4ODSH

Unliganded fab structure of lipid a-specific antibody s55-3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
219
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAGSGITFSGYGMSWVRQTPDKSLEWVALISNGGSYAYYSDSVKGRFTISRDNAKNTLYLQMSSLRSDDTAIYYCARHKGLRGGTNAMDYWGQGTSVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S55-3 Fab (IgG2b) heavy chain
total genus 42
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odsH01
1NPUA 5FUOH 5CJXC 4LPVA 1QACA 3QXAB 1XIWA 3ILQD 5GIRB 3F58H 5LGKA 1LEIB 3N1QC 2BDNH 4HKXA 1UWXK 1EDQA 3JV4B 4CMHB 2ZSWB 5DJDB 1DEEB 3KPSA 2ITCB 1YEFH 3AXLB 4NRZB 1MFDL 3F12A 3IDMB 3QH3B 5E2WL 2EE2A 4BZYA 3L3IB 3UTPE 2K7QA 4IRSC 5I73C 5IVZB 1A1MB 1KXQE 3EHBD 3DX8A 3BGAA 3UJJL 3IDNB 3QPXH 5HPMB 4KMTL 1BQHB 2JK5B 4PRHA 4JRXE 1FZMA 1FFNB 1LE9B 4U1HA 5L6YL 3PWPE 1Z2KA 1EPFA 1N64L 1C7TA 3O4LD 1IM9D 3WFEL 2NTFA 1OW0A 3QFDB 4NFDA 4TVPL 4P5TA 3IXTB 3VW3H 3ARRA 1JYVA 5CJOH 1MAMH 3TNMB 2K3TA 4HWUA 5DF0A 5GSVA 3IDIB 2R8SH 3BIKB 1QSFA 3RBSA 2J8OA 4AZ8A 4HULB 1S5IL 3HTLX 4U2YA 3MV8D 2ICEB 1G7QA 1YA5A 3EFFA 3HZMB 3I9GL 4PLKD 3MZGB 4JO3L 3EHBC 4G7YH 3NTCL 3W11C 4FP8H 5CIPH 2X4UB 3RTQD 3QHFL 4E41E 4OUOA 4POUB 5I74C 4KKBD 1HOCB 5I1HL 5C08A 2XOTA 5D70H 4M8VA 1T4KA 2FYYB 1VADA 1WVZA 2IQ9L 1IQDB 3BP6B 1CL7L 4RA3A 5CEZE 3TN0B 2C1PA 2ZCHL 2AJVH 2V9QA 4NQSA 1FORH 2OJZH 2WK2A 3CFDA 3Q48A 4M6OH 2HJLB 4MAYB 1G7PA 3T1WA 4ZG1A 4BQCA 25C8L 2DICA 3MZTA 1D5ZB 5FO9B 1ED3B 4XXCA 2FHFA 2QR0A 4HFUH 5IJKA 4Z7VE 4LSRH 1TETH 5ID1B 2XQYG 5HGHB 32C2A 1RHHA 3B5HA 1AGFB 3MNVB 1DBMH 1UKTA 3HI5H 4X7CC 1GPOH 4JO1L 1U3HB 5F7KC 4EQ2A 5DK3A 5EU5A 3PGFL 3GSOA 1KN2H 4OKDA 4MA7L 3QDGE 3IETB 1UB5B 5JORB 3OHXA 1KV3A 1IAOB 1C16A 3I6LE 4WI9A 2Q8BH 1CDYA 2EXWD 2NLJB 1C5DA 2QQNL 4H1LB 2J8UE 4O02L 3X3FH 2BMKA 1DQTA 3OMZA 4OLVH 1YEJH 3V95A 2HMID 1YN7B 2BNUA 1WFNA 3IRPX 4FN0A 3GMRB 3IS0X 2NNAA 4CNIA 4HG4J 4ZUWA 1XH3A 1PKOA 1F6AA 1DSFL 4ODVL 1SJVA 1KTDB 4U6XB 4HCRH 5EUOF 1ZV5A 2H6PA 2QHRH 2VQ1B 1FDLH 1K5NA 1N64H 4EXPX 4MAUH 2FEDD 5LGHL 5EFIA 3IFLL 4KKAC 2HN7B 2GY7B 3HG1D 5BOZG 2D0HA 4M6OL 2H45A 3A0OA 2CKBB 3I02B 4BFBD 4ALAH 4ZUSA 1CL7H 3P77B 4MLSA 1SM3H 3HMXL 3EGSB 5EOCL 2NX5A 1V7NH 3SGEH 4Y16A 4P23D 1KCLA 3ZKXB 2YA1A 4NCC2 1EUUA 4FP8L 3SKJL 2VAAA 4GXUN 2R1WB 2OQJB 5DS8B 2EZ0D 3THMH 4NZRL 3BPLB 4UDUB 4O2EB 3V52L 4JM2C 1FV1A 4JANB 1W8OA 1J87A 1NC4D 5DMJB 3RVUD 4M6NH 2F74A 2JCCF 5FUOL 1AGFA 1QO3B 1AO7A 1QFHA 3MJ9H 3DSFH 2VZUA 3KPNB 4U6HB 5DD5H 1RAMA 1Z9SA 4TNWK 3R4DA 4XP9H 1JTOA 1LO0L 5DSCA 2EDHA 3CX5J 1WTGT 4X9HA 2R1XB 3DRTB 5HDBE 3K2UL 4Y5VC 3UTSD 5CKAA 2DJSA 5D6CB 1D6EB 1IBGL 3HZVB 3VXTA 5IMKA 3LQZB 1TETL 2X4NB 3RA7H 3V7AG 3H8NA 4UDTB 3S3PA 1OSPH 1A7BA 4KRMB 1JGEB 1I7ZA 3M17B 3O8XB 5F3HA 2A74B 1I1YA 2ICWA 3WNOA 4F7CB 4CVXA 3NH7L 4PRPB 5CAYB 1LO5A 5TF1H 3FT3A 4Y4HA 1T5WB 1JRHH 3HC3H 4LSPH 3MLTA 3LEVH 4PRHE 3MRCB 4U0RB 4KPHH 4LLQB 3SDCD 3QIBB 1FHGA 2CRMA 4KVCH 4PJ5D 4PR5A 5IV2A 1K8IA 2AXHA 2A77L 3RX8A 4JPIA 1R0AH 1H15A 4KJYB 5IQ9B 3VGBA 4GUPA 3BJ91 3HPJB 3FOLA 3WXWH 3LQMA 4UBDD 5E8NA 2VNCA 3B9EA 4UOW1 1XR8B 1YNTA 2JJVA 4OZHB 4YFLF 4L9LC 1FNFA 4JHAL 3BP5A 3DX8B 3WNMA 3W81A 4OJFH 2Z8WC 5E5UB 3IAGC 2XTLA 1QKZL 3HZYB 2ZCKL 3TBYA 1G7LB 5MHSD 3MRIA 4ODHL 5GRYA 3KPSB 2P42B 1FVCB 3AY4C 4GRWF 4PLNC 1CDBA 4PJCA 3MCLL 5F7EH 1CICC 5D7JA 1HE7A 5DFTA 1J11A 1QD0A 5JHDB 4OM1H 1BF2A 3FQWA 2BY3A 5L8LB 4OF3A 3N0PB 1CDJA 1U8IA 1I75A 1QVOA 1MHPH 5MEPA 1PEWA 4K71C 4G8FB 2XN9B 5E8PA 5FOBB 2Z35A 5DD0L 5AZ2L 2CH8A 5JHDA 1A7OL 4JKWA 4MD5A 3IF1B 2FBOJ 2UWEA 1XF3B 1BFOA 4WW1B 3LD8B 3VG9C 1MVUA 1F6LL 3GMNB 2NMSA 1H3PH 1M1SA 1CDGA 4FRWA 4YBQC 4DUXA 5JO5A 1A4JA 1L7TL 1TNMA 2DLFH 3EYUL 1BBJB 3EOTL 1H3VA 2R4RL 3SDDC 3W5NA 1JGLL 5IOPB 3C60C 4JVPA 3VXRB 5HHOB 3G5YB 4P48A 2F19L 4R0LC 1WBZB 3S37X 4LHUA 4MDIB 5CP7A 3BP5B 4BZ1H 3GBLA 4POZD 4YDIL 1FP5A 4TSAL 3MV9A 4LHJB 1MHEB 3BMVA 3PGDB 1YNTB 3QIBD 1UJ3C 3MOBH 3ZMRA 1IM3B 4O58L 3GJFA 4HCRA 3CPLA 1I1RA 3O3BB 1S9YB 5E5MA 5K9OA 1S7TB 1D9KC 4KROC 3HE7D 3G6JF 3O6LH 5ISZE 5GISH 3WL9B 4LSQL 2MHAB 5LQBH 2XG5A 2R0WH 4PJ9B 3MLTB 3BHBB 3BGFC 3S35H 1BQUA 5JPNA 2BY1A 4FQ2H 1LO5B 3QJFA 4O2FA 4U3CA 4XAWL 4R6UA 2BNQA 3D85B 4Z7UB 4Z95H 5DRXB 4S1RH 4IS6B 4XGZA 3BE1L 4BFIB 1CF8L 2A73B 3QDGD 3STLB 3WUZA 5EB9A 4JR9H 2DM2A 3PWVA 2D2OA 4K8RL 3UBXB 4GO6B 4K9EC 3LQZA 5HJ3B 4IDJH 2X1QA 1KGCD 2Z8SA 4QHNA 1UKQA 3MV7A 4E9LA 5HHXH 3D0VA 3Q6FB 3CSYB 4NN5B 3MJ9A 1OTTD 4H1LG 3S98A 2NY5H 5J1TC 4H1LH 1G84A 3K8KA 4JAMB 3VFTA 1QR1B 1RUAH 2BVPA 1OQOA 4BZ2L 4X4ZA 2BVYA 3VXRA 1F58L 1NMAH 4JFHD 1ZHNA 3KPRD 4YO0A 2DM7A 3FB7A 1PY9A 1EFXB 2NR6C 3RL1A 3VRJA 4NUJA 3KPRE 4UDUA 4V2BA 4WW2B 3V0AC 4HSQA 4L3EE 2O61B 4NBZB 2BHZA 1I1FA 2IANA 1BBDL 4N1HB 3F65A 3HHRB 1BHGA 1YPZE 3G6DL 4DKEL 2OBGA 5DT1L 4OLYL 3TGXA 4U1LA 2GW5A 3WIHL 1FFPB 1C1EL 3QEGL 5FYJE 1MPAH 5I8KL 4JDVA 2O5YH 4ODTL 3WLWC 2BNRD 4R4BB 3B9KA 3F7VB 3BOVA 1EX0A 3DX6B 5CHNA 5J13B 1BOYA 2YBRB 5J9PA 2OTUB 4NHUB 3SHSA 5T33L 3GBNH 5JPMB 4RBPK 4LGPB 3MRIB 4NO2B 3QWQB 5ETUA 1AI1H 3OKDA 4MS8D 1KTDA 5EULV 2B7DT 1JPTL 2FHCA 2XTJE 4FTVA 3U1SH 