2KERA

Alpha-amylase inhibitor parvulustat (z-2685) from streptomyces parvulus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
78
structure length
78
Chain Sequence
ATGSPVAECVEYFQSWRYTDVHNGCADAVSVTVEYTHGQWAPCRVIEPGGWATFAGYGTDGNYVTGLHTCDPATPSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Alpha-amylase inhibitor Z-2685
publication title The high resolution NMR structure of parvulustat (Z-2685) from Streptomyces parvulus FH-1641: comparison with tendamistat from Streptomyces tendae 4158
pubmed doi rcsb
source organism Streptomyces parvulus
total genus 7
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01356 A_amylase_inhib Alpha amylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.20 Mainly Beta Sandwich Immunoglobulin-like Alpha-amylase inhibitor 2kerA00
2AITA 1OK0A 2KERA 4AITA 3AITA 1HOEA 1BVNT
chains in the Genus database with same CATH superfamily
4OF7A 1EFXB 3QC5X 4AH2B 3OAUL 1DN2A 1J1XL 1WBXB 1KIQB 1MJ7L 4UOW0 1N59A 3MUZ1 5E8OA 2DLFH 1FIEA 4Z7VB 5DWUH 2XKNB 5JNYA 3B2UD 3H7LA 5AWNH 3ULVC 5F7HA 2JJSC 3F83A 1T2QH 1CLOL 1ODUA 3CN3A 2KDYA 3QHFH 3Q8CA 4KFZC 1L0YA 4QJ5B 4DERA 1DFBH 1I7ZA 2MHAA 4OZHE 1MWAL 3RWFB 3H42H 1MLCB 1PG7L 2HAZA 3KYMB 2ED6A 2VNCA 2YAPA 3KR3L 3C5JB 4WWKC 2VH5H 1YEKL 3MJ8A 3OX8B 1NC2D 3FT2A 3UJJL 5LBSH 1W72A 4G70B 5ESVA 5CMAB 3D51A 1XB3A 4TUOA 3K91A 2AVFA 4GEJA 1K8DB 3ZKSD 4X6EB 3GMNB 4FI6A 4KHTH 4AENB 1PKOA 3RWIB 1AKPA 4QDGA 2GTWB 4WCYL 4YH6A 4R90L 2A6DA 2BDNL 2V3EA 4P3DB 5FO9B 4H1LH 4Y5VC 3V7AG 2FBOJ 3VFRB 1M9SA 2EYRA 2JKNA 4MB3A 3M86A 4MFHA 3FQUA 3HG3A 1RUKH 1F90L 5JPNC 3L4UA 4NKQB 2EDBA 2P80A 2IWEA 5DI8B 3S5YA 3UZQA 1E9QA 5JR1L 1BCIA 1D5IH 3KLHD 5SWZB 4NP4L 3TNMB 3QUZB 4MCZA 4K3DL 2YGOA 5F7BA 2ADJA 3ECWA 2BRQA 1WQVT 3APMA 3TN0B 1HZHH 4NAJA 1L9OA 3V4UH 1JGVL 1Q94A 3HZMA 1QYGL 3EF4A 3U48A 4J3TA 5CBAA 1BOGA 4EDWH 1KTCA 4JDZA 2H1PL 4AQ1C 3BT2L 3R7RA 2CG9X 2EDOA 4IRZA 4R7DB 1IFHL 1NCAL 4CKVX 5ACZB 2RA1A 4L8DA 4XOCA 2I9LB 3S4SB 3F62A 1LDPL 4PJDE 5BZDA 4HEPA 1EUUA 1W6WA 3CVIL 3N50A 1N12A 3VXOB 1Q72L 3H54A 4G7QB 3FJTA 2XWZA 5E9DE 5DQJB 1IQDB 1HWGB 3AREC 2ATPA 3WTVA 2CIIA 3K6SB 5TTRA 4K23L 2XT1B 5KS9A 4WGVB 4ZMTA 2YQ3A 4WWKD 2F5BH 2BXZA 4Z3JA 5J56B 3K8LA 1Q0YH 2GVYA 3H9SE 3N0AA 2OR9L 2QADB 3PGDA 4OCWL 4CSZA 1GYCA 4BBWA 2WC7A 4JFWA 1G7LA 4O58L 1OAYL 2HRHA 2XZCH 3PWNB 5C9KA 2G2RB 5FR3A 1JZ6A 4G80B 4PJIA 1UXWB 3KBFA 4ZUSB 4BV1A 5EPMA 4P2QB 3TBWB 2BJMH 2XWCA 3QRGL 3KPSD 3T8VA 4URKA 2X88A 1MREL 2EDXA 5AYTA 4KDTA 1B6DA 1ET5A 3GSXB 3QIUB 3Q2WA 2EO9A 2PWEA 4Q6IA 4EXPX 4JFUA 4U1GB 4FG4A 4WEBH 1TJHL 3MR9A 3ROOB 1Q8MA 1RZ7H 4M48H 1Q4NX 5D1ZA 1NLBH 2HKHL 5IF0B 3LAFA 2X87A 1L0QA 5JA8B 3U36A 2HTKD 3IJ9A 3BWZA 3CNKA 3E6HB 4Z1PA 3QORC 5KVFL 2XFXA 5BV7L 3DIDA 1EGJH 4D94A 3MNZA 3O2WL 2WLLB 4GSRA 4GQRA 4PJ7F 2X28A 1BZ9A 1PDKB 4U7KA 1KXQA 1NSNH 4KO5A 5FLVA 3DKHA 3MCKA 1FCCA 3BVXA 3WYRA 5I30L 4I4WB 4LKXB 1PF3A 1E6JH 1OARL 2OJZL 5AW5B 1T4KA 1ZWIA 1LMIA 5K1NA 4KOCA 4A67A 2D7TL 1MLBA 5FYKD 1OPGH 5HHOA 4POYA 3CZEA 1YEGL 4NKOB 3WJMB 4GP4B 4PJ9C 5C0IB 8PAZA 1TVDA 3ARED 3UO8B 3VNYA 3HRZB 5EZOH 1M1XB 3GSQA 3RL2A 3HUJB 3OKEA 3B1TA 1AHWC 1S5HB 4AG4H 1PD1A 1DVFB 3RIKA 3STLB 3X11A 1I7TA 5JYLA 1BJ1J 5DMGD 4GI6A 4GKNA 3ZU8A 1KWKA 3FU0A 4JO1L 1C9SA 4NRYA 5HDQL 4YAQA 1JFQH 3FUDA 2JJWA 1BQKA 2F9BT 4PB0L 5D1QB 5B38G 4BELD 1NMAH 2NY5C 3B7UX 4A1RA 4WW2B 3HI1A 3FHEA 3NH7H 3QIBA 4W9FC 2Y6TE 4X2UA 1D6VH 4OCYH 1KULA 1HEJC 4MYPA 5E5MA 4WJG3 5GGUB 3BP4B 1N0LA 3WEBA 2OL3A 3GBLA 1P7QD 4WWNA 2NY6B 4Q0XH 4ERSL 4HJGB 3MRRA 1H6UA 3LH2H 3SYQA 1M7DA 2XXGA 3SD2A 1S7WA 1I9RL 1P4IL 2CMRH 2BS9A 5E6IC 2CRZA 4OGXH 3BCDA 1KTJA 5HI3C 5HDWA 5BVPH 4YPGA 5GZOD 3BO8A 3IDYC 3P0VH 2KQNA 1XGYL 1HL5A 1IJ9A 5C08B 1JNNH 5JHBA 1TPXC 1LMKA 2E7LA 1Z9LA 1IVTA 3FO2B 3QORD 4S1DD 3VFOB 5KANG 4JO8A 2Z9TA 4UOW1 3VGDA 4PRPA 2GBAA 3MI6A 3T8XB 2MTAA 4PJFE 5H4ZA 3OD3A 3OXSA 3D3VA 2DQCL 4C47A 4NT6A 3ULVL 4PR5B 3KXFB 3STZA 1JZEA 2OCJA 3EGDA 4IIZA 4PJEB 1CXHA 4L4TD 2ODHA 2Q6WB 1Z7JA 3RWEA 2JJVA 3RUGB 2IAMB 1P9MA 3QWOB 2YARA 3O6LL 4K5MA 3K3QA 4OFYA 4XPGL 43C9A 3IRCA 3AMLA 5BOZG 1JGDB 3UBXB 1QRKA 3FYIB 4ZMVA 5IGXH 1OE3A 2G9HA 1A21A 5FUCE 4EKXA 2VKWA 2AMUA 3LN4A 1UH2A 5FK9A 3U1SH 3ZR5A 4A66A 5I9QB 3FSOA 3GJFA 4QTIH 5FOJA 1A6ZB 2K9UA 4WW1A 4DAGH 3A67L 4DQOL 3ULUE 4X7CC 1SRDA 3ILQD 3OR7B 2JI3A 2QSVA 2H0JA 2BRRL 2APBA 4MWFB 1KBBA 1FSKB 1S9XA 2QZ5A 4N90D 1JV5B 5DZPA 2V3FA 2WXIA 3TEZA 1HYRC 4PIRF 5CSZA 3MV7A 3ARDD 4M6OH 2VR4A 2GABA 4XHQA 3WFHB 1A6WL 5KOVC 4PJ8D 2AJVH 2OJEA 5FF6B 4UILL 4NEHB 1AFVH 5E2WL 5TE4H 4JFZH 4HWNA 5KSBA 2ZWKA 4UQIM 5HVHC 3OWEA 4KO7A 1T1YA 5KS9F 1B4TA 2Y2YA 3T1WA 1KYDA 3S36L 1NM9A 5E6ID 4K8RL 1NAML 1HT6A 4RZCA 2DRUA 5J12C 2AJSL 1OHQA 1TG8A 2EVJA 4JW3A 5B21A 4N3UA 1N67A 5F88A 4ISVA 4CDHA 4BD4A 3NFPB 4PJIF 4N2EA 1J9CT 3W11C 4L18A 2F7QA 2F54A 3FB6A 5ID0A 4BK4A 4JFFA 2IH3A 3F04A 1SJXA 2P42B 1CFSA 3HKFA 2B20A 4U4IA 1KELL 2EXWD 1HEHC 3B8YA 2A99A 3SPVB 3SPHA 4MJ2A 4NKDA 4PGEA 4RWYL 2ARJA 3IEAA 3HMWL 1UQSB 3T2LA 4TOYL 1ZTXL 1BEXA 2CLZA 3O3UN 1J9RA 2O4EA 4AEIL 2Q20A 1SY6L 1BVNT 3MRDB 1GW6A 4Z8FH 4PJAA 3G04A 