4ODSH

Unliganded fab structure of lipid a-specific antibody s55-3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
219
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAGSGITFSGYGMSWVRQTPDKSLEWVALISNGGSYAYYSDSVKGRFTISRDNAKNTLYLQMSSLRSDDTAIYYCARHKGLRGGTNAMDYWGQGTSVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S55-3 Fab (IgG2b) heavy chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
total genus 42
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odsH01
4ZDHA 5T5FH 4P5MA 5HPOA 1WZ1L 3ZKXC 5DD1L 1KEGL 4RBPK 1RIVH 3SPVA 3TN0A 3BZFA 4TOYH 4WFED 1FAIH 4XNZB 4PP1C 1J05B 4P9HC 5EUKB 4JRXE 5I8EB 3P4MA 5GS0L 1NGPH 3GI8L 1HDMA 2YD7A 4OD3H 1R3JB 5I1IH 4F33A 5ALBL 1BBDL 1QSEB 4XP5H 4EN3C 3PWNA 5K9JH 1ETZB 3V4VH 1ZWIA 3FB7A 3TPUA 2ZPKL 4DVRL 1T80A 1J9CT 2BDNL 4EQ3A 4P59H 1AC0A 3MMEB 5DURB 4QXUL 5ETUA 2VDML 1ZHKA 4PG2A 1J0YA 5CINL 4N90E 4NQCA 3V6FB 1UWEL 5I71C 3P9LA 1QSZA 1P6AB 3I6KB 3KXFE 5GGSY 5MI0B 4CU7A 1RHHA 1YUHB 5HVGB 4QXTB 3HG1B 1OP5H 4F7EB 3E6FA 1NL0H 1OHQA 3FT2B 3HS0B 3BQUA 2AJYL 2UUDK 3E3QC 4R96B 2GJZA 3U7YH 3UYRL 1NMAL 1JMZA 4LU5L 4OCXL 4D0CB 2CGRH 3FRUA 4HBCH 4GH7B 3WUWG 3OQ3B 2P49B 4JO2H 1GOFA 3GMOB 3G5VA 4G43B 1HHKB 4U31A 5IWLA 3V0AC 4NZDA 4KKCD 4OB5H 4PJHB 5CBEB 3VXOB 4FRWA 1ZA6A 4PG9A 3TO4D 4ZFOA 1IGMH 1JYVA 3EYVB 1JFQH 4C83B 1A6ZA 2KZWA 2W0KA 5DZNA 3VFNB 3K2UH 4IJ3B 4Z78B 4RGNC 3IVKB 4NQUA 3S36X 3O0RL 1DVFA 4XAKE 3FL7A 2DWEB 3WYRA 3BE1H 1CWVA 4EIZC 1V7ML 3OXSA 1D6EA 1DCLA 2PCPB 3NGBC 5I1DA 1JVKA 4UTAH 1F6AB 1QR1A 1AGEB 4JKWA 3GSOA 3MLPA 1TZHA 5ESVB 2OK0L 1FH5H 4M4PA 3VWJB 5L7XH 3MNZA 4MDJA 1OM3H 1KXTB 1C7SA 4HKBB 2AK4A 3Q5OA 4L3CB 1A7RH 3U46B 3DMMD 3FO1A 3K3QA 1MWAH 4PRPD 4K23L 1JWSA 3G5YA 5GISH 1FV1A 1VGEH 2MHAA 1K2DB 2X40A 1ZLUH 1BFOB 5JW3L 1EIBA 1CZ8H 5ADOH 1AR2A 1T1ZB 2PYEB 4OD2B 2AEPH 1I8LC 1CI5A 2I9LA 3RX5A 1RUAH 4X6DB 2A77H 2AXHA 4XGZA 3BT2H 3FONA 3QWRD 3TNNB 3MBXL 3Q1SL 2CXKA 3TCLA 4GQ9L 1I9EA 4RMTA 5DGQA 1JF5A 4HZLA 3UX9B 3DXAA 4YBLB 3FO0H 1I7UB 4LSDA 4O9HL 4N9OB 3BGMB 5D93C 3GHBL 1YECL 1UGNA 4L5FL 4LSSH 1WIPA 4TNWF 4XB7A 4WI6A 1WFUA 4K3DL 2FIRT 5D1XA 2IALA 1KTDB 4HIIA 4PJ5D 3RL1B 1S7XA 2R0WH 2DQDL 4K7PL 1A1OB 2ICWA 4PJXF 5DEFA 3ZZ1A 4D0DA 3BD3A 5BZDA 3BYTA 4FS0A 2DBJA 3U36B 1AD9A 3BIKB 4K9EL 2DTML 5DI8B 5E4IA 2YD3A 5I1AA 4TVPL 3ZKSD 3ULUL 3CX5J 4LASH 5DFWH 3F12A 3VXPB 4RZCB 1A2YB 5D1QA 2HT2D 3MLWH 3IXAA 2P8MB 4Y2DC 2D7TL 4POUB 1AQKL 3MFFA 3VGGA 1ZHLB 4C56D 2H2PC 2DKMA 3JTSA 4ZFOL 5C0JB 3RDTB 3ZDXF 1R0AL 4IIQB 3QJHA 4ELME 2NW3B 1UM5H 3T0EA 3ARRA 3WIFB 2HVKA 4LPVA 5I1HH 4YDJB 4ZD3H 3O3UN 3TC9A 4ZTPH 4RIRA 2BVYA 5ANME 1MSPA 1NH6A 3F6IA 3IGAA 2ILLA 4K2UH 1ORSA 3QFJD 1VFAA 4LFHD 1UZ8B 2BCKA 3L5IA 5EDXA 5T33H 3BISA 4QYOB 1LE9A 2R2EB 3RBSA 2FO4A 1T20B 1HQRB 5GGUB 4Y1AE 5EO1B 3CX2A 4QRSA 3ULSB 3O2WL 4I13B 1YMMB 1EJOH 2EDLA 4X0KB 4ONGL 4JFFA 4LSRH 2YMXH 5HYJB 5K9QI 5DJZA 3AREA 2JCCF 2QHLA 4W6XB 1YEHH 5TPWH 3VXUD 1LNUA 5HVFB 4HUWB 3RTQB 3DX9B 3BD4A 3SOBH 4AMKH 4U2ZA 3OF6D 3MRCB 4ZYKB 3G6JF 4FZ8H 3WIHH 4KZEH 1CT8A 2PYFA 3TVMB 4CVZB 1HWHB 2X05A 2Q1EA 3N06B 4O00A 1FFNA 3V4PL 1VSCA 4PJEB 4WV1A 3SJVB 3DYMA 3O2DA 2GTWB 5J11B 4EUPA 3NZ8B 5HJ3B 1NUDA 4P4RB 2Z31B 1JK8A 3C5JB 3QYCA 1RZKL 1DBJL 2BJML 1EFXD 2R1XB 3B6SB 1KPUB 1U8IB 4X7SH 4JJ5A 5HI5D 3L7FA 4AEEA 4WO4A 3ARBB 2YHGA 4P2OB 4MA1B 4U1JA 1CICA 5EBLA 1IEBA 4L9DA 3CXDH 5SWSA 2O5XL 4MXQD 4S1QH 1FPTH 4YC2C 5C08D 1LO3L 1BQSA 3U0WL 3JVGC 4Y4FC 4LVHB 5MENA 1DQQB 2DWDA 4HIEB 1JHTA 4B5EA 5FA3B 3CFJA 1MCLA 5MEQA 3F5WA 2WIIB 4ODTL 4OFVA 1A6TB 2VKXA 4PLKD 3VXSA 1PG7L 5D2LA 4GRWB 4Z7VA 1PX4A 1ONQA 1ES0B 2XNAB 4NNXB 5GS0C 1UJ3A 1I9IL 5KSAC 1I8MB 5EA0H 4APQC 1ZT1A 4HEPG 2ZSVB 1ZGLM 4R0LB 3LS5H 1IGYA 3F7YA 1U36A 4PJFA 4GMTL 3GSUA 4NC1C 1OF2B 2VXTH 4ZSOA 5IOPB 1BD2E 3VXTB 1XH3A 3WS3B 3U6RA 1L6ZA 4HAGA 1JTTA 1I1YA 2CLVA 4HZAA 3TBSB 3CVHA 5MEOA 4M6OH 5LXGL 2FATL 2E27H 1ZVSB 3QIBC 5KAQF 4DUWA 1T1WB 2C1OB 1E4KA 3PF2A 3QIWC 5DVNA 3TT1L 3EJYC 3O4LA 4HULB 1T21A 5TGBB 1JGEA 2QADD 5GQBA 5GGRA 1JHKL 1VGKA 1Y6MR 3GSXA 3V8CA 1K4CA 1WAAF 4M5YH 5T1LA 4R97C 4HS6B 4LIQH 5E5MA 1P7KA 1TZGL 1SM3H 3KVQA 5BS0D 3GJFK 3LH2H 1KELH 5A2KH 3O45A 2F54E 3HE7B 3DBXA 2YPKB 1I7RA 3U1SH 4F15C 5CIPB 5FDWA 3JV0A 4BJLA 4Z7OF 4GW5A 3DI3B 3B9KA 5L88H 3I02B 3QI9C 1MAMH 1TLKA 5GGVH 4GRLB 4H1LH 1HXYA 1LO4L 3W9DB 5HBBA 4Y5XA 2XKNB 5CILH 1UFUA 2COQA 3RZWA 3GMPA 4LL9A 1EAPB 2YKLH 2H2SC 2X4NB 1NC2B 1HZHL 1JZ4A 2LAGB 4PR5A 3B5HA 2HFTA 1QTYT 3H9HB 1P69B 3QZWA 3IFNL 5C09D 4JN1L 3ZE2E 3RA7L 2CRYA 2C3WA 5DRNA 4L8BA 5I74C 2X6MA 3KLHD 3VXME 2W60A 1NGYB 5CWSA 3TN0C 4GAJL 5FUOL 4ACPA 4R26L 3RY6A 5C92A 2AK1H 1OAKH 5HDLA 2B4CL 4IRJD 2WSKA 5JXAH 3ROLA 3OKOA 1QVOB 5ICZB 4MCYA 5EU7C 3CMGA 3QDJD 5CJ5A 4LHUA 5JUEH 2BY2A 2ZOKA 4Z7UF 3C8HA 3MA7B 4PJ9D 3UAJC 4CN1A 4HIJA 1F4YH 4ODVH 2UVFA 4JFYB 2CIIB 4DZ8B 2VLME 3NFNB 1G0XA 3GSWA 4P23B 5F9OL 1WWAX 1E6OH 1LVEA 1PEWA 4FZEL 5BV7L 1AFVH 5EC1A 4PG2C 3CVHL 5DJ2A 2R69H 2A6DA 4AM0A 5GS1A 2WQRA 5JQ6L 3LV3B 2X4SB 3DV4A 3ZKNC 5B4MC 1IM3B 2P5ED 4PTTA 5F6HJ 5JOPE 3BQUC 3ULUC 1MPAL 2MMXA 