TRPH 4JO4L 2CR3A 3T2NL 1ND0A 3B9EA 5DK3A 4HUNB 4TVPE 5LXGH 2Q3ZA 1JZ8A 4L8DA 4UT7L 1IZKA 3MCKB 5J8OA 3BEVA 2W9LA 3GSVA 1SYVB 1TNNA 3WDHA 4B53A 4MD4A 5TDPB 4HV8A 1R3IL 4W4OC 1T5WA 1TJGL 3O2VH 4GAFB 4NZRL 3X11B 5D9SB 3LHPH 4QF1A 1FSKC 3UEZA 3G6AB 1GGCH 2ZOKA 1T66D 3OR7A 4XP4H 2VAAA 3IDNB 4GKNB 4Z7QF 5F89A 1TETL 2BVEA 2WBJD 5FUZL 4JFOA 1SEQH 1S9YB 1YY9D 2PYEA 2W0PA 1EV2E 1MCWW 4Y19D 3GGWA 4LSRL 4DKAA 3C60A 1JGLL 3SE3A 3D39A 3LD8B 1VFAB 3G6DL 5GGRB 1G9NC 1U8NB 5TDNB 5JORB 4XNXL 4JFFD 4G9FB 4G8EA 1KGCD 4Y4FC 5J9PA 5D72L 2NY2B 1SVCP 1A7RL 3MACH 4ZOAA 1NGZA 4FQ2L 5TPWH 3ARGC 4YFLF 5GGQH 2AAVA 4ODTL 3FFCA 4NHUA 5EA0H 5J1AA 4MXWH 4S11A 2EO1A 5EU3B 5IVXF 4HIHA 3MMEA 4KI5E 1S8DA 3LZFL 1FNLA 5I66A 3TC9A 3GSNB 1N5AB 3JV0A 4NM8H 5E8OB 2VL4A 5ISZE 1UWXK 3ZHLA 1XGTB 2R4SH 4P49A 5HYIA 4G42B 5EC2B 2G9HA 4XVJL 3WIIH 4JPVH 5GS1B 3G6JB 1RZIB 4XPAL 3DX8A 2AGJL 4Q74A 1HHHB 2JB6A 3QDJB 5A3ID 2ESVB 3V6OA 5HHOD 1EAJA 2FEDC 4UAOC 3IJHB 4PJHA 2YUXA 4WEBL 1T1YA 1NAMA 1IQDA 4YHPA 1G7LB 4KDTA 1MNUL 3VDBA 4UIKL 2GK0B 4UV4L 5FCSH 1S9VA 1CG9B 4R4BA 5EO0A 1HDMA 1J1OL 4ZAKA 3NIDE 3JTSA 3VXQB 5F6HI 4ZUSB 4QHNA 5FYJU 3UTTB 4JJ5A 2VLLA 1YPZA 4YE4L 5E99H 5J6HA 2XPGA 4NQCA 1GCFA 3ZDXE 5LBSH 2OMNA 4X5XA 3VXMD 4L3EA 3IGAA 5CD3A 1NAMH 1VESA 4GSDH 2H3NA 1F4HA 1H5BC 1S7SA 2SEBA 4IJ3B 2DM3A 4Y4HA 4PJ8D 2PYEE 5C0RH 5IBTL 3PXJA 3P11L 3P30L 4DEPC 3BDYH 3HE6D 2CKBA 1NLDH 1NCBH 3O9WC 2O5YL 3ZT5A 3L3OA 3D39E 2A2QT 4HX1B 4HCRA 4ZUWB 1BD2E 4U4BA 3T09A 3AROA 2WM0A 1IGTB 1EJOH 3VH8B 1FPTH 4M7ZC 1JI1A 4P5TD 1XH3B 4U1LA 3ULUH 4QRSA 3UTSB 2VDPH 3M1BB 5F7EH 2DBLL 1A0QL 4IIQB 2YR3A 4MXVF 3FFCE 1MIMH 3V7AE 2APXA 1YEGL 1AKJA 4GAYB 1ORSA 4NJ9H 3EIFA 2EDNA 3IFLH 3L95B 1ZSDB 5AYUH 2DMKA 1QFWM 5I6XC 2QSQA 3CFEB 4HWEH 2CKBH 3BVNB 5DHXB 1DFBH 3U4BH 4YNYA 4HCRH 4QXWA 2WV3A 3EUUA 3MBED 3RGVB 5T3ZD 4XBGB 3UJJH 1TJHL 1WICA 4IRJB 4M61A 5D93B 