4LZKA

Crystal structure of inclusion body protein (pixa pfam12306) from burkholderia cenocepacia j2315
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
159
Chain Sequence
SINLEKAAQSIQILAVIDTNYIKRSHPNPSLNAQNPTSIPSTALFMLNGHAPGVSSSEGNGNLGLKLNVGDKVSLMGTSLADNSGDAALIYHVQQYSGAQVFAPFTAVTIEQQVFQAFESVAKSAGSEYLATSFALYTRSQNRKSLFGYFFWVWQAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of inclusion body protein (PixA pfam12306) from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Unknown function
molecule keywords PixA inclusion body protein
total genus 36
structure length 159
sequence length 178
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12306 PixA Inclusion body protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lzkA00
4Q52A 4PIBA 4LZKA
chains in the Genus database with same CATH superfamily
2QGDA 4NNPH 1AQKL 1ZOXA 1SRDA 1KXTB 3QIUA 4U05A 2F54D 1XX9C 1EFXA 4RH4A 1UUNA 1AI1H 2DMBA 1T04B 5DU7A 3QJHA 4XCCH 5HD8D 1G7PA 4D9RD 5L9DL 3QUYB 3FCTB 3BP4A 3P69A 1YMMA 2XY1A 5D9SB 1Z9NA 3KBHE 3LNEA 1K8DB 1OLLA 4Y16C 5H94A 4Y4KB 3IWUA 3ABLB 4LLVB 4HX1A 4PLJC 2VSKB 3ZTNH 3D85B 3U82B 1OY3B 1SVCP 2HSIA 4UTCA 5TE7L 3RVUC 5HYEA 3OVUB 3QNYB 3BIKB 4FXGC 2NSQA 4ONHA 3EJQA 1T0MB 1NGPH 2ADIA 2B77A 5K93A 2WTOA 4FQ1H 1CXLA 1GMEA 4FDWA 4MAYA 4OD2B 2QL1A 3FQ4A 3QQ4B 1UJ3C 1NAMB 2WY3B 4YHKL 5I16A 1XH1A 2KPNA 4NNXB 3Q1SH 4F1SA 2EINB 3IRCA 2VC2L 2BRRL 3CZLA 2VL5A 5J12B 3FTZA 2X7LB 4TNEA 5E2VH 4C56A 3KGSA 3HS0A 4FQIH 2OMYB 3QJFB 1MVFA 4U7MA 2X9WA 4R2GD 2JKNA 4Y2DA 1YEFL 1J9QA 1NCWL 1ZV2A 3MROA 4PIBA 1MCFA 4FNPA 3MJ9H 2Q1EA 3R0MA 4OR1A 3I84A 3TZVC 1UD3A 1CFMA 1C7TA 4GP8B 2DY2A 4XAWL 2NYKA 5CCJA 4N0RA 5MP6L 1FNGB 2OX5B 4R4BA 3MRJB 3UMNA 4N8CL 3UXFA 4N0UA 1MWAB 2E6QA 3MKGA 1XF3B 2VKXA 1UA3A 1A3LL 2X6CA 2TSBA 5D6DC 3T2OA 1GCYA 3CDFA 4EQ2A 1AGEB 5LXGL 4F58L 3UJTL 4F2EA 3D07A 3QR1A 2OXHA 4I7ZC 2X9YA 3QUYD 5HD8C 4WV1B 2OMWA 2VNCA 3CV5A 1QSZA 4GB9A 4Q52A 4B3VA 2A9CA 3WU1A 1J8HB 1NPNA 4I88A 2AXGA 5F3BB 4W68A 3CHPA 3BVVA 3MODH 3QPQC 2NY4B 1JV2A 5HGDA 1HCVA 1Q94A 1UYWH 3T04D 3R1GH 1N3NB 3TJEL 2CA3A 2VXQL 2BP3A 1DLHA 2K8QA 1OV8A 2OJEB 4P9ML 4E9VA 4G2AA 1F2QA 4N9GA 4P0DA 4RLDA 2OULB 2DYPA 3FPXA 4Y19B 1SOQA 1MFEL 2P1YA 3UTSE 2HX8A 2V17L 1IBYA 4UNTA 1ZE3C 3SKJH 3EOAA 2EECA 2P5EE 5IHZA 3ABGA 1CF8H 4HLZH 4K3EH 2HX9A 2XPYA 1RZIA 2C9SA 2NNCA 4QXTA 1IGCH 3UTOA 5EA0H 3UGUA 1HHJA 3TF4A 3I75A 3DURB 1I9RH 3WO3B 5EH1A 4Z23A 4LOVA 3F3HA 3K2IA 5F8QC 3BKJH 2IBBA 3NCWA 4DKTA 2GG1A 5ITFA 1ZE3H 4XTRD 1CS6A 1ADQA 2AZUA 3H3KA 5INDA 2Q3XA 4HHAA 2ESVA 4NQEE 3L6FB 4QTIH 2XTJC 2EYRA 4KOBA 4NO0D 2CO4A 1RJZA 3OKOA 1XL4A 4OVVA 4M62L 1KLUA 4N9OB 1JPGB 4JG1H 4OVUA 2VDNB 4BZ2L 2AJUL 2X3AA 1ZIBA 2ZX5A 5TPWL 4NO2A 1IAKA 5AOIA 3QJZA 3IDJA 4N8UA 4X0KB 1A7QL 3BQVA 4KZDL 3B34A 3Q5YA 1OTTD 1QLRA 4XBPA 1XTLA 3WFEL 4C55A 4ICXA 2PMZA 2NY6C 1TG8A 3O9WB 4J3OF 2WLKA 1BEYL 4K3DH 3RWCB 3GXUB 2Y7SA 1HH9A 1JN6B 5KW9H 5T33H 5C07A 4JG0L 7PAZA 2LU4A 2UWEB 2V2XB 4FQJL 1GXEA 5DWPA 3ET9F 5ANME 3WFEH 4YK4C 2X10A 1AD0B 1W72A 3CG8A 5JW4N 2C7FA 2TSAA 2W9EL 1HOCA 3GRWL 4OCRL 2AQNA 5HYQB 3MLUH 4G6JL 5L9DH 2IADA 2CLVA 4F8NA 1NCBH 1FAKT 3BFQG 5HYSB 5I6XC 5B38B 3SE4A 2BNQB 1ZT7B 1S8DB 3K74B 1FRGL 2WXHA 4RESB 1XCTA 4NLAA 4XWGH 5C0BE 2EXSA 3LN9A 4IJ3B 1KOAA 1GKOA 3WLBB 5D70L 2LTQB 3CUPB 1O5DT 1G7QB 3ECBA 1U3HA 2XWDA 3VW3L 1GGTA 2X6UA 4KXDA 2V2TA 1ZLSL 1M7IA 3BO8A 4AXWB 2ZCHH 1JWSB 2KKQA 2WBJA 1FSKC 3RWFA 2NTFB 3O2DL 2ZYHA 2YOAA 3I02B 2IVFC 1N2RB 4XZUA 4PD4K 3KL5A 2FT6A 5BRZD 4DAGH 2O6CA 4MD5B 1E5ZA 2J4WL 4UUJB 4PRDB 1L9NA 1NCAL 1W0VA 2BNRB 4MTMA 5FUCE 3UYRL 4X80H 5DJCA 2A9ML 3ETSA 2VZUA 4I3RH 4AC2A 4BKLB 1SHMA 4GAYB 3SDAD 1NFDA 5HHOA 3CNKA 5DHVB 1XZ0A 2IIJA 5F1SA 3TYFA 3T6WA 1D6VH 1T21A 3S88L 2D7NA 4PJ9B 4HGMA 1KTBA 2P8MA 3N2JA 2C26A 5LUMA 3VG0L 3A6OA 4AH2A 2J6WA 3MREA 4LPUA 1N6UA 2VE6B 4JM2D 3PP3H 1HH9B 1EMTH 1JK9A 3JVGA 2X40A 2PYEA 3QDMB 4NZJA 5A6MA 2O61B 1I85C 1Z9SA 4MNHA 2DS4A 3EYVA 3GSUB 3NTCL 2VW6A 4L8BB 4L8DB 4MVBC 5FYKL 4LEBA 3S5ZA 2O5XH 2ZICA 1ZLWH 1F4AA 1DBBL 4IEFA 5E7FA 4HF5L 1G7LA 2HA1A 2V3EA 5FYLL 1UM6H 4JQIL 5EZLA 2FO8A 2GI7A 4BA8A 3FU7B 3AB0B 4IBTA 2HRGA 1PS3A 3LH2H 4RMBA 4XC1L 3D39A 3GM0A 4WHYG 2EJ1A 1QWUA 3NVQA 1DBAL 2H8PA 3HE7C 3VXOB 1CD1B 5GS1A 4TS6A 5EN2A 3MJGX 5F2FA 4U1SB 4EI5B 1BHGA 3AWFA 4B27A 3CHXA 2VMJA 2Q8BH 1AHWB 1AHKA 3H42L 3O41B 3DX6B 4QTHA 2UY6A 5BVJB 4C58B 4YNYB 1HWGB 2IAMB 1YY9C 2VQ1B 3IAPA 5B8CA 3WN5C 1T1YB 1MI5D 1P5UB 3F7KA 2BRRH 4FFTA 5KVFL 2XVKA 3KVDD 4NWTH 3VVWA 3NJIA 2HG5B 1SLVA 3OR7B 1CD8A 2WTPA 3IFLL 1ZHLA 4RX4A 1KEML 4IOSD 4MMXB 3T0WA 2GTZA 4YSRA 3ZMRA 3ARFA 4XNXL 4AYSA 2CO3A 3S0PA 4L8BA 4U3XA 4LLYB 4ANVA 1JRHL 4KOCA 2PYEB 4MDIB 4X0NA 2I60H 4IU3A 3ZXAC 2WO4A 2K3HA 1SUJA 3BVNB 4TVSa 2Q10A 4G7RB 4GFTB 2DWSA 3BAJA 3RUGF 3NG5A 4E41E 1FFTB 3FFCA 4WU5A 3ME0A 3IK2A 1B4TA 2YAHA 3DXAB 4CADB 2J71A 5G4NA 2YRBA 1SOKA 1MCOH 2ZTBA 1NSNH 3F64A 5HDOA 1XGQA 1NSNL 5FA3B 1VFBA 5C2BL 3ZMEA 4HAKA 2P7TA 3MCG1 2J8UA 3SBWA 2Z4TA 3U46B 1EBAA 1I1AB 1ZCRA 4A7GF 2Z6FA 2NUTB 4H8VA 4PGJA 5JOPE 1E4XH 2YD0A 1E9OA 4GMTH 2WLZA 1NGXA 1UCBL 