1BG1A 5CP3A 1YECH 1LD9B 3ABGA 2IALB 3P73A 4KRPB 5BMFL 3RZCD 1OPOA 3ZMEA 3T3MF 1S7TB 1J8HB 3RWJB 1D6EA 3L3DB 3RX8A 4KJPC 2ADYA 4XB7A 4HLEA 1T7YA 4O02A 2HT3C 1WZMA 2RALA 2V5SA 2GB2A 2LE9A 5D7IE 4MA1B 3RDTB 3CDZA 3DVIA 3QDMB 4PH8A 3SE6A 5B39B 3DO7A 5EO9A 3ISRA 2I07A 3QXAB 2R0KH 1BFTA 1FUNA 2ZT9C 4JZJA 1E5AA 4B5ZA 2CXKA 3ZGIA 1RCYA 5I15L 2VQ4A 3EYUL 3WTXA 1O6VA 4JY5L 4P2OA 1IQWH 1U93B 1MCRA 3TC9A 3BH8B 1UADC 5BUGA 3X12A 3ABMB 5GXBB 3WTUA 4HFUH 4IGBA 5IVXE 3V4PB 2BVUA 1ZGLA 2BCKA 3T2NH 5I1KL 3SYAA 4XN7A 1F13A 5DFVC 4IBWA 4OCXL 2BFVH 2Y1YA 3G6DL 4H0HB 3LRHA 2RQEA 3GSNH 4DN4H 1BF5A 1Y0LA 2Z4QA 3SGKC 1AIFA 3QA3B 1I7RB 4FLRA 3NIFB 5I1LA 3RFZC 4B60A 5KBLA 4LBAA 2WXKA 4DP2X 2YPVL 5JO5A 2XA3A 5C0AE 1RKRA 2RCSL 1HHIA 1JG9A 4Y5XC 3MOAH 2YRPA 3GHEH 2C4FT 4D0DB 3SIKA 4AXWA 3W11D 1ES0A 4DEUA 1IE4A 4JGNA 1USZA 1NC2B 1JHTA 5DEZA 3ARSA 1WIUA 4K71B 3NVQA 5FECB 4HP5A 1HQRA 1U91B 2XQYG 1V27A 1G87A 4JREC 3IFPA 3RIFF 3RWDA 5I6XB 1E9PA 5IVZB 1GGYA 1NFAA 2B1AH 2XA8L 2PNDA 5PAZA 5K39A 5SX5K 3DXAD 4MMYB 1YN7A 4ZTPH 3RX9A 1UWGH 4PJXB 1F11A 2D7MA 2ZE0A 4V11A 3VD9A 1RZ8A 5IB4B 5GSRA 1BXAA 4L5FH 3EDKA 3MJ9L 4O5LL 4YR6A 1XBRA 2C4XA 3MGTA 3O3EB 4AQEB 1R47A 1PD6A 3DNKA 5J8OA 3VXQB 1FLTX 4G6MH 4AVJA 4KJPD 3FQRA 5ES4B 2HT3D 4OIIL 4HIEA 4Y1AB 2UYLA 2H3XC 5GS2H 2XKSA 3MMEB 1RJLB 1GIGL 5FO8B 2NY0C 2HCZX 4GKOA 2NY5L 1IEBB 4GSDH 2PCYA 2Y36L 1A7QL 1YPZA 3BN9D 3DK0A 4C56D 5ERWA 5FA4A 4L05A 4X4ZA 5MERA 3QDHA 4GQPH 4HPYH 1E65A 3KYKH 3BEWB 5GGTL 4HMCA 1OOAA 5C0RL 1Z9OA 2FAUA 2H9GB 2QJDA 4QCIA 2RJMA 1ILSA 3WEAA 3ZJAA 4EJ1C 2OFQA 2OYPA 4CILA 1LEKA 1PX8A 1W8OA 2OMTA 3WMPA 4JFTA 1JK9B 1GJIA 3U25A 1CK0L 4RGNC 3E8UH 1FFTB 3KNBA 3GSVB 4NQCD 4RGOH 3RGVD 4TMPA 5JZ7C 4LFHD 3KPNB 4HV8A 4L3CA 4P5TA 2A83B 3SKJH 4XNZC 4KK5C 2QL1A 5LQBL 3CFJA 5CD3A 4YHYC 2N7BA 3N43F 1C08B 5CCGE 2IBBA 4G7RB 4NM4H 5CGBA 2P7TB 3HMXA 5KBMA 1HXYB 4DOHE 1NANH 2E8ZA 3FCBA 4RDQG 3QFJE 4ONFL 3QVAA 3S8FB 3CZLA 4XCEB 3ZYJA 4PW3A 3MRGB 2BCMA 4AJVA 4FNTA 1UM5L 3APCA 2WGXA 3QXUA 1N2RB 4JN2A 5E8DH 5AZUA 4WI4A 5H35B 1HAUA 3BPNB 5L4IA 4YHIA 2AQ3A 4DK6A 4MZ2A 3FQ4A 1A4KA 1IBGH 2C9AA 2CLRA 3LN5A 1KEML 3KW7A 4L9DA 4XHJD 4XVUD 5F1IB 2M26A 3DUSA 4HOXA 1NL0L 3L81A 2D31B 3S5LB 3X2QB 4DHLA 2IG2H 4YOKA 1PNCA 2AJYH 6TAAA 1FA4A 5GHWH 1IEHA 4BZ1A 3FDWA 4KVNH 1I8MB 3R1GH 4YHZL 1YQ2A 5AW4B 5TQ2H 4N9GB 4YSQA 4I18B 4N2FA 4BGDA 1B2WL 2E9BA 3ARBB 2B39A 4G1EB 5KYYB 5E9AA 4J4PC 2NXYD 2XVBA 3EO1A 4MAYC 3NRFA 4PJAF 4UNTA 3AROA 5M7QA 5E6SB 1HJBC 4IMLB 3DI3B 3MLUL 4PI0A 3N42B 2OL3H 3U82B 3GMRA 3PWJB 1GSMA 5F7YC 4PV8B 5I0WA 5KJRL 3HFMH 3FTUA 4RGMB 2EIZB 5DURD 5KSVA 2Y24A 2YAOA 1SJVA 1QTPA 2XVLA 3CLFH 2R29A 4K9EH 5CINH 5T3ZH 3UPRA 4W9IC 1G1CA 4EUPG 5DVPA 1JXFA 3IVKA 3KD4A 1OY3B 4ZPTB 1SXCA 4FX5A 3O3BA 4RGND 5JZ7D 1Q1JL 3QUKB 1F0LA 1QBLH 3NTCL 4LO9A 4GBXA 4M56A 4HSQA 4YX2L 4MNQA 5T8IA 1JMXA 2YZ1A 5DJ6B 3BP6B 4XNYH 4I3GA 4PJGA 2WOYA 2K9FB 3FUNA 1EJFA 3LKSB 3ZUCA 1KPRA 2UWEB 3DO4A 4NAQA 4Q14A 2P8PB 2I7OA 4PY7B 4EVNA 1H5BB 5LB1A 3NP4A 5HGAA 5MI0B 5A6MA 5EO1A 3HPLB 1Z9MA 3O6KL 3VFMA 1OM3H 1A65A 3GRBA 4FCHA 12E8H 4FN0A 2MKWA 2OQJA 2M83A 4JKPL 3HC3L 1OCCB 1BMZA 1XSIA 4K15A 3O6FD 3R0NA 2J57A 4OM1L 4X6DA 1RLBA 4XNXL 4YHPA 1KJVB 4G1MB 3SZKC 5E2VH 2QHRL 4Z5RA 4CDGC 2NNAA 3CSYA 4KJYA 2X6UA 4CBZA 4BFEA 1ZVYA 4PJCE 1IBHA 1O6TA 1XH3A 5IQ7H 1P0SE 4LT7A 5EMYA 1FFQA 3OZKA 5E4EC 4PWJA 3PL6C 3QULA 2FX7L 5E99H 1DP0A 1QFUH 3L5HA 5DFTA 4JN1L 2WZAA 4XVJH 2XN0A 2JXMA 3H3PH 4X99B 1P1ZA 3LPWA 4DPAX 1M56B 2ZAGA 2OBGA 1KBVA 2XX1A 2YS4A 2DYRB 3FQTB 5GGQL 5D70H 3NCMA 3FSWA 2YA0A 3GMLB 3HE6A 3V0FA 1RD6A 1WCQA 3P3RA 4I48A 4PBVC 3VI4E 4GKSB 4GLRH 2BNQD 1NCCL 3IJHA 3QEGL 4OY9A 4QHUA 4B6ZA 2G3ZA 1NKRA 1PG7W 4IOSD 1UA7A 1EZUA 1BM3L 1GZQA 3QEQD 4L2YA 1U41A 3SGJC 1JWUB 5B1BB 4RCAA 5JUEH 1WJ3A 1UUNA 5JTWA 3H4HA 1XL6A 4BSWA 2EADA 2JIXB 1IGML 3ABKB 5FUCC 1TEFA 3CFQA 1YPZF 1TDQA 1IUZA 4P9HL 4Y19E 1CGVA 1JTTA 4XO3A 1YC8A 3J07A 4ZX3A 5JQ6L 4AIOA 2X3AA 4UCFA 1LDSA 3EJRA 1ZT1A 1G7HB 1RL1A 3LNFA 1TFPA 1GXEA 2ZD0A 5FDWA 4AY0A 1R5VA 2XIDA 4JHZA 3CPUA 4B9GA 4F7CA 3ARDB 1WBYA 3CIQA 3HI6L 5AG9A 3ARRA 2FLRT 3LEXB 4MXWH 2ZJSH 4NM8H 4R7LA 3KH3A 5CP3H 3CSPA 5AVQB 5I76A 2A77H 5EEZA 2J55A 4JANB 1XMEB 5IFJA 1IU1A 3EH4B 5D71L 1HL8A 2GJPA 5LHDA 4JZNB 1P7KB 2AKRB 2WQVA 3KDMA 1JPSH 2A6IB 3VSUA 3WFEL 2BK8A 4NQSA 5IBUG 1GJUA 2F7RA 1DBJH 4P23D 3M1OA 4EI5A 2WBJB 2CBQA 4PCKA 3QDJA 4YBLB 5B3JE 2ROXA 3QZWA 3AADB 4JFDD 5F3FA 5CJXA 3N1GC 3A4FA 5FHAH 2C9UA 5F9DC 4PLKC 3GPSA 1NIBA 2JB6B 1SYVA 3N1MC 1FAIL 1V8HA 1Z66A 4N6QA 4X42A 1JGUH 3LSOA 2MOGA 2B77A 4TSCL 3NCJL 1X5ZA 2FX9L 2X53A 4XN5A 4ZAKA 2Z7WA 2OMYB 5F7FA 3O4LA 1BZQK 1T2XA 4HH9A 2P24B 2FSDA 3EDEA 1Y07A 5HYIA 4CUCA 3SY0B 3FRUA 3VQLA 4JEGB 3RZCB 2J5LB 4HC1A 4P4KB 1HCVA 4U3CA 2ZCHL 1YUHA 1BM7A 5AQ0A 4MS8D 1F58H 3ETSA 5C71A 2XLLA 1PZ5B 3UAJD 1E4XL 1PTZA 4F91B 2RR3A 2YMOA 5EOQL 1MFCH 4LSUL 2YEQA 5EEUA 2HT2C 1EJOL 5EF1A 2PYEE 1XGZA 5HYSG 3VXTA 4Z95H 1CZ8H 2BW4A 2DS4A 2AXGA 4FFYL 2ZX8A 3OKOA 4I85A 4UWQB 4EDXA 4DN3L 2F74B 1HK6A 2YAMA 4Q9BA 4JHAH 4OGYH 1FZMA 4HKXA 5I1EH 1X5LA 1ZS8A 3OQ3B 2OMXB 5BO1L 2V5MA 4JO4L 