The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
7
|
sequence length |
78
|
structure length |
78
|
Chain Sequence |
b'ATGSPVAECVEYFQSWRYTDVHNGCADAVSVTVEYTHGQWAPCRVIEPGGWATFAGYGTDGNYVTGLHTCDPATPSGV'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Alpha-amylase inhibitor Z-2685
|
molecule tags |
Hydrolase inhibitor
|
source organism |
Streptomyces parvulus
|
publication title |
The high resolution NMR structure of parvulustat (Z-2685) from Streptomyces parvulus FH-1641: comparison with tendamistat from Streptomyces tendae 4158
pubmed doi rcsb |
total genus |
7
|
structure length |
78
|
sequence length |
78
|
ec nomenclature | |
pdb deposition date | 2009-02-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01356 | A_amylase_inhib | Alpha amylase inhibitor |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Alpha-amylase inhibitor |