3E3QE 3WKYA 1EGJA 5E2TL 3ARZA 1Q90A 3GMQA 2ZNXA 5F6HI 4RIRB 2V9UA 1X4YA 2PCFB 2XWCA 3RWIB 3WSQH 1JNHB 3FUMA 4Q89A 4JFED 1BMWA 1JGLH 2QADB 3BC9A 1ZTXL 2C9XA 4TQPA 3CFKB 4TULH 2DI8A 4U1NA 1U8JA 4IRJD 3ZHLA 1OP5H 5D1XA 2QPUA 3CZSA 5DYOB 2UXVA 1QFPA 3LEYL 3ARTA 3O8XD 4XPHL 4Z78B 5TH2A 5F9JA 1JGVL 3OD3A 3QG7L 5FUCC 1E28B 4GQRA 2R4SH 2CUHA 32C2B 3GSNB 3UROR 2CJTA 2FO4B 4AM0Q 3EFFB 3O3EA 1XH3A 2Z31C 3ME0B 5D2NE 4CAGA 2OMYA 3FRPA 3ARXA 3QJFA 1F42A 2W07A 3R06A 2DWYA 2GTWB 1UEYA 3PHQA 2XTJE 3V5KA 5DC4B 1NH6A 1UXWB 2G2RA 2K0RA 1YEHH 4PB9L 1SBBA 4JMXA 2NLJA 4FLQA 5DRNA 5EIVA 4BSWA 4AGPA 2IANA 3P9LA 4XNQA 2G3XA 3OLGA 2XZAH 3SYAA 3KL0A 4TL4A 1U3NA 2XWBA 4PRAA 3MLXL 4CBPA 1KYFA 1NAMH 3P0YL 4ONGL 1Y18A 5F7EH 4K5LA 3TZVA 2ENPA 5EU5B 3CHOA 3FXIC 3U0PB 4YLBA 4XAKD 4ZO9A 3RWGA 2AAVA 1UOKA 4L8SA 2A4EA 1WFMA 1R5IA 3FTGA 2E74C 4JFXA 3SQBA 2VDKH 1INEL 1UA7A 5LAXA 5CINH 1H6EA 4F57H 3D3VD 2VYRE 1DQLL 2R27A 2UV3A 4Y1AA 5KVGL 4I3RL 3ECQA 3PU7A 5EOCH 4ZO8A 3HI1A 1A5FL 1DVUA 3R19A 4MXVE 1L0XA 4OV6F 4WGKA 4FFYH 5EWIL 3QRLA 1QZNA 3KPLB 5I19L 5I19H 2WZPA 2UY7A 4EJ1C 2CR3A 3EH1A 1JUFA 3KLAB 1WWBX 5I30H 1ZMYA 5I30L 4E36A 1OD9A 4IMKC 1WA2X 4WWNA 3MGAA 1P4UA 3RGBA 3CE1A 4N2MA 5C09A 1S7WA 2UUDH 1MREL 5C0FB 4HEPA 2DYSB 3FO1A 4JQXC 2HVKB 5AOLA 4GKSA 1RP9A 1WD9A 3LKQB 1S9YA 2XV6B 2R56H 4IRJC 4Y5XA 1OLZA 3VCLA 2JXMB 2RIKA 4AZ8B 3T71A 3W9EB 1ZVYA 4CSZA 4CJ1A 1UEMA 2HUHA 3EFOB 4AL8L 5ID0B 4NM4H 4X8GA 4MCZB 4G8FA 2BXZA 3UAJA 2WK2A 1XDTT 3IGAB 4X4YA 4M93B 1P0SE 2PKDA 1J1PL 1ND0B 4F7EB 4MYPA 4JFSA 3QUXD 3CDCA 4X7CC 2QV2A 2WTRA 4JO2L 1W0VB 5IB4A 4M43L 4CU7A 2BVQB 1DQJB 4BKLA 4JDTH 4HUWB 3DDGA 3I6LE 1QR4A 5HHOD 3U7WL 1KTLA 4BFBD 4FQJH 2YBGA 1UXLA 3FCBA 3WSQL 5E9DB 1M6OA 3ZHNA 4TNFA 4J3OC 1XFPA 1AC6A 2C9QA 3RIFK 2CRZA 4P8QA 3RNKB 1FHGA 1A6ZB 1FO0H 3NQKA 3TVMA 3FT3A 3C09C 4KJYA 4PY7B 1IAOA 3SJVA 5M7QA 4OFYD 2OQJB 4HIQA 5EU6E 1ZVSB 4JM0A 3IPBA 4JFOB 5DJDB 2LTQC 3T1FA 4P04A 4OH2A 4OCNC 4XBEL 4H0LC 3RNKA 3NZ8B 2OYLA 4DQAA 4F7CB 1T2QL 2FTAA 2A6DB 1NCOA 2Y1YA 2IXQB 1B6DA 1HH6A 4ZMXA 2CO2A 1R4XA 2AV1B 1ZT7A 1OSPL 4G8GA 3NACL 4MSWA 4DK3A 4NJAH 3EH2A 3T0VA 3VJ6A 3T65A 4WGWB 4XPHH 4EUPG 4GRLC 4EXKA 2FYYB 5I24A 3MRKB 1IILE 2X88A 3HR5A 3THML 1PZ2A 4XX1G 4L4TE 4J28A 4OLYH 3CQQA 1U3YA 4XWOD 4HPHA 2VKWA 3OJMB 2CE6A 1OHZA 4ZAKA 4KVNL 4YL9A 5B1JC 4TNWF 3OTTA 4KH2A 2XVBA 3SE3C 1AGBB 1OK8A 4H8WC 2VDQH 2WWMC 2FX8L 3H9HB 1AS7A 4D9LH 1IT9H 3O9WA 3DHPA 3P4LA 2ZF9A 2VITB 3QCTH 2ZXDA 3ROOB 4YDIL 3KPRE 3QNZA 1FL3A 4XZ4A 1J88A 1BXVA 4UBDD 5L4MA 2YC1B 3SE4C 3QUXC 3ZKSD 2DQFA 4MDJA 1AO7E 2FUQA 4EIZC 5K9KB 2FBRA 4H8HA 2O93L 5E8EA 4TVPE 4WWPA 5C6TH 1VFAB 1ZLVH 1UYWL 2EE3A 4FP8L 4DUWA 4MYWB 1CZ8H 2DYRB 4JAMB 5GRWA 1AJ7L 3EDJA 3S3BB 4Z7NE 3QCVL 4LDLB 1G7JA 2N7SA 4W1TA 4PJEF 4XC1H 4UYQA 5F0JB 2CCVA 4YE4L 3DX7B 3NGBC 5ITFB 4PJIF 1SY6H 4Z0BH 1RIUH 1BFVL 2VL4A 4HHAB 3S98A 1PZUB 1HEHC 3TTYA 2AJUH 2KYIA 1E7VA 1NBYB 2YEZB 3K6IA 2Z8WC 4JM4H 3SSGA 3IMTA 3CZFB 4GLRH 4OZHE 2X2HA 4JPIA 4L3CA 1G94A 1Z6JT 4J6RH 2Q76B 4LLMB 4LIQL 1U8PB 4WSJA 4MMYB 1RL1A 1EAPA 5HHNA 1MCEA 4R84A 1F41A 4LKXA 3ASWA 3AT8A 5E51A 5MP6H 3QYMA 5AYUH 3BAKA 3QFJE 3NFPA 3IN2A 4H1LA 3VQ2C 1ZS2A 1WBYB 1UOWA 3NP3A 3RDTC 3WFZA 3BUIA 4FJ6A 1VAHA 4Y4HD 5H35B 2NY1D 4FX5A 3G04A 3GS7A 4RBPH 4KTGA 3DRQA 1LD9B 4IMLB 5E4IA 4Z1PA 4U1GB 1OWRM 2X4RA 1WAAE 3GK8H 4JR9H 4KJPC 3RVVD 3WJJC 3LD8C 5A3ID 4UTAL 4JN2B 4MCYB 4WIQA 2HLAA 4Z7VB 4ODXA 3UJIH 1GSKA 1OCRB 1DHKA 2GJPA 4WEEA 4Y16D 5AVVB 3WN6A 5IW3A 3SY6A 4AE0A 1QEWA 1YUHB 1DBML 5ADPL 1E65A 5C0AD 3HFML 2RA1A 1CFNB 5IOPB 2F8IA 2GIYA 3PQYD 3SGEI 4AX3A 2NLJB 4P9MH 1LHZA 4JCWA 2YUXA 1DZ0A 1B9KA 2XZZA 4ZUTB 3Q8EA 4UB0L 3L4UA 1WBZB 4X9GA 4J4PC 3OSKA 4ZFZA 3GIZH 3WMQA 1XF4A 5B38G 1OWWA 4G8EB 5EOTA 4FEIA 4EVNA 1E9OB 4D9QE 1TEGA 1CDBA 1N18A 4DKFL 1J05B 3S3SA 3VTMA 3MLYL 1D9KA 5EORL 3E6FB 3O6LH 3HR6A 1U8HB 1MEXL 1YEKL 2G9HB 1X6LA 4I77L 5EIIA 5KSAD 1S9WB 1AIFB 4I5BA 4MNQB 4U1NB 3ROLA 2R0KH 4BZ1A 3QIBB 1KJ2L 1HAUA 3H4HA 4WUUA 4UM9D 2VDLL 1ONQB 2PCPB 4ILDA 4KWUA 1IQDB 2IDQA 1CMOA 2UXTA 3M8OL 3S35L 4N4YB 1QQDA 3H85A 3LN4B 3CPLA 4X99B 5KEZA 2Q6WB 3QXWA 1XGYL 2J88L 5HGHA 1F58L 2J1XA 4L3FA 2ITDA 2CXKA 1JGUL 3VXMB 3JT2A 3TPUB 4LLYA 3L7FB 4APXB 4ZI8A 1VKXB 4W9DC 1KCVH 1A6VL 5BV7H 3KLAA 1UT2A 3ARFD 4WI2A 2VDRB 3NP4A 2YEQA 1JJUA 2WC7A 2XV2A 3MJWA 4JGJA 3N40F 4XB8A 4MMZB 3A6BL 4KK5C 5T1KB 4F2MB 4M7KL 3RGVB 1WISA 3ZDXE 1IGJB 4MKMA 2X41A 1T2QH 1BEYH 4PI2A 4WNQA 5DMKB 1EXHA 1T03H 4JRXA 5KYNA 4GBXB 4NIKB 4Y16B 4V1DA 4HX1B 3FCUB 1NC4D 5SWZA 2NXZB 2NNFA 3QDHA 3BPNB 2O4EA 5EUKA 5I5IA 4M4RB 4ZPTB 1X9RA 2E0PA 1EHLH 1FNHA 5IQNA 3EAKA 4DESA 4M1GH 1FPTH 1HXYB 1B2WL 3K6NA 1FLRH 2GAZA 2XC8A 1EO8H 4UT9L 1KJVB 1K8IA 4APXA 5DRNB 1USZA 4CMHB 4KMTL 4E0RA 4GAJL 1LP9B 5EEXA 2DIBA 2WYHA 1L6ZA 4ZMLA 2W65A 4G72B 1NCIA 2FUTA 1I7ZB 2VH5L 1TETL 3O3AA 3P3RA 2C3WA 2OMTB 2AEPL 3PQYA 3QORA 4O4YL 2OL3A 3DMMA 2O72A 4JJHA 4GI9A 1P7BA 2QKIC 4U1JA 12E8L 1DQDL 1HCFX 1C08A 3ZYZA 5IROA 5T1KA 4JKWA 5C71A 2HJLA 1U4EA 2OTUB 3T8XB 5DJCB 1F11A 1U8NB 5TE4L 4HWUA 4ZMVA 1QWNA 3PIQA 1AYOA 2ZX6A 3G7TA 4NQXA 2CXGA 