1MWOA 3HC0A 1RJYA 1CFVL 3MV8D 3PRZA 3EGXB 5EUKB 5C0CA 4JO3L 1O7VA 3UDWA 2ZAIA 4F2ME 4PJGF 1KCLA 3EHBD 3AQYA 4MCNA 5HHNA 4N2DA 1NGYB 1UM4H 3W0WE 5L88L 3RWGA 5C09D 3U4BH 2R0WH 4XPBH 3TX4A 3HE7C 1SBSL 3I6LE 3A0OA 4TVPD 4LLVB 4LCCB 4YDLC 1S6NA 3KYOB 4V1DA 2XDHA 1N5YH 3H9HA 1OGSA 4B9KC 1GL4B 3GO1H 1WTLA 2DEWX 3BVNB 3WLBB 4BFIA 4YSUA 5KN5A 4HLZH 3OR6B 4X6DF 1XGUA 4NC1E 2ZUYA 3RTQB 4KQ3L 1PLGH 1ZA3B 3GDBA 4PAZA 1RU9H 3FT0A 2EO1A 1RULL 4U1SA 3VX1A 3QUYC 5GISH 3K2KA 3CQPA 4TUKL 3LKPB 3QAZB 4JDTL 3S88H 3I3DA 3PWUB 1PCSA 3MBWB 3V7MA 2VXTH 3HNSH 3KBPA 2EDQA 1ITCA 5JHDE 4A2LA 1T0OA 1CF8L 4JCMA 4MJIA 4AV4A 2EABA 1OK0A 2ZCLH 3L1OL 4NQXA 3GK8H 3QPQD 2DLHA 1E27B 2HRPL 4LNRA 4AQAB 3PHSA 2PP8A 1A4CA 1R3IH 2Q76B 3UTPE 4R5VA 4RMQA 2ZUSA 3RI5K 4LLWA 4Q9RH 5D1ZI 1HSBB 1SVZA 4KUZH 5I74C 3T2OA 4GEIA 4QXGL 4HJ0D 3D39A 4J3VA 5LAPA 3VXME 4F80A 2D03H 3W9EA 2WUBH 1W0VB 5ICUA 5JPMA 2VDML 4XNUH 4XC3L 1R3HA 2AXFA 1KCVH 3FCSB 4NO3A 5FYLL 3C6LC 5HDRA 2OP4L 3TV3H 7PCYA 3ZO9A 1YYCA 3HNVH 3I3EA 1RSYA 4G8GB 2E4TA 3V4VA 3PPSA 4OD3L 4R97B 4YS4A 1TLMA 4ODVL 4LE8A 2VAAB 4NDMB 3AM8A 3CZFA 5SWSD 4RAVB 2CO3A 1E7VA 1G4MA 5DHYA 4Z7WB 4TKWA 2FZ3A 4NQCB 3RGVB 4L23A 4BZ1H 3BAKA 4P5MB 4YDZA 5A6LA 1SXSA 1MG2C 4FTVE 1F4WL 1T89A 1UYWL 4QF1B 4R0LB 1LK2A 1HH9B 2AK4D 3LS5L 4PJ7E 3W82A 2EDYA 3EGSB 1TQBB 3OHXA 4NGHL 5HYFA 3UG5A 5DK2A 3FMGL 1L9PA 4WV1C 3PDOB 1XF3A 32C2B 3QEHA 3CDFA 4OLUL 1LO5A 4Z9KB 2IBZY 1TVHA 1JFHA 3BPLC 2ICEB 5A2IH 3LXCA 3LHPH 4WFGE 1BECA 1T2JA 5HJDA 2P43B 1UM6H 2X4UA 4R8WL 5IEHA 4M9PA 2G75A 3LKOB 5HHQB 2R29H 1AACA 3IJEA 2UZIL 5KVEL 5K9OA 1A1NB 3V10A 4TLTA 1EAPB 1LO4L 1SYSA 2Y5EA 4I0PC 1OCWH 1F6AB 2QLYA 1AZVA 3HS0B 5E23A 2BVOB 2DIAA 4MASA 3L4YA 1M71A 3KDPB 3KZ8A 4HS6B 4DGVH 5CCJA 5INDB 3FQ1A 2COQA 4KTGA 1R33A 4YC2B 2VZUA 5EEVA 3BAEL 2E27H 5DUML 4ODTH 3SY6A 1YG9A 1WFIA 2NQ3A 3P02A 3P77A 4NENA 4Z7UE 3SBQA 1OB1A 3RVWC 5B1CA 5FHBH 5A16B 3WIHH 5HPMB 4MSWB 2CO6B 4MXQC 3FFDA 3DX3A 2NXYB 3TWCH 2Z8RA 2HVBA 1WZKA 4YFLF 3N41B 5AZ2L 1A0QH 3MO1B 4J3OH 1S9YB 3UYRL 3VFUA 2Z91A 3TYFA 3WLWC 5BJTB 2P8LA 4LAQH 4UT6H 3Q2LA 5JIPA 4RMSA 3C6LD 3SCMC 1FYTA 5MHSD 3MRPA 1AGBB 1JRHI 5GGSY 3MA7B 5CD5D 4NUPA 1WDAA 2ZKHL 4TVPL 1DL7L 3DIFA 4HGKC 3L4CA 3P9LA 4ONHA 4D3CH 3W5MA 2KPWA 1S78C 1MFBL 2I26N 2YIHA 3SO3C 4XMZA 4U1MA 3U4KA 4F9LC 1Z5YD 3QUML 2V7NA 3ZK0A 3NSYA 3CVHA 1ZLVK 1ADQA 3FRPA 1JVOA 4BSJA 1BIIB 2FQGA 4WI2A 4G3YH 5CZKA 3QJVB 4BH8A 4QXTB 4B9YA 2X6AA 1WFNA 4G8FA 3VXUD 4C4UA 4QRRA 4MD5B 1JHKH 2FSEA 1SBBA 3UGXA 5IIEB 4R26L 1IAOB 4F7PB 4WFHD 1E4WH 1WS8A 5CZXC 4X98A 1FJ1A 1H15A 1O9WA 2NQCA 3C87A 5BRZE 3TT1L 2EIJB 2DQMA 1YHPA 3C9NB 5IHHA 2XWRA 5EZPA 3WHXB 2DWEB 3O6FB 4IU2B 1UA6L 5DEFB 1XBDA 2AC0A 1PL3A 4NPYA 2VB5A 4LLYB 1XFPA 2X70A 4I0PD 3GBML 1MCPL 2OMWA 5IREA 4WSKA 3SE4A 1OW0C 3OGOE 3UJIL 2I7SA 1NZRA 5E94B 2Z8SA 5T3XD 3MA9H 3NAAL 1HWHB 4C83B 3HFFA 4RNRA 4P46D 1CE6A 4FA8A 3EFFA 1OE2A 5B4MC 2O61A 2UXTA 2VSCA 2XY2A 3K5RA 5GS1B 2DQ6A 3AB0C 5K1VA 3N04A 3NK4A 1SEQH 3QO0A 1K3ZA 4WAFA 4OZGA 3HR6A 2PPEA 2CCWA 4L5FE 4XGZA 1YEEH 5F7DA 1CE1L 1OTSD 5LAXA 4ES8A 2WIIA 4AJYV 4EIZC 4ZDHA 2FX8H 3BAJA 5SX5H 3I2CH 3FTSA 3UYOD 3IMVA 5KS9E 2P9RA 3IDIB 3UC0H 1VLXA 3IGAB 3LV3A 4L4VD 1WCBA 1EEZB 1WK0A 2OSXA 1ZT7A 2QDVA 2ENQA 4V33A 1L3WA 1NFDB 2LLGA 1AD9B 2OXHA 3QEQB 1NMBL 3A6BH 4JQXA 3VRIB 3D87B 4GJTB 4ZXBB 1ODAA 3PQYD 1D5RA 2YD9A 4LARL 4UT9A 2JNZA 3NJVA 1X3DA 4PJIE 1IZKA 2FK9A 4R2GC 5I66A 2JMRA 1H9VA 4LRNL 4JFXA 3L7EA 3CHQA 4JFEA 1QFWH 3EG9B 5KAQG 1Z9SB 4DJMA 5IHWA 1KJ2B 4PREA 1MG3C 4Y4FB 3Q5YA 3NDYE 3T0EC 1XCXA 4OD1L 4QKXB 5F9WC 4FQ2L 2K3HA 3GI9L 4OGZA 4XBGB 3SSGA 1OAZL 1QNZL 4BFRA 5J3HD 1U3ZA 3W81A 1QR4A 2XTLA 1ZEAH 2BVQA 4YSCA 3BSZL 3VXPB 2X44D 1HE8A 5KSAC 3MLWL 3TGXA 3CFKA 3LPGA 4OCLC 3HB3C 1LK3H 3T3ME 2I5YH 3FQXA 4U6VH 3OL2A 1MDTA 2ITFA 1TJGH 5DHMC 3HKZA 4K94C 4NQED 4R84A 1CIDA 3GD1C 2R69A 5BO0D 1EZSA 1UCTA 5DLLA 2UZYA 4KTYA 1HCFX 4G42B 3FBQA 4ZS7H 5I1GL 2YD6A 3WS6C 3J2PA 4UTCA 2J8UA 1MCCA 1A3RL 3MNWA 4PG9A 5B4MD 4H20L 5HHOE 4RFEB 3T77B 4LAJH 1HEZA 3L9BA 2SEBB 4NZJA 5DD0H 2NY7H 3KEDA 4PI2A 3D6GA 1LEIB 1GHFL 1JGEB 1AP2B 2KZKA 3EJYC 3T5WA 1UVQB 1XIWA 2DIBA 2A9AA 3LD8C 1A7OH 4X5WA 1OP5K 4IOFC 4JVPA 5KYWB 3S35H 3KS0J 4P2QE 3I75B 5FAAA 5AUMB 5SX4I 1AGEB 1BIHA 1NGPL 4CU6A 3S3CB 1XX9C 2F5AH 3WKPA 4OZFH 3VG9C 3MLTA 2VDOL 3GSUB 4ZFZB 5HJ3B 2PPFA 3GBNL 4H8PA 4Y2DA 1LO3H 2JE8A 4R2GD 1RK1B 3C5XA 3WEXB 3ZKNC 1VFBA 3MKKA 1DQDH 1JIBA 5DVKA 1OZTG 4PBDA 5E6UB 4HIHB 1S8DA 2NW3A 5EOTB 2P49B 4MMZB 3HHRB 4NNYA 5DC4B 4RRPM 1YA5A 3C8DA 1G9NC 1DBAH 2DH2A 4PTUB 3P2TA 2GK0A 1FLRL 1SVCP 3BVTA 5IB3B 2IH8A 2ETWA 3FTGB 3IDJA 1KIPA 1RZKC 4F7MB 2VIRB 5EF2A 2FE0A 2MRYA 5C3LD 4ZW5A 1FO0L 2Y69B 2GC4C 1EX0A 3HB3D 4IKKA 2VITA 3MV8B 2Y7LA 3DURB 2XTJC 4QTHB 3V6ZB 4BXVA 1QEWB 2YQGA 1PQZB 3LKRA 5BUPA 5I16A 2FCBA 1J18A 4PRPE 2NY3D 5HDLA 1DJGA 3EHBB 2NY1B 4IBUA 1ND0A 1P2CB 2V2TA 3N44B 1B0GB 4OQTA 3Q1SH 2V6HA 2D3LA 4X9GA 3L17A 1N10A 2FWOB 3U9WA 4KAQL 2WXFA 3CFEB 3MBEC 2BHFA 3SOBH 3PYCA 2V2XA 2WYTA 4NCC1 5DD3L 5E1HB 3PHQA 3C60B 3NZSA 5EBWB 4PBWD 4FQLH 4HOWA 1BYNA 3P1VA 3RY6A 3FN9A 1H6TA 