3RL1A 4AEIH 3QUXA 3PWVB 5DMYA 3V6OE 3TYFB 4Q0XH 1A7PH 4PJBB 4PJHE 4MQSB 4K8RL 5HHQA 5DEGA 5BRZB 3SJVB 3QUZD 2K3TA 1R24B 2C3GA 5D7LB 5F8QC 3THMH 3V0WL 1E4XI 3QQ4A 2DQEL 2IC2A 1KB5B 4LP4A 15C8H 4FP8H 5D5MB 2FLRT 2IFFH 3BKYH 5JUEL 3OXSB 1EERB 4Z77B 3PGDA 4TVSa 4UDTA 1OGAB 3MRDA 1CWVA 4U1NA 5ESAA 3OKDB 1YPZE 3U48A 4NQCE 2QHRH 3QHZL 3VXSA 1MFAH 4JY4A 4QTHA 4QKXB 4YEEA 2AKRB 4P23C 3QI9A 3EYVA 2FYYB 4POYA 3ULUE 4L3EE 3PWJA 3STZA 3KPLA 2XXMB 5D1ZB 1YYLH 3H3PH 5CCKH 4K3JL 4YHMH 1NFDF 3SKJH 1AE6L 2GUOA 2VLJA 4G8IB 1NUNB 5FGBA 4DWHA 1J88A 3JBG7 1K8DA 4CU6A 4YGVA 1IQWL 4MAUL 1J11A 4WFED 1WC7B 4N9GB 5GSRB 4NQVB 4D3CL 4YFLI 3BN9C 2Q76A 4GT7A 4D9RE 3W0WA 4B0MM 3S34H 2YUVA 2NY0C 3C8KA 3MRBB 3PE9A 4JM2C 2R2BA 5F9DC 4JFQA 1U8IB 4YBQD 2HLAA 2BRQA 2ITDA 1BZQK 1INEL 4RAUA 1TTGA 2N4IA 3T0ED 3ZZ1A 1A2YB 2Q87A 4WO4C 2IGFH 2JJTC 2X4PB 4GW5B 4NO0B 1IT9L 4JFDB 1FVEB 2D7MA 1JHTB 1LO2L 1VGEL 1BAFH 4LHUD 1S7RA 2IPUG 3CD4A 3EOBB 2QHLA 3UP1A 1MCSA 3MV9B 4DUXA 2HFGL 2IPKA 4X5WB 3PP3H 3PWNA 1B4RA 4N5ED 1JNLL 5DMKB 2P43B 4PJGB 1AJ7L 4M6NL 5IHZB 2YD6A 3T77A 5I17A 1KENH 3GM8A 3HMXA 4NIKB 2V2WA 1ZS8B 4EDWH 1NCWL 3LMJL 3V4UL 1KOAA 1IGML 4Z18A 1KPVB 2H45A 3C5ZD 3HNTL 4JLRB 1NDGA 3QO1A 1MJJA 4L9LB 4KHTL 1XCTA 2ICES 1RK0A 1E4WL 3CFCH 1DBBH 5CEZH 1HINH 5ITFB 3VXSE 4X0KB 5BO1L 1DLFH 4IHOA 1MCOH 4Y2DD 3RDTC 4DN4H 5HYJA 3WFDL 4YXKL 2VDLL 4PRPD 3W9EB 3RIAF 5E6ZA 5HHME 1WF5A 3HMXH 3PDDA 4LSVH 4DTGH 1IAKB 1TZHB 1IAMA 5F96H 4BK4A 4S2SA 4R3SB 2VLJE 1INQA 3D0LB 1VEMA 2LTQC 4HUWB 5E0QA 1VGKB 5IGXL 2OZ4A 4PJFB 4EDXA 4UNTA 1RZKC 1XGQA 4KV5F 2KDGA 2VDKH 1LE9B 5DD1L 5DWUH 3UAJD 3MRMB 4KVNH 5FO8A 1T1XA 1YUHA 4XCFH 1PJ9A 5J1TC 1YEFH 3W0WE 1DBKL 2BSED 3IFNH 5C0BB 3G08B 3QUMB 2VDQH 4U0RC 4ZUVA 4AM0A 2DQHL 3LN4B 4F33B 2E27H 4FFZL 3MLZL 5JO5A 3VI4F 5E5MA 1M05B 1MPAL 4WCYL 4KK5C 4N0RA 4XP9H 1I3VA 1NCNA 3F7YA 4FFWC 5HHXL 4LARL 