4LZKA

Crystal structure of inclusion body protein (pixa pfam12306) from burkholderia cenocepacia j2315
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
159
Chain Sequence
SINLEKAAQSIQILAVIDTNYIKRSHPNPSLNAQNPTSIPSTALFMLNGHAPGVSSSEGNGNLGLKLNVGDKVSLMGTSLADNSGDAALIYHVQQYSGAQVFAPFTAVTIEQQVFQAFESVAKSAGSEYLATSFALYTRSQNRKSLFGYFFWVWQAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PixA inclusion body protein
publication title Crystal structure of inclusion body protein (PixA pfam12306) from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Unknown function
total genus 36
structure length 159
sequence length 178
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12306 PixA Inclusion body protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lzkA00
4Q52A 4LZKA 4PIBA
chains in the Genus database with same CATH superfamily
4U6YA 3F7YB 3LIZH 1EHXA 5KSUB 5LKNA 5HHPA 2OMZB 5E2JA 2KPNA 1PZ5B 3VGAB 3HVDA 4N8UA 4OF8A 2Y1VA 1PVHA 5BOJA 1FLRL 3U0PA 3O6FD 4Q58C 4BGDA 5HGDB 1GS7A 5AKSA 3GGWB 2OMYA 1J9RA 4PV8A 4NXSA 1XL4A 5E8OB 5J5EA 3L4YA 5BVPH 5ELIA 2DLIA 3BVUA 3QWRD 4HWZA 4CVZB 4Z0BL 1PCSA 1WFIA 5CLTA 4C56D 5D7SH 5ESAB 1SDAB 1LYQA 2BP0A 1IQWL 4KUCD 5E4EC 4W6YB 4NCC1 4NSKA 1MRCL 3AG3B 1MNUL 2H1LM 3O0LA 4KJQD 2Q6WB 3VTTA 4KTEH 4XMPH 2WHVA 5J3HC 3T1FB 1GJIA 1E42A 1FQ9C 2VXUH 3BUYA 1RSFA 3EGSA 3WUWA 1CE6A 3WNJA 2BP5M 4YBHA 5I73B 1UKTA 1AZNA 2ZUWA 5F6IC 4IU2B 1WISA 3AWFA 3C60A 3RKDD 3EDDA 3WJJC 1KLGB 3BP5A 1TCMA 1ZAGA 3MV9D 3QUXD 3HE6C 4NO5B 2FUTA 3WJLC 1GYCA 2PPFA 3EW3B 1VERA 4K3DL 3APNA 2DQDL 3T0ED 5KVDE 2GBTA 4HJ0C 5F9OH 4K9EH 5D7EA 3ZTNL 4QHNA 5EC1B 1EBAA 2BVUA 2DLGA 3UO1L 4CVXA 3IKKA 3APCA 1OTTD 1AGFB 4G9FB 3MRLA 2Y07H 3MJ9A 1XSKA 5H37A 4CNIB 1A1MB 5AB2A 4JFOA 1OAUH 1XH0A 3EUDA 3ZOAA 3EGXB 1KTKE 2HJLA 4IKNA 5E1HB 2M83A 3D0LB 4N24A 2YPLD 4J3OG 4JPIB 1DHKA 1G7HB 1ZMYA 3GTTA 1URIA 4KOBA 1CLYL 1PX8A 4EO5A 4HIJB 4JG1L 1XAKA 4K7FA 4M00A 4O5LL 5ID0A 4W68A 1J1OL 1JYVA 3ULSB 5CEZE 2Y7MA 2YD3A 1PZ2A 4KVCH 1W9XA 2Q8BH 4WTZA 4GFXA 4JY5H 4HXBL 3V0AC 3GZPA 3HS0C 3BCDA 4WUUD 5C0BD 1YY9D 4M1DL 1QUNA 4ODWA 4F2MA 3MV8A 5A1AA 4BFGA 5IF0A 3TURA 1FAIH 3MLRH 2O61B 5DHMC 2FAUA 3D33A 2GFBB 4I1PA 3KPRB 5HI4C 2YZ8A 5E6SB 1AR1B 2CKBH 3VXRD 1HESA 1IL1B 1CXLA 2BVPB 2R83A 4IRSA 4LSTL 2WZPD 4LCIL 5BMFL 4FFWC 3O4LE 1UT9A 1OGTA 3F7LA 3ALWA 3ZLQC 1PLGH 1LP9B 2GAZA 2F7QA 4OD1H 4A2GA 2I7SA 4RQQB 5H35A 3LZLA 5C07B 1R3KB 1HHIB 3CHPA 1J5OL 1K72A 1MJ8L 1PNCA 2VDKB 3V5KB 3STLA 4D0BB 2EVFA 3ZKMC 3K46A 5DRXB 4LT7A 5D70H 3DMMB 4GBXD 3QDME 3UEQA 1BWMA 3QXAA 4LNRB 4WWOA 2L4OA 4XVJL 4TPRL 4YR6A 4D8OA 3KZ8A 1L4IA 2OSLA 3WN5A 4I8DA 2X1QA 1U58B 2AEOA 3KEDA 3W38A 3TFKC 1AHWB 2X4SB 2Y06H 2EYRA 1KELH 4BWUA 4NB7A 1BYOA 1PPIA 1HZHH 5I74C 3SGJC 2J8UB 3WMPA 2FWOB 1OD9A 3NEOA 1DEEA 5DF0A 5HHOD 1JFQH 2ZKHL 5C0GA 2ZP0T 1JBJA 1SEBB 1MREH 3B6SB 5AZEL 1NMCC 3KJ6L 3HRZA 1A6WH 2A9NH 3C5JB 5KW9H 3PG2A 4PJXB 1GVIA 4Y4KA 3C6LB 4NOBA 4XNMB 2IQ9H 1UKSA 2P3YA 1WH0A 5JW4M 3RDTC 4NUJA 3IDXL 3OHXA 3TT1L 1KPRA 5B1KA 1FL3A 4IGBB 3EBIA 3D12B 3GXUB 4X9GA 4ZDHA 1UHVA 1EXHA 3D3VA 4LU5L 2VGLM 5E8NA 2HRPH 1LEKA 4N2LA 4ISVB 1L9SA 3DVIA 2K7QA 4XBEL 3TPUB 1A7OL 3DGCR 4YMPA 4YHYC 1QI4A 3BUTA 2ICWB 2IDCA 4KH2A 1Q0EA 2QZQA 5D7IF 2B3RA 3APMA 5IESL 1IGYA 4OTXL 1H9DA 2BMKA 2RA1A 2JJSA 4M7LT 4OLYH 2EIZA 1E4KA 1IAKB 2VDMH 5AW3B 3JV4A 3IGFA 3IK2A 2VR6A 3EDKA 4RNRA 3HBPA 2FK9A 2NNRA 4J8RA 3GMMA 3UGXA 5C1MB 2QKIB 2G2RA 2IQAB 4RRPA 3VWJB 3IDGB 1GA2A 2XXFA 1H8OA 1QUPA 4QYOA 4JG5A 4KKLD 3CVBA 4J3OD 1B4LA 4UQ2B 1QI3A 3MLVH 4QHMB 3B8SA 3RI5K 1IM3A 2K78A 3NDYE 2WNKA 5IQLA 1I8MA 2E56A 5ECGA 3ABLB 4X6CA 4HJGB 3EOTL 3RB5A 1FZJB 5L4JA 3LRSB 1WTLA 1L9RA 3IDNA 4F93B 5C2BL 5ICYA 3IF1B 1HNGA 4J2QA 4KOCA 3WFHB 1YJDH 4RGNB 5DC2A 2ENSA 2Y7NA 3EJUA 4N8CH 3V95A 1AC0A 3DI3B 4FF9A 1NIEA 5CIPA 1XZWA 4DK5A 3ARSA 4P23C 4NJ9H 4P2OA 1FE8L 2WW8A 4MQ7B 1VADA 4RA0C 4H1LG 3D9AH 1FAIL 1VACB 2N1TE 4PJFE 4E42A 3RVUC 2BK8A 2AK4D 1RJCA 1I85C 3I9AA 3NK3A 4JFZH 3MJ8B 2O6EA 5TF0A 4R97B 3MOAL 2XWCA 3DX6B 4WCYH 3ZVVA 1C5DA 3QUHA 2J6WA 4PHXA 3VD1A 4AGOA 1E5BA 1KCUL 1SY6L 4FQQB 4G70B 3L7EB 4M62L 4NX0A 1A9VA 1MRDH 4L4VD 5IWLC 1CIUA 1PLGL 3SCMD 2QPEB 5EIQA 2EVIA 4K3HA 1RFDL 4Y16D 1FCCA 3Q0HA 4L8SB 1EZLA 1JS4A 4FQ1H 3E2HB 1KBWA 2XUWA 1ZJAA 2F53D 2D8KA 3BGFB 3WXVL 4BH8A 5K9KA 3S37X 3DRQA 4PRHD 5C07E 3BN3B 4QMEA 1NCWH 5FM4A 2MCPL 1XR8B 3BKJH 2EC9U 5JHDD 5DMIL 4RWYH 4P4KA 1HL4A 5AVXB 1H15B 2OJ1A 2VR7A 3TEXA 1UA7A 3TO4C 1PYWA 2XXGA 4ONGH 1P7QD 4H8WH 2MWCA 1ECYA 1YNKL 1Y1DA 2XQ0A 2PCPA 5EZJB 1HZHL 3VFTA 3PHQA 5FHBL 1XEDA 1BAGA 5I8EA 2FL5B 2WBJC 5E9DE 4BV1A 5IEKA 4JFDB 3AREA 1RJYB 3BW9A 2DW5A 3UXFA 3K2KA 1BBJB 1DE4A 1GYWA 2CK0H 3HZYB 1E5YA 1OPGH 2CLVB 5ETUA 2N1KA 3S8WA 3EH1A 2CRMA 3QUZB 2GJZA 4QKTA 2DIBA 2RQ8A 4HKJB 2ITDB 5HYJE 2BSEA 2YUWA 4BFIA 2DLEA 4JDTL 4Q6YA 5K1NA 4IOIA 4P49A 2H3NB 4OZGB 5D2NA 1QA9B 2ILLA 2UVFA 5D5MF 3FOLA 1I9RL 3LQZA 4FG2A 1KYAA 1L5GB 3ME0A 3FCSA 5LAXB 1UXWB 4XTRD 1LO4H 4DSYA 3NCEB 3RZCC 2YKKA 4KROB 1ZK9A 4URKA 2IV8A 5HJDA 4A2HA 2VDNH 5KBPA 3PWLB 4U6XA 2ETWA 3INUH 3HI5L 3Q2NA 4CUCA 