2GUYA 4FL4C 2R39A 4MJID 4N0YH 5AENA 5B7MA 4F7MB 5D7LB 1JPTH 4KJWC 3F83A 4KV5E 1JWSA 2WBJB 4P9HC 1KYAA 3I6GB 5BJTB 1N8ZA 2A6IA 5IB3B 3ARFC 3CSTA 3CSBA 3MREB 4P5MA 3OAUL 1DANT 4WI6A 5E8DH 2DLGA 5EZPA 4RCAA 1QFWL 3WKMH 4DZBA 1ZT1A 5T1KD 4H2CA 3D87B 4RGOL 4KVCH 2W8CA 4JEGB 1Z0MA 3QBTB 4JKNA 4LPVA 2WPGA 1OB1A 1HE7A 2QJDA 3BQUC 4UV4H 5L88L 5AYTA 3QUZA 5L4IA 1F0LA 3CH8A 5FHBH 4OFQA 4KNQA 2W81C 3N06B 3FHEA 4Z9KB 3VWJB 3UTSB 3CXFA 3NJLA 2IO5A 2NYZA 2FEDC 1NDMA 1AP2A 1U8QB 2NT1A 4NX0A 2AV1A 1HHKB 4WU5B 1JOIA 4X7FC 4ZFQA 3HB3D 5EOTB 3PGCA 3ARBD 2I5YH 4Z7WA 4H5SA 2BW5A 1OARH 4HAGA 2KERA 5A6LA 4C83B 1RUQH 4Y4FA 1KACB 6FABH 3F84A 4AEIH 3IDNB 5A2BA 2JB6B 2N56A 1R3IL 1CUOA 3C8HA 3RFRA 2B3RA 2GSGB 4WFHE 2WVVA 1DE4B 4Q9CA 5I2IA 1N7ML 1MJJA 1Z5YD 1KYUA 3D18A 3TT3H 4AEEA 5SWZE 3HPJB 3OR7A 1QLRB 3VQMA 5I0ZA 3CZFA 3GSNL 4K5PA 3K6SA 4NQSB 4R0LB 5JPMC 3WFBH 5K69A 1JHLL 2AJZB 2B3IA 3Q5TA 3SODB 4KXZI 4MAZA 5JIMA 4DERA 2RCSL 3VWKD 5J1TC 3WY1A 3BJ91 1JPGA 5JOPD 1INQA 1B9ZA 5E4OA 4DNLA 5DZOA 2P5WD 3RAJL 4HFWA 4NQDB 3HVNA 4EZJA 2AQRA 2YFOA 4KJWD 4YHKH 5CJXC 4HJTA 4ES9A 1FIEA 1X5YA 1G7LB 4N8PA 3MLWL 4Z7WF 4G9FB 4M9OA 2EDOA 3SDDB 1I8LA 1CR9L 5ICZB 3QEUA 2NUPB 3N40P 4TTGA 1J0YA 3C5ZB 3PXHA 2XV0A 3U7AA 1JK9B 5KTEL 3EADA 2QTVA 4PVNA 5FM8A 1GC1H 4JY5H 3ZY7A 3VXSB 1NFDF 2X38A 3A24A 3HI6L 1GZQB 2CCLA 4WEBL 5CCKH 1YYLH 2ERJB 3ARBA 5BZDA 2Y5EA 4OZFA 2A74A 4ODSL 1RJYA 4FNQA 2CKBA 4JRFA 1FNEA 5TFSL 3HB3C 1MCSA 1N4XH 1D5XA 1GC1C 4I3SL 2WXGA 4O2CA 1S9VA 1AGDB 3FQWB 3AY4A 4F5CA 1LK2A 4N6RA 3HG4A 3L1FA 2XN1A 3IB4A 4WW1A 5AALA 4HV8B 1MY5A 2ZE0A 3GBML 4QXVA 5GZNA 1A1NA 1XGUA 2FATH 2PF6A 3FN0L 3FUIA 4I2XE 1J1PH 1CJYA 5JO5A 3LNGA 1F3DH 3CUPA 3ECBB 5T3ZL 4OB5L 1P9MA 3JWDL 4LL9A 4L37B 4Y1AD 1AOZA 4UNUA 3QXUA 1RUKH 2HKHH 4HIEA 3QYNA 5DF0A 4G6KH 3NJJA 4HEPG 4NPYB 4UIKL 2YZ8A 4PJCB 5HTSA 4ZNEE 4OZFH 1P4BL 2XIBA 1YPZA 4KZEH 2EDQA 4ZFGH 3MV9A 3ZE2B 1FYTB 2ZSWA 2FZ3A 2P48B 2FB4H 2JSFA 3CFDB 2OTWB 3O4OB 1Z1WA 4ZXBD 1JE6A 2Y1ZA 4IDLA 5F7DB 1E6OH 3EYUH 4XB3A 1KPVA 1UC6A 1BIHA 4WI9A 1NA8A 2XQYA 4WUKL 5D1QE 4YZFF 5DUJA 5FECB 1B4LA 5M95B 1QKZH 1AD9A 2FEEI 3PF2A 4JDTL 4BFFA 2CHDA 2XYBA 4R5TA 1RXLA 4BH7B 1IV8A 2VL5B 5HDQL 2DDQL 3T0EE 5D7HA 4PJXA 4S2SA 3ZTJH 1SJHA 1A7NH 4X7EC 3T6QC 1U95A 3VXQB 2X42A 1A1NB 1XGUB 4JN1H 5C0GA 3RNQB 3WELA 1G0YR 3LV3A 3RZCD 2V7HB 1VHPA 2R69L 2ESVE 4QAWA 2ZKYA 1T1XB 3AU1B 4JQVA 2WGXA 1PDKA 4GW4A 5D7JD 2XOTA 5EO9A 3SCMC 5I0VA 5AW8B 3ALPA 3WL9A 3U0TB 4PTUA 2OSLB 5A16A 3ZUNC 4FQXD 1Q9OA 4WENB 5LBGA 4NO3B 4AK2A 1NBCA 2R23A 2B59B 3GBLA 3A4AA 4XNYL 1IIIA 3O4OC 4M1DL 3F01A 2CPUA 3GZOA 4PB9H 3RKDC 2ZOKA 4NI3A 4JFHD 5GJSL 3O81A 5I26A 4XOBA 5KSUB 4XMLH 1GPOH 2GPZA 3ZL2A 4URKA 3W2DH 2N59A 2A73B 1AGFB 2YKLH 4JKKA 1P6AB 4ZOEA 1N5YH 2YGPA 3EGDB 1W91A 2ICEA 3QUGA 2BVTA 2WXNA 1AAJA 3EJUA 4P3DB 1WFIA 5EU5A 5MENE 4IBUA 1J0JA 3KLKA 1NDGA 5FM4A 3MNVA 1I8MA 4LARH 3PJSB 3ULVD 3PNWA 1B4RA 4HP5A 3MACL 3DTUB 1RFDL 2E7BA 2GSMB 2IANB 3P9LB 4LDOB 4I48A 4QXGH 3TO4C 2LV4A 1U8OA 2OZNA 4K9EH 3S37H 3UEQA 1QLEH 1N4XL 4DUVA 5EC1A 2H3XC 1AR1B 4FCAA 1XGPA 3ARVA 5DURD 5IQ7L 4GBXC 3F6JA 4A2EA 5EOQH 4YHNA 1IAIH 4UT6L 4CC0A 2ZXGA 3ZE0F 1E67A 1YYLL 2LFEA 4GRMA 1F4YH 4QJ5B 4X7TA 3HS0C 1TVBB 3MJ7A 1E28A 2EDNA 4TSBL 5I6PA 4OJCA 1P5VB 5EIQA 3ESOA 5DC0A 3N44F 3P4OA 4OI9A 5A43C 3KDPB 2CAKA 1JXJA 3MV9E 4PJGB 5HGHB 3N1QC 2XN9E 2H0PA 4U6VL 3TPUA 5E2TH 2WXQA 2G2RB 2HFEA 3F7QA 4K94L 1FNGA 2OX5A 4WSKA 2PWGA 4L3ED 4YDVB 4JL1A 5E5MA 4Z0XB 2JJTA 3WHXA 1XF5A 5C9JB 5IESH 2CCWA 2IG2L 2B08A 2F1AA 2NY2C 4IOSA 4PRHB 1JGDB 1VFOA 5CGYC 1ACYL 1N8OE 1RSYA 4EQ3A 3QQ3B 4WWID 3C6LC 3T0EA 3QI9B 3NIGE 1FZKB 3FT4A 3I9AA 4FNLL 4HWZA 1VRSA 3NT0A 4LESA 4MXWH 4NQED 5CSZA 3C08H 3QHFH 4FN0A 3ZHKA 5ERWA 1G6RL 1YEKH 3UZEC 3CU7A 3STLB 4NPYA 4LSSL 1A7OL 2FWOB 3ZL4H 1JZ2A 1UT1A 5ILTL 4AXWA 1D2OA 3GO1L 1T2JA 2FJHB 3AWGA 4NUGL 4RBPK 4TVUA 3WIHL 4EI6B 2VZ1A 1ADWA 2DQMA 3MFFA 4FRWA 1U36A 1MN4A 2ADJB 3OC5A 4JHZA 4ODUA 1RUQL 2IALA 1YNKL 4PJGA 4U6TA 4G6ML 3D50A 3ARWA 4YSSA 3U46A 2R83A 5B38A 2AGJL 2GKIA 2L3BA 3BD5A 1EUTA 3UTQB 3DVGA 1ZHKA 4GBXD 4GRMB 4NFCA 2IADB 3RU8H 1RZFL 2I24N 3I50H 3WUWA 2H9GA 1B88A 1WWWX 2FYVA 3V6FA 3MJ7B 3BGMB 1X9UA 4XBGB 1BQUA 4F58H 1CT8B 1EBPA 4MHHG 4OZFB 5L7XL 4OGXL 2Z0BA 3CJJA 5IUSA 3MDJA 3BT2H 4YNYA 3O2VH 5GGQH 3TN0A 3P4NB 3QEGL 4X8CA 5HHMD 2BIIA 4XP5H 1PZCA 4JRLA 2G0KA 3RVTC 1R33A 5EC2A 3MRFA 4ZW6A 2Q76A 1I7RA 4WTQA 3U7YH 1TQCC 1QR1A 3GSWB 2WBKA 4L4TA 4PJ5D 5T5FA 4N5EC 3QO1B 2YEZA 1U3HC 4LKXB 2CIIA 1VADA 5LGKA 3F62A 1U8PA 4IKKA 3WUZA 3CN2A 3CFIC 2EC9U 1YEFH 3T2NH 4IHBA 1QPKA 4L8CB 5FCSH 1MCWM 3VXPB 5IR1B 2KHAA 2AI0H 1ZWIB 3S5LG 4HOWA 5IV2B 3RGVC 5TE4H 3K1DA 3IDGB 5JXEC 4PY8I 1FV1B 3DROA 3VGBA 3PWUA 3DK2A 1YY8B 4OI8A 3IJ9A 4P2QA 1UKTA 3AAZB 2DQDH 4AJYV 4K07A 2NXYC 3DECA 4FFYA 4HIHB 5K1JA 3V6FB 1O7SA 1NGYA 3BZ5A 2RJMA 3FU7A 1UCTA 1IKNA 1DVFD 1IKFH 1QO3B 2V3DA 4JFEB 4P4KA 4UU9A 4IEFB 1PU0A 3PWVA 1Z9OA 5I23A 2VDPH 5TK4A 3BUYB 2H6OA 3H7BB 2IALB 4LCCC 4OCRH 5C7ZA 2WLHA 3GUFA 1MAML 4IRJB 2VABA 3IRPX 2BC4B 1WAEA 1OAUH 2C4FT 5C08E 3TVMC 1B6UA 3AS0A 1I9EA 1T5XA 1WA1X 