4ODSH

Unliganded fab structure of lipid a-specific antibody s55-3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
219
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAGSGITFSGYGMSWVRQTPDKSLEWVALISNGGSYAYYSDSVKGRFTISRDNAKNTLYLQMSSLRSDDTAIYYCARHKGLRGGTNAMDYWGQGTSVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S55-3 Fab (IgG2b) heavy chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odsH01
2AEWA 1OTSD 3D85D 1I7TA 2NY2D 5JOFA 5GRWA 1NCCL 1AGCA 2CSPA 1OM3L 4OD3H 2ZG1A 1N6QH 4PJ9B 3MXWH 2IFGA 4LHUB 4DGYL 3FMGL 3PE9A 2R29L 4UT9L 1U8MB 1RJLA 5MP6L 5CCKH 3PDOA 1RZKH 5GJTH 1YMMD 4X6CB 3MBED 4GMTH 2XN9D 1RIHH 3EO0B 4KJYA 2JCCA 3AGVA 5DRWA 5E2WH 1J7VR 1IEAB 2NYYC 3TV3L 5MEQB 2NY5H 1RZIA 5FYJH 4OCLC 3R8BB 1X4ZA 3V4PL 4U7KA 2AW2A 1GGTA 4WW2A 5KVDH 2YD1A 3DURB 3PP3K 2BSTB 5DHVA 4OF7A 4NYLA 1J0ZA 35C8L 2YOCA 1DQML 2QADB 4WW1B 2PYFA 2CKBA 4NCC2 1N2RB 2ARJQ 2EH8H 1A5FH 2P8MB 2VZUA 1WSST 5I1HL 5ISZD 4QHNA 3MLPA 1ONQA 4AM0B 2EE3A 1EZVX 4YBQD 3Q5OA 3B5TA 3QUXA 4MNGA 2RCSL 2OTPA 5A1AA 2FB4H 5D71L 3DYMA 1BFOA 3VXOB 3RUGF 1MREH 1OSPL 1DCLA 1IM3B 4W70A 3D0LA 3KS0H 4OLXL 4XX1E 3MJGX 1JPSH 4UINH 5D7JA 5CILL 3WUWB 5GHWL 4D9RE 4IRSD 4TSCH 2ATKA 2DQHH 4GMSH 1U91A 2KQNA 4OCRH 5EUKA 3CX5J 5IM7B 3DRQB 4WI7A 2P42B 1MJJB 4JLRB 4CMMA 3ZKND 1CGTA 3JWDH 1R5WB 5C0AA 4PB9L 2VXTL 1LO3H 5LJYH 1JGEB 1IC1A 3HAEG 4KGLA 1IEBB 4M43L 1R0AL 3P30L 4K7FB 1P7HL 2APFA 1FYTA 3TM6A 2Y5TA 2W65A 1DUZB 1MCEA 5ITBH 1QVOA 3BESR 4HIIB 1EXUB 3BGMB 4X6FB 4NN5C 2EICA 1CQYA 3H3KA 4OSUH 3EO1B 3CFCL 1T1XA 1Q9KB 2L4OA 3AB0C 4XNMB 3KNBB 3KPRB 4J1UB 2NY6B 5H37G 4P2RA 2BVQA 4QRRD 1K8IA 1T7YA 1ADQL 4RMSA 3VGFA 3VD9A 3DXAE 2DB8A 3RNQA 3DBXA 5ERWB 5A2FA 2R4SL 4CVZA 5L2JA 5LXGL 5CKAA 5ID1A 1NJ9A 1ZWIB 4DGVL 2A6KA 3VXRE 4IIQB 3HNVL 3MRPA 4R7DB 2J88L 1AJ7H 4JFPA 4PYHA 1KXVC 1JWSA 3TNMB 2VLJD 3QNYB 3TYFA 3DVNB 5I73B 1RZ8B 5D7LA 3G6AB 5EIQA 2X89A 4S1SH 4RQQA 2E9BA 1UWGL 5LCVH 4S1DC 3U0WL 5B8CB 1TETH 5MEPB 4X80L 1MCWM 4XP1L 4JG1H 2GUOA 4KJWC 3RWCB 1LMKA 3FO2B 4RNRA 4OZIA 4XCNA 3UTPE 5JO5B 4YK4C 4MNGE 5C0RH 4Y16A 5AAMA 3HPJA 1JHTA 2R0KH 3RWHB 3UBXG 4P9ML 3T0EE 1A0QH 1LEIA 1FNSL 2FZ3A 4R0LB 4XNUH 1I3RB 3U7WL 3WFCL 2YBRA 4I0KA 4E41E 2PF6A 3SCMA 3LN5B 4G8IA 4M93C 4ODWA 4HG4J 2Q1EA 3EYFB 4EIZC 4HIHA 4PBXA 2A6DA 1EFXB 5D7IF 4AENB 4BFIB 3P9MA 2WBJA 3NPZB 2A77H 4FQCL 1TVDA 5T3ZE 1QFWM 2P5ED 1ZT1B 3SGDI 4AQ1B 3K4ZA 3GGWB 4ODXB 4POUB 3VXPB 3TP4A 4O2EB 5D7KD 1U58A 5JW3H 4LGSB 5C0AE 4X7EC 3JWOH 3B9VA 1HEZA 3RX5A 4F7EA 2B5IB 1BOGA 4OFYA 1ZA3B 2I26N 2JIXA 2NTFB 1RUQL 5L7XL 3SDCB 3P77A 1Q1JL 4FQXB 3E2HC 4Y0GA 5JXAH 4XPGH 4RCAA 5I2IB 1KLUA 3RY5A 4Y19B 4J6RL 4NKDA 3VFMA 1UENA 2X6MA 1MAMH 5F1IB 3VWJC 2HKFH 1LILA 3MLXL 4Z7WA 2Q76A 1I8MA 2DRUA 5FK9B 5DJDA 1X7QB 2Y23A 4ZOCA 4X9IA 1B2WL 5A40E 1B0GB 2HFFA 1ZT7A 4WTZA 1FHGA 2X9XA 5EU6E 4FFWD 3K80A 1LP9A 2VLKA 2AK4D 5C2BH 3GIZH 1AKJD 1WCQA 3F7VA 3LQAH 3QIUA 4PJFA 5DQJB 1GC1L 3DX7A 2ADJA 3PHOA 1V7MH 5F7WC 3TN0D 5I8CA 2ZCHH 2VXQL 3UJJH 4G9FD 1BQHG 3HR5B 1FIGH 4HG4K 4QRSB 5DMKA 3X3FL 4Y89A 1VHPA 1NFIB 1VERA 2GIYA 2VAJA 1UXSB 1JRHI 5T1LB 3TIDB 1C16A 3CVHH 4JFFD 1WFOA 3C6LA 3X11B 2F58H 5C09B 2X7LA 1NEZA 3RGVA 3NTCH 5EU4A 3ZDZE 1YPZF 4GKZB 5KSVB 3FB8B 3D39B 3T1FA 3LB6C 2IANA 3STZB 4TSBL 2NY1D 1DLHB 4LCYB 1WWCA 1T22B 5F96H 4OZGB 4KRPD 4DCQB 1ETZA 1WCBA 5MERB 3O9WC 3ZHKA 1YECL 1UEMA 5KS9A 3B9EA 1ZLWK 5I1EH 1NCUA 1YNTA 3TBVA 4OB5H 5J6HB 2OSLA 3DIFB 4LLYB 4HK0B 4WEBH 4ELKA 4P2OC 1V5JA 4R4BA 5CD5C 1XF4A 3QJHA 2V17H 3VXUB 2R1XB 1ZHNB 3VFTA 1N5YH 5DQDH 3P4MA 4JFQA 5KVGL 1I3GL 4HIXH 4NZRH 4ELMF 2AABL 4K2UL 1OQOA 2G9HA 2G2RB 5J3HC 5EBMA 4OZFG 3QULA 2UZXB 5I1JH 1BVLB 3ZYJA 3OJ2C 4OTXH 3RIFK 3OJDB 5D8JH 1A3LH 4O51A 5GGRB 4N0CD 3RWGA 3VFPB 2VE6B 4U6HB 3FAWA 2XG5A 3MRQB 2VLMD 3OHXB 4NKOA 2JELL 1DQDH 3G9AB 3L3OA 4YIQB 4Z76B 4NJ9H 1ED3A 5FUOH 1NBZB 1G6RB 1TQBB 5C1MB 1ND0A 4Z7VF 5DDHA 1KBGH 4F7TA 4PRBA 1AHWA 2J6EH 3M07A 1HDMA 1JTOA 1NAMB 4FP8H 4AY0A 1RJYB 1NGZA 5KSAA 3I6GA 2WWMC 3QXTA 2B4CH 4PRHD 4Q0XL 4EN3C 3DRTA 1JGLL 1WC7A 1FYHB 3WHE1 4PJDB 4EZMA 3QIBC 3QDGB 3OKEB 1YUHB 1XGRA 1KGCE 4MXWL 5FOBA 4DZ8B 4NC0B 3TA3D 3ZE1F 3QCUL 4P4RA 1P9MA 1HOCA 1TPXB 1OGTA 1NMCB 3PWPB 4Q74A 1LO5A 4OFIA 4U1IB 5TFSL 1AE6L 4S1RL 4Z95H 1SQ2N 3LDBB 4UQ3A 5IFJB 1X44A 4UV4H 3QEHB 1XAUA 5D6CA 4OI8A 4YHOL 4U05A 4ZAKD 3WFDL 5J6GA 4ENEC 5GRVL 4X9GA 4XMKH 5E94A 2PW2A 3VXME 3H9SB 5CEZL 1SY6L 1ITBB 5FB8B 2GJZA 5GZOC 4JHAH 3IFNH 3O2DA 4ALAL 1A7QL 2ZOKA 3EDKA 5IP4A 1UKQA 3SKOB 1CR9H 5DQ9A 4F3FB 4BA8A 2VISA 2FLRT 5D9SA 5FYKE 4QCIA 1B6UA 3DHJA 5EO9B 2BSSB 4XPFL 3S36L 4U2ZA 4Z7OE 3X12B 1HQRB 3CFBA 4U0QB 1FNFA 5DRZB 4JY6A 3RJQB 4ODSH 3WD5L 4GAGL 4Y4KB 4OGXL 1JNLL 4PB0L 3VCLB 3HB3C 4LHJB 4QKXB 5HJ3A 3BKYH 1OAZL 2FBJH 3HAEH 3MJ9L 12E8H 5DGRA 5CJQH 4PTTB 4L9LB 3GJFH 3U82B 1JZ3A 1RQ5A 1FDLL 3MLRH 3HS0B 4M7JL 1JNHB 1OLLA 5DR5L 4JJHA 4ONHA 2ZUWA 3ZE0F 4XPBH 5FYLE 4PS4L 5H37H 3O8XB 1LGVA 1HWGB 1DQQB 3DSNA 3GMMA 4GLRI 5IB3B 4LAQL 4L3CB 4DGIL 3MLTA 3CFKB 1LK3L 1U8KB 3MZGB 4G7YH 1T2QL 2NY3D 3KPQA 4I48B 5BV7L 