1X5HA 2WBJB 3I3DA 1KCUH 43CAB 5B8CB 1S9YB 3BUTA 3NABL 1XR8B 4GBXB 1DUZB 1T7ZA 5IWLC 3EO1A 1QFUL 1WEJH 3OB8A 2DQTH 3MRNA 3MNVA 3IRPX 4YGAB 4TVPE 4LNRA 2FJFA 4KMLB 5B39A 3FB8B 1YNTB 3MRQB 3STBA 5CJ8A 1KLFA 4H8WH 3TH3T 3CD4A 1NC4D 4HWBH 1I8KB 3ZE0F 3MBEB 1DVFC 4PJ7B 1HIML 2VLRD 2JB6B 4FQQB 4D8PA 5KSBF 3NZHH 1FO0B 5HHPB 4PJAF 4OI9A 4NGHL 4FQJH 2DI7A 3DYOA 2GFBB 2HT4D 3U2SA 4ODHL 5BXFB 5SX5K 4CN4A 4KVCH 5D2NA 1UH3A 3S4SB 4PUBH 4HGKC 5DEZA 3IU3A 4P5TB 4XNUL 3B2VL 1FCCA 4EBQH 3RKDD 5ISZE 3Q5TA 1YN6A 2VDKL 2DYPD 1OAQH 4R4BB 5F9WB 1FFPA 5E00B 5CHNB 4ORZC 1OB1A 4I3SH 3DX6A 1A1MB 3SCMB 1YEDA 4KI5D 2BERA 3V6ZB 5HHNB 4J1UB 4XPFH 2V17L 4P2RA 2HAZA 5IQ9A 1H8NA 4YK4B 1DQLH 2HN7B 1IILE 2CJUH 5EBMB 2I25N 1GOHA 3OAYK 2GCYA 3JTTB 5FHAL 3SDCA 1TJHL 3AU1A 3LIZL 3OKYA 1OGAA 2YBRA 4XCCL 5DUPH 4Z76A 4K8RL 1YNLH 1ORQB 4JDTL 3C60A 3MV9B 5D1XC 2YSSA 4KRMB 3ARTA 1PVHA 1QA9B 4WFGD 2PTTA 3HZYA 2EIZA 3GMNA 2G9HA 4WW2A 4Y5YA 1QKZL 1NFKA 2EH8L 2VQTA 3D87B 1P4BH 5D7JB 1PQZB 2NY2C 5IHZA 1MJJA 2YRPA 2ITCA 3KPPB 2IADB 4X80H 1P5VA 5HD8D 2RB8A 2DQJL 4N0FA 4OCSH 2F15A 1BQHG 1YY8A 1IARB 1ZGLP 1N59B 1DFBL 3QNXB 5D1QC 2P8LB 4IDJH 3TBVB 1TQCB 3DIFA 1HKFA 1P4IH 4R2GB 2V9QA 3DO7B 3L3IA 1CXLA 4PRDB 1A14H 1WFNA 1CDYA 1XGPB 1QBML 4JKPH 1E28B 4WI3A 1MLBA 1C5DA 1T5XA 3ZSSA 4AIZA 2DIJA 3T0EC 3AROA 4NSKB 5F1IB 3UBXB 2KQNA 5EOCJ 5I1LA 3G5XA 2QBWA 5FAAA 1LEKA 3VDCA 1BAFL 3V0WH 4CNIB 3L7EB 4YHNA 1WITA 3VWKB 2P7TB 4PJGA 5CD3A 3KWWB 4EI6B 3C9NB 3B2UC 3O8XB 3MLYL 3FT4A 1JGDA 3ARYA 1SYVB 5DLML 2VLJB 4JVWA 2XY2A 2A38A 1MCJA 1ZT4B 4NQDA 1W2KT 2P43B 4MB3A 5B38G 4ONHA 1KIQA 1WCBA 1VB9A 3NIFE 5ENWB 2Y06L 1OLZA 4M03A 4CW1B 2RFXB 4N5UA 4NO3A 1QG3A 4Q9QL 3SGDH 2OR9L 3LKOB 1W0VA 4UB0L 2F5AL 1DBAH 3AREC 1F4HA 4HKJB 5CZXC 5CEZH 2JJTA 2HA1A 3VCLA 1WC7A 4S1SL 2J8UB 4R3SA 4KHTH 2F8OA 5GRUH 4XHJC 3MV7E 1U6AL 5CLWA 3NA9H 3ZTNL 1U92A 5F9DC 4LSPH 2ZOLA 3O6FB 1U3HB 3WFDL 1SMOA 4NRXB 4Y5VA 2D4FA 4N8CH 1HI6A 3REVA 3R06A 4KK8D 4PRHB 4BUHA 3VFMA 4N0YL 1BECA 5CP7B 1Z3GH 2NY5C 3EOTH 3RL2B 3ZKQD 1VFBB 2X2YA 4WV1C 3D85A 3IYLW 4Y2OA 3GK8H 4KUZL 4WHCA 1QLRA 4F3FB 4HIXH 4XCFH 2W9DH 4P4KD 3VRLE 5D1ZD 3AY4A 2DAVA 1IGJA 3NTCH 4PJHF 2GJJA 5JHLH 1I9RL 2AKRB 5ACZB 4ALAL 4WO4C 3OKMA 4B50A 5A2LH 5EU6B 1MI5D 4Z0XB 1NGZB 1I8IB 1CICC 3KPRD 3VGBA 5E94A 4TYUA 1EEZA 1MAJA 4MNHB 1TTGA 4F37K 2OMBA 2HKFH 2VXQL 5E9DB 3HAEA 1CTOA 4QNPF 2WM0A 3NIGF 3PWJB 5C6TL 2GUOA 3IJYB 1T1YB 1GOGA 2HTLC 2HG5B 3RVWD 5KVGH 2B4CC 4ERSL 1P84K 2ICEA 2VDRH 1UJ3C 3O3EB 3N1FC 5C1MB 5TQ2L 5FO8B 4ZO9A 1YPZE 2F53D 3QQ4A 1PYWA 4O2FB 4BM7A 1MQ8A 3HRPA 3DNKA 4M62H 2VLKD 4JRYB 1PDKA 4WEMB 3NA4A 3ISWA 5IJVA 5ITFB 3CCHB 4GKZA 4WUUB 4X6DF 5FUZH 3E6HB 3WNKA 5BV7C 4K3GA 1D9KD 1N3NA 5T1MA 3UYPA 1CLYL 2Q3AA 2PO6B 1CD0A 1T6WA 4H26A 1JPGB 2GTZA 1EHXA 5F7EL 2AGJL 1JWUA 1Q9KA 1A9EA 1E4KC 2VITB 3QQ9C 3U48A 5J8OA 4QRPA 5KBNC 2IQAB 2GYSA 2R56H 3VD3A 1I1FB 3WEXB 4BH8A 4UV4H 3QNZB 2MQCA 4HF5H 4PLOB 1V3LA 3KPOA 3E8UH 3VFWB 6FABL 2H3NA 3VE0A 1U8PA 5GGTA 4L1HA 3DOSA 1HSBB 5D6CB 3REWB 5EU4B 2NTSP 2DQFA 3L3DB 1DN0A 1J86A 3BH8A 1U8HB 4L4VB 5EZIH 4OCYH 1UYWH 2HMIC 4KKAD 3W9EB 3GJEA 4LP5A 1GYAA 2PXYA 3CC5A 3HR5A 4KDTA 4GRWH 3BP4B 3B9KC 4Z7WB 3O4OC 5CGYD 3HG1D 4NT6A 3O9WA 5IGXH 5E03A 5E6IA 1L7IL 1HILA 3LB6D 5BVJA 4NHCL 4IRZL 4Y5XC 1XIWB 5JLZB 5HGBB 1NFDB 3FOMB 1CGSL 3E2HC 4MJIA 1QRNB 5DSCB 5CMAB 2B0SH 3THML 4G6JH 1RZGB 4B0MM 1T2QL 5FA4A 4B41A 4E41E 2V7NB 3Q6FB 4CU8A 2MCG1 4BK5A 1CFQB 4MS8D 5EIIB 3BPOC 1HOCA 5C0DA 4L4JA 2XICA 4LPUA 4YXHL 1SBSL 3E1F1 4ETYA 2X10A 2C3GA 3CFCH 3EOBA 2ITDA 5F7LB 4AIOA 1Q94B 4ZNEA 1IC7L 2R15A 1UEYA 2FGWL 4PJBE 4P3WA 4EVNA 3RY6C 1EAJA 3HNVH 3LQAH 4HXBH 4NDMA 3FO2B 3KR3L 5CEXB 4KZDL 1XGUB 2XN9E 2E7HA 2EE2A 3R8QA 3GUTB 3S35H 4N0CD 2ICCA 5HGDA 4E5XB 1EERB 2BK8A 3DVGB 3PWPD 3QIUD 4K8RC 4X5WA 1KENL 4G9FB 2D7MA 3RIFF 1R24B 4JY4B 3VJ6A 5E8DH 1RIHH 2BMKB 3LEYH 5CIPH 1QBLH 4G8GB 5F3BA 5JMRA 4M9OA 1YA5A 4MA3A 4YXKH 1YNKL 1Q9WA 4AEHL 2PF6A 3S34H 1X5FA 5LCVL 5GS1C 5CKAA 1E6JL 4WY7L 5KTEH 4NKOB 1DBBL 5A3IC 3RNQA 5C7XL 2AEIT 2A0LC 3SGJA 4XT1C 4OTXH 3O6LH 3IB4A 3LHPL 4XVTL 4ZXBA 3GDBA 1V7NL 1BBJA 4XHQA 5GGTL 4DWHA 2DJUA 1EVTC 1JI2A 4PJEF 5TDOB 3J7HA 2BVUA 4QTHA 4M8QB 1PW3A 1JHLH 1FNSL 1AO7B 3OGOE 4R7NA 5CSZA 1AE6L 5DYOA 3QNYB 1HHIA 5FO7A 3VH8G 3AC0A 1LO2H 4Y8AA 4IS6A 3QEGH 4NC2B 4V1DA 3MACL 4I4WB 5C0BE 1T22B 1P2CB 2AJ3A 5JIPA 4JFZH 1A7OH 3OB0H 5HHME 5F9JB 1X6NA 5E8NB 1HQ4A 3DV6A 4GXVL 1ZEAL 3PQYD 3F58H 3QDGE 4O4YL 3VI3F 4X99A 2PUQT 1E4XL 4Y16A 4YBQC 4WGVB 1F3DJ 4TUKH 4Q9CA 4JM2D 1PSKH 5D2NC 5DO2C 2I5YH 5E2TH 1NGWA 1OAXH 4YIQA 2JB5H 4NYLA 2F58H 4ESKA 4LRNH 4GRWF 2FBJH 3T0BA 5E8PA 4Z7OE 3RDTD 4N8VA 5IJKA 1EHNA 2DQGH 2OL3A 2B2XH 4O5LL 5AZEL 4HK3N 4DGVL 1T2XA 5DRWA 3KJ6L 4OLWH 2F74B 4XCNA 2Y36H 1B0RB 5ICXB 3SDCC 3LRSA 2YPLB 4LBEA 4M6ML 5I8CB 2DQUH 4U3HA 2C3XA 3SGDI 3KLDA 1A3RL 4XVJH 1NAMA 3OAUH 3ARFA 4K3JL 5IFAL 4ZS6D 1NEZA 3PP4H 4X7TB 3P77A 4OT1L 4PJCB 3UTSA 5L0QB 4J4PD 4LCCB 5D4QA 2IAND 5IESL 3BJ91 1FO0H 4WW2C 4Y5YC 3C5ZB 1L0XA 2NY6C 3KJ4C 1P53A 4I2XB 3LEVH 5EOCL 1MFAH 4OF8A 