4MXQD 2JJWA 4B9YA 1DQKA 1OAZL 1U8LB 3D4YA 1H5BC 5EF2A 4GKSA 1L3WA 4YDVA 3ZGIA 2EEDA 2NRDA 1CLOL 5HYIA 4WFHD 4C4UA 4WHTB 4LEOA 1DUZB 4UQEA 3D8MA 3Q6GL 4D0DB 4Q9QH 4ZW3A 5J1TC 2GJPA 1OGSA 2GUYA 4EEEA 2YXMA 4XPTL 3DXAD 1Y0LA 1WGVA 3VXPB 4N2GA 1A7RL 4MMZC 3MROA 3UP6A 1MLCA 4DFHA 4AKPA 2Y72A 3BPOC 5D5ME 5FGBC 3RFZB 2VLJE 1TCRB 4HWUA 4GP8B 1Y7VA 4HLJA 3JYCA 4B9JA 4BSWA 1AS7A 2FYYB 2Y2WA 1IVLA 3O2DL 3SDXA 4P2QE 3TA3D 5C0JB 5HGBB 3NJXA 4GO6B 5CSZA 4Z7UB 3QCTL 4PGJA 3QNXA 1HQRA 3WNNA 3QI9B 1AD9B 4JY4B 3FQNA 4G7SB 4N8CL 4DPAX 2ADJA 3BKYL 2XIDA 4Y5YC 4ZW7A 3W39A 5F7UA 3QARA 5B38G 1SOXA 3V9FA 1I9IH 2E47A 2APFA 2NX5E 2PP9A 4HX1B 5DT1H 3H9SA 4FMFA 1N64L 2XA8L 3D9AL 2IXQB 1FH5H 3ULVL 3GFUA 4MJIE 43CAB 1OOAA 1L0YA 2HMID 4PI2A 1HZKA 2N7AA 4TLTA 1XL6A 4AC4A 1OW0A 4HALA 3DVGA 1IRAY 1FPTH 2FNWA 3T6WA 1QSVA 1UUNA 4AYMC 2DEWX 5K1VA 4MJ5B 3RL1A 3RRQA 3K6FA 4OQ1A 1MRDL 1VLXA 2F5BH 3FB7B 2YRBA 4HK0B 1Z32X 2J1YA 3V0VA 4KWUA 4YHPB 5F6IB 1AZUA 1BJ8A 1ODUA 5BUGA 3OKYA 3HE6B 5DK2B 4OJFH 2AV1B 4YE0A 1E5UI 4NWUL 4WUKH 2AFNA 4RWYL 2ERJC 1D7BA 3UGUA 4OLXH 4YJZL 3KPMA 3NN8B 4ONFH 5FV1L 1T80A 3H53A 5GJTH 1QHOA 3VXUB 3VMNA 1K85A 1F2XK 3E3QC 4QXUH 2WANA 4H8WL 1XIWC 5TF1L 1T6VN 3X12B 2ZX6A 3I02A 3LPGA 5TE7L 3ETBJ 4RETB 4XMZA 4MXVF 4OKVA 2IH3B 3BI9X 3BVNA 5KN5B 2XA3A 5AAMC 2ZUXA 4BZYA 3I6GB 3QFJD 2MNJB 5HPMA 1N2RA 2H6OA 4MAYC 3ESMA 3BLBA 3GIVA 3KVQA 3MJ9L 4J3BA 4PJ9D 5FA3B 1J8HB 3EFDL 4OUUB 4HIIB 3SZKC 1KV7A 1LM8V 5EU3A 1W8OA 2BNRA 3G08A 4OLEA 1SN5A 1JZ6A 4ZUUB 2ZXCA 3UFIA 5LHDA 5AENA 3O9WA 2I85A 4NC1C 4L9DA 2VT0A 2GBUA 4G8GB 2HN7B 4BCXA 4PV9B 1C1EH 1MZYA 4I5BA 4LSSL 4A63A 1H3WM 4LCWE 2VRKA 1S9XA 3NIDE 4QHPA 4K3JH 1CXIA 3CFEA 1WV7T 3CPLA 1JD7A 1K6QH 4LHUA 3O3BA 2Y36L 2ED6A 3K6OA 4PLJC 3VA2C 4NRYA 5CIPH 1C5CL 1M05B 1PJ9A 4Y2NA 3WU1A 4IJ3C 3WLWC 3TONA 4MMXB 3RWCA 1UFUA 3IDMA 5B3SB 3NFPA 4M5ZL 3FCGA 3K5SA 2VDNL 4POZC 2C3XA 4RDBA 5CINL 3HCVA 1N3NA 2FBJL 4OM0H 4ZUSB 4FLQA 5IVZA 3V5HB 2KH2B 1PZBA 3SKMB 1MCOH 2CO1A 3BH4A 3DSNB 4HIEA 1I9JH 1WS7A 3MACL 4CBPA 2WMPB 3HPLB 2IBBA 5C09B 1EDYA 1PY4A 1KTBA 4ZQKB 3QWOB 2WN2A 4DGWC 2QVIA 3MFGB 2CCWA 1HZLA 1QR1A 4UQ3A 2NLJA 3RBGA 3GSUA 4MA3A 5KG9A 1GR7A 3S4SG 3CVDA 2X3BA 3CBRA 4WI8A 3C87A 4CL7A 2ZX7A 1ZWIA 1ZT4A 5I74B 1W8NA 1AQMA 2OW6A 1HT6A 3KGSA 4AV4A 5I17A 2W8CA 2BWDA 3SD5A 4ZO6A 2G2PA 4LEXL 5JIMA 5DZ9A 5IT2L 5BZZA 4FZ8H 4B96A 2DMCA 2XN1A 2IEPA 3BIKB 4RFOL 1NMCB 3M1CA 4MLIA 4ZBJA 4Z7UE 5C9JA 4G80B 1HK6A 3ARBA 3H42L 3DOSB 4XX1E 4XMXA 1IGJA 4XZUA 2DBLL 1I9IL 1ZLVH 5JA8B 4KHXL 2X09A 3BUBA 4DEWA 2O5YH 5L2KA 2K70A 3KJ4C 5DYFA 1OSPH 1NEZA 3TJHC 1WF5A 4HWBA 5HDWA 5A2LH 2FBOJ 3IFLH 1JWMB 4UUJA 4G8AC 4W9JC 2X2UA 3KH3A 1RZKH 2QADD 3CFCL 3FHEA 3MGOA 2FR4B 1S9VB 1SHXA 3LKPB 5CSBA 3HG3A 4HIXL 3S8GB 2FJHB 3UTOA 4YSUA 3M6DA 4H8QA 1WITA 2EC9T 1AE6H 1QNZL 2RTTA 4YHYB 2ZP9A 5D1XE 5DFWH 4LVNC 4X7DC 5I18H 3NDZE 3HMXA 3F7PC 3SKNA 1ODAA 4N0UE 2F6AA 1J5CA 1KGYE 4NQDB 1S7WB 5CO1A 3DETD 3VQMA 2WINA 4K2UH 2PWEA 2V2WB 4HH9B 4J7RA 5IQ7H 4MNQD 4TUOB 1IVTA 1N8ZB 2C1PA 5F8RC 5IQ9B 4LBEB 4L0YA 1IARB 4LVOB 4DZBB 2R2BA 3F85A 4YIQB 4AZ8A 3ULUH 5DEFA 2FQFA 4LQ1A 4WFGD 5CCHE 3KPNA 4LAQH 3A4FA 3WIIH 2NTFA 4WV1B 3NA4A 4F8PA 3MOBH 1VESA 1ZXKA 3LN4A 2Z8SA 3ROOB 5ITBL 4J6IA 2JB6A 1JWSA 2IALA 4Y2OA 1QLRA 1VENA 1CGYA 2NR6C 3MR9B 1PDKB 5IJVB 5T3XD 3CDGB 1CK0H 1VAHA 3KPLA 2WN3A 3HS8A 4R7VA 3QAZB 4Z6AT 2PXYD 1E9QB 1N18A 4ONHB 2AP2A 4YFLI 4JB9H 2VXQA 3AQZA 5JXED 1FZMB 3LRLA 2FLBT 2BY3A 3FTYA 1ZLVK 1MELA 2ADYA 3ABKB 4TVPL 3ILPA 1JGDA 1ID2A 4ZFZB 3Q2LA 3OPZL 1QEWA 3NUKA 4Y9CA 1AO7D 3HRPA 2V2TB 1ADQL 4PRID 4U1MA 2WXPA 3CIQA 4WNQB 3UZEA 1B3IA 3VFWB 5CR1A 4LLDA 1R5WA 2X88A 4UQCA 3S3SA 2D31B 5EUKB 1FL5A 2GY7B 1KBVA 2KDYA 3POHA 1EUTA 1DJZA 1PS3A 4ECNA 5I2IB 2FO8A 3KDMA 4NRZB 1DBBL 3JVFC 3FF8A 5AW9B 3TZVA 4ORZC 1XF1A 4MQXD 3U4BH 1E6OH 2ODHA 3CDZB 4GMTH 2IAMA 2VUKA 3SE4A 1NC2B 4CMHB 1QMUA 5HYSG 4O2CA 4L05A 4LCCC 1SOQA 1U4EA 2ADFH 1AQHA 3MBEC 4GAJH 2BIIA 3F12B 2X0VA 4MD5B 1CD9B 5I8OL 3JT2A 1GMIA 2FHCA 4R83A 1FVCA 4AVIA 3MKGA 4N5ED 3O6MH 1OAKH 4R0LA 1W0VA 3G5ZA 2IPKB 1CZ8H 3G6JB 3UTSE 5EOCJ 3I9IA 1OCWH 4UOJA 2WWKT 3SDDA 4PTUB 1H8LA 1TO4A 3KLAB 2UZIL 3LNHA 3O45B 4F9LC 1LD9A 2F2HA 4K3GA 2W65A 1JF1A 2EEBA 1CD1B 3V4UH 1G7QB 2LABA 3CSTA 3S35L 5CKGA 3T3PB 3QNYB 5I1CL 1OSZB 1FZOB 4XP5L 4NJAH 5E00A 1WYJA 4KO6A 4I89A 5DJZB 3WKYA 1BQHA 2UWEB 5IEHB 2VLMD 1A3RH 1IBHA 1VSCA 1UM5L 3VE0A 3ARXA 4PJGB 1LE9B 5LBGA 4UQ9A 3NSCA 2EP6A 3OAYH 1PLBA 4MDRA 4F7KA 4UMSA 3KYMB 1N26A 3L5WA 4MNGA 2HLEB 3JBG7 4C47A 1ORQA 1HKLL 2DI7A 1LWHA 2BFVL 5CLXA 4ABWA 4C57C 2WLJA 3QDGE 3TBYA 5I5RA 2NXZC 2OZ4A 2D7PA 1HILB 3CK0H 1D9KA 1CDGA 1HIMH 4Z78B 3O41A 2V9QA 4UM8A 4G7VL 1YDPB 3AW5A 3FKUS 2EE2A 3SJVE 4CA4A 3PXHA 4Q2ZB 4Z3HA 1BXXA 3FO1B 1OWRM 4DQOH 1YUHB 3EO1B 3F01A 3T0VA 5AW0B 2O4EA 1RK0B 2C3WA 1F45A 4L3CA 3GEWB 5GZOA 2NY2C 4R26H 1AE6L 1RUAH 4KRLB 1YEKL 2PETA 2X5PA 2OL3A 2VDQL 2X7LA 5CJBA 4BM7A 3MU3A 9CGTA 3HG1B 1CGSL 4JFHD 3MGTB 3LTVA 1BVLA 3VXMB 5DHYB 1JN6B 5JORB 3AU1B 1O0VA 1PLAA 2GUOB 4NKOA 4Y19B 3FB5A 5C3IA 2PABA 2DTML 1I1AD 3CFUA 4WJKB 3TT3L 1KY6A 4BQCA 