2PCPA 2VXSH 2VRAA 4IRJC 4YWGL 1D9KC 4DJMA 3B9AA 3MV8E 2DWEB 4IDJL 4DN4H 4OGYH 3G6DL 1FZOB 3BE1L 4CDGC 4S2SB 5CIPH 4JPWH 3MOBL 1NMAH 2AS5M 1SM3L 4QOKA 2E9WA 1U36A 4R96A 2EECA 1BJMA 3RY4A 3V6OA 4WFFE 3U0PA 3FRPA 4YNYA 3VI3E 4PJHF 5ILTH 2VIRA 3GSQB 3DMMA 1HH6A 3KPMB 2GJ6B 1AY1H 5IBLC 5MENA 5DHXB 2FD6H 4MYWB 1RK0B 3MGTA 3QXDB 2YA1A 3MCG1 1EEQA 2PO6D 1MCPL 3HC4L 3LZFL 3NBNA 2OK0L 2CMRL 5CKGA 4FZEL 5MHSD 4QRUA 4JFOA 4TVSa 5EZIL 2NW3A 4IOIA 3SGJA 5KN5B 1S9KC 3ULUD 3KWWB 2DQGL 1C08B 4KH2A 4JQIL 4X8JB 3GBML 25C8H 5C0EA 4HHAB 2FECI 1WAAA 3B9KD 5DFVD 3R0MA 4KGJA 5ECJE 2R4RH 3EJZC 1G7QA 2BNRB 4JDZB 2F54B 5DFWH 1BQLH 5TE6L 2AXFA 5D5MA 1G9EA 2VZVA 5A3ID 4FN0A 4LBEA 5F8QC 1M7DB 2P24A 1K2DA 1LNUA 5FGRA 3VDBA 1UZ6E 3CSPA 4FXLA 1JMZA 2I24N 3K8LA 4PJ5B 4WJ5A 5CZVH 3MLYL 3PP3H 3PQYE 4MCYA 1INDH 5BO1L 4PLKC 1ZK9A 1QKZL 4XX1G 5JIPA 2NXYD 3QAZB 2R0WH 4TNVK 1FNLA 5E5MA 5IQ9A 4KPHL 5CMAB 4Z78B 1BZQK 4PIRF 2CPCA 2IQAA 5ALCH 4NO5A 1HKLH 2ZCKH 1I1AB 3GMLA 1UZ8B 4Q2ZA 3FTGB 4MJIA 1VADB 4LVEA 4R2GD 4P5MA 3RTQC 3DVIA 3UMTA 4HKJB 4KKNA 4QRPD 3BDYH 4G9DB 1GJIA 1FVDB 4WY7L 1I9RH 2NY7L 4HWZA 1ZMYA 5HD8C 4YAQA 5KOVC 3RIAF 2HH0H 4WUKL 3GDBA 3VFSB 1IAMA 4G6ML 1KEGL 3BD3A 4GH7B 2PYEE 2NZ9C 1DEDA 4WTWA 5EO0A 1C5CL 2GFBA 4ZFZA 3EYOB 1NGWA 2R15A 4PREB 3RX8A 2NY6C 2AJ3A 3UX9B 1OGAD 1RHHB 2Q7NA 2JB6A 1R6VA 4U31A 5MENE 3SGKC 1CICA 3N9GL 5L8JB 1ADQA 4HW6A 4WI6A 3ARGC 4TUOA 4Z8FH 1IKFL 4DUWA 2CLRA 1DUYB 4KK5D 3C87A 3MJ8B 5KJRL 3DOSA 1UB5B 1WT5C 4TOYH 2N56A 5I73C 4RFOH 4BSWA 3X13B 3PGCB 2P5WE 4FQQA 5T1DH 3QXVA 1WGOA 4JZOA 3HI1A 4G6KL 5KSUA 2IG2H 5IMMA 3W5NA 1YEKH 1NGXB 2HTLC 5E8PB 3L3HA 4TPRH 2VXUH 3NAAH 3LQMA 4PLJC 4RIRB 4ORZC 1J5OL 1XGQB 2BHZA 2DKSA 4LSRH 3LSOB 1BIIB 3F7QA 4L8CB 1OPGL 5KSBB 5C0NC 4L3EA 1T5XB 1AQKL 4UAOB 5JR1H 3RWFB 3VW3L 3ZKXC 5GIRA 3D0VB 4Q6IA 3UP1A 3FT2A 4Z77A 1XT5A 4FNLH 3L6FA 3HG1D 1ORQA 1K3ZA 1G7IA 4QHUB 3SDAB 3HUJE 2VR9A 1J1OL 3BQUA 3NPSB 1AXIB 2VAAB 2FRGP 2X05A 1NC4B 4ZO8A 5ITFA 5JA8B 3OKMA 2DQUH 2JK5B 2KBGA 3GMOA 3VFOA 1G1YA 2CD0A 5DUBB 3P0VH 3REVA 1R3KA 1ZA6B 1HINH 3VRJA 2AV1B 5EOQL 5CUSL 5FUCC 2B5IC 4BZ1L 2DQJL 4MD4A 3ROOB 1J8KA 4Z0XA 3SDCC 4M6NL 1FQ9C 4F33B 3LPGA 2WZPD 1NUFA 3IJSB 1HKFA 3ULSB 3WLWC 5EOCJ 2D7TL 1AI1L 1E6JL 2H9GB 1KOAA 2GI7A 3FB7B 2H32H 1S8DB 1YEIH 3QR2A 3TO2B 5IW6A 5FCUL 1YEDA 4FQLL 3HE7D 3PWNB 2DMCA 4UNUA 2R2HB 4H8WH 5FCSH 4HIJB 1JPFA 4P5TC 3DV6B 2A1WH 3LPWA 2W0PA 1TJIL 2E7BA 2OL3L 3L3IA 3MA7B 4P9HC 3IAGC 4CVUA 3WFHB 1WFUA 5FGCE 2HP4A 4MZ2A 4GBXA 1RJZB 4P2QE 4OQTL 5FA4A 4CN6A 2FX7L 1GAFL 3VXSD 2GK2A 4WENB 3X3GH 4NO3B 2Y9RT 3V5KA 4A2LA 1AD0B 1FAIH 4XP6H 1R3HA 3L5XL 3D85B 4Q9CA 2NY2B 1AFVH 1T83C 5IK3B 1HHJB 3TT3H 5IV2A 4X8XA 1IC4H 1UM4L 4KK6D 5F21B 2XICA 4S1QH 2X9YA 4S0TD 4PJGB 4PJ9A 4ODUB 3NCBB 3OGCB 4QNPF 1P2CB 5BVJA 2FEDD 1B9ZA 5T33L 3OKNB 1YMMB 3MBEB 2XN9B 5C9KA 1P69B 4WO4D 5GISL 4HUUA 4WUUD 3C9NB 4NQEE 3SEPA 2DWDB 5DMYA 2GTZB 3BP6B 4NP4H 5TDPB 4X7TA 4ONGH 5TE7L 4L4TE 3MRRB 2V7HB 3O2WL 2OBGA 3HCVA 4K3JH 1MHPL 4V1DD 3DURA 4TQEH 3ALWA 5B4MD 1ZTXH 2BSTA 4M6OH 1LEGA 4LVOB 4ISVA 1TDQA 3TWCL 3MA9L 4WW1A 5ISZB 3U6RA 4PJXF 3PIQB 4NQCD 3SBWC 2P8MA 3BPLB 4YXHL 5CJ5A 4YHML 4XHJD 1PD6A 1AGDB 3MCKB 1ZLWH 5HI5D 3X17A 1KPRB 1GGCL 4BH7A 5FA3B 4NFCA 4O00A 5DLML 1EEZB 1YQVL 2HJKB 3WIHL 3VXOA 3MV9E 1OSZA 4ZPVB 4ZDHB 4GAFB 4ZQKB 1AO7E 5E1AB 1IM3A 2H26B 4JFDE 1ZLVK 3CLEH 4IRSB 3L3KA 5INDB 5HDLA 2VR4A 3EW3B 4OFDA 3FN0H 1A4JB 3GRWA 2UWEE 5E2VH 4AEFA 1P84K 1EO8H 2NX5D 2XZCL 1S7XA 2Q86B 4OBRA 3PABB 3FOMA 1T4KA 3NGBB 4IOSD 1DANU 1TVHB 1KG0B 4FXGB 1MVUB 1H15A 3IVKA 4LCWE 4XHQA 5I1IH 2HT3D 4Y4HA 3JTTB 3IRPX 1QFPA 4GT7A 1JGEA 4G7VH 4IMLA 5E9DD 3QEGH 4LP4A 1UJ3C 5JW4N 4K7FA 3NCEB 1JRHL 1RK1A 3SE4C 5F1OB 1DBMH 4LK4A 5FHAL 2EZ0D 2YD9A 4HLZG 1DUZA 5GGVY 1R3IH 1TPXC 1EX0A 3FO0H 3RY6C 4IRZH 4U0RB 1EXUA 1NMCC 1WZLA 2R8SL 4X6FA 4HGKC 4MAYC 4PRAB 3EO1A 1NAKH 3MOQA 3VG0H 4K7PL 4FQHA 1Q9KA 4HWNA 2MQCA 4WV1B 4XNMA 4QRRB 2PUQT 3KPRA 4J1UA 4Z0BL 4UQ2B 5DD0L 1SVZA 5B38A 3AUVA 4KAQL 3ARXA 5HYFA 5EZLA 5C0JB 4I3RH 3IDUA 1I85A 5F9OH 4N5ED 4CL7A 2X1QA 2IBZX 4OI7A 2B2XH 5TH2A 4X6BA 2VLJB 5JQ6L 4RFEB 4M1CD 4X6CE 3UYRL 1NCAL 1NPUA 5CHNA 2HT2C 2X1WL 1A7NH 3V4UH 4KK8C 4Y8DC 2ORBH 4KTEL 4PJ8D 2ADGB 4XAKD 2QQKL 2I9LA 1ZANH 3ECBB 1ZHBB 2YUWA 3BZ4B 4TUJB 3S96A 2YD5A 3LN4B 4NDMB 5HHXL 2ZOLB 1Q0XH 2EXYD 4EQ3A 1EHLH 3CSGA 3K0WA 5MEPA 1RVFL 3RWCA 1EEYB 1U3YA 2CH8A 4PJAB 4UTAL 4MB3A 3Q6GL 5F1NB 2DI7A 3KYOA 1GGBH 4JAMA 1PKQE 1PY4A 4OZHF 4LARL 4LCIL 3TPKA 4F7CB 3NOIA 2X41A 4YQXL 1CLZH 1CS6A 1MNUH 1VA9A 4PY8J 4FQPA 3T8XA 5EC1B 1I3RA 4JKPH 4X4YB 4HBCL 3TH3T 1C1EL 1U8JB 4OLYH 4OD2A 1EFXA 1KJVB 2P5EB 5BXFA 4AENA 3SCMC 4BFIA 2EH7L 1K8DA 4P23D 3UYOD 1X5JA 3OL2A 3L3GB 4AMKL 1P6FA 4RAVB 2EDYA 4YFEA 3WL9B 5F1SA 2WUCH 4MWFB 3LPFA 1G7LA 4MCZB 2ITDB 2XZQH 2YSSB 3BKCL 1KTLB 1ZA3A 5JUEL 3ZTJG 4KC3B 4ONFL 2LU4A 3ARFD 4FQXA 2DD8L 1QFWI 3MO1B 1HXYA 3OQ3B 1JN6B 5I2IA 5IBTH 4Y19A 4XI5C 2CKBH 3RIFF 4JM4H 3F62A 3IDJB 5A43C 4GXUM 1T6WA 3EOYG 4MAUH 5F1IA 3OGOE 2G60L 3ARRA 1IAIM 2XPGA 3DO7A 3TBTB 