1MVUA 2AXGA 2W9EL 2O61A 1FQ9C 1S7QA 2L7JA 3IAGC 1Z6JT 1ZLVK 3KYMA 3RWEB 4UTBL 2G2RA 4U1IB 1R3KB 2NX5A 4P2QD 2JJUA 3D0LB 4WNQA 3QXAA 3OBAA 4BZ1L 3C8KA 4Y4KB 1MCQA 2E9IA 3WE6B 1J1OH 3C09B 4UT9L 5D7SL 4G7VH 4LLVA 2FJGA 3FFCB 4JPKL 5IQ7L 1D5ZA 2OTUB 2Q8BL 1DQMH 2A9ML 1ND0A 4CGTA 4FTVE 1IC4H 3TVMD 1A7BA 4FQXD 5LJYH 3PNWB 1LK3L 1ZA3B 2CO6B 3T4AB 1IM9B 4ZUSB 2I07A 3G6DH 1OTUC 2OI9C 2XA8L 1NKOA 3TZVD 4ZPVB 2BXZA 1GIGH 1JZ2A 1KN2L 2ARJB 5FYJL 5K9KB 2XTJD 4RFEA 5D7KD 3T1FA 2AJZB 1E4WH 1G7PB 1UWGL 3VDBA 1A1NA 2XWBB 1CG9B 3I75A 3NAAH 3JV4B 2MCPL 3WFCL 5LGHL 1IL1A 4KMTL 4P46B 2V2WB 4NQEA 5DHYA 1KTLA 3LKQA 4F2MB 1DE4B 4N9GB 2R29L 4J23A 4MA8H 1CFSA 4OZGF 3L95A 1FNGA 3BWUC 1N2RB 5KVDL 3T65A 3W81A 3Q3GB 5IB2A 4YEEA 2EEDA 2ADJA 2B20A 1AXTH 1VKXB 3P4NB 3QUZB 1ZKAA 5D5MB 2GK0B 3G08A 1ZV5A 4TTDC 2QQLH 5FCUH 1MLCB 1NCDH 2OL3L 2ESVB 5GZND 3ARXA 3IJSA 4ENED 1J5OH 3VMNA 3TBTB 2Z91B 2JJTC 2DRUA 4PBWD 3V6OA 4LLDB 5DUML 4NO0B 3KS0H 4LOUC 2NY1C 4IEFB 2FECL 4LHJB 1OQOA 3ELAT 4ISVA 4Y5VC 3TBWB 1IGFL 5DJ8B 4DK6A 4S0SD 2MPAL 5HGGS 3KPSD 1NAML 1MUJB 1MCWM 2GJ6B 1ADQH 1WZMA 3MOBL 5KG9B 1FBIL 5J3HC 3M1BA 3SY0B 2Y5TA 3UZQA 3ARDD 5IVXB 4JCLA 4M7ZB 1YYLL 1BHGA 1KJ2L 4FQPA 5JHDB 3HZMA 2IEPA 2OSLA 2V2XA 3QAZB 4JPVH 1U93A 5ECJE 1T7YA 3QHZH 3AY4C 1B6UA 5GS2D 2XZQL 4OLUL 1A5FL 4JAMA 5C07E 4OM0H 5A16B 1MRCH 1CK0H 3GGWB 1XR9A 1RURH 2EDYA 2OLDA 2BNRB 4OFPA 4U6XA 2G5BA 1BQLH 3MCLL 4WRLA 5GZOC 5KJRL 5F97E 4PJDA 1INQB 4YR6B 4PJ7F 1QSFD 4F7PA 4CVWA 3HE7D 5J6GA 1UC6A 4OJFL 3NMEA 1KG0A 1YN7B 4UQ3B 5J57B 3LD8B 5IK3A 4QGYA 4WTWA 3ZYIA 4FQIH 4Y19D 2XQBH 5LKNA 1FLTX 2Q7YB 1BIHA 1IAMA 1XGTA 2DBLH 3CLFH 5DR5L 3VFPA 1S7VB 3AS2A 3KGRA 3K4AA 3QUKB 1R5WB 1HH6B 2X4PB 4PRPA 4P3CL 1DANU 1INEH 1RZJL 4L29B 1UA6H 3MCKA 1NC2D 3M17B 2MKLC 1K8DA 4EOWL 1X5IA 2KKQA 3RPIB 4XX1G 3QG7H 4A6YB 5TQ0H 5L2KE 2E6QA 3CJJA 3EOAA 4U1MB 1ZGLB 1L9NA 3SO3B 3BPCB 4KROB 3QWRA 3C2AH 3FOLB 4XI5C 5DZOA 5DD6B 3ZSTA 1D5MB 3TT3H 4U6TA 3U30C 3M8OH 5EUOB 5DJXB 1B0GA 1RK1A 4XPGH 2YUWA 3HHRB 3KPQB 2C26A 4MQXC 3FB6B 4HPOL 4HFWB 4X8JA 4ZFZA 5I15H 3TYGL 3EJJX 1IC5H 4YAQB 4OLZL 4PJ5A 5JOFB 1XF3A 5ID1B 3NH7L 4QRRB 4NZTH 4WI8A 5DTFB 3QO0A 2H1PL 1C16B 2VDPL 2FX8H 1MRDH 3ALPA 2J6EH 3SDYL 1P7HL 4Q9RL 2OCFD 2PXYC 4ZQKB 4G8EA 3D2UD 3WLBA 4KDTC 1IAOB 1CQKA 4QHNB 2PN5A 3TGXA 3UJJL 2C7UB 4JLRA 4PP1D 4PTUA 1FZMB 5E6IC 3MV11 3MYJB 5FHBH 1UWXK 3FKUS 4X6CE 3QWQB 3FN9A 35C8L 4D9RE 4MD4B 3MXWH 3W2DH 3VXQA 3A6OA 3WKML 4RAUB 3V5KA 3QQNA 3H7LA 4U1NA 4MJ5B 4YO0B 1KNOA 1C5BL 5DVLA 1T0NB 1UQSA 2J88L 3SE8L 4HX1A 4TUJA 3WD5H 4PGDA 1LDPH 4X6EA 3M07A 2ADIB 1X7QB 1N5AB 4NUJA 1V3MA 1DUYA 4XMPH 1JPFA 2BHUA 4NQSB 5IHUH 4N0UA 3Q6GL 3W0WB 9CGTA 3VI4E 1FC2D 3I50H 4ODXB 5E5RB 2KUTA 2P5WA 1MELA 1AI1L 5EO9A 5JMOC 4XRCB 4Q2ZA 2ZG1A 4XCEA 4HS3A 3KLAA 2ERJB 2VH5L 4P0DA 4QNPE 1JGUL 2ATKB 1TJIH 3FN0L 4TUOA 1YEGH 5EZOL 4C54A 5IB1A 1GGUA 1KLUA 2AJUH 1WCQA 2NY4B 2ZKHL 1KT2B 2CRIA 1YEFL 2J8UF 4LCYB 3O11A 3S88H 2EDBA 4OUUA 2IWGA 3X17A 5F89B 3RGHA 4F7TB 4P57B 2IGFL 3QG6A 5DK2A 3SGJC 1Q1JH 2BOCA 3ILQD 5KZCB 1IBGL 4QTIH 2K1MA 2Q6WB 1C08A 4K7FA 1HNGA 3FAWA 1OPGL 5I75C 2GT9A 4ZXBC 2Y9RT 4QWWC 2J8OA 3CFKB 3P30H 4JFDD 2PTVA 4NN7B 1KB9K 2H32B 5HHOA 2FR4A 5DUBA 5ERWB 2OYPA 5EB9A 3QRFM 1BJ1J 4UBDC 3LKRA 3IXTB 2C9AA 1EFXA 2IBZX 2R1YA 5IB5A 5IM7B 5HI4D 5C0FB 4PJXA 1CE1L 1XCQA 3GZKA 2DOCA 4DKEL 4I77H 4YHPA 1I9JH 4JFXB 4L8CA 1TVBA 4GG8A 1D5BB 4HS8H 4PLJC 3HLAA 5C08A 4XWOC 4JEGB 4LARH 5I8KL 4GAYB 5ID0B 3FT3A 4Y16C 3S3PA 3QXDA 1F3JB 5FYJE 2H8PB 3RU8H 4CRPA 3SDDA 2CKBA 4OLYL 5J56B 1TCRA 1CF8H 5CEZE 1KJMB 5KSVA 1KYOK 1UJTA 2O5ZH 2AW2A 2BSTA 1W0YT 3UYOD 1M6OA 3OPZL 5IJKC 3HTLX 3DLQR 1G1YA 3BXNA 4ZUUA 2YUVA 4I3RL 5FOBB 4M3KB 1MFBL 3TIDB 3C5SB 1FG9C 2XZAH 3WSQL 2Z4QB 1GHFH 3U4EB 1CCZA 1F4WH 3DRQB 4XP4L 3FN3A 1OAYH 4UIKH 3MRIA 4G42B 4U1KB 3L3HB 4YHKL 3SKOA 3TV3H 3VWKD 1FGVH 3VFSB 3NFPB 4Q6YA 5IG7B 2ORBH 5JDSA 2Q76B 3ARFC 2ZJSL 3EYSL 2EYTB 3NIDF 2UZXB 5DD5L 1H3UA 3IFOA 5D7LD 2H2PD 1B4RA 4ODWB 2BFVL 5I66A 4LEXH 1NLDH 2BVPB 3QCVL 1IT9H 4LK4A 4PFEA 4FQ1L 1MJUH 4NM4L 2J2ZA 4X9FA 3BKJL 1PAMA 3OTTA 4MNQA 3X14B 3D9AH 4LSUH 1D6VL 1U8OB 2JKXA 2WW8A 2UVEA 3IU4H 3WO4B 1YMME 3QPXL 2P44B 3MX0A 1IGTB 4MNGB 3UBXI 4FQHA 1R3HA 1MWAA 1EXUA 4OCLC 1EMTH 3EO9L 1KN4L 5SWQB 2QKIA 4U1SA 1IZKA 2VQUA 5D96C 1B0WA 2UZYB 2VIRB 5T5FL 4Z7WF 4POYA 1XGRB 3G6JA 1P7QB 3BPLC 1II4E 25C8L 4HLJA 5E1AB 1AGCA 2P24B 1DEEA 4UUJB 4LDEB 4TOYL 1YEIH 3RVTC 1MY5A 1NFDF 5E2VH 2X1XR 5IFJA 1HHHB 4L3EE 12E8L 4U6YA 5CBAA 4D9QD 4X7EC 3HC4L 1NGPL 1RUML 1HXMB 2FWOA 4QXGH 5I1IL 3BZ4A 1QQDB 3O2VL 5SWZD 4Z77B 1FSKC 1RZJC 4PJEE 3SJVE 1L0QA 3BRGC 3ILPB 2DKSA 1FYTD 1KGCE 4M48L 3MODH 4PRBB 4P59L 1EHLH 3F8UB 3D39B 3P0YL 3SDAA 2D0HA 4G3YL 4KTYA 3H2WA 4NIKB 2CKBL 1TPXC 2GITB 3A6BH 4PB0H 4NWTL 2A6IA 2WP3T 1QBBA 4H25A 1RJYA 2VXVH 3QDJA 2A83A 3C08L 4I5BA 2VDLH 2DB8A 3MRMB 4PJ9A 5I9QB 1BFVH 3VFTB 2IFFH 4F9LA 4WFEE 3WN5B 3IF1B 3V6OC 2PW1A 4OV5B 5IBLD 1MAKA 5LGKA 3LMJH 4JRXB 4U7KA 4OB5L 2C4FT 3V0VA 3HC3H 4GRWE 2D03H 5C8JB 2W91A 2DQIL 3QEQD 1AIFB 5DFVD 5I8OH 