5F71A 4EZJA 4BRVA 2DM4A 1KPUB 3UO8B 1H5BB 4E41B 1G9NH 5I30H 1P4BL 1FHGA 5T1LA 2DIAA 4LOFA 2X1PA 5DJCB 5FV2A 3UTZB 5GS0C 4Y1AE 3FQUA 4B50A 5KYWB 2P45B 1JNNL 2F9BT 3N1QC 3MJ6A 4BK5A 2VO8A 5ABDE 4WAFA 5EU7E 2FLRT 1BVNP 4JFYA 4ZMYA 4DGVL 2XWBA 4LSUL 3B1TA 4U1SA 1M6OB 1A7QH 4PJEF 1M4KA 1G43A 2DJMA 3LS4L 4NHUA 1AQDB 4YSDA 1Q0YL 2B20A 1DQIA 4Z76B 1MI5D 2NY0C 4NC2B 4KO5A 2XXCB 5ICUA 4XHJD 2FSEB 4KMLB 4KI1A 3VXSE 4EDXA 3OAYK 3VMPA 3HB3B 4OI9A 4R5VA 1RL1A 1AXTH 3MKKA 3OX8A 3QT2A 2GEQA 1G7IA 1I3GH 1UB6B 1QFWM 1JPTL 4YK4C 1DDHB 1Y18B 2FGWH 4MJHA 4WY7L 4RA3A 3QJUB 1N9PA 3OKDB 2RCSL 4JBSA 1GYVA 4NN5C 2JNZA 2P8LA 1E4WL 1NAML 4XPGH 5LBSL 3BD3A 5CJOH 3RIAF 1OB1B 1K8IA 3CZFA 4K8RL 1SJMA 2Y5QA 2VE6A 3QIBA 2Z31B 4XE5B 2P5WA 3GBNH 4IS6A 1G9MH 4XNBA 1C5BL 2AEWA 1KYUA 1MLBA 3C9NB 3WKPA 4G11A 2ICEC 1RJZB 4X8CA 3WFDL 4IRZL 5AVTB 4I2XE 5CCGE 1XD1A 3CH1B 1FGNL 4HWBH 1ZCRA 2FJGA 1E6OL 4HBCL 3U4EA 3NACL 5IMOB 5JLZA 5ICZB 4FHBD 2FUQA 4OZIF 5H4YA 3U2SB 1KJ3H 4UM9D 4PR5A 4XGZB 2MRYA 3MMEB 4GAJL 5D96B 5E2UL 4ZK8A 1I8LA 1FNEA 1RCYA 3B2XA 3D25B 4XCFL 2A77H 4ZUVA 5BZXA 4J4PA 3ILEA 2BOCA 3MRBB 3RUGF 2ERJB 1WDAA 5EEUA 5MP6L 2LVEA 5D9SB 3HMXH 2A6IA 1S7QA 2D0GA 4R6UA 5DJ6A 3SE9H 4E9RA 5E94B 3A0OA 1OCWL 3L3HB 1YEIH 3IGUA 3C6EA 1P7HL 3OKOB 1ED3A 5IFJA 1XIWB 3ZK0A 2H26A 3FQRB 4XPHL 2D03L 3GTVA 2ZJSL 5KJRL 1PQZA 1E8XA 1KTLA 4HUUA 4YE4L 4HF5H 5EMYA 4L3FA 1WBYB 3ZTJH 4B9CA 4AEIH 2OP4L 5LXGH 2VLKA 3KVPA 1BW8A 4MAYB 2AJ3A 4PGBB 5KYUB 5C0RL 3J2PA 1TVHB 1SHMA 4PRNA 1G7LB 1RZIB 4APXB 2EDLA 4KKBC 2AEQH 3HE7D 3OAUL 1R17A 3K71A 5EN2A 1D5BA 2PO6A 4Y5VA 3RUGE 1PL3A 2WKGA 3QORB 4X5XA 4GUQA 3OR7B 4U1JB 1IM9A 3CFTA 4QTHA 2F61A 4TF4A 2H47C 3R1GL 2VXQH 1A1OA 3IEAA 4HQQL 4OJEH 3D06A 2HRHA 5BXFB 1G6RB 4UAOC 1WD8A 4XO3A 2H4EA 4QGTA 4G1EB 2ITFA 3CZNA 2VSDA 2F5AH 4WKZB 1HHHA 4XN1A 3EXLA 5MENB 4QRQB 1OGPA 3IMWA 4BE6A 3EJZD 5IJCC 4BDVB 3KLQA 1U91B 5EOTA 3T6QC 2ZG1A 1YY8B 2FX8H 3RTQB 4GG6B 1M1XA 1FC2D 1BOGA 1NCOA 1N68A 1NZRA 3U30C 3TJEL 4AT6B 2FECL 1A6ZA 3ZMNA 3N1MC 2I32A 5IKCB 3QRBA 5J7CC 4XX5A 2IPUG 2V3FA 7TAAA 2MNUA 3FT1A 4YPGA 2WQSA 3L9RB 5IM7A 1XT5A 1WRFA 1S7VB 4P04A 4RWHA 3UYPA 5HHXL 4JVUA 5B7MA 2YWYA 4NAMA 3KL5A 3C8KB 3K72A 3VYPA 1FVDB 5J8OA 5KYXB 1NIBA 1ET5A 4KI5D 3ESPA 3ZT6A 5ICXA 2WLKA 2QHLA 4DP6X 2XN9D 3K0YA 4GRMA 4XVUD 5I1IL 1Z9SA 2ALAA 5TPWH 3BUDA 1I82A 4X5PA 5DJDA 1J48A 2CGYA 1HDMA 3FO9A 3H0TB 3IFOA 1YQVL 3K91A 4I48A 2GVYA 3C60D 3NCYS 1E2ZA 1UCBH 4WJG3 1MIEH 2HFGL 2VDOL 2EH8H 4AH2B 5AAWA 3GMQA 3LZNA 3CNKA 4URTB 3KMDA 3B37A 4Q9BA 4JPKH 1SHSA 4F9PA 1S7SA 4NZUL 5GS1C 2W1NA 3L2NA 1CF8H 2JKIS 2WC7A 5DRZA 3WFCL 1NLBH 2GG1A 4U3XA 3FSZA 5FYJD 1UD5A 1FYTE 4RRPG 2OZ4H 2PCXA 1HHJB 2PYFB 5FLVA 4M6OL 3V6OE 1IGML 3D2UA 5FDWB 2BIHA 3QIWC 5CN3A 2MCMA 1EEYB 4IBSA 2RB8A 5C7XL 4QRRD 1KB5L 3DUUB 3RWEA 1II4E 3JWDC 3IDIA 2Q76A 4GYBA 2R2EB 3UAAA 4TRPH 1SN0A 4OD2A 1J1PL 2OL3H 1CFQA 1E4XH 2GSGA 1ZSDB 2DYPD 3PWPE 4Z7VF 2OMTA 5I15H 4U31A 3EYQC 4G82A 2B7DT 4O2FB 2LVCA 3OMZA 1YEIL 4Z0XA 2YFNA 3CN1A 3UIYA 4IEFA 4FLOA 1T4KA 4X98A 3G5WA 2ALWA 3GSRA 2CDEB 5HI5D 4FFZL 2D7OA 4XBGB 1ADWA 1CICA 3QZBA 1TUPA 3MV8D 2X05A 1FFQA 1WIOA 4NBZB 3DVNA 3MRIB 3UH8A 1JXGA 1MW2A 4UZUA 3VRIB 4WVRA 2ENPA 4PMEA 4JHWL 3TBTA 5GRUH 4HF5L 5HHMD 2QT6A 3F7YA 4MRBA 5AYTA 5CP7A 3JSSA 4GS7C 1Q0XH 5KSUA 1TYRA 2OMZA 5INDB 3WTXA 2JK5B 4BKLA 4KK9C 3X3GL 1CLZH 3QPQD 1PZ5A 4BWWA 4U1IB 4IRSD 2JMRA 3T4YB 1KXQA 4OFDA 1MFBL 2F8VA 4ZYKB 3S48A 1FP5A 2E59A 5D7HA 5HGDA 3GGWA 1JPGB 2Q7YB 3P11L 4ZMOA 4OCYH 1XBRA 2PWHA 5E8OA 2QSCH 4MA8L 5L4MA 1C8PA 4Z7VE 3CC5A 2BNUB 5C0AB 3UMNA 4CVZA 4HKBB 2OX5B 5EOCH 3WD5H 5FGCE 2DEYX 2ROYA 1YNLH 4XWGL 1P7BA 3B9DA 2CRZA 4PH8A 2H2SD 3BQUC 5ESAA 1INQB 1GC1H 3ZR5A 2DICA 5FEBA 3MBWB 3DBXB 3TH3T 5BNXD 5KSAB 1IT9L 4LGSB 1G0DA 1ES0B 2Q6WA 2EH7H 2AQQA 1TZGL 4PVBA 5D1QB 4L3AA 4YC2C 5DJXB 4IU2A 1KLGA 4PJ6A 1QSEB 2WVVB 4JRFA 4UOW1 5I28A 4IBWA 2LE9A 4A7QA 4M1GL 4NO5A 1MDTA 3AT8A 1AMYA 3MBEB 4OR1A 4PTTB 1EHAA 1UZ8B 2OYMA 3AZUA 1VFOA 2PPAA 4AZUA 5EEVA 1JDDA 5DWUL 4JKLA 5C0DB 1IBGL 1JVOA 3V0GA 5I71B 4K5NA 4NQEE 2CK2A 3B2UC 1OZTG 1E67A 2WP3O 1EH9A 1Q9OB 3WCYA 2WXGA 1AGFA 4G9FA 5IVXB 2NY3C 2OR9H 4LOEA 4CNIA 3ZYIA 1A1MA 1NL0L 3T77B 1GGTA 4B3EA 4DP5X 1X5MA 3EGXA 4JO8A 4V11A 4KNTA 3D0LA 5DD6B 4ENEC 2YK1L 5EPMA 4XC1H 3AITA 1G7HA 4MGXA 3Q2VA 5FCUH 2D3VA 2HRLA 2RACA 1CJYA 3ZIMA 3FN3A 4XXCC 4DEPB 1O7DC 7PAZA 2RALA 2ZUSA 3BH9B 3G6AB 1VKXB 4M6NL 5GGVH 4DTGH 1G0YR 4DGYL 5I66B 2R4RH 5I1DB 3BD4A 3OXSB 4IHBA 1QTPA 3S3JA 1AD0B 4JHUA 4N0FB 1X5IA 1VGEH 4X6DB 2C9XA 4OFYD 3FUFA 1AQKL 2EQDA 3GM8A 2HT3D 3NA9H 1NCTA 1TSHA 4KUCF 1O5PA 4HFWB 4QOKB 4BELD 2O61A 1NCIA 2EH8L 2NXZB 2BNQB 1EEZB 5FKAB 2HXAA 4N0CC 3KPRA 3E9UA 4QHUB 4HZAA 1GGUA 5DEGB 1PKOA 3MFFB 2DM3A 3N42B 3ZMRA 3EOAB 4JFQB 4GLRH 1IL1A 1OLLA 2BVPA 1CF8L 4DETA 4UINH 3M07A 1MRFL 3VXQB 1ZHNB 1TTUA 2HZHA 2CHWA 4P9HC 1PJWA 4FRWA 1R3KA 3DRTB 2A6DB 1HHIA 1BPLB 1IM3D 4KTGA 3MLUH 3FFCD 1W6LA 1EX0A 1NDGB 1COBA 4HJJL 4C56E 5E03A 2AF2A 4KKRA 3DMMA 4NC0B 3OZLA 1P84J 2MIZA 3T2PA 5B4MC 4JPWL 1AHWA 2X4SA 4P2OD 3EHBB 3QZWA 3U25A 2FGZA 4JDZB 1MOEA 2ZUUA 