2KERA

Alpha-amylase inhibitor parvulustat (z-2685) from streptomyces parvulus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
78
structure length
78
Chain Sequence
ATGSPVAECVEYFQSWRYTDVHNGCADAVSVTVEYTHGQWAPCRVIEPGGWATFAGYGTDGNYVTGLHTCDPATPSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase inhibitor Z-2685
publication title The high resolution NMR structure of parvulustat (Z-2685) from Streptomyces parvulus FH-1641: comparison with tendamistat from Streptomyces tendae 4158
pubmed doi rcsb
source organism Streptomyces parvulus
molecule tags Hydrolase inhibitor
total genus 7
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01356 A_amylase_inhib Alpha amylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.20 Mainly Beta Sandwich Immunoglobulin-like Alpha-amylase inhibitor 2kerA00
3AITA 4AITA 1OK0A 2KERA 2AITA 1HOEA 1BVNT
chains in the Genus database with same CATH superfamily
5GRYA 5IVXE 2C1PB 1MI5B 5D7IB 4JPKL 1U8MB 5CZVH 4FXTA 4L8SC 4OCYL 5ICUA 3OJDB 1U8LA 1IU1A 3ALWA 1IGJA 1RIVH 1ZPUA 4XXWC 3B9KB 5D7EA 3CFTA 1HHJB 1UZGA 3TA3D 5EOQH 4GO8A 2G2RA 4Z76A 3KMDA 1A5FL 1AG6A 3O4OC 3QNXB 2JKNA 3TCLA 4HU8A 1G9NC 2AJSL 1Q90A 2JQMA 4AYMC 3QQDB 1DQJA 4LLUB 3FTXA 2ENSA 2F8IA 2Q7AA 1XH0A 5I2IA 1TTRA 4L5FL 4XNDA 4S1RL 3L81A 2K3TA 3ESUF 4HUXA 2B9AA 3EF7A 4JKPL 3NFPA 2OMUA 2GBTA 4XO4A 1TU2A 2GUYA 2XLLA 3QORB 4RSYA 4QJ5B 5HP5A 3ILEA 1MCWW 3EYQC 3A0OA 5FGRA 4NENB 2J88H 4WFHE 5EEWA 3DARA 5DHEA 4HFWB 2B8OT 1QHOA 4E9LA 1WO2A 2FL5B 5GRUL 2E86A 4MMXC 2WWNA 5D6DA 1OZTG 3SOBH 4JQXC 2Z92B 3K5SA 1M9WA 2HKHH 4NQQA 4PYGA 5E1AB 1BD2A 4MA8H 4M62L 2X1QA 4BM7A 2DMCA 2UYLA 1HAWA 2V6HA 3WKML 2WTPA 3UTTD 1A3LL 1MLBA 1U8PA 1CXEA 3QZWG 2Z4QA 3U1SL 2EDBA 3QXAB 4X5XB 4OUOA 5AYUL 4LSSL 1PJWA 3ISRA 1DZ0A 1GS8A 1KPVA 1MY5A 1VCAA 3MBWA 4QHKI 4WGWB 4FTVA 5G4NA 4ZD3L 2NSXA 5IZ7A 1R33A 3ARED 4FFWC 1BEYL 4OAWA 3MLRL 5ICXB 5JW3L 1LYQA 1TKWB 4N2OA 4PP2B 3FNKA 5GJTH 2XQYG 3DVNA 4XHQA 1CZ8H 4NQCB 3UJJL 3FC8A 3GRBA 3L5WA 3PL6D 3MOBH 4J8RB 5EN2B 5C07D 3ZZQA 2XBDA 5LAPA 2J72A 2D4DA 2Y6SC 3U46A 1ES0A 3QZPA 2XWJB 5ACMA 1LVEA 1XCQB 3FHAA 3ZE0F 3EDFA 3VXUE 5DJ6A 4GLRI 4APXA 3DX6A 3GKWL 3WNOA 3FU5A 4J1UA 4R3SB 2WZPA 1KFGA 3SKUD 2B3IA 5DUJA 1MCPL 4HGKC 3LMJH 2R8SH 3LN9A 2X4OB 4TNVK 3WTSA 5HHMB 4J4PC 1CLOH 2DKUA 1FLRL 4JG9A 3QDMA 3GSXB 3DHUA 3U6XA 5C2BL 4O9HH 5TK2A 3QWQB 4YQXH 5JO5B 4JO4L 3M45A 4UANA 3UJIL 2ZX5A 4F27A 5MEQA 3GLEA 5DMGD 5I19H 4TPRH 1C16B 3RWIA 3BGMA 4PGBA 4JO2H 4GSUA 4IBTA 5FF6A 4V2BA 5FGSA 1MCDA 1G0DA 3FCTA 3KH4A 4PS8A 1J1XH 3HI5L 3M17A 4JRFA 4FQCL 3ZL4H 1CF8H 4MZRA 5L2JA 5I1EL 1N64L 1H8OA 4MCYA 1HZKA 3D25A 1Z9PA 4FC3E 1SJEB 2XC8A 4PSPA 2WQVA 3IMSA 4S2SB 4PJXE 2NX5A 2Y1VA 4PJ7A 3UYRH 4DK6A 4KO7A 3OXSA 1UEMA 4XCCH 4H1LG 1GSMA 1XF4B 5IEHA 3VFGL 1XVSA 3VFMA 3CD4A 1P7KB 5I1LB 2J5LC 4IJ3C 4OZ4B 3SQRA 2IXQA 3FQTB 4KXZH 1S5HB 4ZNCD 1MFVA 5C0IA 5IOPB 1DJGA 1XH1A 2NXYC 1GGCL 3NFNA 5EUOF 2EVFA 4IMKC 1CDUA 4Q4EA 5TFSL 1E8YA 4YHIB 2XTLA 3PIQA 3T3PE 1R0AH 2QZ5A 3PU7A 4CVWA 3RDTB 2NQDA 5DLML 4JPWL 43CAA 4OD2A 2ENPA 4KZEL 1BGXH 4AW7A 1F6FB 2A9MH 1FORL 3RWJB 5LG6A 1HEJC 3LNIA 5ECGA 1ZT4A 3L1OH 3FH8A 4YLQT 3BUPA 4D9RE 3MAWA 4OFPA 5FLUA 4UQBA 2A9AA 4R4FL 3OKMB 1ZXKA 1WUZA 5TQ2H 4Z0BH 1U8NA 3CK0H 3HC2A 3PJSB 4GRWE 3GKZA 3BKYH 2COQA 3PWPD 1ZSDA 3G6AB 2OW6A 2HUEA 2WLLA 2DQDH 2DWEB 35C8L 3CDZA 3EH1A 1KGUA 1OANA 2J1ZA 2V5MA 2XKUA 5MENE 2XNAA 4QPEA 3L5XL 4WJKB 5HJBA 3Q8BA 4HCGA 2NY2B 2IALB 4LARL 1KGWA 4DKFH 5JOPD 4PJ5E 2OMTB 3SPJA 1T2JA 2XWBB 4F2FA 4PRNA 3FOLB 5DJYB 1U8LB 1YRKA 4YXKH 1IGJB 4XTRC 4XAKE 4U1GC 4GKZA 1ET7A 5L2KA 3NACH 2P8PA 1DVFC 2A9BA 4MJ6A 2G2RB 4WVRA 5FYKD 4Z76B 5IVXA 1YYLH 4TNFA 2XWCA 3TCLB 4NCC1 3G6JE 1HWWA 1T89C 4A6YL 3A23A 3OGOE 2Q2EB 3MLVL 4XVJH 3CAFA 4FQQB 5I2IB 2E6JA 2GJPA 4HUXB 3GM0A 3NRFA 1L3WA 1VERA 4PV1C 4C54A 4XI5C 3SN6N 2WBJC 3S88L 4H20L 4JPVL 4BE6A 2W5PA 1XGQA 4UBDD 4OJFL 4YDIH 3UCRA 4YHLH 4U49A 3HZKB 4L9LA 4RISH 3HZYA 4PW9A 2CO3A 4V1DA 3RJDA 1O7VA 4YFLF 2VN6A 1I9IH 1UB6B 2CDGA 3AS0A 5L88L 1JWUA 3E8UH 1QBBA 2CBOA 1RLBA 4MJIE 2ZICA 5E99H 3UABA 4C83B 5AUMA 5DFTA 4GINA 4PJ9A 4XGZA 1MLBB 3K4AA 1NMBL 3L95B 3MRFB 1JK9A 1O6TA 2P52A 3PABB 4Z7QE 2GG1A 4L8SA 3FQNA 1KPVB 1UWYA 4GG6F 1AJ7L 4XXWA 2YRPA 3NEEA 5ERWA 3WO3B 4OW6A 5C0JB 3LV3B 4P07A 4JREB 1HAUA 1TYJA 3KH3A 3MXWL 4E36A 4I0PD 3U46B 1ADQH 1ES0B 1NGZB 2PW2A 3G08B 3MV7A 4IRJC 4ZW8A 3RLSA 3TIEA 3ZK0A 5DF0A 4UV7H 1BQSA 3CZFA 1QHQA 4X6CA 4PVLA 4MS8D 1NOFA 1MFDL 1CVRA 3G6DL 1MELA 5AVVB 4BZ2L 4L4VD 3D06A 3CVCA 1OGSA 2YMTA 3VB8A 5FYJD 4M29A 3LQMA 3P1VA 4PCKA 4RMSA 4OZGB 4JFFE 4MMXA 2AXFA 4FABL 2X1XR 1U8JB 1ZXQA 3HE6D 3FMGL 4JQXA 4FA7B 1DO6A 5I5JA 4NWTL 4KPHH 1X9RA 4NZTL 4Z18A 1X4ZA 4F33A 3RWIB 4PGBB 4ETQB 3RWFA 4PBXA 2QV4A 1PZ5B 2J57A 3L1GA 4G1EA 1KCWA 1VFBB 1OCWL 4NUJA 3OG6B 3MDJA 2DM4A 3IU4L 4JR9H 3KPTA 4JJHA 4QYOB 1W0WB 3ARWA 3MOAL 4A6YB 4KROD 5JA8B 4BRJA 3TO4B 4PJ7B 3MRNB 2EDKA 3WXVL 1QFOA 4FKKA 5C8JA 5CEZH 5JQIB 4TNEA 1Y18A 3SDXE 3DX7B 5I8OL 3ABGA 2IXQB 4TUOB 3EJYD 3PXJA 4X42A 1E5BA 3CVIL 1I3UA 2HT4D 4PJXA 2BRRH 5C08E 3V0AC 3FUEA 3AS3A 1N7MH 