4LZKA

Crystal structure of inclusion body protein (pixa pfam12306) from burkholderia cenocepacia j2315
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
159
Chain Sequence
SINLEKAAQSIQILAVIDTNYIKRSHPNPSLNAQNPTSIPSTALFMLNGHAPGVSSSEGNGNLGLKLNVGDKVSLMGTSLADNSGDAALIYHVQQYSGAQVFAPFTAVTIEQQVFQAFESVAKSAGSEYLATSFALYTRSQNRKSLFGYFFWVWQAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords PixA inclusion body protein
publication title Crystal structure of inclusion body protein (PixA pfam12306) from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
total genus 36
structure length 159
sequence length 178
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12306 PixA Inclusion body protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lzkA00
4Q52A 4PIBA 4LZKA
chains in the Genus database with same CATH superfamily
4BDVB 3VO0A 4UNTA 1BZ7B 4LOFA 4KV5E 2BOLA 3R06A 3TO4B 3L3OA 5HDWA 3MODH 4NZTH 5SV4A 3O3BB 3DVGA 3BPNB 1FNLA 4RGNC 3S36H 5ISZD 1PIFA 3FUFA 3BLBA 3STBA 4MCZB 3L5IA 2X1WL 4IIQA 3V4PL 4AH2A 3RZCA 4P2QA 2R1YB 3RA7H 3S5ZA 4DESA 1UB6B 1MIML 3CVCA 3QWQB 1RY7B 4Y19A 2CXKA 2ZUUA 1T1WB 2VNCA 3C6LA 4ANUA 5B7FA 4QGTA 1Q90A 3Q8FA 4JN1L 4ATTA 3L9RA 4OJFL 4AV0A 1YEIH 3QG7H 3GIVB 5E08H 4GP8B 4TF4A 4UB0H 2DQDH 2NNXA 5ALCL 1JNHB 5BZWA 4H7VA 3CX2A 1I8LA 1DQJB 4AK1A 1CDJA 1I3RB 2R0KL 1BWWA 1FYTD 3G6DL 3KLSA 3VFPB 4QKXB 2I7OA 4I9WD 4P9ML 4Y1SA 3TWYA 3EDKA 3UTSD 1GZQB 4GXFA 4Q6IB 4RFOL 1VLXA 1YNTA 4JEGB 5C0CE 4ZX6A 4C58B 1ZDSA 1FZOB 1LVEA 1BZEA 3N40F 3O3EB 2NY3B 1HQRB 2XICA 4LF3B 4NJ9H 4AIEA 1D5XB 3HAEB 4RRPG 3KMDA 4KZEL 4FQJH 1BEXA 3SQBA 3TCLA 4HIXH 1MW1A 5EORL 3F7RA 4E68A 4X4YA 3QEGH 3HZKA 5B1BB 5KZCD 3PWPE 1NCBH 5HI3D 4ZI8A 5KEZA 5F71A 1KJVB 1X5FA 3A22A 4LP5A 2W9DH 5FWRA 1QAWA 2KLTA 1SDAB 3DDFA 3QXDA 2K8QA 3EYSL 4G9FD 3AS0A 3U6XS 4K5MA 4DZ8A 1W0WB 1FJ1B 3QG6B 4J6IA 3W81A 4JFQB 2IFFH 3OKMA 1H6TA 2KPNA 1OT1A 2MQCA 2NNCA 3K4DA 1TQWA 2EE0A 3LZPA 3UIZA 1B3JA 3WEXB 3GTVA 1YMME 2OSYA 1Z5LB 2GCYA 3HB3D 4BFGA 4R0LB 4W9IC 3I6KB 4HH9B 3WUWA 4FEMA 1U4EA 3ZHNA 4E5XA 4Y4KD 1S7QB 3OQRA 3WYRA 4Q0XH 