3B7YA 1KT2B 4A7TA 2D7TL 4BQ8A 2J8UA 2G3ZA 4ICXA 3EUUA 1HL8A 4GXUM 4K0OA 4IMLB 4NPKA 4TVUA 4RGMC 5C0FA 1A7NH 3T0EE 5I0ZA 3CLEH 1VB9A 3MSPA 2HT2C 4W4OC 3WHE0 3ZL2A 1SEBA 5IMLB 3V0WL 1ZE3H 4OCMC 1CLZL 3EFFB 2CLRB 4M43L 3I6LE 3UPAA 4R4FL 1E4XI 3C5JA 1WFUA 2RGSA 32C2B 3DGGB 4PJXA 4X80L 5I9QC 3QUGA 4NQSB 4XNMA 2VAAA 2G9HA 1NCNA 4GIAA 1S6NA 3B8YA 4IGBA 2FRGP 4OCYL 3MUJA 3V79C 2QSCL 4GXVL 1JXJA 3ECUA 1LNUB 5KAQF 2DI9A 1XGYL 5LGHL 1JPSL 1GC1L 4D9LL 1BD2D 2EYSB 4XVSH 2VLRE 4S1SH 5D7IB 4Y4FC 2ATPA 3QYNA 4HUNB 2JQMA 4HUKB 5AYUH 4AQ1B 3UJIL 3CN3A 4Q0XL 2XQYA 2ICEB 5DSCB 2VMDA 5AOLA 3RVWC 1PSKL 2OXGA 3N41F 3CGTA 3CV5A 4WUUE 4AVKA 2VXSH 4KXCA 5KTEH 1IAKA 3WN6A 3BP7B 5DYOB 1I7TB 2YPKB 3BP6B 3F6JA 3M45A 3QHFH 5CEXB 5JW4Q 3ARED 1IIKA 4WZ9A 5T5FH 2QKIA 4Z7OB 5DD0H 2IQAA 3GNML 3CUPB 5IG7B 1NBVL 3VWJA 1JRHI 3IDGA 3L4UA 3F7KA 2I07B 3P73B 3KLDA 2PW2B 3QJFB 4HFUL 3MRKB 5A16B 1IEHA 5E1QA 1HH9A 4CC4A 1T6WA 5HVWA 4QPEA 2IG2L 4DKDC 3OC8A 2Y6TE 4C4KT 3M8OH 4GQ9H 4FABL 1YECL 4QHMA 4J3UA 4O58L 1DQDL 4D7BA 4AJ0A 3E80A 4JHBA 5TE4H 2ZQKA 5BO1L 2X1XR 5FFGA 4WWKC 4HJGA 1G94A 3QQ3B 2D9QB 4FTVD 4HKXA 3CVIH 1FZJA 3LRSA 1D5RA 5GJSL 3CZUB 4M4RB 1JI1A 5T3XL 5KSBB 1JPST 3IF1A 3DIFA 2WZAA 3WFHA 4DP1X 1TQTA 4DTGL 3LS5H 4MNHA 3US1A 3ULUD 3B7TA 2X10A 1MIML 3F3HA 4P5TD 3NJMA 4OLZH 2NXYD 1WAEA 1HWGB 1FFNA 1ZANL 4GUPB 1KB3A 1MKFA 4MQ7A 2BOBB 1VACA 1FSKB 4W9HC 5DFTA 3RIFK 4GJTB 3B2DC 4FQXC 5HHOE 3F65A 4PJ5D 1DBML 3MJ8A 1KJMB 3BEWB 3FQ2A 3ILQD 4JFWA 1A7PL 3DX6A 3HUJF 4YXLH 4PJBF 3D69B 5B1AB 2O26U 1OHZA 4YBLC 1MVYA 4L37A 3MLWL 1F4WH 4FQQA 1GGCL 3L7EA 1HEHC 4NZRH 3LQMA 5GRXG 4KY1L 4L3EB 1RHFA 5CUSH 2BHZA 2A5UA 2BVTA 4TLUA 4MD0B 4L8SA 3HBZA 4JGNA 2VN6A 3QJRB 2KLSA 4HEME 5I6MA 3T5WA 3IFPB 4J3OF 4OGYL 1XR8A 1XGQB 2GYSA 2AJSL 3GRWA 4GAYB 5DD3L 4PW4A 3IRZA 1KB9J 1PEZA 3S8FB 2MKLC 1E2WA 4UOW0 1CBJA 1HC1A 1QLFB 3A67H 2CJUH 3A6BL 3FL7A 1CXKA 1T0NB 1QRNB 3NJIA 4I9WD 5FKPB 8CGTA 2R4SL 4XN4A 2WM0A 1MFDH 2DQJL 4N2OA 2LHAA 3TBVA 4JFPB 3VI4B 3HUJE 3GXMA 3OKMB 1B3JA 1OK0A 1QACA 3TCXA 5EZJA 3ZE1E 1UZGA 2VO5A 4R7DB 3CMOL 2FL5A 5F9JA 4JFDA 4X4YB 1UM6L 1A7NL 4YDJB 1RJYA 4YSSA 3NGBC 2DWTA 4OZFG 4XCYB 5FFLA 2EDNA 1RU9H 1R1CA 1BBJA 1EZUA 2BRRL 4ADIA 3HZYA 3AADB 5I1LB 2CLVA 2PW1B 1QBBA 1FNLA 4DN4H 1NSNH 4M7ZB 1KCRL 5AB9A 3QUZA 1ZTXL 1FV1B 4YGAB 4JM2A 4EI5B 4KRPD 2WQ8A 4HKJA 2ITDA 1HU8A 4TSAH 4U05A 3F7RA 1FBIH 2DWYA 1UXMA 1E50A 3QULB 4QTIL 5JIQA 4JE4B 2H3NA 4OZGA 1QA9A 4FZEH 2VQ4A 3DJZA 3GTNA 4WK2B 3QJSB 2JTYA 4MAUL 5FAAA 2NDFA 4GUCA 1ICTA 4XO4A 4N0RA 5LAXA 4PBDA 3RGVC 1QQDB 3IGKA 4M1CD 2DLTA 4JQVA 4ATWA 2HLFD 2KBGA 4B53A 4TS6A 4KX9A 3BZ4B 3PWLA 4C4BA 4ZMQA 3ZTJG 1CUOA 2Q7AA 5FYJU 2P8PB 3RY5A 3LKQA 4MZRA 2AK4E 2EIEA 5F7WC 3WI9A 2CA3A 3QIWB 4U7KA 1QSFB 2P5ED 4WHTA 3JZ7A 3WJMA 5H2BB 1G4RA 1IBFA 4YHMH 3CZEA 3V52H 1G9HA 2ZYSA 2GJJA 4LSRH 2WSDA 1JL8A 1JV5B 3VXPA 3VDAA 3QDJE 2MMXA 4XOAA 1E5AA 5B7FA 4IBUA 4L4VE 1OSYA 3KWWB 3QEGH 5AW6B 5I16B 4G5AA 2MEJB 2GIMA 3RFZA 3RWFB 4CN6A 2NUPB 3O9WD 2A9CA 3LMJH 3O4OB 5E5RB 4E5XB 1MAJA 1KYDA 2FYYA 3LPPA 3KXFD 3EH4B 4JRXD 2IPTL 5DUPH 3QUYC 3T2NH 5LN8A 4XPAL 5GSVB 5JHDE 1F1GA 4P99A 1FORL 1P5UC 4AK1A 5TDOB 3CVIL 4ZMZA 2OMXB 4ZW6A 2B14A 5F97E 3QI9A 5DVOA 4ELMA 4JY4A 4XCNB 2IFGA 4MB3A 3THMH 4QRPD 15C8L 1RIHH 2L7UA 5LCVL 1TYJA 4PRPD 3WTTA 4HX1A 4PWGA 3PIQB 4OLZL 3QIUC 2DI8A 5CJ8A 2IXQA 1XZ0B 2XG4B 1Z3GH 5DU7A 43CAA 1GW0A 3CFJB 3K81A 5HVHC 2ZNXA 4D2NA 1GZHC 3EJTA 3SKJL 5BS0B 3W1ZA 3B9KC 1O5DT 3ARDD 2H5UA 1ASQA 4M7JH 3OQRA 2IWFA 4FCAA 1WAAA 4OCRL 1MY5A 2HUHA 4MJ5A 4NIKB 4NZRL 1LDSA 3IU3B 4XMKL 4X4XB 4B5EA 2QTVA 4W4NA 5FB8B 4IRJD 4HK0A 4YC2B 4YHPA 4FNRA 5DK0B 3WJJA 1T21B 5TQ0L 3O81A 3M1BB 5FS5A 2AHIA 1VIWA 1F56A 3HE6A 5ADOL 2A1WH 5DK2A 2R9HC 3IETB 3WJLA 4NGHH 1XSIA 2AV1A 1Y1UA 2DQHL 4Y88A 5IVNA 1ZV5A 2CAKA 1YPZA 2BOLA 2ZE0A 1YAZA 2ZONA 3ARBD 1I3RA 5KZCB 3CTTA 2NY3B 2ZSWB 5AKVA 3ULVC 4A04A 3L4WA 1E27B 3MYJA 1MPAH 1TLKA 2ZUTA 2AZUA 4RGOL 1CL7I 1PX3A 4KGJA 5HHVH 3E8UL 2IH3A 1A14H 2IAND 2AQPA 4JO1H 4I9XA 4HZLB 1U8PB 1B88A 2F54E 4R5TA 5KN5A 4WFHE 1OM9A 5DEZA 3I6GA 1KN4H 4JRWA 2ESVD 3OSVA 5G4OA 4BZ2L 2CGRL 3Q8BA 1NUGA 4UT9L 2YAQA 2E86A 5D7JB 3DXAE 5ISZD 3BKCL 3VG9C 5FHAH 3EF7A 4PFEA 5T3ZD 5FA3A 1DVUA 3QRGH 4OUUA 4HIIA 3ZRFC 3RDJA 3JQOB 2K9UA 1E4JA 4LP8A 4DFIA 1GHFH 4QRFA 3P9WB 1NBZB 2H8PB 1EGJA 3FQXB 4ZUUA 2D0HA 2PYED 2Q3XA 3HS0A 3R4RA 5DWPA 1QBLL 2YQ3A 4X5WB 1BZOA 4DN3L 1FBIL 3JWNE 4EN3C 3KLHC 4ZI8A 3MLPA 4G8GA 2E7CA 2HN7A 4OQTA 4LB8A 4PS7A 3UJTH 2JKRM 4WI0B 5E1IA 1BQLH 3KM1A 2VKXA 4H44C 3MBXL 1P0SE 2J8OA 3LZOA 1SM3H 1OWWA 3RPIA 3AC0A 4KMQA 3TVMD 5EUOE 1BFVL 3FFDB 2EXWD 4OGQC 4R2GD 1IAMA 5L4FA 3SPCA 4MCZB 1U8HB 4HJUA 3ZYZA 2F68X 2NY6C 3NTCL 1EO5A 2A73A 3GJEB 4NO0B 4Q97A 4PREB 1NCJA 2ID5A 3AGWA 1W2KT 4GW4A 5JUEH 5KVEH 3O6LH 4Y2DD 2A83B 3SKMA 1K4DA 3HN8A 3QPKA 1OF2B 3RY6C 3DSNA 2B1HH 2XQYK 1TFHA 1UACL 4YHML 5HDBF 3MOQA 2WMPA 4ZFFA 1E9OB 1LEIB 3HPLA 1AR2A 5C09A 4Z7QF 3QWOA 2OW7A 4AYFB 2R0LH 1UD6A 3C5SB 5B39B 4G6JL 3ULAB 3A6CL 5F3HA 4FEMA 1MF2L 4HXAL 4XN2A 2YSTA 2CH8A 2BM3A 5CZVL 3RILA 3ZQ9A 5DMGC 1RLBA 3QVAA 1TTCA 4FTDA 