4X4XB 4PP1D 3QHFL 4XRCA 4YDKH 3S35L 4NWUL 4Z5RB 1KACB 5FXCH 1X7QA 4L8DB 3GM8A 2EDLA 2W9DL 3QZWB 2R23A 1XGPB 2AK4B 3WYRA 1AKJB 1FNEA 2XNAB 3N85L 1H3GA 3WKML 3FT3B 5DQJA 3TN0B 1K6QH 5EFIB 3O6KH 4G9FB 1NBYA 3BJ91 3BHBB 1U3HD 3AROA 2APTA 3VFUA 1KC5L 5T3ZH 2BFVH 4QRSA 3H9ZA 1AQDB 4N8PA 3CZFA 4PYGA 3QIWA 4EI5A 1FC1A 3EUUA 4LEXH 1H8OA 3B2VH 2CLZB 1UXSA 5J1SC 4JFFB 4LEOA 1FRGL 5DRNB 2JF1A 3EYUH 1AR1C 5IGXL 3RDTA 4L1DA 5C09A 5IVNA 1WIUA 2NPLX 4KVNH 1BEYH 3ALPA 3MBXL 4JHWH 1QA9B 1W72L 5IHUH 4GKZA 4KKBC 5KSVA 1MRDL 1GOHA 1HHKB 2NY1B 3D39A 1N8ZA 4GAJL 4K94C 4HX1B 4JZJC 1QPPA 4OIBA 1RMFL 4KRPB 5GGRY 4ZNEE 4LCYA 1A6TB 2JJTA 2XYCA 1IGYA 1T22A 2M2DA 3CDGB 4QF1A 5GXBB 3EO9H 5J57B 2GSIA 2QSQA 3QCVL 3EFDH 3QUKB 4LDLB 4K3HA 3UTTD 3CFJB 5GS2D 2ZWLT 1SBBA 3NFSH 5KVFL 5J6HA 1I8IB 2CRIA 2NCMA 1OARL 2YD2A 3DIFA 2ESVA 4TRPH 2R1XA 5CBEA 3I02B 2KL6A 4H1LA 2RB8A 1V7NL 1QSFA 4J7RA 5DK2B 1HQ4B 3RVXD 1V05A 3T77B 2CJUH 2VDLH 1F2QA 5FO9B 4Y19E 2JCCF 1Q9OB 1C8PA 3MFFA 1XR8B 1G84A 1U6AH 1DBJH 3OJDA 4QTIL 1KCVL 2AJUL 3VFPA 2VE6A 3VFRA 3EDDA 4JKKA 1PFCA 4WW2F 3OHXA 2XTJC 2VLRD 1RUAL 3IKCB 1GL4B 1A6WH 2MMXA 1QOKA 4YZFE 2A9ML 4CAGA 3T08A 4C55A 2H2SC 2V5MA 3BMVA 5SX4H 1NAMA 4PRHB 2ICEB 2Q8AL 1DQLL 1MCDA 1FVEB 2F5AH 3KJ6H 4QRTA 4MNQD 5I30H 2FECL 1N5AB 3O11A 5DJ8A 5BRZA 3TA3B 3OKEA 3DXAD 3FO1A 4IS6A 1JFQL 2B0SL 3NFNB 3QWQB 1IT9L 1FFPA 1WTGT 3BEWB 5DD3L 4OJFH 3PJSB 3HZMB 3OF6A 3PWPA 2FO4B 4U1IA 4YHLL 4NNPL 4Q9BA 5K59F 2ATPB 4OBSA 3SJVD 5F89A 3ZHLA 1XGTB 4ZAKB 2OI9B 3HMXH 2F74B 4XAWL 3D18A 3K81A 4N9GB 3UJIL 3D39E 4YEFA 2ZJSL 4RBPK 5GS0C 1C7SA 3LH2L 4OZGE 3ZYZA 5JNYB 3QUML 3UTPD 1HILA 3V0VB 4KDVA 4YHNA 1TZGL 4M3JA 3ULVE 2ZUYA 5CEXA 3QPQC 4O9HH 1FG2B 5JXEA 1ZSDA 5DD1H 5DJXB 2VDMH 1NCWH 4LU5L 1T1ZB 2P43B 4Y4KA 4JDTL 5CD3A 1ZGLB 3RJDA 4XCYB 3VXUE 2F19H 1I1RA 5DMIL 2I9TB 3VCLA 1F4YL 1F58L 4E41D 4U6YB 2ZNXA 5E95B 3PHQA 3QEQE 2HTKC 3MRCB 4HH9B 2A9NL 3DUUA 5EUOB 4HLZH 4HAGA 2FL5A 4GG8A 5IJVA 4PTTA 4D9LH 4L9LA 1HYSC 2AEQL 5IMOA 1U8PB 4HEME 2BMKB 3GZKA 4OD3L 5HGBA 3U9PH 1JNHA 3NCYS 2DQCH 1J0IA 4PGJA 5J1AB 5IMLB 2QQQA 3O8XA 1VDGA 4TNVF 1WBYB 5HDBF 3RWEB 5I16B 1MLBB 5T3XL 4H88H 1RZKL 2Z35B 5IB3A 3N06B 2CUMA 4G6JH 2NY3B 4L3CA 5GJTL 4GMTL 2E7LA 1RIHL 1U8KA 5ACZA 4I18C 3VRIB 4GQPH 6FABH 5I15H 5E2WL 5CLWA 2CIKA 4LKCB 4OF8A 2NY5L 5DSCB 5I71C 2X4RB 5C0BE 2O5ZH 3L3JA 4PJDE 3QDGE 5KVDL 2OL3A 4ZO7A 4B7IA 4FRWA 3RKPA 2J5LC 1A6AA 4JM2A 4WDIB 5BV7B 3OX8A 4FABL 1LEKA 2RAMA 3SDDD 3U48A 2NR6C 3IDYB 1NFKA 4PJEB 4Z7UA 3QO1A 2G5BA 3MMEB 1CVRA 5BJTA 4BYHA 2VLLB 1FPTL 2QQLH 5IT2H 2B39A 4FTVE 4I0PA 1S78C 2FB4L 5DC4B 3TZVC 1IFHH 4OT1H 1MREL 1T0MB 3GSQA 5KTEH 3H9SE 4OIIL 3KPMA 3WO4B 4H20H 2EYTA 4X6DE 1JPSL 2PO6B 4LQFH 4UINL 5F7DB 3K4DA 1CE6A 3QXDA 1KIPA 4TSCL 5CJBA 5FYLH 1Q38A 4HKXA 3KG5A 4NKMA 4OLEA 2Q87A 1FFOB 2DQHL 2APBA 4GMSL 5JA9A 5KN5A 4OCRL 1P7QA 1X5ZA 1C08A 4MS8D 3BFOA 3B9KB 4X8JA 1INEL 2V5TA 5LQBL 3P9LA 1BVKA 3JWDL 3OXRA 5C6PB 5IB5A 4GRMB 2DF3A 3WDIA 3WIFA 5C08A 3MRGB 2OJEB 1UG9A 4GRWB 4ZFFA 2BNRA 4JDZA 2E7CA 2F54A 2ZZUT 3KYNA 1QSEA 5LBSH 5EOCH 2HJFB 4HUWB 1MJ8H 5BZWB 3BPLC 3HE6D 4F9PC 2FBOJ 2OJZH 3IB4A 5C70A 5EPMB 1LP9F 3I9GH 1M7DA 4PJFF 4JCLA 1IGJB 1A7PH 3QWRD 4NN7B 3RA7H 4NUGH 4J3TA 4PJ5A 4NHUB 4KFZC 2NXYB 3IDGA 5F7HA 4YHZH 3R06B 1JK8B 1MI5D 4K07A 2PXYC 2Z92B 3DX9B 5J89A 4GUPA 1C5DA 4JPKH 1AJ7L 5D2NA 2YPLA 1LD9A 5E08H 3SKMA 1QTYT 3C60D 1A1OA 1BAFL 1DVFD 4QXUH 4R2GB 2QSVA 3FTGA 1VADA 4QRPB 1XF5B 4HKJA 5B39B 1H9VA 1P6AB 4NSKA 5JW4Q 1CDHA 2HKHH 1X5AA 4G9DA 3V52H 1ZLVH 1KB5B 5GGSB 2AEPH 5LCVL 5IHZB 5KANI 3S97C 2J1KA 4WGWB 1AC0A 3NZHH 2YEZA 5SWQA 1YN7B 2WINB 3U4EB 2R2BB 4PTUB 5C0CD 5C0RL 3WUZA 2X4QA 1PQZA 4MA1C 4D0DB 3DETD 3K8KA 2F8VA 3EYOA 2NY4C 2R0KL 2HVKB 2UUDK 4PREA 1OGAB 1NCBH 3O6MH 1U8LB 3LD8B 5FKAB 4XTRD 2VC2H 2GJ6E 4LHUG 2OR8A 4XNUL 2FHBA 1N6VA 3ZYOA 3DPBA 4WTXA 5K93A 5J12B 2XKSA 2BNQE 2A6IB 3CIQA 4MDIB 2ILLA 5FV1L 1DUYA 2KH2B 4P3WA 2A77L 3L7FA 4U6VH 3W0WD 3CU1A 1RZJL 3HI6H 3VXMD 3O41B 1U3JA 3O45B 2ED8A 4YR6B 4Y1AA 3X13A 1W0WA 1JHKH 5JW3L 2WWKO 1UB6A 3JWOL 5GRJH 5FYKD 2XQYK 5D1QC 2NYYD 3BWAB 4P59H 3SE9H 5JXAL 1YEFH 4XPGL 1CFNB 4NUJA 4LSDA 4RIRA 4AQOA 1XGQA 4IMKC 1NC2D 2Y72A 3SDXB 3LSOA 4ZD3H 4LLDB 4RWYL 1HSBB 5EBWB 4HFWB 5KSBA 3QCTL 3WNOA 5BS0D 1X4XA 4PJ5E 4ODHL 3HG1B 3UC0H 3V0WL 4A2MA 2OX5A 2F8XC 4ZMAT 4Q6IC 3HZKB 4P3DB 1AGEB 3WUWG 5IEKA 4KY1H 3CFDA 1XH3B 3SDAA 5SWSE 3BAEL 5C2BL 1U93B 3LQAL 2XXMB 4QRQB 3RU8H 2R9HC 1V7ML 3LY6A 3BQUC 2JK5A 4ZS6C 5EZJB 3VXTA 1BQUA 2DQFA 3X14A 2ZCHL 4UZGA 3VI3F 1P7KB 5DUBA 4DAGH 5F9WB 1FIGL 1ZA6A 2CIIB 2QJDA 2AV1A 2BCKB 2G75A 1J0JA 5CEYB 3ARYA 1ZOXA 3PDDA 4CMHB 1NUDA 1KXQE 3ZE2E 1P4BH 1EVTC 3CVHL 4F33A 2J4WH 1J1PL 2F58L 2MSPA 1FO0H 3EYQC 3LKQB 3NTCL 4JFYB 2BK8A 3ULSA 1CDIA 3LKSA 3TNNB 2H9GA 1NGYA 1HHHB 1HIMH 2XTJE 5AZ2H 4MA8H 5JHDE 2YRLA 3HE7B 3JV0A 5F96L 3MRMB 3S36X 3RNKB 2DOCA 1TTUA 5I1EL 1IM9A 2OMNA 2R0LH 5FO8B 1T0NB 3MA7A 4OB5L 1VFBA 3VXSB 1J11A 3C08H 1UZ6F 1PLGH 1RJZA 4L5FH 2V17L 4KV5F 3ILPB 3NA4A 1GC1C 2HWZH 3EJYD 4J12A 1N5YL 4NO3A 1TLKA 1XCTA 