3AWGA 3LKPB 3O8XC 5I1KH 3SDAB 4ABVA 4M93B 1X9QA 2FH8A 4F1ZA 1JGDA 2VR8A 3IMUA 6PCYA 4A2EA 5DR5H 4PUBH 2OV0A 25C8H 4ZUSB 3IRPX 3L2MA 1G9NL 2BP8A 1I1FB 4ELDA 1E65A 2W88A 4XR8C 5I8CB 1LE9A 2DQJL 4LVHB 1CT8A 2H47C 4IKNA 1Z9NA 1ACZA 2PTTA 1HDMA 4Z3GA 1PVHA 1ZSDB 3F6LA 3RA7L 2H9GA 3JUYA 3SDYL 2FGWH 4AOFA 1L7TH 4PD4K 2YMOA 2IPTL 2PUQT 4XXDA 2V3EA 5GISL 1AR1D 1E6JL 5G5DB 1IAMA 4HJ0D 3ZMNA 4KC3B 1ETA1 1JZ4A 2XHNA 4ZUUB 1DDHA 4HIXL 2Y23A 1H5BB 5MENA 3QHZH 3IK2A 4BFBD 1J8HD 4AQAA 3N85H 2OJZH 1AO7B 4XC3H 3ZDXE 4P46D 2QGDA 4MJ6B 4PJ5A 2X6UA 1UENA 2F8VA 4ES9A 4P3CL 4PTTA 5C0FB 2AKRA 1UKTA 5BRZD 2DLEA 1MCKA 2JJSC 4XN7A 3LRLA 1GKOA 1FFOA 4HS3B 2YK1L 1BPLB 4GT0A 2OW7A 5HHOD 5FHAL 1WAEA 1FIGH 1XV8A 3G6JA 1HHIA 4EQ2A 4JHWL 4DSYA 4K7PY 3P3SA 1XGQB 1YSOA 2VSCA 2W65A 4CVXA 3NCYP 3CBRA 4QEGA 2GPZA 4V1DB 2XWEA 1OB1A 1PY0A 2WXIA 3PCYA 1TTUA 2CDGB 1DQQA 1JWUB 1BZOA 3SKNB 3BT2H 2YAFA 3MNZB 1NIBA 3QZNA 1ANUA 1JGVH 4OLZH 3RU8H 4D8OA 3V4UL 2JB5H 4WKXA 1TZGH 4ZFGL 4PJ9B 1ASQA 1BXAA 4N22A 4XGZB 3NSYA 4QHMB 2RMNA 2MJWA 4HALA 4PJHB 1NTDA 4YX2L 5FGCB 4LU5L 4FX5A 3THML 4L8SB 3FCGA 3FQNB 3VB9A 5I1AA 4MJIA 1QR4A 5JXEC 2EVIA 4Y2DD 4OLYL 3FJTA 3J7HA 1SNRA 3WYRA 5F7UA 1DVFA 4LMQI 4WKZA 5HDBE 1MCQA 4ZK8A 5FUZH 3K2IA 3JTSA 3HZMA 2ZJSL 4W9GC 4Y9BA 1D5BA 1T89A 3LJ3A 3FRPA 3PYCA 4FTDA 4N2EA 3SKJH 2JCCE 4AM0Q 2FSEA 2PW2B 3SSGA 4Q9QH 3CE1A 3TIEB 1QBAA 4ZNEE 5ISZE 2XTJC 3CQFA 3L3HA 5BJTB 4X6CB 4DOHE 3X17A 1ZLWK 3UTOA 5INCB 4AL8C 5ADOL 3EGXA 3LIZH 4YSEA 4BE5A 1RY7B 3GMQA 3O2VL 4PB0L 4D9RD 3LQAH 3LPFA 2E46A 4X5WB 5EIIA 4LLYA 1HT6A 1XGPA 5F8RC 4WUKL 4MMXB 4WSJA 2D0GA 4KJWC 1M1XB 5AVQB 3T8XA 1G7QA 1HEHC 3BE1H 3BN3B 4ODVH 4DVRH 5EEZA 3Q48A 4XT1C 5JOFB 1MEXH 4QXGL 4Y9FA 4BWTA 4GSXA 4YXHL 4G83A 3KBFA 1RP9A 2AV1A 4W9FC 4LKXB 4KMTH 1TZHB 2R23A 2Y1ZA 2AMUA 2I32A 4F3FA 4A55A 3ZKXC 2RD0A 4W9LC 1DQVA 1UWGL 1DUYA 1C8QA 1IGIH 2HWZH 4NBYB 5JORA 5KN5A 3NEOA 1LWJA 2N0KA 3IB4A 1AC0A 1KUMA 1RUQH 1B6UA 2BY3A 3W82A 1BXXA 1Z1WA 1ZY9A 3FFCA 1KBVA 4IRJA 2ZSVA 3N1GC 2Y3NA 2X4QA 4PVNA 1SVCP 1T20A 3FT1A 2HP4A 3IS1X 4QRPA 4Z78B 2CJTA 4ATWA 1NGWB 1CIUA 2HTKD 1MRDH 1NCBL 4AGLA 2A6IB 3HG1B 5JPMB 1ZVNA 2C8NA 4P48A 3D85A 1OGAD 5B3JE 1LK2A 1VLXA 1XB3A 5GRVK 3CN1A 2ZF8A 2R0WL 4WSGA 5C08A 5A3IC 1JF6A 2XWZA 3ZT6A 1MIMH 4FNSA 1P7QB 4B27A 1T4KB 4A1RA 1KIQA 1RK0A 4JX0A 3B1UA 1CT8B 4PJAA 3OG4B 1MWOA 4Z7UF 3WTXA 1QHPA 4FQHA 1ORSA 4D0CB 3BUTA 1XCWA 5F7MC 4XMVA 4BDVB 4LPVA 4N2CA 3KBEA 4NDMA 5KANG 4IBUA 3PXLA 2VZ1A 3CSYA 2G3MA 4E9QA 2OI9C 2X4UA 3NZHL 2F1AA 3P77B 1H6FA 3FZUC 4J2XA 3RGVD 1WISA 1CL7I 2C7FA 1D5XB 1J0KA 1JV5A 1B0IA 3ILQD 4XCEA 4NJAH 1O7DC 3DSNB 4IJ3B 1Q8MA 5F72S 1M05A 4XPGH 2B4CC 2B20A 4RCAA 4FP8L 5EORL 3VXMB 1UZ6E 4AQAB 2E7CA 5D2NB 2NXYB 3JZ7A 7CGTA 1A7PL 1AQDA 3UJTL 3O8XA 3TBYA 3VFSA 5JHAA 2DKMA 5IT2H 3MRBB 3GHBH 4UT9L 3ZQWA 1KDIA 2BS9A 1FFOB 1JNNH 3VXRA 1EXHA 1V7ML 4WI7A 3H3BC 1AXIB 1MCLA 2YQ2A 3PQYB 4OFYD 4R2GC 3IAQA 2R1XB 4XNMA 3MRPA 4G42A 4L3AA 5CD5C 1JGUH 5CHNA 2KQMA 1HOCB 1YJDC 1OAXL 5IQ7L 3SOTA 3GWJA 1HEZA 2BLFA 4PJFE 2CGYA 1RZGB 1JERA 3T4YA 1FNGA 2E27L 4AZUA 3HUJF 3N43B 4I3SH 5ABAA 3INUH 1DQQB 4AV4A 3IE9A 4JMXA 1AKJD 2V33A 2WXGA 5HD8D 4M4PA 5EC2A 1EH9A 3V8OA 2QGEA 5F8QC 1MCCA 1YDPA 3NIDB 3CLWA 5CFHA 5EZIH 4FQJL 4CU8A 3UP1A 3WCYA 5LUMA 4CGUB 1ZDSA 3H85A 4LPCA 4AZ8A 1H3PL 2ZXQA 4ZW3A 2VR6A 2HTLD 2PABA 3BPLB 2JELL 1KELH 5CFAA 1HN1A 3IJYB 4WKZB 3CVHH 5H35B 4ZX4A 3L7FB 1IM9D 3QUYD 4GAAA 5E4AA 1I9RH 4EDWL 1WBXA 3W0WB 1F58L 5ITFB 3FRPB 3HC4H 1CFQA 1I1YA 4CC0A 2JJSA 5C0BD 1CFVH 3NIFF 1L9MA 2WKOA 3RZCC 4RAVA 4IDLA 1NIFA 1T2QH 3MRKB 5K59E 4RAUA 2VCOA 1SQMA 5JZ7D 1MPAL 3WEBA 3PP3H 4URKA 1EDQA 1PKQE 2EDEA 3V0GA 2WBJB 2JCCA 5FIEA 2UZXB 4PRDB 3DIVA 4KJQC 4ZNEA 5A6IA 4AUJA 3CXDL 3NJXA 4LLYB 4YIQA 1PYWA 4MAZA 1SBBA 4FYQA 1U93B 2F53E 3VFUB 1T04B 3PXHA 1F4HA 3F7QA 4PCSA 3FBKA 2BSED 5DD6A 3SO5A 7PAZA 1S78C 1VKXA 4RWYL 1R3KA 2AV1B 3FTUA 4LDLB 1A7NH 2Y0SA 2LFEA 3RIKA 5H4ZA 2Z7WA 2R23B 4EI0A 4NZJA 4NJ9H 2FX7L 1DQMH 4KGJA 4TSAH 3S36H 5KG9A 3LKNB 2W0FB 4UQAA 5JORB 5KN5B 5CLTA 2DZEA 5JXEA 2MRYA 1JWMB 5KJ4A 3UERA 1SVBA 5K9JH 5BXFA 4AY0A 1HL4A 4ZODA 1MRCL 2BCMA 4XAWL 3FFCB 3H3KA 5MI0C 1M42A 3WO4C 32C2A 3TO2A 3S8GB 1REIA 1RVFL 5KS9A 3DUSA 4JPSA 2WXJA 3TZVC 3EHBC 4FFZL 4RMBA 1F2QA 4MQXD 4KZDH 1T20B 2WTRB 3P02A 4QRPB 5LBSH 3ILDA 2VXUL 3IVKB 5I74B 1JRHL 4BUGA 4OCXH 2BDNL 4EI5D 3D85B 4OSUH 3AB0C 4XPFH 3NPSB 2K4WA 1MZZA 3NJLA 3PJLA 5DJDA 4EOWH 3B2MA 4WEMB 2A0LD 1AE6L 3U4KA 3BP6A 4IOFC 5DJ2A 3K2UL 2MWCA 2MKLC 3IMRA 5DFVD 5E8DL 4ZPVA 3HPJA 1KIQB 3OAYK 3FW6A 2R1WB 5I76B 1JNLH 3IMTA 3LRKA 1KF9B 2LR4A 5DWUH 4DAGL 1IAOB 2KPNA 2HB0A 1JZFA 4QUOA 2NY3B 4PJAB 3DPBA 4QGYA 5ADPL 2V7HA 4OCYH 2VO8A 2ZE0A 2TRYA 4JY5L 2DYPA 1RD6A 2NLJA 4CBZA 2WBKA 3FF7A 1CE6A 4NDMB 3BWAB 1A5FH 2NQCA 3QZBA 3UH8A 3ECBA 1TJGL 3CSYB 4JFPB 4YNYB 1QRNB 3O45A 2LHAA 2WKLA 1PZ3A 2AJSH 3OKOB 4TL4A 1ZJBA 3MBXH 2XV0A 2CWRA 3WD5L 2X7LB 5ESAB 4NFBA 1CIDA 5B7EA 3S36X 3B2DC 5C0AE 2Y06H 4L5FH 4A68A 2W9LA 2XN2A 4JKPH 4PJEF 4MYPA 4FHJA 3BZFB 2BNRB 5DS2A 1EX0A 1X7QB 5ISZD 1DUZB 2CDEA 2UY6A 4I18C 4M8RA 2OX5A 2X0UA 2XVLA 