4GW5A 2B4CH 3QCUL 5C1MB 3LZFH 2YC1B 3UTQB 4N0CC 4YHKH 5TDOB 5AZEL 3C6LD 2NLJA 1C5CH 3NIFE 4FQHB 1NMAL 5BS0B 5E8NB 2WWMC 1G0YR 1YY8A 4RMRA 4C58B 4RX4A 4Y4FC 3S88L 1T04A 5ALBL 3FQNA 1ZVSB 4KJYA 4LHUD 4L4TD 3WUWA 1NGYA 1X4ZA 2XWJB 3GSOB 1EMTL 3SDXA 3HC0A 2J2ZA 1YEDA 4MJ6B 1XEDA 1NDMB 3AY4A 4P9HL 3IVKB 1KIQA 1WCQA 4IDJL 4CN6A 1U3YA 2ZNWA 1XT5A 1F97A 4FZ8H 4RSVA 3QIBA 4PGJA 3DURA 3E8UL 1RIVL 2GYSA 3QUZC 3AREC 3R1GL 3MODL 4JZJA 2YK1H 3AMKA 4HIIA 2NY0B 4CN1A 4YFDB 1X3DA 1WBXA 3TCXA 1T6WA 2VL5A 3D9AH 4GMSL 4PV8A 5EUOB 4CKVX 5I2IB 2A74A 3QDJB 3V5KB 3B4NA 2DJUA 4V1DD 1FYHB 1T2QL 4ZPTA 5EO0B 3S4SA 1RUML 5EO0A 3S4SB 4I1NB 4I8DA 3L95B 5F7WC 5LXGH 4KJWC 5HGBA 3PGCB 1JHKL 2G75A 2X70B 1XCQB 5CS7A 4MJ5B 3MACH 4YUEL 2HKFL 5DURB 3WD5L 3TV3H 3D69A 1NC4B 4PJAA 3C09B 4YXHH 3TFKC 5IKCB 1WWWX 3DTXB 3VFGH 4L4TA 4NQEE 4YNYA 3IDIA 5EU7E 1ZLUH 1UM5H 3NBNA 4JPVL 2JE8A 2V9TA 4PJCE 3BISA 3MXWL 1RK1B 1J0ZA 2Z8RA 1QFPA 1M7IA 2EH7H 2HMIC 5E1AA 5DRNB 5EN2A 3U9UA 1RV6X 4P2RD 1G6RB 4H5SA 4HUUA 4HT1H 1FG9C 4O9HH 1KBGL 4XHJD 1LE9A 4HKBA 1N7MH 4PRHB 4ZUSB 4LCCA 2APWA 1UZ8B 4OCSH 1OM3L 1WV7T 4M1DL 5FYJU 3QUYD 5IMOB 5FUCC 1P7QA 4TUOA 4EI6A 3V6OA 3TWCH 5D72L 3DUHA 3P9MB 5IHUL 3CK0L 5J8OA 4AK1A 1GC1H 3G6AA 2ADFH 3MUHL 5EC1A 5FM5O 2AXFB 4PUBL 5JLZB 4XPAH 3G6AB 5BS0D 1FNEA 4PRAB 3KYNB 5HI5D 1BQLL 1RSFA 3BIBX 1VEPA 3TLRA 5B3NA 1DJSA 1XH3B 3C5SA 4PJGB 4L29B 4PPTA 4M3JA 3UXFA 4APQC 5E2UL 4WU5A 2F9BT 1XGPA 3A6CL 3ZKSD 1F45A 1ND0B 4F8TA 3PIQB 1UZ6E 4P46A 5IHUH 2XNAA 1SBSL 4FQLH 5D96B 1M7IB 4DAGH 2NQCA 1GXEA 4MZ3A 3QG6A 4RMTA 1FFQA 4FZ8L 2VUYA 3RL1B 3L7EB 1KLGA 3HG1E 4EZMA 3DTXA 1VFAB 5ADPH 2UZXB 5DVKA 5IKCA 4UIMA 1RHHB 5T5NF 3VFNA 1NC4A 3GO1L 2JF1A 2QR0B 4IRZH 5HHPA 4B0MM 2BVPB 2X9WA 3D1MC 3L1OL 3AGVA 1QQDA 4AY0A 4JKPH 2ZJSL 3EYSH 3QNZB 1JHLH 3DVFA 4N0RA 3QO1A 1X5HA 4PB9H 2ZCLH 3WIIL 4S2SA 1WJ3A 1TJGH 4L1DA 4L8CB 2NY3D 1MRDL 3C6SB 2G9HB 2HJKB 2Q1EA 2R39A 1CXIA 3MRHA 1IQDA 1YECH 4AM0A 4PV8B 2BVQB 2YPLB 4W4OC 5ABDE 5JPNB 3EOBB 4PIRF 2DTML 3IJHA 1EBPA 3AM8A 1JGUL 3ARQA 1MHHA 3VI3E 1FL5B 2WANA 4O2CA 2FH8A 3D9AL 4N8CL 4LPUA 1N0XL 1KT2A 2HA1A 5EU3B 1Z6JT 3IDYC 1Q9WB 5D8JL 1ZGLM 3L3GA 2OX5A 2XRAH 2L7JA 3IXTA 5EA0H 3VXUE 3FQNB 3V79C 1T04B 4AL8H 2AJUL 4G6FD 1RIVH 5D1XD 3QCTH 2R0KH 3GSNL 1MLBA 1YMMD 1T0MB 5CEYA 3UZEA 3SGJC 4LPYA 3GUTA 3LQAH 4TSBH 4NDMA 4M1CC 3SCMC 2V7HB 1I1AB 2W0FA 4WCYL 4RGNE 2DTSA 4BSWA 5DHVH 4MDIA 3T0EB 4HPOL 3TA3C 3BKCH 5D7LE 1ES0B 1T20B 5HHOA 1MJ8L 1G7IA 3ARED 1AFVL 4NRZA 4KQ3H 4HWBA 5B8CA 4NO2A 4HGKC 5EOCJ 2GJ6E 1RURH 3H42H 4M7ZC 1LK2A 4LF3A 1MVUB 4Q0XL 4X6BB 4OT1H 4WW1A 5C3TA 4IIQA 5ICYA 1NLDL 2UWEB 1FE8H 4L4VB 1Q9LA 2JJWA 3L9RA 4KK8D 1ONQB 3D39D 3PWJB 4NNXA 5DMGD 2CJUH 1Q72H 1LEKA 4PJIF 4LGSB 2BFVL 3G08A 4X6FA 4G8FA 1I9JH 1IC5L 2QV2A 1RJCA 3P73A 1YMHB 1PZ5A 4JFDB 2Q6WB 1U92B 3RVWD 4FTVD 4D0CA 1NCNA 4F80A 5C0CA 43C9A 3WDJA 2DQTL 4NRXA 2AKRB 5E6ZA 5C0RH 2ED7A 1CIDA 5D7JB 1X5GA 1RJLA 3CFBB 3O6LL 1N5YH 1YNLH 1X7QA 2DTMH 5GPRA 4Z7VF 4PJFE 4ACPA 5IHZA 1ZHNB 4YK4B 5E95B 1UWEH 3GMPA 2VLRE 3KPMA 1MELA 3BPCA 5IIEA 1F4YH 5CINH 1H9VA 4I3GA 5ACLA 2OTWA 4RIRA 3OSKA 1MFBH 1S3KL 1GGBL 4ONFH 3RHWF 4QRPD 4PJHE 4F7TB 3A6BL 3ARFC 5DJZA 1GYAA 2J5LC 3P4NA 4AQ1B 2FJGA 3I2CH 1U8HA 1CI5A 1MIMH 1YEKH 2CIIA 4PRPE 4G6JH 4TQEL 1JHLL 4PRNB 2WMPA 1J5OL 3LH2H 5CMAA 4UTAL 4YQXH 1NCDH 1QP1A 2EEAA 3WEXA 2FDBP 4LBEB 4XGZB 1PDKA 4ONGL 3S4SG 5FYKE 4ZAKC 4PJ5A 3HB3C 5HYSB 1T1XA 1K8IB 1F4WL 4UT6H 3WV0A 3FT4B 5I8CB 3TVMA 2DQDH 1QSEA 1A9BB 4XMPL 5I1CL 4EDXA 5JDSB 1B6DA 3RI5F 1EHLH 3SE8L 3RL2A 5JW4N 1EGJH 4XCFH 3LKOA 2KDGA 4PRPA 2CLZA 1JVKA 4AMKL 5J12C 2GFBA 2EIEA 3B2VH 4MA8H 2VDRH 4LPWA 4XXDB 2VN7A 1V3KA 5F9WC 1CGSH 1UB6B 2GJ6A 4YHIB 4HXBH 3HE6B 3OBAA 5MERA 4R26L 4HG4K 3T4AA 2DIAA 1JPFA 2YHGA 1BM3L 2W9EH 3C2AH 4F2MA 1FYTA 5HY9B 2V7NB 1EEQA 3EUUA 4OZFG 3ZLQC 5EC2A 1BD2D 3ROLA 4OV5A 2HT2C 3OTTA 2JCCE 1NAML 3KPMB 3MV8B 4IOFC 1BBJA 4GRWB 2J8UA 4OIAA 4TOYL 1AGEB 3CDGA 1EEYB 2P4AB 1CR9L 2YUXA 3L3DB 2X1XR 4TVPE 1MHCB 1AJ7L 5E6IB 1HDMB 1MNUH 2HRLA 3BUYB 4U31A 4XRCA 3GMQB 2NX5D 2M1KA 4HGMA 3NPZB 3KLHD 4KK5D 5ESQA 5KS9B 5L2KD 4XPHL 2W38A 3RAJL 1OSZA 2CLVA 4P2RE 5L0QC 2EDJA 2X4RA 1J10A 5HI4D 2AXGA 1ONQA 1RPQA 4NQXA 4X7SH 1I1AD 4YFEA 5DK2A 5HYIA 2H3NB 4S1SL 3QDJE 4U6VL 1GAFH 2ZWLT 5JHDE 3QZWB 4UT7L 3VGHA 2PCPA 4XC1H 2GJ6D 3BKML 3WFCH 4JFDE 4J3SA 3TBYB 5EWIL 4IJ3B 4NP4H 1V3JA 5CJQL 5JOPD 5SX5H 2ERJC 2V2WA 2VZ3A 1J0IA 1U3HD 4S0TD 3RY5A 3AB0B 4MCYB 4CBPA 2GHWB 2CK0H 4OD2A 1A6ZA 1F2XK 2BMKB 4MJIB 3GUTB 1NCBL 4KRLB 1U0QA 3CFJB 4DGYL 1GHFH 3QG7H 3DXAA 1AGDA 1S8DB 2FO4A 1EJOH 5IFHL 5E08H 4GAYA 3O0RL 1G9MC 2IBGA 3V6FB 4L8SC 2X1PA 1GGIH 1F4XL 4XI5D 1BF8A 1GGCL 4IMLA 4ZDHA 3MNVA 2DKSA 4JM2A 4GS7C 4MB5A 4QRUA 4LARL 3RQ3A 1MWAB 5DHVA 4RAUB 2E3VA 5ADOL 1ZKAA 5F71A 4PJBA 2QHLA 1ED3A 4HV8B 5INDB 2CDGB 5DI8A 2ICWB 3SE8H 1ZLWK 3M17A 2EE3A 4DKFH 4PJ9C 2A9NH 4X80H 3FQRB 5BW7A 1IGJA 3CFEB 4PJDE 4JPKH 3SPVA 1CGTA 3VH8B 5C70A 5TPWL 1INDH 1MAKA 1NCAL 2NXZD 3BI9X 4QXGH 4GRLA 5ALCL 2JJSA 4KZEL 4Q97A 4UOJA 3GBNL 3EW3B 5IB3A 