3RKPA 3GRWH 3SGJA 2APXA 4EPSA 3V6OC 4KK5D 3U0WH 2A4ZA 2YLHA 4RGMB 2EIDA 1QFHA 1S7RA 2R1XB 2WO2B 3W57A 1XH3B 2XWZA 4M8VA 3CDYA 3BIKA 2PKDA 4UB0L 4XNUH 1XWVA 2EO7A 5LQBL 3DOSA 4DO5A 3EKCA 4DPRA 4F15C 3KLLA 2KL6A 2E75C 1INEL 3TS8A 2Z4QA 4UQIM 3PHSA 4LSPL 5FF6A 1JWMA 1XGRB 4AL8C 3QFJE 1S9VA 3LKPA 4PIBA 4OLVH 4I3SH 4Z9KB 2VAJA 3G5XB 5DZOA 1HJCA 1P6WA 3OAZH 4M7JL 5D1ZC 3W81A 1CGTA 1DJWA 4FKHA 2AJXH 1SJVA 4XVTL 3VWKB 4Y4HC 4V1DD 1DBJL 4P57B 3B4NA 4P48A 3QR1A 1I3VA 4G5ZH 4EOWH 3FQWB 4NQDA 1RUPH 1S7WA 2FX7H 2B16A 3G6DL 1E30A 2B0SH 2BRQA 3GLDA 4DH2A 2P49B 5LWYH 2V2WA 3ARFB 4HH9A 1J9QA 2W9DH 2V9UA 5FYJL 5GRJH 5T1KB 4ZFGL 4PPTA 1MCLA 3X1EA 4PVMA 2J7LA 5IQ9A 4LBEA 4YH6A 4DZBA 4YSPA 5I1GH 1RIUL 4JR9H 4YIQA 5KJ4A 5GHWL 5SV3A 4APQC 1BZDA 3QBTB 3C5ZC 3HI6L 3ISRA 2FEDC 4WV1A 4WGWB 4ZNEA 5I1KL 4HIPA 4PRDB 5FW7A 5LG1A 3ROOA 4U33A 1SJEB 1QD0A 1DLFH 5HHVL 5MEPB 1U4FA 3V10A 3MR9A 1A14L 1PDKA 2DAVA 2AGJL 3PWUA 4HCRA 2WYHA 4WU7B 3CDGA 3PL6D 2WBKA 4K7PH 1YMHB 2FNBA 5DVKA 3MRPB 4AQZA 1E9QA 1TU2B 5E08L 2ICWI 2XVBA 1NKOA 1FZMA 5FHAL 2Z65C 1SQ2N 4LIQH 3SBPA 2ZPKL 3OMIB 4Z8FH 3EYUL 2BO0A 2PWFA 1BVKB 1T66D 3NIGF 4P23A 4PWHA 4EQ2A 4GKOA 3GJFB 2V2TA 1FDLL 5E2WH 3LV3A 4MAZA 1MCKA 2QSTA 4WNQA 4FP8H 3SY0B 3LCYA 5DJYB 3JTSA 1WWAX 1IGIL 3UJTL 1IBBA 2IH9A 1WBZB 1I85A 1ZGLB 5T1LD 3VVWA 1V27A 4OB5L 5FYLL 3O8XD 3OAZK 5IMKB 3D85B 5AQ0A 5IB1B 5C92A 2HTKD 2P9RA 4B0MB 4OIIH 5I2IA 4W9ZA 2AXWA 4YBLB 2MCG1 2E9GA 4NRZA 3W11D 5GIRB 5CJQL 3PQYE 2ZX8A 1WT5C 2EDXA 4OGXH 3CDZA 3L3JA 5IWLA 3S3PA 1NC2A 1ZY9A 3SN6N 2XN2A 3GSXB 4O9HH 1H3UA 1KYFA 4P5SA 2CUMA 2CR0A 3WEXA 5IQOA 2HT4C 2H2PC 4YHOL 3F12A 4YSOA 1PIFA 3NIGE 4H88H 2A4CA 4UDUB 4W70A 4XMVA 1CTOA 2ED9A 1UXLA 3DDGA 2DWSA 2R0LL 1WG3A 2EUZA 1CYWA 2IPKA 3R4DA 5SX5H 3ERXA 3G6JA 5D7LE 3TTSA 3TO4A 3MJ7B 1GS6X 2EDBA 3HFML 2BSTA 4PTUA 4PS8A 4EE2A 3O45A 3KLAA 3UDWC 3O6FC 2DZEA 4IOFD 5I1EH 3WLBB 1AKJD 3GRWL 3CSPA 3AUVA 1MHCA 3QNYA 2WBJA 1OSZA 1FZOA 2E9IA 4FG4A 4GQZA 2E7LC 4EUPA 1UM4H 3NSXA 4WHYH 2ZIDA 1PZ3A 1MHEB 3BT2L 2DD8H 3QIBD 2UWEA 5IEHA 1QBMH 4TQHA 3NRQA 1XTMA 5AG8A 1SXCA 4PJGA 5EDSA 1LE9A 1GL4B 3L95B 4U4IA 4WWID 3ESNA 1YUKB 5KS9F 4AENA 4MDJB 4MMYB 3IDUA 3POCA 4OBRA 1KB9K 1NUFA 1EZVY 3JWOL 3SOBH 5B1CA 4B9FA 4KJQC 4KAQH 3VXOB 4I85A 4UTAL 3QUMA 1MJUH 4AITA 1HILA 3L4XA 4HUXB 4X6FB 3RKDC 3WY3A 1F8TL 1Z5YD 4G8FB 4MCMA 4L8DA 4QR7A 4Z78A 1X7QA 3MLSH 1YDPA 2EICA 5K69A 3QUXC 2XBZA 4Q2ZA 1MW1A 3FO1A 2YFOA 3VFUA 3EO1A 4OLVL 4S2SB 3DPDA 4J4PD 5SWZD 3T0EC 3I50H 5I6OA 4JQIA 1SF3A 4HPOL 5EEZA 5ABAA 3EIFA 3FU9A 1EGJH 1EAPB 3RGVB 3BH8B 3B2MA 5DDHB 3HG1A 4AGNA 3MGTA 5LAPA 5AB1A 4YXHH 2CDGB 5DHYA 1JN6A 1OTTC 1AO7E 3AU1A 3GBLA 4ZMVA 5JORA 2GUOA 1DFBH 2VDLL 3LEVL 4OJCA 4OQTH 4Y19A 1QAWA 4JCWA 1WZ1H 5EBWB 3JTTB 1CWVA 1RV6X 4OLWL 1KPUA 4JS7A 1H5BA 1OQOA 1BVOA 5DJCA 3UTZA 3S34H 1A22B 4PUBH 1NIDA 4B9KC 3KS0J 2BVQB 4ZZKA 1U41A 3QCUL 3REVB 3QFDB 5BZWB 4LVEA 1OV8A 1P69B 4NM4L 4OJAA 4WW2F 2G5RA 4MMZA 3AS3A 4PJEB 3STZB 5IGXH 1NGXB 1O7VA 3ARGB 2BHYA 3QQ9D 5GS2H 4N2HA 5FGBA 1E5CA 5IHBA 1AQDA 3K2UH 1JHKL 1YY9C 4QRTB 4Z76A 2JKJA 3KYAA 1MCCA 3QE5A 2XJLA 2ATKB 4X9FA 3QUYB 3HZ3A 4J2XA 2FSEA 3PDDA 3QP3A 2WXIA 1P5UB 2JKXA 5AW1B 4Z7WF 5HY9B 1IGTB 4KXAA 2EAEA 1EDHA 4WEBH 4OCWH 4JZOB 1G7JA 3IE9A 2EDMA 1FZKB 3KPSA 3LZPA 3ZQXA 3B9AA 4X6EB 4Z8FL 1UB6A 4GSDH 2WXHA 4Y5YA 4EKXA 1K9TA 4I3RH 4LL9A 5ID1B 4CSTA 1B6UA 3OKDA 1AIZA 5ANME 4Z77A 4AYDC 4L4JA 4BQ6A 3LKRB 1NGQL 3P30H 4M02A 4GAFB 1FNHA 2Z31A 2YQGA 1KJVB 4OZHF 4U4BA 4N0YH 2FCBA 3J07A 4FI7A 3C9NA 4GBXC 1MFEL 3GMPB 1N0LA 1RJZA 5EIVA 1ZGLM 2NTSP 1NTDA 3CH1A 1OAXH 2YZ1A 4KMTL 3JXAA 1A7BA 3QEQA 2XFXB 3UJJL 3GSQB 3ZBMA 5BOZG 4E9VA 4B0MM 1BF8A 4OZIB 5IMOA 5FGSA 5ICZA 4Z7WE 3K80A 2Y1ZA 1JDAA 3U2SA 4JO2H 3MUHL 3TH4T 4XHQA 2R56H 4XGZA 3GB7A 3ZSSA 3P9MB 1JGEB 1M9WA 1QPPA 5FUOL 3SODB 1FVEB 2O5XH 3VFVB 5ALBH 4AM0B 5CEZD 3D25A 1WFTA 4U1LA 5DI8B 2J5LC 4NQCE 4Y9EA 3MRBA 1KGXA 5D9SA 3AABA 2J25A 4HLZH 1S9YA 5E94A 5FA4B 3L3HA 5FK9B 5B1BB 3KL3A 2EZ0D 3MNWB 1P6FA 4OZHE 3B7SA 1XIWA 5I1EL 3L5XH 5KVMC 3IGLA 1C8QA 3F5WB 3FQRA 3L5HA 5MERB 5A2CA 4U6YB 4FS0A 1XCWA 2BSDA 4ETQB 2YMXH 1K2DB 2YEZB 1KGUA 5AAMA 3HAEB 2OMNA 1DQTA 4ZG1A 3O4LD 3U0PB 4DP7X 5CJ5A 4MAYA 1ZEAL 4PGBA 5KYUA 5I5MA 4LARH 2ZNWA 1OGAE 1TVHA 3VG9B 3O11A 3D39B 4WW1A 1RZIA 3RI5F 3SE3C 2X6CA 4ZW5A 1P4LB 4K4KA 4K5OA 4HCRH 4HWZB 4X9YA 1MJUL 3OF6D 5TQ2H 3TIEB 3U36A 3VDBA 1CG9B 2WLHA 4AEHH 4H40A 1X5HA 5D6DC 1GIGH 2BJMH 4TQEH 4ZAKB 2CIKB 1NJ9B 1N5YL 4U1JA 1T7ZA 1QFWH 1LWJA 3BGMA 4NSKB 3GBEA 1GYUA 4KTDL 3AXHA 4OJYA 1F00I 4ODHH 3BSHA 3NFSH 2LLNA 1G6RA 3OMAB 3T2OA 5BXFA 4YHKH 1P7KA 5C0ND 4F8NA 1CI5A 3BP5B 4RX4D 4YGVB 4G1EA 4ZFOL 4YXHL 2COQA 6FABH 4KKLC 1HL9A 2YAPA 2NY4B 3FH5A 3GT6A 3P3YA 4FQLH 4J3OC 2WWOA 2PF6A 4OQTL 4F20A 5MENA 2VJ8A 4QRQA 5EEYA 2A9AA 2TSAA 3IJEB 2GK2A 3V0IA 4BDVA 2D0FA 2GC7C 2Y1YA 3D0VB 3P9LB 4CMMB 1YY8A 5FW6A 5J9PB 1ZLDA 4GG6A 4CVXB 1QBAA 1R33A 4ZOAA 5CLZA 4UNIA 4KPHH 3WFEL 1A6TB 3PPEA 1DEDA 4AT6A 1RUQH 2LU5A 3N9GL 1KMGA 3FUMA 4NQXA 5IKCA 2AANA 1MCDA 1NPUA 2VR9A 5IHUL 1T1WA 1MJJA 3QO0B 4I4WA 1FYHB 5DUML 3I9GL 3L9RA 