4JFDD 3RJDA 1VZHA 1DQDH 5D2LE 3GBNH 4Z7QB 4TNVF 4KO9A 3MRDA 4JG0H 4S11A 2C9AA 2XBDA 1X44A 4XPTL 1H3PL 2AERT 1LO5A 5LG6A 4MJ4A 3ORJA 2QQNH 3ROLB 3VJ6B 2OL3L 4TSAL 3Q9QA 3RA7H 4Q14A 3UC0H 1ACCA 4G6JH 3U2JA 1ZY9A 3GRWH 4JFFE 2RCSH 4PRDA 2VAAB 4Y5YA 3UYPA 1X4ZA 4M1CD 4Y5XC 2HTLD 3DMMC 1PBYA 1M56B 1G9ML 4KPHH 1WAAA 3UZQA 4FL4B 4N5ED 1VEPA 2Y3AA 3BP5B 1YPZB 3NACH 4ISVB 2SODB 2BFGA 4KO5A 1M6UA 2CBMA 4ZFZB 1BD2E 4JFTA 4YSTA 2HTKD 3DX1A 1OSZB 5DRZA 4ONOA 2VLME 4E42A 1LO4H 4PR5A 3ECWA 4JZOA 4DETA 4HS6B 2IDFA 4LZKA 2QQLH 3CFCH 4G6FD 3TA3B 2BIMA 1QFUL 3S35H 2OMVA 3RWJA 2BVQA 2ALWA 1C5BL 4LSTL 4MQSB 4OIBA 2Q7YB 4ADIA 1IAMA 1C5BH 3L4YA 3TOPA 4BWWA 5HVWA 2XICA 4X0KA 2OXGA 5CFAA 2X4PA 4QRFA 4WWKD 1OEZW 4MA1B 3SKNA 4H8PA 3H9SD 1CGXA 3T08A 3L7EB 2QVTA 5BZDB 4XXDB 4AT6A 1E90A 4LF3B 4F3FA 2Y6SC 2MRYA 1XT5A 4UIMB 1ZLUK 2EEDA 1D5MA 4URTB 2OA9A 3OLEA 3ZUCA 4JO3L 5JOFA 1UFGA 2VR7A 2KS0A 3NFNA 5D1QC 4JCLA 1M3JA 5LN4A 3RWCA 1XL6A 4PH8A 4PGZA 2DBJA 4R9HA 1P84K 4KQ4L 3VXNA 4B9CA 4A7UA 5AB9A 4JM2A 1GW0A 2YA0A 1QYGH 4N5UA 5DJ2A 3EJPA 3L4TA 1KT2A 5TE6H 4UILL 5F3HA 3BZFB 3VQLA 3HUJF 4QRRB 1ZLWK 4HPOH 2HMIC 3O45B 2JJWA 4FFZA 2P8LB 4J3VA 3V4PA 1SXZA 1W8NA 3GJFB 4RRPG 4X9BA 4DKEL 5MEQA 5CJQL 1LTXA 2XKSA 3QK0A 4BQBA 1PSKL 4HCRL 1Q4NX 2WM0A 1WWAX 5BZWB 4DO4A 1N0LB 2MTAA 3CC5A 2NPLX 2BNUB 1P53A 2UZXB 5T3ZE 4YLQT 3LRMA 5AKTA 5ALCH 3WAJA 4MFHA 4HK3J 1PEWA 5JYMA 3ZDZE 3LEVH 4P4RA 5C08A 2ICWB 4GS7B 1GGIL 1TO4A 2AJZA 1TETH 2DQDL 2DQ6A 1T04A 4ZS6D 5CLWA 3BAEH 1PL3A 2WZAA 1BXAA 2V2WB 2NXZC 3L9YA 3WEXA 1T3FB 4S1SL 2X4NB 5J57B 5CR8A 1J8HA 4V33A 4FFZH 4M48L 1YNTF 1UWXH 1MLBA 1FCGA 3DV4A 1Q1JL 4U6XB 1IJ9A 3FU6A 5F96H 4AG4L 3NDYE 4AQ1B 4XP1L 3SBRA 5MEPA 3IGKA 1G9EA 5JOEA 1N0XH 3HG1E 5TDPA 2MJWA 5ID1B 4YXLL 3KLLA 5ADPH 3HMXA 1VCAA 4BQ6A 5E08L 3AM8A 1LL1A 3L1GA 2G5RA 4ACPA 4HCGA 4IIQA 3ZHDA 2ITEA 3SE8L 4QRUA 3AREC 2PW2B 1BYNA 1FH2A 1BD2A 4EI5C 2P8PA 4HKJA 4PJFA 5EDSA 3EFFA 4XVJL 4MD4B 4ZX3A 1HINL 4HWBA 3DIDA 1NGPL 4DP5X 1SZNA 1ESOA 5TH2B 2NY5L 5LGHH 1ZLEA 1A6UH 1LEKA 2XWJB 5ILTH 3C5SB 2YPKB 2YD9A 5E2UL 4U0RB 5IFHL 1PTZA 1RSFA 1X7QA 5KJRL 4UMSA 1RZFH 4XHJD 4LBEB 5DJXB 5E8OA 4PW3A 4OZGB 1TNNA 4P2RA 1IC4L 2IBZX 1S7XB 1M7DA 1QTPA 3RWEB 4OGXH 3CVIH 1F58H 1GZPB 3MBWB 5FGSA 3D2TA 3QFJA 3CGTA 2QQNL 4N2BA 4QD2E 3UC2A 2WBWB 1Z32X 1WBXB 1MAKA 3QJSB 4U2YA 5F7NC 1FZOB 3R18A 4IRSB 4MA3A 2A3TA 4NUGH 2N3JA 4QGTA 3MXVL 1MFAH 2A77L 4OT1H 4Z7UB 3SGEH 1QFUH 5D8JL 1EIBA 2JIXB 2XX1A 3BKCL 4HUCA 4OGQC 4WEMB 1KSRA 5DFVC 1P5UC 2E56A 3QHFL 3LN5B 2VQTA 3QR0A 1Z0NA 4NNYA 5EF0A 1GGCH 3KBFA 2YQGA 3U1SL 1TVHB 1TKWA 2P49B 3HE6C 3NCJH 3QEQA 4IU3B 3HE6B 1A7OH 5FYJH 3FCTA 2FGWL 5DQ9A 3QULB 2FEDD 4F9LC 1RLWA 4OM0L 5B4MD 1YN7B 5KSBE 2CK0L 3EH5B 2MH4A 4FABL 1WT5C 2IH3A 3SEPA 5EEVA 3B9DA 2ZPKH 4JCMA 4ERSL 1JDCA 5FKAA 2ZF8A 2J55A 1T7WA 5DD5L 1I7RB 5HYSG 1SF3A 2OAAA 4LSQH 2O6FA 5FLUA 3S97C 4QCIA 3L1OH 4FJYA 1QD0A 4EE2A 3O41A 4QTHB 3RTQA 4EI5D 5BVJA 3JYBA 2CJUH 4CJ0A 3UBXI 3B3BA 4R90L 1A9BA 4Y88A 1EH9A 5D7IF 3MBED 3HJ0A 2MOQA 3DX6A 3C75A 5IEKB 3IJHA 1TTRA 3QQXA 2YPVA 5IVXE 1WE5A 4JMNA 5I28A 1L9PA 3MV7A 2YA2A 1I1YB 2FO1A 1Q9OB 4QHKI 1E4JA 1XB8A 1A6WL 2VERA 1R5WA 4LEOB 5JIIA 2YOCA 1CLZL 1UQSB 3B8YA 2CGZA 4ABQA 3KPOA 4AZUA 5DUMH 5F88B 3CX5K 1RURL 2QPSA 4UZGA 1BX2B 1IFHL 5T1MA 2XN2A 3JVGC 4L3EB 4DHLA 4RAVA 1NLBL 2IAAC 4TSCL 1IGYA 3LIZA 4R7XA 5HHXH 5DJZA 4ZDHA 1RJLB 2UX7A 3DV6A 5HXMA 2ADJA 1XO8A 2MOVA 4AUUA 1ECYA 4G43A 4LXFA 4P46C 2P8MB 1YEGH 1AXSA 1SYSA 3V95A 4NM4L 4FQLH 5DD3L 2R0WL 4FFWD 1OP3K 5B39A 3LZFL 4IM8A 1XEUA 2WIIA 3MRHA 5DJ0B 1EZUA 4J3UA 5E1GA 3RP1A 3ZE0B 3V0WL 4ELME 2OCJA 1OE3A 4DP9X 3E6FA 4GQ9H 3GMPA 3CPUA 4UT6A 4JO5A 4CILA 3VWJA 1AKPA 5EIIB 5IQLA 3VFMB 1T4KB 3PHAA 3REWA 3RURA 1P1VA 2IDCA 2QKIB 4OY9A 3U4EB 5TDOB 3MUGB 4NRXA 4ZUSB 2IGFL 5CWSA 3S2CA 4OZHA 1B0GA 1E8ZA 1UVQA 3U48A 1KB3A 2HVBA 1TIUA 1PX4A 3QEHA 4XNDA 4BUHA 3LVEA 4NUJB 5D7KE 3P73B 1SFDA 4WK4B 4A66A 3KPRD 4WCYL 1NGQL 4F8QA 4P9HL 2FBJH 4KJYB 1ANUA 3Q9PA 1PZSA 3ECVA 4NQTA 3T0DA 1MHCB 4EN2A 4P57B 1BX2A 3KW8A 5T1MB 2JKXA 4B41A 4KKAC 3K4ZA 1IC7L 3QZOA 2HKFH 4JRXE 3IRZA 4WFGE 1OAZL 4C56E 4JN2A 4MCYA 3MBEB 5DHYB 4LP8A 2Q86A 4NAJA 1L7TL 1QWHA 4JGNA 1S78C 2ZWYA 5I1JH 2DIJA 1KJ3L 1J8RA 3OX8A 2AJYL 3OBAA 3SQRA 2WXIA 3WIHH 3C2SA 5C3IA 3AT9A 5CJBA 3AQXA 3EYOA 3DX8A 2UVEA 4LL4A 1BVKB 4UYPA 1N5AB 3BVNA 4X6DF 2OMZB 3QCUH 3KXFB 2VERN 2YGQA 4KXBA 4GKSB 1SQMA 4NSKB 3MNVB 1I8MB 3B2VL 2XDHA 4XH2A 3QEUB 2P26A 4QHMB 5ICYB 3J8F7 1Y1UA 1AKJA 3GXMA 3DTXA 4FNTA 2P5EA 3MRGA 5GISL 4F20A 1MG3C 2A9NL 1E8WA 1CG9B 3MA7A 1N19A 4HS8H 3KPMB 3ZE1F 4QF1A 2WMPA 2YK1H 4NWUH 2NR6A 2NNAB 3KWUA 3CVCA 2ZOKB 2A73A 2JQZA 5EUKB 4Y1AB 3IT8D 4K3JL 2I25N 4KKPA 4XMZA 5GJTL 1EJFA 4M7LH 4MXQC 1CR9H 3QH3A 3GNML 1U8MA 4FNRA 3VYOA 4Z7NF 3K72A 1JF5A 1VFAA 1GY1A 3VTTA 3DJRA 1B90A 5AZUA 3L45A 2YR3A 4DGYL 4JPWH 3QG6A 4U1KA 1VSCA 2DAVA 1F3JA 2X0VA 4L1TA 4WEBH 1S9XA 4NQSA 4NT6A 1A6AB 2WO2B 1A25A 3KW7A 4FULA 3AITA 3HPJA 3H3BC 2UZYB 3LCYA 2BLFA 5IGXH 2XWBB 3KH3A 5DEFB 1A9EB 5J0BA 3K5RA 1LO0L 2NY5C 4L29A 3R8QA 2FIKB 5D96B 3IMVA 3IFLH 3V0DA 