2ZPKH 1MQ8A 3D85A 4L29B 2P48B 5C0FB 1A9BB 1BQHB 1NDMB 1BJ1J 2VL5B 3GSXB 4JRXE 3MROB 2XWJB 5IW3A 3S37H 2EYRB 2VL4A 5D8JL 5IJKC 2D0GA 4S1DD 1RZFH 1CGUA 3OGCA 4ZS7H 4G80A 2DTSA 4KJWD 4WO4B 1DQDL 1YMMA 3LRSB 3MBEA 4NQUA 4NJ9L 1DFBH 2XN9A 4EBQH 1MCJA 4WUUB 1U8QA 1Z0MA 4KQ4H 8FABB 1XIWC 1KBGL 3C9NA 5IEHB 2DWDA 2D7PA 3HPLA 4PV9A 2GTZA 4FP8L 5D7SH 5CFHA 3BP6A 5TDPA 6CGTA 4KRMB 4V1DB 5E24E 5IQ7H 2B4CL 1N64H 3MRRA 2V7HA 1H0DA 1CXEA 2EE9A 3PQYD 1ZE3C 4NQCB 4P49A 5BMFH 2BOCA 4OCYH 2EDJA 1X9QA 2GAZB 4LF3B 4MMXC 1BBDL 15C8L 4TNWK 5CSZB 2AV7B 4HFUH 2X40A 3FCTB 1QFWL 4FQIL 5JZ7C 4BK5A 4NGHH 3GSUB 3VXNA 1AGDA 3MCKA 2YKLH 4M03A 3JV4B 1TJGH 5FA3A 4PGEB 1EEZA 4UV4L 5JW4M 3VWKC 4ZPVA 2LU7A 4XNQA 4YO0B 3TO4A 3BRDA 4XMPH 2H26A 2X9WA 4U1KB 4XMKL 3THML 1CXLA 2C3XA 1A6PA 2CR3A 1WAAF 3B5HA 4OZFB 5ANMA 4WIQA 1MIEH 3IFNL 3QFJA 2NX5B 3CZJA 5DRXB 2O93L 4OLVH 1NDGA 3SOBH 3HHRB 2Q86A 1N6UA 3PABA 4X0KA 4DUVA 2PYED 3CVIH 2CLVB 3VWJD 1JGUL 1TVHA 1KG0A 3EYSH 3FFCE 3QNXB 1C5BH 1DL7L 1OB1A 1XF3B 3RVWC 1JPGA 1N7MH 4LASH 5E9DB 2D7QA 3BKJH 3QDAA 3CH1B 4YHYB 4EOWH 3T3ME 3AS0A 4WWKC 2V2TB 3BKYL 4Y4HC 1NQBA 4ZUSA 1T0PB 3RUGA 1L7TH 1OAXH 1RURH 12E8L 2VNCA 5IUSA 4U1HA 3RZCC 4X7SL 2XQBH 1QBLH 4PRAA 4LLQB 5ESAB 3HUJF 1UVQB 5CJQL 2XV6B 1D6VH 4M48H 4ZFOL 4ZAKC 2OI9C 3BSZH 5TF1H 5IROC 4WV1A 4LSQL 4UQ2A 3MLRL 4PJGE 1KXTB 1QBMH 1L9NA 3IJHB 2P5WD 3E3QC 1U8OA 1L7IL 4XPBL 4MDJA 5F9JB 2D2OA 2M1KA 4O2FB 3TPUB 5EIIB 1WVZA 2X4PB 5FM5O 2VLJA 3RAJH 1I85C 2DQDH 4PJ8B 4YHPB 3OKYA 4G7YL 4ZUTA 4JFZH 4KHXH 2IGFH 3LB6D 5DHYB 2D03H 43CAB 1I75A 1R3LA 2ADGA 1QFHA 2VXSL 3ECBA 4N8VA 4APQA 3BZ4A 1CFBA 4JDVA 4DN4L 4RBPH 1BWWA 4OGYL 1E4WL 1BFVH 3O9WD 1HSAB 5ISZE 1YEGL 5F1NA 3D2UA 3WEXA 2CDGB 1NMAL 1UACH 4DWHA 1ACYL 4P2OD 5CD5D 2XOTA 4KHTH 3BYYA 1CLCA 3RPIB 1G1CA 4ETQB 2GJJA 3DUSB 3BGAA 4DVRH 5ILTL 1QR4A 32C2A 3WFEH 2A73A 1R24A 1FC2D 5DK0A 1F4XH 2FD6L 4OQ1A 3HC0B 4QHLB 4DK3A 3ARBD 3ESUF 5IIEB 5J3HD 1DN2A 4Z7NE 4P23B 2P5EA 2LVEA 2NY3C 4ORGB 5SX4I 7FABL 4WI5A 3MRJA 1TQCC 2Z93A 3L3GA 3J7HA 4LRNH 4QXGH 4RAVA 4M8QA 3WL9A 4MWFA 25C8L 4MMZC 2ITDA 2YSSA 3PF2A 4DQOH 3ARFB 5FOJA 3ZKMC 2R4RL 5BV7C 2FNBA 1J88A 2VSDA 5CGMA 3T04D 2GQHA 1BQLL 4PJIB 4X83A 2YWYA 3O3AB 4RISH 3A6CH 3QIBD 1IBGH 5CZXD 4QRRE 4KUCD 2VXVH 4P2QD 3TBTA 4PP2B 2LABA 3JV6B 4O4YH 3BP7B 5CZVL 1INDL 1LO2H 4PUBH 2ENSA 3AMLA 1SYSA 2AK4A 4WI3A 2R0WL 5LWYH 2XNAA 2VLJE 5J13B 1BJ8A 4FQJL 4NPYA 3D3VE 3V95A 5JOPD 3FONB 5ALCL 3TN0A 4GG6E 1PZUB 3ULUC 1U3HB 1PSKH 3BHBA 3BVNB 1HNFA 3QHZH 1I8LC 1J8HD 3ZTNL 3NIDE 4WNQB 1I9RL 2XXCB 3MODH 3WV0A 4PJAE 1T04A 3QIWC 5IFHH 1CN4A 4NQED 2YC1B 3WN5B 1JZ7A 3IXAA 3L95A 4GRLC 3ZT6A 1FL3A 3G5YA 1NFDB 5TF0A 1IL1B 1QA9A 3RDTC 5DEFB 1PG7X 1WITA 4I9WE 3IFLH 3HB3D 4HX1A 1MIMH 2FEEI 3T4YA 4CADB 2QKIA 2WSKA 3VGDA 2OQJB 1CBVH 4PR5A 1Q94B 2FIKB 3GSRB 3UTTB 3MV7D 5IVXB 5I75B 1ZT4A 3JZ7A 3QUKA 3VRLF 2BY3A 4MQTB 5EO1B 3MJ7B 3C5SB 4HT1H 1L9MA 3MRHB 4Z8FL 2F8OA 3TBWB 4HUKB 2DM7A 1OY3B 3MV9D 3U4BH 3WHE0 1EO5A 4QHMB 5GQBA 1AO7D 4CVXA 3QNZA 3F65A 4JFDD 1MCHA 2VITB 2GY5A 4ODVH 1CT8B 4XBEH 2AJYH 3TJEH 3GKWL 3I02A 1DE4B 5T1DL 2FH6A 3SO3C 4K3DL 3QJFB 4HD9A 1NUGA 4OAWA 2IG2L 1ZVSB 1Y0LA 1GGIH 4X6CF 2VXUL 4WI2A 4IRJD 1E4XI 1U95A 4LCWD 2WBWB 3IXTA 3K74B 1VEMA 3AXLB 2VLRB 2YN3A 4XCCH 1N4XH 5I1AB 1DBAH 5D93B 5JR1L 5L2KD 3IKCA 1QRND 4NRZA 4XB8A 1LDPL 4CRPA 4FNLL 1F02I 2BVPA 4UU9B 4UDTB 3ARDA 3QFDB 5J12C 4MNQB 4XCEB 5LGJB 5TGBB 3B4NA 3Q3GB 4R4FH 5HHNB 1MPAH 3DXAB 3WHXB 2Y07H 4G9FE 3D69B 3CU7A 4FFZL 4YPJA 4RX4D 2J7LA 2DQUL 4HKBB 3TA3A 5B3JE 1AH1A 2JB5H 2UUDH 3S5LB 3QDMD 4HIEA 5DTFA 3WSQH 3Q6FA 5DC9B 3WE6B 3BGFB 2BSED 1HINL 2VDKH 3SJVB 3PJSA 3HZMA 4JFFE 5HDQH 3GO1H 1S7WA 1OAYH 1E6OH 2VQUA 1XGTA 1KCKA 3TH4T 1WBXB 2VDNH 3H7BB 4WU5B 1DQTA 2F74A 5IBUB 2A74B 4N9GA 5ADOL 3OG6B 5CINH 4PGBB 5KVEL 3O4OC 1CXHA 4L4VD 1T89A 1F3RB 1F6AB 1YEIL 3FQNB 1S7TA 3R8QA 1ZHKB 4X7FC 3NA9H 1KN4L 4YBHA 3TBSB 2ZSWB 3V0VA 3G08B 4PLOB 1IGIH 3G04B 3UZVB 4H8WL 1QFOA 3BP5B 3JUYA 2A1WL 2CO7B 2D4FA 1X6NA 5DJXA 2B1AH 3E6FB 2XACC 2DJSA 3CFIC 1TIUA 3GSNL 2IPUG 3MNZB 4E41B 4PLKD 3G5VA 4XGZB 2I9TA 4W6WB 3MRLA 4U6YA 4W6YB 4JJ5B 2GCYB 4GKSA 5GGTH 3X3GL 3EDFA 2FJFB 2OM5A 4X99B 4CMHC 4XP6L 2XA8H 4GW4B 4ZUWB 3VDCA 5E2UH 5F70A 2R69H 3AU1B 2YD8A 3RTQD 3TT3L 1A1NB 1MAJA 2BMKA 3CVHA 1M6OB 4S1QL 5I8KH 2VLME 3HTLX 4XZUB 4R3SB 1WBYA 4Y5XB 2D7MA 1IE5A 4DEPB 5JDJA 2ZUXA 2DJ4A 4Y4FA 2DAVA 3U7YH 1FH5L 3MX0A 2NZ9D 5I0DA 4JFEE 5LGKA 4PRHE 2FR4B 4Q58C 1PAMA 4LKCA 3BPOB 1VACB 1KENH 3WNPA 4NP4L 1D5ZB 2E7LC 5I1GL 4ONGL 2IPTH 2X4RA 1J86A 1TNNA 3ULVH 1MY7A 1T20B 1PW3A 4X6EA 1RFDH 4YHKH 3ZL4H 4K3JL 1JNNH 1SYVB 1W0VA 3MCLH 4TQEL 4WGVB 4XH2B 5E00B 3SDDB 1ZTXL 1Z9SA 3KYKH 4M6OL 4WDIA 2Z31A 5DFTA 3ARGD 1CDCA 3L3DB 2E5EA 4HWUA 3MMEA 2VLLA 3O3DB 1YNKL 4KK6C 5HI3C 1J1XL 4XNXL 4RGMB 1IAKB 3V5DB 3GI9H 1PYWB 2R56H 4LMQI 5DJ2B 1T0MA 5DK3A 1FBIL 1LHZA 3O2VL 4I0PC 4JKLA 1CXKA 4PRNA 3E3QE 4JG0H 3CLEL 4JE4B 1HNGA 1ZHLB 3O6LH 2QBWA 5D7IB 3FZUC 2HTLD 3FN0L 1KN2L 4F15B 4PLJD 1A3RH 2EIZA 5CEZE 5MEOB 5D2LB 1EO8L 4M7LT 2BY2A 