4ODSH

Unliganded fab structure of lipid a-specific antibody s55-3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
219
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAGSGITFSGYGMSWVRQTPDKSLEWVALISNGGSYAYYSDSVKGRFTISRDNAKNTLYLQMSSLRSDDTAIYYCARHKGLRGGTNAMDYWGQGTSVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S55-3 Fab (IgG2b) heavy chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odsH01
2VL5B 1G7HB 4O9HL 1PKQB 3FZUD 5GSRA 1N5AB 5A2JH 3IXTA 1YYLH 1OD9A 3ZHLA 1UVQB 3QUYB 3MZGB 4PRIE 1D6VH 2YRZA 1WEJH 3MRCB 4LCWD 3L9RB 2X41A 5I16B 1LE5B 3JTSB 2J88H 4JZOB 1ZHLA 1A1MA 1EEUA 2EDOA 4JRWA 3WUZA 3IJSA 3MRMB 2X09A 1FIGL 3C09B 1BHGA 5F8RC 1BFVL 3NIDE 4GO6B 1AGCB 5HI3D 2EO1A 3BEWA 3FQTB 4CW1A 1I1AB 3MROB 1G7JB 3CVIH 2YBRB 5JORB 3WJJC 4UTBH 2XKUA 3RWFB 5K9OB 3AS1A 4TSAH 2F74B 1YEDA 4LSUL 3BDXA 4X6CE 1TJHL 4DGVL 1P4IL 5ANME 5H35A 3NFPB 2X1XR 5F3BA 1HNGA 5JUEH 4F37K 2NY0D 1MNUL 1P1ZA 1P4BH 1R5IA 1C16A 4X7TB 4YHNA 2DKSA 3WFEL 4XNXL 2WBJD 4PRPB 4WJ5A 1ZGLA 2BHYA 2YKLL 3LD8C 3KLDA 1I8IA 1ZHBB 3S5LG 2NX5A 4LVHC 5FDWB 4ZPVA 4HKXA 3PWJA 3WIFB 4JPWH 3CLEH 3BSZH 4NDMB 2DWEB 3GSNB 1ZANL 1UXSB 5E4EC 4TVSa 4IDJH 1A47A 4MCYB 4N0YL 3GJEA 1NKRA 1F3RB 1I8KA 4PJ5D 1WC7B 2C9AA 3H9SB 1N0XL 3RGVA 1J8HA 1FRGL 3HZMA 3WE6B 4UQ3A 4GSDL 1EERB 1X5ZA 4HXBH 1JNNH 3BKML 4RAVB 5AWNL 3W9EA 3LV3A 4ZXBC 5D1XA 2QBWA 4AENA 3KPPB 2VXVL 3O6FA 5FV1L 2EKSB 3LN5B 1YECH 4M93B 1MHEA 4UAOC 3V7AG 4EEEA 2E6PA 1RZJC 2GFBB 2VQ1B 3L3OB 3QXDB 4G6JH 4BFGA 5INDA 5TGBA 4LSRH 2XA8L 1M71B 1GIGH 3UZQA 2XI9A 4PJHB 1ZLVH 1JGDA 1NL0L 3L3IA 4X83A 1QACA 3KAAA 2F8VA 4OI7A 1MCHA 3V6OC 3ZZ1A 1ETZA 2UYLB 4NZRL 4I3RH 1BEYH 3U0TB 2NXZD 3B43A 3M45A 3DYPA 2AXGA 3RX8A 4BH7A 1JZ7A 3OPZL 3F7YB 4HEPG 1R5VB 2HT4C 3S3PA 1N4XL 4NC1E 1YNKL 5CIPA 5EBLB 1OAYH 5F93C 4S1RH 3WDIA 4ZFOA 5D70L 1JHKH 3U7WH 5IJKA 2GTZA 1EHXA 2HT3D 2P5EB 1RUQL 3T4YA 1QR4A 3ILPA 4BZ1H 5EORL 1B0RB 2X1WL 4AYFA 4Y4KB 4AY0A 1DN2A 1U8OB 5IMMA 1T4KB 5F7EH 3RPIA 3VD7A 1P2CA 4JRXB 4OCXL 1ZVHA 2NZIA 4MDJA 4QTIH 3SDYL 4RGND 1S7UB 1BIIA 3OGOE 1G7MA 1ZHKA 2P42B 5B38A 5D7LD 1P9MC 5F7WC 1SMOA 4NKOA 4O51B 2NX5E 2R2EA 4N8VG 1HH6B 3MLPA 4OT1L 1FNEB 1DEDA 2PTTA 1KTDB 4G8EB 2C4FT 3Q6FA 3QUYC 3C5SB 3SKNB 3FOLB 3HNSL 4TOYL 2V9TA 3VFUB 3FONA 1DBKH 4W6YB 3QPXL 2CRMA 1HQ4A 4K8RL 2Q8BL 1BOGA 4KDWA 4ODVH 1Q1JH 2PNDA 1H8NA 1U41A 1CE1H 2V7HB 2XZQL 5TPWH 4YFLI 5FOBB 4LLQB 4LLYB 5FUOL 2APVA 1M7XA 3BEVA 4KV5E 5E2WH 3C09C 1J8HE 1UC6A 3MMEB 4Y19A 2JJSA 4LHJB 4FNLH 4R3SB 5FIEA 4BSVA 3T3PF 2Z92B 1I1AC 3QUXB 4JM2D 5E03A 3JBG7 3SKOA 5GJSH 3RVVD 4H25B 4OCWL 2HWZH 3VFWB 1SJHA 1F2QA 1OGTA 3CUPB 5AUMA 5DO2D 3OKEB 4QXGL 1U93B 2Q8AH 2YD7A 4MHHG 4CJ1A 5C0JA 5TF1H 1AFVH 5F96L 2X10A 5KJRH 3RY5A 3C87A 4JFXB 3AUVA 3IETA 1RZGB 1NGYB 5FUCE 3PV6B 2XZAH 2CRIA 1MRFH 5EZOH 2XIDA 2DI9A 4PB0L 1V05A 3TT1L 4EBQL 4WI4A 3REWB 3UO1L 3JV6A 5BVJB 1DE4B 2IPKB 4MJ4A 1QBAA 1O0VA 3SDAC 5JXAH 2FRGP 3H3KA 4MDIB 3HNTL 1U91A 3OB0K 4KJQD 5C9JA 1CD9B 3EJZC 3WIHL 4TSBH 3BD4A 3L6FB 2IBGA 2DKUA 3VGEA 4P5TB 4F33B 1MAKA 3LDBB 4NYLA 1QNZL 1R3JA 3HS0A 3I84A 1WT5A 3PGCA 4UDTA 3GMMB 4G3YL 3LPGA 5EU3B 1YC7A 3PXHA 3EYQC 5C0AA 4NQCA 5FK9A 2VSDA 5C3TA 3VWKD 4M93C 1PX3A 1ERNA 5KAQF 2BNQA 2AW2A 2M26A 5IIEA 5JIPA 3QNZA 3U46A 4FN0A 4HH9B 2DQIH 4YIQB 3SDCB 1TVHB 3RKDC 3CDFA 4BKLB 5DVOA 3P77B 5JZ7D 2X4UB 5EA0H 3F6IA 1RHHB 2IC2A 3BH9B 2FEDD 3DV4B 5DUML 5GGSY 1OL0A 2APFA 2NY3B 3WS3B 4XBPB 4FFVC 3VJ6B 5IBTL 4DQOH 4ESKA 4Y19E 4ZO9A 1TNNA 4MXWL 4HBCH 5T1KD 4EIZC 5A43C 1WISA 3RHWK 3MUGB 1CXLA 4K3JL 1DBML 5JIHA 1W0WA 2MQ0A 4U33A 1MAML 3ULUF 2O5YH 2AK1H 4KUCF 4HKZB 2MQCA 4I4WB 1MLCB 5IG7B 3EYSL 5T5FH 3MREB 1MWAB 4Y4KC 1CD0A 3QH3A 4NWUH 4WNQA 2OTUA 3U48A 3BZFB 3CFCH 3WSQH 1VACB 2ERJB 4U6XB 5HHOD 4PJFB 3PWPB 3UTZB 1D9KB 5J6GB 2ZG2A 4OZ4B 4XCEB 4MA3B 5EO9B 1G9EA 1KYOK 4H1LG 3DECA 2YPLB 1EH9A 3K8LA 3IDMB 3D1MC 1IAIM 4NKDB 1CL7L 3UC0H 1KCUH 4OJFL 4UNVA 3D87B 3HE6D 5MEQB 5E8DL 3HAEB 1NEZB 3WKNA 1JPGA 1EO7A 3WFHB 1G7LB 2WIIB 4M61A 2BRRL 3VFMB 3QO0B 3F58L 3GMQA 2R23B 3HKFA 1QA9A 4MGXA 1LEIA 2LQRA 5J89A 4JQXA 3O6LH 4K55A 1FGNH 1G9NC 4WHCA 3TJHD 5J56B 3DO7B 3PABA 1PBYA 2A6JA 5JW4M 4HT1H 4N1CA 1RMFL 4XAWL 3VXMA 3ECBA 3QUXC 5C0AE 1H3XA 4NQCE 4AIZA 4X9HA 5IROA 3MOBH 4PP1D 4M5ZL 3O9WA 2APWA 3BI9X 3CZFA 3RDTD 2MSPA 5L2KA 2VLRA 2BNQE 5EOCH 3KS0J 5IB1A 3GJFH 2BVOB 3L3GB 1LO2H 4P57B 3OJDB 3IS1X 5C08D 3SHSA 1A6ZA 4R0LB 1U8KA 5IB4A 3CXDL 4Y1AD 5KSBB 2EH8H 4K7FA 4BFBD 1I3VA 4MWFB 5HYJA 2FECI 3FQUA 4WU7A 3B9DA 3PDDA 4MJ6B 3OR6A 1M4KA 2EEBA 2H3NB 4LU5H 4DGYL 1TXKA 2EDTA 2DLFH 3G5YA 2OXHA 4LAQH 4HK3J 3PXJA 1T03H 2ZOLB 1J0IA 4YO0B 4XNZB 5JW4N 2FYYA 5JPNB 2B1HL 3TPKA 1FO0H 2BVQB 4KMTH 4LCUB 1XGPB 4C83B 3EGSB 3G9VA 2DQEH 3ARBD 1RIUH 3DETD 1CF8H 3L7FA 4G9DA 3LDBC 4KHTL 4P5TC 4V2CB 3WUWB 1U3JA 1KBGL 4YXHL 5K33A 3FFDA 5FO7A 3OKOA 4ELKA 1R3HB 4PRBB 5C2UB 2NLJA 1NAML 4CVWA 2ITCA 4NSKA 1D5MB 2XXMB 2AEQL 2IQ9H 5C7XH 1IEAB 2FZ3A 3RA7H 1QBLH 2JELL 4IRSB 3SDCC 5IHUH 3I2CL 4LOUC 4P0DA 3B2UC 3QDMD 5CP3H 5F21B 1T2QH 4X98A 4FQ1H 4R4ND 4DKAA 