4LZKA

Crystal structure of inclusion body protein (pixa pfam12306) from burkholderia cenocepacia j2315
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
159
Chain Sequence
SINLEKAAQSIQILAVIDTNYIKRSHPNPSLNAQNPTSIPSTALFMLNGHAPGVSSSEGNGNLGLKLNVGDKVSLMGTSLADNSGDAALIYHVQQYSGAQVFAPFTAVTIEQQVFQAFESVAKSAGSEYLATSFALYTRSQNRKSLFGYFFWVWQAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of inclusion body protein (PixA pfam12306) from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Unknown function
molecule keywords PixA inclusion body protein
total genus 36
structure length 159
sequence length 178
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12306 PixA Inclusion body protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lzkA00
4LZKA 4PIBA 4Q52A
chains in the Genus database with same CATH superfamily
3N5AA 4G83A 2G4GA 5I1DB 5CZVL 1JD7A 1SN2A 1X5KA 4MQXD 4L0YA 3BAJA 3HI1B 3BKCH 3BKYH 2A83B 2OL3B 1DLHB 4JFEB 1KC5L 3CDFA 3AY4A 1MUJB 2YMTA 2XN9D 5D96C 3FHEA 2WXJA 3U9PH 1HHGA 3ARDD 3KGUA 3HZVB 3RDJA 3DOSB 1MFAH 4C59B 5CD5D 1IGIL 1G7LA 1QLEB 3BHBB 4ZYKA 3U0PA 4OM1H 4KXZI 5EV7A 4XNYH 1YY9D 1OLZA 4BSVA 5ACLA 3HHSA 4YH6A 5FOJA 1K4CB 1Q4NX 2VLRB 4XNXH 1QAWA 2LU5A 4TOYH 1BGXH 1NIAA 1Y07A 4MAUL 2C26A 1P6FA 5A16B 3VA6A 1BGXL 5ENWA 4B9KC 3T9WA 5I23A 2ENYA 4PJAF 4LSDA 4F33B 3VM7A 1KTBA 2CO7B 3NZHL 1H3PL 5DA0B 4ELKA 1UTDA 2ID5A 1HXKA 4JJ5B 3O9WB 5HGGS 2QQLL 5JMOC 5C0BD 3GJFB 3K46A 3HS0A 4P5MA 3RNKB 2DH3A 5DO8A 4PY7B 5I71C 1MFAL 2JWYA 1LD9B 5KG9B 3TFKC 5IFAL 2RCSL 2BP8B 1RK0B 1Z0MA 5T1DL 4X4XB 1SEBB 1CBVL 1GZHA 1TTFA 5T3XD 3LD8B 1XGTA 4JZOA 4F7TB 4XN1A 5TE4H 4A6YH 3DX4A 3B6SB 1KPRB 1UCBL 4L48A 1CR9L 4MX7B 5ICXA 2NXYD 2W9EH 4M93B 1OCWH 3B8YA 2FO8A 4M02A 2OX5B 1YEIL 2BWDA 1S8DA 4NM8L 1P53A 2M2DA 1ZLEA 3TJPA 2ZF9A 5E8NB 4JRYE 2IDFA 4ZX6A 3VWJB 1BQLL 3OKKA 1YRKA 3LCYA 3EOTH 3LEVH 3NFPB 2GEEA 4GAYA 4WEBL 1SLXA 3B4NA 4R3SB 3THML 4B3EA 4IBSA 1CLYH 2WANA 1TYJA 2WPGA 3O6FB 4K94H 4K3DH 2VERN 3NACH 3V9FA 3MRBA 3Q5YA 3VGFA 1IO4C 1KXTA 3RA7H 1JWUA 4OVUA 4YZFE 3DURA 4B53A 4ZFOL 4F7MA 3QDJD 4YHIA 1A4AA 3ARGA 3NFNA 1MCSA 1T20B 1TMQA 4XCFL 3DOIA 3U46A 4PJCA 4RMVA 5A7BA 2DWEA 1ZK5A 2R23A 1OTUD 2WIIA 4X9HA 4I7ZC 2NMSA 3UO1H 4TQEH 1KLGA 3KEHA 3WNOA 3U0PB 3MJ8B 3MAWA 1B2WH 5KSAD 3WO4B 3ASNB 4F8NA 3HB3B 3CBJB 1U8JB 1G7JA 2VLRA 3TJEH 3UTSA 2I9TA 2IBBA 2CM5A 3M7FB 3DV4A 1FAKT 2P45B 4MA7H 2JCCE 1UOWA 1HKLH 5JR1H 3BZEA 1OAKL 1A64A 1L0PA 5ACMA 1IBYA 5FLUA 2VN4A 5LDSA 2FX9H 4L29B 2WVSA 4AYFB 3ZQXA 4KU1A 4N8CH 4HU8A 1TUPA 3CSBA 3H7LA 2E3VA 4G8EA 4I9WE 1FSKB 4DP7X 15C8H 4NUMA 5MENA 2YLKA 3W5NA 4FQIH 1LQSR 1L5GB 3TEYA 1NC2D 1XGTB 4PY8J 2WLNA 2IJ0C 1ZVSA 3DMMA 3VXSA 1BEYH 1OAYH 3BAEH 3OL2A 4G6AD 3ZE1B 3V4UH 1AY1L 4OKDA 5I0YA 2C9XA 1J8SA 2WNGA 2A9CA 5GIRA 5JLZB 3EZ8A 4RZCA 5E8DL 2OX5A 4XVJH 3N9GL 4KY1L 4YBLB 1T89C 4DK6A 3RWHA 1DBKH 2F19L 3EFDL 1K3ZA 1NOAA 4L37A 2V7HB 1YQVL 1ZVYA 4PJ8D 2V17H 2HFGL 4W9FC 3LPWA 1F2XK 1BA9A 5TQ2L 1J05B 2R56H 5BZDB 5LXGL 2PYEA 4KDTC 3QDMA 1J5DA 5IHUH 4Z3GA 5MERA 2LLNA 3HE6C 4Y1AA 3F6JA 2D3LA 4CN6A 4L8BB 3KPRA 5EIQA 1TZ8A 4NZ8A 5KS9A 3GSRA 1GY1A 5CBAA 2O5ZH 4J3UA 2JSFA 1WZAA 3ZZ1A 4ZO6A 2W1NA 2J8UA 4NDMB 1CFNA 1SVCP 1R3HB 3X12B 4HS3A 4OJCA 1A6PA 1KB9K 3OD3A 5KYYB 4J8RB 1QHPA 4Z7UB 5IQ9A 4UUJA 1KLGB 5TK2A 1HT6A 4GFTB 2FJHA 3PDGA 5FUCE 5ISZA 2MCG1 3QEQD 3N1FC 3DROB 4HBQA 4HWEL 4RAVA 3JWNH 4KK9C 2NYYC 3JYBA 3QQ4A 4IRZL 5LCVA 1UYWH 2CJSA 1S7TB 2CG9X 5H4YA 3FONB 5J4MA 4FMVA 5E51A 4GKOA 1ZRUA 1KBPA 3L17A 5FV2A 5C0FA 4Y16C 1JCVA 1NTDA 1OARH 2ZX6A 2ZUSA 3GNMH 3MRCB 1ZLVH 4LNRA 4WFGE 3TZVB 1MCWM 2QTVA 3ZHLA 5KBDA 1M7UA 4RSVA 2BSRA 3MUJA 3EDJA 3GBMH 4BZ2H 1FH5H 2RIKA 1A5FH 1H0DA 3SE4A 1GOHA 4B27A 1I3GL 1KCKA 1T7WA 3FO0L 3US1A 2YPLA 4ODUB 3S36H 3CTTA 5I0VA 3D39D 3TEZA 2ADFH 2NY5C 2I5YH 4ACPA 1OOAA 3HLAA 2EUZA 3GPEA 1U3HC 5AVYB 3TV8A 1FNGB 1B0IA 2Y6SD 5DA4A 4LPTA 1BYNA 4P4KA 3DIFA 1KNOA 1LK2B 4N20A 4NN5C 4EIUA 2AABL 1LJMA 4QRFA 1HH9B 3HZYA 2V5RA 4NP4L 4LLVB 4FNSA 1T7XA 4U1KA 3OKOB 2YD1A 1IAOA 3MYZA 4JHZA 5T1JA 5INDA 4PJIB 4KXBA 4O5LH 4X5PA 1BQKA 5K39A 1XGQA 5AB2A 5I16B 5MERB 5T5FH 3AREB 3F7YB 3ARDC 4ZUUA 4BELD 3DMMD 4NQEA 1O5PA 5C0ND 4PJHF 2SODB 4UNTA 4LBEA 5F89A 1WFTA 1QHOA 1HYSD 1UXLA 1QOKA 5EFIA 1RJYB 1Q9OA 2X12A 3PL6C 4KTDH 4QRBA 3S35X 2YD8A 4ICWA 4G8AC 4PY8I 1K2DB 1FLRL 1NZRA 4XN5A 4NB7A 3SQRA 1VCBC 4ZUTA 4JPIA 5C0AB 5FF6B 3VRIB 1CQYA 4CVXB 3RWJB 5ITBL 3V4VL 5C8JA 3UYRL 1BZQK 3LIUA 3VD0A 3ZKXB 1QRNA 2CMRL 3HB3C 2GJ6E 4X5XB 5HHOD 3VXUB 2EYRB 4YZWA 3T0EA 4GS7C 4W68A 4BZYA 3CIAA 2MNUA 4KO6A 5BS0E 3O2DH 4QRUB 4CW1B 5H94B 1HSBB 3S3PA 4RSYA 2CUAA 5BVPH 1KZYA 5IBTL 2WO3B 3PWPB 2O61A 1F3JA 5EBMB 4NZUL 2X6BA 2W07B 2NUTA 3FUEA 1USZA 5J13C 3QC6X 1KBBA 3FTGB 1URLA 3BC9A 3LDBB 3LNEA 1PLGL 5AYUH 2W0FB 1JHKH 1JXJA 1Y0LA 3NRPA 4OFKA 5FKPA 2ITCB 1G84A 4AVJA 5BVJB 3S2CA 5EZJA 1PF3A 4EMZA 4HUVB 2XICA 2ESVB 5C0NC 2X89D 3B1UA 3PGDB 2HVKB 5F7HA 5B39B 4GT0A 1RULH 5LNDA 3NIDF 5AL8A 3WIHA 5KVGH 4I4WB 2K6YA 2CDGA 3AG3B 4UT9A 4X6EB 2YD4A 4L2YA 1PQZA 4G8GA 3RZCA 3MRGB 2VH5H 1PKOA 3H2PA 3ZTNL 4K3GA 1GIGL 