4PJXB 3FS9A 1ZSDA 4B50A 2IV8A 1II4E 4UINL 3RKPA 2MCPH 1W72H 5JHLA 5LQBH 4Z95L 5BV7C 1KC5H 1RY7B 4MBRA 1M3IA 1M1XA 4PS8A 5I8CB 4X6CA 4DQOL 3GLZA 3L7EA 3PWPE 1R24B 2Q3AA 2QGBA 2XG4A 2K3TA 3LD8B 4E9YA 3RPIB 2J20A 3BH4A 4LK4A 3TJEH 3V4UL 2ROXA 3CX2A 3KHOA 4MCNA 1I1CA 4QRQB 4U3HA 3VRJB 1JF1A 3S36X 3ESPA 3K6FA 1QFWI 5DD6A 3SYOA 1BIIB 3PWJA 1Q9WB 4E9WA 2X6MA 3KS0J 5BXFA 2PP8A 1KGJA 3RL1A 1AMXA 3QUMH 1LNUA 2IOMA 4PV8B 3FT3B 1KBGL 5EIIG 4H25A 2AK4A 4CNIB 1IGIL 4P23A 1OT2A 3FHAA 1K5NA 1H8LA 1IFHH 5CF3A 2FIKA 5FHBL 2X6AA 2CIKA 1W6LA 4XXCC 5E4EB 3CCHA 4EAEA 4O2CB 2NDFA 3PIQB 3GSNH 2AJVL 3ZDYB 2GFBB 3IYLW 3VG9B 1VJSA 1QFWH 3DSNB 3KH4A 4OF0A 4PJIB 3WKML 4BEIA 3P02A 5AB2A 1EHXA 4PJEB 3S8GB 3CZNA 2GYSA 4F7EA 1DQJA 1A4KB 1S9VB 1SN0A 5G4MA 1AMYA 1R3IH 1F18A 4XN4A 5E8NB 2BWIA 3P0VH 5BO1L 2WINB 5KJ4A 3US9A 4AYDC 3IS1X 2BSEA 3G6JE 4G7YL 4YHZL 4ONFH 1ZGLM 1JD9A 4J3WA 3F7PC 3DRTA 4K7PL 3MNWB 1D6EA 4OM1L 2MQGA 4FNSA 4ODWA 5ID0A 2VTFA 1AY1L 2H47C 3D0VA 5ACZA 3V4VH 3X2QB 3ULVE 5AVQB 3HKFA 3KJ6H 3JXAA 5T3XD 4GOSA 3MNZB 5IR1A 2H2PD 3GLEA 1G9HA 4YPJA 1J10A 3N91A 1KJVA 1NL0H 3PWPA 4P4KB 1F4HA 4UU9B 3X1GA 5ESVB 2CZNA 2NUPA 4Z3GA 1YN6B 3MGTB 5TDNB 2AZAA 1DQTA 1CLOH 1U2HA 4HHWA 4JO4L 5I71B 2AK4E 3PLYA 2GHWB 4JO3H 3SDAB 1G1CA 1NIAA 3ZE1E 4IHOA 1HILB 1KGCD 1YY8A 2JMRA 4PJBA 4HFWB 4NQDA 5GXBB 3SDCC 1UWFA 3L3OC 5LBSH 3MLWH 3BAWA 4GBXA 5GGTA 4QIRA 4P2OD 1JZHA 4MS6A 4BFIA 1XBDA 2BY3A 2ZWZA 3HS9A 3RTQB 1SJVA 1JK8B 3BGMA 3DNKA 2VGLM 2F58L 3H55A 2VW7A 4K5OA 4I3SH 1KB5H 1L6PA 5IWLA 1ODAA 1QNIA 1R9FA 4LDEB 1DVZA 1TXKA 2HT3C 3FH5A 4NIYE 3VGGA 5JHDA 1EEZB 4Q9QL 1SLWA 1T5KA 1X4XA 2EDRA 2OR7A 3BLPX 4OFKA 4TYUA 3VSVA 3MRFB 4NBXB 4A55A 4NQCE 1EANA 1U6AH 2EVHA 4YHPB 3AB0C 3TX4A 4FNUA 3ZT5A 4EI6A 5KVFH 5MEND 1FLRL 5E70A 4GSRA 4XXWC 3B7SA 1XH3B 5DRXB 1D9KD 1M2VB 4KI1A 3FTYA 1BOYA 1CGVA 2LAGB 1B3JA 2XWZA 3UYPB 4ZMZA 5JXED 4TVPL 5DVKA 1IC4H 1BLIA 3AG3B 1FZJB 2DM2A 1CN4A 2XACC 2Z31A 1XF2A 2Q86B 3VI3B 2Z4QA 5C8JA 2YRLA 4U33A 3V8CA 3UTSA 5E03A 4TXVB 5ALBL 3O2WL 2BINA 2EDFA 5KW9L 5DFAA 5CBAB 3T3PE 2EYSB 2G2NA 2H2PC 4X6DA 1E43A 1RZ8B 4PJ5A 3QAZB 4PJ8C 2CKNA 1XF4B 4M5YL 4FQXB 4LHUG 4ZUWB 2XPGB 3V5HA 1CXKA 4XN8A 4JFUA 1OGPA 4LEXH 4YAQB 4G8IA 1I9IL 2OPCA 4P5MB 5SWSD 1JHLH 3ZZQA 2DL2A 4PJ5B 1NGXB 3IFPA 1IGYB 3HMXL 4RDBA 4YXLH 5TDOA 4RWHA 4DKFH 2CLZA 2NX5B 2GUOB 3IJSB 2J44A 3P77A 3WO4C 5IFHH 2QPDB 3ZKQD 3MLRH 1D6VL 4OKVA 1P5VA 5D1ZC 3W5MA 3WHE1 4OV5A 1TVBA 2M26A 3DGDA 3OGCB 3R1GL 4P2OC 2OTUA 3T8XA 1FG9C 5CSGA 4HMCA 1NCAH 1NJ9A 5DJ0A 3QIBD 4HULB 4NDMA 1I3VA 2D0FA 2JB5L 3L8QA 3PWUB 1YA5A 3RY6C 2FRGP 1LMKA 2YD2A 3JV5A 1QBLL 2NR6C 35C8H 3I3BA 3SKJL 4PFEA 3OHXC 3GC3A 4E0RB 3BIBX 3NEOA 2B2XH 2EDMA 2LW3A 5EHFA 1KFGA 1T66C 3NIDF 3NIFE 2A99A 3E7JA 3IFNH 3A4FA 3BAIA 3MJ6A 2JFCA 5J12C 1KDIA 3WXWL 1PSKH 4N86A 3B7YA 4OIAA 4C47A 5F21B 5I1HH 5I74B 4IBZA 2KLSA 4HC1A 4TLKA 4NM8H 3QARA 1RZJL 1A7RL 3JT0A 1QSEB 2IF7A 2VXSH 3L9BA 4JO4H 4OJYA 5HVHC 4HEMA 5DZNA 3ESUF 2DKUA 2W9EH 1KBVA 1RK0A 2EIMB 2IEPA 5IM7B 1TQTA 5KSUA 4JY4A 4KDWA 2CO6B 4P4RB 1G9NL 3VI3F 3U25A 3GDBA 3SPGA 1JXGA 3FT2B 3N0AA 1QSVA 4KMQA 2X2JA 3KMDA 4HJ0D 3C60D 3FTGB 2CHNA 2WLIA 4DO6A 4G8GE 4FCHA 3VRIB 5T1LD 4YDJB 5TDNA 4HGWA 4N3TA 1EHLL 3BEWB 3MOAH 3ATFA 4GKNB 1T6WA 4LMQE 1LMIA 3ARGD 2OSLA 2QSVA 2XQBL 3QZMA 5A16B 5LBVA 1MF2H 1RVFH 3G6AA 4KUZH 3GJFA 4H1LG 5EO9B 5JXEA 3ZJAA 3F7VA 1QMUA 3OR6A 3EGSA 1J5OL 4QTFA 3Q8CA 2H41A 1MUJB 4GSDH 4BV1A 2E3VA 5AVUB 2VLJE 2QLYA 4Z8FH 5KVEH 1RZ7L 1OHQA 2XZQH 4XVSH 3WAKA 4DQOH 1ONQA 2AK4D 2PCPA 3LQAC 5EMYA 3KPSA 4L18A 5ISZD 2X28A 1FL6A 5KS9A 1RU9H 4Z7VF 3WCYA 2CQVA 4F27A 5KYXB 1JBJA 4XTRC 4ZQKB 4ZODA 3MGOB 4IJTA 2GFBA 5DMGD 1FIGH 4JX0A 4LLDA 4XP6H 4MWFA 4NHUA 4OLZL 2BX5A 1MVUB 2OCCB 5D5ME 5DS2A 3WD5H 3SBPA 4PWHA 4Z3TA 1IBDA 5EUOA 2NTFA 1K72A 4MZ2A 4WFGD 1MWAL 2Y2TA 1U92B 2VJ8A 3V5DB 1GMIA 4HSCX 4UV7L 1IMHC 1F4WH 2HX7A 3W0WB 1OT4A 1IRAY 2Y07H 1QRKA 3LIZL 5E6IC 1J11A 2OSYA 3Q2LA 5CLTA 1F5WA 4YHMH 3EO0B 1FAIL 2F5BL 1G7IB 3T9WA 4MXWL 2XYCA 3SDDC 5FR3A 1CFNA 4IRZL 4QJ3B 1GOHA 2M2DA 5A2LH 2IWFA 4H88L 1E6JH 1IKFL 3T4AC 1CQYA 2XWJA 2QTEA 4GG6A 2ZUTA 1LYQA 5DZLA 4IKIA 3WJMA 4UAOC 5ESAB 5I9QB 1YNLL 1OAUL 3SPVA 2OTWA 1W72B 4HJ0C 3ZVVA 1E5CA 3ARED 4YN3A 4Z77B 4KXAA 3KXFD 2JKTM 4CA4A 1XR9B 5ABZA 3L3JB 5KYXA 3DXAA 4CADA 5C09E 4YBHA 3MRBB 3ERXA 1XB3A 2L4OA 3HG0A 3QUKA 3V4VL 7PCYA 2ZOLA 1OXYA 3RTQC 3LKPB 1KTKE 2R0KL 1GZQA 3D2UB 1CDHA 1U42A 4MJJA 5JO5B 4LAJH 4HIXH 2XZCL 4LGRB 2EVIA 3HRZB 5HGAA 4R83A 5CP3A 2FEJA 4JFPB 3S7GA 4OCWL 2WWKO 5A6IA 1CBVL 2IH8A 4ZMQA 2BVPA 3A4DA 1EEZA 1YEEH 2F1EA 2BCMA 4F15B 2HT4D 1A14L 3EGDA 4LVNC 1S5IH 3OMZA 4PJFF 3T2NL 3IDJB 4BXVA 4YS4A 1FWXA 5CJ5A 2IQAB 1R0AH 2DF3A 4LLVA 4RAUB 1ETZA 3WTXA 4J6RL 3MACH 1ZSHA 4M1DH 5I17A 5I9QC 4P06A 2I9TB 4QRTA 4LARL 1ZK5A 4RMQA 1FUNA 2P5WB 2YC1A 3NEEA 4OU3A 5DURB 2AJ3B 4LCUA 2ZUXA 2H8PB 3L16A 4HXBL 3VXOA 5A2KH 3RY5A 4G7SB 3KPMA 2GI0A 3BT2L 3BRGC 1M9SA 2HLFC 1HSBA 3WLWD 3TP4A 2F7RA 2YAEA 1ZHNB 3NGBB 4HJJH 1AZUA 2V7HA 4R97B 3QNZB 5SV3A 4JFPA 4P5TC 4U0QB 4RMSA 1PGRB 3BGFC 1KWKA 2RHEA 1JL8A 3R4DA 1OP5K 2PR9A 