4TSAL 1IQDA 1KIRB 3NOIA 1RSFA 5CLTA 2P5EA 1SYSA 2H9GA 3ZKXB 2ZCLH 4Z18A 3VXRD 1S9WB 3MRRB 3DX7B 3NPSC 4JY6A 1YQVL 1EEQA 1CXKA 1HEZB 3JV6A 4AEIH 2FL5A 3TO2A 3UTQA 3EYFA 4EN3B 2ED8A 5KSAD 4E42A 1WBXA 2DICA 4H5SB 5FECA 4LSQH 1BIIB 1WAAA 3MRPA 1A7RL 3S6CA 3L3OA 3DYPA 3O3AA 4JFEB 1NC4A 4RGMB 3TYFB 1Q8MA 2Z92B 4PRID 1VGEL 2Z35A 2VLRA 2YD9A 1JYWA 4LGRB 3QCUL 5ADOL 3CLEH 3U82B 2QR0B 1PG7W 3CXHK 3FQNA 3QIBD 1K3IA 1I1AA 4UDUA 1A7NH 4RFOH 3BT2L 3QIWD 5INCB 3IDIB 3EJYD 1XF4A 3CVIL 4XZUB 1LE5A 4TNWK 4PGBB 4M7JL 2NY3D 2DYPA 1PLGH 1W72B 3NPZB 1WBZB 1OGTA 5E2WL 4BZ2L 3BSZL 3WIHA 3NCCB 4LSSL 1BGXH 3R0NA 5T3XH 1EEYB 4Y4HA 2E9JA 2ZWLT 4KKNA 3QDMB 3STZB 1NJ9A 4RGNB 1GGIH 1S7WB 5ALCL 2E7LA 4KKBD 1VADA 4WW1A 4JR9H 1F4XL 4NPYA 1CVRA 1G7MA 2WINA 3S96B 4XNQA 4R8WL 3VRIB 3MXVH 4GMSL 3AVEA 3DRTB 5F7DB 2BNUA 2DIAA 5FM8A 3FRPG 4WI7A 1RFDH 3ES6A 1CXFA 5DHVB 1OP5K 2X1PA 4PP2B 4Z7UA 4PJCF 1MJ8H 3UTOA 1TNMA 4G9FD 1RJLA 2IQ9H 3ARPA 2XFXA 2FHFA 5AYUH 2DQEH 2EYRB 4GXUN 5F1NA 5HHVL 1NGQH 1DLHA 4ELKB 2FD6L 5SX5H 2NPLX 2GQHA 2JF1A 3NFSL 3QUYA 2LVEA 3BDBA 3MRFB 1KXVC 5I1HL 2Q20A 3TN0D 2HT2C 3H7BA 4ZTPL 4DJMA 2WP3O 4PV9B 4MCZB 1A3LL 3JV5A 1MCPH 1OAUH 2B1HL 5LGJA 3BWAB 1F13A 5FYLD 3MROA 1F11A 1FLRL 3QXWA 1F97A 4Q58C 3UAJD 4J3WA 4A6YH 4OSUH 4HG4K 3OWEA 2CH8A 1JF1B 5E4EC 3U7WL 1IEHA 2R2BA 4XCYA 3UC0L 1LMKA 4NKMA 1OSZB 4LSRL 4C56E 3T77A 4HWZA 2YMXL 1ZS8B 1VDGA 4FABL 5B4MD 3ZKND 1VENA 5IEHB 5ESAA 5KSBA 3BQUD 4HHAB 3D0VA 4PJAA 2XYCA 5TPWL 1ZXQA 4TQEH 4HKXB 1XF5B 5DJAB 2M8XA 3GMLB 4Y2DB 1KCLA 3SOBL 1T3FA 2VABA 3VRJA 4KGLA 3X3GL 1KPRB 3WIHL 3QFJE 4TPRL 2E9BA 1YEEL 2VAAA 3P73B 5IB3B 4XXDB 5H2BA 5DRXA 2NNAB 3D5OF 1NMCB 1RZFL 3K8MA 4DCQB 5L9DH 1A02N 1RJZB 3MGAA 1EO8H 1Q9LA 2X9WA 2AV7B 1FZKB 2BNQD 4M1CD 2PR4H 4X4YA 4RDQG 5HYSA 2R2HB 5DJ6A 1DVFD 2GEEA 1S9VA 4LEOA 4UU9B 3C6LB 1G0DA 3MOAH 2AEQH 3OR6A 3BEWB 4H0IA 1JE6A 3CUPA 4FXKB 3T2NL 5I2IA 4HEME 5IVXF 4K7PY 4QCIA 2YZ1A 1MNUL 5LBSH 3VXUE 4HCRL 2GAZA 2QSQA 5TJWK 4EDWH 4MGXA 4P4KA 3DUUA 3ZKMC 1QFOA 4ORGB 4FA8A 1CBVL 2FH6A 1FZJB 5HI5C 3TPKA 3I9GL 3H0TB 3IRZA 3H9SD 1KLGB 3ZT7A 2GY7B 3OHXA 4I0CC 4JFHE 4ZFFB 4NKDB 3RGVA 1GJIA 4UV7L 1G7IB 5C0AB 2PKDA 4IRSB 4MD0B 2VXUH 2HFFB 1NDMA 4OGYL 3EO0A 2V5TA 3ROOB 3IJHA 3O3BB 3SDDC 5F1OB 1QEWA 2FB4H 2E27L 2XI9A 3ESUF 3RZCB 4X9IA 1YMHA 3RUGA 3EJZD 3FQRA 1U58A 1J12A 2F53A 2XV6B 1NCNA 4BSVB 4CVXA 3GSVB 2IG2H 3KPLA 4ODSL 4AT6A 4OZIA 3UXFA 4QEGA 1MHEB 2P8PA 4LLWA 2VLKA 4NRZB 5KW9H 2EDKA 3ARGA 4M5YL 3MRLA 4JO4H 3RNKB 4OM1H 3HUJE 4MQTB 1YDPB 3K4DA 1D9KA 2H32H 3LS4L 4P46D 4LIQL 4YC2B 1HYSC 4L8SA 5AAWA 5EU3B 4RMVA 1SM3L 2GSGB 2L4OA 4Y4FB 4JGUA 4YHOH 3SKJH 3AB0B 4HSQA 4Y8DC 3MUHL 2LTQC 3TF7C 4R6UA 1LO5A 4OZFA 5EUOF 2EXWC 1J05A 5EUKA 1DQDH 3SO5A 1BD2B 2VE6B 5I8EA 4BFIA 4ZTOL 2QADC 3U9UB 4AQOA 1C1EL 1CXIA 3KPMB 2VLJE 1PKQE 3JWOH 5K9OB 5L88L 5FYKD 1R3JA 1RZ8A 4APQB 3HE6D 4BFBD 4BQ6A 3MV8D 5F6IB 4XC3L 1IE5A 2WWKT 1G9NH 2HLAA 3SDXB 1A6WL 4YDVA 1P1ZB 2C4XA 2JELH 1L7TH 4LLMB 4TSCH 3IDYC 1U8KB 2YD6A 3B2UD 3CK0L 5FYKU 1NCAH 2VZVA 4X5XA 4H88L 4GFTB 3D3VD 4MAUL 5DD0L 1I4FB 4KMQA 3QUMB 3MRBB 4Z7NF 4X6BB 2NLJA 1YUHA 2RCSL 4RISL 5D70L 5F3HB 3BGFC 3HG1A 5K9QG 2IMNA 3ARUA 3HS0A 3VFRB 4AENB 4R96A 2BP3A 2GY5A 2HWZH 5BS0E 2YD4A 1T0PB 5LWYH 3FO9B 4KTDL 5HDBF 4D0CA 2R0LH 4IOSD 1TETL 4JFFD 2F54B 5SV3A 2GW5A 3FMGH 5GIRB 4D9LH 3ARED 4G43A 3I6GA 3PGCB 3EW3B 1S5HB 4PJHA 1U0QA 3UO1H 3ECBA 4R97B 3CSYB 4XHJD 5DMKB 3EYVA 4YDLC 4FN0A 5DD3L 4ODVL 5I6XC 5C3LD 4MVBD 2A9NH 4C83A 4UQ2B 3LDBB 3IVKA 4QRQB 2YOCA 2J8HA 1MH5A 3KLHC 4I18B 3IDNB 4F15B 3SDAC 4TVSa 2EDWA 3NCJH 2DWEA 1OQXA 1CXHA 1FIGL 1DQTA 5EU6E 5C09E 2Z8WC 3VG0H 1NBVL 3QI9B 1F6AA 4OF6A 2FX7L 5ESVA 4LCUB 1OAZH 4FQ2L 3QIUA 3PWPA 4G5ZL 3VWJA 4PJ9C 4HKBA 4NJ9H 4L3CA 5E9DE 4F9LC 3DI2B 1A6AA 1NGXB 5DMIH 3VXMB 5BVPL 2AABH 3D6GA 1J8KA 4HKZB 5JW4N 3P11H 1CICD 1K2DA 1BVLA 1GVIA 5SWSD 2PYEA 4P5MB 4OD2A 5CP3A 3BKML 4X6DA 4EKXA 2A2QT 2AP2A 3TNNA 5FUCC 4JRYE 3P4MB 4MAYD 1R5IA 2WANA 3VXSD 1HDMB 4WUUE 4LLAA 4HV8B 1I7UA 3ULVD 2AI0L 4JFOA 1PZ5B 4NNPH 1ZWIB 3FB7B 3TPUB 6CGTA 5C2UB 3PDGA 4ETQA 1NAKH 1KCRH 3BVNA 1V5JA 5DT1H 3T3PF 5ETUB 1ZHKB 1FJ1A 2VL4A 4NQCB 5F1KC 5JA9A 3KHOA 2W9LA 5E08L 3P9LB 3U36A 3BIKA 3H3PH 5BRZD 5DI8A 4KQ4H 2GJZB 1I1AC 2HT4C 4UT7L 1P4LB 3QQ9D 1DQLL 3MRHB 3O4LD 2P8MA 5EC2B 4YJZL 3P0VH 3DECA 1ZHLA 5EORH 1A4JA 1N4XH 1S5IH 4FNLL 4NKQB 1SVCP 2W0PA 2WWKO 4GUPB 4PG9B 4ZFOB 3RDTA 3DX8B 4IBLT 4XPBH 1L4IA 4KI5C 5M95B 3FQXA 2NW3A 3SGKA 1M4KA 4Y4HC 3L3GB 1A6ZB 4AL8H 4S1RH 4H20L 4NO5B 2E7LC 4U49A 4P9HH 4MDIB 5JPMA 4YDJA 5ISZB 2OP4H 3BYYA 2NQCA 4CMHC 4ZFGL 1P4BL 2D7NA 4P9ML 5I1DB 4X80L 3B9KD 1A21A 2AXFA 4NC0B 4KI5E 1TZHB 1UZ8A 3IDGB 4WFFD 5GJSH 4R4NC 2CO7B 4CDHA 1BP3B 2R2EA 4KI1A 1IC1A 4IDJL 2AK4B 1M1SA 1HQRA 1AXIB 2V5YA 4NWUH 1B6DA 3FO1B 5TE7L 5GRVK 1BZ9B 3S37L 3MJ9A 1JWSB 3ULSA 4J4PA 1WSST 3G5YB 1F00I 2IANA 4YX2H 5FGBA 2IFGA 5HHQA 4LCWD 2D3VA 1FP5A 4M8VA 1B90A 2ZNWA 3KHQA 3TWCH 4AJ0A 5HYJA 1MQKH 3LPFA 1LO0L 5HD8C 4L8DA 3B9AA 2I9LB 1YJDL 3QUYC 4P2QA 5GGRY 5EZLA 3T2OA 3FONB 3BP5B 1XCTB 4U1LB 