1YCSA 2Z8VC 1ZIAA 4P2RE 3D3VB 2V9UA 1T0OA 5IUSA 3SGJC 4CILA 3HBPA 1U8LB 2RJMA 2A9AA 3D7PA 2N7BA 4PB0L 4DTGL 4KZ0A 4OB5L 3RNQB 2VE6B 3FOMB 1LE9B 2P3YA 4OFIA 2OR9L 5E5UB 4FF9A 5BZWA 3C08H 1NGWA 5D7JC 4KMLB 2G4EA 3F8UB 2H0EA 3FFCE 3AABA 1BQSA 4NUQA 3NSFA 1JNHB 3GM0A 4TVPD 1U93A 1IVLA 5FYKH 3TA4D 2L3BA 3BSGA 5GS2D 1F4WL 1H5BC 3IS0X 5EBWB 1RQ5A 4HPOL 5D1XB 5IHBA 2SEBB 1RHFA 3SE9H 2F15A 1XSKA 5BZZA 4L4TA 2VO8A 3NP3A 4PJ8A 4ATWA 2MQ0A 4OAWA 1SY6H 2IF7A 2ROXA 2X4RB 3C8DA 3BEVA 4NUPA 4PLOB 3L16A 1EZLA 5FYLH 4WTQA 5EZIH 1GYAA 2HKFH 5CGYD 4P05A 4X6DF 3J27A 4BXSV 1MVUB 1NBZA 1JF1A 1E4XL 1XZ0B 4BK5A 1S7QB 3FL7A 3VFTA 3HPLA 4WHYG 5EOCJ 3IJEB 2CM6A 2WBWB 3QUHA 4Q0XH 1AP2B 1UD2A 1DSYA 4K7PX 2A73B 2CHDA 3N55A 4BRJA 3COOA 4FHKA 5HHOE 1NLDH 4Y4KA 3RDTC 5LHDA 1UZ8A 4U33A 3BZ4B 4Q9CA 4MA7L 3FF7A 1EBAA 4MD5A 1HL5A 4NQUA 5CWSA 5LGYA 3VWKD 1BZEA 3FUDA 3MJ9H 3MLVH 5DHDA 3S34H 4EO5A 1DUYB 2Y7SA 1VPOL 3G6AA 1T4WA 2KZBA 3BE1L 4OZ4B 4NIYE 4X6EA 4UM9D 4LEOB 2UUDH 4IRSB 3EGDA 2KHAA 1OL0A 1OB1B 4N2FA 5L2KA 2V9TA 4YDLB 1ZKAA 1ZTXL 1I8MA 1MJ8L 5EBLB 5L4IA 2K1MA 4ODXA 3FMGH 1EEQA 3GMNA 3EKCA 4ELME 3ULUL 1BBDH 2ZPKH 5DJXA 4HUKB 4N1HB 1AQHA 3CXFA 4LL9A 1D9KD 4HCRL 4KTYA 4D0DB 5L88L 3RHWF 2MCPL 4M3HA 3PGCB 4NO0A 1ZSHA 2DH2A 3DI3B 1ZTXE 4K94L 4HKXA 1XCQA 3WLWD 5DC2A 4PJFB 2HVBA 1W2KT 5HYJE 3EYSL 4XVSH 2WZ6A 1XBDA 2ZYHA 1KB5B 1QUPA 2XG5B 4ZUWA 4LVNB 3ESNA 3BDXA 1PLBA 3EGSA 4XPGH 1L9RA 3PY9A 2VDRH 4F7EA 3LQZA 5EZOH 4NQCA 1DQLH 4AYSA 2BVTA 2HKFL 1DANU 4O00A 2HXAA 2QSCH 1RUAL 2FT8A 3FQTB 3FSOA 1KYOK 5B38A 3EJRA 4KJPD 2F7RA 5CSBA 3V0GA 3QUZC 3BCFA 4TVSa 1VCAA 4OGXL 2IIJA 3EJPA 3HR5B 5IIEB 1NDGA 3KPPA 1WAPA 2DF3A 5CCHE 5I9QB 1NC4A 5J6GA 4XPFL 3NIGE 2PXYA 1GS6X 1OSZA 3ZOAA 3HMWH 2R0WL 1OSYA 1QQDB 3QUZD 3HPJA 4H2AA 3LN5B 2D7PA 5BZXA 4G7VL 1EEYA 4PLNC 4GRLC 2FO1A 3QQXA 1LM8V 3MLUL 3ZR5A 5E08H 5LG6A 4UBDD 4WNSA 2YGVA 3GMPA 4ZFZA 5FM5O 3T4AB 1C5CL 3KBFA 4IKIA 3LXUX 1N2RA 5FUZH 3OVUB 4Z5RB 4S0TD 4M00A 3HAEH 1QP1A 5C09D 4XBGA 3IMUA 4YFLI 5C3IA 3GBNH 1T2JA 1TVBA 1WVZA 1AXIB 4KRMB 3Q05A 4FLSA 3T8MA 3O6KH 1G87A 3FSVA 1I8KA 3AU0A 4J3XA 2Y2TA 4HISA 3STLB 1YNKH 5FYLE 3HE7D 5F3BB 4MD4A 3C5ZD 1I8MB 5CEZE 1SHMA 2VUOA 3ISWA 3V0VB 3QNYB 2N59A 1VFOA 4ZXBD 4UT7L 4ZFFA 4QKXB 5E6UB 2RH0A 5F2FA 3DUSA 2PYED 4ZFOB 4WU7B 2B59A 4BWTA 1ODAA 4HK0A 4ONHA 3ROOB 1I1RA 3HN3A 4C56B 2EVFA 1AO7A 2BMKA 3FRPB 1JRHH 4LRIC 2BOBA 2H0JA 4FLRA 5DJ8B 5ICZB 1ROCA 3V0WL 1IGFL 3N41F 3N85L 4OT1L 3PE9A 1XD1A 2GC4C 4PJ5D 1K6QL 1VA9A 3IDGA 4L9DA 5IVNA 3HMWL 3BVTA 3IGUA 1B0GB 4FN0A 4QNPE 5AB9A 2YAEA 3B9KA 3ZZSA 4P2CG 3IDXL 5KN5B 3T8VA 2J7LA 3M17A 5TE6L 5B39G 5J7CC 4J6RH 2IAND 4N6QA 3H9SA 2EAEA 2PO6B 3V4UL 4Z0BH 3QNFA 4ATTA 3CDCA 2JIXA 1T04A 1OPGL 3PPSA 4PRAA 1CZ8H 3QDGB 2QHRL 3OV6A 3V5DB 3VG9C 1E9OA 1OGSA 2G2NA 3WFHA 1QFWL 3VCLA 4AJWA 3WSQH 1A6AA 2YFNA 5D72H 5T3XL 3OAYH 1XBRA 2AQ3A 2GSIB 3L5XL 1OGTB 4JKPH 4BFOA 3MI6A 3MXVL 1XGZA 1TYEB 1E8WA 3QZBA 2D0FA 2Z4QA 4FNQA 4ZYKB 5D2NA 1DJGA 2ZYRA 1GOGA 4J1UB 2QKSA 1HXYA 1GC1C 4L9LA 4K9EH 3VFPB 3BYYA 2C7FA 4M5SA 4UZUA 3V4PB 1TSRA 3K2KA 3OB0K 4LLMA 3RUGE 1NCCL 4Z7WF 5I1KH 5C0EA 1I1YA 3QWRA 4BDVB 1AYRA 2HMID 1U91A 1IFGA 2B3RA 3LKNB 2EXSA 4N2GA 2CRYA 4X8XA 3C60C 3P40A 1EANA 3VXNA 4QJ5B 4J2XA 1LMIA 2NUPB 1A1OA 5T1KA 2J2ZB 3APDA 3BWUC 3MLZL 1X5LA 3P0VH 1NKGA 3Q8AA 4HJJL 2X0WA 4CNIA 1G6RA 4FKEA 4ZSOE 4O5LL 5CZKA 5IFHH 2B08A 2O5XL 2XBZA 4UU9A 2MNWA 2V9RA 4MX7A 2F53E 2WJ7A 4FOMA 5JW5A 2OJZL 1CLYL 5GGTA 1JWUB 5C0RH 2VSMB 4KGJA 1U8HB 1QG3A 2Z34A 2BOBB 2VDLH 3D09A 1MH5A 2XACC 5J6SA 1KJ3L 4I2XE 3O3AA 1G9NL 4I0KA 1YEDB 4PJDB 2R23B 3VXRD 2G3ZA 4G6KH 1WZLA 2APXA 4TNWF 4AYDC 2W9DH 3U82B 4ZX3A 2BSSB 3QFDA 4ISVB 2WXIA 3KLAB 1B4TA 3QO1A 5CINH 1E8ZA 3MV01 5DD5L 1XFPA 2WBJD 4O2EA 4XOEA 5DZOA 1ND0A 5T33H 1RUPL 4XN7A 2IVFC 4G6AC 2YEVB 3KYKL 1HXMB 1VKXB 1S78D 4WV1B 5IW6B 3D85D 4U1JB 4PCSA 1LWHA 4K2UL 5HHNA 4BINA 4UOZA 2HLEB 2CNYA 4AYFA 2WBJC 3ARFB 4JQXC 1C08A 2TSBA 4PJ5A 1WAAA 3H0TB 4QUOA 3T3MF 3VE0A 4AYBA 4JFXA 4JANA 2ZKHH 4LMQI 4TQHA 2KLTA 4Y7MA 1NBQA 1UWEH 1CU4H 3AWFA 3L3OB 4F8PA 4ZMLA 3IJYA 3D2TA 3TCXA 3QIWB 4XNYL 4KVPA 4FA6A 1O75A 4QEGA 4DAGH 2PP9A 2ZICA 3GHBL 1IGIH 1DSFL 1MI5E 4RIRA 3O6FC 4HSCX 3E3QC 4IU2B 1GHFH 4AVKA 2O5ZL 1TCRB 3I6KA 3IBOA 3OAWA 1I7UB 3BI9X 1INQB 4HETA 5FO7B 4OJYA 2XDHA 1B4JL 2H1LM 2K8MA 4PP2A 2XY2A 4L3EE 4IBWA 1MCWW 3QP3A 2WBXA 1DBBL 5D7IF 3S88L 1EJOL 2ICEC 2Q8BL 2ZSVA 5CCKL 3S8WA 2AJZB 3IAQA 3I3EA 4K8RD 5F9WC 3V6OE 1DN0A 2G0KA 1RH8A 3N0AA 4OLZL 2PWHA 2BOCA 1KGXA 4UAOC 3BXNA 4MCNA 3QUZA 4Y2NA 3O3AB 4DKFL 3I9PA 2IH8A 4W4OC 2FDBP 2ZXWB 3WEXA 5F9JB 5HDOA 2OJEB 4YDKH 2GQHA 5AAPA 4NQQA 5JUEH 2WCPA 5SX4H 4G7YH 3UGXA 2J88H 3VX1A 3TTYA 1ND0B 4L8BA 4DIXA 4Y5VC 5DMGC 2AKRA 3LNDA 3BMVA 4AQEA 3I50H 2Y36L 4HUXA 2GJRA 4V33A 2AANA 5E4IA 3F3HA 4UT6A 1YMHB 2WUCL 1OP5H 4PLKC 1FDLH 5EU6A 4XMTA 4BD4A 3QHZH 4IBUA 3QWOB 4HHWA 1NCCH 2OZNA 4Z7UA 1L9QA 2JJWA 1B3IA 5I1KL 1V3LA 1XH2A 3N43B 1E30A 3QS3A 4L3ED 4QRQB 1K8DA 4TF4A 3JSSA 1SOQA 3MYJA 4HXAH 3A3YB 5D5MF 1NGXB 4FHBD 3VFRB 4QR7A 3MA7B 1FLRH 1NBCA 1S46A 4P23C 4B96A 3IDJA 1J5OL 