5D7LD 1CDIA 5DQ9B 3REVB 2QQKH 1AR1D 2H8PA 4KKLC 1QO3A 1A64A 4Z0XA 1IBGH 4UIMB 1QLEL 4X0KA 3MJ7A 4Y4HC 2IGFH 1DE4B 2V5YA 3RVXD 1QSFB 3CXHJ 4M7LH 1BAFH 2IPTL 3X3FL 2UYLB 1JPGB 3MV9E 4OFIA 4HJGB 2OQJA 3DV4B 2VAAB 2MKLC 1FO0H 2KZ1B 2IAMB 1BBDH 3BVNB 4P46B 4WWKA 5IBLD 1A3QA 1A1OB 1O0VA 3MLSL 3QWOB 1LP9E 2E7BA 2I07B 2OP4H 4AIOA 4CVZA 4JO1H 4N0UE 2OR9H 2MPAL 5B4MC 4L29A 3GSVB 3VG9B 2FO1A 5BZWB 1LD9B 2FEEL 3PWUB 1AC6A 2OXGA 1M05B 4MVBC 3M8OL 1CXLA 1U8LA 3O8XD 3H9SE 3FB8B 5C7XH 5GZNC 2VQ1A 3GJEA 4P4RA 5SWSB 1DQDL 4TTDC 3CXHK 5DJDA 4E42A 2WUBL 5FDYA 3VFSA 5A2KH 4HKXB 1YJDL 1QBAA 1LEIA 3KHQA 3EYFB 4JG0L 4WFEE 1FGVH 4ZQKA 3KLDA 4QY8A 1JCKA 4DKFL 2HJFB 4FNLL 2YPLE 4XVTH 4LCCB 3BEVB 3CJJA 4J12A 4NKMB 3S3SA 1RY7B 1II4E 3ZTNL 1IAKA 4KFZC 1YUHA 1DUYA 3M8OH 1C16B 1RZ7H 5EN2B 1UB5A 3O6FD 4KHXL 5GS2H 1RK1A 2ZPKH 5E9DE 1F3RB 1A6WL 2OR8A 4P9HH 3MCKB 2HH0L 5E8OA 4DW2L 4WHYG 1Q9OB 3GNMH 2DF3A 2LFGA 5ICXB 5FB8B 4NCC1 32C2B 5FV1L 1ZANH 4OFPA 3BH8A 1FO0L 2RBLA 3OKLB 4MXQD 2IMNA 4ODUA 1WZMA 3D2UD 3PGCA 4LVOC 1HCFX 1D9KA 3O2DL 4P3CH 4JDZB 1AGBA 2DD8H 3EDKA 3DROB 4HZLA 5E9DD 3SJVB 1QLEH 1WEJL 1VFUA 3MXVH 1JPTH 2HT2D 4K7FB 2VDNH 1MCWW 3AS1A 1NGQH 4K3DL 2DWDA 3ZTJH 1E0OB 4ODBD 4TRPH 1M6OB 3LB6D 4PRPD 4GH7B 3QFJE 1HYSD 4M7KH 2JIXD 3K8LA 5CP3A 3P4LA 5DUBB 1I7UB 5TQ0L 3DUSA 1KPUA 4P4KA 2OJZL 1NFIA 5KG9A 3QQNA 5EIIA 2P43B 5K33A 4OZFB 4RGOL 4XBEL 5C0ND 5HPOA 2YKLH 1OT2A 1X5YA 3NMEA 4LFHG 3TVMC 2OI9C 3TNMA 3EYOB 1FAIH 3WUWB 1ZVSA 3T1FB 4LLVB 1BJMA 1QSFD 3EZ8A 4OCRL 3QFDA 3OJVC 1W8NA 4JHWL 5BS0A 1A3LL 3WS3B 4NQTA 3O3EA 4PJFB 4KROD 1P6FA 3IJYA 2P45B 5C0FB 1DQMH 4DN3L 5KJRL 5MEQB 2CMRH 3HB3D 5F97E 1JZ5A 1MAML 1S7XB 5ACZB 1TVHA 4X7DC 4GW5B 1QNZL 2EYSA 3C09C 3BPLC 1T22A 2NY7L 4YHPA 5ESVB 1P4IL 2VXVH 4P3WA 2PYEB 5D1QA 1PZUB 1D5BA 1OP9A 2RB8A 3A6CH 1LP9B 1X5XA 5ITFA 1CK0H 5KW9L 4LP5A 4XNUH 1YQVL 3B9KD 1G9NC 1NGXB 1J1OH 4XNYH 4GG6F 3RVWC 5C0CE 3DUUB 4HMEA 4CGTA 3O3DA 5GS1B 4OZFH 5GIRA 3RWDB 3RZWA 1HZHL 4TNWF 3MA9H 1F13A 4CU6A 5B4MD 5KSBF 4RAVB 2X09A 4FQ2L 5A40E 2AQ1A 5TE4L 3QQ3A 5T3XD 3PJSB 3TBWB 2QADC 1DDHA 1T1YB 5JR1L 5F1NB 1K3ZA 2BSTA 2GITA 2IANB 2XPGB 4YDVB 1E4XI 1B0RA 2MWCA 3NFPB 3L3KB 5T5NG 1CE6A 4FTVE 1NAKH 4OCSL 1ZSDA 4GRMB 2HRPL 2C7UB 1N7ML 4YZFF 3OR7B 3S36H 4YO0B 1MCOL 4KK5C 1W2KT 1BD2B 1OY3B 1A6UL 4H8WL 4O58H 3CVIL 4PRIA 4K8RC 1XIWD 1ZLSL 1MCJA 3IDGB 4FMFA 4QHUA 2MSPA 3K8MA 2FB4H 3L3HB 3KVQA 4M48H 2AQ2A 1YEKL 4XWOD 2FWOA 2KBGA 2VR4A 3CZJA 5C0JA 1R5WB 3FO2B 1QBLH 3FKUS 4TULH 5C0BB 5HYEA 4XPFH 5EWIH 3H3BC 4K94C 4GRWE 1OGAD 1EIBA 2A73A 4GKSA 3NAAL 4XP9L 4Z0BL 2WQRA 3STLA 1OB1B 2YWZA 3U79A 1PEZA 1WLHA 4MD4B 2H1PH 2E27H 2R4SH 4HXBL 4M6NL 1EAPA 4LLYB 5DRZA 5D7IA 1HHIB 1KLUA 2ADIB 4RCAA 4GW1A 4HMCA 3JV6B 4J2XA 5M95B 2X9XA 1ZA3B 4ONHA 3U6RA 3QFJB 4EEEA 3EO0B 1Q9KB 3LN5A 4WI4A 4PRBA 1MJ7L 4EVNB 2YD2A 3QAZC 4PRDB 2C26A 1KB9J 4I18B 3SE4C 3E8UH 1H5BA 4HBQA 3W0WA 5IB4B 3GSXB 2PXYA 4ELKB 5E8EB 4NM4L 3HAEA 1DQJA 3HNSL 5D1XB 4OTXH 2VDPH 4NO3A 1WGOA 3TPUA 2DQCL 3GM8A 2X9YA 4J8RB 3ARBA 1U3JA 4WUKH 2HFGL 5HHMB 2A83B 2IEPA 2WNGA 3BT2L 3DRQA 3PHOA 4KGLA 3SDXE 1ETZB 3ECBA 2Y23A 2RFXA 1JPSL 3CVHL 3VXUB 4AEIH 4JM2D 5DYOB 3BH9B 3NN8A 4LLDB 1UGNA 4K9EH 3RWCB 1AXSA 1U8OB 2E7HA 3ARGA 4M9OA 4M5YH 1VHPA 2F8OA 4WCYH 1MWAL 4NHCH 2VLKD 1Q0XL 1R3KA 2ZUQB 3V9FA 1F4YL 4YFLI 1U8JB 4PJ7F 5J6HA 2VLLA 2O5XH 1AP2B 1QBBA 3V6ZB 3LEYL 2AP2A 3QQ4B 2P8MA 4J1UB 3BQUD 1PJ9A 3MRBB 4KVCL 2DQEH 2XICA 1QRNB 3STZB 3QDMB 2YWYA 5IMMA 3FQWB 4CN4A 3W0WD 4TVSa 1QLFA 4IIQC 1IAIM 4JY4B 1NGWA 4LKCA 3S9DB 1HXMA 2CDEA 4ZSOA 1CL7I 3BZDA 3NH7H 5IW6A 3QUKA 3L5WA 2ENSA 3BKYH 3F5WA 2D4FA 1BFSA 5DVLA 4EUPG 2VDLH 2AAVA 2GK2A 2PYFB 2X6MA 4Y2DA 4PJBF 4XHJC 1P2CB 3O3AB 5FO7A 3HMWH 5A2FA 1J0JA 4HC1L 4EDWL 5SWZB 3EDDA 2BSED 1RURL 3H42L 5ITBH 3G5XA 3HCVA 1KCUL 3OKEB 5IVXE 3X14B 5JUEL 1V3LA 1WIOA 2VSCA 3CVHH 4F3FB 4PJ8B 2VRAA 3R0NA 2D7TH 4N9GA 1LNUB 1CD1B 2XZQL 2HFEA 3NTCH 5GQBA 3ZT6A 4JFDD 5F7MC 2FJHA 3KS0J 2X4PA 3K4ZA 4Y2OA 1ZT4A 3VG0L 3MJ6A 1BZ7B 3ZE2F 5BZDA 3HPLA 5EPMB 2NY1D 3GKZA 4BQBA 3S3JA 4NT6B 3R8QA 4FABH 1N8ZB 3SQBA 3OXSB 3D3VD 4LFHD 5I71C 2XA8L 1RZ8B 3PWPA 5D1QC 1AQDA 3MNWA 3W9DB 3O9WB 4XI5C 1A4KB 4QHLA 4PTUB 4BKLB 3I3EA 5AYUH 4W70A 4NKDA 4F7EB 4OGXH 2HWZL 1I1YB 1IC4L 5F3HB 5MHSE 3UPCA 5IW1A 1S9VB 4EIGB 1A6AA 5MI0C 4L3CA 2CRYA 5KVFH 5D2LF 3JTTA 3V8CA 4N8VG 1QR4A 3PQYD 2G2RA 1CTNA 3DRTA 1MREL 5FGCB 4AIZA 3T2NL 1DBKH 4G42A 2OR7A 1JN6B 1GC1L 5HVFB 5IT2L 1LO3L 3KJ6L 5I0DA 3SOBL 3QEQA 3ARDD 3E6FA 1P7HL 2AJYL 5C2UB 4BH8A 3KPPB 2NCMA 3O6KL 4F9LC 4G7VH 3QDGB 3RGVA 1KIPB 4XAKD 5I71B 3UC0H 4GLRI 4P2RB 2F19H 2R1WA 1OCWL 3GRWL 4Y1AB 4PGCB 3NVQA 4JZOA 1JHTB 3WN5C 1UJ3A 5D7LA 3QUXD 1FVDA 2VXQH 5ID0B 3VMPA 5J4MA 4DCQB 4P5KA 4A6YL 2DM3A 5C0NC 4KJQC 4LDEB 2X4QA 5AG9A 2V5TA 1JGUH 2W59A 1CU4L 1EZVX 4PJIE 3BXNA 5C0IA 1D9KD 5DDHB 1MH5B 1KENL 1IKFL 2DN7A 3VJ6A 1LGVA 3U0PA 3D18A 2N4IA 3MR9A 1K5NB 5GGSB 3MLWH 4RGMB 4Z7UE 1NBYA 5EU4B 1NMCB 1QYGL 1SEQL 4KAQL 3FMGL 5IF0A 1BWMA 4X9BA 4X4MA 3MPCA 4B41A 3IB4A 3FO1A 3WIIH 2O26U 1J1OL 4KQ4L 5GSRB 