2F53D 1OD9A 1C12B 1HHGB 1G6RH 4K9EL 5C0ND 2BXYA 3E8UL 4N0FB 4GQ9H 2J6EA 3B9KA 2V7NB 4YGAB 5L6YL 2GTWA 4LGPB 1NAMH 4Y2DC 3DO3A 1IJ9A 2E8YA 5HHOD 4J4PA 4G7VL 4F57H 4GRMA 3UDWC 4ZFGH 1DBBL 4MHHI 5GGSY 1DBML 3HE6B 1R3IL 3FO0L 5EUOE 2HJFA 4PG2A 5I74B 4IRZL 3GMPA 5IR1B 5MI0C 3HI5H 4PJHA 4Q6YA 2BVEA 1NCDH 2HA1A 5EPMA 2EC8A 1NAKL 5AWNL 2OS7A 3VG0L 1S9XB 2ITCB 3S35X 4LSPH 4JRYD 5HYQB 3P2TA 1I1FB 3L5WA 1MI5B 3WJJA 3R06A 1JK8A 4I3RL 1G0DA 3UEZA 1IGTA 5HVFB 2Z92A 2ZUSA 5HGDB 3C60B 1DVFB 2VDOH 3FAXA 3T65B 5ELIA 1JMXA 3WLWD 3GJEB 2AP2A 3VMOA 3RRQA 3V4UL 5D2NC 4KI1A 4ZYKB 2Q7YA 1BZ7B 1MWAL 2V6HA 3AC0A 4OV5B 1ZANL 3I50H 2YD4A 1KB5A 4YHYC 1Q0XL 5JW5A 5F3HB 4U1GC 1EHLL 1T21A 4MZ3A 3FQTB 3FB6A 4OZGF 4P5TD 4PJEE 1PEZA 3PNWB 4K3EH 1A2YB 1YN7A 4L8BB 2WINA 5C0CB 4PTUA 1VPOH 4XP9H 5TE4H 3HAEA 3W2DL 3ULVF 5K9QG 3NZ8B 5GZND 3G6JE 1GIGH 2HVKA 5D70H 1CLZL 1OGAA 4PY8I 5FEBA 1QO3A 3ARVA 1YYLL 1RUKH 5FKAA 3GJFA 3NFPB 1MNUL 1L6ZA 1H5BB 3OKOA 3PUCA 1EGJH 4LRIC 2VDRH 4N5EC 2W0LA 3SQBA 5I66B 4GS7C 1X5KA 4JKPL 3QDJA 5MHSE 4OLYL 5IW1B 3W0WB 3ULUE 2BP3A 4X98B 4HPYH 3VXMB 3CXHJ 4PJ8C 5I1CH 1G0XA 1PG7H 3V6FA 3B43A 2E9IA 3O41A 3JXAA 3O45A 4RGNC 4WFHE 2WUCL 4YR6A 1OP9A 3C09C 1CGSH 1JPTH 2HN7B 1IMHC 2DJUA 2PN5A 1XZ0B 1NC2B 2C26A 3GK8H 1CFNA 5IBTL 3STLA 4DW2H 2CKBL 3SDXA 4IJ3C 4LLDA 2A83B 1HSBA 5BS0B 2Y06H 4MAUL 4HFWA 4LNRB 3EAKA 2K7PA 1TCRA 2OR7A 5C7XH 3R4DA 4PJDF 4ZPTA 5ACMA 3EJJX 3FT4B 3MTRA 4YDKL 5IG7B 1Z9OA 3MLVL 4KUZH 5M95B 4YX2L 3ZKSD 3MUY1 1T7VA 2E7HA 3K1KC 3HZKA 4P3DA 3UBXA 2BHUA 3FO9A 1AD9B 4LCCC 3P4NB 1RI8A 1EBPA 1XGUB 3AY4C 5EU3B 3BRFA 3D6GA 4BQ9A 2HVJA 3W9EA 1K6QL 4UTBH 3QUYC 4N1CA 3O6KL 3D48R 4QRPE 1NGPH 1H3WM 4TNWF 2VH5H 1KCUH 5T3ZL 1M1SA 5CGYC 3VG9C 3LHPH 5CEYA 3V6ZB 1WQVT 3B2VL 3PDGA 1KELL 5BVPH 3CXHK 1AXTH 1E27A 3NIFF 5T1MA 2AI0L 3EYUL 1AC6A 4F80A 4G6AC 4KVNL 1BEYL 2DLFL 4JFYA 5C0BD 1T1YB 4JHWL 3JWNC 1ZLSL 2C4XA 5IHUL 5IVZB 2WP3T 5E7FA 1HHHA 5GRUH 1OCWH 5KZCD 1HK6A 3RQ3A 3HE7A 3BIKA 1LE5B 4Q97A 2XWBB 2C7UA 3MRMA 4F9LC 3EO9L 4MAYD 3AB0B 1YZZA 5I1KH 3EFDL 5HHPB 3KGRA 4FTVD 3FRUA 2VO5A 4CBPA 4NQXB 5JPMA 4JZNB 5C8JB 5FF6B 3BRGC 4PBWD 2H45A 5E03A 1U3HC 3OB8A 3TESA 3VXSA 1BPVA 2DLEA 5C92A 1CFTB 3QRGL 1FVCB 1KJ2B 4TRPL 3ILPA 5C6TH 2DTMH 5H94B 2GITA 2OP4L 3TBYA 1CGWA 4FOMA 2HT2D 3D25B 2OXHA 4L29A 5FUZH 4WFGE 4KK8D 5C0FA 1A9BA 1BQHA 3LKRA 1BFSA 5K33A 2VDLL 3MROA 4YGVB 1VFUA 4N0UB 5HPOA 4PRPA 4ZXBA 1U6AL 1DBJL 2EYRA 2F9BT 5D7LD 5I1LB 1S5IL 5A2KH 1T03H 4JN1H 2X89D 4G43B 4R97C 1U2HA 3ZDXE 4GAYB 5IOPA 4YK4B 4WO4A 3HG1E 1D5IH 3JTSB 5JHLH 1A6WL 1TNMA 4WUUA 2LTQB 4HCRA 8FABA 2W9EL 1HI6A 3IRZA 1NL0L 3OPZH 5EBLB 4Z7QE 3BN9C 2HRLA 5IEHA 4KROC 3WFBH 1CD1B 3KJ6L 4UV7H 4V1DA 3LMJH 3PQYB 3RHWK 4Y16D 5I30L 2DBJA 5DI8B 3GSOB 4K3GA 4UDUA 5CGTA 1UM6L 4LF3A 2GAZA 4XMLL 3FJTA 2AV7A 3T0WA 2CRMA 3K2UH 3W39B 2WQ8A 2K1MA 3BH9B 1DP0A 1UGNA 3CPLB 2HFGL 3SCMD 3DARA 5DYOB 1BM3H 2ZUTA 3IGAA 1KB9J 1OP3K 3P40A 5GRVK 4KK9D 4PGEA 3HMXL 2WBJD 4YPGB 1ZEAH 4JFXA 3DX6A 5DD6B 1DEEB 4M5ZL 4Y5YC 2D4DA 4W4NA 4HMDA 3E2HB 4XPAL 2UZYB 4OZFA 5D93C 2Y7QA 1A7OH 1IEHA 2E3VA 4K7PY 5E1HB 5FV2A 4CJ1A 4OFYD 2JIXD 4YFLI 1CGVA 2V2XB 2PYEB 2QV2A 4OCWH 3VWJB 5EC2B 3QZWG 3MC0A 1RULH 5DUMH 4OUUA 3C5ZC 3GSWB 3QNXA 4O9HL 4OLZH 4ZO9A 5LKNA 2IWGA 5IB4A 5IESL 1G9MH 2AJZB 4EVNA 3VXSE 3IFPB 1MH5A 3C2AL 1CK0H 5SX5K 3CH1A 3UJTH 3MYZA 2F19L 2V2TA 1CL7H 2CRZA 3ZDYE 1ACZA 3QUZA 4OF6A 2BNQD 5C0GA 3PL6C 2KUTA 4U3CA 3BO8A 4KRNA 3UTQB 5F7FA 4JPVH 4R4ND 2VLKD 1LO0L 4D9LL 2Q6WA 3H9HB 2VUOA 2P5WB 5IMKB 1G7MB 2AJSL 1KJMB 3IJHA 2DQCL 1Z3GH 4OLWL 4JO3H 1MRFH 2PTTA 4NZUH 3PGFL 4UILH 4A6YB 4GJTB 5F9JA 5HTSA 1AR1D 1WK0A 3MNWB 3TPUA 1IGFH 5EIIA 3EHBC 4H88L 2X4PA 5DUPH 1WFNA 2H32A 4LCUA 1R5VB 2G5RA 4G6JL 4PRIA 4HDIA 4YHPA 4KKBD 6FABL 1TVBB 4E42B 5I15L 1KIUA 1JUFB 4HQQH 1FLRL 1OLZA 3ME0A 1KSRA 5BZDA 1NBVH 4EXPX 2O5ZL 3O9WB 4DOHB 4FXKB 3GEWB 3LV3B 3MYJB 43C9B 4NQCE 1MVFA 3QXUA 1IGMH 5DJ0B 2C1PB 3WS6A 2BOBB 4I2XA 1VKXB 2GK0A 3GMNA 1ZLUK 2UZIL 4PG9B 1YDPB 1QQDB 2CDGA 5SWSD 3OJVC 4NZDA 4P2OB 5ESVA 1E4XL 2QQLL 4BSVB 3L9RA 4QLRA 4HWBA 5IT2L 1O0VA 3CDCA 1CQKA 2L7JA 3DV4B 3S6CA 4XT1C 5DS8B 4C57C 3WJLC 4C56A 3DUSA 4OT1L 1N59A 4U1NB 1MHCA 5KTEL 4AJ0A 3EIFA 1M05A 4H20L 2VERN 3VGBA 3SKNA 3BUYB 1KTDA 3ARBB 3MACH 3ISWA 1A64A 4Y5XC 2NX5E 4QHLA 3HC0A 5E8OB 4Y5VC 3T2QA 2FHCA 5FYLL 2JJSA 4XXDA 1KCRL 1NCCH 1KNOB 4ORGA 1OM3H 3VXQB 1CF8H 1PG7W 2FDBP 2R1YA 5DEGA 3GHEL 3QQ4B 3MUGB 2DI8A 1RZKC 4DGYH 5DT1H 2XTJD 3FMGH 4KJQC 5E9DE 1JWMB 5KSBF 3RL2A 1RUMH 2XKNB 1E28B 3SE3A 2DI9A 4OZHA 4CN1A 1PJ9A 3ARFA 2H2SD 4M6MH 3TGXA 3AAZA 4OKVA 5BCAA 1TCMA 1HE7A 4PJIA 5EOCL 5LBSL 1UJTA 3QIBB 1MJ8L 4ZOBA 5FGCB 1RZ7H 3V4PH 3O3EB 3OR6B 2OJZL 5KSAD 4ZSOE 4P2QB 3IF1A 1G7PB 2J3SA 1XCQA 1A7PL 3RA7L 3VI4E 3IYLW 4NQDE 3MRFA 3E1F1 3B8YA 4M8VA 1TJHL 1F4WH 5JDSB 4PBVC 4G42B 3OXSB 1K5NB 4RAUB 4JPKL 5ICXA 4JRXD 1BZ9A 1I4FB 1X5LA 3FONA 5E08L 1OSPH 3VFVB 4X9BA 4EXKA 4QXUL 4XAKE 1U92A 5L9DH 3BVNA 1J8HB 5GS0D 3OR7A 4RGNE 2DM4A 1MCKA 4CNIA 5GHWH 4MD5B 4M1DL 3EOBB 3ROLB 3V52L 3KYMA 1J0YA 