1BLNA 4OZ4B 2DQHL 3V0WL 2QQKH 4GLRH 3DX9A 4G8GE 1W72H 1ZLSH 5CD5C 1QP1A 2DLFH 5CCKH 2IPTH 1OP3K 5CJOH 3AM8A 3TVMA 2DL9A 2J7LA 4LKCA 4UDTB 1IGIH 1J1XH 5D1XB 4HIIB 3QWOA 1S7XB 3F62A 4E9LA 1OY3B 3OZ9L 4P4RA 5AWNH 1IMHC 2ICWB 3QH3A 1I3VA 3C5JA 1UADC 4D0DB 3TFKD 4QHUB 3VFGH 2FJHB 2GHWB 4XPTH 5TFSH 2EDRA 1AD9B 2NY2B 4KK9D 5I19H 3LCYA 2D0FA 1H15A 4PJIE 2IH1B 5GRJL 3V7MA 5A3ID 3F12B 1TTUA 5D1QB 5GRUL 4RAVB 5DHVH 5B3JF 4OUOA 1GAFL 4XMLL 1BX2B 2R4RH 2R4SL 2D9QB 1MEXH 3NN8A 4KRNA 4FMFA 4PS4H 3UJTL 3HZKA 4HIEA 5CZKA 4OCWL 3TIEA 3JTSB 1KJVA 3MSPA 4FFZL 4M43L 3WUWA 4DFIA 4N68A 2F19H 4KJYA 3QJHB 1Z3GL 3T0EB 1VFMA 3VGDA 4NNXA 2XNAA 4ZS7L 3Q5YA 3GK8L 1LQSR 4JZOA 3GM0A 2HVKB 1MIEH 1CU4L 1TTFA 4R0LA 4D3CL 4M5ZH 3ME0A 3IGAB 1WIUA 5EPMA 3QB7C 1ORSB 3KS0J 1VFAB 3KPSA 4HPYL 5ESQB 1ZTXH 3QR2A 1JGVL 1G6RB 3WS3A 5DMJB 4G6ML 4PY7B 1LE9B 2FO4B 3ARDA 3LVEA 4YBQD 1WQVT 3S36L 3F6LA 3MJ9L 4YHZL 4X7DC 4QRSB 3OKNA 1NCTA 1T1WA 4P4KC 4IMLA 1J0KA 1DBKL 4O58L 4G6KH 4JG0H 4OF0A 5DJZB 3LN9A 3SE9H 1SEBA 3MLVH 4XNYH 4CBPA 2HRPL 1WLHA 2NY0C 4PGCB 7FABH 4K3EL 4P2RD 4HS6A 3WNPA 1QSFA 3RGVC 3N1GC 1OGAD 3HE7A 4UILH 1NSNL 1CT8B 2PYFB 1AXSA 5FGSA 1MI5E 2WV3A 3RVWC 4Y19A 1PY9A 3KPRE 2APVA 1GC1L 4LLQA 2JIXD 1I1CA 4XP9L 1ERNA 1JMXA 1GGBH 4EUPB 1IFHL 3TH4T 4GRLA 4K3HA 3MLUL 1G1CA 5JIKA 1MCSA 1BEYH 4HWUA 4XNXH 3FFCE 1SMAA 2W0LA 2NY6D 4WO4B 2X4NA 4UV4L 1NC2A 5C0GB 4ONOA 4HF5L 4U1JB 1SY6A 3ARGC 4U1HB 3AS1A 1M7DB 2QQNH 1MRFH 2JTDA 1D9KC 5F7UA 2FBOJ 3CZJA 4Q6IB 3QEHA 1K8IA 4KQ3H 3RIAF 3PV7A 4IHOB 4QXWA 4L8SC 2YK1L 1YPZB 4OCYL 1EO7A 3O3DA 4LCIH 2DWDB 3RJQB 3HFML 4YQXH 4OZGA 5MEQB 3LKNA 3LQMA 4WU5B 2VL5B 5D2LB 4XVUD 4Z7VB 1ONQB 5ICZA 1UJ3B 4MJ6A 1JTPA 3HPJB 3L1OL 1ZT1B 1JYNA 1FL5A 3F7YB 4JFYA 2CIIA 1YYMH 3SE3A 3TJEL 1XZ0B 3GSUB 2R8SH 4P23A 1U8JB 3S7GA 5D5ME 4QY8A 5C0EA 2B5IC 1FL3B 1XH3B 4XMKH 4CMMA 5F7WC 5BMFL 3D2UA 5BV7B 1R5VA 4NUGL 2VB5A 5MEOB 5JR1H 4UIMA 3LV3A 4NQDD 4MZ2A 5CGYC 2C3HA 1IVLA 5I17A 1J8HE 1UM6H 1RU9H 4GJTB 1LEIA 4DKDC 5IROA 4G80A 4BUGA 5B8CA 3HNVL 1S9YA 4U1GB 1JGEB 2GJ6E 1V3JA 1XR8A 2GSIB 3IFLH 4OGXH 4GBXA 4TTDD 5GGRB 4BSWB 5T3XE 1VGKB 3GSXB 4C4KO 1K4CB 1A0QH 1ZANH 3KXFD 2HH0L 4KKLC 5T1LB 2IBZY 1UVQA 3OV6A 5JHDE 1CD8A 5E5MB 1P7KB 4LOUD 2NY1D 3QUXB 1YNTA 4ZO8A 2HP4A 5ADPL 5DD1H 1RIHL 5FIEA 3O45B 1KEGH 4IJ3C 1Q38A 4X98A 1XAUA 3DBXB 4GS7B 3RY5A 1I8KA 1GXEA 3FQWA 4PJ7A 5FDWB 3S34L 5JOEA 2JB6A 4FQQA 1A9BA 5J3HD 2WUBL 5HHPA 4UNUA 3FB5B 5GS0H 2RBLA 4BQBA 1L9MA 1PGRB 3GI8H 3OKKB 2BNRE 1DBML 2J12B 3QQ3B 4N0CC 5ALBH 3D85D 1ZVHA 1HXYB 4J7RA 3QIUC 3VWJC 2GFBA 4OTXL 4Y5XB 2ZPKH 5JW5B 3CFBA 3QHFH 5BXFA 4X9GA 2BDNH 3GMPB 5JO5A 4RGOL 4P5TA 4YFLF 2QV2A 4PR5B 4PJBB 1SY6L 4QXUH 1Q9OA 1EV2E 2VDMH 5C70A 2RQ8A 1DR9A 4H1LG 2XN9B 3Q2CA 3QUMH 5CHNA 1UWEH 1A1MA 3EZJB 4YZFE 5GZOD 4HUXA 1UWXH 4PV8B 5HHNA 1IAIL 2B7DT 1LO2L 3QEGL 2W60B 3UYRH 5TE4L 4LU5H 4Z5RA 2WUCL 4JFZL 2CDFA 3UZVB 3KYAA 1G9MH 4CJ1A 3ROLB 3OKOB 4YBLC 4OIAA 4JFDA 2CK0H 4MCYB 1G0YR 4LHUB 2N56A 5KVMC 1GGCL 1K9TA 4Z0BH 1LP9E 1ORQA 5IKCA 3MV9A 1MHHA 2IF7A 2WBWB 3O0RH 2R1WB 4GLRI 5EC1B 4YUEL 1V7MH 2A6DB 5DJ2B 4AM0B 5GS1B 5D7JA 4J3UA 8CGTA 3KPPA 4NZUL 2IADA 3SBWA 4QRRE 3JWNC 2OK0H 3T4YA 3QNXA 2P8LA 4UOW1 4NNYA 4QF1A 2EEBA 4OLWL 4QRPD 4OCRH 3FQTA 3MLTA 2E5EA 5C0BB 1FVCB 4PRDA 4K23H 4F80A 3EYOB 4R4FL 4W6YB 5D71H 3MRNB 3MNVB 1XGPA 4N1EA 3BPNB 3OAUL 5JW3H 1E28A 3RDTC 1ADQA 4DQOH 3PQYE 1HCVA 4LNRB 3QDGB 5EU5B 4HMDA 3SGKC 2FJFB 5B39B 4NSKA 4WEBL 1VFOA 2X4UA 5F1IA 2XKUA 1QACA 3UBXA 1H0DA 5HDBE 4XVSL 2K7QA 3MBXH 3Q1SH 4CNIA 4X5LA 5HHXL 4D8PB 4JG1L 3VWKA 5D7IE 1BFTA 1FORH 1T4KB 5EWIH 1DQJA 4O9HH 3EGSA 4JDVA 5TF0A 4QOKE 3F7VB 3U2SB 3FZUD 4L5FH 1MHPL 5D2NB 4ZS6C 4HH9A 5BO1L 4K3DH 5D7LA 3IU3B 4X6FB 2MWCA 5ENWA 1YN6B 3QP3A 2DQDH 4K7PH 1FFPB 4J4PC 2ZUTA 1OB1B 3DX6B 4NOFA 5FGBC 3LKOA 4OIBA 4K9EH 4TTGA 2DTMH 1A6UL 4X4ME 3S5LG 4HAFA 4TVPH 1BOGB 1IAKB 1JJUA 4TRPH 2J8UA 1CDBA 2X9YA 1E4WL 4Y1AD 2QSTA 1QFPA 1ZAGA 4JPWH 3SDCB 1U3HA 2FEEI 2D7TH 1AQKH 3NAAL 2YBRB 4KHXH 4Z76B 4PRHA 2DI8A 5D9SB 3AM8C 1R0AH 2X1OA 3TVMC 3C60B 5CP7A 1CN4A 2YPVL 3NCMA 2YSSB 1VFBA 1UXSA 3CFDB 4JHBA 1YY9C 3WNNA 5GRYA 3GKWL 3HZYB 2EIZB 1GZPA 3GMNB 4WWID 4Y5YB 5I30L 4HWEL 3KJ4B 5F8RC 5SWZA 3VFUB 2DTSA 2AKRA 5ACZA 3GMRB 5FCUL 1MJJB 2FEDC 2ITCB 5ILTL 4YFLI 3OG6B 1FYTA 1YY8B 3D69B 4Z0XA 1I8IA 5J12C 4PREA 5JW4M 1RZIB 4BZYA 4MA7H 1M7IB 2XTJE 5D7KE 2DLTA 2SEBA 5H8DA 1J18A 1SJHB 4ZXBD 3L3IB 4QWWD 4LVHC 3O2WH 1CXEA 4ONGH 3ZE2F 1ADQL 1T1YA 2J6EA 2C1PA 3V6BR 2WK2A 1C5DB 1T5XB 4OQTH 4UBDD 4OLEA 5CJBA 5JZ7D 3O3EA 3QO1A 5I1LB 3F7RA 1KPVB 1LEKB 4V1DD 2I60L 3QHZL 4WENB 4HBQA 1FE8L 4R0LC 1G7LA 1WVZA 1MVFA 4YHNB 5EIQA 5CD3B 5H35B 3QEQA 1KCSL 3FT4B 1JGDB 5ITFA 1MRCL 3GI9H 1RURL 4P5KA 3VXRA 4Y16D 3ARDC 1UB5B 1QBAA 4WFHE 4NJAH 3V4PH 5BOPA 3AMKA 1WCBB 1D5IL 4NO3B 5DRZA 1RZKH 1KB5L 1DBJH 1NCBL 1W0VB 2IQAA 4RWYL 1PEZA 1NBYB 1I1FA 3WEXA 4BYHA 3LQAC 2XQBL 3VFWA 3ZT5A 3V9FA 4KVNH 1WC7B 5I16A 1H3PL 4R3SB 4I48A 4RDQF 1HSBA 5D6CA 1U92B 1LO3H 4PRIA 3U0WH 2ZOLB 3V52L 1U8HA 4L4VA 2IPKA 1EHAA 2OTPA 3TA3D 3R06B 