3LZPA 5C0FB 2AI0H 1P9MA 3GHEL 1Q0EA 3DMMC 4XN2A 5IROA 1A21A 3HMXA 2AV1B 2ARJQ 4RNRA 4DPCX 2B7DT 1TJIL 4Y4FC 4AGMA 4PJXB 2EYTA 4RCAA 3NDZE 4YDMA 1XH1A 1CXKA 5JUEL 4D8OA 3KWVA 3SKOA 5D5MA 4Z7OB 4WSKA 4JY6A 1CXIA 3BP7B 1AO7D 1QFWM 4U1MA 4S1DD 3SKJL 2PCXA 4G9FE 3IU4L 4GNKB 5D7JA 4UNIA 4LLDB 3SE8H 4KI1A 3UTPD 1UH4A 4ZUUB 2EILB 3HLAB 1BQLH 2PCYA 5EHFA 2AERT 4AEIL 3MVSA 3JQOB 1IRAY 4LARH 3HE7A 1QW9A 1DE4A 3VYNA 1MPAH 1NLBH 2Q8BH 3ZR6A 1CFTB 5KTEL 1OCWL 4UDUB 3HZYB 1AG0A 3SGDI 1N19A 4MAYB 2P4AB 4OLWH 4FXGA 1TTCA 4N3TA 4XVUC 2VLJA 1XXDC 1T0MB 3FH5A 3H9HB 1MJJB 2BNRE 4IHOA 4U7SA 5J9PB 2L0DA 4PJBE 4JDVB 2X6VA 5CR1A 1MCJA 1AC6A 4ZMYA 3OAZK 3HNTH 3GHBH 3ZMRA 1HH6B 1NAMB 3ULVC 5KVDH 4JN2A 5H94A 3AWEA 1WTGT 3OXSB 1KPRA 4QRAA 4HLZG 2DJ4A 4PRBA 3RWIA 4UINH 3NYKA 2G5UA 4FI7A 3O4OC 1T22A 2KZ1B 5JOFB 5ABDE 1UH2A 1VJSA 1KXHA 2YSTA 3VFGH 3IJ8A 5EORL 1X3DA 3DTUB 3DYPA 2UYLB 5E9AA 3EIFA 3EOBA 2E5EA 1KYAA 1A4CA 3OX8A 3ZL4L 1TO5A 5KVEE 4KXDA 2EXWD 5KJ4A 1X4ZA 2F1EA 3F6LA 2QQKH 4F3FB 1DLFH 1R24B 3QB7C 5EOQH 4JPWH 3S4SA 3VXUD 4BK5C 2VQ1B 3PGDA 3VFWB 2LAGB 5T33L 1C5DB 3TCTA 3SGJA 4R4BB 5H35B 4NM4H 3DI2B 1MI5B 4AW4A 1TOXA 5IKCA 5CHNB 1TLMA 2BHFA 2W9DL 3UBXB 2UZYB 5DVPA 2ZXEB 1LXMA 3MRMA 4R83A 3QDJB 2WINA 1TETL 4I1NB 5GRJL 4ZMXA 2MH4A 5GGUB 5BXFB 1ZAGA 1XR9A 5IHHA 2Y2WA 5F6HI 2ENPA 1QI5A 3RZCC 4PVMA 1HN1A 3L2LA 3Q7JA 2YGNA 2ESVA 4OQ1A 3ALXA 1X6NA 2VE6A 1AY1H 1LO0H 2ICWI 5LUMA 3KBHE 3RVVD 3QR0A 2I60H 4X6DB 2B1AH 3QJOA 5DRXB 3RFRA 1S5IH 1YEHL 4AMKH 4JGMA 3WS6C 4DEPC 3MLRL 2NZIA 2WB7A 4PJ7F 2VM9A 3MRGA 5SWSE 1JP5A 5FHBH 5A40E 2B14A 1YEJL 5J9PA 1U6AL 1BFOA 3BHBA 1A6TB 2C9RA 2IANA 4QRPB 3D3VE 3PF2A 4XO3A 5C9JA 2MHAA 3FCUB 4NUGL 4UDTA 5FFGA 5DD3L 1URZA 2A9BA 3V6BR 3WHXB 2VDOH 1ZVSB 5DGQA 1BHGA 1NUFA 3PWVA 3PXHA 3ZSSA 1OF0A 4FXKA 2UXFA 2OW7A 2CKBB 3T6QC 3KDPB 2PYEE 4YJZL 4YR6A 5F0JB 1P7QD 4HX1A 3SJVD 2VDOL 1B2WL 1AHWB 2R2EB 1YEEH 2VDKB 1U93B 3GJFA 3Q9PA 3FHQA 4Y1AE 1MQ8A 3QXAB 3VJ6B 4DP5X 2V7HA 3ZDYE 5I5RA 4MB3A 1R3LA 4BWUA 3L5XH 4JQIA 3TT1L 1QMUA 1W0VB 4JM0A 4ZAKC 4X8CA 4JFHD 5I74C 4XOCA 2J4WL 1C5BL 1PZUB 5EDXA 1MFNA 5EZIL 1VZGA 2A6IA 5DRZA 3VFWA 1M7IB 5TF1L 3VD3A 3L3DB 3WTYA 3NACL 3ULVL 1C7SA 3LKOB 4XBMA 2ADGA 3O9WD 2XVKA 3C6LC 1B3JA 4KHXH 4NPKA 5DEJA 4GYBA 3UBXI 5E8NA 1N7ML 1XMWA 1YPZE 5IG7A 3LNHA 3CLFL 3V5HA 5L2JB 2Y7QA 4YXHL 1HQ4B 1I85A 2ZOKB 1VFAA 2OSLA 3DO7A 1KGIA 3Q6GH 4KXAA 4LSSL 4PRDB 4YBQD 3KXFB 1M7DA 1YYML 3DROA 4RAVB 1I4FA 1JRHL 3SBWC 4Y5VA 4CMMB 1JNNH 2LTQB 2N4IA 1MHPH 3EDEA 4V11A 5DJXB 2A6JA 5GZOA 4JVWA 5E6RB 2E9WA 3VXMA 4LLAA 3GRWH 1NUDA 2ZCKL 1DVFD 4D0BB 2QQKL 4HKXB 3O3DB 3VWKB 5IP4A 3G6JF 1E9QB 1JDAA 3TLRA 3ME0B 3POCA 3AG4B 4NKMB 5DQ9B 3ZL1A 4DOHB 2XG4B 3QUYA 3A4EA 5T1LD 2IQAA 2BSRB 4IMKC 3KEDA 2JK5A 2R29A 1PCXA 3VU2A 3VFGL 4PJDF 4K23L 3NZHH 3IF1A 5E9DE 1HEZB 1HINL 3BKMH 5BMFH 2BSTB 1WICA 2ITDA 1L9PA 2DQHH 4MJ6B 3RI5K 4OLXL 2BY1A 1EAJA 1HOEA 3B7UX 1OGAA 3LOWA 5DRNB 4AVHA 4DQOH 4MS8D 4FHJA 1YVLA 4M7KL 5FW6A 2V2WB 2JQZA 5TDOA 3AAZB 1RZ8B 5CEZD 1PAMA 3D5OF 4ZMTA 5I8CA 2AMGA 3IXAB 1X7SA 2D31A 4MB4A 2ZUYA 2YPKA 3H85A 4JO8A 3TVMB 3W5MA 1UOKA 5GS1A 3PDOA 5AYUL 3M86A 4PGDA 4AL8H 1EUUA 3GHPA 3KM2A 4XC1H 4O58H 2WQSA 3RVWC 1PY9A 3BKCL 4QXVA 1KB3A 7TAAA 2X4SA 1XEDA 4U0QB 1QKZL 3S35H 3NH7H 2ODHA 3B2XA 3QHTC 5F6IB 1MJUH 5I15H 4EI5D 2G5BB 4DERA 1EXHA 4H8PA 3JWNC 4YHLL 1U36A 4NZDA 4PRHB 3E3QE 4AYMC 3ARED 3DX9B 4OW6A 5BV7B 2L7EA 3WKML 5A2IH 5E8EB 2H3NA 4LHUA 4GKZA 3LMJH 4I88A 4R7DA 4HGWB 1BM3L 3CPUA 1W0WB 5E2UL 5AEAA 2BH0A 3UTSD 4WWKC 1NFIA 2EDOA 2JCCB 5IB4B 5KUKA 5F7FA 4MXQC 4C4KO 4EDXA 4EZJA 3MLTB 3MGTA 2V5YA 2F8IA 1UACL 2D9QB 3P0VL 3FO9B 5L0QC 5F70A 4XC3H 2VXTH 4ZMZA 2XWXA 3OHXC 1GZHC 4AMWA 2EQDA 1YDPA 1PJWA 3O81A 3CZLA 1Y1DA 1KG0A 2YPVA 5L7XL 4H8WC 3OKKB 2VABA 3DUHA 4W9DC 4KMQA 4MD4B 4ONOA 2W65A 2MKLC 4U1GB 5DXWA 4JW3A 2I9LA 4AE0A 3MV7D 4OQTL 3RVXD 2OMWA 4AUUA 1NGQL 3EYUH 3O6FA 1VPOH 4KVCL 2B1HH 4UBDC 1HEZA 1RAMA 3PWPD 3CMOL 2OR7A 4Y4KC 2C9QA 3FTGA 2Z35B 4LDOB 5C92A 4IMLA 3LZQA 4ONHB 2VQ4A 4FADA 1P84K 2HFEA 4UTAL 3X1BA 2UWEA 5HDQH 4R2GB 1B6DA 1Q72L 4KXZH 1RZ8A 4HH8A 4A37A 1LO5B 2OYPA 5IJKC 3LVTA 4JFSA 4GLRH 4N8VG 2XUWA 1FNEB 2ERJC 1KTKE 2D7QA 3KW7A 4FXTA 2HZHA 3TVMA 5JHDB 1XIWB 2ZUTA 3D08A 1SF3A 4FG4A 4ZOAA 5HBBA 4KHTH 4GW1A 3HRZC 3HVNA 4HJTA 3AADB 4J8QA 1CGXA 1R5WA 1ZT7A 4M9PA 1NGPL 2AC0A 1T04B 4TQ8A 1GYUA 4QTHA 3ZKNC 3WLBB 2VNCA 1IEHA 3QWRD 4FJZA 2A74A 2OR8A 5AVTB 5IEHA 2MRYA 3HC2A 1OAQH 2BP3A 2R1XB 3K7UA 4JGNA 1ZEAL 2R2HA 4HOZA 4DGIH 3BAWA 2QVTA 1CYWA 2Q3AA 1M56B 5E8EA 1OGTA 2YXWA 1HL9A 1XWVA 4I2XB 4JUTA 1OT2A 3U36A 1DZ0A 2IADA 1MLBA 4NJAL 2BJMH 5BS0B 3MROB 4L1LA 3KL5A 3NRQA 3HC3H 4KI5D 3CX5J 1CCZA 1J1OH 1HI6A 1F4HA 3QRBA 4HWEH 2NY6C 4AIZB 4POUB 2V6HA 1IAIH 3MGTB 5IGXH 4JG1H 5ERWB 4FI6A 2ATKB 2XN9B 5BW7C 2QPUA 4D9QE 1RUKH 4J2QA 4UM8B 4JR9H 2CBQA 1U8HA 2FB4H 3D0LA 3T65A 1S9VA 4JDEA 4EI5A 1F45A 1Z32X 2N0MA 4HFUL 1RPUA 5HI4D 2CDEB 4F15B 3CD4A 4LGSB 3ZTNH 3WIAA 5HP5A 4XZUB 2VJXA 1X9RA 3SB3A 4UTAA 1TVHA 4LOUC 5GRVL 2W65B 3E0GA 3BGFB 4O02B 5FUZL 4J7RA 2BSSA 3FFCD 4QHMA 4EVNB 3RFZA 1A4JB 5KVFE 