4JFUA 1K3ZA 4XN9A 3O6FB 1NSNH 2Z8RA 3WLBA 3WJMA 2G0KA 1FFNA 1UT1A 4M62H 2PXYC 3GSQB 1UWXK 4U1IA 3MROB 3MRPB 1DE4B 3K5RA 1W72A 3WKMH 3IXAA 1CICC 5CHNB 1QWUA 1A3LH 2CG9X 2CHDA 3U1SH 3VXQB 2P24A 1QEWA 5AYUH 2R9HD 5DDHB 4NQSA 3N6YA 4AL8L 1BAFH 1FPTL 2FNWA 4AMWA 5JW3H 3QZOA 1BEYH 3MLRH 1BQKA 4ADGA 1KULA 3HHMA 5CN1A 5D7IF 3KPQB 3WEMA 3UJJH 1YEEH 4ACTA 4FCHA 4JFYA 1BIIA 3PAVA 4PJFA 4Z3IA 4L8CB 2D03H 5DURB 3LXCA 3KWTA 4JKKA 2PKDA 2DIBA 1YDPB 2VXSL 2R2EB 2GT9B 2CCLA 3GKWH 4QXUH 1IC4L 1LO5B 2CIKA 1U8QA 4NI3A 4AZ8B 2WN2A 4O4YL 1QMUA 4MA7L 1MCPH 4HSAC 1VAHA 2NUPA 2GJ6D 2DAVA 1R9FA 5JDSB 1WEJH 2QLYA 1FLRH 1J05B 3EJUA 1K2DB 3MRGA 2BIOA 5C2BH 2EXSA 4N0UE 4HBCL 4JO4H 4JUTA 3JYCA 4QRUA 3IDXL 4E9VA 3S37H 1M2OA 4NX0A 3NSJA 4Y16D 3K1KC 4G8GE 4G9FD 4RAVB 1MUJA 5E9DB 1Q1PA 3KJ6H 3QHFH 4HT1L 3VD4A 1WG3A 2CO1A 2I7OA 4RAUB 5ITBL 1I7RB 4TNGA 3WNKA 3HI5H 2DJMA 4B7LA 4FQCH 4QO1A 3B7SA 3VH8G 4E5XG 1N64H 5GGQH 1D3CA 4MDJA 4BRVA 2DWXA 5FS5A 1OAZH 4FI6A 4TSBL 5C6WH 5AAMC 3U9WA 3TNMB 1DTUA 3U0WL 1P6WA 4Q6YA 2ZYSA 4WI2A 1TYEB 1PKQA 1SOKA 1WFIA 1DSFH 4L29A 3QIUD 3O0RL 4X7EC 1HSAA 4ZFFA 4TULL 5DJCA 3MRQA 2OCFD 2XBTA 2GB2A 5BO1H 3C5ZC 4X9BA 4NN6B 2F53A 2KH2B 4OVVA 2LU5A 3AREC 4YAQA 3H2PA 3TXAA 3PDDA 3U0PB 2M26A 5F9JB 1CG9A 4NRYB 1T0NA 3BAIA 2L7JA 3PL6C 5TFSH 3QUKA 4YSAA 1GGTA 2OSYA 3L54A 4JPWH 2EVJA 2CIIB 4MCMA 4KKCC 4G8EA 5LCVA 2RR3A 5FCUL 1FORH 3X11A 1PLCA 1QTPA 2HFFB 1G7LA 32C2B 2FO4A 3OSKA 3REVA 5KS9B 3VI4B 1OOWA 3DUSB 2QTEA 3RZCA 2XTJB 1FUNA 3A4DA 4R4FH 1KNOA 5IR1B 3EOYG 4OQTL 1MFBH 4F8PA 2ZXWB 3EJJX 5HHNA 1A1MA 2MHAA 3JWOC 4KVCL 4P5SA 3V6OC 1ZHNA 3S37X 1NKOA 1OCRB 2EABA 5LN8A 4F37F 4HIIA 4IGBD 4JE4B 1Z3GL 1JNJA 5DJDB 35C8H 1W0YT 3BMVA 5TD4A 5F7EL 2N0MA 3BP4A 1BJ8A 3TCXA 3ATBA 4LARH 1DBAL 2Y24A 1E9PB 2Q9OA 4XO5A 1FAKT 1AGEB 2FE0A 3IJHA 1JK8A 1I7TA 3RNQA 3DPBB 5EBMB 2V7HB 3PHAA 3PGFH 3QJXA 3MYJB 4KH9A 2WNKA 4WDIB 2EDLA 2PYED 3ZKXB 2JKJA 4DCQA 3GB7A 1FFRA 1WBZA 4HEME 5DVPA 2D3JA 3KYMA 2HRGA 2XXMB 5DRXB 1KSRA 2NY1C 4NPKA 2F7PA 3O45B 5I73B 3U30B 4ZSOE 5DWPA 2LV4A 1F3DH 2X4TA 2AAVA 3ZU8A 3U9PL 3FN9A 3MLVH 5CINL 1RZJL 3QRLA 4AGNA 5IFJB 1IZJA 5DC2A 5ANME 3QJRB 2QSCL 3RY6C 4QWWC 3B3IA 3TZVA 5E00A 3NCJH 5T5FA 3GYRA 4Y19A 3S88H 2X1OA 2FBJL 2KLRA 4NQVB 5IJVB 4I3RH 1D2PA 5I6OA 3GS4A 5C0AA 3UADA 1NH6A 2NCEA 3MTXA 3T0WA 3IAPA 2HN7B 2UX7A 5I16B 5L88H 3MBED 3SPIA 1MDTA 1AXSA 4WFED 3I3EA 3QCVH 4GW1A 4AKQA 5IHLB 4ODWB 3JSSA 4FQXC 1P4BL 2EICA 4U1IB 4F2MB 4KDVA 1ZT7A 4NSKB 3U36A 1U2YA 3IXAB 4Y1AD 2XDHA 1JMXA 3OSVA 3WKNA 5B38G 1WC7A 1NMBH 2YD9A 4PB9L 2YZ1A 1ID2A 4NQSB 3IKCB 4L3EE 4UQ9A 3CDGB 2FX9L 3TVMC 2PP7A 3A4AA 5IROD 2ADIA 4RNRB 3Q9QA 1BG9A 4H8QA 5AVTB 4P2RD 4TVPL 3BW9A 4LCCC 1HU8A 3EO0B 4UTBA 3MRMA 3TFKC 4CJ1A 4H8WC 4HFUL 4PSRA 4PS3A 4EN3C 4PJBB 1ZLUH 4FL4C 5I1CL 4HS6A 2J43A 3CTTA 4PD4J 2DMHA 2JF1A 2AQRA 1K6QL 3RWHA 3MRDA 1S7WA 4D0BB 3BJLA 1ICTA 5DK0A 3VU2A 3QRGL 4MGXA 5AW5B 3ARYA 3MO1A 1FO0L 2P43B 2YXFA 4I18A 1AI1L 2WXLA 4BIKA 4F7KA 2YQBA 4QRUB 5HI5C 1TJHL 3O2DA 4FABH 2R1YB 4WI0A 3FMGH 1J5OL 5I66A 4XBGB 3AROA 4N6QA 2H2SD 1FBIL 2NUTB 4BFEA 5BS0D 4ZZFA 3JVGC 5DFAA 2CD0A 3LZFL 2PXYA 3CFDA 1HL5A 4KK5D 4R2GB 4NO5B 1S7TB 3Q13A 5FECA 1CICA 5KYXA 4UBDC 1XB8A 1F1AA 4Y0GA 2XN9E 4HJJL 5D1QD 3FT3A 4G8GA 3WDIA 4MAYD 5EBWA 2Z0BA 1GW6A 3IU4H 4B9FA 3GHPA 5EDSA 5T5FL 4DZ8B 4K5MA 3MOAH 1NCHA 4WEUD 4Z9KB 5HHXL 1L9OA 1BVNT 3H9HB 3S97C 2J12B 3ECWA 3WXVH 4N0FA 2DLHA 3BAJA 4L29B 1EPFA 1FH5L 4MDIA 4QHLA 4Z23A 2OULB 4IU2A 5IKCA 5I8OH 4ZFFB 3FB7B 3P9LA 4NO2B 2WQ8A 1WFUA 3CVIH 3WHE0 1SHMA 3MLYL 3KPOB 1NANI 2EDXA 3LPWA 4MYWB 4NFCA 1IZKA 5FKAA 4YAQB 2BRQA 5JDJA 1D9KC 1DBKL 3BSHA 3HJEA 2AHIA 1M57B 1T0NB 2Z8SA 5ILTL 1S9WA 3QUKB 4J3WA 1K8DA 1Z9SA 4X5RA 1GIGH 5HYFA 5CKGA 3U9UB 3RL1A 4G8EB 5CCGE 1HTYA 1AG0A 3X11B 1G7LB 1R5IB 2FO4B 4OFKA 5FFOA 5CF3A 5T1LD 3ULUF 3C8DA 1G9NH 3RZCB 4YSDA 1T1YB 1T80A 2UZPA 1JF5A 3PPSA 1I7ZB 2GQHA 1JZEA 4OZGF 4K9JA 2R0KL 4P57B 1F4WH 2QHRL 4LNRA 5BW7C 5JHBA 1ZHNB 1GHFH 4YMPA 5EIVA 3EFOB 2Y5EA 4HIIB 4TQPA 1CR9H 2CO6A 3SDYH 3HE6C 4GI8A 3O6KH 5I75C 2BVOB 2IPTH 3RJOA 2WQUA 5GISH 5AAMA 5EPMA 5JYMA 1E6JH 5KSUA 1THCA 1MVFA 1TYRA 4K3HA 4NQED 3SGDH 1TVDA 3MODL 2DY2A 4XP1H 4MB1A 3RURA 3G5ZA 1BEXA 4PBWD 1N19A 1J8RA 1AR2A 5DEFA 4AQEA 1JK8B 5G4MA 3QC6X 4JJ5A 5GZOC 1JF1A 2ZG1A 3C5ZA 1FO0B 3AREA 3EJZD 1PG7W 3ZRFC 3DVGA 1FC2D 1G9ML 3GB7B 4LCYA 4U3HA 4TVUA 5KYUB 1LO2L 4P3CH 3PL6A 4KRPD 3BIKA 2Y36L 5GS0C 2NY4D 4I48A 1E28A 5MI0B 2YK1H 3LZNA 4K3JL 1WVZA 2HT4C 1FDLH 3RPIB 5CP7B 5EU6E 1ILSA 4HEMA 3S5YA 5AB2A 1AZCA 3TZVB 5E5LA 3QEUA 5IM7B 2MCG1 4ZSOA 4Y19B 4TOYH 2QGCA 2YD8A 5EU5B 5J13C 4I89A 1FQ9C 3V6OA 3QFJE 3VTMA 1HI6A 3SE8L 2WXPA 4LB8A 5ANMA 1S7VB 3GFUA 1NBYA 3NK3A 5EO1A 1CXFA 2BVPB 2D7MA 2DIEA 1VB9A 5KBNC 4KNTA 1E27A 4RFEA 4HC1A 1A6VH 3V4UH 4TSCH 1WZ1H 1DO5A 1FL3B 1ZT7B 2X4PA 5D1ZC 2XWTA 3DOSB 3MCKB 1W8NA 1F02I 1Y6NR 4LU5H 1ZLVK 2BMKB 3L7EA 3LZOA 3VI3B 5C97A 1PGRB 3HS8A 3CXHJ 4MWFB 4MD0A 2F1EA 4P9HL 2CJSA 4H40A 5HYQA 2FHCA 4JEGB 1XCXA 4O2FA 4HBQA 5HDRA 2JFCA 3FSVA 1S2EA 1IKOP 2YAOA 2XJKA 4PY7B 5AOZA 3SE6A 3HAEA 4GMSL 4JRYD 3WOVA 4L3EA 