3W9EA 3HE7C 4FFYL 5C07B 4ODTH 5TQ0L 4OGAC 1PG7H 1I3UA 3KAAA 3MRJB 3O41A 5HPMA 4Z7WA 3BKCL 2APWA 1I9IH 1I1RA 4GRLC 4FXGA 3UTSD 5IVOA 5EOTA 1IGJB 4HIHB 5HGBA 3PDOA 5DSCA 4XPGL 1QRNA 4GMTH 5CMAA 3DWTA 4JGMA 1RZGA 1LEGA 2MSPA 5DJYB 1G6RH 2V7NA 3GHEL 4N1CA 1EEZB 1YEJL 2D7OA 1HHJB 3V5DB 3PJSB 1BQHA 1XMWA 4HFUL 2OZ4A 4OI7A 2FX8L 1MRDL 4NM8L 1B4JL 2GUOB 1Q94A 2G60L 4DKFL 4KDWA 3FO2A 5CEXA 1XGUA 1LD9A 1N6QL 5KS9E 4F9PA 2BOBA 5L2KB 1IKFH 2XG4A 5E95B 2RJMA 3HPLB 5GHWL 3GUTA 3C8DA 3RVTD 3WJLA 4E5XA 1FC1A 2VZ1A 3DUHA 4UOJA 1A3QA 1X4YA 1MIML 3DVGA 4ZOEA 5FHBL 4G9FA 3QQ4B 4U3XA 1PYWB 2XRAL 1TZGH 3MXWL 5CS7A 2NXYD 3NCBB 5DC9B 4JY4A 3SE3C 4I0PD 4HQQL 4P23C 1SEQH 3MUZ1 5F9AC 4KJWC 5T1KD 4GKZB 4NQED 4YHIB 2J5LC 5T3ZE 1N3NB 5T1MB 5CGMA 4EUPH 3HNTL 4H26B 3OMZA 3N1PC 1G6VK 4NKOA 5FO9A 2YD1A 1JWUB 2VKWA 4XMPL 2V6HA 5FK9A 2YA0A 5IROC 2B39A 5B38A 2ARWA 5B8CC 4LQFL 3PGFH 4BH8B 1HZHH 3CMOL 2N1KA 2CDEA 1KCVH 4GBXC 5EZJA 5JTWA 3I50L 4JM4L 4OBRA 2ZUQC 3GM8A 3IFNH 1U8PB 5TDOA 4NQVA 5I1JL 4JN1H 5E6ZA 4LMQE 2Z93B 5FGCB 3QEUB 1AO7A 3T8XA 4IOIB 3V2AR 3S5LB 3BH8B 3ZDYE 3QNYA 1TJIL 2M26A 1YEGL 4X6CB 4EQ2A 4WHYG 4GG6E 5FUOH 1T22A 4LVEA 4R26H 2BVQB 2PXYB 3CC5B 3HR5B 2B4CH 5D72L 4JZNA 3WNOA 1HKLH 1SHMA 5E8NA 4JFEE 3ZE1E 1LILA 4NT6B 3O9WB 1GSMA 5F7FA 5E6IB 2PW2B 2EDTA 1HILB 5BVJB 2ED9A 3HRZA 3A67L 3LOWA 4MJIB 4OGZA 3WHE0 5IW1B 4P5TC 1NMBL 5FA4B 5F9OH 1S7SB 3AXLA 4YDKH 4FZEH 3E3QE 5BV7H 4Z95L 2UYLB 2AJSL 2BNQA 2Y7QB 1SJEA 2ZUYA 3NIFF 1HOCB 3BX7C 4G6FB 4JHAH 5C0DB 2OZ4L 3DARA 2W65B 3BESR 1WK0A 3ILQC 2ITDB 1MPAH 4EVNB 4NDMB 4I77L 4L4TD 4LDLB 5ICXA 3B9VA 1I9JL 3QDME 2YPLA 1QFUH 4RGNE 4WWKD 4YFEA 2R23A 4M3JA 4KRPD 1INDL 1ITBB 2D2OA 2I26N 3VJ6B 3ZHLA 2DD8L 3CU7A 5HI4C 4PJCA 2VMFA 5HYEA 4MA3B 2ZUSA 3B3IB 2AAVA 2VR4A 1HIMH 3H9SA 4HT1L 3C5ZA 3DROA 4I2XA 5D7JC 3SQOL 4LLUB 4NGHH 3GJFA 3SBWC 3RNQB 2BY0A 3ZL4H 2UY7A 2W59A 3EYUH 2BSSB 2XZAL 4Z7QF 3RWEA 3VRLF 4U1IA 1R3KA 4X9BA 3W11D 4Q0XL 2APBA 1MREL 4ODHH 4AEFA 3D0LA 5FYLL 4HUVA 3HZVA 4UIKL 1TQCC 4Y4KA 4XNUH 3TV3L 2R9HD 3WFHA 2XACC 2VDKH 3WE6A 1BBJB 1JNNL 2N4IA 5HYQA 3BN9D 3OAZH 1NEUA 5L2JA 1MF2L 4QTHB 4CADB 5F7YC 1MCOL 5MP6L 1ZA3A 3T4AA 1IM9A 5CSZB 3RAJH 4YNYB 4ZPVA 3FTGA 5DYOB 2A1WL 4F58L 4LEXL 2V17H 1JZ5A 5K9KA 3H6JA 2AJZA 5JORA 1I7ZB 1J7VR 4WTXA 1S3KL 1G7PA 5C0CE 2XWBA 5FHAH 1TJHH 1CG9A 3LIZH 4HUMB 3VWKC 3JV4A 4LSUL 4P46A 4C57C 3HI6L 1HSAA 4XCCH 1JP5A 1HQ4B 4K8RH 1Z0MA 2X41A 4X99B 1YPZF 4JDTH 1DE4A 4N9GA 2NXZD 3PWVA 3CDFA 1NGWB 4EI5B 4NYLB 4M93B 1GL4B 3Q3GA 4Z7VF 3DTXB 5E8PB 3L5JA 1Z0NA 2B8OT 2EH8H 2XWTA 2GK0A 1WWBX 3HE6A 1MLCA 3MV8A 2ESVA 2DQJH 2OL3B 2YR3A 1EUUA 4XXCA 5E2VL 4JQIL 1DFBH 2DLGA 2ZNXA 4LLDA 4XBPA 4KTEL 5A2FA 1TQBB 3QJFA 4DTGL 2ICWI 2WLYA 1UT9A 3D3VA 1U3HC 4U4BA 4I9WD 4RFNB 2NR6D 3TBWA 4DN3L 1P84J 5F7KC 3S35X 2P5WD 1MUJA 1BZ7A 4ODUA 1NAMB 5KG9A 3MJ7B 3SY0A 3ARFB 1OARH 5IVXA 4PJ8B 4G9DA 3AAZA 1KJ2B 3P77B 5C0RL 3QXTA 4FP8L 3MV7D 1PY4A 2CIKB 2IAMD 3A6BL 1UCBL 1RQ5A 3MRKA 3EUUA 2YZ8A 1KF9B 1T7VA 1HN1A 2H26A 2O61B 2AXGB 5E8EA 3MLZH 1S7QB 3MLYH 5TH2A 5A16A 5L6YL 4X7FC 3KYMB 2G2RB 1MFCL 3GGWA 5DLMH 2NX5B 4YEFA 1EZVY 1QLFA 2EICA 3QXAB 2RR3A 3S98A 3LMJL 3WFZA 5DK0A 3BKYL 4YR6A 4L3EB 2Y06H 3L5WB 3UEZA 3H9ZA 4M1DL 4PB9L 3G5ZA 5I8OL 1D5ZB 4UQ3A 4Q9QH 1ND0B 4DUVA 2OR9H 5HHOD 1I3GH 3S4SG 3UJIL 1WUNT 4UB0H 4XPHL 3I3EA 2ZCLL 1V05A 2OMNA 5E2JA 5GGSB 5C0AE 2DMKA 3ZKMD 2VZSA 4S1SH 4LVNC 5IFHH 2OJZL 4PJBF 3T1FB 1U6AH 4DGYL 1HH6A 2X4PA 4AK1A 4AEIL 5IBLC 4GAGL 1TXKA 3VH8A 1A1NB 1FSKB 3WFDH 3I75B 1CD9B 5J1AA 1IL1B 5DFVC 3T1WA 2APFA 3UTTD 5KN5A 4A6YA 5DC0A 1DN2A 4BFEA 3BPCA 1KJ3L 1FNGB 3FOLA 5DD6A 3T65B 1FL6A 5GRWA 1TPXB 4MAYA 5IB2B 3SDDD 5FYKL 2ADJB 1FVEB 2NYYC 2BXYA 3CLEL 4WGWB 5EUOA 1LDSA 5DJXA 3LN5A 4BQ8A 1I9RH 5M7QA 3KPQA 4ALAH 4XBEH 4HFWA 3IJSB 1U3YA 4KWUA 2AJXL 2UWEA 4YAQA 3LPGA 5DTFA 1PLGL 4N8PA 3N85H 4N0RA 2VXQH 3R1GH 3C6SA 4ISVB 1C16A 2QSVA 3BEVA 5BRZA 4BH7B 1HYSD 2QHRL 2O5YL 4K94L 2Y5TB 4JY5L 1IAOA 2X5PA 3H3KA 4QHNA 5EN2B 1NCCL 4ERSH 1MJ7L 4W81A 3TM6A 3SDXE 1XFPA 4NC1E 2EXWD 4JR9L 5ITBL 2V2XB 5TQ2H 1FZMA 1U93B 2NY3C 1PJ9A 3EFDL 2VISB 4MD4A 3LEXA 3U4BL 3EDJA 4LGPB 2DIBA 3TO4B 3UBXG 4RAUA 4MNQD 2YC1A 4MJ5A 3BZEB 4YO0A 4KC3B 4HLZH 3IS0X 3RBGA 3D18A 1KTRL 4WI9A 3VGAB 2VUYA 3EZ8A 4OFIA 1HWGB 1CLYH 1OCWL 2ADIA 3GSNB 2IQ9L 4KKBC 1RV6X 1BWWA 3QUXD 4RX4D 4UNVA 2AGJH 1N5AA 2NY5L 5HXMA 2L7UA 4J3TA 3CH1A 3O2DL 3W0WA 5IT2H 4MD5A 4E41D 5FKPA 2QTEA 3KPTA 5KOVC 4F9PC 5FGRA 1OVZA 6FABH 4X9HA 4ZAKD 2X4RA 4XRCA 3WJLC 4CAGA 3VFPB 4O02L 3DMMB 2EDFA 3BUYB 4PRPB 2CPCA 3JUZA 3K4ZA 2KL6A 2ATKA 3INUL 4LCWA 4ONFL 3P3YA 2XN9D 3JXAA 2GK2A 1KT2A 2EC9T 3EOAB 5IIEA 4LCYA 3MYZA 3SDAD 5I73B 5F89A 4F7TA 4P57A 1ACZA 4BELD 3MTRA 3GRWA 4OZHA 2EO1A 3UTPE 1L7IH 4NHCH 4IRZH 3ULVL 1B0GB 1CGSH 1RK1B 4YXLL 3THMH 2P4AB 1FZOA 2BVTA 1T2QH 2NY7L 5CJQH 4S10A 4ZFZB 2LU3A 4LLYB 4TQEL 2H32A 1SQ2N 3BDYL 4PJ5B 1XF3B 1JPST 3H9YA 5ERWA 3QO0B 4LF3A 2CXGA 2G75B 5F72S 4GRMB 1SBSH 5IM7A 5FYLE 5EU7E 3ARWA 5C0FA 2A6KB 1IC7H 2FGWH 5J13B 3WLBB 1JL8A 2VOTA 4KZDH 4JO3H 2PR4L 4KPHL 4PD4K 