4NQEB 3WLBB 2AEPL 3FL7A 3PWUA 2VWEC 2Z9TA 4GXVH 4O5LH 2YC1A 3NZHL 3QPQD 3WN5A 3HE6C 2ZUUA 4W4OC 3EFFB 3JWDC 4NQVB 2W91A 1IGCH 5SV4A 1BLNB 1I8KA 3OKKB 5F9DC 2PTVA 5F88A 4PB9H 1KULA 1R0AH 3P30H 1M71A 4DKFH 4CADA 3O6ML 1NCBL 3MV7B 2HTKD 3FQXA 1TTGA 3T3MF 1Q94A 2VC2L 3GSRA 2FIKA 2RFXB 5I19L 4PJ7E 1EAJA 4MVBC 5DJZB 2PNDA 3V6BR 5J0BA 1G9NC 4MXVE 3MV9B 3MJ7A 3H0TB 1FN4A 4QWWC 1AO7B 1EH9A 1DVFC 1XFPA 4OUOA 4UUJB 3TBWA 1X5IA 4QHMA 3QSKB 4JFDB 4E5XA 2AJVL 2BRRH 2X4UB 3JVGA 1NANH 3HI6L 1AIFA 4NKQB 4XNYH 5DVKA 2VITA 3OBAA 4PJGF 2UWEB 2PR4H 4LAJH 4BFBD 5D96C 1S7QB 1CG9B 3DSFH 2J88H 1FJ1B 2FJGB 4LLVB 3EDJA 1IRAY 1JTTA 4IRJB 1ZVSA 3PXJA 4OZ4A 4LCWB 3MLZL 4P59L 5M7QA 3FFCD 4PJIE 1YEFL 3BPNC 3IDMA 3Q5YA 3ALXA 3GB7A 4DFIA 3Q2CA 3GBNH 3KR3H 4ZD3L 5DWUL 4H26B 5L2KB 1QRNB 1WZ1L 5H2BB 4X80H 4XP1H 4XWGL 2NR6D 3F8UB 3EZ8A 1H5BC 2Y36L 2A0LC 4ZUUB 1GYAA 2DN7A 3BW9B 1P5VA 2WUBL 1O5DT 4NRYA 4NO2B 2WLYA 4UU9A 4FA8A 5E56A 4UDTA 3V9FA 3UPCA 5I76A 5EU5A 1TZHB 1S78D 4KY1L 3QFDA 5DEZA 2F5BH 2P8LB 4XCEA 5LGJA 4QOKD 3TZVD 1BD2E 5FO7A 3QH3B 4XC1H 3DXAA 2EDOA 4YDLC 3KLHC 3QDMB 3RU8L 3MREB 4NJAH 4B0MM 4U6XB 2VDPL 1BBJB 3L1OL 3S5LA 3VXRA 5JOEA 5F6IB 2CUIA 4DAGL 4OKDA 4D8PB 1RZJC 5CS7A 2IBBA 3K3QA 1AXSB 1K4DA 5J11C 2EDFA 2AJXH 1RIUL 2J8UB 1WBXA 1DDHB 2IFFL 2J4WL 4WU5A 1NFDE 3JWOC 2A74A 1FO0L 3NABH 4L4VB 4RAHA 2WIMA 4AK1A 3TJHC 3B6SA 3QG6B 4PGBA 3FOLB 5CP3A 2YUVA 1HIML 5E2TH 5AZ2L 1RUQH 5TJWK 1E4KA 4MA8L 1PKQB 3S9DB 3UTTE 5IVXE 3KLDA 1MQKH 1H3TA 3KPTA 2AQ1A 5DJCB 2WK2A 3G04A 1IAOA 3OKDB 3BP5A 1FORH 4LSTH 5GRZA 3T0EA 5GS1C 3MLXH 2R0LL 4AH2B 3HZVA 1TMCB 3V8OA 3DJ9A 1JZ4A 4E41A 5D1ZA 1DZBA 4XGZA 5L0QC 3WNMA 4YHIB 5JPNB 2PXYD 3GMQB 2ZG2A 5B39G 3BP4B 3LQAC 1A47A 2HWZL 3GSNB 3MRKB 1GXEA 4X99A 1KT2B 1BX2B 4UBDD 1MFEH 2ZPKL 1GC1H 1JF1A 4MJ6B 3RTQB 1SJEB 4QY8A 4GW1B 3EDEA 3AU1A 1LE9A 1H3PH 4XPHL 4MJ4A 3LKNB 2VXQH 2ZSVB 2FX9H 1MEXL 3BEVA 3P4LA 3X3FH 4I3SH 2VLRE 2P8PA 1RZFL 4ZS7L 1JE6A 3O3UN 3FKUS 3NIDF 4L8SA 1DFBL 1DN0B 4LP5A 3C6SA 3O4LD 4MD0B 4U1SA 5FM4A 3JUZA 2C3VA 4Y4FC 4UNVA 5ICYB 3KDMB 4MNQE 2IAMA 1VACA 3TCLA 1GZPB 5D7SL 5HVWA 2NY4D 3RWIA 4TSBH 5IQ7L 1Z6JT 1N64L 4ZTPH 1FCCA 2P45B 3ARGB 1EAPA 3EJYC 5EU6A 2R2EA 5BMFL 3CK0H 1RD6A 4HFUL 2NY0C 2DIJA 3N0PB 2CDEB 4NNYB 3SJVE 4P3CH 2Z31C 5I8EB 3D3VD 4B7LA 5ETUB 4JO4H 2YKLL 3O3DA 1B88A 1TJGL 2HLAA 4QXTA 3BMWA 3V5DA 2HFEB 1SVCP 2HMIC 3UCRA 4XMPL 1INQA 4GKOA 4D0BB 5KVGH 2Q8BH 1I3GH 3CX5K 1PGRB 4K2UH 1ZHLA 2KZ1B 1E4JA 5D1QD 1MIEL 4MQXC 5FECB 1FZMA 3ZT7A 2F53B 2LTQC 4OLVL 3DI2B 3QXAB 3SOBL 5MEOA 4EUPG 1RV6X 5ID0B 3RWJB 1C12A 1WICA 3ZKXB 3CVIL 3EYSL 5HPMB 1C5BL 1KPVA 4I9WD 1B90A 5HHOB 1JYNA 1N7ML 4LASL 5C2UB 1U8IB 1CTOA 3MLSH 3BKJL 1VFMA 1J05B 1ERNA 1HN1A 2IH3B 2YXMA 1QBBA 4EOWL 4H0HB 4KXZH 1W8OA 4OFKA 1HXMB 5F1KC 4AEHH 3EOAB 4AIZB 4J4PC 2B4CC 2QQNH 4KMQA 4JFHE 1L7TL 5HSFA 2NLJB 1OHQA 1QBLL 1JF6A 2R9HD 3QWRA 1XF1A 1O7VA 3BQUD 1BGXH 4JRYB 1D6VL 4ZS6D 5TF1L 3BSZL 1S9XA 2ITCA 4KMTH 1YEEL 2V2WA 5E6IA 2QSCH 5HYQA 3HMXA 1I1FA 2GT9A 3QCUH 1AGBB 5B3JF 3QP3A 4C58B 1VGKB 3KPLB 1S7SA 2E9JA 3MNVA 1N3NB 3WJJC 3C60A 1ORSA 2JKXA 1Y18B 3RAJL 3PWLA 3EYQD 2ICES 1OP3H 3GJEA 2DQDL 5SWZE 3E6HB 4P4KA 2CDFA 4KHXL 3KLAB 5T3XE 3P73B 2C3HA 2YPKA 1BZ7A 2D03L 3BZEB 4OV5A 3GNMH 4LLMB 1S9YB 2VZOA 4P5TB 5L88L 1YNLL 1SJXA 4JQXC 4GO6B 3PNWA 1TZIA 4UMGA 1GZQA 4L8BA 4HUVB 5C0CA 1JI2A 1UACL 2FATH 3IJYA 1D5BB 1Q72H 3M1BB 4J23A 1JNLH 3HR6A 3FFDB 3AS3A 4GXUN 3AS1A 4MX7B 5DA4A 5SX5H 3T2OA 3U79A 4DVRL 3WFEL 5I0ZA 3IDNB 4M61B 5I66A 2VSCA 5D7IE 1F4XL 1IKNC 3AM8C 5E99H 2X4OB 4YDVB 1I9EA 4QT5A 5FDYA 4M7KH 3DX8A 1AGFB 1I7TB 2FYYA 5IB2B 3INUH 3PWVB 5D2LE 5JOFB 2XA3A 4X98A 1KFAL 3VXMA 4BK4A 4PY7B 5DVNA 2DQIH 1PVHA 5HXMA 4E0RA 2UY6A 4QXGL 1A4KB 4ODBD 1I9JH 1SJHB 1XIWD 4DQOL 4KJYB 2APWA 4HJJH 5CBAA 1QP1A 3EOTL 2CK0H 1OD7A 3V4VH 1X6LA 5BV7H 3WKNA 3TVMC 4JB9H 4TUKL 2A83A 3A6CL 4U49A 5TDNB 1T7ZA 4LNRA 5K9OA 1IBGL 5DHVB 2VXVL 4NYLB 1XR9A 2O5XH 3QEQB 3A0OA 2PYFB 1MI5E 1PBYA 4XVTL 4O4YL 2W0FA 3FT4A 5JZ7D 4BSJA 3CUPB 2NTSP 2XFXA 4QHNB 1LO2L 4PUBL 3ARBC 3WFZA 2X4TA 1ZLUH 5C71A 2WIIA 1AD9A 3P4NA 3VWKD 5EU3A 1UM5H 1BFOB 1FP5A 3RHWF 1G7JB 4F7PA 3D0LB 3GRWL 4MJ2A 2HG5B 4FFVC 5GGQH 1PSKL 3QI9C 4BKLA 1NLDL 3QHZL 3ULUH 1OW0C 3NACH 1U8HB 2Z91B 4MNHB 4XNZC 5C86A 1WBZA 4LPXA 5D6DC 2X44D 3V6ZA 2OK0H 2ATKB 1CL7I 2CKNA 3MODL 5IFHL 4JFED 1KLFA 5I17A 5C0BB 5C0CE 1YPZE 5EUKB 3DTXB 4WU7A 2NW2A 4GRWH 3MV8A 5HHVH 3GBMH 1UWEL 3RVWD 4CMMB 4LLAA 4P5KA 1UJ3B 5CZXC 3ZO0A 4N1HB 5KZCB 4C83A 5JLZA 1KJ3H 5IVZA 5HYSB 1YQ2A 4WWKD 2LU3A 3IFLL 5DF0A 4Y4HD 4MAYB 2Y5TB 1CBVL 4FS0A 1MOEA 3MPCA 3RZCD 4YDIH 3WO3B 4FTVB 3CXDH 2X4SA 2IBGA 4NQSA 2H8PA 5FGBC 2C1OA 1FFRA 5EUOF 4UOJA 4HC1H 3W0WE 3WXWH 1AP2A 4JZNA 5C8JA 1YY9D 2ZUVA 2BVQB 4X6DB 3MLYH 4UIKH 3RNQB 1BF2A 2MPAH 2PTUA 4HULB 3DECA 2AVGA 2ZG3A 1EJOH 1UH4A 1KJ2A 1NMBL 4ODVL 4CVZB 5ID1B 1NJ9B 1QEWB 4XBEL 4ELME 4O02H 3MRPB 1S7UB 4GKNB 4DKDC 5H94A 4WVRA 1JWSB 4R8WL 5CEZD 3QQ3A 1ZV5A 1RHFA 4TVPL 3TYFB 1KB5H 1F3JA 3GI8L 1JIBA 4YGVA 4NNXA 5D7LB 1D5MB 2ZUQB 4X5XB 2Z8SA 