1KV7A 4TVSa 1K4DB 4DP8X 4E42A 4NT6A 4FFYL 1XMWA 3WFZA 4U3CA 2VDRL 2F5AL 5ACZB 4AIZA 3RY6A 1D7BA 5ADOH 5J9PB 3QP3A 1HZHH 4YDVA 2WJ7A 3BFWA 2VAAB 1Z9LA 3QQ9C 4P05A 1X6NA 1X5HA 2ICEC 4AWJC 5GIRA 1N5YL 3O2VH 1UJ3C 4FULA 5F88B 2GK0A 2HSIA 4LLWB 2C9RA 4M7LL 1S4IA 5CU9A 2P5EE 4WI0B 3FTVA 1FCCA 5EN3A 1ZOXA 1JV2A 1TT6A 1IVLA 1EEZA 2NW3A 4YFEA 4KFMA 4FQXA 1OF2A 4QXGH 4OJYA 4YXHH 4BYHA 1CICB 4ZW5A 4FCAA 4LEXL 4XCYB 5FW7A 1L0PA 4EUPG 4LLMA 1HHHA 4EO5A 2PPEA 3P2TA 3SJVB 3OGCB 2WOBA 3PWPA 3STZA 3VXSB 4GEIA 1BVKB 2XZQL 1X4XA 1E3ZA 5SWSE 4HXAL 9CGTA 1O9ZA 2K0RA 4L8DB 3TVMA 3ZXAC 3ALPA 3OB0H 4PJHF 5DYFA 4TXVB 1E3FA 3D6GA 1P53A 2YIHA 2WXRA 2XVGA 4ZYKB 2H5UA 4FDWA 2YOAA 4LCCA 1S7XB 1BMZA 1VRSA 4JDZA 3S3PA 4HC1L 1JXKA 3GZKA 1L9TA 1UM4L 3DV4A 1ODAA 2JIXA 4EN3A 1MJ8L 2V2WB 3E1F1 2VZTA 4FYRA 3LZRA 1WS7A 1DN0A 1FSKC 5DD0H 1NCBH 1SVZA 2BNQE 2Q87A 3TA3B 5T3XE 4P4KC 5FK9A 2X2JA 3O4LA 1NCNA 1DANT 3EW3B 1KCRL 3FO0L 2R39A 4PTUA 2IQAA 4UQCA 5INDA 4YK4C 2PPAA 4LVOB 4N0YL 3GUTA 2R0WH 1A6ZA 1J48A 1Z0MA 1ZT1B 2OL3L 5ICYA 3VFTA 2DLFL 1COBA 3LKRB 2XXCB 4NQXA 3JVGA 4YGVA 4XPAL 4CU7A 2OZ4L 4DGUA 1SEBB 2ZWSA 1F8TH 4PP1C 2NW2A 4HJ1A 1GZQB 4JY4A 4PVBA 4HKZA 2R29L 2ZYHA 2WLHA 4LNRB 5A2BA 4Q56A 1SLWA 3K72A 3PAZA 4K23H 2AEPH 2JK5A 4PRHD 5DEZA 3GMOA 2ALWA 2ED7A 2ZWYA 1BQHA 5JNYA 1GYUA 5H94B 5LGJB 3ARDD 1L9QA 1EFXD 5KSUB 4BZ1L 3NZHH 2VDRB 4JN2B 3G5ZB 4FXKC 3UTTB 4LAJH 1INQA 4YUEL 4RDQF 3MXVH 1JF1B 1HCZA 1RAMA 4FP8H 2L7QA 2RA1A 4YBLC 3BXNA 3AREB 3EJSA 2WUBL 1AS8A 4X6BB 1KTCA 4FQ2L 4QRRA 1D9KA 4FE9A 4LOUC 1A7PH 2BS8A 1XR8B 3I6LD 4JO5A 3PL6B 3UJTH 5C07B 4F7PA 3BIKB 3TYFA 3NBNA 2O61A 1A7RL 1BQUA 4I48B 4KTEL 2P4AB 3GXMA 3OKKB 4UT9H 3CFCH 3S9DB 3AQYA 2FJHA 1I8IA 4TKWA 4YDKL 5FWRA 4GP8B 1V7MH 5E8PB 1FZOB 2WSDA 2XZCL 3WEXB 5GXBB 4MMZC 3KS0H 5TH2A 3MYZA 2MH4A 1IIIA 2DI8A 2WZAA 2ADFL 1PDKA 3IWUA 2GJJA 5TJWK 1OAXH 5IQ7H 1URLA 3JT0A 5BUAA 2J8OA 1IB5A 4GQ9L 5CJQL 4BFKA 4LSPL 1AS6A 5G55A 1AP2B 4U1KA 2IWGA 3W11C 5FYKL 4YL4A 3OLGA 2DIAA 4KI5D 8FABA 4XWGL 5EO1B 3HE6A 3KHOA 3QR1A 3MRIA 3L3IB 3JBG7 3MLWH 2XN9D 1E27B 3RI5K 3KPRE 1PPIA 2O5XH 1NUDA 2A4ZA 3MNDA 3R7QA 1FWXA 1IBGL 1TG8A 3QFJA 1N0XH 3V0VA 3ZUNC 1GGIL 2DM3A 3WIAA 1YO4A 1UVQA 4YDNA 5JQ6L 1E4HA 1UT2A 1P5VA 3MV9D 3MLZL 3UZEC 4NWUL 1G0XA 5GZOA 2BIMA 3MPCA 2NY0C 5E5MA 1O9VA 4IMLA 2ICCA 3FCUB 1AZRA 2AV7A 3GXTA 3IFPB 2B5IC 4MD0B 3ZYIA 2JELH 1TTBA 2NY5L 4PJIB 2YOCA 1ACYH 1KY6A 1NGXA 4ZO9A 4BJLA 2OL3B 5AZEH 2E8ZA 3ZE2B 1SBSL 1U3HD 1SN0A 3RGVC 1F58H 5JTWA 3HAEB 1XFPA 2GJZB 5I8KL 2EYTA 3ARZA 3FS9A 1U0QA 5K39B 2ATPA 7FABL 3QEGH 4DPRA 1MHCB 2AQPA 3HZVA 1C9SA 2XT1B 4IIQC 1N59A 4JG0L 4OZFG 5JR1L 4AQ1C 4YDVB 3TC9A 5C6PB 1KEGL 4YEFA 2DQCL 4U1LA 1B0WA 1AAJA 1E5UI 2VDNL 4C8XA 2YWYA 5J3HC 2WZ0A 4XPHL 1R19A 3TWCL 4B9YA 3IMBA 2IO5A 2K9UA 3CXDH 2HVJA 1OAUL 2Z7YA 4U6VH 4FN0A 4Z7VB 1IFRA 2HX8A 4TTGA 3KPNB 1EEZB 4RGND 4YSRA 3IXTB 5FA3A 3EXJA 3FT4B 5D1ZA 3BLPX 4EDXA 3N43F 1OAJA 4PJGE 2K6ZA 2NDFA 3EFFA 4LLMB 1HHHB 2P5EA 3NCFB 3U2IA 5C0GB 4X50A 3ARTA 5DUPL 2FX7H 3PWPB 3C8KA 3STZB 5DHMC 5FYJL 4JL1A 3TVMB 3EXLA 3NIDF 3R8BB 5D1XC 1XX9C 2G3XA 2NNAA 3ROLA 5C3IA 5HD8C 3ARGC 4PRID 4XAWH 4F93B 2J6EA 4LCCB 2D73A 3RVTD 2FX8L 2Y7QB 2YGNA 3D18A 1RVFH 5GGSA 3N0PB 4FFZH 5F70A 2MOGA 3RVWC 3DV4B 2VN7A 2YUVA 1MF2L 1ZTXE 4FOMA 4MCZB 1BMGA 1WCQA 1DN0B 4AYEC 2VN3A 5FK9B 4JANA 2ICEA 4ZO7A 1QFWL 3P4MB 4IOSA 2IQAB 5BRZA 1UJ3A 4F2EA 2HKFL 3GJEA 1YY9D 4HGWA 2ZKYA 2JQAA 2OQJA 1AE6H 3Q3GA 5ICYB 2BNQA 1TR7A 3KE0A 5E8DH 1F3RB 4NQXB 2CKBA 3DIFA 3KLSA 4DAGH 5SWZE 2IPUK 2H26B 4M1GL 2NXZD 1MW2A 1KYAA 2ZWLT 5D1XE 5ADPH 1BHGA 4HKZB 4F7CB 2GVYA 4JY5H 3H55A 2A3TA 1CXKA 3K72B 4K3EL 2FIKA 4N2IA 3IFLL 2YBRB 5E1HB 4WTZG 4CVUA 2FHBA 4ZTOL 5JNYB 1BM3L 1BJ1H 2H32A 1HXYB 2E6QA 3F7VB 1TJGH 5EHFA 3QS2A 4Z3FA 5DLLA 2EC8A 4LOVA 1BOYA 2F58L 1CDCA 3MRRB 4PGDA 5D72L 4KO6A 2G5UA 3MFFB 2EDYA 3BH9B 4G8FB 3U6XS 2VDNB 3RUGF 2J8UE 3QZWA 2F5BL 1BPVA 5I9QB 3BXNB 3OAZH 4GKLA 2OYPA 4QRRB 3A6BL 3WY2A 3K3QA 4P4KA 3P30L 4NRZA 4L18A 3VYOA 4C59B 2XQYA 2EIEA 4HF5L 3TYFB 3GXIA 1WAAE 1S7RB 1SOQA 4I0PB 4YOKA 5MEPA 3V4VA 2FJHB 1I8IB 2HFGL 1SJMA 4KQ4L 1D6EA 2VWEC 2JTDA 2RJMA 2KDGA 2WZ5A 3QQ3B 3WNIA 4WNJA 2R2BB 3MJ9L 3GSOB 5T5NF 1IFHL 3IGFA 3M1OA 2HZHA 5JHMA 5DJ8B 1A9BA 4LCWE 1HKFA 1TLKA 5DA0B 5KVFE 4G5ZH 4EI5C 4K5NA 2KDYA 4OCMC 4RMRA 2IH3B 2JNZA 2P42B 2ZXCA 1TITA 4HQQL 3UACA 4M6MH 3D39E 3DKHA 4AL8H 3K0YA 4GG8A 4POUB 2A0LC 2ZXAA 4KITB 8FABB 3L3GA 3HE6B 5L7XH 1MHEA 1TZIB 5DFVC 2NT1A 1XGYH 2ID5A 4CADB 1EHLH 4FLRA 3DECA 4KRLB 3DGCR 4QXWA 5IQOA 1CFTA 3IETA 2COVD 1UVQB 2Z93B 1SJHB 2XPGA 4FXKA 1P5VB 2VXSH 4ODTL 1TZOA 3IE4A 1OWRM 1VFMA 4PY8I 4AUYA 2VJ8A 4XN4A 1A7QL 4DP5X 2CKBL 3ZTEA 1IC4H 5E5MB 4FERA 4DK3A 1XD1A 2VQ1A 5JXAH 4MBRA 1XZ0B 4HIJB 3FTGB 3KPRA 2VWEE 3FCSA 4LHJB 1T21B 2VLLA 2R7EB 1KIPA 1J0ZA 4W6XB 4XO8A 5FKPB 1YLBB 2AERT 3G5XA 2P8MA 4F7MB 1NDMA 3N44F 2X53A 2ZX7A 3IDXH 4MX7A 4G6KL 5CCKL 3M88A 4UQ2A 2EYTB 4H1LA 4OCWL 5J8OA 3ZR5A 5A2JH 5T3XD 4AYSA 4DUXA 2X2HA 5IJBC 2QVMA 3T04D 2ZOUA 2ATPB 5B1CA 4MMZA 4C56D 4HT1H 5A43C 2JI3A 4MB3A 2A38A 1DSYA 2J4WL 1R3LB 2C7UB 1KXVC 3LN5B 