1AGBA 4M7LL 1D5BA 2Q8AL 4NHUA 4PTUB 5HVHC 2ZUXA 4GAYA 5ID0A 3K1KC 1KENH 4J3OC 3PP3H 4NQCE 5F88B 4C56B 4CJ0A 1N8ZB 4U6VL 3MCG1 4JO1L 3V5KB 5KVFL 3T0VA 2OXGA 5GSRA 3GBML 1KNOB 5IMKA 1FN4B 3GFUA 5HHMD 3MLRL 1YNKH 4AEHH 3ULUE 3ZYOA 5IMMA 4TUJB 4PGDB 1O0VA 4M1CC 4X6EB 5LCVH 1O7VA 3PWLB 1IJ9A 4U05A 4M6NH 2VLLB 4WU7A 1E6JH 4WY7H 5EOQL 3TIDA 1DBBH 1OP3H 5C7XH 5IEKB 4OCNC 3U4EA 3MRDA 1JNLL 3OKEB 3QFJB 4R90H 3BH9A 2X4TA 4YFDB 3VU2A 3UP1A 3L3HA 4QO1A 2WWMC 1P5UA 1A47A 1V7NH 5A1AA 1I1AD 4JB9L 3QDHA 4Q2ZB 4XCEB 2V5MA 1FVDA 4HS3B 1K5NB 3KLAB 1FNSH 2EYTA 4NO2B 4O2CA 5J1TC 4LPWA 4TUOB 4ODWA 5IV2A 2VNCA 2BVPA 5DZLA 3MACH 5IB1B 1S7TB 2BSRA 4Y4HD 1QFWL 3N9GL 4YDIH 1FFOA 3C5ZC 4NP4L 2AK4E 5DK3A 3O11B 4EXKA 3VXUB 1SJVA 1RK0A 3GRWL 1ZEAH 3QG6B 4FFWD 5DK2B 1S7UA 4ZO6A 1IGTA 4X4XA 2B1AH 4K7FB 2C3VB 2GT9B 4Y4KC 4R4ND 1KXQE 3VD4A 3C09C 4G8FB 4O2EB 2KQMA 5AD0A 1A4KA 1G7HA 1N6UA 2JIXA 1ULVA 1P7QA 3KYKH 1HINL 2FO1A 2W38A 5D6DA 5DQJA 5GGQL 5E1AA 3RHWK 2P24A 5FM5O 4UUJA 1RMFL 3EJZC 1BVKA 4KJQC 1EFXB 3DXAE 2R1YB 4ZUVA 4WDIB 5AZEH 4DW2L 5BZWA 1HHHA 3GBLA 4DGVH 4PJXB 3KJ6H 1HXMA 3SKNA 3T3ME 2ATPB 4OF5A 4YHPB 3QUYD 2PNDA 1N64L 2ZSWB 2VZTA 3JWDL 3K7UA 4GG8B 4FTVD 4HXAL 4P46C 3HLAB 3ILPA 5C08B 2VWEC 2HT3C 3PL6D 1G9NL 3WIIH 4QHLB 5T1DL 1QPXA 2JELL 2EKSA 4K3JH 5J9PB 1S8DA 5CD5D 3RWIB 3D39A 1V3KA 4OT1H 3QA3A 2Y6SC 2CKBB 3ZDZE 3NCFB 4WIQA 5KSVB 3HUJB 2BSTB 1M6OB 2KPNA 3HE6C 5EOCH 3BXNB 4ZUUB 2W9EH 2HWZL 2WZPD 4JHZA 2DM4A 4TSBH 3VFTA 3WXWL 4DEPC 1QNZL 4M1GH 4UTBH 5JW4Q 4XXCC 3LKSB 1A7QL 3WN5A 4D9LL 4PY8J 2EEAA 1IAIM 5F93C 3MRIB 4JRXA 3RWHA 3T0EE 4UT9H 1PKQB 1LGVA 1U41A 5C8JA 4KK5D 4JPKH 5BCAA 4OAWA 2A9MH 4NN6B 3RWJB 1KIRA 4OLXH 3IFPA 4Q7DA 2LTQB 4K94C 4PIRF 2XA8H 1S9WA 1G7JB 1WZLA 5MEPA 5I66B 1B2WL 3RWGA 1KN2H 5FYJH 1VCAA 3QAZC 3WDHA 2QADB 1TITA 1HHGA 4NRYB 3VG0L 1V8HA 3MGOA 1UWGH 3HMWL 3KXFA 4POZD 3CNKA 5ACMA 2MCPH 3WFCH 3ET9F 5LGHH 5K59E 4KMTH 1IKNA 4H5SA 4XAWL 1UH4A 1BIIA 4MVBC 4KGJA 2ZG3A 5BS0B 1I85A 1S7RB 4X6CF 4JFFE 3IDYB 1TJGL 3O6MH 4FQHB 3TYFA 1R3HB 2F8XC 5KVDH 1E0OB 1RUQL 1T89A 2MNUA 1S9XB 2QKIB 1CLZH 4U1SB 4YHML 2V7HB 4MLSA 2XZCL 3BGFB 1A6PA 1T04B 1DEEB 2FGZA 2VQ1A 4ZPTA 2OL3H 3RWFB 5LAXA 4Z7QE 2EDOA 5INCA 3IDIA 4XZUA 1AY1L 5IFJB 1KEML 4PGBA 5DUMH 5CBAB 1C5CL 3QRGH 3VI4F 2DMCA 1W72A 1H3GA 1WBZA 1ED3A 2HJLB 5C09B 2NY0D 3BI9X 4JFPA 1BF2A 1IGFH 4YDLB 1NAMH 5I6XB 3MOBH 1FBIH 1JWMB 3RGVD 1ZHNB 1KCRL 1IZJA 4LSTL 5IR1B 2RGSA 1S7WA 2FX9L 3B9DA 1YYLH 1KJ2H 2VUOA 1UB6B 4MB5A 4WTZG 5DT1L 4KROC 2QJDA 3BFOA 3GO1L 2VR9A 2X89A 3L3KB 4IRJB 1VFUA 1T1XA 2EDEA 4MAYC 4H25B 1RJYB 2Q87A 4JZJA 5SWSE 3QDJB 1RZ7H 4I5BB 3ULVC 4HJGA 3VRIA 2XZQH 4OLUH 1A5FH 3DRTA 4PJ9B 5HGAB 4RRPG 1Y0LB 5MENE 1HK6A 4WJ5A 1EJ6A 3MCLH 2PW1B 1JRHL 3OKDA 3VXSE 3V0VB 3ARGD 2EYRA 5D2LE 4Z7VE 5IMOB 3BW9B 3MUGA 5I0ZA 2D0GA 4OJFH 3IAQA 2P5EB 4MXVE 2H9GB 3LQZA 4KUCF 1N7ML 2BY1A 4Q74A 4PJFE 2H41A 1QRKA 4JY6B 4QLRA 2W0FA 5DR5H 4ZSOE 3JV6B 4P3CH 1Q0XL 4IOFC 1RY7B 3BWAA 2FL5B 3U0PB 5JW4R 3EYFB 4YE4L 1NBQA 1Q0YH 4WHYH 4E42B 1QSED 1WBXB 2XXCB 4EOWH 3PGDB 4WI4A 5FECB 2VC2H 4PGZA 1KBGL 3L3OB 5F6HI 1NC4B 3O4LE 4XC1L 5DURD 3RWCB 4PGJA 1NDGA 1VEOA 2Z35B 5GXBB 2VLRB 3MRGB 4D9RD 1ZS8A 1ZSDA 2XT1B 1U9KA 1KB9J 3GIZL 2CRMA 2WIMA 3X13A 4DGIL 3I2CH 4R7DB 4ELMA 1S78D 4UDUB 4HHAA 2NW2B 1EFQA 4GSDL 4HH8A 3OSKA 4HKXA 2EECA 4OLZH 4TN9A 5IB4B 3GMLA 1RUPL 3NH7H 3HC0B 4HGWA 2DYPB 2D7QA 5ANMA 5E8OA 2H1PH 1OGTB 2IPTL 5JXED 3VD7A 4KKLD 3U4AA 2VDPH 3L3JA 5IB3A 5MHSE 1ZHBB 1WICA 4OF3A 2NNAA 3SDYH 1DZBA 3IDJA 1NJ9B 2NY4C 2AV7A 1YEKL 4KXZH 5AWNL 5H37G 3UJJH 1VADB 5C0IB 4MSWA 4WW1B 4Y1AA 4QHMB 3PV6A 4CMHB 4RA0C 4XPTL 4NPYB 2Z8RA 3H8NA 2VERN 1G7MB 4UU9A 1WGOA 3C6LA 3TBYA 5I19L 2WINB 4OKDA 4XNQB 35C8H 1T7WA 4XPAL 4C59B 1KYOJ 2X7LA 3WKMH 4YBHA 3UTZB 1Z2KA 3MO1A 3GSQB 3VWJD 2HFEA 3H42L 3ES6B 3VFOA 2J88H 5I76B 1ZK9A 3GSNH 4PS4L 3TNMA 1RJLB 1H8SA 3TFKC 5FF6B 3IDXL 4HJ0C 4W68A 1UEMA 1JUFB 1DLHB 5GRXG 5KANI 4KK9C 2ED7A 1AC6A 2PYED 3JWOC 2HJFA 1AQDB 1RULL 2E8YA 4M4RA 3OJDA 3H7BB 5EFIB 4YPJA 3ZMRA 4BFGA 4F8TA 3JWDC 5DJ0B 1TVHA 1ZT7B 4DAGL 4KUCD 1XGYH 1G9NC 5LGJB 4IRSA 4OLVH 1T0MA 1ZTXL 3FN0H 3MROB 4WUKL 3WCYA 4PJIB 1JPSH 3O3BA 4JJHA 2ZKHH 1Q72L 1YEFH 4S1DD 1WTGT 3RZCA 2FEEL 4NFDA 2R2BB 4XCYB 4NKMB 1JN6A 4DN4L 2IGFH 4HWZB 1T03L 1A7PL 1IBGH 3SE9L 4NRZA 3GMQA 1OPGH 1I75A 1IEAB 3F7PC 3MLVL 4XNYL 5ESAB 1NCWH 3GKZA 5DQDL 2OS7A 3D0VB 1YDPA 5CEZD 1QO3A 4FQCL 1F3DH 5EU3A 2GSGA 2VABB 3VRJB 1AGDA 3KYNB 4GW4A 2OJEA 5SX4H 3VXNA 1K6QL 3VMOA 3U9UA 1OD9A 3KPMA 5K9OA 1F2XK 4DKEH 1U42A 1GGBL 8FABA 1QLEL 2YEZB 5D2NE 4X4YB 3WDJA 2BC4B 3HI1B 5HYSB 5DJ6B 4TNVK 3STLA 4HMEA 4XNXL 5AUMB 1S9VB 5I8KH 4LEOB 3WO4C 3RIAK 1P1ZA 4LLMA 2FZ3A 2ARJQ 3TA3A 2HLFD 3EYQC 4YGVB 2JK5A 3CUPB 4LSVL 2YN3A 4OD1H 1JBJA 5I2IB 1KSRA 3QUMA 3L5XL 3MRBA 3CSBA 4X6BA 5IMLB 3VA2C 4P2RE 4FFVD 5F3HA 2WNGA 3OPZH 3VFRA 5D6DC 4AENA 3FRPA 5C9JB 1EBAA 4P4KB 4I3RH 4FQLL 5D1ZB 4TULL 1YMMD 3BHBA 3V4UL 1MFBH 5DEGA 1OGAE 4JANB 2F54A 4OI8A 1R3IL 4HUUB 1DDHA 1LHZA 4MQ7B 5GIRA 5HYJD 2VXSL 4XP4H 5C71A 4KAQL 3PGCA 