4ANUA 5CP7B 1B4JH 4U6YA 3TFKD 1BVKA 5DO2D 1CL7H 3LTVA 3KXFA 4BIKA 4GS7C 3L3JA 4XVUC 4ZAKB 1WTGT 1RD6A 1H5BA 4EUPB 5DXWA 1IEBA 3KM1A 4Q8BA 2ENQA 2PO6B 1FGVH 3C6SA 5I1CL 4ZO7A 3G6DH 5IHHA 1SUHA 1R3KA 2A1WL 3ULUL 1YMME 5FXCH 3WTUA 5BNXD 4NKIH 5BOPA 3RLSA 2JIXD 1UM4H 2V6HA 3CK0L 2ZSWB 5HI3D 4L48A 4AENB 2IWEA 4X6EB 4OGYH 1J5DA 2MCMA 5E8PA 3MV7E 3THMH 4U4IA 1XXDC 3F6LA 3OF6A 4V11A 4Y4KD 2F8XC 4XCEB 5I5MA 2RD0A 5KSBA 1UATA 1TZ8A 4FQQA 3NIDB 4L1LA 3LKSB 1J1XL 2JKLA 4PS3A 3L08A 5FHAH 4QMEA 5HJGA 3UG3A 1M57B 4UT7L 4XCEA 3DGCR 3DO3A 2B9AA 1A22B 4JREC 2H1LM 3SYCA 1JMXA 2APFA 5E2WL 3KYOA 4QRBA 1QSFD 1F6AB 4ZFGL 4OD1L 3CWGA 1TJGH 2MFNA 3UTTD 4KGLA 5FFGA 3WE6A 1CVSC 2R1YA 4GQPH 1SVBA 4ZW8A 3X3FH 4NFDA 4C56B 2WTRB 5E99L 4BSVA 1KIUB 1M1XB 1MFNA 5CEZL 2BY0A 2HLFD 3ULSB 3BP7A 2AFNA 4QT5A 3P2DA 3L3GB 1C12B 2D0HA 4N1CA 4R2GB 2HJKB 5I0DA 4U1HB 3HAEH 2YEVB 5FKPB 4EZLA 1ZT4B 4MNGE 3QYCA 4KBPA 1IM3B 1E9PB 3OR6B 1FQ9C 3WNIA 1JWMB 4MMZC 4WUUE 3WTWA 3D08A 4UNVA 2BZDA 1YEEL 1ASOA 4GUPB 4RGNB 1P9MC 1CBVH 4JGMA 1IU1A 1NEPA 2UY7B 3EGSB 5LLIC 2XU9A 2GAZB 3B7UX 4RSVA 2F53A 1ZGLA 3IMRA 3U1PA 5FO9B 2H5UA 3L5HA 4X7TB 3UPRB 1MREH 2WWMD 5T5FL 3S5LB 2WYTA 5FCUL 2HFGL 5IK3A 4FTDA 4P2QB 2CLRB 2AEWA 3KPSD 2WUCL 1WTLA 2Z91A 3NCYS 3O8XC 1TZAA 4NQCD 4WU7A 4Y16A 4H8WL 3FU3A 2C1OA 2E9BA 1DEEB 2N1KA 2Z31D 3U0PA 3PRZA 5E9NA 2ZONA 4M61B 2OCFD 3INUL 3FSVA 3HHSA 1PQZA 3FB7A 4JO2H 3FUFA 3QIUB 1UA6L 1BAGA 2E7CA 2VN7A 3QAZC 4PJ8B 2D4DA 2X4QB 4JHWH 1FZMA 1JRHH 3CMGA 3IU3A 4CN1A 2GK0A 4OZFG 2CUAA 3APDA 1I8LC 2CG9X 3SDXB 1TKWB 4LCYA 2F54E 5DD3H 2NMSA 4YO0B 1KPUB 1B4JL 2Z8RA 1BAWA 5GRVL 3GF8A 5I1DB 1ITBB 1RUMH 3AQDA 5IMMA 5EZJB 4Y5YC 3WD5L 4OCYL 2F53E 4NZRH 1RP8A 1UWGH 1ZS8B 1MRDL 2VDLB 3FYIB 1NJ9B 1FGVL 2FT8A 4XPBH 3RDTA 5I1CH 4OCSH 1GJIA 5HHPA 3RUGB 3DSNA 3GKZA 4PJIA 1FFQA 1Q1JH 3PQYE 1RV6X 4PAZA 3CFKA 4F7PB 4FKHA 4NO0B 4TUKL 2X09A 1FVEA 3MCYA 1VKXA 3EOTH 5I6OA 1SFHA 5D1XB 5KJRH 3CHRA 1A3RL 2N0KA 5E2UH 1S4IA 5F1KC 43C9B 4DGUA 4HOZA 3GMLA 1BQHG 4HJUA 3OAUH 5E8DL 4P23B 1DVFA 1AG6A 1LILA 5AW2B 2MMXA 3E1F1 2Y6TE 4EOWH 1LVEA 2TRHA 4X80L 1HC1A 3CBJB 5E1HB 5IHBA 1PX8A 4FJZA 3FUDA 1OARL 2Z35B 4XMVA 3OKLA 3UERA 2WGNB 4QRQA 5BS0D 2V9TA 4IKJA 4PWKA 3E6HA 1NIBA 4MB4A 3KVQA 3QI9D 5SWSE 2DICA 5BVPH 2HJLB 3OLDA 1A02N 4J23A 3V8OA 2H7WA 4R26H 3G5ZA 3NCXA 1KB5B 4WO4C 3I9GL 2FB4L 1HL9A 1URIA 3EF7A 5EF1A 2WJ5A 4M6MH 5J11B 2F18A 5K9JH 4NZUL 1KCSH 5D71L 5JNYB 3BSGA 1XD0A 5C0CE 2DM4A 1SYSB 1NOFA 1IARB 1IBBA 2FGWH 2VQUA 4NM8L 1ZA6B 3RX5A 3UOAB 3UX9B 4FFVD 3QFGA 2B4CH 4Y2OB 1A14H 4AIZB 3I3EA 4L3AA 4LCYB 1MIEH 4CRPA 3FAWA 4HD5A 3MR9A 5G5DA 3FT1A 5BMFH 3JWNG 1A4JB 1YC7A 4DEUA 2FX9H 2QQKL 5D7KD 4ZO6A 1A4CA 4NEHB 3LQAH 4AV0A 1XXFC 3PWPD 2X70A 3NCJL 4JY6A 4OIIL 4I2XA 4U1MA 2AQQA 4ZOBA 2WAQA 1BFOA 1CWVA 2MPVA 2ZX9A 3UG5A 1A3ZA 4RNRB 2Z64C 1G1YA 1UZGA 4NAQA 1V10A 3CC5B 1K8DA 2DJMA 2O1AA 1V05A 2V9QA 4FABH 5EEZA 1YDPB 2R29L 2DQFB 4MDJB 3D39B 2CRYA 3WFBL 3T0XA 5FYJD 4BUQA 4YDLC 1ZGLB 2B5IB 1EFXB 3PWNB 5BS0E 4GLRI 3L2MA 1PZDA 3BX7C 1NEZB 2WSPA 4GAJH 4KI5F 1LE5A 3GSOA 2VJ0A 2HCZX 1Z9SB 3BVTA 4I8DA 3VXMA 3ZGHA 4PJAB 1G7MB 1TTUA 1RZKC 1FGNL 1AGFA 1TMCB 1U93A 4BCXA 1HT6A 1I1FB 3ISWA 3DRTB 4L5FE 3ZQ9A 4PYGA 4MNHB 3TBSA 3QULA 1S6NA 3S3DB 2K1MA 4HDIA 5DMIL 1K5WA 4M3KB 5GRJH 2GJZA 3UZEA 5GGRB 5K9KA 1NINA 4GSUA 5DRWA 4D0CA 2DKMA 1BJMA 4I0PA 3VXRD 4ECNA 3I9IA 5T5NF 4Z77A 3DX9B 3GB7A 3SYPA 5I1EH 5FWRA 4DP1X 5DK3A 3SDCD 4EPSA 2VAJA 2UWEF 3D4GA 1A4KA 2N4IA 1F02I 1G5GA 3APNA 3K6SB 3TA3A 2YPLE 3U4BL 2L7EA 5GS2H 1NBZA 3SJVD 1QX1A 2JJTC 2J1ZA 1H0DB 3FFDA 3UAAA 4AG4H 1OZUA 1N2RA 1LQSR 4XZUB 2CDEA 4YXKH 3X13A 4YAQA 4AEIL 2H2SD 3P1VA 5IOKA 3HC3H 4WI0B 4GI8A 5ENWB 3CXDH 4HJIA 1H8SA 1LQBC 3NH7L 3FOMB 3AQYA 3O6FD 4NCDA 5GGSB 4YLCA 5IROC 5HYSA 4FTVE 4PGEA 3IFOB 2ILLA 3PJNA 3H9SA 4X4XB 5IEHA 3G6DL 2QKIA 2BNQA 4FXKC 4ZG1A 3N43F 5DQDH 5EEWA 3NTCH 3O2DA 5FYKH 3X14B 2P80A 3CXHJ 3K8KA 2GJRA 1YECH 4Y4HC 1WGVA 1BZDA 2X6BA 4JFQB 1F6FB 1QI3A 3T3MF 2ZSVA 4M5SA 3ZZSA 3U2SB 4LO9A 5IP4A 1RZKL 3BQUD 5HYJA 4WJKB 2VDML 1BM3L 4I0KA 4LRNH 1BV8A 1BM3H 4F33A 5CO1A 2BVYA 2CM6A 3HMXH 4HIIB 1E27A 1KV7A 1NKOA 4D8PA 2X0UA 3TBWB 4AL8C 4MA8L 3B1TA 1NL0L 4F7MA 4WHCA 1XSIA 4GSQA 4IRZA 3FQXA 3QXVA 4R5VA 1JPFA 3VFUA 2XG5B 4J4PD 1E2WA 2JH2A 4BE6A 2H0JA 5AW0B 5GGVY 3FU8A 1SY6L 3VXRB 3CDYA 1KLFB 4WFFE 4AKQA 3V4VB 1RZGB 5F9DC 2XA8H 1FVDB 2YUZA 1KENL 1KXVC 2KLRA 3I2CL 1ODUA 4QYOA 2NNAA 4MQTB 4V2CB 1MHEA 5CIPH 5FUZH 4KI5D 3V4VA 4H2AA 4ANXA 4XPFL 3WS3B 4DVRL 1BXUA 2HVKA 2ZKXA 2W91A 2WVSA 1D5ZB 2PABA 5AOMA 3FUJA 1NMBL 3MLVH 4M00A 2H2SC 3WUWG 4AUYA 1KBKA 4GRWF 4XCFL 4DN4H 2BCKA 5D7JB 5EZOH 1CGUA 1T66D 1QASA 4Q56A 3NEXA 1VGEH 4NP9A 3RY4A 2XWRA 4J8QA 2P80D 1N5AA 4A7SA 3U30B 2PO6D 5KANG 4OLXL 4E68A 4K3DL 3EOAB 4JHAL 3QWNA 4J3TA 1EXUA 3FTWA 3O3UN 5ISZA 8FABA 3DIVA 5JQIB 3CIQA 1PEZA 4MXVF 1ZPUA 1MCPH 1KB5A 2EXYC 4S1QL 4L4VE 1O5PA 1H3PH 1MAMH 3CLWA 4FQCL 4K0OA 5HGDB 2A9BA 2WKOA 3I6KB 4KAQL 3V52L 3BPLC 5JLZA 3WY4A 5MEOB 2A6DA 4XX1E 5I5RA 4YPGB 3FB5B 3VXTB 1NPUA 2P42B 4C4KT 5IJDC 4LVEA 4XNQB 5FS5A 3L3KB 3BVDB 3MLYH 3GFUA 