1OB1A 4APQB 5HYEA 2W9EL 2NY3C 2IH1A 1NBYA 4LLAA 3H7BB 4ONHB 4RZCA 3SDDA 1KEGH 4DAGH 4OAWA 4DTGH 3VXME 2WBKA 4OZFG 2I25N 4NJAH 1V7ML 2GYSA 4YPGA 1OCWL 5L2KE 2VLRE 5J1SC 5TDOB 3RJDA 4Y4HB 2DQCH 3MLSH 3QFDB 5C2BL 3M17B 5F7KC 3MRFA 1GGBH 5LBSH 3ZTNL 2ERJC 3LQZA 2ZOKB 1D9KC 3OWEA 2R2BB 3QUMA 3OXRA 4RDQF 1WBYA 3RUGA 3LKSA 5DJDB 2H26A 1E4KA 2LU3A 4FXKA 5HYJE 4JB9L 4LEOB 2E5EA 5F9OL 2UY6A 4X0KA 2Q6WA 4HK3N 3WXWH 3HMXA 4JFFD 4Y5YB 3CFDA 2WZPD 2NY2B 3HUJA 2JCCA 3D2UD 1UM4L 1X7QA 3QIUD 3VFGH 3FL7A 3EHBD 5GHWL 1T20B 1ORQA 43C9A 2WWMD 3EO9L 1WBZA 1BGXL 3RWJA 5L0QC 4NQEB 2DBJA 4V1DA 4NNYA 1EJOL 4NHCL 3HNVL 1RZ7L 2X4NB 2F5BH 3L3DA 3VFOA 4GG6A 3TZVA 3NZ8A 3ALXA 4MCZB 4AK1A 1RUAL 4XNUH 2HN7B 2DMBA 2EC9U 5HGAA 1ES0B 4KK8D 4P23D 1GGTA 3BW9A 3OKMB 3UJTH 1J1OL 1GC1C 4KKLC 4HGKC 1TNMA 1KN4L 3QZWB 3PDGA 4XCNA 3DGCR 1EAJA 3NCYP 2OMNA 1UM6H 2VXUL 4HD9A 3VRJB 1A2YA 1T7VA 2J8UB 3BESR 4FP8L 5DSCA 3T0XA 3KDMA 5IBLD 2DDQL 4NWTH 2X89D 3RRQA 3EFDL 4O5LL 1S7TB 1OARL 4LHUG 2NYYC 5D1ZB 1KCRL 4FZ8L 4L3CA 1BWMA 1FG9C 5TE4L 5MHSE 2YC1B 4EQ3A 2J4WH 5J13B 4XP4L 1NMBL 4LLVB 1OAKH 4NUJA 3PWLB 4XNZC 3DUUB 1ZVYA 3E3QE 4NRYB 2BMKB 3OX8B 5DMGD 4WO4D 5HYSB 1CGSH 4JPVH 1EGJH 4H26B 4WGWB 4LP5A 1KIRA 3QAZB 3LKOA 4U1LB 3RUGE 3JV5A 1CTNA 5FM8A 3VMNA 4JN2A 2RB8A 3O2WH 2AJSH 1OY3B 1LGVA 3OQ3B 4H1LH 4M8VA 4Y8AA 1MEXH 4JRYD 1JJUA 4CAGA 2HKHL 3LH2L 4IOIA 2XACC 3OZ9L 3G5VB 1YEKL 3CX5K 3HUJE 4XHJD 1Q9KA 2JCCE 5C0CD 3MJ8B 1LP9A 1M7DB 2BOCA 43CAA 4U0QB 4MNQD 3WXVL 3RTQD 1RHFA 4APQC 5IVNA 4PGZA 5BRZB 3M07A 4V1DE 3HE7A 1TZGL 1QVOB 1ZS8B 4GG6E 4PG9A 4P4KD 5IW6A 4Z7WB 2EXWD 1SJVA 4FFYH 4NN6C 4O58H 3WDHA 3FQXA 4N5EC 1RZIA 3VWJA 2WINB 4UMGA 4WI2A 3S96A 2JKXA 3O6KL 4NZUL 2G2RA 2Z93A 3K1DA 4Y4HC 2R4RH 5DI8B 3P9MA 5IMKA 3BOVA 3T1FB 5F72S 3PNWA 3RP1A 2NY4D 3SQBA 3D3VD 1W72B 5F6IC 3NPZB 3STBA 4QHKJ 5JPMA 2YA2A 1FL5A 1XF2A 4GXVH 1RURL 1ZOXA 1YA5A 3VRLF 3QO1A 4B7LA 1HOCB 2YA0A 2Q86B 4XNMA 1KIQB 2EDQA 3IDJA 1QFWI 4PJIB 3KXFB 5F44A 4Y5YC 1Z3GH 3A6CL 4M7JL 4WV1A 1T6VN 2NY2C 2IFFL 4HWBL 1DUYA 4JJHA 3H42L 1DDHA 1OW0C 5DD5H 1HI6A 1ZLSH 1JNHA 5E6IA 3G5XB 1SYVA 5GIRB 1M05B 3QHZL 3W11C 3CLFL 3GB7B 3EIFA 5DD1L 5DMIH 4F7CA 1ACYL 4NJ9H 4XT1C 2DRUA 2EE2A 4L8SA 4Z5RB 3IAPA 2BFVH 2XWTB 1EEQA 1BQHA 1S9WB 4FTVD 4Y5VB 3ZE0F 2VLMD 4HV8B 5C0ND 5I8OH 2FR4B 5HGBB 1WSST 3TNMB 4ZFOL 4Z77A 1A6WH 5KOMC 1NBQA 2OL3H 1MCPH 4HF5L 1CXFA 2XRAH 5IFAH 5EBGA 1DN0A 1JN6A 4XWGH 1HHHB 1LP9E 2CKBA 5A2FA 2UWEB 4A6YA 4R4BA 4N5UA 3H9HB 1WIOA 1DP0A 5EWIH 4PPTA 4MQTB 4HUXB 4ZTPH 1FH5H 4OLVH 2HRPL 5F97E 4QXWA 2VLKB 3FKUS 1U42A 3BKCL 5E08L 1ACZA 5D1ZC 3GMPA 2HT2C 1FL6B 3CSGA 3PIQB 4OBRA 4M7KH 1UFUA 5J13C 3UYRH 1DSFL 5KAQG 1OAXH 1Z5LA 3WLWD 3SKMA 4PB9H 3MLWH 2CDFB 3OAUH 2VDKL 1FYTD 5I1KL 5BJTA 4FG6C 3SE3A 1JZ2A 1MLBB 2ZG3A 4FQXD 1BX2B 2ZSVB 5B3JE 1Y0LA 4HIJA 3LMJL 3QUZD 1T0PB 2QHRL 4HPOL 4U49A 2HJLB 5F7MC 3QAZC 2VJXA 1H15B 1XGYL 5HHQA 1F4WL 3P4MB 5DEZA 2X1OA 1U8IA 2NY7L 2ESVB 5FYLL 1KCVL 2NY6B 3SCMD 1FG2B 4WW1B 5E2TH 4FQIH 3KYAA 5DUBB 1I3RB 3MXWH 2I9TB 3GMNB 1R0AL 4Z78B 3C8KA 4OV5A 2B8OT 2AERT 1E6OH 1FFOB 2XG4A 3MR9B 4DW2L 3QDGD 4KDTA 1TTGA 2B7DT 3HG1B 4GRWB 2HH0H 1WZ1H 5GGVH 2X4RB 4XNYL 2ADGB 4MNGA 4NN7C 1BMGA 5CLTA 1D3CA 1BWWA 3OAYH 3G6JF 1QKZL 3BP5B 2YUXA 1KB5H 5D8JL 3TBYB 1MFCH 4D2NA 3U83A 1AE6H 4HUVA 1YPZF 3DRTB 4UINH 3T65B 2IGFL 1J86A 1R3IL 1QP1A 1A4JA 1FLRL 4HCRH 1H5BB 1BQLL 5EC2A 4EUPG 4OD3L 2W0FA 1T21A 2W38A 4F7EA 1NCNA 4OKDA 3VDBA 3THMH 3F12B 1ZLWH 1JZ5A 4LP4A 3V7MA 1CZ8H 3PHQA 4GAJH 1JUFA 3VXSD 2G60H 4E5XB 3WN5B 3X12B 3ARDA 4GRLD 4NNXB 2B20A 1UACL 2HYMA 1RULL 2OJEA 4AG4H 3O6MH 4TULH 5DC4B 3E6FA 5J8OA 5DD3L 1YJDL 5K93A 4ODHH 4M6ML 3I6LD 1VESA 2I5YH 3V6ZA 1XF1A 2P49B 2A6KA 3P0YH 5D6CB 3GSWA 2YK1H 1HIMH 1C5DA 1JHTB 5BO1H 4RMTA 5IQ9B 2CDGB 2DQUL 5IHBA 4EOWH 5FAAA 1CLYL 1X5HA 4H8WL 1KLUA 1W8OA 4GBXB 4Z7WF 4H5SA 4Y5VC 4IS6A 5C6PB 3O4OB 3PL6A 4Y0GA 1PX4A 1NBZB 2PW1B 5GGQH 1QRND 1Q0XH 5D9SB 3ABZA 5C0BB 4XPGL 3HI6L 3MLTA 5HHMD 4HIHB 5F88B 5LQBL 4KRPB 1A7PL 1LO4L 4JREB 2JB5L 4B53A 1D5XA 4D3CH 7CGTA 5E1AB 5ENWA 1CT8B 4RRPA 5KW9H 3R1GH 2R2CA 1D5IH 3FT4A 4D0BA 3KLSA 1T3FB 3MRHB 3QRFM 5MEOB 3FT3B 4MNGE 4YE4L 1ZT7B 4C56A 1MI5D 1YEHH 4P2RA 4YGVA 1T22B 4BQBA 1KXTB 3W2DL 1L6ZA 2HLAB 2E9IA 4N1EA 2ZUYA 1YEFH 1PQZB 3HZYA 2ICEA 5TE6H 3P4OB 3FRPG 4OFIA 3W81A 3KPNA 4OLZL 5DTFB 1FNFA 3H8NA 2P1YA 2VWEC 3CAFA 3FFCD 1NFKA 1YN6A 2SEBB 3PQYB 3HPJA 4KY1L 3WNNA 4MXVF 4BK4A 4B0MM 3DX6B 2IBZX 1AD0B 5BXFA 1BIHA 3C60A 5DJYB 2PYED 3LKNB 3JVGC 4KAQH 1RVFL 2NY6C 1FAKT 1ZA6A 2VIRA 5ISZA 5ID1A 3LPFA 2XKNB 4FABL 4DZ8A 1NFIB 4OZHB 4F7PA 2N7AA 5MERA 1BFOA 1DJSA 4KH2A 1QEWA 1T66C 4TNWK 3IU4H 1XZ0A 1MCEA 3U9UA 3QNXB 1CE6A 4RDQG 1KN2L 1S9XA 4LHUD 4L4TB 3T0VA 4QRRB 4HWUA 1JHLH 1HYRC 2JCCF 3ZE1F 1XCQB 5IWLC 4Z6AT 3TIEB 1BJ8A 4LSTL 4Q6IB 1CXKA 3SJVB 1BLNA 4UQ2A 5F1NA 3QHTC 3IVKB 1KCSH 3STZA 4QT5B 5C0DB 1DQQB 3TWCL 3V6FA 5K9KA 5IHLB 1V5JA 3R06A 4FQLL 4O00A 5DJAB 5IEKB 4X6BA 2K3TA 2VAAB 5DYOB 1H5BC 2D0HA 3L3JB 1IGCH 2YZ1A 2VLJD 3BN3B 1HSAA 1EAPB 5DK3A 5DJCB 3HRZB 5DFWH 