2E7DA 3DXAE 4Y1AB 1HHHA 2ZWKA 2Z35A 1MFUA 2W94A 1SDDA 3QCUH 2VXQL 3RURA 3LZFL 1QSEE 3B9AA 1J10A 1OALA 3E2HB 5JPNC 1YQVH 3TEWA 1NIEA 4LMQE 5DUML 3IFNL 2HMIC 3MODH 1N4XL 4M93C 2X6UA 4N0RA 3UZEA 5A2LH 5GS0C 1UC6A 4PWHA 3KYNB 5E2JA 3P77B 5LBGA 4Y4HA 2B8OT 3UIYA 5C0GA 3LZRA 2VC2H 4HD9A 5LBVA 4XWGH 2FECI 2P52A 4LLQB 4BGDA 3EJQA 4FQCH 3WNLA 1AXSB 3L5HA 4HJ0D 1AYOA 3X1NA 1IC7H 4D3CH 4A67A 2DM7A 2XY1A 2BINA 3NVQA 5IROD 4I89A 2CBPA 1M05A 2DAVA 3RVWD 2CPCA 1R5VA 3GI9L 3C60D 5EZPA 2ARJB 3LXCA 1NJ9A 2EDXA 2YLHA 4K8RC 1TJHL 3C5JA 2FX9L 2IV9A 2XWEA 3I6LE 2VLKD 3VM5A 3QYMA 4JUSA 4PGJA 2RGSA 3SDDB 1VGEL 4FS0A 1GMEA 4UTAH 2W80C 1A1NA 2GTZB 3QCVH 4C4BA 1TKWA 4LK4A 4MJ5B 5FO7A 1UJ3A 3BSZH 3MCYA 3Q0HA 2P8LA 4QO1B 1AR1B 5HHVH 2YEZB 2WIMA 3ELAT 4APXB 4PJCF 3EHBC 5GZNC 5TTRA 1M1XB 4FNRA 4E9YA 1U8NB 4PH8A 3RY4A 5E8OB 4Y4FA 3AZUA 4Z23A 2W0PA 2ESVD 1DN0B 1C9SA 1AXTH 3GPSA 3QAZB 4GW5B 4BQCA 3APMA 4LEBA 5JXAL 35C8L 1GPOH 1LP9A 3BVVA 4AWJC 5MHSD 4G72B 3LKSA 3RVTC 1ZGLM 2IH9A 1AVAA 1UVQA 3DJTA 4JM4L 5DUBB 5DD6B 3DX8A 3RL1A 3U4AA 5D70L 2VZ1A 1T83C 2R7EB 5DFWH 4YX2L 1IBFA 3OQ3B 1DLHA 2CQVA 3CVDA 2OI9B 4KFMA 4U6YA 4Z7WA 5DS8A 3VI3A 4JKWA 5BQDA 4HOWA 3LJ3A 3U30B 3BP6B 4EQ3A 1Y6NR 1H15B 1Z3RA 5AQ0A 4X7EC 4POYA 2O72A 4RFEB 5MENE 3A4FA 1PCSA 2HT2D 4GT7A 1EZSA 1OD7A 3QNXB 4FAAB 4N5ED 3DPBA 3KCWA 4BSVB 1NFDE 1RJYA 1IC4L 3T2NL 2X4RA 1MFMA 1QVOB 1QYGL 4JFTA 4YE0A 4YBLC 5DEZA 4TM9A 3LQMA 3QUMA 4XI5D 5K1JA 3UYOD 4YXLH 3N1MC 1RFDL 3MACH 1J9TA 4X5WA 2Y72A 3EYFB 4JFOA 5C0DA 5FEBA 1J8HE 3VGBA 3U1QA 3KWXA 1JZHA 4YFLF 3WJLA 2YMXL 5DD0L 3NIDB 1RK0A 4OCYL 3UCRA 1SEBA 1I7RA 4X50A 5GGRB 1T5KA 4NJ9H 5E2VL 1J9QA 4FYQA 4J3SA 4XXCA 1BREA 3JZYA 4FQXD 1H3XA 5KANG 3CX5K 3ISYA 4WGVB 3MC0A 3SN6N 1UM6H 2WNXA 4N2IA 2Z31B 4KDWA 2DN7A 5C0CA 2COQA 1CTNA 1W9XA 5AB1A 3U4KA 2Q7NA 2JQAA 1HHJA 4PM1A 3RQ3A 2GW5A 2Z8RA 5L2KB 3OTTA 2GK2A 1QPPA 3CFDA 3T3PF 1RZIB 4WFGD 5IBUG 3UADA 1Y0LB 4GIOA 1J7VR 1AD9A 1FG2B 3RWCA 4I18B 2DYPA 2OSWA 3NZ8B 1KC5H 1TJGH 2HVKA 1WGVA 2FGWL 4P57B 1UM6L 5IV2B 3I2CH 4I4WA 2JB5L 4WNQB 4NQDB 5LXGH 2XHNA 2VLJB 3TV3H 1KB5A 2YPVL 1XGYL 3GT6A 3H9HA 3UACA 2JTYA 3NCYS 2WD0A 2J5WA 4MSWA 2ADJA 3H3PH 4LQ1A 1NANI 2JB6B 4JFYB 2R29H 4WEUD 4KBPA 1ZGLP 2LW3A 3AG1B 3ZTJH 1FFPA 3D52A 3FUKA 3CFJB 3B7RL 4OGYH 3F12B 3DV4B 4MQ7B 4PTUA 4KHTL 1MFVA 2P43B 1XX9C 4JHWH 3EXJA 3V79C 2WQAA 4JHVA 1SVZA 5F6HJ 4I48B 4TNVF 1JBJA 4X6CE 4CSZA 4PJIF 1MJ7H 1JWSB 3FB8B 3IDIA 3MCKA 1U3YA 4YWGL 2AQ1A 1WRFA 4MZIA 3SKNB 2JH2A 2RQ8A 5C08B 4MHHG 4WJ5B 1SXSA 3WGVB 1DEDA 4F2FA 1FFQA 3BQUC 1HNFA 2IO5A 4AV5A 5KYWB 5D1ZI 5E94B 1JDDA 1JI2A 4XB7A 2WV3A 3IN0A 1PIGA 4YSAA 1SMDA 2H8PB 3X1FA 2FT7A 4NX0A 4OLUL 5JOFA 3T8XB 3TBSA 4GG6B 1GCFA 1CD9B 1JPSL 1XZ0A 5H37H 3P4OA 4QT5B 4ZMOA 4N6RB 1C8PA 4FLOA 5EU3A 4L3EB 1NOLA 1YEKL 3VI3F 3V7AE 2VL4A 4IJTA 4X8JB 4PPTA 1E7VA 4G9FB 1S5HB 3QR2A 2EC9U 3UMTA 3L1OL 3KLAA 4I85A 4YSDA 2DYPB 5FO2A 3UROR 3ROOA 3EOYG 3NSJA 2CCVA 4U05A 1KN2H 3GJEA 2DLFL 4XPTH 4NP4H 5GJSL 2ODIA 1N10A 1VGEH 2O30A 4U1JA 1NAKH 4ANKA 4M5ZH 5MHSE 4P3CL 1OP4A 1T7YA 1R34A 4ZBJA 4L3FA 4I1RA 5I1LB 3B3BA 1RZJC 4YHOH 2AHIA 3HBQA 3T4YB 3QG7L 3PQYA 1RHHB 4IU3B 4KJYB 4HEPA 3PIQB 2Y5TA 1OQOA 3SYAA 3LRSA 4IK6A 2J55A 2P5EB 1YUHA 4JANB 1WGOA 5F1NA 1MJUL 2AK4A 4JHWL 4ZDHA 2FNBA 2QV2A 2ILLA 4P2AA 4Y8AA 1E5AA 5F7DB 4BCZA 1U58B 1BZOA 4RMSA 3BQUB 4PI2A 3V4LA 3O6MH 4TUOB 3CFUA 4A55A 3H8NA 3S9DB 2RCSH 3K6NA 2LTQC 4B9GA 2IPKB 1DFBL 3PWLB 1TCRA 2IWKA 3FN9A 4CVZA 3IMWA 3VG0H 1ITBB 1UEMA 4FQQA 4H1LB 3SKNA 4LSUL 4N85A 1E50A 1KLFA 2JCCF 4H5SA 4M7KH 5C08A 1QBBA 1H0DB 1H3PH 3TV3L 1KIUB 4NQSB 5FYKL 3FQWA 3DX7A 1IM3D 3MV9B 4MHHI 1ACXA 3GGWA 4DP8X 1K8IB 2Q8AL 3WS3B 1PDKA 4L1HA 2AJZA 1AZUA 4F37K 1I3RA 3HW7A 2VSDA 3VI4B 2EIJB 4F20A 4OFQA 1E3XA 3NJNA 1ZV9A 3FU8A 1LDPL 2ED9A 3HNTL 1FPTH 4QXWA 5D1QE 1MKFA 2Q86A 3PYCA 3VNZA 1A7QH 5I28A 1A1OB 3WEXB 2A9DA 5L4JA 4WW1A 3TEUA 3BWAB 3LSOA 2ZCKH 5DC0A 3UJIL 4XTRC 2D03H 5HDBB 5I76B 3BJ91 1FORL 2BP0A 4YGAB 1S9KC 4FABL 5GS1C 1FL6A 2BVOB 4XE5B 3VXMD 1J0HA 2O4EA 2AS5M 4ELMA 4XODA 1WQVT 2K3TA 2VDLB 3PREA 3OAZH 2NY0D 3QIBB 1A7RL 5D2LF 4P4RA 3RTQB 3ZUCA 5JPMB 3WJMB 4I9WD 1E67A 3EJUA 4AEIH 1X7QB 4NHUB 3IU3B 1BOGA 4JPKH 3AU1A 3SOBH 1K2DA 1OP5K 3T4YA 1NWPA 3JWDH 2Y1VA 2ZWYA 4U6TA 2WP3T 4JPIB 3CZFB 1ES0A 5KSBB 2ED7A 2YGQA 1D9KA 2OMUB 4KKBC 1NGPH 4QRQA 4RDBA 2H9GA 4CVXA 4P3DA 1RLBA 4X7FC 4ZS6D 4P99A 3G5XB 4TQIA 5F1NB 4NKOA 2XWJB 3EXLA 2J43A 4J3OG 1VKXA 5IBTH 4S2SB 4NUJB 4JFED 1CL7L 4DGVH 5IMMA 3MTRA 1M2VA 1FAIL 3TESA 4HSQA 4C58B 15C8L 3MNWA 3QI9A 3WMPA 1AZCA 2DIBA 1SYSB 1U8OB 3VXRB 5B1BB 1BF8A 2QDWA 5C0AD 3VQLA 3ZDYF 4NKMA 1DJXA 2FSDA 2YPKB 1TENA 3K2UL 2Q7YB 1DCEA 3D9AL 3PWPA 2KLRA 4OCWH 4OIFA 2EKSA 4ZO8A 4O4YL 4B0MM 3WAJA 4M9OA 1SM3L 2X5PA 2J5LC 2DJUA 2JLPA 3HFML 5KVEH 1KTDA 3AC0A 4OU3A 1CLOL 5D96B 2B1HL 5D5MB 1AACA 1BXXA 4PI0A 2FIKB 4CRPA 4LCWD 1HHKA 1N5AA 4XMKL 1SJEB 5DD1L 1ZA6B 5F0PB 5HGDA 3DTDA 3VCLB 2M1KA 4PJGF 4ZFGH 3LB6D 1WZKA 4E9TA 2NY3C 1J9RA 3ETBJ 3DX9A 1A8JH 2NW2A 4Y5YA 5I1JL 5TGBB 3QBTB 2ZXBA 4AK1A 5LXVA 3L4ZA 5A6IA 5HHQA 2RFXB 2W0KA 5CJOH 4YLQT 