5D4QA 5FFLA 4OD1H 1SMAA 5BS0E 3H42L 1F6LL 2YHGA 5I1LA 2FJHB 4U33A 1ES0A 4XCCL 1N4XL 1UH2A 4GAYA 3M17A 4FG6C 4Z7VE 4TVPD 4KZEL 4WUKH 4RNRB 4OZIB 4XCNB 3BZFA 2IPKA 2FSEA 3HLAB 4LSUH 1OAQH 4PJEF 4M5YH 1T66D 3SY0B 1CD1A 1XMWA 5FKPA 4Y16B 3HPJB 3K8MA 3BUTA 1NH6A 3F58H 4CVWA 4R4FL 3PQYA 5AYUH 1LEIB 2Y07L 5DI8A 4GFTB 2W07A 2ICCA 4KQ3H 2DDQH 5HDOA 2JB5L 1EZVY 5C9JA 2YBRB 2N4IA 3VDAA 3SCMB 4NKIH 4ODWB 1LO4L 4YXKH 3W39A 1IKFH 4JKMA 4HIHB 2VDKL 4NT6A 1R5IB 2Z4QA 2WBJB 3GO1L 1J10A 2GSGB 1QNZH 5KJRH 1E6OL 3CSYA 3ULUF 2OZ4A 3HZYB 4YPGA 3GSVA 4XXCC 5DD6A 1U58B 4NQTA 4HZLA 4TULL 2MTPA 3H3BC 4G6KH 5DJAA 3ZKMD 5T1KA 2JIXB 2CRYA 3DROA 1EBAA 1YEJH 3NA9L 3P4OA 2V2XA 2PYEA 4GRWF 4ACPA 3VWJA 5EC2A 2YK1L 3KPSE 4BUHA 4I3GA 1IGIL 4N68A 3GSWA 1AQKH 4Z7WB 1I8MB 2B1AL 3VW3H 5HY9B 2AJZA 2HT4C 4JO1H 3ABZA 3IDIA 3KPOA 1BHGA 2EDQA 4BH8B 1KCLA 1JCKA 1OAUH 4AYFA 2HAZA 3O6FC 5F9AC 2X4NA 2BNQB 5F6IC 2HFFB 5I9QC 1ZT7B 1FL5A 3MLWH 3UROR 2X42A 5GGTL 2VLKB 1S9VA 3KAAA 3F7VB 3UTQA 2XA8L 4NO0A 3DX7B 2ADJB 3ZT5A 4XBPA 2R69L 3C5JB 2CXGA 5I8CB 3H9HA 2K7QA 4N0UE 4RFNC 4F2MA 1L0XA 2P5WA 4OFVA 4X5WB 4HWEL 4WFHD 5I8KL 5D1XC 5EOQH 5CUSH 1FO0A 4A6YA 3QIWD 4EI5D 3EGSB 3MNWA 4GRLD 1I1YA 1C16B 1MF2H 4BZYA 5F71A 4AL8L 3ZZ1A 1R5VA 2C3WA 2VB5A 3U7YL 1WJ3A 3RDTD 4JZJB 1TVBA 2D7TH 1EK3A 1AI1H 3IS0X 1E6JH 3UTSE 3ZSTA 5HHQA 5DJYA 4P57B 4FQ2L 3ES6A 1OTUC 2IPTL 4FQ1L 1M7XA 2ARJA 3CCHA 3I75A 3ULVL 2CXKA 1NANI 2X2YA 2BERA 2WLZA 4FXKA 3LV3A 4NCC1 4H8WC 4PJBB 5FCUH 4FQLH 3H9YA 5ICZB 3KYKL 2C1PA 1ETZB 2BOBA 3HUJA 4HS3A 5SWSB 1VKXA 4RGOH 5KS9B 3O81A 2Z8VC 1YNTB 3TBVB 4P2OA 4C4KT 4LPCA 5K9JH 1F4AA 4O2CB 4KKAC 3I85A 3PV7A 5E6YA 3TIEB 2R1WA 2RHEA 3GMRA 5DS8A 2R56L 3R1GH 5DURD 2ZKHL 4U1NA 3VFTB 2ESVD 4URTB 5A16A 1I7RA 3BPCB 3P4MB 3CJJA 4HXAH 3L5XH 3O6LL 1QSFD 1T6VN 5E8OA 3U9UA 1UFUA 1A3RL 1T1WB 4KTDH 4LLWA 4QYOA 2XTJB 3P0YL 4HCRH 5LAXA 3RWGB 3ZMRA 1A22B 3SDXF 3T2NL 4GQ9L 1CDUA 5JHDB 3FB5A 3T2PA 5T33H 5CP7A 1NAML 4NKOB 3L3OB 4O58L 1ED3B 4JQVA 4IOFC 3U30C 1ND0B 4U1JA 3S5LG 4NM4H 4F57L 4F7TB 4ZFGL 1AHWB 1HDMB 1F42A 3VA2C 4EN3A 3SGDH 4MQ7A 1NGZB 2R0ZH 4H5SA 1T5WA 5TE7H 5KSAB 3E0GA 3QHTC 3QIBA 4Z7QF 3HI5L 3DRTB 3O2WH 4YDJA 1NCDL 2UYLB 1WC7B 4P2QA 1MHPH 5EOTB 4I13B 2B1HL 3U7AA 1XGRB 2W9LA 4D2NA 4J3WA 4LSPL 5BRZD 4LIQH 5IBUG 4P4RB 1HOCB 4JR9H 2VTFA 2UVEA 3NIGF 4YXHH 4YHMH 1LO5B 1T2XA 2I60H 5JDSA 4JRXB 4UQ3B 4WFGD 3OF6D 1SEBB 1K5NA 4OZFH 1EPFA 5D6CB 4P46C 5J6GB 1IZKA 2DQEH 5E94B 2PW2B 1UXWA 2GJZB 4HXBH 2ZOKB 3MRDA 4DOHE 1FZJA 3LAFA 4NFBA 2DLGA 4M00A 4NQEA 3WLBA 2A6JA 4K9EC 4QCIB 2Q20A 4K3EL 2YUZA 4L4TA 2W60B 2X5PA 4WHTA 5EWIH 3MFGB 4NQVA 3CFBB 1VPOL 4XP9L 5TE4L 1LWRA 1Y6NR 2XWTB 3P11H 1UYWH 4PGDB 5DVOA 1FFNA 5D70L 5HJ3B 4HV8B 1U8NB 3IETB 2NQCA 1RUKL 1WZKA 1TTFA 3OB0K 5E8NB 2FGZA 4JGMA 1MFCH 1FGVH 5J56B 2VDRL 3ZDYF 4G8FA 1QFUH 3MV9A 3O3BA 3H0TA 1KEMH 1AO7A 4Z0BH 1OVZA 4QGYA 5DD0H 4JFDA 5LGHH 4HPYL 3LQZB 3MV11 4MJ5A 1DANT 4I4WA 4ONHB 5I1CL 1PG7L 4HS8H 2UWEA 3OZ9L 4HS6B 1S5HB 4YUEH 4NBYB 5EH1A 4I18B 5INCB 3QA3A 5JQ6H 5E4IA 2FJGA 3UYRH 4YC2B 2O61B 2BNUA 3FFCB 3MLTB 5I71B 4IRJA 4M6AA 4LCWA 1D9KA 4KTEH 5B3NA 3I6KA 1R3JA 2QQKH 2PCPB 4DW2L 3V2AR 2J5LB 4K8RL 4IM8A 4OLUL 5GZNC 2AERT 5HHXH 5DD5H 1MCRA 1QRNA 2D0HA 5C7XL 4U4BA 3A6OA 4HWBH 5I8OH 5IVOA 4UTAH 3QG7H 3J8F7 4KRLB 4JM2D 4ZUUA 3AREC 4KUZL 3ESVF 4K8RD 2EXWC 4LARH 4LCIH 4NO2A 4QOKB 5JOPE 3TZVB 1TZHA 1F6FB 4JREC 4R96B 4YQXH 2P8LA 5HI3D 2OTUB 1Q8MA 4RX4A 3QH3A 4I0PD 4LHUA 1IC7H 4UTBL 4UIMB 3MREA 1J8HE 1HH6B 1GOGA 1U8MA 1NGPL 4BFGA 3AFLA 2VH5L 1KCUL 4HBCH 1C1EH 3FZUD 5GPRA 1UKTA 4X6CA 3U83A 2DBLL 3EO0A 3RVUC 3DHMA 3FN9A 3LHPL 3SDYH 1IEAA 1AXTL 5MEQA 5ALBH 4QRUB 1MCNA 2NW3B 4IOIB 1EUUA 4J3XA 3CH8A 4Y2DD 3RVVD 4CDHA 5CJXA 1P7QD 3QG6A 1JHLH 4WW2C 3FOLA 1N2RA 4ZTOH 3BKCH 5DZLA 2IEPA 3MV7E 1QYGH 4EEEA 1PKQA 4AM0A 4EJ1C 5C08D 4M62H 1MJUH 1QBAA 5D5MB 4QGTA 4XVUC 5I1KL 1QSED 4HPOH 1FZKB 4LBEB 3QUXC 1K2DB 1LNUB 3L7EB 5HGHB 4X9HA 1SHMA 1WEJL 3QHFH 4I5BB 4IDLA 3ETBF 1SEQH 2PXYB 3WUWA 5EZOH 4MCYB 1B4JH 3VI4F 4YHIA 5JPNA 3GMQA 4XWOC 5HYEA 1HWHB 3BP4A 5D7JC 5C6TL 2DTML 4NWTL 5IQ9B 3KHOA 4JY5H 2D0FA 3MRKA 5FM8A 3WKMH 1KT2A 1BX2A 4NO5B 1P5UA 4MJ6A 3RTQA 5FUZL 5IM7A 3DRQA 4P2CG 1SJEA 2YPLD 3GMLB 1MJJA 4JLRA 4P5MB 2I07B 1R5WA 1IEBA 1CIDA 1WLHA 5L2KE 1QRNE 2B20A 4JN1L 3RKDC 3T1WA 3REWB 3QDHA 4HWZB 4DFHA 1JZ6A 4HIIA 2D7NA 3BGMA 5DO2C 4XC3H 3O4LB 4KI5D 5JHLL 2MHAB 4MA1B 4MD0A 2NY4B 2RQ8A 3Q1SH 1OT2A 1W72H 3KNBA 2AXGB 5EO0B 1YYMH 4GAJH 2GFBB 4ZFZB 5GS2H 1NGWB 3SGKA 5ERWA 3SGEH 3I2CL 3QDME 4NQDD 3QQ9D 1ZWIA 4PJXE 2MWCA 2JB6B 3ARGA 4XBGB 4GLRH 1KIRB 4IIQA 4OF0A 4N90D 4R7DA 3UTZB 2BVTA 3D9AH 3HNSH 3TNMA 3D3VB 3K2UL 3QNYA 4K55A 5AG9A 4GG6B 3DVNA 3LVEA 2CLRB 4MXVF 5ETUA 1RZ8A 1DLFH 3M45A 3LKOB 2XIDA 2R2CA 3G6AA 2J8UE 2YWZA 5EA0L 1FIEA 4RGND 4L4VE 2ZUQC 1NGQL 2ZCLH 2ICWB 5B8CA 4FQQB 3BISA 5D1QB 4JZOB 4YFDB 4Y1AD 4UT7H 3FO2A 1N26A 5KSUB 2IADB 5IMMB 1A7OL 5JO5A 3L5JA 3PHSA 5FECA 4EKXA 5EULV 3FHAA 3H8NA 1A8JH 4OCWL 1P1ZB 2Z8WC 5F93C 1KCVH 3RWHA 1QR1B 1PX3A 4PJIF 3TF7C 2AJUH 4OLZL 