4UNTA 3LKRA 4UNUA 3U4EB 4P2OA 4QNPE 1A14H 1LK3H 1L0YA 4C56E 1KLFA 4ZUVA 3DX9B 2X5PA 3DXAB 5AAMA 5SWSD 1YYLL 2VZ3A 3WHE1 4P2RE 3GUTA 2BVYA 5B21A 4QGYA 3LY6A 5C6TH 1IGJA 1NPUA 1WV7T 1D6VL 1HILA 1WEJL 5EU7C 5J6HB 2J88L 1UT9A 4AEEA 1QR1B 4UUJB 5CSGA 4M1CD 2GY7B 4LF3A 2Z35A 4PJ8A 2A74B 5JIIA 4GRWF 1BD2B 1J05A 4GQPH 2EIBA 4KGJA 4GBXC 4YBLB 2D7MA 5DJ0B 3BP7A 1CU4L 1NFDA 3O4OC 3VFTB 4UTBL 4C58B 2P5WD 1KJMA 5ISZE 3HAEG 4TSAL 3U6RB 1NEZG 2J3SA 2CO6B 1QOKA 3QT2A 4LARL 4M8QB 4E0RA 1A1OB 3WD5L 4JREC 1V3KA 1WJ3A 1ZAGA 3MJ6A 3BWUC 1K4CB 1MJJA 5JUEL 1WZLA 4K23H 1P4BL 2VISA 5TQ0H 3QUML 4KU1A 4RFEB 3LRSB 4ZYKB 4NQTA 4OKVB 4Y2OA 2NW2A 4K8RC 5JHDA 2I9LA 3PWVA 4LIQE 3RWIB 4U3XA 5CFHA 3HMXL 4JPWL 3CLEL 3BSZL 1LP9F 1K8DB 1Q9OB 2OS7A 2VRAA 3CH1A 4IDJL 1YY8A 3NN8A 3T3ME 5C09D 2CLVB 1MPAH 4YXKH 4ONGH 2R0ZH 2EICA 5D1QB 4IRZH 3UBXI 4I0PB 1TQCB 1RD6A 5FKAB 4CL7A 4ETQB 1A8JH 2CUIA 3S36X 2ED9A 1LDPH 5FO8A 3DYOA 1MY7A 4OLXL 1MFBH 4EUPH 1IM9A 1DL7L 4HXBL 1JNNL 2D7OA 1XF4B 3WNOA 4X7DC 3QUYD 5HYQA 2CIKA 4FFZH 4OTXH 5GGRY 1NGWB 5E6ZA 5I1AA 1EZVX 2FBJL 4G6JL 1B2WH 3QDJD 4LSRL 5CEYA 3LB6D 1A7NH 3QCUH 4P59H 2BVPB 3X3GH 1GIGL 1U8HA 3FO1A 4F3FB 4KJPD 4TUOB 2CIIA 3WUWG 2W1NA 2Z4QA 4HS3B 4I18A 4I3RL 2FX8H 3IFNH 3VXPB 1TMCB 4X8XA 2PXYD 1ZT1A 3D9AH 2VZ1A 4GRMB 4Q6IC 1GVIA 4YH6A 3O45B 3BQUB 5D7JD 1OF2A 4I2XA 1LO5B 4XNQB 1NFDE 3CNKA 5CP7A 3U30B 1OAYL 1I1FB 4S1RL 5JLZB 1JHKL 2BVEA 1NAMB 2P46B 1XAUA 4JO2L 1OTTC 1KJ3H 4D9LH 3C5ZB 4BZ1L 3N1FC 4M1GH 2OR8A 1A9BB 2BOBB 4HJJL 5F7EL 5KZCB 4PJBB 3JUZA 4LRNL 4GLRI 5L6YL 2DI7A 1BP3B 4QXTB 4QTIL 4S1DC 5J9PB 1V3LA 2FIRT 1EFXA 5FYKE 1IM3A 2A6DB 4GAYB 3U0WH 5JHDE 3KNBA 1SBSL 1CYGA 1HEZB 5FGRA 2VNCA 5JNYA 1J1XL 1H3UA 1N7ML 3FB6A 1XIWB 3SE8H 4OCNC 3EJZD 1TDQA 1BFSA 5JMRA 3SE4C 1TJGH 2PCPA 1A3LH 1DBKL 3VA6A 4OF0A 4PJCA 3KJ4B 3OAZK 4PG2C 4ODVL 1NUNB 3UTOA 5TPWL 3VW3H 3S37X 3NABH 4L3EA 4PRIB 4MD5A 2XZCH 5F6HJ 3BVNA 4JPIA 2BXZA 4X4XA 2EKJA 4FNLL 4YBLC 3FB7A 2YWZA 3MACH 2ATKB 2YSSB 2DL9A 5TFSL 5GJSL 4O2EA 1GGYA 2HWZL 3BMWA 2AQ2A 3L3HB 1I4FA 2NY1B 4Z8FL 3D6GA 3MFGB 2Q8AL 1PG7H 4X7SH 3RZCB 4V2BA 1AFVL 1J0ZA 3RFZC 2WSKA 5DA4A 5KJRL 3MRNA 3R8BB 2M1KA 2ARJA 4J3TA 5A3IC 1FVDA 4DOHB 1JZ6A 3VGBA 4X6CB 2AI0H 2XZAL 4R7NA 4YHKL 4YZFF 5SWQA 1EXUA 4XP1L 5GS1A 3S9DB 2R56H 2FIKB 1QSEA 1E4XI 2NR6C 5SV3A 4OQTA 4WDIB 4FXGA 2OLDA 3JUYA 4JJ5A 1MY5A 1Q9WB 3DX8B 3KYMB 4KC3B 4I2XE 4XGZB 4KVCH 1KNOB 3AM8C 1YDPA 1CICB 2GAZB 2AGJL 5JXAL 4JKKA 3FN3A 2H8PA 3QZWG 4PRHA 2BJMH 3VA2C 5IVOA 3SE9H 5D1QC 4JRXD 4WI9A 4I0PC 1TQCC 4TSBL 4HKBB 3LAFA 3VCLA 3FT2A 3AFLA 5FHBH 4P46B 4FZEH 2AV7B 5IV2B 1E4XH 2ZCKH 5IW3A 2CDEA 4ZUWA 4CU6A 4NBYB 2AS5M 3FCTB 4G9FA 5LJYH 3UTTD 1FZOA 5ETUA 5HDOA 1S9VB 3L5WB 3OKNB 4MZ2A 1YN7B 1TVDA 4JFDA 5J57B 1I8LA 1SYSB 2DQIL 4JHAH 4PJCE 2E9BA 4TSCH 4MXQC 2IALB 4WI8A 1HWHB 2KZ1B 5EA0L 2P44B 4JHWL 4L3EE 2H45A 5DS8B 4DQOL 1HSBA 32C2B 3SQOH 5A16A 1ZHLB 4LGRB 4HBCL 3IDXH 4I5BB 4ONOA 1NGZB 1WWAX 1NAKH 4HS6B 3BQUC 3I50H 3MLUH 2K7PA 2O5YL 5KN5B 5T5FL 1EV2E 4S0TD 2P24A 3C5ZC 3BEWB 1ZVSA 4P9HH 4NWUL 2FGZA 3CFCL 3WSQL 5IVXB 1WVZA 3QUKA 3QJFA 4NQSB 4KXZH 5H35B 3UEZA 1QSEE 3P30H 2XTJB 3GI8H 3IXAA 5F3BB 3T0EA 1IGYA 4RX4A 4WUUA 1IAMA 1P1ZB 3WJLA 1R5IB 2D3VA 4YR6A 3MBEA 3DBXB 3S3JA 4F9LC 5CEXA 4WJ5B 1ZGLB 3UC0L 1KCUL 3B9KD 4KK5C 2AK4B 2CXKA 1I8IB 3DV6A 3W0WD 3BO8A 2NX5B 4PRHE 3PWJB 4JFEA 3KJ4C 2CJUH 4KQ4H 1Q0YH 2DBLH 2E6QA 1I1RA 4LMQI 3QI9B 1NH6A 3TFKC 1FL3A 2FHCA 3MRQA 3MV7D 4ZAKB 2HLFD 3O6LL 1FGNL 1I8KB 5J3HC 4G7VH 3GKWH 1PZUB 3FTGA 4ZO6A 2EE3A 4HT1L 3X13A 1F45A 1OGAB 3MOBL 4G9FE 2OQJB 3HZMB 4UQ3B 1CFVH 1TJIH 3GHEH 3W9EB 4JFDE 3LV3B 2LFGA 4AENB 2NY1C 2GJ6A 3EW3B 3GSUA 5I19L 1JE6A 3RZCC 3RNQB 1RFDL 1LO2L 5FYJH 4PJBF 2WP3O 4U1MA 1JWMB 2BSRB 4YBQC 3BJ91 4JHBA 4GKSA 3UPAA 5INDB 3MGTB 3CU7A 5KVMC 1CD1A 1YNTA 3PF2A 1T1YA 3WNLA 1JGDB 1D5ZA 5EO1B 1ETZB 3DVNA 1UKSA 4LU5L 1M7IA 2DLFL 1CICC 3EOYG 5KSAA 2EYTB 1DLHA 4RGMB 1T03L 5I66A 2I27N 4Z18A 2H9GB 4L4VA 1SEQH 2RFXA 1FO0L 2R4SH 2DQEL 3PDOA 5T1LB 4U6YB 1RIUL 4ZFOB 2WBJA 2A1WH 4UIKH 3TBTB 3UTSA 1ZT4B 2GTZB 1PJ9A 1BQSA 5AEAA 4P46C 2O5XL 3T4YB 4K2UL 1A6VH 2DAVA 4KROB 3F7PC 3T0EE 2FECL 4EXKA 5IMMB 3RPIB 4WUUE 3T3MF 2PTVA 3MLRH 4N8CH 1WK0A 3LSOB 4XCFH 4POZD 4LASH 5C7XL 1AXSA 3IDNB 2FSEA 1G7MB 1HXYA 3LRHA 5B38B 3RA7L 1IT9H 1QBLL 2O26U 3RKPA 3EJYD 1PY4A 4W70A 1TFHA 4JFEE 2W60B 4D0CB 3GSQA 2Y36H 1T6WA 1T2QL 3Q6FB 4FQ1L 1Y6KR 4K3EH 4MS8C 2JK5A 1U8MA 5EPMB 3P73A 1Z9OA 1DANT 2XQYG 4EI6A 1E4WH 1IGTB 1OAUH 1KEGL 4YDKH 1AH1A 1OSPL 4KKLD 2QQQA 1INQA 2G75A 3I6GA 3NIGE 3QJHA 4MB3A 5E99H 5DHYB 4DVRH 2FGWH 4G43B 2J12B 3QEQB 2DQCL 3C6LB 3MLSL 1X5KA 2GJ6E 2XPGA 5EZLA 1SVZA 2A73B 2JIXB 2DI8A 4PJGB 4OI9A 5LBSL 5IF0A 3SKOB 1RIVH 2G5BA 2NYYD 4NQUA 2J2ZA 5E5MB 5HGHB 2XTJC 4XHQA 1VGKA 1N3NA 1HYSD 2F53A 2E9JA 5HVFB 4ZO8A 3ZHDA 4EI5C 3WXWL 1FP5A 2B4CH 2X4TA 4M7LT 2ENSA 2EDHA 1GRWA 3H9YA 3MV9A 5FYJD 4LCYB 4L4VE 3B6SB 3K0WA 4NP4H 2YS4A 1FC2D 3QI9C 3H2WA 2X40A 1X4YA 3UTSE 4ZAKC 1FNGA 1I7UA 3PP4H 1S3KH 2UUDH 5FF6A 3L5XH 5CKAA 5IEHA 1G6RA 4N0CC 4U6HA 3I85A 