3L4TA 3MCG1 5D7EA 2NCMA 4PJHA 3PHOB 2CR6A 4I3GA 3BSHA 2XBTA 3GLZA 2QTEA 3IKCB 3KL0A 3S98A 1HX0A 1CG9A 4FFZA 1XT5A 5FYLD 5BRQA 5E5MB 2GJ6B 2QV4A 2ICWB 4XP5H 3OSKA 5F9OH 1LE9A 3ULSB 1CQKA 4YHLH 4HIJA 2BDNH 5D6CA 4NLAA 1X44A 1EEZA 3VI4E 4D3CL 5IESL 3S36L 1ADQH 1CN4A 4N0CD 1A5FL 1B4JH 2HJKA 1XB6A 3F7KA 2EXWC 1NC2B 3SDXB 4ZTOL 2AP2A 2ZOOA 1YJDC 1WA0X 2R1YA 5DZAA 1B90A 2UWEB 1XSJA 4DK3A 4LOVA 3DGGB 1X6LA 2G5RA 5ANMA 4YK4C 1QBLH 2C9PA 3VXRA 4HG4J 1L9OA 4MDJB 1I9IH 1HKFA 4WK2B 4RMWA 1IBDA 5MEQB 3MRFA 2PMZA 4OZHB 1VGKA 5FXCH 1I9RH 1XF1A 5H35A 2A77H 5ISZD 3FKUS 4DGUA 3PWUB 2XFXB 3I6SA 5DR5H 2X89A 4WUUA 1WISA 4FX5A 4TOYL 1R3IL 3W9EA 2P5PA 2JI3A 4NNPH 3DHUA 3KPTA 4K7FA 3IDMB 3F5WA 1SOSA 2NSMA 2FBRA 4CSTA 4CJ1A 3PG2A 5CEYA 4AKPA 4B9PA 3CDZB 2F74B 1XCWA 3C5ZB 2IFFL 5IB5B 2NW2B 5KBNC 4AXWA 1MCPL 3ZHNA 1MFEH 1B2YA 1KT2B 4W9IC 2L7QA 4BGLA 1J1OL 4PJEF 1ZLUH 4MA3A 4P5SA 2J6EA 4OLEA 2IAMA 2BNQD 3GDCA 4O9HH 5GSVB 4P46B 5JIHA 3TVMD 2DQDL 2AQQA 4HIIA 1A9EA 4FG6D 5KS9F 1CVSC 1ZT7B 1IL1A 3D2UA 4FG0A 4UT6L 2HH0L 4URTB 5IB2B 1BFOB 4M7LL 4G8FB 3LRGA 3OPZL 2EE0A 2NQDA 4UDTB 3Q2CA 4AY0A 2ZXQA 1I7ZA 4O2FB 5IQ7H 3WNMA 2PTUA 3W0WB 5J3HC 5FDWB 4JO3L 2VITB 3WNKA 3BX7C 2AXGA 3IJHB 4PG9A 2LGNA 4PGBA 4I2XA 4BFJA 1DJZA 1IILE 2O5XH 4ETQB 5D6CB 2H32H 4H8WH 2DDQL 4IW4C 5AAMA 1XD0A 1JE6A 1FNSH 5B3NA 4OLYL 3N50A 4Z7UE 4GBXC 4AIZA 4CBPA 1N8ZA 3GSXA 1KV7A 4GI6A 2P1YA 2WLJA 2XN9A 3E8UL 4PS7A 1HH6A 1NAMA 5A2CA 1U3NA 3GSOB 5CSZB 1MG2C 1WDAA 1ACCA 3I9GH 3NA9L 5CJQH 5F9AC 3RU8L 2VKWA 1HCVA 2FGZA 3QFGA 4HS8H 4LOEA 2FWOA 1T0NB 1MCDA 1FL5B 4UV7H 3ASWA 4U6HB 1CLOH 4XWOC 2MPAH 3QXUA 1AD0B 4O02H 4XO8A 3II3A 2VLMD 3LRHA 2VN6A 1NC4B 4WAFA 1D5XB 1E27B 4WU5A 3BDYH 5L2JA 3VUAA 3ILPB 1M05B 4M3KB 4M5TA 4PS3A 1OP3H 4M1CC 2V0AA 3FQNA 4YWGH 3RLSA 4F3FA 3L08A 3G3LA 2R0ZH 1GRWA 3C5JB 1W72H 1J0KA 2VDKL 4P2RA 3E8VA 3P4MB 1DDHB 5IB1A 3GMPB 1YNTA 4ZFZB 2F54D 4WI0A 1NSNL 5J6HA 2H32A 4Y4HB 4G7YL 5EB9A 3T0EC 1OPGH 1HILA 2I60L 4M8UA 3RA7L 1TLKA 5T5NF 5IB3A 2B77A 3UBXA 4U1NB 5AW2B 1KIPB 2MIZA 4PG2A 4MBRA 3D69A 4M8QA 2WVTA 3MLSH 5J89A 3CFCL 4YPJA 1BIIA 4H7VA 1R5VB 3FCBA 3D2UD 5DRWA 4AITA 3V7AG 5J3HD 2GCYB 1G7MA 4Y2OA 2QFRA 3TPUA 3ZDXF 4HV8A 3V0WH 1SYVA 2J6EL 4WU7A 1BZDA 4PG9B 4DVBB 2WY3B 5CEXB 4Q9RL 3QQ3B 5I1GH 4IRJC 2HTKC 5EN2A 4RGND 2XYCA 4CA4A 1XF4A 1Y6KR 4W9CC 5ICZA 5F7YC 2DWDB 3O2VH 3SDXF 3ZN6A 5HGBB 3SDDD 4NZFA 4Q97A 2DQCH 5IMLA 3LKQA 4UT9H 2D4DA 4Z7WB 1D7CA 2F5BH 2ZUXA 4JFDB 3FUIA 1UWGL 3HUJE 4LLDA 3APNA 2A4ZA 5E1QA 1IEAA 5LQBL 2RTTA 3WY1A 2QBWA 3PDOB 2DQTH 4QHLB 4RFNB 4W9KC 3D4CA 5JIQA 1SXNA 2YOAA 4GUOA 3LZNA 4KWUA 4S1SL 5IVZB 2ZF8A 4Q2ZB 4R7NA 4WEMB 4YE4L 4K07A 2A6KA 1QNZL 3AREC 5CILL 3R0NA 5DURB 2HX9A 1MCKA 3GLDA 3KPOA 1DL7L 2J25A 4AIOA 1MRFL 4YDIH 1E6OH 3F7VA 2AQTA 5ITFB 3Q1SH 3EYFA 1CE1L 3ARWA 4XBPB 2R0WH 5LQBH 4GW4A 1S78C 1R19A 1QWUA 2LABA 4I0PC 3PAYA 5AW6B 2Z4QB 4RDQG 5JIIA 3MR9B 2W95A 1OM3L 3UAAA 3T77A 3OM3B 1TEYA 5K9KA 4ZNEE 1BW8A 3U6RA 2A6IB 3GJFK 2QKIB 4EUPH 1QVOA 1OVZA 1P7QB 3SJVB 3DK0A 4OLWL 5CZVH 1HILB 2BHUA 1F5WA 2ZYSA 4NNXB 1DQLL 2FT6A 2NXZB 3P2BA 5BO1L 3OJMB 4U3CA 3VD2A 2WJ5A 2Y9RT 3CK0H 4TRPH 1G9NH 5AOLA 3V6OC 1CDHA 3C6LB 1CICA 2G3MA 3ETBF 3FPXA 4FQ1L 2YWZA 3QZWG 1E40A 5JDSA 3OKDA 3PHQB 4J3TA 1RZIA 3DKHA 4PRPA 2NY1D 1M7DB 4WWOA 4Y4KD 5DRWB 1Z9SA 3MFGB 3QPXL 2WXOA 2GB2A 2P28B 3CGTA 4HUMB 4EIBA 3RUGA 2Y5EA 1J9SA 4X6FA 4JL1A 5K9OB 2ED6A 1ILUA 1I85C 3EYOB 4XAKE 4OUOA 4MJ4A 1C5DA 2OTWA 4R5TA 4Y1TA 1JCKA 1G43A 2LLGA 2UZIL 4D0BA 4ORGB 4W4OA 5JHLA 3IXTB 2BW4A 4C4UA 3GMQB 5MEOB 1H8NA 4QOKA 5IMLB 5KVFH 3SKMB 3ARRA 3D3VD 2NTSP 3MRMB 1HDMB 5I1JH 5EF1A 3VI3E 4YHNB 1YEKH 1KEGL 2HKAA 3KPSD 3E6FB 4MSWB 4PJGE 1N64H 2X4TB 5GGUA 5BXFA 1ZPLA 4R26H 4HLZH 3RYMA 4OLUH 4RAUB 1EDQA 5I6LA 3DUUB 9PCYA 4IBYA 3WIFA 3T1FA 1ORSA 3TYFA 3HHSB 4XMXA 5DJ2A 3VFNB 3HAEA 4LSTH 1EA9C 2HN7B 6TAAA 5IV2A 3FH8A 3WEMA 4Y5XC 2YC1B 2OPCA 3QC5X 4BFEA 4GQRA 3SPJA 4PGCA 3CFKA 1NFKA 2VN7A 2XTJE 4WFHE 2QR0B 3W57A 1E90A 3UZVA 1WBZB 3O3UN 1ZT1A 5DWUL 1FAIH 2JB6A 4JFYA 3CFNA 1YNLH 4JFXB 1CLZL 3ZKMC 1UWFA 3ZUNC 1WHOA 4AI7A 4JG0L 2APVA 3PWVB 1OWRM 4M62L 1H5BB 1S7XB 4O51B 1C1EL 4MD0B 1QACA 1FSKC 1WCBA 2X4QA 3IKKA 4OCRH 4X42A 1SY6L 4XWGL 3VI4F 4KRPD 1O9VA 1G9MC 2WLIB 4PJFF 3JWOL 4QXGH 5GRVK 6PAZA 1SHXA 1Q90A 2GI0A 2R29L 5DT1L 4JEGB 2J56A 3TBSB 4N6RA 4F2MB 2KZWA 3WE6A 3ZYZA 4CKVX 4GKNB 1GJIA 4PCTA 4OF6A 4LPCA 2V2TA 3RGVC 4Y0GA 2M83A 2GTQA 1FZOA 3OLIA 4PJEB 3RX5A 4OJFL 4MXWH 3ZRSA 5AZUA 1E5UI 3V4VB 2X88A 5I8EB 3X1GA 4LKCB 5H8DA 3P4LA 2E4TA 4AGPA 4QF1A 5DHYA 2FLMA 3QEHB 4HPHA 2HTKD 1X9LA 4M56A 2DB8A 4R96B 2YBRB 3CU7A 4JRXA 3P4OB 3REWA 3I9AA 4I8DA 3WFZA 3KYNA 4N90E 5I1LA 4XAWL 1NQBA 3EBGA 3AT8A 3DRTA 1JZ8A 1O7DE 4KAQH 1S7UB 1INEH 2NLJB 2FO4B 2X4NB 1KBVA 1NEZA 3F04A 4RZKA 4S1QL 3VW3L 4PRDA 3DGCR 2WOYA 1ZHKA 3CVHL 4BSWA 3MV8E 3HC3L 4GQPH 5DO2D 1GMIA 1JUFA 2BNUA 2EEAA 3TC9A 1QFPA 4M3JA 1EHXA 4A68A 1AS8A 1QBLL 3CFQA 3Q9QA 2DJSA 3A47A 3G5VA 3EUUA 1MF2H 3TONA 2VXQA 3RG1C 4E0RA 2RR3A 2JKNA 2P80A 1GJWA 1ZT1B 3QARA 2H5UA 2ZCHL 4A2DA 1PX4A 4N9GB 3ZDYB 1JOIA 1NGXA 4OD3L 4LNVA 2NW3A 