5I1JH 5D7JB 5EN2B 5I1DA 4GQ9H 5D7IB 1I9EA 5F7UA 3BRGC 4LCCC 1JHKL 5EBWB 2OZ4H 2GJ6D 3X14B 1P7KB 5C0IB 2VL5B 2PO6B 5HGHA 2CJUL 2F5BL 3TYGL 1PEWA 1P53A 4Q9BA 3BD3A 4XVUD 1KXQE 2GT9A 3QA3A 4LLWA 3KPPA 3F7VA 4ZOEA 5CEZE 1ORQB 5EZLB 3UZVB 5DHVA 1G7PA 1ERNA 1CIUA 2OXGA 2EKSB 3HC3L 4TULH 1UQSB 1NANI 4BZ2L 4XGZB 1OAQH 5IB5B 5B8CA 4OFPA 4HWZA 4ZMAT 2D9QB 1MAMH 3PWUB 4M7LT 1MCKA 1A1NB 3L9RA 4PJDF 1AR1C 3H9YA 3BQUC 4M7JL 5F7DB 4NNXB 1WZKA 3JXAA 3EOAA 4LQ1A 1YQVH 3TBWB 2PYFA 5D1XD 3TT3H 5HHVL 2PUQT 5DHVH 4PUBH 4D0DB 2WINA 1A9BB 4AEEA 4KRPC 3FT2A 3MRLA 4H20H 1CYGA 5ICYB 4RQQA 1LEIB 4XCYB 2AXHA 4Y4KD 4JN2A 1CGTA 3FTGA 4PJEA 4OI9A 3WNMA 3D87B 1NC2B 5AD0B 5ITBL 5JPNA 1DLHB 3BP4B 5LXGL 4OCSH 5F93C 3SDCA 3O2WL 1HCVA 3QIUC 1F3JB 3AU1B 1CE1L 1IKNA 2IG2L 2CIKA 1GC1C 1CFQB 4ESKA 3MOBL 4OBRA 5BV7H 5FHAH 4F7PA 4QXUL 4BSVA 1OTTC 2R29L 3FQTB 2ZUUA 2VZSA 3BD5A 4U1KB 3QULB 1JGEB 5D2NC 1GGCL 2PW2A 3PQYA 3KYMA 3UYRH 1PKQA 3GI8H 4CKVX 4PLKC 4MDJB 4RAHA 4L29B 4X7FC 1K3ZA 1SEQL 2HVJB 4WHYG 5HPOA 4L8SB 4OM1L 4M1DH 5IW6B 5JDSB 5LG1A 2YD7A 4ZPTA 3O45A 1ZLVK 4Z78B 5KG9B 1U2CA 3HC0A 5I30H 4JRYB 3HG1A 4X9HA 2Z8RA 5I1EH 4LQFH 1B9ZA 5KS9B 2FH8A 5TPWL 3G5ZB 1JHLH 2ZSWB 1CZ8L 5EA0L 1YNTA 4AL8H 2V2TB 3O4LA 1GPOH 1G6VK 3P40A 2P46B 3ARFA 4X8JA 4W4NA 1M7XA 4NM8L 3QIBD 4ETQB 2R4SL 4Q9QL 4O2EA 1PGRB 1MCPH 2B2XH 3RY4A 5DXWA 5KSAC 4XNYH 3DRQB 5IJKA 1AIFB 1WCBB 3R4DA 3MRGB 3KLAB 2G2RB 3BO8A 4CN1A 3ZTJG 4M4RA 4TUOB 3BPNC 1YECH 3FO0L 3FQWB 1FL5B 3QUML 4HHAA 2PCPA 4KUZL 4YC2C 4L4TE 1DVFD 4PJEE 4PREB 2XT1B 4R26H 1SBBA 4R2GC 2V9TA 3O0RH 2QQNH 4MCZA 1CDYA 5GRUL 5HYSG 1F6AA 2BDNH 4U7KA 4J3UA 4R90L 4P5MA 3HKFA 5HYSB 1NFIB 4YAQB 4DQOL 4GW4A 4ALAL 4JFHD 3T3ME 4QHLA 5E2VH 1DQQA 1FCCA 2Q7YB 3O8XA 4UUJB 3CLFL 1NAML 2DIAA 2XKNA 3PQYE 4O58H 4U1JA 2L7UA 1PKQE 3MJ7A 1EFXB 4ZFZA 3RIAK 5K9JH 4OZIF 1D9KC 3DXAA 1QSEB 2AXGA 4KZEL 3QDGA 5C70A