4F1ZA 2W07B 2DOCA 1FH5L 2ARWA 2Y9RT 5GJTL 4F57L 2JVUA 2XPGB 2Y5QA 4Y9FA 4NZRL 5AVYB 3GM8A 1AVAA 4NZUL 4P2RA 1A9BB 1U8NB 4M4RB 1KWGA 1HOCB 3FQ2A 3MACL 4XVSH 1N5AB 3L3OA 1WGVA 3RKPA 2DLEA 4IOFD 3DSFH 5DGRA 3AW5A 4MAUH 4W9KC 1HINH 3L3IB 1KCRL 1WWWX 1AE6H 3WENA 1VKXA 4UBDC 3MV7E 4FC3E 2O30A 5DMIL 3S3PA 4FZEH 2C8NA 2ZUQC 1TIUA 1HZKA 1USQA 3RVTC 2Z65C 4OZGF 3Q6GL 1UWXK 4J3UA 1F3RB 3SGDI 3TF7C 4W4OC 5LVEA 4MDJA 4B96A 3BD5A 1AO7E 5INCB 1DCEA 1J8SA 1IBYA 5AAPA 4ZMPA 4QRPE 4ELMB 1XF5A 4LKCA 1TETL 2UY7A 5LCVL 4KK9D 2C7FA 1S7QB 4HPOL 3O0RL 4K3GA 4OFKA 2XRAL 15C8H 2AMGA 4KXZH 5FXCH 1JF1B 4FQCL 4J7RA 3V6OC 4AYDC 3DOIA 4PM1A 2FJFB 4YUEL 4L8CB 5KSUA 2CBPA 4DIXA 1VEOA 1I3GL 3OQRA 5D4HA 3ZT5A 1OLZA 3VQMA 6CGTA 2EVFA 3FS9A 3BP5A 4QOKB 3X13A 4IRSC 4NOBA 1NOAA 5T1LA 3F58H 5IR1B 1WZ1L 4LHUD 3WD5H 2YKKA 3KM1A 3ARFA 4JFFE 4BSVA 3RUGE 3CU7A 1JZFA 3NJIA 4TN9A 1AH1A 4H13C 3BDBA 4HK3J 1KY7A 5D1XC 3P9MB 3GRWA 4NQDD 5I8KH 5TPWL 1WBXA 1HU8A 1W15A 2B1HL 2Q3ZA 1CLVA 2AK4B 4LB8A 4Q9CA 4PJAE 4Z7VA 1KEGH 4IU3B 4E41D 2I60H 4ZO6A 1BAWA 2QKIB 5HYJE 3IETA 4TQHA 2GIMA 4P5KA 1RIUL 4X5XA 2OAAA 1Q9LB 5DHVA 2FUQA 1MN4A 2PYFA 2Y7NA 4ZMAT 2KS0A 5C2UB 3F05A 5ID1A 2F53D 1AS7A 3NJHA 3QI9C 2GITA 1ZVHA 3ZPDA 3IFNH 3M8OH 2J8UF 3U7WL 4ODHL 3CN4A 2ZWZA 2MNWA 4TNVF 2ZQKA 1W0WA 3HRPA 3B43A 3OKKA 1BZOA 4X80H 3QZLA 3QZPA 4UBDD 5F6IC 1AS6A 4W6YB 5JIIA 2P48B 2ZCKH 4XBEH 1DVQA 4J39A 1IBFA 3FL7A 3KLDA 5C0EA 4K3EL 2V7HA 2F8IA 5DC9B 2O5XH 2DIEA 4EI0A 6FABL 1UT1A 4FP8H 4RAHA 3Q05A 4XN1A 4QEGA 2OXGB 3ESNA 3O41B 2GTWA 4APXB 5FYJH 4YGVB 1EPFA 1MJUL 1U95A 1GPOH 1DDHA 4K94L 5FO9A 2WVUA 4AYFB 3P2DA 1AY1H 1TMCB 2P5WA 3WBDA 2WXOA 4X7TB 5GGRB 3QS2A 4AIZB 4IRSD 5CP7A 1IGIH 2IANA 3NA4A 4WI9A 3ZHDA 3TEYA 5DI8A 5F3BB 4GIOA 5DZNA 3O2DA 3SDCD 4HWEH 2XTSA 1NC4A 5SWZA 2JCCB 3EYSL 1T66D 2V8LA 3ZMRA 1ZT4B 5K9JL 4GAJH 3F8UB 5GZND 2JELL 5EF3A 1HHJA 3SJVD 3A3YB 5J13C 2B7DT 1K5NA 2X4PA 5IB5A 1MNNA 4WO0A 4YPJA 2ED9A 4GB9A 3UBXG 5HJBA 4M8QB 4L3FA 4I77H 1XGQB 3G9VA 4PB9L 1EHKB 3HNTL 1E5ZA 4X0KB 5ACMA 4NZTH 5A6IA 3VXUB 7TAAA 3L4ZA 4JNXA 3S4SA 2JQMA 3QEUA 3OMZA 4FYTA 2L7UA 1FZJB 3ZO0A 4N8PA 2P5EB 3KG5A 4LLUA 5FM5M 4WZ9A 3P4OB 5I1CH 3MUHL 4ADIA 2Y06L 3RU8H 4YDJB 4BA0A 3MODL 1Q9OB 1ZVNA 2IH9A 3MXWL 1YPZE 3KJ6H 2GEEA 1JPGB 2DQFB 1AR1C 5I82A 1XH1A 1N64H 2EILB 2FJHB 2CO7B 1RPUA 4XB3A 1AJ7H 1TTAA 3C8HA 1G9NL 4LEEA 2DJMA 5G4OA 1MF2H 1X4XA 3PXLA 3QJHB 1GGUA 4QRQB 1UXWA 4WLCA 3S96B 1RZKL 4QUOA 1H19A 4P46B 4M1CC 3DX6B 2ADIA 4MA8L 1N3NB 2VW4A 4M7LH 4Z78B 2FR4B 2DL9A 4YDMA 5JORA 2BHYA 1JPST 4DGYL 2R2EB 3KPRD 2X4NA 4LSSL 2DL2A 3AG1B 4QXUL 3QIUA 2IXQA 5KJ7E 1MHPH 1BGXL 2QMKA 1M9WA 1BXUA 2EEXA 5C0FA 3WSQH 1QKZH 3DHMA 2G30A 4XPAH 2XVGA 4ETQA 1BEYL 4PRHA 4WJKB 1F3DJ 2R69H 5EFIB 3L3JA 4K7PX 3RAJH 2A9MH 1B9ZA 4WTQA 1CTNA 4Q8BA 1NDGB 5IV2B 2VDQB 1J5DA 3BXNB 2ITCB 2FNWA 1GGIL 3B9KB 4YFLI 3IXTA 1CICD 3E3QE 5BS0B 2FB4L 4Y1AE 5JDJA 2XZAH 1NJ9B 2ZYRA 1EANA 3JWDC 4Y5YB 2PTTA 2TRYA 4G6KH 3DWTA 1W2KT 5E2UH 3TESA 3UO1L 4FG2A 3KGUA 4NPKA 4W70A 1JNLH 4ONOA 4G43B 2WMPB 1MFAL 3FO1B 3LPFA 5B39G 2M8XA 2W60B 3V0VB 2C1PA 4DPCX 3WJMA 4NNXA 2V5TA 3EH2A 2VUOA 4ANUA 2HJLA 5JW3H 4U05A 1KN2L 3IF1A 1YMHA 3LYRA 3PWPA 3HRZA 2W88A 3MJ6A 4JM2A 3CPLA 1U6AH 4TRPL 5D1ZC 4F2EA 5I28A 2F58H 5TF0A 1MDAA 2Y1ZA 4L9LB 2AQ1A 3CFBA 3FBKA 1OTTC 2VDRL 1AR1D 2J2ZB 4HUXA 1J0YA 2H6PA 3NSFA 1HWWA 2FLMA 4LU5L 2K78A 3AXLB 3TVMA 1MFEL 5D6CA 1XAUA 5KW9H 1ZKAA 4PD4J 5F7EL 4IKIA 3E38A 2WUCL 4MJJA 5GJSL 2A4EA 4M5TA 2P28B 5KYUB 3H9ZA 2FO8A 4HLZG 5B8CA 4BRJA 4ODSL 4DGIH 3WY3A 2A73B 2CJUL 3QXWA 4OAWA 1SMDA 4R4NC 5IB2A 5E0QA 3BGAA 1ID5I 4C58B 4WTXA 1E5YA 1DBBL 5DJYB 3T6QC 2BC4B 4QI3A 4KKLD 3P3UA 3BZDA 4HS3A 3B2MA 1RZFH 4TUJB 2VSMB 1EAOA 1GC1C 2OSLB 2R27A 1HNFA 2XBZA 1QSVA 3LZQA 5B3SB 1EJ6A 3OB0H 4GINA 3EJQA 4UV7L 4QT5B 1BVKB 2E75C 3GMOB 4KUCD 4OW6A 3V5HB 2IPKA 1ASQA 4XCCL 1KC5L 1MWAA 5I5JA 1F1AA 3QIBC 4JRLA 1X44A 2N3JA 2W65B 4M1DH 4CC4A 1I1AA 4DPRA 3LZPA 1Q0EA 3GS7A 4X6DE 3EO9H 2FL5A 3OPUA 2O5NA 2FEDC 4IRJA 4XMTA 3S8GB 1G7MA 1WGOA 2AEPH 1AQKH 4FG0A 4L3ED 5TK4A 2NZIA 4AZ8B 2MWCA 1RHFA 1GYAA 3QQDA 4MX7A 4DFHA 5KUMA 1IGJB 2OMNA 2N7AA 4OVUA 5F1OB 1A6VL 4B7IA 1IC7L 4EI6B 4NBYB 3US0A 2OJ1A 3ME0A 1DJSA 3EH5B 2GT9B 1P6WA 2E7LC 3TONA 1TR7A 1QNIA 2A4CA 2EH8H 2ZWSA 4EN2A 3RYMA 2R0LL 4QRSA 3VWKC 4JO2H 3O4OC 4YWGH 2NY3B 1U42A 1Z5HA 4F37F 4FLQA 3RVUC 1IB5A 4DW2H 4EPSA 4OM0L 3TWYA 2KHAA 4D9QE 1HTYA 1ETZA 5DJAB 2B8OT 3BGFB 4P3CL 3TJEL 3EXLA 1MCDA 1URZA 3G5WA 4DKEH 1ZLVH 4G5AA 1WA0X 2E5EA 2R4RH 2ZUXA 4HAKA 3G5XA 5FF6A 4A7SA 4G9FD 1P9MC 1S7UB 1CDCA 1URIA 5GGSB 4W9ZA 4WVRA 3MX0B 3QDGD 2J88L 2OMVB 2CPCA 1NWOA 2DQHL 1W72L 1EO8H 4APQD 1RZIA 2HG5A 4ALAH 4IIQB 4LHQB 5SWQA 3ARPA 2PTUA 2OI9B 2BSTA 5E2TL 2W9DH 1RI8A 1RUML 3KVPA 4F27A 1E3FA 3L95B 3B3IB 3MRHB 4NS0A 1U8CA 2OZ4H 3QZMA 3NFPA 5C7ZA 1OAKL 1CS6A 3ZR6A 1PZ3A 3B5HA 1UCBH 3W2DL 1DUYB 3GIZH 4M62L 4PRAB 1CDHA 3G6AB 4L8SA 5DVMA 2R4SH 4LLMB 1YNTB 5E1GA 1PAMA 2VL5A 2CDEA 5DRWB 5JXAL 1P4BL 3FZUC 2A3TA 2AERT 4PN6A 2H32B 5A3IC 2FEDD 3LPPA 1F4YH 4PEEA 4LESA 1B3IA 1E4HA 1LO0L 4HHAB 2Q7NA 4J3OG 2EE3A 5DTFB 