4U1NA 4YE4L 3HFFA 2A6KA 4OI7A 3PHQA 3PFQA 1JPFB 1CDBA 5J13B 1O7SA 2KUTA 2OA9A 4HIEB 1DJHA 1GGYA 1QKZL 3DYMA 4QTFA 2KKQA 4BK5C 4X4YA 3WFBL 2VXQL 3C5SA 4TSBH 4PRAA 2H2PD 4OZIE 4JRXD 3OBAA 2BSSB 1SYVA 2NMSA 3QWNA 2OMYB 4G80A 2G2NA 3P2BA 2CRMA 3F5WB 3CXFA 1OALA 1U2HA 1RJYA 2L3BA 3UTZA 2AEWA 4TULH 1JD9A 3TX4A 2XFGB 3EFFB 2XN0A 4H5SA 2R9HC 1H3GA 5E2JA 3UZEA 3MV11 4PRPE 1W72H 3MJ7B 3MREA 3C8KB 3ZHKA 5HSFA 4ANKA 2ZUSA 3COOA 1JVKA 1PIFA 2Z35B 5B39A 5I28A 3IDNB 1KBKA 4Q8BA 2A6DB 2V7NA 2KPWA 2EIZA 1FZJA 2NNAB 3ROLB 1CGTA 4PJGA 1NGYB 1N4XL 2ICWJ 3ZL1A 5JLZA 1TF4A 4O2CA 3QI9A 3RGVA 3WE6B 5FCUH 4AGOA 2P80A 4YHZH 4IU3A 3SBQA 5BOPA 1KJVA 3D18B 4MRCA 3MNWA 5DT1L 1XGUA 4OBRA 3W81A 2HAZA 2YQ3A 2BZCA 1CC3A 1J8HB 5E5RB 4OQTH 4MD5A 3D3VD 2VABA 4IIQA 1WCBB 2ORBL 4P46B 4AQ1A 2XUWA 4KVCH 4N2NA 2B4CH 4Z3TA 2V3FA 4KKPA 5D7KD 3QQXA 3VD3A 5BRZB 3ILPA 3QUZC 2W07A 4Z7NE 2H8PB 2X4RB 2OQJB 1IAKA 1CFMA 4AX3A 1NEZB 1GZHC 2YD4A 1WITA 1XXDC 4NP4L 4YBQD 4WI5A 2CZNA 3MA7B 2CKBB 5CEYA 4AT6A 3LZQA 3CVDA 2QLVB 5DC0A 5HHOB 2WW8A 3KWXA 3BPCA 2B2XL 5T1DH 2PLTA 2EUWA 4S1SL 5BOZG 4OUUA 3KAAA 4K15A 1F86A 2FEEI 5D55A 3CDFA 5AVXB 5JOEA 3QPXL 3ABLB 3QWRA 2IIJA 1YPZB 1YJDH 4MZIA 1G7JB 4HIHB 2H32B 4LGSB 5SWZA 1WPCA 1AKJA 1IEAA 4GSRA 5D1XA 3TU6A 4MD4A 3ARGA 4KUCF 4KY2A 2Q86B 3JTTB 2AS5M 2ATKB 2OFQA 1IILE 1YNLH 5CINH 5FFGA 2Z64C 4LL1A 5CGYC 1JN6A 1L9RA 3L6FA 2QSCH 1OW0C 1YNTB 4OZHE 4J2QA 3L3JB 2JVUA 1YMME 4AG4L 2FB4L 4GSDL 1ECZA 4KNQA 4ANVA 2FBJH 1DJZA 2W80C 2H3XC 4QHNA 2WD0A 3EUDA 3VI4F 1AOHA 2ZOKA 1BVZA 1DVYA 2F18A 2GSGA 2J8UA 4YK4B 5C0BA 4QT5B 1SMDA 3KYKH 3QO0A 5HGDB 1K8IB 1FYTD 4BK8A 5HGBB 1FL5A 4LLDA 4U1MA 4LLQB 2X2YA 3QDGA 3BCDA 3IFNH 3ARFC 4DIXA 1P4BH 5LCVH 2XV3A 3D5OF 2UXVA 4H26A 4WENB 3NTCL 5D2LE 1ED3A 1MCFA 2C4FT 1A9BB 4Y7OC 2Q10A 2CLZA 2YUXA 4XCNA 4JDEB 1E5ZA 1OM9A 4ZDHB 5I1GL 1J5IA 5DO8A 1WAAA 4NQDD 4CSTA 2J1KA 3T77A 3MUZ1 4W9CC 4F7EA 1LEIB 2OYKA 1KACB 2AK4D 1PD0A 2X44D 1Z0NA 3EBIA 3G9AB 1HZLA 3ULVD 3UTSE 5H2BB 1AH1A 2FX9H 2BJMH 4FG6D 1DHKA 1M1SA 5DS8A 3ZDYE 4IS6B 3ZTNH 3L3GB 2X3BA 2UXTA 1SYSA 5GGVH 5AAWC 5MHSE 4BHUI 1L6XA 2MSPA 4PV9B 3MNMA 4ZMYA 1A25A 4ZMZA 3C5JA 3U82B 1MSPA 1UATA 2EIJB 3UTQA 3MLUH 3ZJAA 2A4EA 2R4RL 3UAJC 4KY1L 2XPGB 3D39A 4PS4L 1MQ8A 1NQBA 4TYUA 3AQXA 1JOIA 3KR3H 1AHWC 2O5NA 4XX1E 4MXVF 2V8LA 5FA4A 3VCLA 3GSNA 4LPYA 5I1CH 1CYXA 1QLFA 4FQLL 1K6QH 4NIKB 5DRWB 1LNUB 1NGPL 1KIPB 1G9HA 5CBEA 3QRGH 2VZOA 3MLTB 3HVDA 4L1DA 3QVAA 1NC4D 1FO0H 3G5XB 1AI1H 4I5BB 4IBVA 4F15C 1W6LA 2EDRA 1TJHH 3NZ8A 4OCSL 1J5OH 1TVBB 2OJEA 1FBIH 1X6LA 3FUHA 2D7TL 4C4UA 5IQMA 3TEZA 4MMZB 1D7CA 4M61A 2QADD 1P69B 5I6PA 4DFHA 4Z7AA 2QSTA 1EQWA 3HHSA 2BXZA 4U1NB 1KYDA 4YHPB 5KTEL 3PHQB 4APQD 3SPGA 1IKFL 4EI5A 1KJMA 4HJJH 4I9XA 1N12A 1OGAB 2AEIT 5IVOA 1MCNA 4X4YB 5T5FH 2C9XA 1WIOA 5F0LB 3CN4A 4G7RB 2VH5L 4R83A 5HHXH 2XQBL 5J57B 1TENA 1MCEA 4JPIB 1SMOA 2ZUVA 4G80B 2Y07L 2QKIB 3HG2A 4YHYC 4PG2C 4GMTL 4IBWA 4E9WA 3S48A 4OZIA 4X4ZA 2HXAA 3MLYH 5LDSA 2YGOA 2XICA 3MREB 2NY0B 3P9MA 2NZ9C 2WXHA 4HS8H 2GY7B 5IROC 4JLRA 3EF4A 4X4KA 2B9BA 5ILTH 3RPBA 1CWVA 3VGFA 4U4BA 2OMNA 4QGTA 4BZYA 1FZJB 1SFDA 4J3TA 3MRHA 4WWID 5JLZB 1YEFL 2ZCHL 3FXIC 3OKYA 4PPTA 4PJBF 5C0DB 3KXFD 3FSZA 3RGVB 4LSVH 1URIA 1QBML 4OIIH 4IU3B 3GMNB 5BMFL 2QSVA 4HX1A 5AD0B 5L6YH 3OB8A 1R24B 3WTVA 4MD5B 4UTBH 4LZKA 4MS6A 3TURA 1EHXA 1MN4A 3TONA 1HL8A 2R0KH 1KXVA 4DETA 5LO7A 2QHRH 4N0CC 3WFCL 3GSNL 1JYNA 1BM7A 1CI3M 3ILPB 4BK5A 2ILLA 4Q14A 1BP3B 4LCWD 5I0WA 1TSRA 3QNFA 5CKAA 43C9A 3IPEA 4U1SA 5HI3C 2PTVA 3VFRB 3ETBF 3ZE0E 4BFFA 4AC2A 3MODH 4YWGL 3U4AA 1IARB 4XO3A 5CEYB 2CXGA 3ATFA 3KEDA 5HYIA 2VM3A 3BPCB 5JHDE 2HT2D 2RB8A 1SHSA 2YWZA 1BZDA 1KXQE 2BFVL 1RULL 1RZIB 3GJFB 4UDUB 3CFJB 1OL0A 2CUAA 2IWEA 5AW3B 1M7DA 2Q7YA 1FRGL 3TBVA 1LO2H 3VGGA 3LHAA 4BQ6A 2GABA 1AKJB 1IEAB 2L8AA 1A65A 5CO1A 2EE6A 1DLFL 2Y36H 3O3BA 4ONGL 3ARGB 1C5CL 2AI0L 1B4TA 3N1PC 3NRPA 3MJ8A 3MRJA 4MKMA 5AZ2L 1OAQL 3OKDA 4K3JH 4ZX3A 4NNXB 5FV1L 2ARJB 1H3TA 3E6HA 4NXSA 5CP3A 2CR6A 4F7TA 1CB4A 1ETZA 2IDQA 4QHNB 5DC4B 1IM9B 3QUYB 3SE8H 2B77A 1Y1UA 2GSGB 3QUZA 2GUOA 1RL1A 5C0BB 3H3PH 3QXDA 1YMMA 1Q0EA 5ETUA 1FVEB 4IRZL 4LFHG 1GZHA 3HB3D 3N42B 4RWHA 4MHHI 4H26B 2AJVH 3S7GA 3TBTA 4FG2A 3B2UC 5E4OA 3WLWD 2OMXA 5GS1C 2XI9A 4DEUA 4OF3A 5EUOE 5EZLA 4JN1H 4HLJA 3QGVA 1A4AA 1FG2B 1F41A 4QOKA 2BFGA 4WSKA 5DS8B 5EOCJ 3D05A 4UINL 2IBBA 4HUUA 1H8NA 1SYSB 5D2LA 3VQ1C 5DQJB 5E51A 4U33A 4Z7IA 2ERJC 2EP6A 4W4OC 1JGEB 4I9WD 1PCXA 1XH3A 3C5JB 3TJHC 8PAZA 2NSQA 2O6EA 3NJVA 3BP5A 5TDOA 4ZMLA 4WJG3 2VDRH 1CFNB 3VCLB 5FA4B 4GUQA 3GSNB 3ZDZF 3N5AA 3MLPA 1OW0A 3S3BB 3AQZA 1NCUA 1QLFB 5IW6B 3NN8B 2BSCA 5EOTA 3WGVB 1T83C 4KRPC 1N5YH 2IH8A 2PWEA 4BSJA 5DEGB 1DBML 1JZIA 4M3KB 1KPUA 5SV4A 3F12A 3QH3A 2ZP0T 5CJBA 3KPPA 3B7RL 5CGBA 3WN5B 1FZMA 3RY5A 3TPUA 3ARFA 2SODB 2TSBA 1M56B 4CSZA 5CIPA 1BVNP 1A14H 3VFNB 2AXHA 2X89D 4ELKB 5AALA 4GKSA 4EI5B 3GXFA 2X3CA 3S4SA 2FEDC 2EEDA 3QCTL 5E8OA 4JM2D 5CWSB 5DTFA 4NI6A 2IMMA 4H13C 4HXAH 5CZXC 4CSPA 5IFAH 5KVGL 5F89A 5AAWA 2YEVB 2FATL 1MHPH 5ID0A 5E6RB 3MCLL 4WUUA 1SEQH 1ET5A 3VI3F 3PG2A 4Y2OB 4IW4C 