1PY4A 1EA9C 2BNUB 3FFCE 4BYHA 1A7RH 3QHTC 1L6ZA 4DZBA 2F54A 3ARFB 5KVDL 5IB1B 2VH5H 3MRRB 1Z3GL 1P4BL 2VDKH 1K2DA 5E24E 3OHXB 3RNQA 3QI9C 2VLRD 3PDOB 3CZFA 1R3HA 4LCYB 1GGCH 2M8XA 2Z31C 1MY5A 1JZ8A 4NQDE 4WFHE 4DN3H 1Y0LA 1U8QA 1QFWH 5E00A 1Q0YL 2PYED 5I1KL 5ERWA 1XF1A 4U1IB 2YXMA 4GRLD 4QWWC 3B3IA 4WWID 1EVTC 1CE1L 4X5WA 3UO1H 3FQXB 4JB9H 1RZKC 1KCRL 3LSOA 1C5CL 3BPOC 4Y4HD 1IEAB 3MRQB 4X4YA 4YHZH 1FZJA 5IQ7L 1BFVL 1CLZL 4XCNB 3ULVF 5B39A 3VXSA 5BVPL 4KRPB 5I19H 1FLRH 2AW2A 4LSPL 1B88A 4LNRB 3VD3A 5TF1L 5TQ0H 4PG2C 4QRTB 1D6VH 2FYYA 1IKFH 5GGUA 3VA2C 3F58L 3SDCB 3I6GA 3QWRA 4LCUA 5E1HB 5C6PB 3OXRA 3QAZB 1T2QH 5IVXA 2WW8A 4LPCA 3QXUA 2EH8L 5BRZA 3ARGD 3JWDC 4HKJB 3MTRA 1UZ6F 2WBJB 4QXUL 2Z92A 5SV4A 4GBXB 4PLJD 2W65B 3ARDB 4OZHF 2CUHA 4PJDB 4MWFA 3BESR 1FLTX 4I4WA 4JFYB 1F3DJ 3HA0A 1LO0H 3FT2A 5TFSL 5ILTH 1QZ1A 5F3BB 4OGAD 3KLAB 1IAMA 2ILLA 2VUOA 2VQUA 3U7YH 3MJGX 4PJHA 1EEZA 1FFNA 2EEDA 2AJYH 4RNRA 3VGFA 2MKWA 3IDNA 3LRSA 5EU6B 2CIKB 5DXWA 4ZUTB 3ALWA 5ALBH 3IFNH 3H9ZA 2OK0L 1EERB 2R1YB 4XH2A 3HR6A 4U6TA 4X6DB 5JIKA 4PJBE 4IOFD 4UV4L 1NJ9A 3OAUH 2ARJB 3VGDA 1KGCE 1ZS8A 5E2TH 1QSEE 1CGSL 3O4LB 2EDQA 3H9HB 4MAYC 1RZGA 4JG0H 1PKQB 4HKZB 3ZO0A 4X6CF 2XKNB 4XPTL 3F7QA 4PGBB 5KSBE 4R3SA 1PBYA 3WFHA 1DVFA 2CUIA 1HKFA 4NPYA 4MX7B 4S1RL 4LEOA 4KUCD 1A1NA 2X4TA 2A9ML 1A9EA 3H3PL 1JWMA 1S7QA 2Q86A 1TTGA 5J57B 3UJIH 3CAFA 4RMSA 3MLRH 3VWJC 3IU4H 2AJ3A 4KV5F 3HMXA 4OLVL 4EOWH 3CFKA 5L88L 5D5MF 4OI7A 1N26A 2LU4A 4X99A 4YQXL 3BFOA 1NLBH 1VA9A 3VFRA 4P23C 3GDBA 1GOHA 1KB5H 5IMLB 1KCUH 1KUMA 5JQ6L 5C9JA 1A7QH 1P5UA 4WFFE 2Y07H 4HC1H 1GPOL 4M5YL 4LIQE 5CUSL 3LKPA 2YN5A 4WHCA 4Z7WA 2WINA 1JUFB 3OB8A 1BPVA 3QUZA 4BJLA 3MREA 4UAOB 3GI8L 1T03H 1OAZL 5I17B 4PP1C 1ACYL 5E70A 4LRNL 1VACB 2C3VA 2DBJA 3KPRA 5CGTA 1ZHBA 5ELIA 5F88A 1W0WA 1YY9C 3BW9B 1HH9B 4P5TC 1UFUA 4ODTH 4WUUB 3W9EB 3IJSA 3VFPB 5CKGA 1AGCA 3O2WH 3ZYIA 1ZGLP 5A16B 1CVRA 1FC1A 4KZDH 3MROB 5MEOB 3P4MB 3VI4E 2YXFA 3QO0A 3L3JB 2ID5A 2NY6C 3QIWA 1DBBH 3L7FA 1DR9A 1QEWB 3PG2A 4AH2B 4PJEA 4PJFF 4Y4KA 3HE6D 3ME0A 1MCRA 3BD3A 3GGWB 3TBVA 4C56D 1CD9B 3KPLB 2PO6B 1T7YA 4IRJB 3HG1B 4JLRA 2BSRB 2ICWI 3OKNA 4OIIH 3WKML 5LAXB 3LPGA 5HGAB 1EV2E 5CBAB 2GCYB 3FL7A 1AO7D 3IFNL 4DGIH 2IALB 1LP9F 4G5ZH 3HUJB 2K9UA 1A14H 4TSBL 2XTJB 4YC2C 2YPVH 2WQ8A 3OGOE 4P23B 1W0VB 5EU6E 3LKQA 2FL5B 4PD4J 5AD0B 1I9IH 1XGTB 5F89A 1IM9A 5EZLB 3RWHA 3VXQA 4PJ7E 1YEHL 4RX4D 3BKYL 4JY5H 4GG8A 4JVWA 4PD4K 3U30B 2YPKA 3UPRA 4Z95L 5FAAA 4PGDB 1WFOA 5FV2A 3CD4A 4ODWB 4UT7H 1G7MA 1S5HB 1R6VA 2MTPA 2Q7YA 4ONOA 3MNZA 2CKBL 4LP4A 4LOUD 4QRPA 2C3HA 3L7FB 4RFOH 5DFWH 4DEPC 3SKNB 5KVEL 4B53A 4HK3N 4JGMA 3REWA 2D31B 4JREC 4HQQH 1HIML 1OVZA 3ULSB 4JO2L 1JZ3A 1OLZA 5DMGC 1A6VH 4BQ8A 2GSGA 3VFPA 3JUYA 1XCTB 5JXAH 3HI6H 2CO6B 5EUOE 4OQTA 3GIZL 3RA7L 1JNHB 4LCWD 3QT2A 1J8KA 1Z0NA 1N59A 3LB6C 4JFOA 5F1SA 2C3VB 1IGYA 4LVHC 5DJCA 1CE1H 1SHMA 1D5MB 2EDLA 4OF0A 5DHXB 1A6TB 1JGLH 1ZLSH 1U58A 1PG7H 1ZGLB 3GI9L 5F6HJ 1EK3A 2J6EH 2JJTC 4D9QD 1QSZA 1N2RB 1H3GA 1DN0A 4HXAH 5J3HC 1UKSA 4ZODA 1XGRA 4EXKA 1B6UA 2BOCB 4P2OB 2GTZB 5GGRB 1FCCA 5F44A 1ORSA 3MA7B 5L7XL 5IESL 3VFRB 2PW2B 4OZ4B 3B6SB 3G6JA 5C0BE 4X99B 4QOKA 5HHOE 3L5IA 1X9QA 3QDJD 2BK8A 3D25A 2IH1B 3TIEB 4C4KT 4JCMA 5JA8B 1N3NB 1OP3H 3WFDL 3QIUC 2J7LA 3SBWC 2IMMA 3UTTA 5J6GB 4KAQH 4R4FL 1UM4L 4OLWH 3L3OA 4NQUA 3DGCR 2NW3B 1F4WH 1XF2A 1JK8B 2YD4A 5I1LA 4R3SB 4YE4H 2QHRL 5I6XB 2XKNA 5I1JL 2FBJL 3BQUC 3TWCL 1G7HB 5IGXH 3GI8H 3V4VH 1W72L 3RWEB 2WWKO 4U4BA 3R06A 4H88H 4NQEB 1HN1A 1WUNT 4R0LA 3TCLB 3SDDD 2DYPB 3HE7A 4YGAB 1KBGH 5ANMA 5F93C 1NFDA 4W4NA 1QPPA 5GGTL 5JW5B 3FB6A 1YC8A 1BZ9A 4O02H 5FYLD 2R0ZL 3GMLB 1QRNE 4P46D 3OAYK 3RWGB 3NFNB 3TIDB 4WEUD 4QT5A 3RPIB 3ALXA 3GHBH 3LRSB 5JHLL 1F11A 3ZL4L 5EU7C 2NY1C 3KNBA 2X40A 4F15B 3C08H 3PGFH 4UUJA 3ZDZE 2IFFH 3VD4A 1OAXH 3FO9A 2BVOB 1OP5K 4DW2H 2F15A 1QFWM 4JE4B 1BX2A 3BQUB 4GQPH 1MCKA 3PL6B 2AV1A 4N90D 5SWQA 3GSUA 2DQIH 3QQ9D 4XBGA 5GJSL 2HFFB 1EVUA 8FABA 4ZUVA 1UYWH 15C8L 1AD9A 5IEHB 3TFKD 3PUCA 1HQRB 2WBJA 3SKMB 1DQLL 3TO4C 4WI8A 1NGQL 4NRYA 5IVXB 1CT8B 4XCEB 2H32B 1U95B 2PW1B 3I84A 1HYRC 3PNWA 4Y5XB 5FUZL 2F53E 2GAZB 2HLFC 1IGCL 2P5EA 2VDOL 5T1KB 5BVJA 4KJWD 2R2BA 1JZ6A 1P4LA 3V5DB 1SYSA 1A3RL 1QLRA 2YA2A 2A6KA 3RDTD 4NM8H 1ACZA 3ZYZA 1UENA 2PUQT 2H9GB 1L6XA 1MJJA 4F33B 1RK0B 2XQBH 4XAKE 5KSAC 2XACC 1QNZH 1X5FA 2XA8H 3DSFL 5DO2C 2FR4B 4JFEA 4ZO9A 4HW6A 3P11L 2ARWA 4MQ7B 2CMRL 5BQ7A 1DQML 1XMWA 2PXYC 2X7LA 3BGMB 1M71A 1B90A 4P2QB 3VXOA 3MRDA 3OAZK 1KF9B 2C1OA 3SDXF 3THML 4OCRH 1WFTA 4G9DB 3QBTB 2XZQH 5B38A 5E6IC 2LAGB 4L8DA 5B38B 1P84J 3FTGB 2YD7A 1L0XA 4QTHB 4NBYB 1IMHC 3K80A 3K2MC 2YKLL 5DK0A 4YHKL 1Y6NR 5ITBL 1N0XH 2DQFA 4NQDD 5L6YH 4K71B 2GT9B 4MA1B 4Q6IC 2WIMA 3OG4B 1JRHI 1H8OA 1P7QD 1H3TA 4XVUC 5CEZL 3BZ4A 3RNQB 4MQSB 2DRUA 4L5FL 4LL9A 3TBSA 3TO2A 4PFEA 5D2LB 5E8DL 3FCTB 3DV6B 1NBZA 1NQBA 2A6KB 4GG6B 1P9MA 5T33H 3RWFA 1SYSB 5F6IC 3ZE1F 5CGMA 5JOFA 1A02N 1FPTL 3MGAA 5FECB 3GKWH 3SDAA 5DFVD 5KSBB 3BPNC 1CIUA 1C1EH 4U7MA 1NAMA 3G04B 