3HC4H 5C9JB 2DS4A 4ORZC 2F5BL 4OM0H 1V3MA 5DLMH 4LIQL 3TN0C 1NDGA 5IW1B 1Q72H 4XNUL 5DVLA 5EUKB 1J5OH 2V2WA 3G5ZA 2WIMA 1OT2A 3NMEA 1P4LA 4KI5D 5CLWA 1BVLA 1R3JB 2ZG1A 3HS0B 5BZWA 1LK2A 1AY1H 1RUPL 5IVZA 4QY8B 4IRSD 4NN5B 3PGCB 4QF1A 1TZHB 4YDLB 5C0AB 3GNML 4TVPH 5FK9B 4U1HB 1UH3A 3VXOA 5CHNA 3BD5A 3V4PL 3UBXA 2XV6B 5IVXF 7FABH 3K4AA 1UM6L 4YGAB 2X4PB 2ZNWA 3UPRB 2BNQB 4PGEA 5DZNA 2O61A 5FM5O 3ES6A 3VXUD 3U46B 3HR5B 2BX5A 3C8DA 4NWTL 4MAUH 1KEMH 4XX1G 3ARUA 5D72H 5E8EA 1OAZL 5CILH 3S3SA 2BY1A 3LVEA 4RGMC 4P9ML 3OMZA 2IBBA 1CGSL 4JPVL 1EGJL 2FATL 3NCJL 1DLFH 5F70A 5T3ZH 3INUL 1NGXA 1CIUA 5I9QB 3B8YA 4AZ8A 4OCRH 5I1GL 4KROC 2X4OB 3BKJH 5TE7H 3TBSA 4PYGA 2XQBH 3I9GH 2FJFA 1V7NH 5A2LH 3PWUB 3O2WL 1NQBA 2P8PA 2AJSL 4PJ7B 2E8ZA 1OTSC 2F53E 5T3XE 1UWEH 4UBDC 4DUXA 1MEXL 4BQ8A 2VYRE 1VKXA 2WW8A 4Q2ZA 1XGTA 1ZTXH 3MV9E 1OPGL 5GGRA 4HG4K 2HFEA 1X9QA 4Q6YA 1OAQL 2A9NL 4YK4B 4G42A 1X4XA 1W72H 5J4MA 3JTTB 4ZOCA 3IJHA 4N9GA 5FYKL 1FLTX 1JPGB 2H32B 5I8CB 1AQKH 2BNUA 2QL1A 4HDIB 4M61B 3MUJA 4OBSA 3GMQB 1QA9B 4P3WA 4FFYL 4O58L 3IDUA 3MJ9A 2OJZH 4A2MA 2VL4A 4ONFH 1R3LB 2YD1A 2ITDB 3FB5A 3PABB 4IMKC 2EIDA 5F7FA 4NRZA 3C6LC 3VXMB 5HYFA 2B5IB 1ZEAH 4PJDF 4X6FA 2CO7B 2VUOA 4S10A 4TNVK 1JGVH 1F6AB 5IB1B 1GL4B 4GXVL 4HWNA 1YQVL 3MRGB 4QKXB 5KG9A 1JZ8A 1MJ7H 5D5MF 5HDBE 1A6ZB 1U8KB 1WICA 1Z3GL 2D03H 4G8GD 4PJ5B 5GRUH 5IB4B 3BPCA 4K7FB 1CN4A 5F7DA 4TVPD 3FB8B 4R7DA 4AEHH 1CXIA 2PO6B 3LKQA 4NCDA 4WU7B 3VFSA 1AI1L 4U1IA 4ODXB 3HLAB 1IQDA 3OR6B 5H37G 5DD5L 1ZLSL 1HH9B 4ZUTA 3ULVH 4PJ9A 4EDWL 4UOW0 4NZJA 4CNIA 4X6EA 2FYYB 4NJ9L 1UEYA 1JI2A 2BFVL 4MJ5A 4BK5A 1AJ7H 4G9DB 1QFWL 1RV6X 3OKLA 3KJ6H 4K94L 3ZDXE 3D69B 3B5TA 3SY0A 5I8OL 1BFTA 3OKOB 1FIGH 1MJ8L 4NN5C 4X5WB 1A6WL 1BFVH 3BXNB 3DVFA 4LCCA 2OL3L 2IAMC 1MCPL 2J6EH 3IF1B 4YDLC 2WUCH 5IFAL 4OFVA 4XWGL 5T3ZD 1DVFA 2NXZB 2Y6SD 4WTZA 3F6LA 4FHBD 4LLMA 1U9KA 4JEGB 1LNUB 2FZ3B 4O2FB 5K9JL 4X5XA 5J11B 4JVWA 1F6FB 4U05A 4L3AA 1YJDC 4KKCD 1B6DA 4ZTPL 1KELH 1P4IH 4OLVL 2VITA 3ARWA 1MHHB 4X98B 3QIWD 1MNUH 4D8PA 5GZND 1OB1B 3V5KA 3B2VH 4J4PD 3V5HA 4XVTH 3UYRL 1NBYB 3QPQD 2KUTA 1OAXL 1LMKA 2YKLH 4H8WC 4M48H 3ARGA 1AGBB 5DHVH 4Z7QE 3VXRD 5ICZB 5DEFB 3SDDB 1SJEB 3MLWL 2EC8A 5FOJA 3OAUL 4ODWA 5CWSA 1RK0A 2BSSB 5C08A 4RAUB 1X6NA 1FIEA 5D7LB 1ZANH 4AM0A 1HHJA 5I9QC 3FZUC 1JVKA 3BGFB 4N0YH 4OLWH 4NFBA 4NGHH 1NC2A 3U7YL 2CGRL 2QADD 5LG1A 4MSWB 1DQTA 5I74C 2ARWA 1JWUA 3QUMB 5E1HB 3OXRB 1GZPA 5E2UH 1FRGH 4G6FD 5E5RB 3MFFA 5K59F 4GW1A 5E2TL 4FXKB 4PJAA 1U92B 4N0UB 3F7RA 5JR1H 4X0KB 2YD9A 3I6KA 3MUHL 2OBGA 3GIVA 4IMLA 4YK4C 2APXA 1E6OL 1Q94A 2VXVH 3DVGA 3HUJB 3GO1L 5FO9A 4MD4A 1X7QB 4JM2B 3TCXA 1K2DB 4ZFFB 2HH0L 4YHOL 1WZ1L 3Q2CA 4AQOA 1NL0H 1ORQB 43C9B 1DBAL 3K8KA 5CD5D 1LHZA 4NZRH 3RWJB 1DQDL 1KB5L 1UJ3A 3L3DB 4XVSH 3VFOB 2ID5A 1QFOA 3TZVB 1MFCL 1AE6L 5I71B 3ULVD 1BQUA 2FDBP 3J7HA 4WHTA 1HWGB 2B5IC 5HGAB 1W0VB 2J8OA 4HCRL 4NKQB 4NCC1 3BW9B 4P2YA 3A6OA 4U1JA 5D70H 1BM3H 2HTLC 1T7XA 1B90A 1RUQH 2JF1A 1SEBB 3PGDA 4LRIC 3THML 4UT9H 4XVUD 1CZ8L 5JXEA 3OSKA 3DGGA 4GAJL 1A2YB 1VEOA 3KDMB 5FFLA 3D85D 2JJTC 5D2NC 2IFGA 5HHNB 1J0KA 3BIKB 4RAHA 3MNWB 3O6ML 4JLRA 3VU2A 2PO6C 4E42A 3AREA 4TULL 2ADIB 4M7ZB 3WLBA 4S0SD 3IFPB 1FN4B 3KYNA 1U3HA 4H88H 4ODHL 4L3CB 1HNFA 5C08E 5EU4B 2I5YL 1UM5L 3TO2B 4PJEA 3P0YL 4J12A 3GMLA 2YK1L 2DIJA 1HIML 1AGEA 2ESVD 2V5MA 5BO1L 2FJGA 5FGBA 3VWKB 2IPTH 3QPXH 2LE9A 1FNSH 3GMRB 4HX1A 2Q8BH 4E9LA 2XNAA 4L9LB 2XZQH 4GXUM 4S1SL 3BUYA 2IH3B 4QOKA 2JB6A 5GGQL 1Q0XL 3RWDA 4KTDH 4PJAE 1T66D 5BS0B 4HAGA 5DQ9A 5DRZA 2NXZC 5HVWA 1N59A 1JF6A 1K8IA 2VR9A 3BISA 4IOIB 4YHPB 3HG1D 5BQ7B 2CK2A 4D3CL 3N06B 3KPLB 5J11C 3QFJD 1A7RL 4RMSA 3VRIA 4YEFA 5KW9L 1D5IL 4P5KA 1EHLL 3DWTA 5INCB 4JDZA 2BOCB 5I30H 4YDJA 2LVCA 4QXGH 3MNZA 2HT3C 1UWGH 1HN1A 2R1YA 5F96H 3VD3A 4OCSH 1YEHL 1AC6A 3AXLA 4S1QL 2VE6A 4PGJA 1VFMA 4PG9B 2Z31A 4P5MB 5HD8D 3MRIB 1WCQA 3X17A 3FQXB 4GXUN 4OD1L 3R0NA 4LMQE 3S96B 3VFPA 4P3DA 4ZOEA 5D2LF 1KF9B 2Z93B 3BGFC 4K3GA 5HPMA 1LEGA 5KVGL 4IRJA 5KS9A 2CH8A 3PNWB 5T33H 4PREB 5LKNA 2DQGH 1CDYA 1T7WA 1JGLH 1UQSA 1QNZH 4KAQL 5JPMB 4WWKD 1FL5B 1X5GA 1XF2B 1FFQA 1QRKA 2DIAA 4GMSH 4AJ0A 2BCKA 2AJ3B 3IDJB 2W59A 4X80H 1QSFA 3TO4D 5EC1A 5JHLH 2YD3A 3QWRD 3TYFA 1MIEH 3DIFA 3IU4L 2X9WA 5H37H 4G8IB 3GGWA 2R0WH 4PJEE 1Y18B 4JFHE 4JM2C 3IT8D 1AP2A 4PRDA 3TCLA 3EYUH 1MUJB 4CMMB 3I75A 1HKFA 1JHLL 4I48A 35C8L 3IYLW 2YD8A 4QYOA 2Y7QB 5DO2C 1KJ2H 1U3ZA 4F7CB 3K8MA 1NCBL 4QOKE 4OIBA 1KCSL 5EOCJ 4HK0B 3ARFA 4KRPD 5IR1A 3TZVC 4YHLH 5L8LB 2EE6A 5I71C 2W65A 5IMLB 3PGFH 1BQHB 1T80A 2IPUK 1DBMH 3EO0A 4IOFC 3WKML 3RY6C 2HA1A 3O11A 4Z77B 2HG5A 1BZ9A 3FHAA 1YC8A 3SO5A 1IGCL 4WI7A 3EYSH 1JN6B 2XOTA 1PEZA 4JANA 4WEUD 1I7ZA 4KJQC 1A14L 1LK3L 4R4BB 1K3IA 4NNPL 3UYPA 3QULA 4XPAH 5C0GA 3CSBA 2EYSA 3ZYZA 5SWZA 1MHCB 1JIBA 4M7ZC 5LGJA 1U8LB 1N2RA 3QEGL 3UPCA 4JFOB 1HINH 1CL7H 4MA8L 1VSCA 4WW2B 4JM2F 4M7LL 4DK6A 1Z5LB 3VE0A 3SKMB 1YEIH 4NQVB 3VWKC 4HWEL 3K4ZA 5KS9E 4GAFB 3O8XA 2ATPA 2K7QA 1C1EH 4M62H 2GITA 1Y0LB 1KT2A 4HIJB 4L9LC 5DD0H 2GW5A 