2YWYA 4IEFB 5IUCA 1FFPA 1M57B 2E76C 2NX5D 1LE5B 4LOVA 5CZVH 3MRFB 5F1NB 1QSEA 2PWFA 4JPSA 4PV9B 3I9GL 1R3LA 5ANMB 3D12B 5D7HA 5GSVB 5DJ2B 1D9KD 2R2HB 4HUUB 1D5ZA 3JWNE 2JFCA 4TL5A 4XWGH 1LLAA 1JPTL 3S3JA 4OCRH 5EWIL 5JOPD 5FUZL 4YDVB 3BFQG 5LNGA 1HI6A 1J86A 1FQ9C 5AAWA 3ORJA 5EORH 5J11C 4IRZL 3FCTA 3D07A 1L6XA 1ACYL 4M93B 5B1AB 2CHXA 3NQIA 3QJTB 3NIGB 3M6DA 3RPIB 5SV3A 3NCEB 4ZOCA 3AJ7A 1HHKA 1E4JA 1NBVL 2IDTA 3QGVA 2V5YA 4NQDB 5J6SA 2VDLB 3B1UA 1MKFA 4OJAA 3SDDC 4L8BB 5C8JA 3GXTA 4OJFH 3UZEC 2QPUA 2B9BA 3VMPA 4A37A 3NCFB 3ETBJ 2BNUA 1BFVH 3OTTA 3GMPB 1J1PL 1E2ZA 1AHKA 4KV5F 4JM2F 4LCWA 2JKWA 2APXA 3NSJA 4WO4D 4E41B 1N8OE 4R3SA 2MNUA 1O7DC 1MJJA 3T4AC 1I7RA 2WLIA 2A6JA 4LOFA 1JUFB 3BE1L 4FQJH 1K8IA 1UOKA 2NZ9D 1XVSA 1OAQL 1M6OB 4W4NA 2IADB 3O2DH 35C8H 4BRVA 2DEYX 3GDCA 1QABA 3ZSSA 3AWFA 5C6PB 3U0TB 4O2EA 3RL1B 4JZJC 4EAEA 3CN1A 1YSOA 1J87A 2D4DA 3JWDL 2DMBA 5ADOH 4ZI8A 1NC2A 1UD6A 4P2OC 1F4XH 3MLSL 4QHNA 4MMXC 5EEYA 4IDJL 2Y2WA 1U91A 1H9DA 2QVIA 5J0BA 3HCVA 4GIPD 1V10A 3SYCA 5EOCJ 1GRWA 1UKTA 1KT2B 4WEMB 3VWJD 5A3ID 1MCOL 5C0CE 4UM9D 4F5CE 4HETA 1AKJB 3V2AR 4ZUTA 3G9AB 4K5PA 5FKPB 4L0PB 2G5UA 3CFCH 1HSAB 4OV5A 1BBDL 4XOEA 5CXPA 1WBZB 1XF2B 1MJ8L 1NCOA 4D0BB 1CLZH 1ZXQA 2C3GA 4O2FB 3IGUA 4S1QH 1KZQA 2BIQA 2XYBA 2BW5A 1XSJA 4N1HB 3X3FH 3MPCA 4M7ZC 1IKNC 2Z31B 3TA3B 3BVVA 4I13B 2AQSA 1OP5H 3VVVA 4HDIB 1SHWA 4V1DE 4A6YL 4OBRA 2QFPA 4Q4IA 5E8NB 2YFOA 3S2AA 2ZIDA 2CGYA 3EDJA 4E5XB 4JGUA 4F58L 1CYXA 3KGTA 4N87A 4KZEL 1TZHA 4OF5A 1UJTA 4Y88A 4K7PY 4R4FL 3MUY1 5T5NF 3HAEB 5IESL 3KLQA 4Z0XB 2AANA 3VFNB 3SDDD 4ZFOL 3MXVH 4F92B 5F93C 5FFLA 5IB1B 1K2DB 1CLYH 1SUJA 3L9EA 1BAGA 2BOCA 3OWRA 4ZFFA 1I8KB 1MCBA 3QIWC 1NAMB 2R1YA 4LSQH 4O9HL 3TYGL 4EF3A 4I3RH 4E2OA 4E9WA 3GSOB 3KCPA 1GC1L 1LGVA 4LDCA 5DMKB 1I9JL 3WAJA 4ZTOL 2JJSA 1H8NA 3R8BB 1NCWL 1Q9WA 1AXTL 2APVA 1R1CA 3J7HA 4GSQA 5DUJA 3ATAA 4AMKL 2O5YL 4AQ1B 4MJIE 1OZUA 1NDTA 3C75A 4L4JA 5TDOA 2W9EL 1TJIL 4UTBA 5HD8C 4HCGA 1WO2A 2WVTA 3JZ7A 1GH7A 2V2WB 3VFTA 4H25B 1A6UH 5DQ9B 1MW0A 4WWKA 5AZEH 3NZHL 4LZKA 4XP5H 3SODB 3VW3L 1TZIB 1I7UA 4IK7A 4Z7QF 1JGLH 2GPZA 3U2SA 4ZMWA 3PGCA 1CXIA 4YL4A 4GG6A 3CLEL 4F7TB 5L7XH 3TO4D 4KZCA 4FXTA 2OTUA 2ESVB 5D72L 3D39E 3NJNA 2QPSA 2YFNA 1WLHA 1QPKA 3D2TA 3DV6B 4S1RH 3MCG1 4TNWK 3H9SD 1N2RA 1BLNA 3KPSA 1ASOA 4WUUA 7FABH 5BPPA 3O3DA 4ZQKB 2DLGA 2DQJH 3DVGA 4TV3A 1T7WA 1O5DT 4JY6A 1A66A 1FL6A 4Y5VA 4FI7A 5CNHA 1N4XH 3FT3B 4Q52A 3ZDZF 2AQQA 1JRHL 3BUPA 1LO2H 3S5LA 1MEXL 1TSHA 1VDGA 2CPUA 1ONQB 1KPVB 3LQAL 5JPNA 1KYUA 3QCTH 1YEDB 3CMOH 3GJEA 2EP6A 3U0WL 1EHXA 4OZFG 2JCWA 5EDXA 4D9RE 3EOAB 4RZKA 4UM8A 3FUEA 5CGYD 4Y9CA 2BY3A 1SFHA 2VLME 3ECVA 4N9GA 1PBYA 4G1EA 4NWTL 3JZYA 1E6OH 4WI5A 3H56A 2XN9D 1K72A 4NCDA 4LVOC 2R8SH 3V0JA 2FEEL 1GSKA 4LDOB 1UWXH 1WD9A 4MNGB 3HZ3A 1CICB 3QFDB 4KO6A 5C2BL 1I85C 1YZZA 4GMSL 3WKQA 4M43H 3PGFH 3MRIA 1ZSDB 3WTTA 4CVXB 3QIWD 4N26A 3L5WA 3OAUH 3TPUA 2QQLL 1J1XH 4C4KT 4LSTL 5DJ8B 4J8QA 1MJ7H 5AYUH 2EVIA 2UZXA 4UUJB 1SDYA 1L9TA 2GKIA 4LVEA 3LZFH 4E9QA 1CQYA 2NY4C 3TBVB 4ZPTA 1T0NB 1KF9B 1KPUA 3T6ZA 1R3JA 4UU9B 4BKSC 2BIHA 2YD4A 2WKOA 2R59A 4BINA 4OLZL 2VRQA 3AREA 1SY6A 1D7DA 4JCLA 3BN3B 2N01B 4X5RA 1BQLL 4TQEL 1PGRB 2Z92A 3R18A 1WRFA 2ZNXA 3FSAA 2YSSB 2AGJH 5I73C 1MWAH 3QNXB 3TFKC 1O6SB 2P8PA 1PG7H 2OZNA 3MFGB 1J5CA 3ZSTA 3KR3H 3P30L 4O2CA 5BZZA 2PABA 2WINA 3Q0HA 5IJBC 1YEKH 2XWXA 1CFNA 3HPLA 3UJJH 2WCPA 1NCJA 5MEPB 2DZEA 1IAIL 1FYTE 4E9LA 5HHMD 1KV3A 5L2KD 4LP5A 1HJCA 4PTTB 3QQ3A 4U1KA 3G7TA 3RA7L 2WHVA 4KH9A 4YXHL 3ZTJH 1JI2A 1P7QA 3NZUA 2FYVA 1J05B 4LCVA 3CSFA 4HUVB 2H1XA 4YXKL 5I8CA 1ZVSB 5D96C 4JRXB 1IE5A 4GBXC 4ANWA 3KLSA 5J1AA 4WCYH 4ZS6C 3Q2VA 1HCYA 4JL1A 1J10A 1YDPA 2YAHA 4NFCA 4NUJB 1LYQA 2G2NA 4R90H 2BDNH 2YPLB 3O3AB 3QUXC 4N0FA 5DS8A 3S7GA 5A2LH 5EO0A 4GRLD 4QRRE 3ZOAA 5BXFA 1IC5L 3ZL2A 2WVSA 3B7SA 4JHVA 4QYAA 5I75B 1F90H 3QORA 4Z77B 4LOUC 3D52A 3ALPA 2ODIA 2IF7A 5JR1H 3LDBB 2YPVA 3QH3B 5FYJE 4U1NA 4K3DH 4P5SA 4BE6A 5EF0A 5F71A 5HHPB 2DW5A 3GMLA 4AYEC 4O02L 2WQXA 5TDPB 3DHJA 4MJ6B 3UJTL 3IU3A 3GGWA 1XCTB 4ZMZA 4ZSOA 4L4TA 5IG7A 1QYGH 1G7PA 4DP5X 3WEOA 5LKNA 3DV4A 4L3EB 3K4DA 2H1PH 1JWUA 3BT2H 4FHJA 5EU3A 5D7JC 1QZ1A 3DMMB 3FPXA 1IFHH 1NCAH 4PJ9A 1FE8L 3D85B 1CU4L 1G5AA 3Q43A 3N06B 3V52H 1LDPH 5E0FA 3ZKMD 3T0AA 3CVIH 3DRQB 4RRPA 4PJBB 1U8QA 1EK3A 2OW7A 1KCSL 1AHWA 3S97C 4LDLB 4Z3EA 5LUMA 2PCPB 5C07B 4Z23A 3AACA 4K23H 1WISA 1VAHA 3FTVA 3AU1A 4PHXA 3VXNB 3QB7C 5LNEA 2AQPA 3IMTA 3MJGX 4OUUA 4I2XA 2GAZB 4GAAA 2DPKA 2HLAB 2OR9H 3I9PA 4OCWH 3HOGA 4MA7L 3ESPA 3LEXA 3ULUD 1XF4B 4O58H 4PJ8A 4W93A 1KSRA 1OAYH 3F64A 3IWUA 1FL5B 1F56A 3DDGA 1SXNA 1XXFC 2WKLA 5HDBF 4KI1A 3DSNB 5GGTA 1GGTA 4FXKC 1DSWA 3QRGH 1NLDL 5E6IA 2XG4B 3KPOA 2X7LA 3WNMA 3ARQA 3NCCB 3EUDA 1HXMB 3PJNA 2WM0A 2HT4C 4HGWA 4JFEE 4GG6F 4HT1L 2Q10A 4GQ9L 2OMUA 3CE1A 3KLKA 4OGAC 3T1FA 4CSSA 3MCLH 3BCFA 3K2UL 1KB3A 3QCVH 1TJHH 2ZXAA 5ICZA 3JVFC 3L3GB 5GIRA 1NCDL 4MB4A 2OKMA 2HKHH 2JB6A 2NNCA 3TIEA 3H0TA 1U8OB 1GGBL 1V3JA 4WKZB 1P5UC 2IOMA 3SD5A 3WV0A 4AYGA 5KVFH 5BV7H 2XG5A 3F6IA 4P06A 3O2WH 3IXAB 2RFXB 4YEEA 3O9WC 