5A40E 4D9RD 1PKQA 3D52A 3W0WB 5B3JF 1CD8A 2TRYA 1AS6A 4J28A 3BJ91 4H8VA 4OD3H 1WA1X 3MV7A 1ZLEA 3HLKA 3QB7C 2DRUA 2WXMA 3C8KA 1FVDA 1FWXA 3DIDA 4OF6A 4U6HB 4B9PA 4CN1A 5KYXA 3ETSA 1TJHL 2JB5H 3MNDA 1RVFH 2CUAA 3AS2A 2KZWA 3VSQA 4ESKA 4RESB 1Q38A 1QUNB 1HFUA 2VDNB 5IF0B 3H0TA 4F2MB 1CURA 4EBQH 4PJDF 4G8IA 4F15B 3PHOB 1DZ0A 2KLTA 4HD5A 2GABA 3SCMC 5IB2B 1O9ZA 5IHWA 4Y16C 4AH2A 4ES8A 1NPJA 1OAQL 4P9ML 3ZSTA 3WNMA 4MB4A 4G2AA 2GK0B 3FUDA 2X89A 3MRMB 2QPFA 3ZKXC 3BE1H 4JO3H 4NNYA 1TNNA 2IMMA 1IQDA 2PR4L 5H35B 2APBA 1QWNA 2MOVA 4G9FD 4J3VA 1MCSA 2QFPA 3PWNA 1BMWA 1GRWA 1JMZA 1HHJA 1U8NB 2D7NA 5DLLA 2PYFA 1KACB 2R0KL 3U46A 1HNYA 3N3EA 4M48L 5FDWA 5F72S 1NOAA 2ZXEB 3OKKA 4KHTH 1EEYA 1I53A 3QXAB 4ICWA 5C08B 5HDLA 1KIRA 1HYRC 3DUUA 3IKCB 4DEUA 5HYFA 2G2NA 1N67A 1T7YA 1N59B 4GKNA 5ALBL 1DBKL 4K07A 1N0XH 2R2EA 4PJDE 5GGQL 3WN5B 4JQIH 5KVGL 3LXAA 2JELH 3RJDA 1ZSDA 4JCLA 1KJ2L 2XKSA 3NRPA 3L5IA 1AI1H 2OMBA 3R06B 1A2YB 1AGBB 4N3TA 2ZSVB 4DAGH 3C5ZB 2Z92B 3CZKA 2ORBL 1EJ8A 1OP4A 5IBTL 4KI5F 5BPPA 2CDEA 4RFEB 5DMJB 2F8OA 4XBGA 3MA7B 5CP3A 5C0GB 1MAML 3MUY1 3MRIA 2YAOA 3P40A 1PZUB 1OP5H 3MCLH 4E9XA 2NR6A 3VRIA 2YMXL 2R29L 2ZG3A 1UT1A 2ICES 3L08A 3N1GC 3L81A 5F3FA 2OK0H 4WO4B 3K5RA 4Y4KB 3ML8A 5INDA 2F19L 3RPKA 4TULL 2IC2A 4U1IA 6CGTA 3E38A 3IRPX 4GAGH 5H4ZA 1JOIA 5FM5O 4ZYKA 4XTRC 2HX9A 1WQVT 3B43A 2CO6B 3NSDA 4ZMTA 1D5MB 2WUCH 4KO7A 5C07D 5F7EH 1LEKB 1SFDA 5LGJB 2EACA 1VEPA 2DQGL 4MXQC 1T1ZB 2C3HA 4DGIH 1EJ6A 4EZKA 1N6VA 1FIGL 5C0AA 3S3CB 1DJXA 2OX5A 3C09B 1YA5A 3TU6A 3Q5YA 3DMMD 4Q56A 4KI5E 1INQA 1IGYB 3MUGB 2E8YA 1WFMA 3MBWA 4LCUA 5ILTH 2BMKB 1ZS8B 4G6KL 4OY9A 4YX2L 1HI6B 1ES0A 4P2RA 2UX7A 4TLKA 5D72H 3T2QA 1DR9A 2EXYD 1ZK5A 5DA0B 1F5WA 1MQKH 5E7FA 5F7NC 5L88H 5DJXA 4JNXA 4X50A 4FKKA 3CU1A 2KYIA 4RNRB 1BZ9B 3FRUB 4WI7A 1JUFA 5D4QA 1OTSD 3MBEA 1JZ2A 4PTTA 5M95B 1QFWI 2WZ6A 1JVLA 2DS4A 1LQSR 2IOIA 3MRQB 2A9MH 5C0DA 1H6TA 2AC0A 4KPHL 1DJGA 2W88A 3TA3C 1G1CA 1T89C 5GS3A 1F90H 2BW4A 2YD5A 3D51A 5IOPB 1Q1PA 1Q9OA 2XSKA 5IVXA 3FT2A 5JTWA 4MA7H 3C6LD 1KEMH 2WQWA 3T77A 1IGFH 3VX0A 3DBSA 5C3TA 1KCVH 3RJOA 1BF5A 2FEEI 1OP5K 1B0WA 3O6FB 5DD6A 5F7LB 3KPPB 5G5DB 4JPVH 2C26A 5DHDA 5I19L 3BFOA 2WLYA 4KXZI 2Z0BA 2H32B 3U6RB 4RMVA 2P1YA 1XGPB 1RZ7H 3V55A 2VW6A 3KHOA 2HMIC 1NKGA 3G6AA 3ZR6A 1VKXA 3QGVA 5I66A 1TQCC 1KF9B 5I1DA 5F9WC 3ZDXF 3US0A 3OXSA 1VADB 4O4YH 4ABVA 4EBQL 1AD0A 4AG4L 1DVZA 2CM5A 3PJLA 1AFVL 5HYQB 3LHPH 4JHVA 5T3ZL 3BRGC 3PNRB 4F2ME 3MV8E 4PJ7F 4QOKA 3UC0L 5I1HH 3W5MA 5CGYD 4QKXB 5HDQH 5FKAA 3HNTH 2WY3B 4FQ2H 5HHME 5IFHH 4QHUA 2R1WB 1NANI 4YO0B 3CMGA 3MV9B 2X2YA 5DEGA 5AOZA 3RAJL 3N1PC 3SGKA 3KL0A 1G1YA 3MFFA 5BQ7B 1PG7L 3BE1L 3EOAA 4JFQA 5T1DH 2EC8A 1MFAH 1D5IL 3VXQA 4X4MA 2N4IA 1ZHNA 4PG2C 3TWCH 3K6DA 3QUML 1H3TA 3GYRA 4BH8B 4K5LA 4AE1A 3H56A 5E6IC 2GBAA 5I6NA 1IKOP 3CHQA 3DRTA 2A6DA 2X9YA 1F42A 3BMVA 4LFHG 1JDCA 2HJFB 2AVFA 3FTZA 3N43F 3ZDXE 4XVOA 1QABA 1G6RH 2YC1B 4AYSA 4RZCB 1WSST 2VXVH 2W5PA 2HFFB 2YPLB 4JG0H 5B8CC 1PYWB 3TV8A 3GUTB 4QRAA 3FQ4A 1DVXA 1KGIA 2NX5D 3IBEA 3BUQA 1BVNT 4G72B 3BUPA 4PJ9C 3PHQB 4PAZA 4QF1B 2X3AA 4XX1G 4MJID 5C70A 4YFLF 1KT2A 3BW9B 3UERA 1PX4A 2E46A 4PCTA 2NZ9D 3G5YB 3L48A 4IMLA 4QXTB 4YLCA 1BFTA 1DE4B 1EV2E 3K6IA 3KBHE 3LX9A 2PTTB 2K7PA 3N06B 1G6VK 5IMLA 5CILH 1D7DA 2IOOA 4I1NB 4CSZA 3EFFA 2CLRA 3UACA 2VDQB 4OM1H 1I7UB 4X8XA 3DGGA 32C2A 4U1HB 3FMGL 4NQSA 3VXRB 5IBLD 4Z7NB 2Z7YA 3CLWA 1QVOB 2MH4A 3NK4A 5F70A 4XP1L 5FYKH 1NFDF 2X9WA 3X11B 4K55A 1K4CB 3LQZB 4DGIL 3CVHL 3LDBB 1CQKA 3D3VE 1DSFH 3N1FC 4NCC2 3ME0B 3L3KB 5JHAA 1LNUA 4YDKH 3FCSB 4P5RA 2ITCB 1YCSA 4KZEH 2EYSA 1QYGL 5D7IA 2B3IA 2W95A 4AQ1A 3BCFA 4GBXB 4PU2A 2ICEA 4X6CF 2VN5A 1SLXA 4Q6IC 3UBXI 5L88L 1WZMA 1NC4D 4YDVB 1L9MA 3F62A 2FT8A 2PNDA 2WWKO 4LEOB 2YQBA 3BP7A 5DYOA 1I7TA 2YPKA 3BP6A 5K93A 2AI0L 2J57A 4AMKL 1N6QL 3BZEA 1Q8MA 1RPQA 1AHMA 4MD4B 4XO9A 2YAFA 1T22B 1GTNA 2XVLA 2BIOA 4HSQA 1BXUA 4ODSL 4HG4J 4FFYA 3CUPA 5IG7A 3MROB 1U6AL 5CU9A 3SDCD 5L2JB 2I07A 3P73A 3QJFA 2PW2A 2J5LB 3LH2H 3MRKA 4L1TA 3U7WL 1YC7A 5A16A 3GDBA 4BA0A 2JXMB 3C2SA 1TR7A 1XCQB 2J6EA 4WI5A 5GGTA 4Z23A 1QW9A 4P46B 2JJVA 1AP2A 3SDXB 4DGUA 1JG9A 2K45A 5EF0A 5D2LB 1NAMB 1OL0A 2DM2A 2MOQA 3FFCE 3S88H 3HZKB 3IWUA 3ZN6A 3T0XA 4NP9A 4X6CE 2Z4TA 3NJVA 4DQAA 3FQNB 5F7KC 1BQKA 4Y7MA 4KUZH 3QQ3A 2CBTA 4TXVB 2QADC 2DPKA 1CFTA 3RX9A 3W39B 1F11B 1BZQK 5JW3L 5I6XC 5KSBA 3BOVA 3KR3H 4PJ8D 1RSYA 1SBSL 1MFCL 5E99L 3CD4A 1PNDA 3D4ZA 2BY2A 2I26N 5CP3H 3LB6D 4HVBA 5D8JH 2FT7A 2JKSA 4GUPA 2R2CA 2VZVA 5DQ9B 1TETL 3QZLA 2BOBA 2WXKA 3H85A 3WNLA 1F58H 5HDQL 4B60A 2GTWB 3DETC 1KIQB 3BEWA 4DKFL 2XZQL 1H6EA 1SMDA 5HYEA 3FHAA 3RL1B 4GKLA 5ENWB 3LPOA 4XXWC 5E9DA 3L3DA 5KVDH 3D69A 4HUVB 2XJKA 1DVFD 3C6SB 3TASA 4I0PD 1G84A 3SE6A 5T1DL 3S0PA 1I1FB 2VN4A 4LFHD 3BKMH 4XMUA 2GJ6A 4M7KL 4MD0A 4Q9CA 4A7VA 1FFTB 3GQFA 4RVBA 1F86A 2CO7B 1WIUA 1PY9A 5I1JH 3D87B 1XMEB 3D05A 3IFPA 1XGQA 2XTJE 4GAYA 4G6MH 4UILL 3EJJX 2VXVL 1E3ZA 4JG0L 4ZRGA 1NCAH 5ABZA 1QKZL 4G6AC 3VGDA 2PXYC 5HVFB 3SDAB 3QI9D 2H3XC 1QRNA 2Y7LA 2Q5BA 4ALAH 5JXEC 3FBQA 3ZKQD 4QRSA 1HEZB 2O6CA 