4MA1C 4HP5A 1KT2A 3QA3B 1NCOA 3R7RA 2CPUA 3UAJA 3L4VA 4HC1H 1N0LA 1RSYA 3N1FC 1AHWA 5KBKA 1E8WA 3GT6A 1MJ8H 3QEQD 4NZFA 4R26L 4Y8AA 4JLRB 4QRBA 2JTYA 7TAAA 3NQKA 3ULUD 4ZOAA 4FMVA 1IX2A 5DJZA 4Q4IA 1ZS2A 4GRLC 1KCRH 2PNDA 3BD4A 3IRZA 4O51B 4U0QB 5TPWL 3MRHB 3BQUC 3KEHA 1RUMH 3SQOL 1Q72L 3RBSA 3BRFA 4WI4A 3R1GH 2O5YL 2DLFH 3QUMA 2XIIA 1RZ8B 4G6ML 4IHOA 2VLKD 4ACPA 4MQTB 4XPAH 3HAEH 2OZ4H 3WE1A 2C9QA 3VAEA 2VL4A 1YY8A 4X0KB 4GG6E 2R2HA 1NFIA 4M5SA 1Q38A 3CSGA 5ISZB 1S46A 1HSBB 5HI4C 4ABWA 2E9BA 3CMOL 5T1KA 5LG1A 3DA0A 4WFFE 5JIIA 3VMPA 43C9B 4IKJA 3SDCC 1A7OL 1NBZA 5GPRA 2BINA 5JIQA 4PG2A 1KFAL 2P5PA 3MGOB 1V54B 3LEVL 2E76C 1EJFA 1J1OH 1LO0L 1NIAA 1T0OA 1AFVH 2XU9A 2Y7MA 4YUEH 3I6GB 2EXWC 4W81A 1HKLL 4M7LT 4KK6D 4CDHA 3PS6A 4KVNH 1PZDA 2WUBH 5ALCH 2IAMC 2R51A 3PV7A 2WB1A 4FQ2H 5IROA 4CDGC 3PRZA 5DJAA 4NUQA 1R17A 3VXOA 3L17A 3BPOC 4UIMA 1OSZB 5JHDA 3PV6B 2ESVD 3K6FA 4KTEH 2LAAA 3C6LC 2ZKMX 3BKML 1QI5A 3CCHB 3BDYL 3BH4A 3L4YA 3KPLA 1I31A 4M03A 4NZDA 2QELA 4PGEA 1V05A 4YDKH 3FT2A 3OKDB 5TF1L 4CBPA 2DQ6A 3VM5A 3HNVL 2Q7NA 5IQ9B 1GY2A 1UOWA 2P9RA 1QSFD 2DLIA 4DGIH 1GR7A 4Y5VC 3UC0L 5AENA 1TNNA 3BEWA 5HDQH 2GJ6B 2BOLA 3WSQH 1V55B 4GS7C 1IAII 1ESOA 3NQIA 5GZNC 1UOVA 2WINA 3DMMC 3R18A 1I53A 1KPRA 5FYKH 3BO8B 4MQ7B 1KCKA 1PEZA 4Y16B 3QXDB 1UEYA 3KGRA 2GSMB 4G9FB 1L7IL 4YDJB 5BS0A 4WW1A 4MXWL 1SDDA 2MKWA 1IBGH 2W1NA 1J87A 3FQ4A 1UQSA 4URTB 3TBTB 4ECNA 5IF0A 5JQ6H 3ABMB 2EO1A 4M8QB 4NWUH 3QUHA 1NC2D 3EGDA 2QPUA 4P2YA 4N90D 2KI6A 3R06B 1CI5A 1TETL 4IKKA 2FRGP 4XMLL 3VG0H 4DVBA 4JRLA 3CFBB 1PZ2A 5AOLA 3ZTJG 5DHVA 4DK5A 1TEYA 5DD1L 2OMWB 3LQZB 4I0KA 1QPXA 2VZVA 3M46A 1SBSH 2WNGA 5EUOA 3QIUB 3JT2A 1OARL 3H53A 4KXCA 1FYHB 1URZA 3FTYA 1WBYA 2G0LA 2APSA 7FABH 2BVUA 5C0NC 1HE7A 4GXUM 5HYJA 2Q5BA 4MLSA 4J3UA 1DP0A 3KDPB 2H45A 2VDNH 4PJ8D 2JI2A 3RX5A 4XPHH 3TWCH 4LSQL 3W2DL 3FB6B 4CMMA 3AW5A 1XXFC 3NABH 2VDOH 2NQ3A 3V2AR 3JV6A 4K0OA 1UA7A 3U6RB 1SRDA 3MX0A 3WJLC 3DROA 3HN3A 3T6XA 3H0TA 5DJ0B 4J5VA 3RVUC 5EFIB 5E7FA 2BPBA 4LRIC 3TJEH 3P11L 1PIGA 5CIPB 3OPZL 1NFDB 4Z7OB 1SFHA 1M6OB 5GS1A 2VLRE 3KJ4C 2PPFA 3HC0A 3I3DA 1OPGH 4B6ZA 5EEVA 2DWSA 3V0HA 2OZNA 4IGBB 2CQVA 4KI5C 3TF4A 4G6AD 2GAZA 2P1YA 3J27A 4N24A 5F89B 1LEKB 3UZQA 3GBEA 3WAKA 4N6RA 4NQEA 3F2LA 4DN3L 5DVNA 5ID0B 4AMKL 4WUUB 3LXAA 1IGML 2CLVB 4W4OA 3ESOA 3QIWC 1J5CA 1J0YA 3MACH 1A4JB 1L6PA 4MSWB 3DYOA 4PJIF 1H0DA 2NT0A 4OB5H 4ZMTA 3B7UX 4ZW7A 3WNNA 2IPKA 2WLNA 3DXAA 5EZOH 1INDL 2P26A 3ZE2F 2PYEB 2HLFC 4UOW0 5E8EA 1JWSB 4N28A 3UGXA 3GMPA 3PP3K 4KZ0A 4KX8A 1T83A 1QFWH 3BP7B 2HKFH 4NBZB 4OTXL 1M3JA 2YS4A 1E4WH 4JFDD 4F15B 4HJGB 2BH0A 1FH2A 1JG9A 5IFHL 5JW5A 3PGDA 1PAZA 3V0WH 3QT2A 3ECQA 3RG1C 2FJFB 4IHOB 3MC0A 3V0IA 5GS0H 5AW1B 1J9RA 3REWA 1MAKA 1XSJA 3BVUA 5CLXA 5D9SB 3QC5X 4M1GH 1XSIA 4Z7VF 3FULA 5F9JA 4LSRL 4K3EH 4R96A 4RFOL 3IFLH 4OF6A 4IBYA 3V9EA 1H9DA 1U8CA 1N5AB 3MQIA 1DJYA 1Y7VA 4ZTOH 4P2OC 3MBEB 1BM3H 1T1ZB 4BK4A 2I27N 3PNRB 5L0QC 1EJOL 1UC6A 3SGJC 4RGNC 4ZXBC 2F58H 4GEJA 5D72H 4DERA 2AJZB 4YHYB 4TQ8A 4Y1AB 3VFOB 2BCKB 3A4EA 2R69A 4XH2A 5EO9A 3VXNB 1UGKA 2Z31C 4M43H 5KSVA 1BV8A 5A1AA 3HBZA 2F5BH 1KIUB 2VNCA 4R97C 3G9VA 8CGTA 5I6XC 2X70B 2MNUA 2QQQA 5E2WL 5DJAB 1CGYA 2ZWZA 3VXOB 1U2CA 4ZTPL 4BINA 4GRLA 4P2RB 1BBJA 4M56A 2IFFL 3BQUA 5DQ9B 3BZ5A 1C08A 5DC9B 2WYHA 3VSUA 3DO7A 5L8KB 4PGEB 2HFGH 3PP4L 5DQDL 2IADA 3WIFB 1ZHLA 2MPVA 3MN8A 1IFHH 4G7SB 4Y4KC 3BEWB 3U7AA 3LIUA 3RWGB 5T1MA 2W91A 1HHGB 4HQQH 1LWRA 3NOIA 5D7SL 1ZIAA 2YPKA 1XMEB 1KPRB 2F54E 2EXTA 3L5JA 4K2UH 1NPUA 2B1AL 2FYVA 2WWMD 3QXUA 4W9IC 3WY1A 2VZ3A 2Y22A 1NLBH 1QOKA 4OLUL 4WW1B 1YA5A 5D93C 3SDCA 5BS0B 4JS7A 3GIVA 5BZDB 4LFHD 1JPSL 2P5WD 4X8GA 3IJ8A 4P5TC 2XRAL 4WIQA 2V2TB 2VMJA 2OPCA 4AEIH 2A9DA 2VR5A 1A7QH 3L3DB 2CKBH 5D1QB 4MAYB 5GGTA 1NLDL 1SXCA 3Q43A 1SLVA 3VH8A 4E5XA 2IAMA 1NIEA 1IM3D 1Z5HA 4CMHC 1E5CA 3HR6A 1HXKA 4N68A 1KENH 4IEFA 2YRZA 2X4NA 3UYPB 4L1SA 5IQLA 2F74A 3C6LA 2H32H 3BAWA 4G6KH 4K5PA 4EQ3A 1U92A 5CCKH 5HHQA 3KWVA 4MTMA 1U8KB 1QSEA 3F58L 4BFIA 1YYCA 4AH2A 2NR6A 4Z7UE 1U3NA 2IAND 2NOYA 1IT9H 3QUXC 2J4WH 4ZUWA 3JQOB 4Y5VA 3NVQA 3OF6D 5F9AC 5GS3A 2K70A 1CGSH 1EDHA 4BKLA 3QIBD 4ESKA 3KYAA 1C1EH 1SXZA 4UM8A 1P5UC 3EH3B 3WFBH 5GZNA 3JV6B 4X7SH 1EZUA 3MX0B 1E2VA 3DMMA 4PJDB 3DROB 4XNXL 4LBEB 1VCBC 2V17H 3J2PA 3LZLA 4P5RA 1C12B 3AT0A 5T1LB 2DH3A 4KHTL 1CBJA 4IIZA 3RY4A 5F7HA 4UTAL 2IDUA 3U4EA 4FA6A 3BUDA 2ED9A 3V4VH 2CE6A 1MHHB 3FYEB 3VJ6A 5KVDL 1PBYA 1KYFA 4WFFD 1IO4C 2HKAA 1KDJA 3AAZA 1HVXA 2IVFC 4QRAA 4ZMPA 5IBLD 5I82A 3N3EA 1NMAL 5HJ3B 1G7MA 4Q9RL 3ESNA 4WO0A 2V3DA 4AEFA 1P1ZA 4AYDC 3GBMH 2NZ1A 4HZLB 1XB6A 5TE6L 1AD0A 1YUHA 4JKLA 4A66A 4N6RB 4NQEB 2X3AA 1PU0A 5B4MD 3AU0A 2VLRA 1ETB1 4IDJL 1M4KA 2Z4TA 3NCBB 5C09A 1E4XH 3GXDA 1EZLA 4GI6A 3DXAB 1X5KA 1FGNL 1UYWL 1Y1DA 2G5BB 1A22B 1BZ9A 2ORBH 3GMPB 3ELQA 2LVCA 3E2HC 4I77L 4ZG1A 3BGFC 5GGTL 3HUJE 2M1KA 4KRPB 5F7DA 4FA8A 1I8UA 1SHWA 2NY4B 5T3ZH 4NKMB 5ESQA 1ZA6B 1WZKA 3OZ9H 1WFJA 3WJLA 3A6CL 1GL4B 3PGDB 4NP4H 1SOSA 3LSOB 5BQDA 3HCVB 3PGCB 4GFXA 4ENZA 4OLXH 3MJWA 3VGBA 4LRIA 5J6HB 1DBJL 2XZAH 2KHAA 1X5ZA 