3V4LA 3QEHB 3B2PA 4Y1TA 4PP2B 2NY1B 2OL3H 1FO0L 4PJHB 4M5ZH 3B6SB 1ACYH 2EAEA 4NRYB 1BQSA 2N01B 3GMLB 3MVSA 4E2OA 2D7QA 3WN5A 2YPVH 4AE1A 4APQC 5EUOB 5KG9B 2AMGA 5GRZA 1HHHB 2AV7B 3FU0A 4PIRF 1MVUA 1U92A 3B9KD 4X5RA 5DJ8A 3J2PA 1IM9D 1CI3M 3DJ9A 5D2LA 2YD4A 1CDYA 3GQFA 2FX7L 4EIBA 4PRHA 4QKXB 4EOWL 3CBKB 5HDRA 5MENA 1CICD 4XAWH 5JW4R 3QEQD 3SPIA 3MZGB 5DJ8B 1B2YA 1MZZA 3IGAA 3OLIA 5EZJA 5FM5M 1M71B 2YQBA 5L8KB 3JVFC 3G9VA 4ALAH 5J13B 1MY7A 2EP6A 1A3RH 4ONFL 4CDHA 2RTTA 1ID2A 1U91B 4WI7A 4ZDHB 4XMLL 2ZOWA 3C60B 3QWRD 4M6ML 3ILPA 2QFRA 5JW4M 2RQ8A 3I9GH 4J1UA 4CUCA 5JQ6L 3E2HB 3BUQA 3EDFA 1HIMH 1OGAE 4IKNA 3PDGA 4N85A 5EU7C 5IOPA 4YOKA 4PRHD 3PGDB 3FB6B 3B2VH 2C8NA 2GEQA 1T3FA 5CJXA 4PJ7A 5DYFA 4PWEA 2CO7A 4IGBB 3MQIA 4FA8A 3S8WA 5HYFA 4CL7A 1UQSA 2V4LA 1V27A 2DQCH 2FVNA 3MRQA 4QXGL 4MVBD 1HXKA 4Y4KA 3NRFA 4BFOA 4AY0A 3CH1A 4FZ8H 3QUYC 4APQB 3DSFL 4ZMOA 5FW8A 3HNTH 3FU5A 1U8MB 2A9DA 1RUML 2PPEA 1PYWA 4B7IA 1TQCB 3MV7D 4A6YB 1OF2A 1ZXQA 2ZUQB 2N1TE 3QPQD 4J7RA 4DGIH 1E42A 4PJBB 3GKWH 2R69A 5I1HL 3U7YL 1HI6B 4X6DE 3ETBJ 3K91A 3V9FA 5A2FA 4Q2ZB 5FO2A 5TE7H 3WMSA 3INOA 5C86A 2DMGA 3LIUA 4XCNB 3ARFB 3KCPB 3QCTL 2HVJB 3D0AA 4D8OA 3L13A 4ONGH 4DZ8B 1KXTA 5L7XH 3H6AA 1MVYA 4Q0XH 5KSVB 1T0NA 4PRNB 3HZ3A 5ICYA 4L4VD 2Q7AA 2WUCH 3JWDC 3RILA 1AR2A 1G87A 3VXNB 5IBTL 2EDXA 3ABMB 4ZTEA 2EXWC 3Q1SL 2ZXQA 5GSVA 1QTYT 4ODWB 2P52A 1D6EB 5DDHA 4OF6A 2FL5B 3E8UL 2YKKA 1AJ7H 1NZRA 5HHVL 3TN0B 2HXAA 1XAKA 2J8UE 2JCCA 3LRSA 3DX8B 3QEQB 5KVGH 4F57L 4U7KA 4RFNB 2AXWA 32C2A 4IOIA 2R4SL 1NCUA 3A47A 3U4BH 2WWOA 4KVPA 4Z78A 3HNSH 1GY2A 1AC0A 1I8KA 1CD9B 3HZKB 4CMMB 2DWEB 4UQ3B 4ZJ9A 5D93C 5KZCD 1I9IH 1N6VA 1NCNA 1BGXL 4FQLL 3GXPA 3L7FA 3GIVA 4P5SA 2O61A 3RWIA 5CEZH 2FR4B 1NCDH 3PP4L 3V5HB 1QRND 2FJUB 4W9HC 1JZIA 3W39B 4ATWA 1E27B 3CD4A 2NSXA 3D3VB 5IJBC 2W5PA 1BVNP 4GQQA 5I82A 2BY2A 1OM3H 1RUPH 1VACA 4BH7A 5A40E 1ASQA 4DEWA 3CN1A 2VUOA 2IBZY 2J8UB 2ZWLT 1YYML 3TBYA 2FEEL 3R8BB 3RIAK 4UT7H 1JWUA 4WFED 4CW1B 4WI5A 4GW5B 2YAMA 1FJ1B 4KFZC 2I7SA 1BW8A 3LKRA 4M29A 4X4XA 1QA9B 5GZOC 2YKLL 1I8AA 3K7UA 2KDYA 2PW2A 3IDIB 3G04B 2EDJA 3B6SA 2L0DA 2R29H 3ZKMD 4YO0A 4KROD 4HUKB 2HKFL 2VDOL 5HI3C 4PCYA 5DRXA 1CI5A 1GS6X 1A1MB 3H54A 1CBJA 5FX3A 1ZSDB 3R7QA 4FI7A 3HUJA 5L6YH 1T5WB 1KTCA 1QPPA 5LNDA 2Z8SA 4DEPC 3L4XA 4UZSA 1RULH 1OGAD 5E8PB 2DEXX 3ZO9A 1JTPA 4PJBE 2A6KB 3HNVL 5DGRA 1U2YA 2PUQT 3F8UB 2Q8AH 1IC7H 3GJFH 4KFMA 4OZ4A 1WS7A 5DLMH 4PBVC 5BRZE 3E38A 4FGMA 4MB5A 5K1NA 4HETA 5DTFB 4LVOB 2ZUUA 4H0IA 4XNYH 3QJXA 1NLDH 5CEYA 4PB0H 3RG1C 5E9DD 1MJ8L 3TJHC 2AAAA 3FQRA 1CXEA 3LDBB 5EU6A 4EN3A 1XH0A 2P5WA 4ELKA 1UJTA 4KDVA 1EXUB 2IAMC 5B1AB 1HILA 2EDEA 4YDLB 1N68A 3SGJC 3CAFA 2AJSH 1JTOA 4QNPE 2AXHA 1Q0EA 4I48B 5DA0B 3WKQA 1DQLH 2WZ6A 3ULVF 3AC0A 4E5XA 1EAQA 2WQSA 2AVFA 3GMMA 4LVNB 3VXRA 4WI4A 4JUSA 3TA3D 4Y9BA 5C0CD 3FSWA 3SOBH 3JWNE 4JM2C 4DN3H 2JLPA 1AKJB 2B1AH 2YUVA 3ZSTA 4E5XB 3DVIA 3C5ZC 5T3XL 1CYGA 1V54B 1UM5L 4J3SA 5DUPL 1JS4A 2Y22A 5DJ2B 2EZ0C 2Q8BL 4DEPB 1IGFH 3ZQWA 3SGJA 5A2JH 2E7MA 1OCCB 4OCLC 7FABL 5INCB 4B53A 4F3FB 1BQLL 2W1NA 3L9RB 3QW9A 1S7RA 4LSPL 3SDCB 5E8NA 2J5WA 1SDYA 5EBLA 3PL6B 5AW1B 1DO6A 2RMNA 2VDKL 4G6AC 1P7KB 6PCYA 5GZOD 3ZO0A 1M7XA 4DIXA 1GIGL 4PJ5E 4EDWL 4XNZC 3RGVD 4R97C 2BNRA 3WGVB 2B5IC 2E76C 2WVTA 4D7PA 5BPPA 2HKHL 4HAFA 1HHIA 4DO5A 4NQQA 1TEFA 4DK6A 3DGGA 4XP9L 3UAJD 1EXGA 2BSTB 4JRYE 3K71A 3D18B 2FATL 2Y5QA 1S7VA 5HHME 3EOYG 1SGKA 4M5ZL 5B39G 5FOBB 1JFQL 1U3HB 2CNYA 1BVZA 1JAEA 5IB5A 5J06A 5DHDA 4JFOA 4TULL 2B1HL 4P2RB 4XB7A 1NWOA 3IDXH 3IBOA 1WRFA 5L2KB 1QG3A 3V4UH 1VPOL 1SEBB 1A8ZA 4XR8C 2H6PB 1UWEH 4OAWA 5JDJA 1SXAA 3WTTA 2A6JA 1M6OB 4IQHA 1E6JL 2BZCA 2OBGA 4KHXL 3F6IA 2PP9A 3GRGA 4AITA 3NJGA 5D7EA 2IDUA 1UD8A 1HZLA 3BDYH 3BHBA 5HGBA 1LWRA 3M07A 4KK9D 2W60B 3T6VA 1SN2A 4EEEA 4LFHG 1A0QH 4H40A 4PTTB 1TZGL 4YFDB 3DX4A 1YEDB 3FOMA 4Y8DC 2ATPB 1PKQE 3OKMB 4OI7A 5TF1H 2L7UA 4XO9A 3T3PF 4KV5F 3F00A 4MCZA 4HDIB 3WMPA 1LXMA 3TURA 4NNXA 4Y2LA 3NK4A 4GT7A 5D7LA 4L29B 4Y1SA 2BC4A 1NGWB 2DYPD 4LHJB 3MLUL 1F4WL 3HC4L 3S3CB 5CMAB 3FK3A 5GSRA 4AWJC 3NA9L 4P23C 3WTVA 2ADFL 3HJEA 3FOLB 1ZDQA 2RB8A 2H32B 4MAYD 4PJBF 3UGEA 1A8JH 4KZCA 2C9VA 5JHBA 2ZOTA 2LABA 4XRCB 5I8EA 1BQ5A 1E5YA 2YWZA 3F2LA 1I1YA 3Q8FA 4X6CF 5HDBE 5FA4A 2ED7A 5GS1C 2PNDA 2FQGA 4DPAX 3N1FC 3QI9C 2X1OA 4XN5A 4NP4L 5F7UA 1DCLA 2QEJA 4UAHA 1HXMB 3IDGA 3AM8C 2CO6A 1U8LB 3U9UA 4HS3B 4R3SB 5FGBC 5J11C 4OLVL 1ROWA 4PJ6A 5CEZE 3LJ3A 3QIWB 4AC4A 1LP9A 4JZJB 1AVAA 4K55A 5L0QC 5IJVA 2ETWA 1UH3A 4KY1L 5D4JA 1N12A 4RMUA 4GW1B 4PJGF 3ARGB 4GG6E 3R7RA 4ONHB 2G9KA 2LT9A 3N44B 4JFYB 4CSSA 2ED9A 3DBXA 2ZYSA 3FUEA 1MF2L 3QQ9C 2IH3B 5E1QA 3S48A 1EVTC 5GRUH 3MV8E 2R8SH 4CVXA 1ZV5A 4EZKA 1DVQA 1YRKA 3C6LB 1U8KA 1X7TA 5DD1L 4RFEA 3EJYC 2GBTA 2VQ1A 3QUKB 4JG1L 4H4NA 2OJEA 4OF5A 2Y2WA 5B8CB 5IUCA 3JWOC 1CT8A 4P2OB 3CU1A 4NI6A 1PW3A 2GCYB 3K81A 3T5WA 3X17A 5JW4Q 4FFZL 5ES4B 3PV6B 1EK3A 1JRHI 4APQA 1E7UA 1ILUA 3KYNA 4C8XA 2BDNH 1DO5A 3ULAB 4TSAH 4KUZL 4PJHF 3MNDA 1YQVL 4YSOA 5F9JB 2X2UA 4HUUA 2F53B 1IM9A 4NKIL 2ZCKH 3OKDA 3VWKA 3L4WA 4IYKA 