4DFHA 3QA3A 2NY6D 3HR5A 2I9LA 4K55A 2NY4C 2P48B 4LSVH 3DO7A 4XMLH 2JIXA 5C09D 5I8OH 3BXNB 5HD8D 1HQ4B 1MFAH 1BX2B 3BQUA 2E7MA 4YWGH 4QO1A 1SEBB 1YNKH 4V1DA 3DVIA 3KGRA 4WU7B 2EYRB 3QCVL 4WO4B 4OGYH 3RUGE 1KB5B 4PREB 3UTSA 4Z7OE 5FKAA 5D7LB 3FAWA 4KKLD 3MRPA 3V4VL 3TIDA 4HJJH 1CICD 3KPQA 3VW3L 3BT2H 3RX7A 3DVGA 2DS4A 2JJTA 3LEXA 4QXGL 5JQHC 1Z3GH 2AABH 3HN3A 3KXFA 4CUCA 1FGNH 2DQHL 3KPPA 4RRPA 4Q9BA 1KJ2A 4I5BB 3ULUL 3TCLA 3TO4D 3E6FB 3PV7A 1U93B 4KMTH 4L4TE 4NQEA 2A6DA 5I1DB 3L5HA 4Z76A 3S37H 1YJDH 3DSNA 5D7IE 3ZHLA 4J23A 3SDAB 5FECA 4U2ZA 1TFHA 2V5MA 3MLXH 2NPLX 1MJ7H 3EDJA 4R2GB 1HH6A 5C7XL 3ZHDA 1U8KA 1YEFL 3OL2A 1VGKB 5T1KD 4P5MA 5DMIH 3MLWL 3SCMD 2W9DH 1CGUA 3EO1B 4HHAA 2EYTA 2JB5H 5DA4A 4I0PD 4K07A 3ULUC 5GISL 5IW1B 2VABA 1ZVYA 3QXDA 3MFGB 1KC5L 3V0VB 4F7EA 5I0ZA 4CVWA 5I8EA 3STBA 2DQFB 4RISH 3Q5YA 2F58H 2VLRB 2V2XB 3RKPA 1A7NH 2OSLB 5DK0B 4PB0H 1CFTA 4QTHA 4UAOC 2J6EL 1YEGH 3LPWA 1D5XB 3MOBL 1NH6A 5DD6A 4XNQA 3GSNA 4DVBB 3BP4A 2XWBB 4GXVL 3IAPA 4XPFL 2FIKB 3UC0L 4X5XB 3HI1A 4PJGE 4AT6B 5C2BH 5SX4H 2EDDA 1VESA 1RULL 2G60H 1GZQB 4JFEB 3TF7C 5BXFB 5IFJA 5F72S 4G6ML 4XVJL 1J8HA 1FNLA 5AUMA 5JXAL 3EZJB 3WJLC 1L7TH 4Y5YA 1JHKH 1INEL 1BGXL 3HNVH 4HQQL 3VWJB 1FZKA 2YUWA 5EBLB 1PLGL 2V2TA 1TENA 3O81A 3CC5A 3QDMD 3OPZH 3T3MF 35C8H 1IARB 1I8MA 2GAZA 4NJAL 3O11A 4YPGB 3LKNB 5HYQA 4UMGA 4WI7A 2CKBH 5TGBA 5D2LE 4L3AA 4NOFA 1KCRH 2VDRL 4JB9L 2ORBL 4U7KA 4EI5D 4GKNB 3T8XA 2FX9L 5CWSB 1MY7A 4XPHH 5HHNA 1NMBH 3IFPA 2AI0L 4GOSA 2GSIA 5EBWB 3HLAB 5HHOD 4JY5L 4HH9B 4F7PA 4E0RA 2CO7B 4CADB 4JRYE 4D8PA 1IE5A 2V9RA 1UH2A 3UYOD 4OQTH 3RX5A 4JFFA 2WLYA 3MBED 4ODWA 1HK6A 3CH1A 3QQ4A 3UBXI 3DHJA 2XZAL 4D0DB 3ZSTA 1PGRB 4XNZC 4NO0A 1PG7L 4WO4D 1U8JA 2WIIB 3BYTA 3FRPG 4ZNCD 4PY8I 2RGSA 3U4EB 1VENA 2NY7H 3UEZA 3UP1A 3V0WL 1L4IA 1NCBH 4FS0A 4LIQH 3H6JA 2EKSB 5JW5A 4HH8A 4OGAC 4I0PA 2MQ3A 1C5BL 1EHAA 3TT3L 1U8OA 2HVJA 1I3UA 3NN8B 3RWCA 3OKKB 4RWYL 3VXUA 4RMVA 3TZVD 4JHWH 3IDJB 2DJ4A 4D9RE 4GAJL 1T0PB 4G6FB 4JFPB 3RZCA 2GK0A 1AIFA 1N6UA 4HMDA 4P57B 3IXAA 5GRVL 4NYLA 4HS6A 3TO4A 4KY1H 1RZIB 5TDNA 2BXZA 1AXTL 4TSCH 5J6GA 5D96C 3U82B 4X6DE 1N5AB 3DI2B 5I74B 2AEPH 2P24B 3BZFA 2QADB 3T4YA 3MV9D 5D7SH 1S9XA 1PQZB 4W81A 4JN2B 5I8KH 3SJVD 1MPAL 3BAEL 5DTFB 1KXTB 2VXQL 1KG0B 4H25B 1DQQA 2EE9A 5CWSA 4HEME 1I9JL 2OJEB 3JV6A 5GS1C 1MSPA 3HC4L 4XMKH 1T03L 1MQKL 2NXYC 1E4KC 1PX3A 2ADIA 2AK1H 4YPGA 3DMMB 3F7RA 2F8VA 2BJMH 1KB9K 4FFVC 5CIPB 1CN4A 1LE5B 5B38G 2Q8AL 3S34H 4I3SH 5I1IH 5L2JA 2YD6A 3PWLB 1CVSC 1TTUA 5JQ6H 5HYJE 2GUOA 2YZ1A 2IAND 5BV7C 4WUUD 3BD5A 1DL7H 5EZIH 2UZIH 2P8PA 5A2JH 5F7FA 3S96A 4Z7QF 1UVQA 5JIHA 4NN6C 5BXFA 5IFJB 4WUUE 3QUXB 5TQ2H 1T0NB 3DXAE 3MO1B 4N68A 1R5WA 5EZJA 4HGWB 4NQCD 1MI5A 1WTLA 3EO9H 3PWNB 4I0CC 5C9JB 5C0RL 1TJIL 4V2CB 4CMHC 2XWBA 3E3QE 5H94B 4XNQB 4DVBA 2VMFA 1JIBA 2K7PA 5CJ5A 3E2HB 5DJAA 4FMKA 2W92A 1RMFH 1T5XB 1XAUA 5C3LD 3CU1A 4DFIA 1Y6KR 2WM0A 4D94A 5HYJA 2R23B 3REWB 1E6OL 4NM8L 4PRID 1SYVA 2BHUA 1T21A 1KJ2H 5H35B 5EOTB 5CD3B 1JWMB 2Q86B 1A9EB 3QUYA 1A1NB 4I3RH 3DX7B 5K9JL 1KLFA 4UT6L 1S7RB 1DBAL 2EYTB 3GB7A 5DHYA 3EO9L 1SJHA 3BEWA 5C07B 1MCPH 5DQJA 3O41A 3K46A 3EAKA 4OZHE 4UU9A 2B1HL 1KYOJ 1DVFB 3CMGA 1JNLL 2I27N 1RQ5A 3RWDA 5SV3A 4KI5E 2PO6D 4IRJD 5BJTB 4U6YA 3ZHKA 2Y7QB 1N6VA 5JW4R 5AD0A 3D39B 4MMXC 4NQDA 1W0VA 3DGGA 5I1DA 1GVIA 2VDML 2YSSB 1S9WB 2BCKA 1U93A 2Q8AH 1ADQA 1J8HE 4N0YH 1IQWL 5ISZA 4I5BA 2OP4L 3UTOA 2HLAA 5AWNH 4BH7B 1G0DA 4J3VA 4A6YA 3BWAB 1ZT1A 4KTDH 3CVHB 4M93B 4YHPB 1ZAGA 3VI3F 1HINL 4MA7H 4C57C 2EYSB 3KPQB 1FCGA 3Q3GB 1S7XA 4DN4H 2Z91B 3MRGA 4ORZC 5EU6A 4YX2L 5T1DL 2IPTH 5FKAB 3OF6D 2XG4A 1BOGB 1N5YL 4WHYH 2QSCH 1A5FL 4I0PC 1KOAA 3X12A 2X41A 4S1DC 4V1DB 2EH8H 3HUJE 2AEPL 5D5MA 1IGIH 2C4FU 5IK3B 2MOVA 4FHBD 1HQ4A 1AXTH 4TSCL 4WJ5A 4Y5VA 2YD5A 3S8WA 4HK0B 4LCCC 1NSNH 3TZVC 3U0TA 2R69H 4AENA 5MEOA 1TITA 2DQUH 5F1IB 1JYXA 3BSZH 1KPRB 5E6ID 4ZFGL 4HUWA 4BA8A 1NFIB 2B20A 4NZJA 2XZCL 2NXYB 1IGTB 1X5AA 4AIXA 4X98B 5IG7A 2ZCHH 5JW4Q 1IL1A 1FRGL 4MD0A 1KCVH 1FL6A 2X44D 4B50A 1NFDE 3MRJA 5JOFB 3G5ZB 1IC1A 1ZLVK 3VA6A 1JPSH 2L0DA 3O6MH 1IGML 4AEEA 2IADA 4LU5H 4XPBL 3AROA 1DLHB 2ADJB 5EORH 1BLNA 3U7WL 1X5KA 3LKRA 4KUCF 4JDZA 4WGVB 3P9LB 5IM7B 3S36X 1RJZA 3SGEI 4CU7A 1FVEA 4NNYB 3E1F1 3VH8G 3OX8A 4IBLT 3WFBL 3UZQA 1P1ZB 2CR3A 5T3XL 4F37F 3B3IB 4M43L 5EA0L 2FD6H 3DI3B 4CMMA 1L9MA 3RGHA 2EH7L 4DKAA 2AK4A 2VLRA 4ISVA 5I8EB 2B5IC 3P9LA 5IM7A 4Y4FD 2X7LB 2DQGH 3CZFB 1PD6A 2E7LA 2AJZA 1PW3A 1PYWA 1S7UA 1K2DB 1BQLH 3HI6L 3ZE0E 1FIGL 4OCLC 1KULA 1E4XL 3HC3L 3K4DA 4MNQB 5HGDA 4XVUD 4BK4A 2L7UA 1NSNL 5JXED 1LQSR 2R2BB 1PKQA 5SX5K 2G60L 2IPKB 4PB9L 5EU4A 2MJWA 5GRUL 4LEXH 1HQRA 1A5FH 3I85A 2Z93B 4YHOL 5GRVK 3C5JA 3DVGB 3P0YH 4XBGB 3JZ7A 2XWTB 1TNNA 4L4JA 4MJ4A 5SX4I 1MCOH 4D3CL 3FONA 5D5MB 4PJEF 2YS4A 5KSVA 4KTDL 1QUNA 2F58L 4G7VL 4RNRB 4JJ5A 4FQJL 1HHGB 5J7CC 1T6VN 4WU7A 4D9LL 3QWOA 5D2NC 4LPXA 4Y4KC 5TE6H 3KLAA 2XA3A 3MRGB 1UJ3B 1B0WA 4QT5B 3RDTC 3RPIA 5LG1A 3TV3L 3V52H 3DV4A 4LLWB 4XPBH 3LDBC 4OIBA 2XKSA 5JDJA 1DVFD 1BREA 