4ZNEA 4Y16C 5E8DL 1G9ML 5GIRB 4R0LA 4Q6IB 1BECA 4R7NB 4Z77B 3LN5A 3UJTL 1J05A 1EDQA 4BM7A 3EYFA 4KTYA 3VMNA 1HXMA 1CL7L 3EOAA 1G7IB 1DQLH 3V8CA 3BQUB 1ZT1A 4KK9C 1OAKH 3GGWA 2WBJC 3QUYD 4ODXA 3VXPA 4G8GE 4O2EA 5ITFB 4JRYA 2AXHA 3GMOB 3VFOB 3CSBA 3IU3B 4TN9A 2EDBA 1IT9H 1R3KB 4XP5L 1CXFA 5CGYD 2IC2A 3P9WB 2NTFA 1UH3A 3VRJB 1VGKA 1Z3GL 3SDCA 1MRFL 4YHLH 4NZUL 4UILL 5IF0B 1IC5H 4MD4B 3HC3H 4Z0XB 1IGFL 5CP3H 1PZ5B 4G6AD 5DUPL 4KKLD 5T5FH 3BI9X 1VGEH 1QHPA 1YJDL 3IDXL 3KLAA 1NFDF 3AS2A 1H3UA 1QACA 4HQQL 3BZEA 5FK9A 5TPWL 3WCYA 4RMWA 3F7YB 4P4KC 1NBVL 4KKCC 2ZNWA 4LLMA 1KV3A 1B0GA 5IW6B 3QPXL 2EDEA 2JTDA 4P5TA 1YEDB 3MRBB 1RIVL 5AEAA 2MKLC 1TZGH 3CLFH 5TQ0H 5IVXF 1JPFB 1ZXQA 4D0CB 4HUVA 2COQA 1I7UB 1ROWA 4R4NC 3VJ6B 1BD2D 4LU5H 3QIUC 5GGTA 2LV4A 1IM9D 1D5BA 4DK6A 3M1BA 1W2KT 3HR5A 4LLUB 3WMSA 5DMIH 5FA4B 4MX7A 5C07E 4EDXB 5HVHC 1NFIA 4RA0C 5H35B 5T1LA 1T83A 3TIDA 3IDNA 4M61A 3MACL 1R3HB 3X11A 1A7RH 4R9HA 2F53E 2AEQH 1AGFA 3C6LC 5IB2A 3PWVA 5IV2B 3FB8A 3RGVC 1F4HA 1CF8L 4N8CH 4PY7A 3STZA 1DLHA 2K3TA 1A4KA 3F7PC 5HHOE 3W11C 5DT1L 5BVJB 4HJ0D 2C4FU 4OZGA 2E6JA 2GW5A 1XIWB 5T3XH 1V3MA 1X5GA 4DCQA 5MERA 1RUML 4V2BA 1SJHA 1QLEH 4JHZA 4HUUB 1FV1B 4M6ML 1EJ6A 3BN9D 1NUNB 4KROD 3DGGB 4ZUVB 1FE8L 4X7TB 5AZEL 4LLYA 4HK0A 4BQ8A 3QXWA 1RZ7L 3HCVB 3VXUA 4JRYE 3RL1B 4OM0H 5TDNA 1ZHNA 3SBWA 1LEGB 3QEQA 4ISVB 4JANB 5FUCE 1XF2B 4FABH 1GGUA 3DVGB 3U6RB 3CUPA 2G2RA 1FPTH 4Y88A 1F4WL 1BWMA 3VWKB 3K2MC 4LOUD 3H6JA 1BVLA 4BH7B 4I77H 2KPNA 2BY1A 1OSZB 3VD3A 3DGCR 5GGRA 1G7JA 1GHFH 4U6HA 2HG5A 2VR5A 4OIIH 3MRQA 3TO4D 5L9DL 4YIQA 4Z76A 3MLUH 3UBXI 1NBZA 1G6RA 2D9QB 1U8HA 3L3KB 1CFVH 2Z91A 4MNHA 1DR9A 1JF5A 3QFJD 4WI8A 4JFEB 2BDNL 1RJYA 1S7XB 4GXVL 1CGXA 1AHWC 3FOMB 3C5ZD 4O5LL 3CC5B 1T4KB 1H3VA 5C0BA 4ZODA 1J18A 3DTXA 1H15B 5KSAC 4PJDA 1INEH 1IGCL 3IVKB 3QDGA 1YUHA 4WWKB 5LQBH 1UJ3A 3SE4A 4DZ8A 4Y4HB 1RUPL 5HYSA 1F45A 5A2JH 3DVFA 4IMLB 3RY6A 5DMGC 1RK1B 3D87B 3PGDB 4DKFL 3BH8B 3RZCB 1F97A 4MAYA 5B22A 4CU7A 4WCYL 1P9MC 3PL6D 3TC9A 2FWOB 5IHLB 5E8EB 5CAYB 5IFJA 5GJSH 4FTVA 4JY4B 1M7IB 2X1OA 1JTPA 4N1EA 3QEHA 4RRPG 1B0WA 3OV6A 4FQHB 1CFSB 1G9NH 4S11A 2EC9U 3H9SA 5B38B 2BRRL 5FB8A 4X6DA 3UZEA 4AEIH 3SKOA 4XNYL 5EZLB 1EMTH 4F3FA 4B5EA 4WEMB 1QEWA 2PR4L 3D1MC 4EIGB 3EHBD 1JPST 1S7UA 4GKNA 3DSFL 4OCXH 3K1DA 5TH2B 5EO9A 2XY2A 4X6BB 2BSSA 4MB5A 2JCCE 1BAFH 4PD4J 4HF5H 1AR2A 1HQRA 5CHNB 3X12A 2AK1L 3L5HA 2A2QT 5DRZA 1Q0YH 2RBLA 1BIHA 2Z0BA 3S37X 2Q3AA 2I9LB 1D5MA 4X5XA 1BF8A 2VN7A 3S96B 3GBNL 3KR3L 1WZMA 2FJHA 4APQD 2E27L 3SKJH 1F00I 5HGGS 2IH1B 4N0RA 3DUHA 4LPVA 5HYJD 5A2IH 3KYOB 2VKWA 1MSPA 4JAMB 4JFHD 1PKOA 3HLAA 3D2UD 3ARTA 1EGJA 3SY0A 3ARWA 4RWHA 3HS0A 2F5BL 4FMFA 1N6QL 1CWVA 3MXWL 1TENA 4XC1L 2W38A 5FHBH 3HNTH 4NJAL 3T8XB 1DQQA 3F5WB 5CCKL 2ERJC 5K59E 3OB0H 3CFKA 4CGTA 1JV5B 4OD2B 1TQCB 5BXFB 1R5IA 4I48A 4YC2C 2GSGA 3VMPA 5FYKH 1K8DB 5SWZD 5F7UA 5FYJL 2AJXL 1RZJH 5D2LF 3S98A 3VE0B 5T3XD 3ZDZF 3HZYA 2DWEA 4KJQD 3NABL 1G7LB 1FZOA 3MXVH 2H2PD 1UC6A 4S2SA 4NIKB 2CR6A 4PD4K 1N0XH 2EH8L 1A5FL 5E2TL 5FYJD 1FYTE 1X5XA 1HXYB 2XG4A 1MQKL 5FYJU 1B3JA 3CDYA 4BUGA 4RWYH 3G6JB 5DGQA 1OWRM 4LSTL 1FORL 3QCTH 5LVEA 4F58H 1D5XB 1QLFB 2BJMH 1H8NA 2XPGB 3DO7B 3V6OC 5HY9A 4P2RE 2GJ6A 1VSCA 1CLYH 4ODHH 4XRCB 3V0WH 1RK0A 3DMMC 4BH8A 2W1NA 3DYPA 2BNQA 4LL9A 2R23B 4U7MA 4UT6H 4J3SA 1FNEB 3BAEH 1HYRC 3ARUA 5EORH 1MFEL 1CDBA 3KWWA 4KWUA 1NBYB 3C5JA 5F6HJ 4HHAA 3SGJC 5D7LE 1H3PL 3S4SG 4HUXB 1QHOA 4X5WA 2FX9L 3VFUB 1LO3L 2IBZY 3LEYH 5HDBE 5D72H 1VEPA 3CZFB 3QIWB 4I3SL 2WV3A 4EI5B 1CXIA 3O0RH 4GRLB 3N1FC 4LEOB 3PG2A 4XPTH 5ITBL 3ZTJH 3EGSA 4L1HA 4OZIE 3RDTB 1J1PH 4FFYH 4LNVA 4OSUL 4N9OB 4H25B 4JZJA 1MFNA 1N8ZB 4P57A 4KJPC 5JIHA 1U2CA 4ZTPL 1IGYB 2W92A 4QF1B 4PJBA 4MVBD 1FSKC 1GPOH 5ICZA 5CMAA 4Z78A 2GSIB 5SWSA 3CK0L 2XRAH 4QWWD 4UBDC 3LS5H 1I1AA 4P3CL 1KJ2H 1UZ8A 4Q9RH 2YXFA 4JO4L 4O2CA 3RFZC 4XP4H 5DURB 3TIEA 1UT9A 4S1SL 2ESVB 3SO3B 1FVDA 1BMGA 1IQDB 5CBEB 4LDEB 1O7SA 4H1LB 4NRXB 1TETL 4JG1L 3BPCA 1FGNH 1QSFB 2Q8BL 2OR9H 2APXA 2DKMA 3CGTA 3VFSA 5IHBA 4TTGA 3U4AA 5HVGB 2MCPH 2H6PB 4Z7OF 3MFFB 1T1WA 2EE2A 4JEGB 1A0QL 4WHCA 4Z7WE 1MCOH 3VFRB 5JHDA 4CN4A 1RHHA 4MA7H 5DVMA 2A0LD 3MLSL 2IMMA 3FHQA 4DKEH 4DZBB 1CICC 4JQVC 4AEHL 4N0YH 2QQNL 5IKCB 1LP9E 1FG9C 1MFDH 2VLKE 3MJ8A 2GEEA 4PJFE 4LHQB 1MJ7H 1UB5A 3ARDD 4QRTB 3KLHD 5JIKA 2UYLA 3O11B 3T3PE 5EOTA 5DJ8B 1BGXL 1QRKA 3MJ6A 5BRZB 3MOAH 3PGCA 4LVHB 3R0NA 3F12B 3FO1B 4KMTL 4IS6B 1BBDH 15C8H 2QSCL 1FFPB 1EHAA 2OZ4H 1QFWH 2D31B 4FQIH 1F3DJ 1NGXA 5E8PA 5H8DA 3UAJC 4JRXA 5F89B 1SEBA 1KPUB 1A9EB 1BIIA 4L8CA 5CZKA 5J9PB 2HLFD 3O4OB 1MAML 3D18B 3B2UC 2E7MA 2HKFL 1T5XA 3TJHD 5F7EH 2P46B 3THMH 2HFTA 3RWFA 3D0VA 5HI4D 2IANE 4PGCB 3GNML 1BFTA 4EUPB 1HCFX 4PJBE 3BZDA 4QHUA 4K23H 1HILB 4OGZA 1T80A 3VFNB 4YHNB 5KS9E 2V9RA 5E5UB 2VAAA 3GIZL 1JGUH 2KZWA 5CEXB 2W60A 1NC4A 1A6ZB 1OF2B 1ZSDB 1DL7H 1S7VB 2ADIB 2FATL 5KANG 2ADFH 1Q72L 3UJJL 2XWTA 5CD3B 4PGDA 4P2YA 3GHBH 4HV8A 1U8NA 3IETA 3PHQB 5E8NA 3HFMH 5A2LH 3ROOA 1UCTA 3DUUB 2NXZC 3Q48A 4HJGB 3UZQA