4QWWD 3CX2A 5HHQB 3QDMB 4JGUA 3S97C 3BWAA 3DRQA 3BZ4A 1B4RA 1U8IB 1VFUA 3REVA 3MRLA 1J12A 1IKNA 1MHPH 2FEDC 4LKCB 1LDSA 1QSFE 4JGMA 3MTRA 2J5LB 3OR7A 4M5ZH 4YWGH 4K23L 2ZUUA 5TQ0L 4QRRD 4OCYL 3EDEA 1T1ZA 2B39A 5BZDA 3C8KB 4M00A 1CDGA 5IFHH 1B0GA 4LDOB 2EIEA 3ZHKA 4ERSH 2OZ4A 3G04A 1D6EA 3Q48A 4M4RA 4U7SA 5J1AA 3SEPA 1UXWB 4CU8A 4OSUH 2FJHA 3KPSD 5FM5M 4YDIL 3U0PA 1YMMA 5GGSB 3N1MC 3DX7A 1F97A 3MJ7A 4ONGL 3BPOB 2PYFA 2R0ZL 4X4YB 4K7PY 4H20H 1X5AA 4YQXH 4NUGL 4R96A 4JFFB 1LDPL 4ZS6D 4I3SL 4HUVB 2Q3AA 3GJFB 3GRWH 4Z7VF 3VXQA 5ACZB 1G0XA 3WBDA 4LFHD 3DXAD 4KHTH 3WHXA 3VDCA 5F9WB 2DF3A 3FMGH 5EC2B 4YXHH 1T21B 4F7EB 4M02A 3NZHH 1NAMH 4IOSD 4QHMA 5SWZE 1B2WL 1H3WM 3K74B 4ELMA 1A7NL 3QCUL 3PWNB 4P59L 3X3GL 1JUFB 5I1LB 2VQUA 1H0DB 1QHPA 3OHXA 2ICWA 3NGBB 1R24B 1UB5B 4PP1C 1SQ2N 3WNKA 2FX8L 3IFNL 3DVIA 1S7WB 2VZSA 4JN1L 3V0WL 3PJSB 1KIPB 5IB3A 3CVHA 1FO0B 3SGJA 2LAGB 3MXVL 4LLDA 3D9AL 3QWOB 4HUKB 3GSWB 4YFEA 2KBGA 1MJUH 1C5DB 4X6DF 2C7UA 3UXFA 5IOPA 1G7QB 5B38G 3KPMB 1AGFA 5DA0B 1KJ3L 2L4OA 4FQ2H 3CFKA 1T0MA 4MJIA 3MOAH 5DJZB 3PL6B 3P40A 4N8VB 2OR9L 3HI5L 1PY9A 1OCWH 5DMJB 3ZL4L 1A5FH 4NM4H 5C2BH 4NHUA 1G1YA 4D94A 2VTFA 4RMRA 4C54A 3AS0A 1E4JA 4WO4B 2X7LB 4YAQB 3DETC 3SE8L 1XR9A 2Z8RA 1YMME 3K2MC 4JB9H 4F9PA 1A3LL 2Y72A 4C56B 3AAZB 4EJ1C 1WCBA 1FFNA 3OV6A 3VGAB 4HFWA 4WW2C 4YGVB 5I76B 4WHYG 1OM3L 5IJVA 4U3HA 4JRYB 3VW3L 2RR3A 3NABL 3HI1A 2H6PB 3HZYB 3SE3C 4NZTL 2QJDA 5BW7A 1N6QH 5M95B 5C0CB 5F1IA 1MQ8A 3ARRA 3EO9H 3QXUA 4P3CL 1AHWB 5B22A 1YN6B 3MACL 3GSRA 4MNQB 3HPJB 3FQWB 4U31A 1FZJA 4WIQA 3RTQB 3HNVH 3NFNB 2MTPA 1RUKL 5FKPA 3U9PL 3C60B 2P48B 4Y2DD 4EN3A 1F4XH 3X3FL 4ELME 4MXQD 5C3LD 2YD5A 2J5LC 2VQTA 1PG7L 4HFUH 1X6LA 4X7SL 3D18A 2VIRB 4FQJL 5ID1B 2DM3A 1OOAA 3C5JA 2XXCB 2AI0L 1EEYB 3X14A 1BFOB 2R56L 1ED3B 1REIA 4OZFA 2C3XA 3AMKA 5EULV 4HMDA 3BQUD 2VDLH 4UU9A 5IHZA 5E8OB 3VI4E 4JDTH 1VERA 1HDMA 3U9UB 4WI5A 1CE6B 2BK8A 4BFEA 3DMMA 4RCAA 1I8MA 2LABA 4E41B 2GQHA 4O5LH 4QTHA 5KZCD 2BJML 1CFSB 4MJIE 3BPOC 1KCRH 3SE9L 4FZ8H 3BHBA 2OMBA 4WW2F 4D0DB 5HBBA 4ORGA 4MVBD 1CFQB 3D39A 3OAZH 2ADJA 4HHAB 1B9ZA 2NNAA 5FHBL 1AKJA 1E4XL 2ZCKL 3QIUC 5HI5D 1XIWD 5F9WC 3S35X 5EOTA 2EDLA 4XTRD 3EHBC 1E27A 4KPHH 1KGCD 1A6UL 1FJ1A 2VAJA 3LKRB 2WWMC 3DROA 1KIUA 3GI9H 3DHMA 4RGOH 3CDGB 5SX4I 3TFKD 2YD4A 4H0IA 4KVNL 4JHAL 4ZUVB 4TSCL 3EYFA 4PRID 1QSVA 2C1OB 3NGBC 1XMWA 2CLZB 4FTVB 2DLHA 2QSVA 5E8NA 3K7UA 5J3HD 3FO9A 2AKRA 4KK8C 4P23C 4XRCA 1OSZA 1NLBL 3SQOL 1KB9J 1SM3L 4M6OH 1S8DA 4NPYA 5GGTA 3WXVH 4BQ6A 1GYAA 1ZHNB 2F19H 2Z35B 2KQNA 3I50L 3MLUL 4EVNA 2WBWB 5CBEB 2DMKA 4JY6B 2NY1D 3CMOH 1BVKA 4RQQA 2EE9A 5IBLC 5SX4H 4HJ0C 3MV8B 2E9WA 1KG0B 4P9HL 4K07A 2MWCA 3PL6C 3W5MA 4DFIA 3KPOA 4HH8A 3MCLH 1KJMB 4DKFH 3R8QA 3T8XA 2AAVA 1YY9C 4OUUA 1CBVL 2VOTA 4ZFGH 3P30L 3WJJA 3GI8L 5ERWA 3BP6A 4GW5B 3QNYA 2XTLA 1J1PH 1FYTB 2AJZA 2VISB 3KPRA 4WO4C 4FQXB 3TGXA 1H8SA 5CSZB 2ORBH 1RURH 4YJZL 3NCFB 3QUZB 1FHGA 5JHDB 1K3ZA 4QHUA 1K6QH 2HJFA 4P4RA 4BFIB 5CUSH 2XWBA 1UB6B 2CJUL 2YD2A 4M7JH 4PGBA 1CGXA 3VGAC 4LEXH 4P46D 5TDPB 2DBLL 1GZQB 3U79A 3D39E 1S7RA 1YY8B 2XYCA 4GQ9L 1XH3A 2YWYA 3O0RH 4N0FB 3SCMB 4OFYA 2WUBH 4XHJC 2YHGA 2P8LA 1TETH 3FHQA 3GKWL 1DBJH 3RVXD 3MX0A 4LQFH 3QHZH 4AIOA 1AHWC 3GBNL 2G9HA 4IHOB 3RTQC 1CFVL 1TJIL 3QDGB 1IM9B 1P7QA 4HW6A 2VDRH 1NC4A 4KGLA 3ULSA 2VKXA 5ILTH 4R2GD 4I13B 5FYJL 4RNRA 5CIPH 4MS8D 2EXWC 2IANB 4GH7B 5KANG 4X99A 4ZXBA 4WTXA 1BBJB 2C4XA 1F4HA 4J3SA 4DN4H 4MAYB 2EEDA 3TIDB 1RJLB 3P11L 2CIIB 3SBWC 3TJEH 5FCSH 3GIZH 3D0LA 4BSWA 1VFBA 2WNGA 4AEFA 1MH5A 4GKOA 4Y7MA 1IAKA 1ZT1B 2HRPH 3IFOA 3ZDZF 3V6OA 3BKCH 5IP4A 1GOFA 2W9DH 1SEQL 1OF2B 3RL2A 3TBVB 5FYKU 1F2XK 1MREL 3R4DA 4UIKL 1ZE3C 2ZUQB 5IMOA 3TH4T 3LQMA 3E1F1 3MV01 2C1PB 4QHLA 3VXSB 5C07A 4DUWA 1R5WA 2GUOA 4GRLB 1WWWX 1A6VL 5I1KH 1ZLUK 5DWUH 5MEPA 1IRAY 4HIEA 1D5BA 1CLOH 4ZOBA 3KPRE 2ZSWA 4RSVA 2WV3A 1XGYH 2NX5D 1IM3B 5CZXD 4PGDB 1JWSA 4JCMA 1S7QB 5L2JB 3KYOA 4ZAKD 1XCTA 1QZ1A 5DMKB 2V2TA 2Y36L 5HDQH 1UWXK 2Z91A 2OTWA 1A7BA 1P9MA 2VL5A 1G7HA 4MLIA 4WHYH 1GSMA 3MLZL 3CXHJ 1N5AA 3MODH 4LQ1A 3S8WA 5H8DA 1R0AH 4PJCB 2WWKO 3BAEL 3RGVD 1J8HD 3QUYA 4F80A 1E4WL 4XMKH 3MCG1 1S9YB 3I02A 4MD5B 3S37H 5I16A 3JTSA 5D1XD 3BVNB 3OF6A 4JPIB 5IB2B 4U4BA 1LE5A 5HYIA 1NSNH 3AS3A 5E99L 4JPKH 4DVRL 3O6FD 2FGWL 3MRMA 9CGTA 3MRRA 3T0DA 4J3WA 1MI5B 3FQTA 1RIVL 4O2EB 1MCSA 4ZO7A 5HY9B 3CJJA 1I1AA 3MROA 1G7JA 4WY7L 4KMLB 5JORA 1I4FB 4J23A 2IGFH 3RWFA 5K9OA 1R3IH 1FLRH 2F74A 2ZNXA 4FQXC 1BQLH 4UV4H 4W81A 4YUEH 2B4CL 1KV3A 2P4AB 5SWQB 4OD3H 3NFPA 1XF3B 5JOPE 3QUZC 2OK0L 3FFCB 5ID0A 5CJXA 3V6OE 4X7TA 2GT9A 4JJ5B 4PRPA 4PLJC 5AD0A 3EDJA 3SDXF 3ZKMD 1ZHBA 2PYEB 5IM7A 1KB5B 5FDWA 1A3RL 1S3KL 1N8ZB 3L5XL 3T3PE 4PRHB 3SCMC 2VKWA 5C07E 5DD3H 3HC4L 1YJDH 3GSNA 1UXSA 3OKKA 1ONQA 3SDAA 1Q72L 4F2MB 4PR5B 2PTUA 1J5OL 4XCCL 1MCOH 3O3AA 2DQUH 2WQRA 2AEWA 3H9SA 1IE5A 4G8FA 4O4YL 5D93B 3UTPE 4PJXB 3C2SA 4BZ2H 3WE6A 7FABL 1FZOB 5ETUB 1QO3B 4PD4K 4JFPA 1UYWH 2GY5A 1AC0A 3G08A 1I3GH 4UT6L 4MAYC 4MAUL 2DLIA 1NDMA 1G1CA 1KEML 5LQBH 