3RWIA 3HNSL 3UOAB 4JFPA 3VI4A 3ZKND 4UV7H 3BVNB 3OKMA 4KJPD 4XO5A 3QA3B 2EO1A 2JWYA 4R7DA 4MS8D 3F64A 3VGEA 3ULUF 3CSGA 4X4YA 1CBVL 2M26A 3I2CH 2O6PA 4YDJA 4XCYA 4OAWB 5F7DB 1TT6A 3AWGA 5CILL 3MNVB 5D1XD 4A37A 4AXWA 4WEUD 3BYTA 3VM5A 4F7PA 5I1LA 2PW1A 4A2LA 4TOYL 3PAZA 4CC1A 1CC3A 1R5IA 2R1YA 5I82A 3L4VA 3OR6B 1V05A 1FV1A 2YN3A 4EI5A 1RD6A 1R6VA 4PB9L 1F6AB 4MQXC 1DUYB 2H0JA 4YXKL 3PRZA 3RVXD 3QULA 3SCMB 5D5MA 1J0JA 4Y16B 2GSIB 5D2NE 5L8JB 2QMJA 4LOVA 4JREC 5MEOA 2XFGB 5AD0A 4HLZG 3LEYH 4NZDA 2YD0A 2F53B 2WTRB 4PRHB 1TIUA 4WTWA 3D48R 4P2QA 2AKRA 3QDHA 1I7ZB 4N5EC 3ULUE 3VD2A 1ZVNA 1GOFA 3VXUD 4MA1C 5DO2D 1TITA 1CXHA 3BZ4A 3NH7H 3FB8B 3FUKA 1E3FA 1LILA 1W72A 1SNRA 4U1KB 2WBXA 3GSOB 1TQVA 2P8PA 3CBKB 3QUKB 3QQDB 4HIEB 1F6FB 4JKPL 5AVWB 2X1WL 4FL4C 4PJ5E 3QIWA 3BWUC 1WTGT 1QSFA 5JDJA 5KYYB 1S5IH 5H2BA 1QR1B 4EQ3A 1RKRA 4CRPA 4YDIL 3BX7C 4KJWD 4MA3B 4WW2C 1JV5A 4UT6A 3NG5A 1J8HD 2G60H 2DQTH 4YDZA 4DW2H 3KWWA 5I16A 2H3KA 2DJSA 3DJSA 3NAAL 1NA8A 5AWNH 2VDOB 5I17B 3RWFA 4L1DA 2NUPA 4ZXBD 4E5XA 4G8GD 2WP3T 1CTMA 3EJPA 3BDYH 4XOCA 4DKEH 3SDXE 4FE9A 1HOEA 3O2WH 5GSVA 4HKZB 5BRZB 4FHKA 5CGBA 1AJ7H 3DTUB 2NMSA 1IGJB 4XZUB 1SBBA 1TF4A 4GRLD 1W15A 5AOIA 3I6KB 1DQLL 5L9DL 2VZUA 4WU5B 4XCNA 1OAYH 3NP3A 2FVNA 3HN3A 5AW2B 3H9SE 3PIQA 2I5YL 3N5AA 3LVEA 5D8JL 4W9EC 5IOKA 1PIGA 1KFAH 1F0LA 1FH2A 1KB5B 1XZ0A 4R90L 1F58L 2IGFL 5GS2D 2OTWB 3CFJA 1I1AC 2E76C 4IOSA 3C2AH 3DO3A 3KPQA 1ZLUH 2CJ3A 2D2CC 5BS0A 2DH2A 2FT6A 3A23A 3P2BA 1X9UA 5KVDL 5C09D 1RUMH 3BQUA 3SKNB 4ZTOH 3IJYA 2FLMA 2PLTA 1TENA 3ARQA 4EDWH 1AZVA 3QJOA 2JQAA 3ECVA 3IU3A 1UOVA 1WIPA 4X4XA 1A02N 1F3JB 1J5IA 4MWFB 2YIHA 1AZRA 2X4QB 1FO0L 3Q5OA 4PJAF 1KWKA 1INDH 3AT0A 2JVUA 5DK0A 1T21A 2C1PB 4G3YH 3M1BA 4AZ8B 4OBSA 4FQIL 5DO8A 1BFOA 3UG3A 1IILE 3B7RL 1E6JH 2MQCA 3ARPA 4XHJC 5EZOH 1KC5L 4AUJA 4GT0A 2CLZB 3ZX1A 3DIVA 3AB0C 2XN0A 2YGOA 5E5UB 1UUSA 3ZKSD 4D3CL 2N7SA 2IALB 3LXBA 4ZMNA 1U93A 2ZSWA 2GKIA 2HWZL 2QQNH 2YKLL 3FU7B 4UV7L 1E27A 1I8AA 2GSMB 4H1LB 4PSRA 1N4XL 4K7PX 4X7SL 4E36A 3TPKA 1OCOB 4I13B 5D93C 3SJVD 3NIFF 4HT1L 4JVPA 1JNLL 1M7UA 4ODVH 4AW7A 4MDIA 5D7JA 4XXCA 4WI3A 2VSKB 1N6UA 1L6ZA 3T8VA 3OMNB 4Y8DC 1QEWB 5C0CA 3RL2B 2J6EH 3RQ3A 4JUTA 5GGTH 4F2FA 2O93L 3KW8A 1TQCB 3LRMA 2X2HA 5I8KH 5E51A 1FL6B 5F9WB 2BNRE 1NBZA 3KD4A 2H8PA 3ZYOA 5CD5D 2KQNA 3F05A 3FQXA 5F1SA 4NQDD 4GI9A 4N85A 4X5WA 1FI8C 2QDVA 4MJ6B 5FC9A 3PJSB 4Y1AD 3OBAA 2BXYA 4U3HA 5B1JC 3P0YH 2K4AA 1W0YT 3KDMB 4YZFF 3BAIA 4JFSA 1QO3B 1T20B 2XV2A 3RY4A 4G7YH 3RYMA 3VRJB 3U9UB 1W80A 3AACA 4EN2A 3AVEA 4FGMA 3FFDA 4R3SA 4WKXA 4MYPA 1OM3L 3UADA 3NIFE 4XNXH 4IIZA 3CLFH 2FJUB 2QSVA 4UANA 4MCZA 5I23A 5EZIL 2B1AH 3MODL 3DPBB 3ZXAC 2A2QT 1E5ZA 3GJEA 4NO0A 2A0LD 5J1AB 5E6IB 4PREA 1BAFH 1MCJA 5AYQA 3L17A 3SO3B 5HDBB 2NCEA 3G5ZB 3UBXG 3GHEL 4WK0B 4Z7QB 5JHBA 2G3XA 1ZLSH 1LEIA 4HEPG 1XGUB 1E9OA 1Z66A 3UG5A 5IIEA 4POUB 1SJHB 2WXQA 3MN8A 5SWSB 5B39A 4ELKB 4CN4A 4H20H 5BUAA 4GG8B 1JF1B 3SGEH 5AZ2L 4PJ9B 4KBPA 4ABQA 4YZFE 5J0BA 3WKML 5K9JH 1YYLL 3HE7C 3A22A 5I5JA 4OI7A 1J18A 2DQEL 3OJMB 4F7MB 2YGNA 3UBFA 2W92A 4N0UA 1BREA 3VE0B 4LLYB 1KEGL 3O2WL 1KCSH 2IWGA 1QFUL 5GS0L 5L0QC 1IFHH 2YN5A 2R1XA 5B3NA 4DKTA 1XH3A 1UWGH 4W4OA 4OCSH 3CFBB 3HG5A 2KHAA 3T3MF 2ZOOA 1D9KB 4JFVA 3COOA 1E8YA 5L2KE 3WO4C 1A6VL 1N5AB 2WO4A 5HDRA 1NC2D 2AV7A 3O41B 4MB1A 1QSZA 5CS7A 5IB5B 3GO1L 4XC3L 4LVHB 5J11C 1S7UB 4QLWA 2ZUYA 5F44A 2VJXA 1QG3A 1XGRA 3P2TA 4L3CB 3IAPA 4YHLH 2ESVE 3EJZC 2SEBB 3TV3H 4U2YA 3UTPD 2GEEA 3KHQA 1DVTA 2X7LB 1G1KA 3BPLC 1GPOH 3T04D 1Z9MA 3WEOA 3G5XA 5ISZE 3CQQA 1MFNA 3LSOB 1S9KC 1FNSL 4ZTOL 1UB5B 4Y4FA 1HCYA 2FQEA 3QHZH 3NPSB 3Q43A 1KTRL 2QVTA 1CE1L 1INDL 3FQWA 1RIVH 1X5XA 4C8XA 1WP6A 5BO0D 3QCVL 4KKNA 2NSQA 3FQUB 3HI1B 5T1KA 3QXWA 3T3ME 1OT1A 4HGKC 3ZZLA 5F6HJ 3CXDH 1T0MB 3JV6B 1T83C 5F1NB 2OYLA 4GB9A 4KI5C 1T03L 5KYNA 1W72H 3NABH 3PY9A 4XVUC 1F4XL 3NSJA 4L4TB 1JXKA 1LVEA 2AJYL 5L6YH 2R8SL 4WU7A 3ZZQA 1R3JB 3C60C 2XVKA 4BBWA 4FFYL 5TE6L 3ZRCC 2XZCL 1DBAH 3Q5TA 4FJYA 2NYYD 3UAJA 3ZDZB 3MLYL 3DX1A 3TP4A 4RAVB 3BZDA 2EDEA 1TU2A 4WWKA 3TN0D 4GMSH 4UT6H 1CFVH 5CN2A 2QADB 3GXTA 4PJHF 3FUIA 4JN1L 3GK8L 1DJIA 4FMVA 3SO5A 4NFDA 5I8KL 3BSZL 2YAHA 3R7QA 2ZYIA 3VXMD 2P8LB 1OQXA 3L4TA 5JOPE 3PUUA 5ADPH 3GJFA 1G7MB 1GMEA 1U8CB 3QG7L 4Y19D 2EDKA 4Z95H 4OFPA 4G9DA 5TFSH 3SY0A 3VRLF 5DJYA 1JF5A 2C4FU 4CILA 4IBVA 1WBZA 4E41D 5IMKA 3D85A 5IB1A 3K2IA 2F7OA 2P7TA 2W9EH 2AJUH 4J8QA 3G04B 4X9HA 2C9VA 4LHJB 2X6MA 4EXKA 1C08B 4KQ4H 3GLZA 4IKIA 5GIRA 4NS0A 2B1AL 3EOBA 5HDOA 3MNMA 1AY1L 3ZHFA 3DLQR 4LGPB 1G5GA 1X4XA 1BAFL 5HHNA 5JIPA 3S9DB 2Z7ZA 4DP0X 4V2BA 5I6PA 2ZP8A 4CU8A 4CKVX 3FQYA 5HI5C 4RDQG 1EMTL 3D4GA 3MTXA 4I77L 3QDGA 1DVQA 1ZLSL 2A6IB 1J1XH 4UDUA 4XPBL 3NBNA 5ACZB 2N01B 4P59L 4BFEA 4XBMA 4AJVA 3HB3D 4FYQA 4MJJA 3VRLE 1IAIH 3TYFB 2FWLB 4JMNA 4H2AA 3NPZB 3MJ7A 3QPQC 2CUHA 4A6YL 4IRSC 4MB5A 3DO7A 2FQDA 2OZNA 2X28A 3DHUA 3FUNA 3CFIC 2UXVA 3HZMA 1E7UA 3WLBA 3AUWB 2WV3A 3IJ7A 1V3LA 2Z8RA 4PRIB 1KCKA 1NCBL 1MHEA 1UXSB 1DQVA 2Z31D 3GBML 4QRBA 2Q20A 3FBKA 5F96L 4GNKB 1FLRH 4JQXA 1SY6A 1SRDA 4HW6A 4AVJA 