2Z93A 2ZOKA 3MA9L 4NC2B 1EO8L 2YRLA 4YDJB 1RZKH 4X0KB 5ENWA 5FXCH 2DDQL 5IVXF 4JM2F 4R0LB 3OKOA 4JRYB 1FRGH 3LZFL 1ITBB 4XB7A 4QNPE 3T04D 2XZCH 5KSBA 3NZ8A 3SDDB 3JSSA 4M6ML 3RWIA 3MUGA 3C5ZD 3D6GA 4K3HA 5H8DA 5CD5C 3EYVB 3VXNB 4RZCA 4JRXA 1NCUA 2Q7NA 1WIUA 3UROR 3CU7A 3QUYB 4O4YL 4Y8DC 5H35A 4MHHG 4ISVB 3UJTL 4HWEH 2AK4B 1ACYH 1TQBC 1IAIH 4HAFA 5DJAB 1MWAA 5HHMD 3S7GA 4QEGA 5B22A 3C9NB 4G6JL 3OB0H 5HDBF 5CUSH 2UY7A 1RJZB 4I3SL 1P84K 4QRRB 3BGMA 5E0QA 4JM4L 2J4WL 1GGBH 2UZYB 4ONFL 4Q58C 5JXEA 1J1XH 1V7ML 2WSKA 3K0WA 1DLHA 1XGUB 4XCYA 3UTZB 4FXKA 2QQKL 2AK1L 4WV1B 4Y19D 2IADB 2F54B 3HCVB 4U05A 1K8DB 5LBSL 5HHME 1P7KA 4Y1AD 4C83B 5GSRA 1OW0C 1T7ZA 2MCG1 3T3ME 1LMKA 3FO1B 4JPKL 2EDBA 3BO8A 2P5EB 1UEMA 3HKFA 3MOAH 4MVBD 4MNQD 5HI3D 5IG7B 3LN4B 4LMQE 4Y5XA 4M61B 1CT8A 1XCTA 2DD8L 2NY4B 2D9QB 1X4YA 4RAHA 5E2JA 4KY1L 3BE1H 3FFCB 3D18B 3T2PA 1M7DB 3B9DA 4Y19E 1MH5A 4UQ2B 3N1MC 2FX8L 5FGSA 1ZANL 4JY4A 1PQZA 3S35L 3PL6A 4NC0B 3H9SA 3T4YB 5KOVC 1GH7A 2I24N 4OI9A 3WE6B 1G1CA 4QRPB 1N5AA 3GNML 3EOYG 4LSQH 1T1ZB 4DCQA 1YN6A 3CX2A 1UXSB 5MP6L 3C8HA 3PP3H 1CFBA 1UCBL 1UM6L 1F5WA 5D71L 3RTQA 4FA8A 3RGVC 3SBWA 5GS0H 1RZ7L 4GG8B 2YPLD 3C8DA 1MRCH 4ZTPL 2D7TL 4P2RA 4KKNA 3ULVL 3AAZB 3H3KA 3ZTNH 1ZT1B 3QDGA 3OJMB 4BH7A 4M5ZL 4ZO7A 3M07A 1E28B 3OKKA 4FQXC 1HWHB 2HVJB 4LVNB 4LLDA 2EO9A 5GGQL 5K9JH 5DYOA 4X4XB 2DLGA 1B2WH 1NBVH 5GS0C 3TM6A 4RMUA 3WHXA 3TYFA 5KSAD 1WFUA 1E6OH 2WZPD 1MCBA 4LSUL 1JPFB 3F7PC 4U1MB 4XP6H 1VKXB 3EOTH 4D0DA 4NO3B 1DQJB 5DQJB 1HHJA 1NBQA 3VFVA 5IBTL 5DUML 3OAYH 5JZ7D 1S7RA 2B8OT 4D8PB 3QUMA 3KPOB 3NACH 4MNHB 3HFML 4CADA 1T66C 1IJ9A 3NZHL 2O5ZL 2ATPA 3T0WA 2GFBB 3FFDA 4F7PB 1T21B 4OUUB 4DKEH 3VRLE 1NCTA 4YXKL 5AAMA 1HNFA 1KJMB 1UH4A 1QTYT 4DVRH 4NFCA 3RU8H 1QRKA 4GKNA 3T8XB 3TEUA 4HDIA 5DD3H 3ZT5A 2PTTA 5MENB 2ZKHL 3LV3A 5DJYB 4LHUG 5HVGB 1Q1JH 4GRLC 5DD1H 2VC2H 2V2TB 2R2HA 3N1PC 2EDOA 2HTKC 3KPRB 4HLZG 4XXCC 3RJDA 3VWJA 1F58H 1FO0B 5T1MB 4LBEA 1DANU 2LVEA 3P30L 4GXVH 1GZPA 1U58B 1AE6H 3VRLF 3MLUH 4PJ8A 5D2NB 2IANE 3TBTB 1U8HB 4QF1B 3ARWA 3S36L 3G9AB 4G43B 1U2HA 2BRRL 1A7NL 2IBZX 2XKUA 3MLZL 4JHAH 1UM4H 2NY1B 4OLWL 4UNTA 4YDKL 1K6QL 1CBVH 1LE5A 2NZ9C 1J7VR 2YUZA 4FZEL 5DJYA 2GTWB 2ICWJ 5IIEB 5E4IA 3IDGA 1T83C 2HT3C 1PKQE 3I75B 4G6AC 3GMPB 4C4KO 3MBXL 4X9IA 4ZS6D 4H25A 4O5LH 1L9NA 2EC9U 3D0LA 3EDFA 2VN4A 4ELMF 4C55A 2BOBB 1NGWB 4LKCB 4WFHD 2AERT 4HWBH 3GZKA 1NDGA 5DZOA 2P5EE 4OM1L 4Y0GA 5F9JB 1E27A 1IFHH 2XPGA 4YDVA 5F7EL 4WHDA 2BSTB 1RU9H 5I6XC 1F4XH 1I7RA 1R3LA 5I16B 2Q7YB 43CAA 5K9QG 3MRBA 1S5HA 1JRHL 3ULVD 4NYLB 3MRNB 5KW9H 2J1KA 3C6LC 3EYQC 1V8HA 1EJOL 4KJQD 5FF6A 1KENH 4RFEA 1IM9B 5EZLA 3IDJA 1CFSB 2FL5A 4TYUA 3QRGH 5C0EB 2NY5C 1F00I 1WAAE 2B5IB 1EUTA 5CD5D 3I2CL 4UOW0 3DNKA 4P2QD 3MC0A 2DLTA 2DI9A 3QI9A 1UWXH 1ERNA 3MGTA 4XT1C 1BIHA 1XR9A 2AGJH 4RBPH 4ZXBD 4N8PA 3H7BB 1NMBL 4K94H 1TVHB 4RDQF 3RU8L 2CIKA 2HT4C 4OD3H 1UM5L 5CZXC 5HHQB 2HRPH 4Y5YC 3P9WB 3KPLA 2W0KA 4GLRH 5E8EA 4WHTB 2YD8A 1YN6B 2IQAB 2O5ZH 1OTTC 1T0MA 2NY2C 3B9AA 1IILE 5E7FA 3AMLA 3WD5H 3DYMA 5DUMH 4KTEL 3T1FA 3FT2B 5GRJL 1SJEB 4HH9A 2ZZUT 1XZ0A 3N85H 3CCHA 3OGCB 4FQCH 4N5EC 3MMEB 3DIFB 3IFPB 5EO9A 4J7RA 5D6DA 1TMCB 5HHNB 5IVOA 3RDTA 4Z8FH 2VLJA 4XB8A 1AHWA 1FL5A 3G04A 3I50H 1MHHB 5BRZB 1TQCB 4TUJA 4ETQB 5E8DH 2DKUA 4F37K 3MXVL 3O6FB 1NFDF 3BPOB 4G80B 1I8MB 2DLEA 3BW9A 3CC5B 1QFOA 1NGPL 3IFLH 4NKOA 4IDLA 2XXCB 5GRXG 3NPSB 3TZVB 1WZ1L 2P8LA 1FAKT 2ZCKH 3SE9H 4DEPB 5C09B 4Q9RL 3MREB 5D1ZB 3BP7B 5AUMB 1TVBA 4ZOAA 2KUTA 4UNUA 7FABL 4YXKH 3SJVA 4Y16D 4GRWH 1X6NA 1CGWA 1H8SA 4IMKC 3VXPB 3L3HA 1BVZA 3UYPA 1MRFL 2Q8BL 4KK6C 3LS5L 2RIKA 5DD6B 4AMKH 3S5LG 5FO8A 2QL1A 3X11A 1GGTA 4ZFFA 1CLYL 5DJ0A 4G9DA 4X7EC 5IR1B 5DC9B 1LO4H 2OSLA 4KU1A 1TZHB 3MLXL 4PBWD 4ZAKA 4DWHA 4GRMA 1KPVB 1M71B 3QEHB 2VERN 5C0GA 4IJ3C 1T1WA 5FUCE 2V17H 4TUKH 4QRSA 4RGMC 4RZCB 1T83A 4LEOB 3VXMD 5T3XE 1MJJB 2YEZB 1Y18A 3IT8D 1L0QA 1QLRB 5DZLA 4G6AD 25C8H 1JZ4A 4Q74A 5F7UA 1U2CA 3INUH 3NZ8B 5B3JF 1KTLB 1RZJC 2LU3A 2JCCB 2NY6B 2PF6A 3VD9A 4QWWD 1O7VA 2D7QA 4FXLA 4ZFOL 1YNKL 4B5EA 2RQ8A 5DT1H 5JLZA 4YWGL 1CFNA 5CZVL 2ZJSH 3EYSL 2Q3AA 5E5RB 3Q5TA 4XMLL 3FO0L 1T22B 1WBYB 3FN0H 3GSVA 4IRZL 3OR6A 2R0ZH 2BVOA 1GIGL 5FCUL 2EDXA 1UZ8A 3RVTC 2CLRB 3UJTH 4FQXA 5A2IH 5MEQA 4QHMA 4IOIA 5KN5A 1N4XL 3H3PH 3CIQA 4YHYB 1F11B 1A1OA 1HKLL 1GGYA 4UIKL 4CL7A 1JHTA 3G9VA 5DRNA 5FGCE 3ARTA 4HJGA 5LBSH 1IC5H 4RGNB 3C5JB 4Q9RH 3SE9L 3QNYA 5FDWB 2OZ4A 3WO3B 5DJXA 2AJSH 3V5HB 5ANMB 2XV6B 3HS0A 3ZDYE 5FYJL 4ZOCA 4PJAB 3QEQB 2RAMA 3R06B 2H8PB 3SE3C 2J8UF 1GC1C 4DJMA 4CW1A 5KN5B 5JW4M 4K7PH 2FECL 5DVMA 5DUBA 2E9WA 4UV4H 3CSPA 1GSMA 2GI7A 2HVKB 2BVEA 2DIBA 1KXVC 1MFDH 5E2WH 4EUPB 4Z6AT 1XF2B 2VLME 4G8IB 3JTTB 4MJIE 5GJSH 1KTRL 3ZYJA 3K3QA 8CGTA 3ARXA 4S1QL 2H2SD 4QTIL 3C6LB 1PYWB 1OAXL 2NTSP 1ZHLA 2CGRL 1MCNA 2YD9A 1N6QL 2KH2B 3DBXA 4P0DA 1DCLA 4IEFB 1WBXB 3GMMB 4HZAA 1GGIL 3GK8H 3MLSH 4N0UA 3H9SD 5ICZB 2OCFD 4HIXH 4X5WB 4JZJB 2ICES 4GJTB 4Z7QE 4L8BA 2GEEA 4M3KB 3WFEH 4JGUA 1BAFL 4M4RA 2YEZA 3LCYA 4NT6A 4M7LL 1FFRA 