4GS7C 5CJQL 3FONA 5AB1A 4FLOA 4O4YL 5D55A 3MRKA 5I30H 3OZ9L 2JKLA 1Y18A 2H26A 1OARH 1NIDA 3RZCA 4K07A 1WAEA 2IMMA 1FGVL 3QQ4A 3OMNB 4EI5C 4TXVB 1YY8B 2D7TH 2PXYB 2J8UE 1BFOA 2FLBT 1KIRA 1T0PB 4AGPA 1JZ2A 4PRNB 3FAWA 3UBGA 1YEGH 1B0IA 3UTSD 1CD1B 3A23A 3V0EA 4M6ML 4WI7A 2WSDA 4GKZA 1L6PA 1MIEL 4Y4HB 3FOMA 5E6RB 5L2JA 2E56A 1UG9A 2K4WA 4CN1A 5B1KA 1R19A 3DVNB 3NP3A 1T1ZB 3KPQB 2WAQA 1U8PB 3K1KC 1G84A 3VGEA 4NHCL 5F89A 3FO0L 1QATA 1RP8A 4HX1A 1CDIA 3Q8AA 5DRXA 1Z1WA 3IN2A 4JO1H 1ML0A 1R5WB 3AS2A 5E00A 1F3JB 2WNKA 3H85A 5HDQH 2B1OA 3B9EA 4RISH 5KVDL 5MEQB 1PW3A 3L3HA 2B14A 2X6MA 4TULL 3KLAA 2WKOF 3EGXA 2ZG3A 1GS6X 3U0PB 2OPCA 4WO4B 1UTDA 2QR0B 3WL9A 1DUZA 5CILL 3H1ZA 3HMXL 3LNDA 4ERSH 4F2FA 4HQQH 5LGKA 1ZHLA 1NGQL 5GS0D 4BZYA 4XP4L 2ADFL 3DBXB 1U8KA 4MYWB 4NLHA 2Y7MA 5HSFA 1MH5A 1AG6A 1FIGL 2K45A 4IHBA 4PP2A 2X4RB 5EU6D 2DMHA 2W0KA 4FQXD 3QNYB 1XGYH 3ATEA 4HD9A 5E4IA 3ZTNL 4Z0XA 3JV0A 1I4FA 2P47B 2YD2A 3HEIB 3JWOC 5EZLA 3W57A 5AOLA 4YLBA 4G8IB 5C0AD 4OZHB 4P49A 1EEYB 1JS4A 3CDYA 3WS3B 4EN3C 3RWCB 3P3SA 3UTZB 4H88L 1M7IA 1A7PL 4AV5A 3DXAA 3O9WD 2DQCH 4PD4K 3ULVH 4UM9B 3MNVA 3HG1E 2AJ3A 3FQWB 1HILA 3B4NA 3MN8A 2AK1H 2OW6A 1A8JH 3LKPA 1QLEL 1UZ8A 4IKNA 2Z1KA 2Y3AA 1VSCA 5D2NE 5EZJB 3MBWA 3A4DA 3S34L 1MFVA 1IRAY 2F1BA 2Y7SA 4UB0H 1H6EA 3O6LH 1A7RL 1QVOA 2R56H 3D25B 3ETTA 2X4SA 3IDGA 4XWOD 5KVGL 4UTAH 5ECJE 4M7LT 2D3NA 4H44C 3RFRA 3IPBA 2A7BA 1TLKA 1TVBB 2Q76A 3F3HA 1DZBA 3K6OA 3ZHNA 1A64A 4C56A 3A67H 3MLZL 4DQOH 4P2RE 4M7KL 4U1HA 3OKLA 3M17A 5CLTA 1T1WB 2ENPA 2BRRH 2TAAA 1CFQB 4OIFA 5IQLA 3B5GA 1DQTA 1OALA 1U9KA 2R7EA 3NZ8B 5E8PB 4MZRA 3AQZA 25C8L 4LSRL 1NGWB 1EDYA 3IYLW 4DFIA 3AGVA 1GS8A 1BD2A 1A6WH 1QFHA 4XODA 1TFHA 5K59F 2X1QA 3Q01A 4UILH 5E2WH 3SGKA 4HCFA 5DLML 2EYSA 4YHLL 3RFZA 3QP3A 3CK0L 4RAVA 5I1JL 1VGEL 3HAEH 3CSTA 3O11A 1HQ4B 3MUUA 1FNFA 2UXFA 4NQCA 1M3IA 3RGVA 4JM4L 4WHTB 4DO4A 2NXZB 3FFOA 2FWLB 3GHBL 4K8RH 2VUKA 1NAMH 2Y5TB 3LS4L 4Y5XA 3BWSA 5BOPA 3RURA 1I3RB 4ZOEA 2B59B 4PJDB 4AW4A 5T1KA 4KWUA 4JFYA 5ACLA 3QNZB 4ODUA 4F33B 2VN4A 2Z35A 3P3TA 5J89A 4PUBL 5E9DB 2HLFD 4X6FB 3TO4B 2F68X 1LWJA 2G5BB 4EN3D 1VADB 3H3KA 4OLWL 5JPMC 1GZHC 3PS6A 2IDUA 2W9LA 4LCYA 1NICA 2RAMA 2EVGA 1IC4L 3I6SA 1KELH 4S2SB 2EXTA 1VZGA 1LM8V 3AM8C 4RWYH 2LABA 3HMWH 3PDDA 1QA9B 1ZTXH 3TZVC 2X4OB 3TCLB 2BSCA 1BVLA 2B4CC 3PNWB 3HS0A 1UD2A 2EC8A 5IW1A 3KL5A 1BAFH 4WWID 1ETA1 1T89C 4XCNB 1DQLH 1YLBB 3QSKB 5FKAA 1XGRB 3WJJA 2VXQL 3DO3A 2GEQA 1KOAA 2WWOA 3FFCA 4PJ5B 4JBSA 4NJAL 4BZ2A 2C4FU 1OT4A 4G7YL 1QSFD 1OF0A 3O45B 1J0KA 3HHSA 2J5WA 3PIQA 2QMJA 1I8IA 5B7EA 2GI7A 5LN4A 5I15H 3EYUH 4AM0B 4JY5H 2CDGB 4ZOAA 4N5EC 2DM7A 3C6SA 1VPOL 3ZDYB 4NRZA 1AXSB 3VXSD 5I1KH 3U46A 1OWWA 1KB5B 2EXSA 2VLKD 4OCXH 1SLWA 1K85A 2HFEB 2E0PA 4ADGA 4PLJC 2GY7B 2HJFA 1I31A 2B2XL 4QOKE 4XXWC 1FRGH 1JWMB 2D0HA 4A68A 1N70A 2NTFA 3CDGA 2IQAB 1TCRA 3CZKA 4GW4B 4MTMA 4QXTA 3IGFA 1LJMA 2NSMA 3P0YL 3QARA 4DPBX 1E4KC 2Y7QA 2P5WE 1MRCL 1ZDQA 1MCEA 2IANE 4CMHB 1ZA6A 4X9BA 5D8JL 1AXIB 4EXKA 5DRZB 3Q8EA 4ZYKB 5I71C 1LL1A 4JAMA 3O6FA 3PREA 3ZYOA 4YL9A 2KZ1B 3MBXL 2LLLA 4YDIL 1KCKA 4CKQA 4KH2A 5HHXL 4FFYA 3TZVD 2ZXQA 4UZGA 2P52A 1BZ7A 4UQ2A 3VE0A 5A2JH 3CBJB 5EIQA 1CDJA 3DX8A 3VSVA 4J27A 4AI7A 3MJ9H 3FB8B 3CXHJ 2BO0A 4QAMB 3GSWB 2FVNA 3P11L 3D33A 4U6HA 4Z7AA 2QELA 3D34A 5T33L 4OIIH 4UI2A 4ZO8A 5IM7A 1PLBA 4C54A 5GS1A 4C4KO 1VHPA 3EBAA 5J1TC 1GIGH 1UHVA 1WFOA 1J48A 2VDMB 3E2HB 5CGMA 1R46A 3MREB 4HC1L 2Y36H 4B9PA 1A7QH 3RJQB 3TURA 5DHXB 2NMSA 3IU4L 2JTYA 3C5ZC 3IAGC 3PL6B 5G55A 4RX4D 1HFUA 3B2VH 2BNQA 3VFWA 3WXVL 3T0DA 1FVCB 4R7NA 4F8TA 3IMBA 4N5ED 4IOSA 5C0RH 1B0RB 4PJFB 4UQ3B 1NGXA 2IGFL 1IZJA 4XNDA 3L2NA 1BYPA 1F4HA 2V17L 4FXGC 2ALAA 3NN8B 4HZLA 4TNEA 3V0WL 1V55B 1OGPA 1OSPL 4NKMB 5DVLA 5B3NA 3JWOL 3PHAA 3TBCA 2DQEL 3WE6A 2PCFA 3ZL4H 1HH6A 4B9IA 2ZPKH 4GW1A 1S9WA 1CK0H 1EJ8A 2VUYA 2FO4B 3EG9A 3K6DA 1SGKA 2J4WL 3N91A 2XV3A 4GI8A 2VR6A 4I3SH 5CR1A 3ZUNC 4X7SL 1CBVL 3KS0H 3L6FB 4HHWA 1NUFA 1H3XA 4NN6C 4OH2A 1MCKA 4Y19D 3SBWC 2LGNA 5LQBH 3OKMB 1BX2A 5D7KD 2DMGA 2N7SA 3F7RA 4YXLL 3N85L 1WYJA 3VXPA 4PRHE 3GC3A 1AIZA 3UBFA 2BIIA 1SM3L 2QT6A 3DUHA 3OJDA 3HZVA 3EJPA 2X2HA 3QYCA 5D9SA 4B0MM 2EKSA 4JQXC 4ONFH 4LIQE 1S2EA 5FCSH 1J9TA 2OK0L 1LVEA 2NCEA 2EC9T 1NOLA 1R34A 1U8HB 1UM5H 1ULVA 4XAKD 3I02A 1DJXA 1SHSA 2VR7A 1CGXA 4GP8B 3VGAB 1WFTA 3CU1A 3KJ4B 1QD0A 4P23A 1A3LL 1KEMH 4WU5A 5IWLC 4OR1A 2H2SC 3L9RB 4D9LH 1NMCC 1NL0H 3D2UB 4JQVC 1PKQA 2AQTA 3PUUA 1T04B 4JFDA 4YGAB 3T77A 3LKQA 2BVEA 4U33A 3IKKA 1MXDA 2CHZA 2J56A 4YHZH 3KE0A 2CKBL 3BYYA 3V5DB 3HPJB 4YK4C 1UGNA 4IM8A 1B2WH 1COBA 1HIML 5KOMC 3PWPE 4NO5A 3KAAA 1T21B 3C5ZD 2EDFA 3FPYA 1PLCA 2OTWB 4ODXB 4X4YA 2BSSB 3GMQB 2DI8A 3K74B 3MJWA 5A1AA 4JFHE 5E03A 1RHHA 3QUMB 3DGGA 5KJRH 3PHOB 2X2IA 5EIIB 3VX0A 1QRNE 5TE6L 4FA7B 3LQMA 3CC5B 4GSUA 2FH8A 4HUCA 4N6RB 3KPPB 4LK4A 3K6NA 4FNLL 4RAUB 3IB4A 5ELIA 3WEXA 4XRCA 3UAJA 3CX2A 2F1EA 1OHZA 3TM6A 3CUPB 2DH3A 4TQPA 3FW6A 5K9QG 1AHMA 4U6XA 4YX2H 1PVHA 3VFGL 4BUHA 4NRXA 2EIDA 1PJ9A 4XI5C 1XR9B 1H6FA 5DYOA 1XIWC 3FUFA 5D7IB 1X4YA 3FTGA 3LMJL 1ZHNB 3COOA 