5K1VA 2XA3A 4OU3A 4XO9A 3TN0A 5B21A 4X9IA 1A8JH 4R96B 5GRVL 3RIFF 4BFNA 5KSAC 4HLZG 5L9DH 1LE5A 2N3JA 4U2ZA 2CR3A 3DRQA 3AS1A 4ZAKD 3Q06A 3S35L 3BUYA 1AYOA 1ZRUA 1VFOA 4L0PB 1CLYL 3C08L 1CTMA 4NKQB 2GTWA 3CUPB 4JFEE 3KPSE 5D7JC 3NIFE 2BSTA 2YD3A 5H37G 2NNRA 2Y69B 5DSCB 2UWEB 1DEEB 2AK1L 4Y2NA 1P2CA 3QIWA 3KYOA 4ZZKA 5E08H 1YEJL 5EO9B 2C34A 3RZWA 3BZ4A 5KSVB 5B38A 1M7XA 3AS2A 5E6ID 2F7QA 3J07A 4GFTB 2XVKA 4AG4H 5BUGA 1I7UA 1OLZA 1BQLL 2FB4H 2OMBA 3F7LA 1OCZB 3D8MA 4FADA 1E0OB 2YPLE 3EO9L 5CJ8A 4D2NA 3N50A 4WTXA 3DO7B 1Q0YL 4JRYB 4ADJA 3TYGH 2IADB 4MNQD 3RL2A 3MMEA 2ZOWA 3FQXA 5IV2B 2F1BA 1VSCA 4ILDA 1QNIA 1VADB 3LRHA 4ODBD 4OFDA 1B0GA 4ORZC 5FGBC 2Z9TA 3HPLA 4DO5A 5IJCC 3MRLB 4HKJA 5M7QA 2AQ2A 2P7TA 3D09A 3UDWC 4DPBX 3B9VA 1B4JL 2RHEA 1IC0A 2X38A 2VLJE 5IB1A 4F8LA 4P2OA 1UD8A 5J1AB 5KJRL 2APVA 1HINL 1O6SB 5G2NA 2ZOLA 1G0YR 3GIVB 2YD2A 3SGJA 4ZXBA 2C26A 2KT6A 3TA4D 4FFVD 3DX9B 3K6DA 2BHUA 3HN8A 4JHVA 4KY1H 5DK3A 1T2XA 1YPZF 4P5MA 3WFHA 1HQRA 5FFLA 2CK0L 4FHKA 2ZNWA 2Z31A 4WWKD 3RX7A 5J1SC 3ECUA 1XF5A 1E7UA 1ZLDA 3CHXA 1YEKL 4FQLH 2E9JA 4M9OA 4GO6B 1BDYA 4PJCB 5TDPB 3VH8B 1NGPH 5E2TL 4JNXA 4M4RA 4JDTL 3D69A 3DTXA 4L4TE 1OE3A 1SQ2N 2FT8A 3VRJB 1XIWC 3FUKA 2X4NB 3TBWA 1YNTF 4GPVA 5D71L 3ARSA 5J12B 3EJQA 4L37A 3T0DA 2ZUQC 3TNNA 2Y7SA 3CPUA 5MP6H 5HHQB 3SPHA 2QR0A 4ERSH 1QSEB 1Q9KA 6CGTA 4BFIB 2ITDA 4RSVA 3BI9X 4X6FB 4I4WA 5IB3B 2JB6A 3QXWA 4JQVA 4U6YB 1P4IL 3MOQA 4OCLC 4Y4KA 4DP9X 5KANI 4PWHA 4X6DE 5KTEH 1PLGL 1MWAA 1QFHA 1QVOA 4YSPA 4GS7B 1PSKL 2IGFL 4JFSA 3RTQD 2W60A 2CLRB 1LQSR 1WIPA 5BRQA 4TUJA 1CO1A 2XQBH 5CLWA 2Y1YA 5EU3A 1I1CA 1D5RA 4XRCB 4LSUL 2Y07H 4ZMOA 1LXMA 1VZGA 4KDTC 1R75A 5C3LD 4GMTH 3VJ6B 4LF3B 4P5TA 4IJTA 3FFOA 3VSTA 2N4IA 4LCVA 1AIFA 2J56A 3VWKD 3AAZB 4K7PL 3B9KC 2IDFA 4PRHB 2P46B 1EAQA 2EH7H 4FG6C 3NMEA 1T3FA 1P1ZB 2VDLL 3K6SA 5A7BA 1RIHL 3ARDB 5KSBB 4U3XA 3ARQA 1AD0B 4F24A 3MFGB 1YEFH 3QWOB 4X7TA 2XKNB 5J6GA 5AVZB 1QX1A 1FAIL 4LEOB 3PWVA 4QHKJ 5GGRA 3VRLF 5BMFH 1RP8A 3F7PC 5C09B 3CFKA 4KQ3H 1G1CA 4DWHA 1HJCA 3STLA 3QORC 4NYLA 1W0VA 2OTWB 1NIDA 1KTLA 5LAXA 5AWNL 4BH7A 1EWHA 2D7NA 3QUXA 3X2QB 1QLRA 1H15A 2P44B 3TH2T 1RV6X 3QRFM 3GSNH 3OMZA 3ZKNC 4X80L 2OSXA 4JFOA 5CEZD 1MI5E 1P5UA 5GSRB 2WLIA 4POZC 1KB3A 2UUDH 1IQWL 5F9OL 3I84A 1U58A 4IOIA 3BDXA 4ODUA 4MFHA 1G6VK 2FO1A 4YWGH 2EKSA 3EZJB 4HWNA 3IDIA 4M1DL 4W9ZA 1YN6A 1WTLA 3S3CB 2YKLL 1YCSA 2BFVH 1RULH 2JKWA 4LAQH 3EFDH 4NUGL 3CC1A 4CVZB 2OSLB 3KJ4B 4HJTA 1AY1H 1PX8A 4ZRGA 1TO4A 1FRGH 1AQHA 4XZUA 4A38A 1BWMA 2J1XA 1DLFH 1UHVA 4N1CA 4ONGH 5ID1B 2XFXB 4UT6A 2Z34A 4L4JA 3MV9B 3LOWA 4WO4D 5AZ2H 2FIRT 3LIZA 3LKOB 4GAGH 1BF2A 3F83A 3QNZA 3F7YB 4QHUB 2AJ3B 4QRFA 4GAYA 3P4OA 3KPSA 4P3WA 4BV1A 5IREA 5IBTL 3APDA 1I7UB 2B14A 4MA3A 3T3MB 4PLNC 3QO1A 5I1IH 1A9VA 1XSKA 4JVUA 4E41D 2VIRA 2CSPA 4AE1A 1U3HB 2ZWKA 2NY6D 3DX0A 4J12A 5D7LA 3BLBA 1X5IA 3AM8C 2OMZB 1CDGA 1PLBA 1KBGH 5I6NA 1B9ZA 3WL9B 3Q9PA 3KVPA 1M71B 4IRZH 3GO1L 1UKSA 1RPUA 4P2QD 2K45A 2FYYB 3FQXB 4GW4A 4R7XA 4PW4A 4E0RB 2YSSA 4A7UA 2YPLA 4NQCE 3VG9B 5CN3A 3C60D 4EEEA 5K9OB 4FLSA 2VDLB 1A4KB 1J1PL 1E9QA 4HKJB 2P7TB 5J1TC 3ARVA 1C8PA 3MUJA 5L4IA 3U7YH 3P69A 3RRQA 4R90H 5BVJB 5KSAA 3QDJD 3L4CA 4DPCX 3B5GA 3EYFA 2VE6A 3QG6B 4P2OB 3X1BA 2Z1KA 3NSCA 3KL3A 3TEXA 3LKQB 1J10A 3JV4A 1RZKL 2ZOLB 5D7JA 4RGNB 4KKRA 1DANU 1LO3L 1V7NL 5HHME 3K81A 4GY4A 3KLAA 5HBBA 2CO7B 3O41B 4WFGE 2CBMA 4LASH 1HQRB 4PREB 4XCFL 2VLJA 1WHPA 3FN0L 2VSDA 1I4FA 4EUPA 5FDWA 4JG1L 1XF5B 5E6ZA 2YJLA 4ZUVA 5CSBA 4DN4L 5I6XB 1QWHA 3T9WA 3AXLA 1TNMA 3D69B 3RDTC 2DTSA 3PDOA 3RIAF 1DBMH 4RMTA 5AKSA 2WIMA 4JFHE 4PRIB 3TBWB 4G9DA 1PY9A 4L37B 1USQA 4HV8A 4WTQA 2IH1A 4XN2A 2QR0B 3FUMA 1Q9KB 3M1BB 3U83A 1BVLA 3GSRB 4GI9A 4B60A 2YLHA 4Q2ZA 4L4TA 4QIRA 3T2OA 1U36A 3D3VA 3I2CL 3UL4A 3S8FB 1CU4L 3IDMA 4ZX5A 1QZ1A 4L5FE 1JZ3A 5FGBA 4JGUA 4X4XB 3SYAA 5LQBL 2HJKA 5CP3H 1S5IL 3N42F 3UDWA 2BNUB 1G6RA 4X4ME 5JIPA 5KVGH 4YFLI 4N1EA 1KGJA 2NY2C 3DGGB 3HB3C 1DQTA 3V5DA 3BH8A 1XGRA 1NPNA 1KZQA 1OTSD 4H0IA 5D4HA 1RK1B 2Q8BH 2HA1A 3MCLH 3QJFA 4LLVB 1MJUH 3GLDA 2NXZB 4QJ4B 1GY1A 2LVEA 1I8KA 1UUNA 3FU7A 3FPYA 1T3FB 2VDML 4OT1L 5IT2L 3CC5A 4R26H 1LP9B 4V33A 3K6SB 1T1XB 4YDMA 4YH6A 3WIHL 4CMHB 4PJEA 4U1HA 3V4PL 5TPWH 4V11A 1XIWA 1E3XA 5J6GB 2DQUL 2OP4L 1IAIM 1M53A 4Y5YB 5HPMA 3PWVB 1U8HB 2PMZA 4RA0C 5T33L 3KYNB 4XC1L 3LNGA 1FI8C 2O5YH 4Y4FD 3V7AG 3BRGC 3NAAL 4G6MH 2O30A 1F90L 1QBLH 1EAJA 4AJ0A 1CD1A 4XVUC 1QUNA 1EEYB 1KTLB 5LAXB 1HH9A 2BS71 3FBQA 3LS4L 4NB7A 4XPTL 1EVUA 2OK0H 1QLRB 1H15B 4Z5RA 4HXBH 1AGBA 3AY2A 2A99A 4X9YA 4YC2B 2ICWA 4YSOA 1P5UB 2EYSA 3CMOH 4KKZA 1SGKA 3OLIA 4X7DC 3VDBA 3BAEL 5DMJB 4DGVH 2P28B 1FNEA 1FYTA 2Z1PA 3H7LA 1B0RB 3D52A 3ORJA 2W0LA 2JKRM 4IOIB 3CSPA 1NJ9B 3OB0K 3R19A 5CSZA 3CV5A 5DHYA 1A7OH 2E7DA 1KFAH 4KDTA 3LEVH 2VITA 1IC5L 4IKLA 5D7IA 3ZT7A 3GMMB 3ZMRA 5IHZB 2XYBA 1U8MA 4NQDA 3OHXC 4WGVB 5IESH 2CHNA 1LK3L 3OJDA 3ZY7A 3WAJA 1F1GA 5CIPH 3B9KA 3GSUA 1HHJA 3NG5A 3L5HA 4MQSB 4UU9A 1MQKH 5B1BB 4JK0D 3QNXA 5KBPA 4OV6F 4XZUB 3EJRA 5CAYB 1G6RL 6FABH 1S9YB 2WN3A 4NM8L 3QQDA 2NZIA 2HCZX 4JW3A 3BDYH 4L48A 