1YYLH 2C1OB 4QRSB 3NIGF 2CK0L 2Y72A 3P2TA 5FUZH 1T1WB 2Y9RT 3MUY1 5FKPB 3ARBD 1CD1A 1GGUA 2ADJA 1TQBB 5HTSA 2EKJA 2IBZY 3MRRA 3K1KC 5F21B 1RK0A 3EYUH 1E4WL 1UYWL 3U9PH 3UTQA 2AEQH 4PLOB 5SWZA 4Z5RB 2FGZA 2H2SC 3BZEA 1N59B 1JNHA 3KG5A 5E9DA 2A9NL 4D0BA 3VXPA 4XZUA 1IGTA 2H32A 2PW1A 4OCXL 2E7LC 3NIGE 4OM0L 1WK0A 4OAWA 1EXUB 5LWYL 5ETUB 2VWEE 4DUWA 2VISB 3WNNA 2FH6A 4O5LL 4KDTA 4R97C 4ZFZB 3U0TB 3QHFH 1F42A 2HG5B 3U0PB 3VGEA 8FABB 3P0YL 3ZDXE 3GSUB 2QEJA 4NFBA 4JFFE 2FJFA 2IF7A 4EKXA 4QCIA 2BSSA 3MX0A 1L7IH 5DO2D 1CFQA 4R7DA 4UV7L 3O6FA 3LIZH 5ESQB 5KS9A 1FVDB 3QIUA 3K4AA 3GI9H 1SBBA 2VZSA 4F57L 4XBPA 1I1FB 3GSQB 3FHQA 5C08D 4M1CD 4J4PC 4JQXC 3RWGA 3MLUL 3DOSA 3V4PH 3MMEA 1YYMH 3RDTB 4ZNEE 5CILH 2N56A 2XQYK 4A6YB 3FB6B 5E2UH 3NOIA 3NCYP 3QPXL 5L2KB 3WUWG 4HUVB 3SKOA 1QA9A 3ARGB 3H2WA 3TNNA 2A2QT 1OWWA 2IQAA 5HXMA 1OGAE 4N5UA 4WHTA 2BVTA 4OZIE 4LVNC 4GMTH 4XPAL 2CR6A 1CLCA 1FYTB 2ADFL 4K8RD 4YLQT 3T4AB 3MBXH 1K4DA 3D0VB 4HX1B 5HI4C 2BSRA 1EGJL 3GIVA 5FHAL 1JGDA 3EJYD 3WKNA 3N9GL 1IGJB 4ELMB 3QI9B 2EXWC 3PWVB 1VFBB 4G8EA 4AH2A 4OGZA 4MQXC 2VIRA 4HIEB 4WO4C 5E03A 5F7NC 4OV6F 4PRBB 1I85A 1UWGL 4LLMA 5IFAH 5TE7H 3U83A 3MV01 4PJBB 4XCCH 4Q2ZA 3UDWA 4OCNC 4GW1B 1AGCB 1QSEB 2VDNL 4Y4KD 3WL9A 3MRNA 4KK8C 1ORSB 3OJ2C 4AG4L 5EPMA 5I66B 1WEJH 5FYLL 3IFOA 4FFYL 4NC1E 3GIZH 4Z9KB 4N0YL 4N0CD 3QIWD 3V6FA 1G6RH 4PJ5B 1ZHBB 4QYOA 2X4PB 5J11B 4NGHH 4KKCD 1UQSA 4J3WA 1NDGB 1L0YA 2WAHA 4GKSB 1JFQL 2C5DC 6FABL 2WBJD 2YD1A 1LNUA 3WHE1 3C5ZB 1NLBL 2P8PB 4PGZA 2PN5A 1RUAL 1MHEA 4ZS7L 5K59F 3BJLA 4G3YH 2FJGB 4OSUL 2IH3B 3FO2A 1EBAA 2NY5L 1OPGL 5DJZB 5MP6H 3WDHA 1IGIL 3WCYA 5GS3A 3CDYA 2R56H 3UJIL 3LRGA 1PG7W 1HSBB 3WN5B 2A9MH 2Y6SC 3SKJH 4H8WC 4MA1C 1IC4H 2GSGB 1AKJB 3KXFE 3KYOB 4KDVA 1OARH 5IHZB 1HINH 1GOGA 2NXYD 1J9CT 5C6TH 5EU6D 2CDEB 4Z7WE 1FH5L 4U0RC 4Z7OF 4L1HA 3DX9B 5JW3H 3BPNB 3L3KA 1HI6A 3LKSB 4DK3A 1TCMA 5FOJA 3V6BR 3QWRD 2GITB 3LRHA 4LASL 1JF1B 3QDMA 4Q6IA 1U92A 5EBGA 2CLVB 2VDMH 5TDNB 4KRNA 4GSDL 1G7MB 5MENA 1M7XA 1HHKB 3G08B 2EXYC 2PTTB 5DEGB 1NC2B 1SMOA 4LDLB 3WFHB 5IUSA 4ZTPH 1MJ8H 3PWJA 4NNXB 6CGTA 4QGYA 1WQVT 3BUYA 4XRCB 1RFDL 5FM5M 3T3PF 3ULUD 1KJMA 1MIML 4APQA 5IROC 1UCBH 1UM6H 4OLUL 1ZLWH 3FQTA 4HLZH 4FQPA 4KVNH 5B8CB 1PG7X 2W60B 1KB5L 4KKBC 5BO1L 1HHJB 3T77B 3DRQB 1BEYL 3U4EA 2XRAL 1K4DB 3FRPA 4ZUTA 1RVFH 3PHQA 2EECA 1YNLL 1I1AA 1MFEL 3VD5A 3RIAK 4LOUC 3CH1B 2C3WA 1U6AH 4NDMB 3ZKMD 4LRIC 4ELKA 2PXYB 3JXAA 1UB6A 3IDXL 2W60A 2DQTH 4X4XA 4Y4KB 1OAUL 4HD9A 3B5GA 1QPXA 5F3BA 4P2QE 3FOLB 4LLVA 2VQTA 2OYPA 4E0RB 3QIWB 1H15B 3SCMA 5DD0H 4JQIH 4PJDA 4JY6A 4ONHB 3U6RB 4PR5B 2I9TB 5D1ZC 4I48A 4GQ9H 3B9VA 1Q0XH 4XP5L 1FE8L 5JMRA 3MRCA 1MEXH 2Y25A 1OT1A 1FORL 4LLYA 5DRZB 3S34L 2AJVL 1HH9A 3S97C 3Q5OA 1NKRA 4DZ8B 4FFYH 5F88B 3BKJL 3I3BA 5EBLA 3TT3H 4LGRB 3P40A 1FZKB 1FIEA 2R0LH 4AG4H 2YUVA 4QRTA 4BSVA 1MQKH 3DX9A 1M6OA 1AQKH 3E2HC 1TQCC 4K23L 2EDEA 1QRND 5EUKB 2LTQC 4PRNA 1QHOA 5C6WH 3HZVA 3KYOA 3Q6GL 4WFGD 4HZLB 1IEAA 1MAJA 4KC3B 4D9LH 3QO1B 5FM8A 4AT6A 1HSBA 4XZUB 5JW3L 3V7MA 4OZGF 5E9DB 4U0QB 4FQLL 4ZOEA 1ODAA 3OF6A 4G6KH 4NUGH 1U3HC 1DN2A 4OB5H 5GZND 2VLJE 3WIHA 4PBXA 5KVDH 1CFTB 3MV8E 4FXKB 1AKJD 2C3XA 2RCSL 5F7LB 3E6HA 3MCKA 5DS8A 3W0WE 1S7QB 1WIPA 4XWGH 3DMMC 4JFHE 4QYOB 3LN9A 2IG2L 3VMOA 4OSUH 2CXKA 4NSKB 1MCFA 1YMHA 4JFDA 4OF5A 2Q6WA 3QQ3B 4N1CA 4NPYB 4X6FB 2OK0H 4UINL 1FL3A 4G8GE 5GHWH 2HJFA 3RPKA 1FLRL 4Q2ZB 4LLUA 2CKBA 3CK0H 2ZSVA 5ICZA 4P2OD 4P5TD 1TJGL 1PSKH 1JTTA 1YZZA 2H41A 3NABH 5ICYB 1SQ2N 4EJ1C 1G9EA 2NYYC 1NCWH 3WNPA 4E42B 2XXMB 2HTLC 1LO2L 1P5VA 1AR1C 4HEPG 5EC1B 5IW3A 2PYEA 3LEXB 1JGDB 4WW2C 3QRFM 4MJ2A 2F8XC 4ZUWB 3MXWH 5DD5L 1I3GL 3U0WH 1J0KA 4QXUH 3CFCH 4MXVE 1OAYL 2EYRA 4DAGL 3QDME 2E5EA 2FHBA 3RBGA 4KK9D 3QQ9C 4JFED 3RGVD 3NCBB 1LO3H 1FNSH 4APQD 1NFKA 4Y1AA 1QA9B 2VZOA 2JIXB 4NC1C 5EU3A 2VR9A 1E4WH 3ARDA 3U9PL 2QQLL 2ZUUA 2IG2H 2X4SA 4J3UA 2PYEE 1KCVL 4OLZL 2D7PA 2ESVE 1DBJH 3D69B 4XNYL 3S37L 2RCSH 2XT1B 3I6GB 4MDJB 5CILL 4EI5B 2FJFB 4MAUL 1F4AA 3F7YA 3SGKC 4GKZA 4Z78A 2PKDA 2FZ3B 3J8F7 2AABL 4RMWA 4GG6A 4NUGL 4PTTB 5D6DC 4F57H 5TJWK 3FCTA 2C4XA 5D2LA 1CFNB 4H0GA 4XCNA 4L3EB 4NQSB 3SO3B 2PO6C 4IRJC 3TN0A 1KJVB 2VXSL 1L7IL 4ZD3H 5EOQL 2VL5B 5I2IA 3VFUA 5DI8B 3JTSB 3JWDH 4KJPC 3ZE1E 2ZSVB 3WXWL 5DVOA 5EIVA 3S88H 4LU5L 3KLHC 3PWPB 3OXSA 1I9EA 3DURB 3V7AE 3O6ML 1JYWA 1Y18B 5C09E 4YC2B 4C56E 4F58L 1Y0LB 2XTJC 1J18A 4TVPD 4K3EL 1YEDB 2ENYA 4MJ6A 1S7UB 4P2QA 5GSVB 3A6BH 4R4NC 3FRUA 2ERJB 5E8OB 1VFMA 5CBEB 4P5TB 3R0MA 3EJZD 2J6EA 3INUL 4YUEH 3ARZA 5KAQF 1RHFA 1YY8B 1DUYB 1TZHA 3QDAA 5DQDL 3PIQA 2VXUL 5B21A 4WI3A 3ARFA 5IB1A 3QUXC 3H7LA 5E7BA 4MJIA 3T3PE 3OKEA 2N7AA 3J7HA 2ED9A 1BQHA 2JK5A 4HIJB 4QY8B 4PS4H 1H3WM 3EYFA 4WFED 5CEZH 2OM5A 2DQJL 3I6KB 5M94B 5I1GH 4MXQC 2EC9T 2P1YA 4R96B 4WNQB 1KJVA 2GY5A 5FCUH 4KI1A 5CLWA 4CAGA 3ZDXF 4JPWL 1A7PL 3WJJA 2CJUL 5C8JB 2VJXA 1P7QB 1S7VA 2AXGB 4NQXB 2HVKA 2AJXH 1FL6B 4UUJB 4MD0B 4P9HC 2CGRH 5HVHB 3EFDL 2F53D 3ETBF 4H5SB 3V6ZA 3GKWL 4X83A 4HUWB 5F96L 5BW7C 2VLLB 3V2AR 1HCVA 