1OT2A 2DIJA 2B4CL 1OGAD 3CFDB 4W9GC 5BS0E 2Y6SD 3AQDA 5FX3A 3O6KH 1JCKA 1G6VK 1E28A 3ZE0F 4G8EB 4Y4KC 4QRFA 2AJUH 2AJXH 4JKPH 2ID5A 2YGPA 3HC3H 5F1SA 2VH5L 3SPJA 5KVMC 4OM1H 3LNIA 3M7OA 4XNXH 1XQ4A 1S7VA 5C09A 5LBSL 5TD4A 2X6CA 2QHRH 1TOXA 5IVXB 2Y1VA 2VYRE 3GLZA 3JT0A 5E1AA 3O8XB 4OSUL 3B34A 2WXGA 2CK2A 2CIKA 3QJZA 2BOBB 1CL7I 5FO7A 5E5LA 1MHHB 3CIAA 3QDAA 1F6LL 1RAMA 2VZ1A 2YHGA 3D48R 2FECI 3CH1B 4XBPA 2OMZB 1JXDA 4JQIL 1H0DA 2FX7H 1C16A 3HE7B 2XPGA 3I6LD 3UXFA 5C0AB 1K9TA 3CH8A 4JN1H 5EN3A 4EZMA 5L8LB 2XU9A 4XH2B 3ZYIA 4Y89A 4CADA 4XAWL 2ORBL 3BKMH 4YVNA 5GGQH 1HHHB 5IROC 3KVDD 2ZOLA 1J0IA 2Q7YA 1DN0A 3JBG7 1WD8A 1BZDA 4FQPA 5E5RB 2BY1A 1WZLA 3QEGH 4MQXC 3F7YA 3VO0A 3SKNA 4Y16D 3KWWA 1E40A 3UEQA 1BM3H 2VSDA 2OA9A 2QBWA 2AV7B 2RB8A 4Z7QE 5EH1A 1Z5LA 4PRBB 2YUWA 3VTAA 1QPPA 3SN6N 2ATKA 3EYQC 4HIJA 4WFEE 3EYOB 4P9HH 3I9AA 5I1HL 4MB1A 2BINA 4HS8H 5JQ6H 2IFFL 4XI5D 2VLLB 1BXXA 5IFHL 1NQBA 1JYWA 3DOSB 2BPBA 1UZ6F 1L3NA 2A4ZA 2F08A 5TF1H 3FB5B 1M2VA 5J6GB 5L4FA 2H3NB 3DDFA 3CVHL 3EZJB 3EDDA 1ADQL 3HI6H 4UIKL 2DYPB 4Y4KD 1RUPL 3ZDZE 4M8UA 4F9PA 2GY5A 1JPFA 3W1ZA 4YBQC 2EYTA 2F5BL 2YN3A 4MD4A 2LLNA 2OX5B 5SWSA 3V6FB 3L7FB 2X42A 5D71H 2EIBA 1JTOA 4PGBA 5CU5A 4JDVA 4WI3A 1OTUC 4WDIB 4F7KA 1KN4L 2Q9OA 2XZCL 3BW9A 3FO9B 4LP8A 3WFEH 1IL1B 5M94B 4MA3A 3GYRA 4L1LA 2HXAA 3RIAK 4GXUM 3QRBA 5IJVA 4HKBA 2F7PA 2WK2A 1TZOA 2QGCA 3EIFA 5CEYA 3CC1A 1WHOA 2C5DC 3ZYZA 43CAA 2WZ6A 3KWUA 4FTVD 4RMTA 3THML 4JFQB 5HGBA 4X8JA 1J5OH 4WI0A 3FCUB 4P07A 3ZTJG 3IFOB 4ODWB 2X12A 1FAIH 3P0GB 1YNLL 4DEWA 2GBTA 2NLJA 2VDOB 5IROD 4AGQA 3ARFC 2IFGA 2O6PA 4FFTA 2TSBA 4TSCH 4WV1B 3QUYA 3LRMA 4QHMB 1FFOA 3NCJH 4H8WC 2AV1B 2FX9H 3L08A 3BRDA 3WO4C 3ILPA 3QFJB 3U4EB 4E42A 1VENA 4RVBA 4KXBA 3BSZA 2WXMA 3MROB 4I89A 2W0PA 4WFGD 3BPLB 3RHWF 1IO4C 3BQUB 1REIA 4U31A 3MAWA 4ONGL 4X7EC 1FZKB 2J6EL 4LL1A 1VFAB 1ORSB 2BSBA 2QGDA 1NSNL 1IAIM 2VR5A 4NQVB 1JVLA 1RZGB 2JKIS 5KVFE 2ZCHH 4U6YA 1OEZW 3EYQD 4HXAL 2YC1A 4KROC 3MJ7A 4LCWE 4NHUA 4XNAA 4HF5H 1E4XH 4HWZB 2OXGA 2WLZA 5F97E 4G5ZL 4TS6A 1SJEA 3IGLA 3DTXA 5EOQH 4XN4A 4UT9L 4AYFA 2A1WL 4GMTL 5GRVL 3U7YL 1RVFL 2X4TB 1EJOH 5JOFB 1U21A 2VDNL 3MCYA 1W8NA 4Z3TA 4FFYH 3DX7B 2XBTA 3N1QC 4L0YA 2IOOA 3C6LA 4DN3H 2BVPB 5IHZA 1T3FA 3JTBA 4GAYB 1ED3B 5BO1H 5ICXA 4JO4H 1ZT4A 4GG8A 1CFVH 4B97A 3II2A 2H0FA 4IDLA 5C6TL 4UDUB 5FOBA 2G4GA 2FJUB 1SDDA 3KHOA 1XV8A 1UACL 1YEHL 2EXYC 5L88H 4BKLA 4NCC2 2VJ0A 4HA1A 4CW1B 3GEWB 2WVVA 5AD0A 3GLDA 4TQIA 2YK1L 1KGIA 1SBSH 4UT7L 3MLVL 5DQDL 2D9QB 1F3DH 4A2FA 1C5CL 1HL9A 4Z6AT 5GRZA 3DGCR 1FORL 4UINL 3LH2L 5H94B 3BEVA 4FNPA 1FZJA 3BDYL 4F8PA 2AXHA 4G6AC 5IKCA 1CR9L 1DJHA 1MIML 3QUZC 2WLKA 1AD0A 3K71B 3DX9B 3P0VL 4NSKB 1ZGLP 3G5VA 4POUB 1FL3A 3TN0C 4X5LA 3L2MA 1IAKB 4NAMA 4I0PA 5F0PB 5BRZD 1NKOA 1RULH 1K4DA 2HA1A 4P9ML 1NFKA 2Q8AL 5E56A 1FO0A 1FGNL 1Q9KB 5DO2C 4OZ4A 1KYAA 4TUKH 5L0QB 2IAAC 2P8MA 3KPMB 4JDTH 3DPBA 2MFNA 4WENB 4WFFD 5IBUB 4OZIA 4ZW7A 4D0CB 4KY1L 1BZEA 3C09B 1CDUA 3TBYB 2FATH 3ULVE 1CF8H 3X1NA 3WIFB 3R19A 4OU3A 1RJCA 5K1JA 5DU7A 4GFTB 5C0ND 4PJCB 3L1OH 5C9JA 3GINA 2HRPH 1Z2KA 1IGFH 4UF7C 4XNQB 4WJ5A 1WAPA 3W56A 5DJ0A 3WG7B 5JOEA 1OE1A 2GSIA 1JNJA 2AF2A 3DTUB 5HDBE 4FQHB 1OSZA 2WQRA 4HKJB 1MW3A 3SCMA 1CG9B 4L4VA 4FYRA 4QXGH 4W9DC 3C08L 4EO5A 4ZUWA 2QADC 1I1YA 2WNWA 1D5MA 4HPHA 1NDGA 2VDMH 1DE4B 1JDDA 4DAGL 4JDEB 4WU7B 4XC3H 5FYLH 1LE9A 4GG6E 3VI4B 2OP4H 3PQYA 4H1LB 2W8CA 2W95A 1U8LB 3ABZA 2KT6A 4KOBA 1PX3A 4OD3H 3FUKA 3LXAA 4HCRL 1KG0B 4ODVH 5GS2D 2NYYC 1DVZA 5IMLA 1SF5A 2EXYD 4DT2A 1M05A 3FB7A 3VRJB 3ZE2F 2PPAA 3T65A 4AM0Q 5CO1A 1RPQA 5I6OA 3SQBA 1YYML 2QZQA 3KPSE 1FN4B 3P54A 4CAGA 4WUUE 2MKLC 4GUPA 1F4WH 1UYWH 3QIUC 4J3XA 4WY7L 3LS5H 4U1GC 4OQTL 5MENA 4U1LB 3D09A 3INOA 4GRMA 3D0AA 3O0LA 1XCQA 4NGHH 3FMGH 5EU7E 4G6AD 3ZRSA 1OCZB 3AABA 1NWPA 3L8QA 3U2IA 1ZJAA 3QUZD 1II4E 1UT2A 4OCSL 3D18B 4YSEA 5HPOA 2C3WA 4YO0B 3POCA 4JG1H 5CWSB 2WIMA 1UENA 2YPKA 3WN5B 3TN0D 4R8WH 4K9EC 4GW5B 2IO5A 4KMTL 4NQEA 5G5DB 1LHZA 1WICA 2UZIH 3ZZ1A 5KVEH 1ZPUA 1F8TL 1OW0A 4ZUUA 2GUOA 3NFSL 3A4AA 1P4LA 2XN2A 4YDNA 1R3KA 1LO4H 1FZOA 2HRLA 5IHBA 1G6RA 3S3SA 4QD2E 3QJOA 3CSBA 1ZHBA 4MDIB 1ICTA 4FOMA 4N0YH 4CN6A 3BAEH 1VEMA 2F19L 5DUMH 4N8VB 4JPIB 2KLSA 5EC2A 5JQIB 4TTGA 2GCYA 1DVUA 4J6RL 2VN5A 1A1MB 3S37H 3OPZL 4BIKA 3CFIC 1DDTA 1ZTXE 1BVNP 5DEGB 3TNNB 3ZTEA 1NUNB 1IGYB 2ESVE 3HRZC 5AKSA 2Z7ZA 3KEHA 4LBEB 1CYGA 4GH7B 3BZEB 2QV2A 2HG0A 4NO2A 4MXVF 2V4LA 2WJ5A 1DVFC 2FH6A 3ELQA 3VH8A 1KIUA 3UYRH 2QADD 4DCQB 1MVUA 2VDKB 3LRSA 5CEZL 2DBJA 1OF2B 1XXDC 2WSKA 1J9QA 5FA3B 1XD1A 2R0KL 4OLXH 1S7RA 3U6RA 5D1QC 1VGKB 2X10A 4KX7A 3KMDA 3I84A 4WW2C 1BBJB 2ZKHH 1DL7H 1XF1A 2D9CA 2W65A 5T5FA 2GW5A 4P2QD 1MFBH 1RFDL 2I85A 2R2BB 3T4YB 2EDJA 1TZ8A 2B0SL 5JIKA 2ICES 4JUSA 4MJ4A 2XNAB 2BP0A 3HJ0A 2NY6C 4U3SB 5DK0A 1KTLB 3QUMH 5LG1A 3T0EA 4WK0B 3VG9B 1IX2A 2Z0UA 4NFDA 4TF4A 2OLDA 4AZ8A 4ZX6A 4JY4B 3WTWA 4DN4L 1BQHA 4Q6YA 4H8WL 1I3UA 1U8JA 4E5XG 4R26H 3GRWL 3H7BA 4ABQA 2WQAA 5HGGS 4EI6A 1EHAA 4MGXA 1QTYT 1U58A 3DYOA 4QWWD 3TT1H 4KZDL 2G0KA 1OVZA 2PYEB 3HAEG 1FNSL 5T3ZD 3GHEL 3F7KA 