1ASOA 4XODA 3VDCA 2H2SC 2K0RA 4M8QA 4KDTC 4MDJA 4MMYA 1CS6A 3WAKA 5J4MA 4MNGE 3RA7L 4FQCL 3SGEI 4X5XB 3VXOA 4HCFA 4KK8D 2EABA 4Z5RA 4Z0BH 3KGUA 1TTAA 4HUXA 3V6FB 4X6FA 1NH6A 3BLKA 4PGCB 1AS8A 1IQWH 4YNYB 3TV3L 1MRCH 1MNUH 3NJLA 4JM4L 5IBUB 4S2SA 2VMEA 2OBGA 4DVBB 3Q7JA 1IE4A 2C9AA 1HHHB 2RR3A 3QHZL 3VI3B 4R4BB 1EAPA 5DUBB 5GGVY 1DDTA 3RGVA 3S3DB 3BH8A 3AS0A 3WXWH 5DDHA 2Q8AH 3S4SB 2CDGA 5IUSA 4GPVA 5KBLA 2ZWNA 2D2OA 4ES9A 4L29A 2ZOWA 12E8L 1A6AB 1LO0L 5EBWA 1UOLA 2DQDH 4L1LA 3TIDB 3JTTA 4C4KO 3S5LG 1WEJH 4BKSC 3OHXC 3ZTNH 4XPFL 3CXFA 4FL4B 3L3OC 4NZFA 3RLSA 3UO1H 2UUDH 5IB3B 2AW2A 4XP4L 3JWOC 2BVQA 4EIZC 3REVA 4GINA 4F92B 5BZWA 1W72L 2E3VA 3STZA 4PJEA 1WHOA 1MHHB 3ZPDA 4GEJA 2SODB 4PLKD 4Q89A 3UYPB 3D09A 1I31A 3GMNB 3GF8A 4I2XA 4KZCA 4OIAA 5GRWA 1CLYH 2JJSC 4QRTA 3QORD 4JG1H 2HT3C 1E4KC 3RTLA 5KBNC 5DGQA 1J1OH 2C3VB 3JWDL 5ICXB 3UBGA 5T33L 3QUYA 4L9LC 3KCWA 5DJDB 4UT6L 3F58H 1P5UA 1X5JA 4QCIA 4HC1L 5HY9A 3V0DA 4JZOA 4L8BB 1P4IH 2HVKB 1FZKA 2X4OB 3FPYA 1S9WB 4M1DH 2Y7SA 1JZJA 4NAJA 4X6EA 3SPVA 4BXSV 4Q74A 5ID1A 1MCBA 2G5BA 2Y2TA 1JZ5A 5DS8A 2NQ3A 1MHPL 3QIUA 5MEND 2WB1A 3N85L 5TFSL 1J0ZA 4FG6D 1IE5A 5JIDA 1T7WA 2X6UA 2YBGA 5AKRA 3V6ZA 3WY4A 1TQUA 4NQED 5MEQA 3RTQD 4NERA 1KUMA 3BHBB 2P5WE 4LCIH 2MKWA 4WENB 1H8NA 2V5SA 3D30A 3B9KA 3GMPA 3ZGHA 3D2UB 1LE5A 1U95B 1J5OH 1EHLH 3MLZH 1MJ8H 2XFXA 4FNLL 3B5HA 3RWEB 4OZIA 5KAQG 4NKDA 4P2OC 2ZUQC 4LASL 3K2MC 4GRWB 3O2DA 2A99A 3T4AC 4OD2B 2UUDK 2GQHA 3GBDA 3P9MA 1JGEA 4LOUD 4HK3N 2GSGB 4XVJH 1FVEA 4TPRH 4FXKC 2WNWA 3VFVA 4HWEL 4AM0A 1J1XL 5CZXD 4RMSA 5JQHC 1MI5B 2JIXB 5SWZE 3RU8L 3GI9L 1IIIA 1T4KB 2HPTA 2B4CC 4FDWA 3PFUA 5FK9A 3NCJL 2MTPA 2P48B 3MNWA 5GSRA 3DARA 1ZGLP 2BSSA 2ADIA 3TBTB 2ZKHH 2DQUL 1QOKA 3F5WA 5MERA 1U8KB 2NQCA 3MREB 2FDBP 3VGBA 4PLNC 5CP7B 4ETYA 2AITA 1NCDL 2AEIT 5CZKA 4E9QA 5AZEH 4BKLB 4ETQA 1K2DA 3KJ6H 2YEZA 4H0LC 1AGEB 4UT7H 3OC5A 3HAEA 3P4NA 3MCYA 2VLKE 2YMTA 3DGDA 1DSWA 4J39A 2FJFB 3LRKA 1MEXL 3UROR 4AQOA 5EBGA 3SOTA 4OCLC 3IDXH 3TT1H 3D39A 4DVRL 2LU4A 3BWAB 1HAWA 3DX8B 5JQIB 1P4LA 3CC5B 3SY6A 5HYSB 4LU5H 2J44A 4LLMA 3TIEA 4FEIA 5DC4B 1CG9A 3EBAA 3ESOA 5H94B 4HU2A 1C9SA 4EN3A 4ZAKA 2CIKA 4PD4J 1NJ9A 2YEVB 1IC5L 3CFDB 1T1XB 2W91A 1A7OH 3K4AA 4XBEH 5E5MB 4TM9A 5F89A 3FUHA 1OT4A 5DD5L 3AREC 5IESH 4UM9B 4WWPA 4RBPH 5F7HA 4OTXH 5F7MC 2WKLA 1EFQA 4OZ4A 3WXWL 4YGVA 3GJFH 1BEYL 3LN9A 5E2VH 2Q8AL 1VHPA 3R8QA 1DL7L 5H8DA 1EEUA 3VFOB 2XWJA 3I3BA 5DRNB 1NBYA 3IJEA 3UCQA 2WLMA 1WEJL 2FQGA 4L48A 4U2ZA 5FUZL 2ZCKL 5LLIC 5J9PA 3D0VA 3P9LA 4CMMA 1OT2A 1REIA 3FS9A 2CQVA 3I6LD 3K6SA 2OCJA 3B3IB 3RY6A 1NMBL 3ZDYE 3GDCA 1A6TA 3O2VH 4J6RL 1UA6L 4XRCB 1CU4L 2FD6H 5DZAA 2QL1A 2DQCL 3MHZA 3MCKB 3X3FH 4P9HL 1OARL 5GZND 2QPSA 3QO0A 2YD9A 5EPMB 1OE1A 3ULUC 4WTXA 3CC1A 1ZDQA 3ISYA 4JKKA 4P5TC 3UBHA 3ZE2B 3VH8B 4AWJC 2NXYC 1OANA 3EOTH 1R19A 3HE7B 1FYTA 3W0WA 3LJ3A 5C0AD 3AG4B 5C2BH 2VLRD 1N7ML 3V6OA 4Q4EA 4YEEA 4U6HA 2C4FT 3F58L 3ILQC 1S7TB 5DQDL 5I76B 3O0RL 5KSAD 1FE8H 1JP5A 1P4IL 4OCXH 4F7EB 2AXJA 3ELQA 4QLRA 2C9SA 3ZE0F 3PLYA 5D1QD 3PHOA 3APDA 3PWPA 3WO4B 4GO8A 4XO8A 1QSED 3FTXA 3L4ZA 3MOAH 5IB2A 1BBDH 1RMFL 3Q8AA 1B0GB 5J11B 2DDQL 5LN4A 3B5GA 2Z0UA 1A5FH 4RBPK 2GK0A 1KCUH 3VX1A 1SY6H 4CSPA 4M8RA 4M62H 3GSWB 3MRMA 4ZS6C 1CYGA 3II1A 4PI0A 4XCCL 3GJFK 5CBAB 1RFDH 1FJ1A 4M56A 2JTDA 3E6HA 5D1ZA 1YSOA 1EHLL 3MLZL 4L1BA 1E90A 2AXHA 4RISL 3BJLA 3WXVH 4Y5XC 1U8NA 2ZF9A 1VPOL 3H6JA 4OGAD 2MCPH 4FQHA 1IGCL 4S1RL 4A7SA 1AG0A 1UQSB 2GT9B 4TKWA 3H1ZA 5C08A 3IKCA 5DMIH 5JMRA 4LE8A 1SDDB 1N59A 3ZE0E 2KKQA 5AVQB 4WDIA 1THAA 1URLA 2IWEA 2VTFA 4HK3J 4PP1D 3U6XA 3EYOB 1TEYA 3QZWB 4F24A 1MWOA 3BD5A 1FFRA 1YNKH 4Z3GA 3R06A 1SN2A 4ZSOE 1A2YA 1AGBA 2X6VA 1HOCB 2VIRB 2XPGB 4Y1SA 2ZSVA 4NN7B 5FHBH 3DECA 3C5ZA 2Z92A 3CZLA 4NLAA 2XN9B 3CHXA 4WSGA 4XI5D 1DVYA 4YQXL 1J9TA 5C0FB 4RFEA 4RIRB 2Y69B 4V2CB 1MG3C 4E0RB 1HXKA 3P2DA 3MA7A 2X12A 3PV6B 2BNQD 1IKNC 1OD7A 4WLCA 3E7JA 4UT7L 4JGUA 2DQIH 4WO4A 2XQBL 3MLXH 4N9GB 4DK6A 2VAAB 4PJCB 4ZO7A 4UU9B 3AXLB 1J05B 1KXQE 1S7XB 2G9HB 3QJXA 2Q1EA 2YUVA 5EZPA 3RVTD 5ESVB 4JDTH 4M1CC 2CO6A 1WFNA 2HLFC 3C8DA 1D5MA 8FABB 1TTFA 4M93C 3UPCA 2VSCA 2ZXAA 3K1DA 5LGJA 4D9RE 1I9RH 1A25A 1SUJA 4GOSA 1NEUA 1T1ZA 5EV7A 3RHWK 4DOHB 4L5FH 2ATPB 3BP4B 4TSBL 2Y5EA 3OJ2C 2WO3B 3I75B 3L1FA 4JO4L 3MX0B 3UYRL 3B2VL 4LQFL 1BZ7B 3MUGA 4QRRB 3BFWA 5HJ3B 2OXGB 3LKNB 4M8UA 4N2KA 3CWGA 5DJ0A 1ZS8A 1HI6A 3LQAC 3HI5H 1PZDA 1ZOXA 2ED8A 3SQOL 3NESA 5E2VL 1M7IB 1OAZH 3EHBD 4IM8A 2VN7A 4BA8A 2DYPB 3UTTB 1WT5A 1CLOH 3AGVA 1TEFA 1BZ9A 3FRUA 5E7BA 3Q6GH 3O9WC 4XPTH 4PJFF 4A1RA 1TQSA 3MRQA 3X17A 1A7RH 1HH9B 3JZYA 1YEHL 3V7MA 1IC7L 1IC4L 2ARWA 4AOFA 3O2VL 1QPXA 3PJNA 3C08L 5IOPA 1B0IA 2FD6L 2FWSA 1G9NC 4G9FE 5GISL 4AYID 3MDJA 3PXLA 3X3FL 3UZQB 5GRZA 3DV6B 4I0KA 5JZ7D 1ADQA 2YEQA 3W3BA 3WNOA 3O2DH 2MQGA 5DMKB 3P0VL 3ZHLA 3H6AA 1EFXD 3O6FA 1QHPA 3KPPA 3QCTH 4HKXB 3KWTA 3S6CA 3JWNG 5G5DA 3ZTEA 3L2MA 1E65A 5T8IA 3DIFB 1LP9F 3X13A 4G83A 3REWB 3ESVF 4GSUA 4XBPB 5F8QC 2E7LA 4MNHB 1V7NL 1UVQB 2H32A 3U6RA 3BKYH 4YHZL 2YR3A 1XGPA 4BYHA 2FJSA 3AG2B 1G0XA 3QWRA 4N3UA