1N5YL 1MI5B 4YHKH 2FSEB 1G84A 3KPRB 1NANH 3ABZA 3LRHA 2R0KL 3OHXB 3RQ3A 1UXWA 5E56A 3D1MC 3RTQD 3BJLA 15C8L 2Z8SA 4UQ2A 3GNML 2R8SL 2AS5M 2ZJSH 4QRQA 1J11A 3G6AA 4PBXA 4U6HB 4I18A 5DD5H 2LAAA 1OWRM 1BPVA 4DK3A 3EO0B 4ZNCD 3IJHB 3QCVH 4JFQA 5IW6A 1I7TB 4XVUC 1F8TL 1QEWB 4OF7A 2E7BA 3BKJH 4P49A 3SJVD 2EDJA 1YY9D 1YMHB 1RU9L 3RUGB 1KGCD 2Z31D 1U58B 3FQRB 4XH2B 2F53B 5I9QC 1D6VH 4ZOBA 2X70B 3ZYZA 1O7SA 2APXA 5DJDA 3KPLB 1M7XA 1KC5H 1NGXA 4AT6B 3QPXH 4HC1A 3VXMA 4OZIB 1UENA 4I0PA 3WN5C 3PWUB 2P8PB 4HKZA 2FEDD 2VLKB 3ARBD 4LLWB 4OGXL 5BQ7B 5DMGD 4P2OD 5AZ2L 5T1KA 3CXHJ 1IGCL 1KN4H 3PHOB 2AXJA 1D9KB 3P0GB 2IH3A 2Q86B 4L8SB 3IKCA 25C8H 1RIUL 2K3TA 2DM7A 1LO5B 1X3DA 4OZFB 2NZ9C 3MNWB 4PJGE 1XGQA 5IBUB 12E8H 4NBZB 4BFIB 3HC4H 3L9RB 1RUMH 3WFEL 4HV8A 3O2VH 1RZ8B 4NQDE 1PZ5A 4OKVB 3MFGB 1IKNC 1WBYA 3QHFL 1CGTA 3V7AE 1J8HB 3G9VA 2A6JA 3SEPA 4M48H 2HLAB 4YDVB 1I85C 3PABA 1K85A 3FFDA 5EG6C 2B5IB 3P0YH 1AKJB 4RGMC 4G3YH 3GEWB 1RUKH 4X5XB 3QUML 2CKBH 2V2TA 2JJVA 1R3LB 1T89C 2JJSA 3IETA 4NWTH 1NLBL 3ARVA 2NLJB 5DQ9A 3C08H 3OR7B 2CLRA 3MC0A 4G7YH 1B88A 1P4LA 4WHTB 3MRHA 2XQYK 1F4AA 1G9ML 3I6GB 5EC2A 5IF0B 2CK0L 3CPLA 4K71C 1QHPA 3ECBB 4GUPA 5I1GH 2DQIH 3DX8A 4Z0BL 4TSAH 3IAPA 5E99L 2CMRL 3L3GA 1D3CA 5EBWB 2X42A 1MH5B 3D48R 4NO5A 2Y07L 1OTSC 4MDIA 5ISZA 4L4TA 1YQVH 2H6PB 3DURA 4OGAD 3OX8A 1KCKA 4HG4J 3P9MB 2BRRL 4WWKA 4JZJC 1FDLL 3IDGA 2R0ZL 1CFVL 3PWPB 3QIUB 1QSVA 2ZCHH 4GRLD 1MOEA 4J6RL 3DUSA 3BP7B 2FH8A 4KV5F 4HC1L 2IJ0C 1A6AB 3BDXA 4OCRL 1Z5LB 5DS8A 5MERB 1JZ3A 4KXZI 2ZZUT 3PIQA 1BZ9A 2EC9U 1X5JA 2A73B 5D71L 4JN2A 4QRTA 1BVLB 5ICYB 3MREA 3QCUH 4DQOL 5CJXA 4I3GA 4XBGB 4OQTA 1LP9B 1VESA 4HUNB 1EDQA 3BIBX 3P9WB 1NUFA 3BP5A 1XCTA 2YUXA 4U1LA 2I9TA 4OZ4A 3CVIH 4M7JH 5DHXB 1R5IB 1FORL 1E27A 5EWIL 2DQCH 5E2WH 4O51A 4BZ2H 4JFOB 3BSZH 1T7XA 5TDPB 3LRGA 4UDTA 3W39A 5CUSL 1KTKE 3QULB 3LZFL 3HI5L 1NFIB 4ETQB 1U8NA 4YHYC 3BVNB 4JQXA 4QRPE 4P23D 5ALCH 5J0BA 5FB8B 3WXVL 4QHUA 1FJ1B 2FJHA 4KJWD 2VDNL 1F4XH 3OXRB 4JREB 5DGRA 4AH2A 2EIDA 3NBNA 5IVZB 4JHWH 5L8KB 5FGCE 2IH1A 3CDCA 3PQYB 4R8WH 1UG9A 4GMSH 1MCRA 4TRPL 4X4ZA 3HNSL 2VDQL 3FZUC 4RAVA 4JM2B 3RKPA 3OKLB 3N50A 2WBJD 3WL9A 3CDGB 1BX2A 4JPWL 4HK0A 1TZIA 4UINL 5CSGA 4GBXD 4KHXL 1A4JB 5I0DA 3HUJF 5D7IB 5HHVH 4DUXA 5CEYA 1A22B 5LQBL 2FD6H 3FQXB 1N26A 1NMCC 4QOKB 3NFSH 1R6VA 4MJIE 1H5BA 5JPMB 1H3XA 3MBED 4OV6F 1MFDL 1A3LH 4XTRC 3VW3H 5CFHA 3C6LC 5EO0A 4RQQB 2B1HH 2AXFB 2HJKB 5ESQA 5SX4I 1FLRH 1G6RA 4HK3J 3T08A 4PY7A 4S2SB 4F7MA 4NKIL 2HRLA 1EGJA 4MA7L 2VSCA 4G8IB 3GMMA 1CR9L 5TF1L 1K4DB 4ZNEE 3BMVA 3MV7A 4P5TD 4Z8FH 1RVFL 3U7WH 3WJJA 2IAMA 4JPIA 4NQXB 2IANB 3UC0H 4PRNA 5HHQB 2EH7L 3SCMD 3IKKA 4OQTL 4FABH 4JDZA 4L8DB 1G7QA 2YS4A 2W92A 2HFGL 4P2QB 4PGCA 4XWGL 5EZLB 5DWUL 3HB3C 1BLNB 2AJVL 2F8VA 1AJ7L 2YD8A 3X3GH 5C0NC 1DSFL 2ZG2A 1TDQA 4GKNA 4IRSC 4TPRH 1YEEH 3GI9L 4FQXB 4LKCB 1SVZA 1QYGL 3U9PL 1RZFH 3TZVB 1BJ1H 1KIUA 3W5MA 5TDNA 4NJAL 5JZ7C 3MV9D 3QWOB 4JFHD 1NANI 1DLFL 3RZCC 2XTJB 3QH3B 1WIOA 1FG2B 4G6AC 3K46A 3V95A 4EDXA 3D25A 5GJTL 3C87A 5D7JD 1H15B 4ZOCA 5C0GA 4EZMA 3SKMA 3BAEL 3UTTA 4MHHG 5J12B 4PRAA 2ADGA 4KVNL 4U1HA 4WCYL 3T2NH 1M7DA 4L9LA 4EEEA 4ZUWA 4Q6IA 1MNUH 2AQ2A 4FG6D 2EDXA 3T09A 4D94A 4IHOA 5J4MA 4V1DE 3LN4A 4HCRH 3NN8B 1YPZA 4R2GD 3HZKB 1P6FA 3AB0C 3TIEB 2LVCA 2CR3A 2FYYA 1ACYL 4HMCA 1KJVB 2DM3A 2QSCH 3GBNL 3WUWB 2XOTA 5KSUA 1CBVH 4KJYB 4WU5A 2VL5A 3I9GH 3LAFA 4DVBB 4JZOB 3HPJA 3LY6A 4HJJH 3VMPA 3NACL 1FNFA 3RY4A 5F6IC 1CD1A 1VPOH 1MCWW 4M9PA 4UV7H 4KY1H 1XZ0A 5EPMB 2CR6A 1WJ3A 2DDQH 1MCEA 1BM3L 3MA9L 1U8JA 3KPSB 3TA3C 1G6RL 3FHAA 1DTUA 1FL3A 3O8XD 4I1NB 3X3FL 4OGYH 5DJCB 1EGJL 4YHLL 2VLJD 4UT6L 3ARDB 1C12A 4FOMA 3DSNA 2HKHL 5D8JH 5C6PB 1CLOL 4P99A 3RI5F 3MQIA 1T66C 5F96H 4UNTA 1MCFA 5HDQL 3OKNB 4U0RB 1KIPB 2GKIA 4IMLB 4X83A 2BVOB 5HVWA 4C58B 1F58L 3GSRA 4ODSH 4OIIH 1Z9OA 5L8LB 3GIVB 1OLLA 2GSIA 4BSWA 1SEBB 5JNYB 4F57L 1BQUA 1IKFL 3O6KH 1G9MC 5KVEL 1ZOXA 2JCCA 5EBGA 2BY3A 4HDIA 4YPGB 1EUTA 3LS4H 2CSPA 3TEUA 3UTSE 1QSFB 3QUXA 2KDGA 4RX4A 1UM4L 3O6FD 1U3HD 1QOKA 1VACA 3LDBC 3DSFL 4PBVC 1SEQL 1EK3A 4I18C 5J89A 3R0MA 3NVQA 4PRHD 1AXSB 5HGHB 4E41A 3BRFA 3IDUA 5INDB 4Y19B 4ZTOH 3FB5A 4PPTA 1C1EH 4LLQB 3FCTA 2NX5E 1RIVL 3OKKA 4CUCA 4KJPC 4ZAKA 1FAIL 3QQ3A 1I3RB 1N0XH 5BJTA 4XC3H 5JW5A 4PGEB 2KH2B 3DHMA 4OD3L 2NXYC 4LHQB 1A6WH 1CFNB 1CGYA 3PGFL 3C2SA 4I0PC 4XP5L 1QPPA 4KI5F 4QRUA 1KCVL 4PJBA 4GKOA 3UPCA 2HTKC 3V4VL 5IUSA 5K9JL 3CK0H 1U8LA 3S8WA 2XN9A 5EU6D 4H88H 3ZTJH 5KS9B 4MAUH 5DD0H 2EYSB 1DANT 4R9HA 3QEHB 1K8IB 3I85A 4M61A 2RCSH 4RISH 5D70H 4PV8A 2GI7A 5F44A 5JPNA 3O3DB 5E9DD 3I84A 4OZGB 4KTDH 3LKNB 1TETH 2VSDA 3CFEA 4LRIA 4FMKA 1NL0L 2CLZA 1HKLL 4NQEE 1J88A 3U7YL 2W07A 2XQYG 3VGEA 1U91A 4MJ6B 2DMBA 4PYGA 1GZQA 2CGRL 4HBCL 4M7KH 4GW1A 4JO2L 3U0TB 3X12B 1QFWM 1FL5B 5DD3H 2ZCKH 3OGCA 2XZZA 2DLIA 1AHWB 3TLRA 5C0EB 4QY8B 4KDVA 1IGML 4YDKL 3DGGB 4JRYD 1CYGA 2R1WA 4CMMB 3SE4A 1JFQL 3D2UB 3HMXH 1R5VB 2J5LB 4WUUD 2JJSC 1FIGH 3K2UL 4J8RA 5K33A 4UIMB 1NBVH 3V6OE 4JHAL 4K9EC 2PO6D 4D0BA 32C2A 1Y6NR 3ARZA