3J7HA 4N86A 4NERA 3WNPA 5CKAA 5E6IC 3MX0B 3WFBH 1N6QL 2PABA 1I1AB 4P4KC 4R2GD 3P54A 1T21B 5GIRB 1AQDB 2KQMA 2QKIC 4PGEB 4RMBA 1X5JA 1P4LB 4XPGL 4XP5L 1TJMA 4N3UA 4OD1L 4MMXC 2LU7A 5AOMA 1XGUB 1JZ3A 1IKNA 3AMKA 5BRZE 4L8SB 1IAKB 5FW7A 3SE8L 3TEXA 5AKSA 2P46B 4CVZB 1AMYA 4JRYA 1Z9LA 4TSCL 2VC2B 1P2CB 1H6FA 2DLFH 1QFOA 3BVXA 3V4VH 4LP8A 1RVFL 1QR1A 4QWWD 5JZ7D 4ZMNA 3BP7A 4QKTA 4U1HA 4PVLA 1PZCA 3NJMA 4GAAA 2PO6D 3ESMA 1YEWA 1D5IH 1G7IA 1HHGB 2ZKXA 3CG8A 1UM4H 1V55B 4XX5A 3WHE0 1IM3B 1BZ7B 4N0FA 4PVNA 3SDXE 3RTQA 5KEZA 4N22A 3VDCA 5I1AA 5FC9A 2OCFD 2UXTA 3HE7B 1R3HA 3SKUD 1C7TA 4GKZB 2KT6A 3B9DA 3C09C 3VRLF 5KYYA 3DBXB 3GEFA 2AV7B 1KYFA 1XCTB 3DHMA 4FTVE 3QIUD 4RGOL 1D9KB 2OMUA 5E0FA 5D93B 3QWNA 3FZUC 1FFRA 2PW2A 4I0PA 3R8BB 1SDDB 1S7TA 3BLKA 1CDJA 2BNQA 2JVUA 3DURB 3AB0B 3K6IA 4G3YH 3HR6A 1O7VA 4JKPL 1AGFA 3O11A 3W38A 4GB9A 2YA2A 2ZWLT 1S9WB 2OV0A 4X6CF 3B5HA 3OBAA 1E3FA 1R17A 4YIQA 5SWQA 1S9YB 4LVOC 1CXLA 2A6DB 5FKAB 4A2MA 5I0ZA 4LCCB 3WFBL 2CGZA 3NH7L 5DTFB 1HS6A 3D1MC 4KI5F 2K4AA 5GHWL 5FUCC 3IM1A 3M7OA 2CRMA 3UTTA 2VDML 3L3IB 1HIML 2ARJA 1R4XA 2OMXA 2AGJL 3UC0H 4M7JL 1FO0A 4Q56A 5H2BB 4JZJA 2WZPD 4BEIA 1TJXA 2ATPA 5HD8C 5HYJB 3B37A 2HTLD 4X8GA 4WIQA 4JPVH 3KLLA 5E99H 1MZZA 3VRJB 5MENB 1IAKA 3UO8B 4MJ5A 3CNKA 3WFCL 2PWGA 3X11B 1HWGB 5KVMC 2W60A 4R4BA 3VQ1C 5H4ZA 3WUZA 1GGCL 3GZOA 1P5UC 1DZBA 3AUVA 3QRGL 4KZDL 3PGFH 5D7KE 3BQVA 1FORH 3ULUD 1EWHA 1F58L 1AH1A 4HUCA 1HINH 3JV4B 1DFXA 2AJXL 5EWIH 2DM4A 2APWA 4KK5C 1D9KC 2GIXA 1P4BH 1YN6B 4KAQL 2CLRA 1N5AB 2H6OA 3VG9B 3K6DA 3O8XB 1FPTL 1DSFH 2OLDA 4TUKH 1A3RL 4N2AA 2R1XA 1KCWA 2IGFH 4LCWB 5HHMB 3LNGA 3ECUA 3J8F7 2VH5L 1UUNA 3N0PB 5ID0B 2J8UE 1FBIH 2XWRA 3GK8L 1M6OA 3B2VH 1QFHA 2XX0A 4PMFA 5GGQH 3BUBA 2PYEB 4JPQA 1NIFA 4IMKA 3SCMA 2EABA 3CVBA 5EO1B 5CJBA 1HI6B 3KR3H 4I3RL 1TDQA 3MRIA 4JGUA 4YDVB 5JIPA 5HGAB 3WN5B 2LOEA 1WG3A 3MCKB 5EU4B 1JN6B 1NL0H 5FCUL 4NNYB 1ZEAH 3U30C 3TNMA 3HLKA 4WY7H 3QIWD 1AGFB 1CXEA 4NN6C 3X12A 4BV1A 2ZNWA 3QCTL 4K71C 1Z5YD 3RWDA 1KBKA 3MLXL 4LFHD 5C09E 3RTQD 3ZE2B 3MZGB 5EIIB 3C8KA 4A2FA 2DIAA 4XZUA 4M7LT 3CVIL 2O61B 1HCYA 3K0WA 4FTDA 1TQVA 4UTCA 4WKXA 3QQ4B 2JKRM 1IKNC 4AENB 5ISZE 4EVNA 1XF3B 3JUZA 3CCHB 3SQOL 5FK9B 4GSUA 2D3NA 3KCPB 5DGRA 5EU5A 4H0GA 3KPMB 2C9SA 2MQGA 2FR4B 3VMPA 5H2BA 2H7WA 2X28A 1PEZA 5EU6D 2ATPB 2JJUA 2VDLL 2FHBA 3VU1A 1KIRA 3A67L 4EZKA 2VDMB 2ALAA 1UUSA 5GJSH 1O0VA 1J11A 5E6YA 4UQAA 2VRKA 1QRNE 1DQJB 3BN9D 1THAA 5DJZB 2YPLB 1Z5LA 3KDMA 3PL6D 4OF7A 1MW1A 4OV6F 3IWUA 1ZS8B 2DI9A 4HIEB 1WA2X 3I84A 3IDMA 4ZQKB 4M43H 4HCGA 1VFAB 1RZGB 4RMRA 1DBAH 4YFDB 1Z5HA 5BV7L 3B2PA 1GC1L 3GXDA 5IB5A 3DIFB 5E4OA 3AS2A 3BO8A 2EADA 5FGRA 2YD3A 2VZVA 1BJ1J 2A83A 3PAUA 1F13A 3JWOC 4S1RH 3L4WA 1YPZA 2OTPA 3VDAA 2FX7L 3WIIL 2GHWB 2P8LB 4JQVA 1ZGLB 4WDIA 1Q8MA 3OLDA 3MRPA 3QXWA 5E2UH 4R0LB 4A7GF 3HRZB 2XZCH 3G08B 5TDPB 2WKOF 1NIDA 1ZVNA 2HLAA 3FTYA 4K3EL 2EDNA 2CK0L 5KYUA 2WTPA 3MUY1 4LRNH 5PCYA 5I8OL 4X6DE 1OIOA 4F91B 1EAOA 4PTUB 1I8LA 5DUBA 4HBCH 5EIIA 3VWKC 5DDHB 4U6HA 3GTVA 3HG1A 5ESAB 1AR2A 2VC2L 2EZ0D 3MNZA 3GQFA 4PY7A 4AL8C 1BWWA 1WYJA 3MKKA 5IFAH 2BRRL 4WU5B 2MMXA 1SHSA 5EU5B 1AP2A 1F18A 1NEZG 3AVEA 4FL4C 5A2KH 2QZ5A 4HPOH 1GJUA 4X9BA 3TIDB 1R0AH 1PAZA 3MCLL 3SY0B 5E94A 1X5AA 2CHWA 5I76A 3QORD 1XAUA 2YAPA 1WPCA 4MA8H 1DVUA 3IAPA 3T0WA 1SOKA 3U0WL 3U2JA 4JO1H 1YN7A 3QUMB 5CILH 4BZ1L 5BMFL 4F15C 4IGBD 5KSBE 4F24A 1JWMB 1CB4A 3LEXB 3GXPA 4KX7A 4DP0X 1MDAA 2BLFA 4JFQA 4X6BA 2ZKMX 3R7RA 4F93B 1U8QA 3Q06A 1TTUA 3WFEL 4D8PA 1R9FA 2VXUH 2C4XA 4P06A 1O5DT 3EGDB 4XPAH 4BH8B 3RZCD 1M9WA 1RZGA 2APSA 2GCYA 4Y2OB 3TPUB 3GBNL 3LRLA 3FSAA 3CWGA 1L9MA 4XH2A 4PUBL 4AQAA 5E5LA 4BZ1H 3CVHB 4I0CC 3SSGA 4GAJH 1KZQA 3V52L 2J71A 3ES6B 4GMSL 2NCEA 1NLBL 2R56L 2QGBA 3O45A 4EIGB 3HNVL 3WXWL 3GC3A 4B7IA 4JRLA 1CGWA 4PCKA 1KG0B 2R15A 4P04A 4K7PY 4B5EA 1TTRA 3FC8A 3BPCB 1EK3A 4DKAA 4X6CA 1X5FA 4NEHB 2BNRD 2I07B 4FQXC 5AVQB 3RBGA 3ML9A 5LB1A 4ANVA 3ULVH 4H44C 1GYCA 3FUMA 4FQHA 1NGWB 4IMLB 3BOVA 1P6AB 3HA0A 1JK8B 3AQYA 3WEAA 2PXYC 2FYYB 4XMLL 2NNCA 4NN6B 4WWID 1OHZA 1BIHA 1UKSA 3KPOB 3HG2A 4XN8A 5B8CB 2DWDA 1KN4H 3SDCD 2CDFB 2CK0H 1KTJA 3DJRA 5DWUH 4NKDA 3WY4A 4EI6A 3N44B 3V6ZB 4A1RA 5EBWA 5E2WH 1SUJA 4CMHC 5I1CL 4QAWA 3HZVA 4ZZKA 4GW4B 3G5ZB 4UM9A 2D3JA 1VIWA 2FJUB 3G9VA 1WSST 2F9BT 1SJMA 2JKXA 5DYOA 2CDGB 1QWHA 5IQNA 1IBGH 1JGVH 1JRHI 1WHPA 4WFFE 3ZDZF 4P9HH 5CLZA 3TN0A 3GF8A 3U6RB 1HE7A 4IYKA 5IEKB 4KVCH 4J4PC 2P8MB 4HD5A 1P7QA 3SJVA 3VI4A 3BEVB 3B2DC 3QG6A 1AKJB 3ALPA 5ENWB 4BCYA 2VR7A 1IQWL 4G7RB 1CDUA 2WXKA 4I13B 2BIMA 3D3VA 2KS0A 1UM5H 4X7SL 3ASOB 1SVBA 3IDYB 3C2AH 3FTSA 2BX5A 5IMOB 4WW1B 5JDSB 4KKLD 4K0OA 1WIUA 1SXCA 3APCA 3IDNB 4JLRB 5IUCA 3QZWA 4JZNA 3FN0L 4BZ2A 1CFQB 1VHPA 1WZMA 1NCAL 1WUNT 1S3KH 5C07B 1CPUA 3SZ6A 4F7TA 1T03L 1GR7A 3DX2A 4WI9A 1FYTA 1TVDA 1AOZA 3RDTD 3UC2A 3AQDA 2F7QA 3EJYD 2EDHA 2GC7C 1MCHA 3P3SA 4HKZA 3FTZA 1BAWA 3CN0A 4GIAA 4B50A 1S9VB 4JDEB 5KANI 3VD5A 3KPSE 3LHPH 1OGAE 3T8XA 4GG6A 4EJ1C 3DRQB 3Q5OA 4ONGH 3PJLA 2IG2H 3SKMA 5IQ9B 2CGRL 1RIUL 2X7LA 3AT0A 5CLXA 2X87A 2NY5H 4U6XB 3DIVA 