3HS0B 1F8TH 4YHMH 4Z18A 2GKIA 1OL0A 3OKYA 3M1BB 2PNDA 3GMLA 2EDKA 2UYLA 4JY6B 4EBQL 3RGVB 4L9LB 3CCHB 1H3UA 3FB7B 3ZT7A 5DUPH 4EI5C 2DQCH 3CDGB 3MRLA 1AGEA 3HNSH 2J8UB 3ARFD 4MCZA 4NM4H 4MB3A 4GBXD 4K7PY 1IGCH 1B9ZA 2R15A 1FH5H 1G7HA 4XMKL 3NCJL 4F2MB 1Z9OA 5HGBB 5HHQA 1VFOA 1P6AB 3ARUA 2VLKA 3L6FA 4PJXA 3WLWD 3MJ8B 1LK3H 3MV7B 4YJZL 1DP0A 3CVHA 4UIKH 3CFEA 3T77A 1NUFA 1J0HA 1D3CA 1OLLA 2BNQD 4F9PA 3DYOA 5DGQA 2OR9L 1YEJL 5C0AD 2Y6SD 1KFAL 3P3YA 1OPGH 4EVNA 4XNXL 2NW2A 3PDGA 4NQDB 1CFSA 4ZS7H 3O8XC 3D25B 2O5XL 4PTUA 5FYKH 5KVMC 5C08E 1KN2L 4E41A 2MHAA 1XF5A 5D7IB 4EDWH 1MRDH 1G6RL 1SJHB 2WBJC 4NO5B 5I1GL 5BZDB 4Q6IB 1NGPH 2BOCA 2WBWB 1ITCA 1NEUA 2QSQA 5HYSA 3HC0B 1JI1A 1EAJA 1LILA 4ZS6C 5IBLC 1OB1A 5C0GB 1X5ZA 2VDLL 3E6HB 1FN4B 1JNNL 3L1OH 4OCWL 5SWZE 1SYVB 3DXAB 1NEZA 3PP4H 5K59E 2QBWA 3MBEA 4YE4L 1ZTXH 3WO4C 5BOPA 5DJCB 2APTA 4OD1H 3X14A 2DLFL 3X11B 2FNBA 5FO8B 3P4NB 5FYKU 5C0JB 5H94A 1YEIL 3CSBA 5FYLE 1D5IH 1RU9L 4IOSD 4K3EH 2Z4QB 4NIKB 3OKDB 4M62L 1IZJA 3D2UB 4PRIB 1CLYH 4MYWB 4JN1H 2SEBA 4UILH 4LSDA 1NEZB 3QP3A 2Z9TA 2MMXA 2ORBH 5ADOH 1X6LA 3CH8A 5C09A 2R0WL 2AGJL 2IWGA 4HBCL 2CDFA 2GUOB 2AKRA 4KMLB 3NFPA 1A22B 1FJ1A 1OAQH 2F5BL 5DLML 3SDCC 2R2HB 5C0CB 1XGQB 3IFOB 3GHEL 3QDHA 4NO5A 5BV7L 5I66A 3QRGL 5ECJE 1XF5B 3EKCA 4ETQA 1BWWA 4Q7DA 3RIAF 5L2KE 2DBLH 3HRPA 4I48B 3D39E 2A6IA 3WMSA 4Y19A 4GFTB 2VLJB 1JL8A 2OXHA 3JWOL 1DQQB 3GMQA 5E56A 3RWHB 1KG0A 2MQCA 1XGTA 5F89B 2VLKE 4N1EA 5DTFA 3LKQB 2NZ9D 3SCMB 2NW2B 1EFXA 4XPGH 4TNVF 1RZFH 1SJEA 1RIHH 5BS0E 3HZKA 4F15C 3NA9H 5DJ6A 1T7WA 4ZMAT 2QKIB 2I25N 3N50A 1TZGH 1UG9A 4ZXBB 2RFXB 4X8JB 1BD2E 5GGTA 2APBA 2V7NA 3T0BA 1KJ3H 1JWUB 2AI0H 2VYRE 3T0EA 1FAIL 4PJXB 4BSWB 4FQCL 1R0AL 1F2QA 1U91A 3OKNB 4KTEH 1JWUA 4OQ1A 4YHIA 3WHXB 3TBVB 3GGWA 1QFUL 1TXKA 4RGOH 4XBEH 3S35X 3UBXA 3IRZA 3EIFA 3VGAB 3VXMB 4ODSH 5DJ6B 1D5IL 2P5WB 4KUZH 3SGJA 5C9KA 4GUPB 4N8VA 7CGTA 3WFZA 1MHPL 1Q9WA 2EKSA 1I3GH 2BY2A 2Y1VA 5HI3C 5TE4H 1Q9KA 4L9LA 3EO0A 3LKOB 5DGRA 4RFEB 4LSUH 4Y19B 3PP3K 4OCWH 1OSPL 5EIIB 1NC2A 4KXZI 3QIUB 1EO5A 3T0EE 4LLQA 1C8PA 1RUMH 3W9EA 1BJ1J 2DLHA 5IVNA 2DYPD 1RIHL 3QXTA 1CFQB 4R7DB 2I5YH 1T1ZA 3EJYC 3FT3B 1MFCL 2HAZA 1T1XB 2BSSB 1PSKL 4MD4A 4ODHH 3WHE0 3GMOA 2P47B 4MNGB 3O8XA 2CDFB 3UCRA 1JGEA 1I7ZB 5GHWL 2BOBA 4ERSL 5L9DH 2BX5A 3DHMA 4UTBL 4ZFZA 4LLAA 5GS0L 2W07A 4P2OC 4GW4A 1D6EA 3D2UA 4M7JL 5C0AE 4CVUA 3D3VE 2ESVB 1CZ8H 4F7TA 3ZE2E 2Z4QA 2F5BH 3I6KA 5DLMH 3DO3A 3HFMH 4D0BB 3GRWA 3MLVH 5HGGS 4JGJA 2J88H 3ZKQD 3ARSA 5HHPB 3MYJA 3WXVL 4Q9QL 2XYCA 1DBBL 2IH3A 3TYGH 3DMMD 4LSVL 4JN1L 4PY8J 1MJUH 4M62H 4WV1A 3OR7A 1I3VA 3BUTA 3FJTA 1XGUA 4XCYB 3UTZA 4M93C 1IC7L 1XF3A 1FN4A 4NNPL 5FKPA 3T0DA 1OTUC 1FGVL 4M6AA 4YDKH 2R9HD 3D87B 2KPNA 3HI1B 3DYPA 4MNQE 4X5XA 4M5ZH 2UV3A 3PJSA 4JKMA 3ILQC 4MX7A 1XGPB 3TJHD 3WS6C 4E41B 5HDQL 4WU5B 4XX1E 2FECI 3MFFA 5MI0B 5F9WB 3I02A 3TJHC 3ES6A 5GS1A 1Q9LB 1DVFC 4N0UB 5I18L 1I9RH 3H9HA 4X6BA 3GMMA 1NL0H 3VFUB 4LPTA 2VIRB 4OFKA 2ATPB 1DLFH 5TDPA 4LQ1A 3VE0B 2OL3H 4M4PA 1IAII 1BECA 4MNHA 4WIQA 2AXFA 1GIGH 1D5BB 2FX7L 3VWKB 1VFBA 4JHBA 2QJDA 5D1QB 3QB7C 1XGYH 4XH2B 3VXNA 1ES0A 1T20A 3GIVB 2VOTA 3LMJH 1URLA 3L5JA 3MJ9L 3PWUA 4JKLA 4J3OC 4HX1A 4TUOB 4EI6B 2BVUA 3L6FB 2VLKB 1SY6A 4EI5A 3CDCA 4OZHA 3TH3T 1WSST 1AC0A 3EJJX 3SDDA 2DQJH 4PJFA 4CW1B 3H9YA 5CEYB 4HUUB 1NCCH 4W6YB 1AY1L 3BVNA 2IAMA 5E1AB 2VAJA 3IETA 1LK3L 1TLKA 5L2KA 2ZOKB 4M7KL 1SM3L 3HMXH 4I4WB 5FDWA 2J5LB 2W65A 3NGBB 2X1WL 3M1BA 4GT7A 4XVSL 4Z7UF 4XPTH 3GSQA 1J8HD 4YBLC 3VD7A 1TCRB 1HILB 4OCYH 3WJLA 1B4RA 5LGHH 4IOIB 4LCUB 1KPUB 4JR9L 3SDCA 4QHMB 3DUSB 1YC7A 3ARGC 3NCFB 2CLRA 2G5RA 4QCIB 4OLXH 1MJUL 4U7SA 4GXUM 3QUMH 4ZUUA 1WBYA 3TYGL 1KELL 4W68A 5C8JA 1I8LA 3L95A 2IBBA 3K1DA 3WXVH 2VXTH 3WYRA 1KYOK 4UDTA 4K7FA 3HR5B 3C6SA 5CGYC 3VGGA 4L8CA 2WV3A 3IU4L 1RZJL 5C86A 4OKVA 1C12A 2P46B 4M1GL 4PP1D 2AJXL 4R96A 2IPKA 5DC4B 5KS9E 5GGVH 4D9RD 3C08L 3U7YL 3QNZA 4X6DF 3FQXA 3O0RH 2C9AA 5TH2A 4LLUB 4HIJA 1A7PH 4C83A 3HRZA 5E08L 5DHVB 5D8JH 1UADC 1VCAA 2DM4A 3HZMA 1G7QB 1WZ1H 3K7UA 4DGYH 1VFAA 4NSKA 3L7EA 1TPXB 1K3IA 3UJJH 5CBEA 2UY6A 4QRRA 3FRUB 2B1AH 4GAYB 5IGXL 5CJQH 3T0EC 3RWJB 4Y16B 3T0VA 3EGSA 1INDL 1WZLA 4ZFFB 4QRQA 2FRGP 5FEBA 4OD2B 5JA9A 4Z7WF 1AY1H 5HPMA 3HRZB 1CGYA 3QPQC 5BRZE 4ZQKB 4XNZB 4I18C 2EIBA 3VXOB 3WFDH 5EFIB 5KANI 1NUGA 4PRAA 5FYLH 1OAYH 3QH3A 2X4OB 4OKVB 2LABA 2ITCA 1CDUA 1UCTA 4L3EA 3RAJH 1J0YA 5GJTL 5JPMA 3JV0A 5D1ZA 3MR9B 1IAIL 4Q6YA 5EUKA 2H26A 3VJ6B 3EYVA 3P9MA 4TN9A 5FCSH 2FD6L 4PTTA 2NXZC 3RRQA 4EUPA 1XIWB 4GKZB 4Z78B 4JDVB 1GRWA 2X4RB 1ULVA 3G5ZA 4MDJA 4DZ8A 4H88L 2ZG2A 1IL1B 5IJVA 5E94B 2NY0D 1HILA 2EICA 1TCRA 1P53A 2X4SB 4G9FE 5ENWB 3JWOH 1QKZH 4JEGB 2I9TA 1NANI 4OJFL 3ULVE 1IGMH 3ABZA 5EU5B 4HK0A 5E99L 1A7RL 1U3HA 1CLOL 4R9HA 5BVPH 5I19L 1S9KC 3ULUE 3QZWG 1MLCA 3W5MA 1XF4B 3BD4A 4P2YA 1RZKL 3ZKNC 5IB3B 2LU7A 1JN6A 1XFPA 3KNBB 5CSGA 1BVKA 1TPXC 4ORGA 4GRLB 3PHQB 4PUBH 5DURD 1BP3B 1YYML 1FFOA 4GBXC 1KEGL 3ILPB 3Q6FA 1OOAA 4XCFL 4ZO6A 1KCKA 3SPVB 3VH8A 2VO5A 2BERA 3BWAA 5J06A