4N8UA 1EXUB 3D9AL 4FFZL 3SDAB 1UA6H 3F5WA 2HFFB 3UTOA 3ZGHA 1CFBA 3GBMH 1OP3K 4DGWC 1KLFB 2FYYA 4ANVA 5MEOA 1MCPH 4BK8A 2R9HD 1TENA 1QHQA 3DYPA 4IRJC 4HKZA 4L4TE 4ZSOE 1TXKA 3JV6B 2IWGA 4F2MB 3ZZLA 2XY1A 5IJDC 3C8KA 2IAMC 1V7NL 1ZXKA 3NAAH 4FI8A 1D5BB 3W0WB 3UAEA 1XO8A 5EDSA 4EQ2A 3I6KB 3OKDB 4LLDB 1S9KC 3P4LA 4M3KB 3BSHA 3MBEB 3MOQA 5I9QC 2D8KA 4IBSA 4L1TA 1ZLWK 5K59E 3OJ2C 3V0IA 2MOVA 1TKWB 2C1OA 5CCHE 2SODB 3MYJB 4FA6A 5LGJA 5IJCC 2AEQL 1FV1B 5AKVA 1BJ8A 5G4NA 1FSKC 4OZIF 2I9TB 4N25A 5D1QD 3OKYA 2DEXX 1AGFA 2NZ1A 4I2XE 4ECNA 3FUIA 3FTZA 4JHWL 5JXED 1NMBH 1XT5A 4H8VA 4E9VA 1KMGA 4JFPA 1KYFA 3H6JA 5EZIL 1MHCB 5DJXA 4LARH 1WVZA 4J28A 3T04D 2XZQL 3ZRFC 2HMIC 3H55A 2NY6D 1ASPA 1OSYA 3CXHK 3R8QA 3AT0A 3ROLA 2YD8A 4X6BB 3E6FB 4LRNH 2C9VA 1IM3D 3ISYA 3ZY7A 5JHDB 5J1SC 3CCHA 3WUWA 3SHSA 1NBYB 4XP9L 2W91A 2FGWL 4OD1H 1AO7D 3RILA 2VDRB 4FQ2H 3PFUA 3B6SB 4QRPD 5C08D 4CVZB 5JW5B 2XQBL 3GI9H 1OAZH 1QNZH 1VJSA 3G5ZB 3LZRA 4HUUA 4KK6C 4N0UE 3X3GH 5J9PA 5EU4A 3TEWA 4LHUA 4FJZA 3BSZH 3OJMB 5AG8A 4MNHB 2R1XA 4FGMA 1PPIA 1KNOB 2HPTA 3SKJL 4CRPA 4I9XA 2CR3A 2XXMB 3VXMB 3KXFD 1FG2A 4WNQA 5I2IB 5ICYB 2AVGA 4L1DA 3BFWA 5AFAA 1E7UA 4NQDA 3U83A 1TZGL 4XNMB 4JK0D 1KJMA 2J71A 3B7YA 3BUBA 4JFFD 5I1GH 3LRKA 4HIPA 1MCWW 3H3BC 1KCWA 2AJZA 1A3RH 3A6CL 4KRPC 4PLNC 5C07E 3PWLB 4QRUB 1MI5B 5CJ5A 5D2LA 4H20H 3MV9A 2FO1A 1X9LA 2NDGA 2A74B 1FNAA 4FTVB 5KG9B 4W9LC 5A7BA 4MA1C 4I9WD 4ZX5A 4PJ7B 2E7DA 3PABB 1NPJA 1GHFH 3VI3F 2Y7OA 3MRMB 2F53A 4B53A 1L5GA 2BP5M 2CBOA 4X9HA 2IG2L 5HYJD 2AJYL 4S1SL 3NABH 1SXBA 5DD1L 4U1IB 3N5AA 4KVNL 2WBXA 2FT6A 5F3HA 3VDAA 3CDCA 2RGSA 5I24A 4K3HA 4MRCA 3VGFA 1CFTB 2ZKMX 5I0YA 5JDSB 3QI9B 1T1XA 1NGPH 2HTLC 1DTUA 1XAKA 4W4OA 2VDOH 4RMVA 3K72B 3RNKB 1LNUA 4DZ8B 3B2UC 3IDNA 4AT6B 4WTWA 3BJLA 2GFBB 4KNQA 1E5UI 1SN0A 5FUOL 5DCCA 3MRCA 4OVVA 4J8RA 4PVBA 2X9ZA 4A7TA 3V6OA 5JLZA 1HCZA 3FOLA 4H5SA 2ZAHA 1N59B 3ASWA 4K9EL 1CLCA 4QLRA 3UH8A 2KMWA 2YLKA 1KGCD 3AT9A 2DQUL 5JNYB 5ISZA 1FLRH 2C3VA 4KKRA 3QJUB 3E1F1 2ADGA 2JK5A 4IRSA 5E4OA 2WJ7A 4YQXL 3VCLB 2HVJA 3SDCA 3GEFA 3GMMA 3QBTB 3DOHA 4K71C 2VJXA 5D7LE 1FO0H 3TBSA 1SXZA 3EJJX 3Q7JA 4C59B 1AGDA 2E3VA 5CKAA 1DSYA 2HB0A 2PO6D 1I7ZB 2KQMA 2MHAB 3EFDL 5FFGA 5FGRA 5GZNA 4JR9L 3SJVA 5I6XC 3DJZA 5D1XA 5J4MA 5T1JA 1E0OB 4UDTA 1BQUA 2XI9A 3H53A 3MJ8B 3RIFK 3FT2B 1OM3L 1PZ2A 2R1WA 2J21A 4PCYA 3VFSA 4KAQH 4U0QB 3F6LA 5ESVB 2O5ZL 3SE8L 4PGDA 4TUOB 5DD3H 3U6XS 2Q2EB 3BAIA 2IPTL 3STBA 4PWGA 1JK8A 3TL5A 2HX7A 4J23A 1NAKL 4OQ1A 5E2VL 3RDTD 1FH5H 3QDMD 1MCLA 3ZW3A 5GJTH 2MCPL 4F57H 1HKFA 4NZRH 3IJYA 3TF4A 2A6DB 4H26A 5D93C 1LP9A 4LF3B 2MCAA 4HZAA 4ZD3L 1U8IA 1J9SA 3QZBA 4HMEA 2EYRB 4C56E 2PN5A 3FQUB 2HUHA 5E99L 1IFRA 3OGCA 4XVJL 5DUBA 4YFDB 3UZQB 1E9QB 3IFLH 4N3TA 1SMOA 2HTLD 1N6QL 4JX0A 4MCZB 5EHFA 5DMIH 3S3DB 1CT8A 2EEFA 3DV6A 5D70L 5C0GA 2ADJB 4G82A 4MJ5A 4AYMC 4EOWL 1BD2E 3FTWA 2WXRA 1Q94B 2VQ1A 3HZMB 2OYKA 1JZDC 3KPRA 5CBAB 1BOGB 3K0YA 3GJFK 1NEZA 1XGTA 1TETH 3N55A 5LCVH 4HPOH 3O0RH 4M7JH 3VGGA 3FT3A 2XRAH 3WNNA 5ABDE 2NT0A 3HZKB 4FQCH 2NR6D 4L8DB 4WTZA 3QFGA 2EAEA 1J11A 4YUEH 3GKZA 2DWYA 3FHQA 3ML9A 3ZBMA 5BZDB 2E6QA 1JN6B 1WFUA 2ATPB 2W81C 2CIIB 1WZ1H 4KKQA 2W5PA 3QPXL 1BPLB 4OIBA 4XTRD 3TS8A 1XGPA 1PZUB 4ABWA 3AS3A 5T1DL 4M00A 1UXMA 4HH8A 5KS9B 4FQQA 2H8PA 1JBJA 3QFDA 1T6VN 2WAHA 3WU1A 4BJLA 1AGCA 4LCIH 3PGDB 1OK8A 3PV7A 1G7LB 2WXJA 2BHZA 5TPWH 4E9SA 2B1HH 4UUJA 4PJIB 1F1GA 1PY9A 1AZBA 4Y1AD 4Q58C 4J3OC 5EU7C 5D5MA 1IARB 2KYIA 1IM9A 2BSEA 1WFMA 1RIUH 4G6JL 3FFCE 3LZNA 3IS0X 1W80A 2HTKC 1MZYA 4PBXA 3SDXA 2H45A 2HFGL 3H8NA 4I18C 3ARBC 4ZUVA 4Q6IB 3P9WB 1UB6A 4KRLB 3VFVA 1GGCH 3VD2A 4HWBH 4K0OA 1C8PA 1J8RA 1ZK5A 5CAYB 3MR9B 4LP4A 3U7WH 4ODHH 5D1ZB 3T3MB 4OKVA 4Z3IA 3U36B 5D2LF 4CVUA 5IEKA 4PJ6A 1MVYA 4RGMC 2XFXB 1X5JA 3V9EA 3NQKA 3MNZB 4XXDA 1PU0A 2Q86A 4K3EH 3MCKB 2G4EA 2NYZA 2V37A 1ACZA 2WP3T 1HS6A 6FABH 4RGNE 4MD0A 1T4KB 1QX1A 5HGDA 4AZUA 3ZE0E 5IW6A 3FTYA 1JMZA 1MLBB 4KMQA 4XCYA 1BVZA 5HHOB 1MJUH 1F58L 4K94H 5BZWA 1JF5A 4ABUA 4K55A 5DMGC 2EEAA 5TDNA 3PF2A 5MI0C 1ZLSL 3GSQB 3RL2B 4LQ1A 3OKEB 3EYSH 2X4QA 1NCGA 1QUNA 3JV4A 5K9JH 1U33A 1I7TB 4KKAD 2CR0A 4Z95L 3HHMA 2JELH 3T2PA 3OLEA 4GKNB 4MJ6A 2BX5A 4NRYB 4FABL 1X5AA 1A7NL 4YAQB 2DQIL 3SB3A 1F97A 4PJ5E 2VDKH 3G3LA 3BQVA 4G6FB 4L3EA 3B56A 1UJ3A 4N2MA 5IOPB 2WLMA 3HI1B 2AZAA 1V3KA 3N6YA 4PB9H 3QIBB 5DSCA 3HNTH 4PYGA 5BQ7A 5E5MB 4J3OD 1D7CA 5GZOC 4ZNEE 1MY7A 2GJZA 4P4RA 1N0LB 1JCVA 2CA3A 2OL3B 5EN2A 4XPBL 4PHZA 4POZC 3Q6FA 5H37H 1M7DB 1AMYA 3ARBD 4G2AA 4IMKA 4S1DC 3V4PL 1WSST 3CMGA 2CAKA 5E4AA 1MCFA 3DYMA 3QYMA 4YPGB 3BO8B 1N5YL 3MODH 4H2CA 2KH2B 3ZDYE 3LH9A 1IT9L 3MXWH 5F96L 3BZ4A 3GO1L 4NUGL 4UAOB 3M7FB 4A6YA 3MLXL 1S46A 1SJHA 2BNQE 2AXWA 3FF8A 1XTMA 1CC3A 2B5IB 1XF4A 4YE0A 2CJ3A 4HK3N 1A2YA 4PRPB 3CFNA 2YWZA 4G9FA 1UZ6E 4D9QD 3PAVA 1RU9L 2BY2A 3ARGD 1RZKH 4QO1A 5CBEA 4BFBD 1M6UA 3EGDB 1LP9F 1G7IA 2AXJA 3QDGA 1TQVA 4MA8H 4ZFOA 3LIZA 3RVXC 4A63A 4G7SB 4APQA 4QHLA 1NGZA 4DGYH 2QVKA 1CGWA 3RWEB 4QXUH 4XNBA 4Z7OF 4JLRA 43C9B 3OBAA 3NRPA 2WXHA 3MRNA 1U30A 3GB7A 3ILQC 1SQ2N 5DS1A 3V8CA 2G9HB 1YNKH