1OP3K 3LN5A 1A7PH 1LO4H 1KULA 3HZVA 5KSVA 15C8H 3L3OA 2GFBA 2VQ1A 3QXDA 4Y19D 3A6BH 5CILL 4HUNB 4LDEB 1I9IL 2PKDA 4U1GB 1QLFB 1XGUB 1HSBB 4P99A 2VLJB 5A16B 5B3NA 4LPXA 2UYLA 1Q9LA 1JF5A 2JIXD 4YE4H 2BC4B 3U0TA 1H8OA 4K94C 4DKEL 5FHAL 1DLFL 2ZUQC 5T3ZL 2XN9A 2P24B 3F7YA 4GRLC 1FGVL 1R5VA 4OCRL 3BKJL 5TE7L 4RBPK 4F15B 5L8JB 2VR5A 1B4JL 2XQBL 1ZA3B 4GW4B 5EBLA 3ZYOA 1V7NL 3Q3GA 2P5EA 5I17A 4Y4KA 5TQ2H 1U8OA 1T4KA 1IGYB 1ZTXL 4WUUB 4D9QE 1R3KA 4DWHA 4YR6B 4PRPE 4OGAC 1RVFH 2P47B 3NCEB 1A6TB 4O51A 4GUPB 5GRZA 5KANI 3O2DA 4FABH 5DD6B 1MVFA 3BO8B 1HH6A 3ROLB 1FNEA 4U6VL 1AQKL 2ADFH 3ULUE 4NKMB 3FOLA 5JW5A 3GSVB 3TC9A 2CK0H 5KTEL 2OJZL 1KN2H 5C0AD 4ONFL 4NQCD 5CSBA 2V7HA 4J3UA 1XGRA 3H9SE 5FOBA 4LLQA 3X13B 4LLYA 3DSFL 1ROWA 2BNQD 3MMEA 2BNRA 3ORJA 1CDCA 1RAMA 1JYVA 1T0NB 1P84K 1MCJA 5ADOH 3U36B 2Z92A 3QUXA 1L9MA 2NTSP 2GJ6B 1L7IH 3BN9D 2AEPL 4L8BB 5C09B 1MJ7L 4U1MB 2Y4SA 4J8RB 3CUPA 4GKSB 1JGUH 2VZUA 2D03L 5GRUL 1F58H 3OKEA 3AB0B 1YNTB 4JFXA 1BQHG 1RZGA 3PV6A 1HCVA 3ILQC 4JKMA 4ZODA 2X9XA 4HUWB 3ULVL 3U82B 1A7QH 2XN9E 4YXLH 4DCQB 3F7VA 1GPOL 4DJMA 2IPKA 5EIIA 3CVHL 4MA1B 3KPQB 5E0QA 4R26H 3I3BA 2D4DA 1AJ7L 3UTSB 1U8PA 4MDIA 3BGMA 3QDJB 3KJ6L 2P5EE 4W4OC 2X4QB 2DQHH 5GGUB 1JL8A 4P5TA 4F33A 2J6EL 2WUCL 5D93C 2H2PC 2PXYB 1CGVA 2UVEA 1CU4H 3UTQA 3GMMA 1AXSB 3MRDA 5EU3A 2FSEB 4PBVC 5D7JB 4Y88A 2VXQH 4PTUA 1I8LC 1OWWA 4Q9QH 4PBXA 5DJXA 3MLYH 1KELL 4LARH 4NQDA 5E2JA 2E6JA 3WD5H 2A83A 1A9EB 3GSQB 2EEAA 2R0LL 3B2VL 3QUMH 4XH2A 3TA3A 4YIQA 4HH9A 4XVTL 5CJ8A 2JK5B 3SDCA 1UKQA 3VGDA 1U8MB 4U1GC 4WEBH 1NCUA 4U1NB 1TVHA 3VXMD 3P73B 3VFNB 3BP4B 4M48L 4BKLA 5DRXB 2E7HA 1FCGA 2X4UA 1VPOH 3O9WD 4EI6B 2QR0A 3MUZ1 5H94B 1RHHA 3BH9A 5L2KD 2VLRD 3HMXH 4XBPA 3S34L 2HJKA 3CD4A 2HTLD 3R0MA 3VJ6A 5D96B 2BNRE 2G75B 3QJHB 1LQSR 4YX2H 4OZIB 3QIBB 4F15C 3HPLB 4OLWL 2EDDA 4NGHL 2FL5B 2HAZA 5EZLB 3V79C 5IF0B 5BV7H 1MLCA 4Q7DA 1MWAA 4KKBC 5HYJD 2MFNA 2DQJH 1U95B 2G5BB 1IGML 3JSSA 2PO6D 5E2UL 1DANU 2Y5EA 4M1CC 4OLXH 4U2ZA 3BZFA 2EYRB 1MOEA 1DL7H 5JR1L 5IKCB 1ORSB 4PJFA 3PWPA 2R9HC 2CUMA 2OCFD 5ALBL 1D9KA 3UTZA 4PJXF 1ZLVK 4OZ4A 4XCEA 4MA3A 2X4TB 3BDBA 3O3BA 2YPLA 3ZT6A 2FBJH 3MRBB 1LO3L 4JE4B 2XWJB 3FQRA 1QLEL 1J0YA 1FNGB 3HAEA 1I7UB 1AD9B 1NEZA 5FF6B 2P7TB 4U6HB 3WFHA 1G7LA 2WIIA 5M94B 5GPRA 3W39B 3GKZA 4EUPB 4XVSL 5C70A 5C9KA 3FO0H 4GG8A 3CPLA 1TCRA 2MNUA 3CK0L 4U3CA 3X11A 4AQ1B 3G5ZB 5E00B 1P4LB 5I6XC 1HKLH 1H3TA 2F15A 5GXBB 1LK2B 5IVZB 1BM3L 4ZQKB 5EU6A 4QF1B 1T7ZA 4JO2H 4NQDE 3VXOB 4HPYH 5CHNB 3LPWA 4UT9L 1GGCL 4HJJH 4KRMB 4LRNH 4PP2B 2AEIT 2O61B 4XB7A 5L6YH 3SDDD 2AXFA 3AB0C 3L3GA 4P57A 5MHSD 4R97B 3MGOB 1SBSH 5GQBA 4H88L 2R69H 1J1XH 1N7MH 3HCVB 4MJ6A 5AG9A 1Q8MA 3LEYH 3UTTB 2H3NA 2IPTL 4MA1C 3BE1H 1FNSL 4DZBB 3Q5YA 5ICYA 3C9NA 3LB6C 5EBMB 2ZOLA 2XICA 1NANI 4KJPC 4LCUA 5CEZE 1XGPA 3EGSA 2YPVH 2CKNA 4KTDL 4Y16B 3WUWA 1I7RA 4GT7A 4PJFE 3PWPE 2PXYC 4XZUB 4PTTB 5EUOB 1R3HA 4FQCL 4PRBA 1KLGA 1WZMA 1OQXA 1AQDA 5D7JC 5TFSH 2YPLE 1E0OB 4JY5H 1CQYA 1PKOA 1D5MA 2GEEA 5GGRB 5E5UB 3HMWH 3A67H 5I30L 4Z8FH 5L9DL 1IEAA 3HRPA 1UWGL 1F8TL 2OSLA 4OCSL 5D7KE 1ZSDB 4XXDB 3IJHB 3TZVD 4N9GB 4YHKH 4XXCC 4I9WE 4XP1H 4QXUH 2BNUB 1YUHA 3BPNB 4IOFD 1IC7H 4APQA 1UEMA 5CJOL 4OD2B 3H7BA 4ONHA 2AGJH 3T4AB 3MRJB 3QHFL 3UAJC 5EU6E 4HS8H 1TVBA 3VMOA 2YUVA 3QIBC 4NRZB 3B9KB 4OCLC 3M1BB 1MIML 4GMTH 2ICCA 3TH3T 5GRVK 3W0WB 5T33L 1FYHB 2DQGL 2OX5A 1JGLL 5TDOA 4Y4HA 3QFDA 1AIFB 3P9LB 4B41A 5I1EH 4GMSL 3MV7B 5AZEH 3QQ4A 1LO0H 4KZEL 1P5VA 4ZTOL 2ZOKA 4X80L 4JFZH 2R2BA 5JHLL 4YEEA 3IDGB 4YHIB 1CFTA 5DJDA 1MIEL 3BPCB 2EDYA 4BH8A 5F7DB 2R0WL 5EOQH 3PE9A 4LEOA 5LAXB 3GBMH 3EYUL 4HC1A 4PFEA 3RWCA 1RJYA 2HVKB 3EAKA 1S7SB 3MGAA 2C3GA 2DTMH 4WFFE 3F5WA 2MQ3A 3JWDH 4PJ9B 4A6YH 1S7XA 1KJ2L 3N0PB 2C3VA 3HR6A 5BS0D 1OW0A 4JHWH 3HFMH 4MNHB 3V5DB 1T20A 4HGMA 4MJ5B 2LU4A 4JO1H 3V0VA 4YHLL 5EZIH 3D0VB 3PGFL 3OKLB 4NQEA 3FAXA 3SY0B 3ZSSA 2X4NA 1Y6NR 3VRLE 1HQRA 1IL1B 2O93L 4MCZA 3SGKC 1T5XA 3ALPA 3EFFB 5F9AC 4OZIF 2HN7A 5DDHB 3HC3H 1DVFB 4FQQB 1EUTA 3OKMA 4LLMB 2YD6A 1AO7A 1KYOJ 4CRPA 1QSZA 3HE7D 4XPAL 4K3DH 5C0IA 4Z7UB 2IQAB 3MNVA 4R97C 3VWJD 2J8UA 3V5KB 3FN0H 1HINL 4NKIH 3V5HB 1S7TA 1ADQA 4FFWD 1F5WA 3ARGB 4EQ2A 1YEIL 3MA9H 5D1ZA 3G6JA 3ZE0E 3ARZA 4L8CA 5CWSB 5SX5K 2YC1A 4PJHF 4M62L 1C1EL 3S4SA 4X9BA 5DD0L 4ETYA 3RL1B 2Y06H 1VADA 1HHJB 1JZ3A 2W07A 4WU5B 4NRYA 1YPZA 3OX8A 3GSOB 5HYSA 4XC1L 4HMCA 2DD8L 1S5HB 1MELA 3BZEB 4HEME 4Y16C 1PEWA 4RA0C 1MHPL 4MX7B 4EDXB 1A22B 5E8PB 4CVXA 4YWGL 2IJ0C 3SOBL 4GW1B 4PJAB 1FC1A 4DFHA 5CJBA 3E2HB 2FB4H 5E6ID 3WEXA 1KTRL 5I19H 3JV4A 3GIVB 2PW2A 5IFHL 1RFDH 1CFBA 4ERSL 3ZLQC 2WK2A 3GSXA 3MJ8A 3O2VH 4XBGA 4OSUL 4M5YH 3LKPB 1INDH 4RFOL 4QRPA 4JKPH 2EDNA 3BPNC 4DGIL 2NCMA 5BRZA 1U8JA 2IWGA 1HXMB 4NQEE 5CBAB 2R2HB 3AY4C 1KCKA 1F02I 1ZS8A 1QVOA 4H20L 4RIRA 4YQXL 3G9AB 4WVRA 3ME0A 4Z7WA 5C0FA 5C0RH 3OGCB 3B9KC 4BQ9A 1R6VA 2WINA 3ULUL 3GRWL 4MQ7B 5E94A 1AO7E 1ZGLP 4JAMA 3FMGL 5ALCH 2O5XH 5DI8A 3L5HA 4LBEB 3T1FA 4K2UH 3ZYIA 4GKNB 4OIIL 3NZHL 2HLFC 2J8UE 3VG9B 3DGGB 5EUOF 1CIDA 