4GP5B 3OKDB 1L6ZA 3VACA 4PJFE 4X4MA 3T6ZA 1REIA 4P5KB 5CR8A 2VCOA 4JFFE 3GMNB 2I07A 3F2LA 1FGNL 5B1JC 5IVOA 4C57C 4NO3B 1UKQA 2LFEA 2PYFB 1MVUA 3Q13A 5CO1A 4FCAA 1EO8L 1ZANL 1JF5A 1Q1JL 3BZ5A 4FEIA 3DSFL 1BJMA 4GG8B 4RQQB 2YD6A 2F7OA 2XBDA 3GINA 1LQBC 1FWXA 2VR5A 3LIZL 5MI0C 5EORH 1AIFA 3S0PA 3TT3H 4CSPA 4Y9GA 1EVTC 4NNPL 1J87A 4PJAE 1F56A 1U4EA 5IJVA 3RGVD 4PV8A 2IDUA 1QEXA 3L1EA 1FE8H 4X9YA 3ARXA 3UTSB 2AJVL 2I9TB 1TTBA 3HN5A 3IJ7A 4PJIE 3T0EE 3TBCA 2XQBL 2CHXA 3GSQB 5DK2A 5C0IA 4WW2A 5KVDL 5EH1A 3L9BA 2EXYD 3BZEB 5DURD 2FYVA 3AQXA 3IMRA 1KELH 3SDDA 1N0LA 4P2OB 2QR0A 3O2DA 4G5AA 4BH7A 1A4BA 2IOOA 3TBTA 4PG2C 3KYKH 1QFWI 3LKPA 4ZUSB 2VLME 1FVDB 1ZHNA 2NUPA 4OSUL 4R5VA 4GSQA 3BMWA 2X2YA 1ANUA 4KK8C 3DO3A 1QFUH 4AQ1B 1SFHA 1K72A 1WE5A 5C7XH 1SJXA 2Z65C 1YYMH 4LCVA 1A22B 2KZKA 4UI2A 1FIEA 4PLKD 4DKDC 2TSAA 5AW3B 1KCVL 3DVGA 3UTQB 3AXLA 2JJVA 5EZLA 4XP1H 5CBEA 2H2SD 2BSBA 4EN3C 5I0XA 1FCGA 2GITB 4AZ8A 3WCYA 3NJHA 4YHPA 1IC0A 5DD6A 3DX6A 1XGRB 1TCMA 2BY2A 4MNGE 5BZDA 2Q2EB 3VFOA 1E2VA 4DEUA 4XGZB 1FZOB 2B2XH 3QDMB 3OG6B 2FJGA 3QJFA 4Q8BA 5HPMB 1ZHKB 4HJJH 4BSWB 1H9VA 2NY1B 4PJ7B 3PXJA 3GFUA 4G42A 1AQKL 4GS7B 5I8EA 1W72L 2VDKH 4ES8A 2BXZA 1TQBB 5KSVA 1I1FA 1ZWIA 3GIVB 2AI0L 1EEYB 4DN4H 4F8TA 1T1WB 5FHAL 1BOGB 1AC0A 1BD2D 1RZFL 3FPYA 2EYSA 2FZ3B 2F53B 5J13B 1S7UA 4LHUG 1JZ6A 5AZEH 3BRFA 1LEIA 2Z0UA 1CDGA 1QSEB 3P0GB 1JUFB 4HCIA 3L3OA 3DDGA 1LNUB 2XWJA 3LZLA 5T3ZE 1N59B 3QHZL 1U42A 1ZOXA 1E9OB 4AQ1C 4B7LA 4F7PA 1WC7A 3G6JA 4PU2A 2F2HA 1A6AB 1JGDB 1Y7VA 2Y7LA 4OKVB 5I1CH 1KEGH 1NICA 3MRQB 1JFHA 2HJFA 1QBAA 4HGMA 5EOTB 2XYBA 3L81A 1CL7H 4DGVL 4L4TD 1MIMH 5DJDB 4J1UA 2I85A 4OZFB 1ZLWK 4PREA 3PL6A 3ORJA 1A9EB 1GYVA 4PP2B 1EFXA 3C12A 5F88A 1NCUA 3K72A 3V4PA 4LDLB 2EDKA 3SGEH 4EN3A 4PCYA 3THMH 2X70B 1A3LL 4PVBA 3RGVA 3EZJB 3ZDXE 3GYRA 1DO6A 4KQ3L 1I1YB 4BCXA 4QHLA 3ZJAA 3BISA 4GPVA 3RJOA 3QGVA 5CJXA 3D0VA 2X6MA 3NCWA 3C9NB 3KLHD 3NZ8A 4NM8H 2EH7L 3OKNB 2I5YL 3CN4A 3QHFL 2DLEA 2EDRA 3AITA 1OQXA 3NJKA 1AZZC 2KDYA 5F9JA 4LLVA 4K7PH 3W39A 3NSDA 1XCTA 4F92B 3DK2A 1PTZA 2D03L 2PCFB 3ZKQD 5E0QA 4ABVA 5TE4L 4A6YL 2FJGB 3PNWB 1YEFH 1MSPA 5EEZA 2FJFB 5BCAA 3ZL4H 1UENA 4Z8FH 1MOEA 2P26A 4J3OD 5DK0A 4P23D 2PWDA 3RKDC 1DBJL 4ERSH 1W80A 1DJYA 1OARL 1ZWIB 4N5EC 2E75C 1BQHB 3PFUA 5EU7C 1M6UA 5CN1A 5EA0H 1AD0A 5C70A 2FUTA 5DR5L 1EEZB 4F9PA 3FU6A 2J1WA 2WZ0A 2VR6A 4YDJA 1OO2A 4HKBA 3L7FA 4HWBL 2WKOA 4K5MA 1ONQA 1INEL 3MREB 1AE6H 3FB8A 3IDIB 4G7VH 5FIEA 3DJ9A 1RJLA 4WO0A 4D9LL 2UXGA 4NFDA 3SCMC 1EDYA 5J06A 2XXFA 3G6JB 4QTIL 2YEQA 1ASPA 4MJIA 4LCIH 2NY2B 3RUGB 4ZTOH 1A9BB 5TE7L 1EZUA 4PJ7E 4YIQB 3O3EA 1NMBL 2E7HA 3MFFB 3VRJA 4LQFH 2FVNA 2WGXA 4KNUA 4PJ5B 4UU9B 1PKQB 4N5UA 5F21B 3E9TA 4F9LA 4PREB 5GRYA 2GJJA 5CJXC 5IK3A 3U0TA 3MPCA 2O6CA 4WUUB 4FERA 1Z3GL 3DTXB 3ZL2A 5C6TL 3QO0B 1PY4A 2X70A 1YC7A 3F7QA 3VXOB 4OJAA 2X9WA 4ZO7A 4EN2A 2OMTB 2GVYA 1MNUH 1CFVH 3LHPL 4JY4A 4LLUB 3CDZA 3PUUA 3AY2A 4M5ZL 2XN9E 1N0XH 3HNSL 1FIGH 2IBGA 3WIFB 2A2QT 1L0QA 2KC0A 2WZPA 5DHEA 1NPNA 3WUWA 5CGMA 4TNFA 4OCRL 2QL1A 1NUNB 1J1XL 1OM9A 4NRYA 4OIIH 3V4PL 3ARBB 4LPXA 1S3KL 1T03H 5DU7A 5IREA 1NSNH 4GY4A 3FRUA 4HH9A 4RBPK 4KPHL 3BSZA 1T1XB 4ZS7L 1OWWA 3IMTA 3GLEA 1YC8A 4KKNA 3L9RA 3D2UB 1GKEA 4KMTL 1JD9A 5D7SH 2FQDA 4P59H 1RHHA 3T6VA 2UY7B 4I1PA 1G9EA 3MRDB 4UOW0 2WWOA 4YDZA 1JTPA 4XOBA 3B3IA 4PRHE 5IVZA 4ZZFA 1Y6MR 3FCTB 4EBQL 1SNRA 4ZDHB 4LPVA 4AYEC 4WHDA 3RUGF 2DRUA 3FB6A 3MO1A 3QYCA 3WE1A 2Y1AA 2MOGA 4MD0A 4Z3FA 2HRPH 1YY8A 2MPAL 9CGTA 3DBSA 3FFCB 4TUOA 2HT2C 4D94A 1ZSDA 3EO9H 3D9AH 4HS8L 1G1KA 3PQYE 1QSVA 1ZHBA 1IV8A 1V7NH 1AR1D 2R0KH 1KGYE 3BP5A 3MREA 2GG1A 4MZ2A 4P2QE 5DZ9A 4GRLB 5JHMA 2AEQL 1GW6A 1KFAH 3HVDA 3TIEB 2HLFD 3QAQA 3JTTA 4XMPL 5KBLA 1VACA 3WSQL 5L2KD 4MA1C 4BHUA 1G0XA 4JVPA 1PLAA 2B9BA 3B6SA 1GGTA 5EEVA 2ZP9A 3QWOA 1KPVB 2DIJA 3HKZA 3M45A 4XXDB 2P8PA 4MQTB 2DDQH 2EUXA 1I3RB 4TMPA 4PB9L 3D07A 5FYKD 3I9IA 3MRJB 4XX1E 1KY7A 2JIXD 2G3XA 3A6CL 5T3XE 4S0HA 5K1NA 3K8LA 2ZUQC 3IDJB 5F3BA 3ZTJG 2DW5A 5KZCB 3L95B 4FD0A 3V0VA 4HYTB 4QY8B 3MV9D 2A73A 2C3XA 1HOCA 4GO6B 3WU1A 3RBSA 4QRRA 1YEGL 4UF7C 6FABH 2BP0B 1UASA 2ICCA 1KF9B 1R3JA 3P73B 3WUWB 4APQD 2BVOA 3HKFA 2ZAIA 2OYKA 4YQXL 5CWSB 5FW8A 4LCYB 2NX5B 4P4KD 1DUYA 3C08L 4YHIB 1MREL 5I17B 2Q87A 3KYMA 3MBEC 3RAJH 4DTGH 5IWLA 4PYGA 1IKFL 4NBYB 2XWBA 3IJSB 3DOHA 1HFUA 1IX2A 3L2NA 4BSJA 1LDPH 2VISB 2YPLD 3O4LD 4JBSA 3GXTA 25C8H 3EF4A 4MNQD 2O26U 3ATDA 3MBEA 4G6JH 1KGCE 4S1DC 4GIPD 5AAWC 4WUUE 4GI9A 2M26A 5I1IH 2CKBL 5GSRB 1D2PA 1JZEA 2AQPA 5IBUB 1P7BA 4JO1L 3OR7A 2BWIA 4MAYA 5IJKA 4D0DA 4JG5A 4AC2A 3NP4A 4ZAKA 3FFCA 5KSUB 3WFCH 1D6EB 3NEEA 1P4LA 2MQ3A 3MNWB 1RIVH 1R3KB 4LKXB 1KTLA 1RKRA 4PD4J 4PTTA 5C3TA 4AGNA 3DX0A 2OKMA 1DBJH 4U3SA 4DO4A 1NBYA 3BP5B 1MFDH 4JAMB 5ADPL 1RZ7H 4G7SB 5KBKA 3DSFH 4HSAC 5BW7A 2EC9T 4IK7A 4KK8D 1WH0A 4GSXA 3Q8FA 3MJWA 4JFUA 5GISL 4OCSH 1BVKA 2HYMA 4K9JA 1A65A 2FWSA 5GHWH 4NQED 2FIKA 1FF5A 1BAGA 3G6JE 5DC4B 3Q1EA 3F7PC 5F93C 3ZY7A 1G7IB 2J6EH 4LRNL 5I8OH 1NKRA 2NDGA 4POZC 4AKOA 4YSRA 1JPTH 3ZTDC 4X0KB 3WMSA 2DQFB 3C60B 1FGVL 3VDBA 