5JIHA 4N8VG 5TF1H 1D5ZB 4IRSD 3QNZB 3HJ0A 2ZX8A 1S8DB 4UQEA 3QORA 1FV1A 3UC0H 3P4OB 4ENED 1NL0H 5D70H 5C0CD 4UM9D 4MA3B 3MV8D 2Z6FA 4NENA 3U2SA 3ULUC 5KEZA 1IEBA 3JZYA 1Q0XL 1NC4A 3CX2A 1BF8A 2FL5A 2AANA 1NFKA 2NYKA 4GIPD 2Z92A 5I1JH 4HPYL 2GIMA 2YAQA 5E1AA 2UZIL 2DM2A 5CU5A 4N8UA 4C56B 5IVNA 2WQSA 3A67L 4MXWH 4GW4B 4K3GA 3T0ED 1OHQA 3HC3L 1Z3RA 4QJ3B 3QUMH 2VDMB 4XMPH 4S1QL 5E70A 4XNQB 2BOCA 4OZFA 5JHLA 3QXAA 1PY4A 4X8CA 3V4PB 4TUKL 4YSSA 4XMLH 5KSAB 1UOKA 3TO4C 4PP2A 4JRXB 5DD1H 3GNML 4UDTA 2BSBA 5EN2A 4J8RA 2ZCKL 3O2WL 3JV4B 1A0QL 1OARH 3HHRB 2EVHA 2XWJA 1XCQA 2NSMA 2FUTA 4A2LA 1NINA 2R4SH 4OZGE 2APWA 2FZ3B 1MREL 1I4FB 2ICES 2ITCB 1GC1L 4LGRB 5A2FA 4R3SA 1A9EB 3FL7A 4KDWA 2XXGA 4TNVF 3AXLB 3SDAC 1LD9A 3FTWA 2OCJA 3GSXA 4M93C 4YLCA 5HGAB 3LCYA 5IB5A 4UMSA 3ULVL 4MKTA 3DETC 5FUOH 1E4JA 3N91A 5JO5A 5I1HL 2YD6A 3AM8A 1MCRA 2IH1B 4Q9BA 4LNVA 3E3QC 5K69A 3U48A 3MU3A 4LCUA 1C16A 1AGFB 1KB5A 1KGCE 3W37A 2DS4A 1NOAA 4QRQB 1AXTL 2XETA 1OZUA 3P11H 4RRPM 4LVHC 1OAKL 3D3VB 4ZFQA 4PJ7E 2B1OA 1HYSD 2VMFA 3QXTA 2ZZUT 4N3TA 4I87A 1BBDH 5C92A 3UIZA 1T7ZA 2HJKB 1FVCB 3B83A 4JKNA 1SJEA 2C3XA 5B3JF 1G6RB 1PZAA 4NKIH 1J11A 3RVXC 4S2SA 3UO1L 3ZZ1A 2WO4A 4J3OD 4BD4A 3BH8B 1CQKA 4DN3H 4AMKH 1IGMH 1T66D 1SY6A 1P7KA 4KKLC 4CRPA 3FQTA 4OGAD 1JDAA 1S5HA 1H5BC 5DRZB 5LGHH 2APTA 4F58L 3E6FB 4FNLH 4N0RA 4YHML 1MFCL 5IOPA 4NUPA 4ZS7H 3EYUH 1XT5A 3GTTA 4EI6B 1INDH 5GRJH 4O2EA 4AJWA 5JHLL 1TIUA 1KG0B 4WTZA 4PJEB 1RIUL 2P47B 4U1HB 5EH1A 4X9HA 3RDTA 1VF5C 5D4QA 3NFSL 4KTDH 3RWJA 1SUHA 4KUZL 3IKKA 5I18H 2ZUQB 3G5VB 5IFHH 2XG4B 1FHGA 1IE4A 3OKMA 4L1HA 5EU7E 3OKLB 4XNZB 1KBBA 4PJ8C 1UZ6F 3MRCA 2XOTA 2WWOA 4OF7A 4Z5RB 3PJSA 4DQAA 2DB8A 3HLKA 4MJ5A 4J6IA 4X2UA 4H8VA 3G6AA 2ICWB 1VACA 2DWEA 3HKZA 1J8SA 5FM4A 3B37A 5DD3H 4RMWA 1NFDF 1FYTB 3SPVB 1EJOH 2PPDA 2AXGA 2I25N 5CSZB 4YHKL 1AO7E 4B9GA 2OMTA 2ETWA 2VITB 4AITA 2J1YA 1YYML 3RWDA 2XWBA 3EDDA 3WFDH 1KB5L 3FOLA 4NQDB 5DJYA 1WGVA 2AK4B 3LDBB 3OKEA 3VGAC 3GSUB 4UU9B 1A7BA 4JJOA 3NJGA 2OM5A 4ZBJA 2DN7A 1SM3L 5E1IA 4ZTPH 1ZPLA 4XMZA 2IFFH 3ZW3A 1NEZG 1LDSA 5ECJE 1C7SA 5DYOB 2OSWA 5B7MA 3C12A 2AP2A 4KK9D 1TQBC 3LN4B 3D4ZA 4FQQA 5D8JL 2GBUA 2IFGA 4HKXB 1VEOA 2XA8L 4V1DE 3VGHA 2K6YA 1SY6L 2YEQA 2Q3XA 4BH8B 4JMNA 1FV1B 1GYCA 3KCWA 4JFHD 2AJYH 3S3JA 1IGTB 2EDFA 4UIKL 3K6NA 1CUOA 3U2SB 4DO6A 4LBAA 2W9DL 1ZWIB 4JCWA 1IEBB 5FO8B 1NC4B 3HZKA 3TASA 1RMFH 1GS6X 5GGVY 4PJHE 1UB6A 1V10A 2A77H 1I8LC 5DUML 2QPEB 4RFNB 2DI7A 5FGCE 3UMNA 3QYMA 3MHZA 3ZKQD 2DMBA 2B1AH 3ARBD 3P2DA 5KYWB 3KCPA 4GYBA 4OLUH 2VRKA 3SE9L 4C83A 3HMWH 2A73B 1JYWA 2QADB 3G3LA 5TE7L 2LU3A 5K59F 5ICZB 2XRAH 3EDEA 3H8NA 3L95A 3MRFA 4APQB 2BOCB 2APBA 3B5HA 3OAUH 3PABA 4OZFB 4MVBD 3OHXA 5KZCD 2E5EA 1NLDH 3MV7E 4TTDD 4X9FA 3JYBA 4YR6B 1TUPA 3PNWB 1MCJA 4X6CE 5C0JA 4QXTB 3OAZK 4UV4L 3LV3A 4EVNB 3EZ8A 4UDTB 5FLVA 3VACA 3FFDA 4WHDA 4YHNA 3FQWB 4R5XA 1WD8A 4UOZA 2QQLL 4NN7C 4CA4A 2C3HA 1NGZA 3DI3B 3G08A 3O6LL 4KRMB 3S96B 1MCHA 2J73A 3RWEB 4YDLB 5F7WC 1TJIL 3Q2CA 1XHHA 3ATEA 3K8MA 5BZZA 2R69H 2DDQH 2X9WA 5JPMC 2X6BA 3IM1A 1U8OA 3DO3A 1LD9B 3GXUB 3S34L 5IB5B 2FLBT 1P4LA 1QQDB 4LL9A 5I71B 2GW5A 5F6HI 1L6ZA 1NMCB 1QI3A 4OZGA 3LXBA 3KXFB 2NYYD 1G84A 1YMHB 1U8JA 4XNXH 3UZVB 4PLKC 2CGRL 1MRFL 4LCUB 2K7QA 1KB5B 12E8L 3HI6H 4DGWC 3OR7A 2GBVA 4ETQA 5IHUH 4UZUA 4UTAH 3S8WA 1PZ5A 4X99B 3HG4A 5KVDH 4FNUA 2PO6D 1VFBA 5JQHC 1H3VA 5TGBB 2EZ0C 3GBDA 4R7NB 1NMAH 2X12A 4QYOA 4Q9RH 1W0WA 1T7WA 2AQSA 4A6YA 1P6AB 2DMKA 4G7VL 1MG2C 4ZMVA 2FECI 3TO4A 1GOHA 2QGBA 5TE6H 3GSVA 4JAMA 3MRNA 3LRSB 3VMNA 3N0AA 2QSQA 5AW7B 3D9AL 3VXPB 3HG1E 5EZJB 1XEUA 3TFBA 3DX7A 4TUOA 4N8CL 4IDJH 2XWXA 5IVZA 4PYHA 3UG5A 1TPXC 4Q9CA 3T8VA 1NKGA 4ONHB 4J7RA 5I5MA 1T5XB 5D2NC 4O2EB 1FGNH 1UYWH 3QDHA 4OLEA 4DKEH 4I77H 3LKPA 4RMVA 3SDAA 2C4FU 5GGTH 3C9NB 3KWUA 1BJMA 1JPST 2ESVA 1QW9A 3C09B 5J6SA 5E4IA 4ZO6A 5A7EA 1GGBH 4DP6X 1B2WL 1DVUA 3D33A 4P23D 1BD2D 2A9NH 2M2DA 3TTSA 4OD3L 3NJNA 4L1BA 2ZYIA 4ZUSA 3I75B 2IC2A 2F8OA 4XP6L 2B1HH 1I1FA 1MNUL 4QY8B 1RPQA 1R46A 4FAAB 3K1DA 3FONB 1OTTD 1DBJH 4TLSA 5I8CA 4P99A 4J3BA 4I1RA 3NPZB 3MRCB 4PJDF 4H2CA 3V79C 4KZCA 4FTVD 4MJ5B 4QYAA 5J0BA 4FJZA 3IJSB 1FFPB 4GW5B 5M94B 5EOCL 1VACB 3GLAA 3IPBA 4NRXA 4UUJB 1A3ZA 3S35H 3ULUL 1CLYH 4G59C 1RZPA 3NDYE 1ZGLM 2AXGB 2IGLA 3FAWA 3HB3B 5G5DA 1EVTC 3K91A 5D2NE 3WN6A 5HY9B 4F57L 2AK1H 5IW1A 2IEPA 4ZUUA 4ZQTA 4ICXA 1JBJA 2WVTA 5AKRA 3RWDB 1A6TA 1YEJH 4BZ2A 1OPOA 1H5BA 2K8MA 4E68A 2ZTBA 1RFDL 3CNKA 3OKEB 4D3CL 1YEIL 5E4EB 3Q1SL 3BPLC 1XR9A 2OCCB 1AO7A 4BUHA 1BQLH 1MCOL 2GEEA 3QDMD 3PQYE 5LXGL 4TNWK 2ZKHH 1H19A 3NJJA 5C0FA 1CS6A 3H9SA 3EO9H 1YC7A 4BQ8A 1Q0YH 3ULAB 5IB2B 4HS3A 1DQLH 3GD1C 4HCFA 5E94B 1LO4L 2Y25A 3W39B 3MUGB 1P7BA 4UQ3B 4XE5B 1II4E 3QEHB 4K94L 4LVEA 4NQUA 4QF1A 3ES6B 3US0A 4PJ8A 2H1PH 3MUY1 2B08A 1KGCD 2VDKL 1B4JH 1X5JA 4PI2A 3NIDE 5D5MB 5FV2A 4H8HA 3KLLA 1F18A 3BIBX 2NX5D 4NUMA 1AANA 1CLZH 1DQDL 3SKNA 4PMFA 3MNZA 2D7PA 3KCPB 1OGPA 1EZSA 1BYPA 4M00A 1CPUA 3EOTH 3X3GL 1LEGB 2HLAA 3HIZA 5I23A 4QHMA 2ZOTA 4PJHA 1NM4A 3AXIA 4ALAL 2LOEA 5ABZA 4AM0B 3W0WE 2CK0H 3OHXB 4MNHB 3PREA <