3VD9A 4L4JA 3OXSB 1HOCA 1KIQA 1XEDA 4JLRB 4E42B 3KXFA 4X8JB 2OR7A 3G6JE 1IEBA 3KYNB 4XP6L 3EZJB 3U2SB 4PJEB 4KQ3L 3STLB 3D25B 3GMLB 4LGPB 1MJUL 5EFIB 1MSPA 1AGEB 2A6IB 4P49A 4D9RE 1YPZE 4HLJA 5CCKH 2FD6H 3G5XA 5JOEA 5GIRA 1G84A 1M05A 4NZDA 4PGCB 2XNAB 3VXUB 1BF8A 4FQ2L 4ZUUB 4HWZB 3MOAL 3OL2A 1OSPH 3BUYB 4Z5RA 4QOKB 2XWTA 3RWDB 2HFGH 1K5NB 3T2NH 1WAAF 1S9WA 4Y5VA 2EDKA 3EBAA 5DQ9B 3Q1SL 1A5FL 5DRZB 5TH2A 5L88L 1DVFC 4NM4L 2FR4A 1N59B 4ZSOA 4QO1A 5KSUA 3MRPB 4NCC2 5T5NG 1EPFA 1F3JB 3VRIB 3RWEB 3SPVB 4JDZB 4YHZH 2DM4A 4QRPE 3MNZB 5FYJU 2UWEA 3TYGH 3WFCL 3H9HA 1A4KA 2BY0A 2Y9RT 5BRZE 4HUXA 1IGFH 4X9GA 2YPKA 3EDDA 1HHGB 1HCFX 3AXLB 1U8QA 2VE6B 3KLHD 2VLKA 1QLRB 5FGCE 3ARGC 1H3PH 4Z7WE 4POZC 5M7QA 4P9HC 1N6QL 2FWOA 4F8QA 2M2DA 1JF1B 2VERN 3EJYC 1VCAA 4F7MB 2CDFA 4NIKB 3MA7A 4YNYB 5HPMB 1MLBA 4F58H 3V2AR 4AMKL 3P0GB 5KS9B 4X7CC 4LIQH 4ZUSB 3ARDD 2HJLA 3VI3F 1CS6A 1H15A 5JW3H 1F4XL 1UQSB 4JQIL 5ESVB 4HFUL 1V8HA 2LVEA 1RUPH 4HUUA 3E2HC 3BRDA 3KXFE 3JVGA 2AXHA 4LDLB 1EFQA 1FVEB 3GNMH 1FG2A 5C92A 2VDLL 4WW1A 3DIFB 3V4PH 2MCG1 5GJTL 4JDTL 1I3RA 1RIHH 3TCLB 1LVEA 4PJFF 2I9TA 4R0LC 3GMNA 4RMWA 4Z7UF 5DJ8B 4HJ0D 5DT1L 5HJ3B 1FFOA 5I1JH 5T1MA 4I48B 4PS4H 4S2SB 3MR9A 3EOBA 3PL6D 1A6PA 4LPYA 3VXTB 4QYOB 3LQAH 3EO1A 1OAZH 3BT2H 1NBVH 2Q76B 1HYSC 1YY9D 2ADGA 4MXVE 3GMOB 3ARFB 5IWLA 3S98A 4G8GB 4P9MH 3BP5A 5I1DA 1I85C 4Q97A 4C59B 1ND0B 4ZSOE 3TP4A 3MV11 3TBYA 3O11B 1M1SA 2FATH 3NCJH 3WL9B 3INUH 5HVHB 3DRTA 4KPHL 3QXVA 5I1GH 4C56D 3CX5J 1NLDH 2IF7A 1H5BA 4G6KH 4JANB 3GI9L 5MI0B 4QRQB 4RGOL 2UWEE 3VG0H 4P2RD 5DK2A 5JXEC 3VG9C 3ZKNC 3QULB 5C0GB 1DQLH 3F12A 3T0AA 2VLKE 2NTFB 2EDEA 2EXYD 5SWZB 3ZE1E 2ENYA 4KI5C 4QCIA 3HTLX 1OPGH 4IRSC 4E5XA 3X12A 2ZCHH 4NNXA 1OAQH 2A9NH 4MD0B 4M6OL 5IBUB 4P2QA 3WIIH 4JQVC 2F19L 5CJQH 3VE0B 1IAOB 4PY7A 5KSBF 2HFFB 3C60D 4JR9H 5FYKH 2P8MB 4WFEE 1W2KT 1SY6A 3L95B 3O8XB 2ICES 1HHKB 3CMOL 4KKNA 1FPTH 1JHTA 2DWDB 2VWEE 3AVEA 3QEHA 3O4LA 5ISZD 3E0GA 3E6HB 3UP1A 3UZEA 2AJUL 3BZ4B 3QIWB 3MCLL 1G0YR 3REVB 4DKFL 3DSNA 4GBXA 1IC1A 5ABDE 4LVOB 1CGTA 3CH8A 3OJVC 5HHVH 1FE8H 3CSYB 3IFLH 4ZFGL 4LLUA 2GK0B 1NBZA 3VXRB 12E8H 4CADB 1CG9B 3RWHB 1J1PL 1LWRA 5C0BA 4E41D 4ZDHB 3UJJL 2EIZB 5CEZL 1AXTH 1NMAH 1NKOA 2ORBL 3ZSTA 3WO3B 3ZDYF 5HGGS 5FECA 1YQVH 5E1AA 1OWRM 1K6QL 3G04B 1D6EB 5CUSL 4GRWE 2QADB 1X5IA 5MEOA 4LEXL 3U0PB 3FT3A 1YMMB 1NUDA 4KI5F 2BRQA 4JO3H 3ARQA 3DX7B 3O0RL 1AI1H 4G6FB 4Z7OE 4QRSB 2WUBL 1TETL 1DBJL 2VLLB 1T22A 1KB9K 4XAKE 4R96B 4EDWH 4LQFL 3S36L 2Y25A 1NUFA 4OGZA 4P2OD 4NO2B 2GTWB 5DTFA 1LD9A 3CC5B 3MBXL 3O41A 1QFWH 1KACB 2VDRL 5FA3B 4LNVA 2SEBA 5A2KH 3PQYA 3TNNA 5ILTL 4K94H 2B4CC 3EOAA 3DX6A 4QHNA 4C55A 1MJ8H 2W92A 4JZNA 1AD0A 3L3KB 5DJYA 5LGKA 1NCCL 1GHFH 1LEKB 3LKNA 2DJUA 3MOQA 4ELMB 2DYPB 3OBAA 4DN4L 4PJ8D 4OI8A 2OTPA 3CIQA 4WFHE 1JGEA 3TJEL 3GIZL 1G9MH 4ODUB 4P2QE 4ISVB 5EDXA 5A40E 5K9JH 3CMGA 1YNLL 4UIMB 3DOSA 5I8EB 5EU7E 5IB5B 3MV8D 4PV8B 5IB3B 3E8UH 3CVHB 1EDQA 2OYPA 3QNXA 3VGGA 5FEBA 2CLRA 2W9DL 3O4LE 3RWGB 3BRFA 4L4TA 2YUWA 3WIHA 1M6OA 3NA9H 4KKAC 1XCQA 3TIEA 4Q6IA 3D85B 3SJVA 3N1PC 1T0MB 2DM2A 3IVKA 5DWUL 2Q1EA 4KDVA 2QKIB 3P4NB 5GISH 1CLOL 4QT5A 5TJWK 5FYKD 1DQQA 5C0BE 5HVHC 3S6CA 4GKZB 5JHDD 2KDGA 5IEKA 3BDYH 2VAAA 2QV2A 5MI0C 3U7YH 4PLJD 2CGRH 3P9WB 3L3JA 4YHYB 4KJYB 5GS0H 5DJCA 1A6AB 4KZDH 1JBJA 5HDQL 5F9DC 2E7LC 1KPVA 5DHVB 2KKQA 3EYVA 5D7IB 1JP5A 3UMTA 3MODL 1WCBB 1FFNB 1PYWA 2ZKHH 4PY8J 4R8WH 3JWOH 4DVBB 3OAYK 4O2CA 1EEZA 3F65A 4XMKL 4LLWA 3GO1H 2Y6SC 2J8UF 3SE4A 1BZ7B 1IM9D 3QYCA 5IJVB 3S37L 5J6HA 3HB3C 1F13A 1T1WA 1ZWIA 2J1KA 3O8XC 1C08A 1NSNL 3QFJB 4UUJA 4YHOH 1QR1A 4JPKL 4I8DA 4AH2B 3KLAB 3B5GA 2Z8SA 1IBGH 4KKCC 2DICA 4OQTH 2IAND 4XPBH 1DBAH 1BD2A 3PQYE 5TF0A 3CCHB 2I60H 3UDWC 1DQDH 3QIWC 1EO5A 4GJTB 4RFNB 4MAYD 5GZNC 1DUZB 4LVOC 4J4PC 2B0SH 4HIXH 4O02L 5DJ0A 5FKPB 3QPQC 3VFTA 1F4AA 3EZ8A 1U8NB 1KOAA 5DVKA 1CDJA 4UV4L 3NA4A 4YUEL 1AGDA 2CRYA 1Z6JT 2E8YA 4Y4FA 1T2JA 1HDMB 4RFEA 1OTUD 3LRSA 4ZYKA 2QADC 4L4TE 1I8MB 2GSIA 5IGXL 4ZFZB 2R15A 3RWIA 1UWXH 3WCYA 4WWKB 2BHZA 4FXLA 3SJVE 5CGMA 5BVPH 3CXHK 1K8DA 1OP9A 3UBXG 1Q9OA 3O3EB 3AM8A 4Z76A 1UM5H 2AV1B 1EFXD 2DJSA 3D39B 4OM1H 5LWYH 3TO4B 3UROR 2NNAB 4FQHA 2CR3A 1MCOL 5D1QA 4I0PA 1T83C 2X1QA 3LRGA 3RX7A 1FDLL 4OGAD 3SKUD 3QG6A 4HJGA 5C0EB 4QEGA 4KI1A 5EOTB 4S1SH 4TPRH 4YZFE 3S35H 4BZ2L 3TPUB 1FJ1B 3W9DA 3DJ9A 5GS3A 2N7BA 4M3JA 5CD5C 3DROB 1UYWL 3IJYB 3JWNC 3K2UH 4K7PX 3TF7C 1I3GL 2Y07H 5IK3B 1LE9B 2VO5A 4L3ED 3WFDL 3ULVC 4LHQB 15C8L 2RIKA 3BJLA 5E8NB 1A7RH 3A6BL 2I24N 3C08L 1IFHL 2AKRB 4U1SA 1FFPB 2F54A 1OSZB 1EHLH 4F3FA 5HGDB 1NMCB 3SGJC 4TUOA 5GS0D 2VDNH 2JJVA 4HS3A 4NPYB 3IU3B 4PJIF 1BD2E 4LVNB 4XVUC 4EVNB 2YEZB 4S1QH 4RWYL 1RZKH 1Z0MA 3H9ZA 1ADQL 3OKDB 2D7TH 4GRMA 5J12B 3G6AA 5K9QG 3O45A 2VSCA 1EMTH 3ROOA 1LO5A 4XNQA 2R1WB 4OD1H 5JLZA 4HULB 3KPOB 4RMQA 1QSED 3RX5A 3IKCB 3C5ZA 1XF5B 1A0QH 3K80A 5DC0A 5TQ2L 5KVGH 4X7EC 1A9BA 2BOBA 2MOVA 3ESUF 3ILQD 4NO0A 4PJBA 2VXSH 3BP6B 4YHYC 4QGTA 3QNYB 4XVJH 5DK0B 4L29B 2AJZB 4QXTA 5J9PA 3B83A 4PRHD 