2BSCA 5HYIA 3DSNB 4ADIA 4N2BA 3W0WD 2PXYB 3BESR 4EXKA 1BJ8A 4N2CA 1GAFH 1KCUH 1IFRA 4WK4B 3DXAD 1HOCB 2H3KA 4ZNCD 1DVYA 4XPTL 3BUIA 1Q38A 2IDTA 3FT4A 3HG1E 3KXFA 3O6LL 3R19A 5CU9A 2E6JA 4DK5A 4N8PA 2K7QA 1RERA 3GKWL 3EYVA 4WO4C 1YN7B 1T1ZA 4Z5RA 2HX8A 3AT9A 1V7MH 4PJBB 4WWKB 1ORQB 4XNBA 1WFNA 3UTTE 4TLTA 3KYMB 2K8QA 1ZCRA 2X53A 1ZT4B 1RMFL 5TFSL 3FAWA 3HI6L 5HI4C 1ADWA 4HIJB 3VYOA 4PJ6A 1L4IA 4UNUA 3CZNA 3ATEA 4OZHE 1D5IL 2JK5B 4JFEE 3O41B 2DBJA 4Y9EA 4LIQH 3NFSL 4RMTA 3O0RL 1QRND 2Z6FA 3BAYA 2EE2A 2EICA 2C7UB 3DUSB 3V6OA 4K9EL 4ZFOA 3L3IA 1A6VH 5BJTA 4AE1A 1KENH 2F1BA 5EOCL 1F6FB 1MAMH 1OGAB 1IBZA 2CIKB 4ZAKB 3FQRB 5HHNB 3ZMNA 4JL2A 4FFWD 5CF3A 5B4MD 1RP9A 3W9DA 1KPUA 1J9CT 3BZFB 5ABZA 3IS1X 3GS7A 1OTUC 4I9XA 1X5YA 3SDYH 1YG9A 1CGVA 4HIXL 1N6QH 3GZQA 4JM2C 3VXME 1FNSL 1YAIA 3RVUC 2EO7A 1IB5A 3JV6B 4EIZC 2ETWA 5D2LA 4WI5A 1CK0L 2LVCA 1EJ6A 3TN0B 3G04B 5EUOE 2QLYA 4P5TD 2LT9A 5CZXD 2HA1A 4OCMC 3B8SA 3TPKA 3CDGB 3VXRE 2YC1A 4WY7L 5AB0A 4IRJB 4YAQA 2CDFA 4IU2A 4JPKL 2IH1A 4C8XA 4NKDB 5AENA 4DP1X 4LCWA 3MBXH 1C8QA 5D1QD 1KNOB 1ID5I 1LK2A 1X9UA 4XN4A 4OCNC 1QX1A 1IGFH 3N85H 4UQDA 3UZVB 3E7JA 4MXQD 2A4CA 1OSPH 4KGLA 4D9RE 3A4AA 4WZ9A 4JFVA 1UOLA 4MA3B 4IOSA 4MQSB 4NZRL 2IWFA 3NDYE 4DUXA 3NSCA 1CFQA 4KUZL 5LAXB 4URKA 4G2AA 3UJJL 2VR3A 2YGOA 3B43A 3MRRA 2YAQA 4MNGB 4OSUH 1VF5C 1S7XA 3F7YA 4TS6A 4ENED 2CO4A 2FH6A 3SHSA 3QORB 4Y2DA 3MXWL 3SQBB 4WSJA 5CS7A 3RJDA 1J48A 5FWQA 3SE6A 1N5YL 1KCLA 2EEBA 1ZS2A 1AKJD 3NQKA 4JJHA 2KYIA 4F2MA 4G8GE 2MKWA 1PZ2A 4P46C 5KYXA 3U79A 1NANH 2CLVA 2XZQL 4ODSH 3TH2T 3VH8G 3FQXA 5JPNA 1U8CB 3NCBB 3WL9A 2B4CH 2ZCLH 2DKMA 2GBUA 4HPYL 3LIZH 3OR6A 4OCYH 4CW1A 1S9WA 3DDFA 3UC0L 1KPUB 2AJSL 4YXKL 2GJPA 1G5GA 1Q1JH 4M48H 3VYPA 2DY2A 2EIMB 1FYTE 2Y6TE 3D25A 4S11A 4XI5C 4P5KA 3KWTA 5DD5H 1DQVA 4GRWE 4AJ0A 2GK0A 2ITDB 1XMEB 1O9ZA 2BSTA 2H6PA 2DQGH 3MA7A 4UMGA 4O2EB 1IE5A 4KROC 1UB5A 3MNVA 3GSNB 3DIDA 1Q9WA 2K78A 2N0KA 3W2DL 4Y9BA 3QG7H 3S5LA 3P9WB 5TDOB 4WW2B 4NFBA 1ZLDA 4AIEA 4KKZA 4IRJA 4FTVB 4YAQB 4IGBA 1Q72H 3DX1A 4HWZA 5C71A 5I9QC 2JJSC 1DDHA 4P3CH 4OZIE 2CH8A 1FFNA 3LRKA 4NO0D 4PJXA 1CGUA 4NGHL 3S3SA 3U25A 5J6HB 1DQDL 2AITA 1TU2B 3UYRH 2VW6A 3IFPA 2WW8A 1BSIA 5IWLC 2QELA 2DM3A 4GUPB 3OHXB 4ENEC 2OAAA 5LNGA 2XN2A 4OQTH 5LAXA 3BW9A 3P11H 1RPQA 5TDPA 1T1YB 3DHPA 3KH4A 3MV7A 3HI5H 3GXNA 3ZBMA 5TFSH 4Y4HD 4M43L 1TTGA 3WYRA 4J39A 1NKOA 3H9SE 4NAJA 1M1SA 3RKPA 3B2MA 5MEND 4I77L 4MAYC 4R7DB 3PV6A 4G9FD 1G6RH 4NHCH 3D8MA 2WSKA 2YWYA 2DMBA 5LN4A 1BM7A 3SZKC 2APFA 4Y89A 1V5JA 2IGLA 4M7ZC 3U2IA 1T0MA 3IN2A 4CUCA 1WFJA 5CAYB 2WQUA 4XCEB 2LR4A 2QADB 4OCWL 4XRCB 1P5VA 3WTUA 2Q5BA 2AABH 4W9EC 4NNYA 1NCBL 2WNKA 4FQ1H 2IAMC 3LMJL 4MKMA 3C5SA 4HDIA 2P49B 4LRIA 4NN7C 3G6DL 4XCCH 4JN2B 3U9UA 1DN2A 4HUWB 3VSUA 3EADA 3EGXA 4JVUA 5DHXB 3F84A 1E4XH 1EHAA 1V8HA 2FBJL 4HMDA 3V0DA 2EEFA 1IC7L 1WFOA 5FYLL 5A43C 1IGML 2AV7A 1RP8A 4AENA 3L3KB 5L6YH 4F37F 3UEQA 2CD0A 4FNTA 3BQUD 4ZODA 5EIVA 4B3VA 2J1KA 4FJ6A 4O58L 2DQIH 4NAMA 4A7VA 5G2NA 3TNNA 3U7WH 3QI9D 3KXFD 3HE6B 4L1BA 4X7CC 4W9GC 3MV9E 4O2CA 5DC9B 1LEGB 4FQ2H 1KGWA 1JV5B 4HGWA 3HB3D 2P7TA 1UZ8B 4RWHA 4OT1H 1A7RH 1DVXA 3LZFH 4NOFA 2DBLL 4DFHA 4GAFB 4KRPC 1LO2H 2XT1B 4XPBH 4R8WL 4DPBX 3GBLA 3KR3L 4I3RH 1U3HB 4G59C 3V0AC 2AXWA 2C4FU 2H26A 5DQDL 2F53A 1ZV5A 4WO4D 3D85A 5KYNA 3B1TA 1FVCB 3MV8D 4PMEA 1QNZH 3PWJA 5GGQL 2GUOB 4IKKA 3RIFF 1SN5A 3UJIH 1JVOA 3MOBH 5LGKA 3HG4A 3IE4A 3P2DA 1R5WB 2DZEA 1B4RA 2CXKA 2WQVA 3GBEA 3K72B 4EN3B 4MRBA 4L9LC 5CP3H 2JE8A 4J6IA 1CIUA 2VL5A 3P3TA 2FX8H 1SXAA 2NY4D 2OMXB 3ARVA 1WC7B 1DVQA 4K3JL 3QDGE 2VXUL 1AGCB 3P3UA 1DQKA 2R2HB 1T5XA 4LVHC 3QFJE 1MREH 5D9SB 3HZ3A 4RLDA 4IKLA 1K4DA 3H56A 2R69L 3BGMB 5DJDA 2IADB 2AEWA 2L04A 3DX8B 4LCUB 3RL1B 3S96A 2Q10A 4L4JA 1XV8A 2ZXDA 3C2SA 4KKCC 1MY5A 1Q94A 2WO4A 3MRPB 3C6LD 2PUQT 4QHUB 6FABL 2F5AL 4XBEH 3OMAB 1H6UA 4JRFA 3SKOB 5HHOB 1HNGA 4CU7A 3HJEA 1LO5A 1DHKA 4EZLA 1KWKA 1GTNA 1YN6A 4DGIL 1WT5C 4CADA 2HTLC 1AANA 1W72A 3D0VB 2DWTA 5E8DH 1PLGH 2RALA 4JFPB 3LQAC 4UWQB 4N8VA 2UXVA 5IEKA 5B1AB 3ECBA 4Y5YC 4ANUA 2Q0ZX 1QBML 3FSWA 5C1MB 4QTHB 3QDME 1GZPB 4Z7NF 5I75B 1GH7A 1MWAH 4BJLA 4PBXA 4IJ3B 4IHOB 1OSZB 4TTDD 4G9DB 2WXLA 2Q3XA 4GKSA 1WBZA 1WS7A 2DOCA 5F7EL 4O2CB 4N0YH 2XZCL 3VB8A 2R0KL 3STZB 1OAKH 2V8MA 1NAMH 2FCBA 1PY0A 3VD4A 1E8XA 1JG9A 2XWDA 3CIQA 1A9BA 3US0A 1YMME 2ITEA 2ZONA 4AYGA 1MW0A 2H26B 2RA1A 2HRPL 4ZJ9A 4X5RA 1KCRH 1BOYA 2W92A 4HLJA 3OZ9L 3WO3B 5IK3B 3WDHA 1HAUA 4D9RD 3I74A 4N2NA 4YHMH 2FQGA 1W8OA 3BIBX 2J1ZA 5AKRA 1SQ2N 2PP7A 3TA3D 3CH1B 4JRWA 3WE6B 4Q7DA 5JIKA 2W91A 2VL5B 2EKJA 1U6AH 4YNYB 5DFTA 2NRDA 4BXVA 5I6XC 1WZ1H 3NJIA 3L9EA 5PAZA 5D7LD 1AI1H 1CL7I 2CNZA 1FL3A 2WHVA 4KPHH 2G0LA 3BN3B 3BJLA 4XPHL 5D9SA 1S7SA 1UKTA 2IOIA 1K4DB 3S34L 1QNIA 4ADGA 2PP8A 3I75B 5K5YA 3FT3A 3OWEA 4CN4A 2OMYA 4AEEA 1BCIA 5L4MA 1U0QA 5IKCB 4GG8A 4JKKA 1KMGA 3ME0A 3G5YB 4JRXB 1Z5LB 3KDMB 5E03A 4F2ME 1CFVL 1P69B 4HAFA 3ARGB 4L5FH 1RPKA 1BJ1H 2V4LA 4M1DH 1LO4L 3SE4C 2X05A 3WD5H 4M7LH 4ZD3L 3MRDA 5CKGA 1WWCA 1XR9B 5A2FA 4OGZA 4UT6H 1YEIH 8PAZA 3U2SA 2BZDA 5CIPA 1CTOA