2AABL 3OPZL 1LP9F 3ILPB 3MV11 4OCMC 5D4QA 3RVVC 3W9DA 5AAPA 2YPLB 3PHSA 1T5WA 5ALCL 1OF0A 4G1EB 2J43A 5FYKU 1BAFH 1OAYL 2PCFA 2W94A 1JNLL 1LK3H 2MPAL 5I15L 3ZQXA 1N26A 2X3BA 1TCRA 4PBDA 1IAIM 4P59H 4TQHA 2ODIA 4QOKB 3HZMB 1DDTA 1HL8A 1UXSB 3T77B 3HC0B 1C7SA 1AP2B 1U8QA 3HC3L 2VDPB 2EQDA 3KPQB 2XETA 3LVTA 1I1AA 5HPMA 2WUBL 5J1AB 4M02A 4WO4B 2XBZA 3E3QC 1A3LH 5C07E 3TNMA 3P77B 3T77A 4O02H 2O5ZH 3VI4F 2ED8A 2K78A 3VWJC 3NJXA 4GMSL 2Y7MA 2XWTB 1OAJA 2YXWA 4G80B 4JG5A 2I7OA 4PGDB 5LXVA 3O2DH 1UH2A 3U1QA 3IDYB 3L4ZA 2LR4A 3UAFA 3ASOB 3FFCB 1FO0B 4G9DB 1OQXA 3FT0A 4I0CC 5HDBB 3ZPDA 5I0WA 4OZIE 3OAZK 1ZJBA 1ORQB 3BOVA 3GSXB 3TCLB 3W9DB 3JTSB 1KGUA 5IMKA 3D2UD 3UBHA 1WG3A 1XSJA 2B0SL 4TQ8A 2M1KA 1UJ3B 3LNHA 1NQBA 3DV4B 2EUWA 1HAWA 4HW6A 4ZX6A 2J1KA 4KQ4H 2A38A 2N7BA 3LB6C 4TUJA 3ZGIA 5JLZB 3H7LA 4WHTA 2Z31B 3DUHA 1LGVA 1X5JA 4J39A 2WXLA 3PGFL 4G1MB 2HJFA 2YMXH 1HJCA 4WW2B 4UT9H 2WBJD 3CFNA 1W80A 4M7KH 2LGNA 5GS3A 4JK0D 1FNSL 2FIRT 2YAOA 2BIQA 4LSUH 5F93C 5H35A 1OGTA 1KY6A 2DRUA 2VM4A 4KY1H 4XVTL 5C0RL 2F8OA 1CD0A 1KNOA 1R3LB 1PIGA 2VRAA 3EYQD 5F0PB 3CSYA 3TJPA 4A7GA 4YWGL 4XMPH 1R75A 4WSGA 4KQ3H 1AS6A 2DOCA 2ZWSA 3RL2B 4AJ0A 5JA9A 1RPQA 1I4FB 3FB7B 1G7HB 4GG6F 4ZMPA 1VGKA 2OMXA 2SEBA 4BZYA 1TOXA 1UKSA 3T3MB 5TPWH 1EV2E 4M4RA 4ZPTA 3NFNB 2VLLB 4LVHB 2YGVA 5HHMB 2DQGH 1CC3A 3GGWB 3W11C 3RZCB 4M62H 2Z7YA 3GIZL 4UBDC 3RFZA 4P3CH 3EDEA 3PUCA 2B59A 1RJZB 1RPKA 5FB8A 5KZCB 2B1HH 4NNYB 4Y5VB 3S34H 1RZGA 4AK1A 1DVTA 4HBCL 4CVZA 5LWYH 1IE4A 4TRPL 5D6DA 3SKMB 2X53A 1ZTMA 1QRNB 4HWNA 4L0PB 1JNLH 2MPAH 4RDQF 3VB8A 1IUZA 1TQUA 4OSUH 3UGXA 3DJZA 3MJ9A 3P3SA 4P3WA 4ODUB 5D1QD 2ZKWA 4WTZA 3WG7B 4ZNCD 1WK0A 3DUUA 4X5WB 1WZKA 4EDWH 2YGNA 5DEGB 1BLNA 1SJEA 2E5EA 2F08A 4GQZA 4U6VH 3VMPA 4FAAB 4XP9H 5IJKA 3B7TA 2RAMA 3MUY1 3QDJE 1JYVA 3LKPA 1V7NL 1S7XA 1WT5A 2W38A 3P9MB 3AXLB 1UB6B 4HALA 4YVUA 4ATTA 4ZZKA 5SX5H 3L54A 3MRBA 5JHDE 5E8OB 1OCWH 4W9EC 3V0HA 3VNZA 2EDBA 4XNUH 4GXUN 1YC8A 1AD9B 3M88A 1DTUA 1W0YT 3QP3A 4LOUD 5IZ7A 2AANA 3JWOH 1O7DC 2F54B 3MUJA 4K5NA 3Q6GL 2VOTA 3FKUS 3X14A 3RPIA 2HFFB 5I66B 4IIQB 5EOQL 2OW7A 3WJMB 4OCYH 3VSQA 4D9RE 1R24A 3KPNB 2AXJA 3ULUD 3QUML 2Y24A 1VACB 2VZSA 5DC9B 4MJHA 1AY1H 3HE7A 4CSTA 1TCRB 2MHAA 5AVXB 4X6BB 3GRBA 2IPKB 2F0CA 1O7DE 3LNFA 3WEMA 4FERA 1DBJH 2QGEA 3BWUC 2YARA 4U3CA 4QHLB 4AMWA 1NTDA 1QBBA 4PUBL 3P2BA 3H53A 3AY4C 3P4OB 4RFOL 3HPLB 5KN5B 5FDWA 1H6UA 4RA3A 1QHQA 4IBVA 5AAWC 4ADJA 4U3SB 1S9XB 2BWDA 5I15H 1X5MA 3AADB 4J6IA 5D7SH 5E4EC 4BK8A 2OZ4L 4N6QA 3AREB 1PZ5A 5KBNC 3PAUA 4XI5C 1RLBA 1DN2A 3WKNA 5IF0A 5IVOA 1RPUA 5KS9F 2DTSA 3SGKC 2CKBB 3BYYA 1MJ8H 2DJUA 1RULL 4IIZA 4RGNE 5BRPA 1AI1L 3FN9A 1UASA 4NGHH 4M7ZC 4PJDE 2HFGH 3KPSB 1KGIA 4Z0BL 1NFDE 1JPSH 5HHOE 1AKJD 5CP7A 1JGEB 2HFTA 4MNGB 5EWIH 4AQ1C 5CZVL 5M94B 5EEYA 5CGTA 3DPBB 2HUEA 3MCKB 4H8WH 5EBWA 3VXPA 4AEHH 5CU5A 4X6CE 4QI3A 4N0UE 4KO6A 2YD8A 5C6TL 2R69H 4IJ3C 4LSRH 5KSVA 5AW7B 5AFAA 5ICZA 4B9PA 3EHBC 4U6HB 4HMDA 1KULA 2Y7OA 2HRLA 3QO1A 5GJTH 3OG4B 3QIWA 1EJOL 1FSKB 2VN3A 3VG9C 5GGVH 3HHMA 4Q2ZA 2FX9L 2QQKH 1BZ7A 4QEGA 3RZWA 4NKMB 1VFUA 4JAMA 1OTSD 5D7IE 2GBVA 4ZTOH 5D1QA 4RSYA 1AYRA 2ZJSH 3LPWA 5AD0B 1FG2A 1WGOA 1XR8B 5IBLC 3OMNB 5I1AA 2A4CA 2AK1H 4KKQA 4MB1A 4BGDA 1KJMB 5GRJL 1LO0H 3WNMA 1KIPB 5HI5C 3MRQB 4ES8A 5BCAA 2PTTA 1BBDL 5FCUH 4HEME 4JNXA 4GAAA 1J12A 1IC0A 2GC7C 4K9EL 1AQDB 1NGZA 2UZPA 2DPKA 3V6OA 5ESAA 1LO2L 5LB1A 1XCQB 1WAAF 1AGCB 3FQNA 1HYSC 3JV6B 5B4MC 1DUZB 3RWJB 1UGKA 4JLRB 4NN7C 2WNGA 4Y19D 3CSPA 5I2IB 5B3JE 1OZTG 3IKCB 2BFVH 2F8VA 2J1YA 2FH8A 2W07B 3QWOB 3UFIA 1R5VA 4EF3A 5GS0H 4AYID 1LO2H 5H4YA 4G42A 1Z9MA 2O5NA 4GW5A 5SWQB 4Y5YB 3K0YA 3DOHA 5D72H 4Q9QH 4PG2C 3BWSA 3ZKND 1QA9A 4HHGA 2CR6A 5B1CA 1ETA1 4PLKC 3Q01A 3KDMB 5I6NA 3BXNB 3Q5OA 2OMWB 3EOTL 1O6SB 5F89A 3HG1B 4TUKH 1QEXA 2FBOJ 4L2LA 4AMXA 1E4XL 3D3VA 2B8OT 5KJ7E 4OGYL 1NCGA 4PJCA 5AEAA 1T20A 1CDUA 3GWJA 3T6XA 1S2EA 5E2WH 2MQCA 3KBPA 2CPCA 4A1RA 1HSAA 3MRJA 2DBLL 3EHBD 4LIQE 3DV6B 1RJLA 3H7BA 1A7NL 4NN6C 2Y0SA 3GXDA 4JGUA 4P05A 1QSFB 4AYMC 5JW5A 3D09A 1WA0X 5FA3A 1GPOL 5ICUA 3P3TA 2OR8A 5FWQA 5CJ8A 3TWYA 5CINL 5IB4B 1QBML 4V2BA 4RMVA 4HH9B 4P2CG 3VMOA 3HZYA 4BDVA 3RZCC 4ZUVA 5KVDH 1UA6H 2H1PH 4FZEH 3HNTL 4MA1C 3WENA 1WIOA 1PAZA 1JHTB 3MCLL 3O3AB 2AQ2A 3FQYA 4ZRGA 4NQCA 1QKZL 2JXMA 4MZIA 1KCBA 1NUDA 2QPFA 4O2FA 4TNGA 3CVBA 2D03H 4FYSA 4ELDA 3VQ1C 3VFRB 3FPYA 3DX2A 3PJSA 4BFRA 4BQCA 2F6AA 3OHMB 4M4PA 2YSSA 5EUOE 3V0VA 4RDQG 5I76B 2QVIA 4GRWE 1K4CB 2V7NA 2WWNA 4PJDB 4WV1C 3TWCH 2DL9A 3RQ3A 1XWVA 5CIPB 5CGMA 1BM7A 1RI8A 1XCXA 4TF4A 3MRCA 1JI2A 3QFDA 4FLRA 1TJHL 4UTAA 3B8SA 4KKAD 4OB5H 3NABL 2K7PA 4WW2C 3X12B 1G0DA 5AKRA 3RVUD 3NCFB 1CXFA 5I1KH 1OPOA 3O3DB 3S9DB 3SO3C 4NBYB 1MQKL 2BY1A 5DD5H 5DZPA 5JXAH 4LASL 1D5BB 1T6BX 3TJHD 4ZFOA 2LVCA 4S1RH 3VGAB 3NPSC 3EJZD 1D5RA 3VFWB 4KHTL 4HH9A 3L1OL 4G5ZH 3U0TA 4TPRH 3QIWC 2PR4H 4LPTA 4MMZA 3Q43A 1Y18B 4ZBJA 2QSTA 4X2UA 3DBSA 5B7EA 1NCDL 3PP4H 5IMKB 2V3FA 1LDSA 5HBBA 5C0GB 3N3EA 4LCCB 4ZUUB 3QQNA 5JDSB 1UJ3A 3ARDD 4ZTOL 1SJHB 3GPEA 3N5AA 5LCVL 2E9JA 3ULSA 4PJ9A 2VE6A 1G6RH 2H26B