2A6DA 4GAYA 5DVNA 3LEXB 4X7FC 4OF7A 4OB5H 4F9PC 4HXAL 4F9LA 2ADFL 5MENA 4UOJA 2UWEF 1S7RB 1RUMH 4LVHB 1X5LA 2CK0L 1XGQB 3NCYS 1XH3B 4CKVX 1JTPA 5BW7C 2H2PD 4EXPX 4CVUA 35C8H 4JKLA 2D9CA 1QFUH 4JFDD 2G9HB 3LS5L 5J0BA 1NCBH 3CDYA 2D7QA 1I9RL 1P7QB 2BY2A 5ADOL 4MZ3A 1KENL 1ZKAA 3KPSB 3U7AA 3ULSB 1L7IL 4OV6F 4X4ZA 1MCKA 3WKMH 2ATKA 4BA8A 2YSSA 4RBPH 5HD8C 2D0FA 4B5EA 1JGUL 3BH8A 3L3HA 3BGAA 4G7YH 1F58L 4ALAL 2F54E 3DLQR 3RZCA 3OKYA 2JE8A 4NNPH 1KJ2B 2FCBA 2Y5TA 1E28B 3WN5C 3SGDI 1MCNA 5FGSA 3HHRB 3DUSB 1MH5B 4JKWA 5B8CA 1F11B 1A7QL 5DJ6B 4JZJB 4U0RB 4WDIA 4YXLL 4WWKC 4J3VA 4IM8A 3KYMA 4XGZA 3QEGH 6CGTA 1A1NB 1KNOA 2BSTA 1CICA 2GAZA 4KKBD 1UA6H 4R26L 2BHUA 4MA8H 1J0JA 3TO4C 4N90E 3GHBH 4XCYB 4M7LH 3T0ED 1MFDL 4RX4D 1YEGL 1R5WB 4WUUD 2DQHL 4HWEH 8FABA 2R9HD 1KTLB 4L1HA 4HKBA 4PRNB 5DRWB 5MEPB 4CBPA 4PJBE 6FABH 1D5BB 5CZVL 4LK4A 5FA4B 4YDVB 2AV7A 4Z7OF 5I1IL 1CLZH 2BVTA 3QBTB 3SGDH 1TITA 4JG0L 2APBA 1T7YA 4JFED 3L5JA 2QHLA 2VXQL 4M4PA 1Z9LA 3FCTA 4Q9QL 3MLYL 3LZFH 4KRPC 1T04B 1S9VA 5MENE 1YN7A 3B8SA 3AGVA 2YMXH 2OTWB 4GS7B 1ITBB 1WFNA 1KGCE 4OCYH 1SYSA 3VXNA 1NMCC 4WEBL 4UDUA 4HKJA 1VPOL 5T3XH 2IALA 4MMXC 4PUBL 1KCLA 2RQ8A 4NO3B 4LVNC 5CMAB 3I02B 2VDMH 5DS8A 1WGOA 3TESA 4YDIH 2GJ6D 1VEPA 32C2A 5J12C 4I5BA 1NGZA 4HS6A 1U58B 4YX2L 1GJIA 3FRUB 2P43B 4KRNA 3QG7H 4UZGA 3MRRB 5KN5A 5BV7L 4NUGH 3QQ9D 1FZMA 1UENA 1KPUB 2DQJL 1YQ2A 1G6RH 2HVJB 4I3SH 2MCPH 1NGPH 2EH7L 1EVUA 5IVXA 1VDGA 4ACPA 4NQSA 4IIQB 1V3JA 4DOHE 5KSAD 2DLTA 3FQNA 1T5WB 4TN9A 1WF5A 4Q74A 1F3DH 1KFAH 4L4VD 4ENEC 4QWWC 3FO2B 1CTOA 2PF6A 5ID0B 2HTKC 1RJZB 1L0QA 4EI5A 1FVCB 3DBXA 5F89A 3UTSD 2GT9B 3PV7A 4ZD3L 2AXJA 5AD0B 2AK4A 3FAWA 1RJCA 1S7VB 5IM7B 4Y2DB 4OZGB 1A21A 4M6NH 4JN1H 4Y5XA 2RJMA 3V0WH 4HIIB 1Y6MR 3QI9A 3FO0L 3OKKB 1ONQB 3MXVH 3SDAB 4KK6D 4ZAKA 3IGAB 1RZFH 5LXGL 1HKLL 3O3AB 1HE7A 3TN0A 1WUNT 3H3BC 4NQXA 4CDHA 3VH8A 2X4SB 4HZLB 1OGAA 4G8FB 5GZOD 5K9QI 5CD3B 4HPYL 2OQJA 2B1AL 3L5IA 4I0CC 2OR9H 2X1PA 3HI5H 3VFVA 4JFPB 1NCWH 4XMLH 3ZL4H 5C86A 3G08B 3RNQA 3V8OA 1NDMB 4TYUA 4ZS6C 1JWMA 3HZVB 4G5ZH 4XP9H 2BSRA 4HWBA 3C2AL 5KSVB 1OT1A 5E9DA 3MGTA 5I75B 2R69L 4FQPA 3UAJD 1G7PB 2O5ZL 5BMFL 3QIBD 3KR3H 2Q7YB 3T09A 4JZJC 4U0RC 5F8QC 5EO1A 3U4BL 4OZHF 1Q9LB 3LEYL 4PRAA 3BE1L 2EYTA 3LIZH 1J87A 1MFAL 5D6DC 3GDBA 4WCYH 2XN9B 4OCMC 1OM3H 4GLRH 2H9GA 2F53D 1NJ9B 5T3XD 1SY6L 4NZTH 5T1LA 4PJDA 2YPVL 4U6YA 1ZMYA 3TBTA 4I0KA 3QDHA 3ARXA 3S88L 5IVXE 3Q3GB 1ZT4A 1KTKE 1C5CH 4TTDD 5AG8A 5MP6H 3TV3H 3SGEI 1EIBA 5I17B 1HK6A 3MJ9H 2A0LC 3MV9D 4P3CH 4JY4B 3QCTH 2YOCA 2XTJE 5JO5B 4LPWA 4PV9A 5D5MA 4JY5L 1QQDB 1RUKH 1R3KB 2G5RA 3U9PH 3LSOA 1WWCA 4JGJA 3X3FH 3HMWL 3A67L 4L1DA 2AQ1A 4JDVB 4PLOB 3IDNA 3RQ3A 2AK4E 5JMOC 4N0RA 2DQFB 2NXYD 4GS7C 3QA3A 1AXIB 4FQJH 4LNRB 4NM8H 5I2IB 1J0HA 2W60A 4D0CA 5ANMB 4QXUL 3EUUA 2XG5A 5JW5B 1IC7L 5JOFB 3SGEH 3RPKA 3CFBA 2EDWA 5EPMA 1C7SA 2AJVH 4MA7H 3HZKB 1IGTA 1XGRB 3O3DA 3WS6C 4HS8L 4TUKL 1OGAE 4M43L 4IJ3B 1IKFL 4GMTL 2BNRB 1ODAA 5DHYA 1WIPA 1TLKA 4IMKA 4JFQB 4G43A 4OUOA 3QEQA 1BF2A 1DTUA 3C6LA 1P7KB 5E56A 1T1XA 4JFYB 5I1EL 2QQLL 2JIXA 2A73A 5AZEL 4PJGA 1LO0L 4F57L 1WFTA 4IIQC 5B39A 4JFZL 1ZGLM 2AJYH 5E9DE 2IEPA 3L7EA 5E5MA 3MPCA 5HGHA 4NO5B 1TTFA 1A6UH 4EZMA 5HSFA 4OF3A 4ODTL 4JM4L 1RZ8B 5EOQL 3GBML 2QTEA 5CJXC 2X05A 4KVNH 2DTML 5GSRB 4WENB 1UH4A 2CKBL 2AABL 3IXTB 3JWDL 4AEIH 1FAIH 1TTUA 4TNWF 3BKYL 2UZYB 4Y2DC 4A6YL 4LCYA 4R2GB 3F7VB 3V4VL 4Y16D 3B6SA 3NTCH 3HFML 5EIIB 3ULUC 4F7TA 4PJDE 4CN1A 5DJ2A 4JO1L 1NLBH 4XP5H 3N9GH 5EZIL 1L9NA 1SM3H 1U8PB 3BGMB 3NAAL 4OF8A 1A1MB 1N26A 4PLKD 3IAQA 3KWWA 2BXYA 3IJSB 3U30C 5HI4C 5IW1A 5EUKA 5D5ME 1ZXQA 2D4FA 2DL2A 4CW1B 3N1QC 3HC3L 2IMMA 4QY8A 3UTQB 5IBUG 3OB0H 3QP3A 4WFGE 3MRDB 2GCYA 2IAMA 1TZHA 1X3DA 2D2OA 2BVUA 3TBWA 4K3DL 4PTUB 1YEDB 1U36A 4U1HA 4UV7H 4MVBC 5DJXB 4NQDB 1IEHA 2HKFL 1CBVH 2A83B 1INEH 1NUGA 2X4PA 5F7HA 3UPRA 5I75C 3ELAT 1C16B 3FN0L 3HR5A 3KGRA 4NKIL 4YHNB 4XH2B 3TA3B 5HI5C 3DNKA 1XIWC 2W91A 1CGUA 4XTRC 3IS0X 3MA9L 5KBNC 2QR0B 4ZPVB 4HKXB 1I1YA 2HJKB 2VMFA 2YZ8A 5EZJA 4Q9BA 3T77A 4OZGF 2Q7NA 2Y06L 5FYLE 1O7VA 3QEQE 4GQ9H 4M1DH 1EVTC 3GJEB 4MQXC 3HC0A 3TVMA 4J1UA 2VDPH 4PJGE 2R1XA 4I77L 3FOMA 3RGVB 2X4OA 1JNJA 2LAAA 1J8HB 3GBNH 2YA1A 3PWUA 1OVZA 4PJ7A 4TTGA 3V6BR 4LCWA 2FB4L 5D1XB 1IARB 4PJ9D 4XBEH 1MFEH 3O3BB 4TRPL 3O6FB 2OXGA 2Y1VA 1MHEB 3UZVB 1KPRA 3O2VL 5I8KL 3G6DH 4M5YL 5TGBB 1INDL 1WBXA 4JKPL 4Z0XA 3KPTA 3L3IB 3JTTA 3FQRB 1HHIA 3P11H 2QSQA 5KVFH 1G6VK 1EBPA 5I8CA 2H32A 2QQNH 1T89A 2DM7A 4HDIA 1DVFD 4GG8B 3CPLB 1TCRB 2AXGB 5C0RL 2L7JA 3X11B 4BH7B 3O3UN 5L0QB 4IJ3C 1II4E 1DQMH 1R3LA 2ITDA 5CIPB 3T04D 5SX5H 5K59E 1MREH 2DQDH 2MKWA 5EU6B 4Y8DC 5ALCL 1H3VA 2KH2B 3ILPB 5EH1A 2CMRL 1S9KC 5GRWA 3T08A 1BOYA 1F6AA 2F8OA 2GIYA 1GGIL 1QPPA 1P2CB 3ARGD 3H6JA 3RVXC 4MDJB 2AXFB 1PGRB 3MRGA 1BIIB 4LRIA 3NIDF 4KHXH 1ZHKB 4NKOB 4PJ5A 4Q9RH 4NRXA 2Q87A 1GXEA 2R2EB 2JJTA 5D2NA 3FB8A 1MRCH 2PTTB 4LSVL 4UI2A 2Z0BA 3ARSA 2PO6A 1NC2D 1VFOA 4R2GC 4X6CF 4ODXA 3HLAA 3FONB 1U2HA 3MLZH 1N5YL 5CCKL 1HH9A 2FD6L 1HQ4B