3S0PA 4PWHA 2J6WA 5LNEA 2A0LC 3WJLA 3K6IA 1GJWA 3MV7D 4WO0A 2AQRA 1YMHA 2C1PA 4HLZH 5FM8A 2E7CA 1N0LA 3IPEA 5GGQL 4KI5C 3TVMD 1RIHH 1OQOA 3C60D 4K7PY 5A2BA 1CO1A 4ALAL 4X5QA 1TF4A 3WTWA 4HFWA 5JHDA 4PLJD 4AEIL 2FEEL 2JJTA 1P9MA 4PJEF 2DYPA 3GXNA 4FG0A 4RDQF 2GC4C 2ZXGA 1I7TA 2G0KA 5IJDC 1QMUA 1UJ3C 1BYNA 2KLRA 5JW4R 1NKGA 2YGVA 1I3GH 2VQ1B 5TF1L 4RX4A 2BRQA 5F7YC 3VG0L 1BFVH 2ENPA 3K6FA 1A7RL 1NGWA 4OV5B 1MLCA 1HWWA 2VM3A 2F58H 3A24A 4EN3B 2OMWB 2FJSA 3VFUB 2F74A 4FEIA 2FX8L 1XGYH 35C8L 3MJ7A 3NJFA 4UQ3A 1INEL 3C9NA 1J8HA 2IH9A 4PWGA 3P4NA 1L9MA 3HLAB 4KAQH 1E4XH 3L3JB 3NABL 1DBKL 3EGSA 4PY8I 3TA3C 1U92A 1JZIA 1DVFC 4V2CB 1FZKB 3DBSA 2XG4A 4PG9B 4WGVB 5D7IF 4W70A 2QSVA 2ZYHA 2HLEB 3F58H 3QJFB 4LARL 5F1NB 4OZGB 5EA0L 4FXKA 1ECYA 1OAQL 1NGYB 3QAZB 3GJFB 3PYCA 1AZCA 3FQ4A 1Y6MR 4KY1L 3AG3B 2NMSA 4L48A 3HZYB 4WWKB 5B38B 4ZSOA 4JANA 4FQXA 5AZUA 1MWAH 1ZT7A 1GAFL 2CJUH 2KYIA 1LO0L 1MI5A 4G3YL 5T3ZD 3QJHA 3M07A 4GW5B 4PYHA 4D9RE 1YQVL 3T4YB 3FTYA 2EUWA 2BIPA 3MUGB 4U31A 2A9MH 4LLUA 3BAKA 4WENB 4M6AA 4G70B 1I8IA 1PG7X 1KACB 1XB6A 4AG4H 5ITBL 2B39A 1G7QB 2VLKB 2BSSB 1DJZA 3BSZH 1EHKB 1NCWL 3HC3L 3O2WH 1EJ6A 5E23A 2OA9A 5I1HH 4OB5L 3X11B 4QRRD 1QFHA 2EDNA 2E7MA 4M43L 3VGAB 4JREB 1XF1A 4IU3B 5FO8B 2OMYB 1LK2A 1HZKA 5I66A 4S1RH 4N0UA 3MBXH 2DQCH 3G5YA 3IDUA 4JDTH 4K71C 4UIMA 1HILB 4ONHA 2OQJA 1Q9WB 2P26A 5D8JH 5H2BA 3TBCA 1Q0EA 4YGVA 5A6MA 1MCFA 4WWID 2JVUA 2XXMB 2P52A 1ILUA 4R2GC 3KL0A 3DIVA 4JHUA 4WTQA 4I89A 1DDHA 4XN9A 3TONA 1HE7A 1CN4A 5KYNA 4L3CB 5IB3B 4DGIL 5IK3B 1EDQA 2WLKA 5B21A 4ZMWA 2XPGB 3PY9A 5DYOA 3U4BH 4KO5A 3UTPD 4ZQTA 5CKGA 7CGTA 4ELKA 4PGDB 2B7DT 3R7RA 3V7MA 3VXRE 4UT9A 4Z7OF 2PYFA 1AQMA 1PLGL 1T6BX 3LS4H 1QA9B 1WFNA 3LNIA 1PX8A 3HVNA 5H35B 5HYJA 3X13B 2QVFB 3SE6A 3PL6B 5TJWK 2I85A 4LSPH 3C8HA 4PRBA 4XP1L 4X6BB 1L9OA 1YG9A 3VB8A 3W0WA 2XDHA 1HCZA 3T1WA 4GBXA 1NH6A 2R2HA 1MIEH 5F6HI 5HYIA 3HS9A 1ED3B 1S9VA 1GZHC 5SWSE 3QJXA 4Y4HB 1OO2A 3MREB 5BW7A 2ZWLT 1EEZA 5KWYC 3B3IA 1YAIA 1O7VA 3BIKA 3ARFB 3KJ4B 1L7TL 5E2VL 5EF2A 5CJ5A 4RZCB 3IMBA 1TJIH 3VH8G 1M6OA 1MCPL 3HC2A 4LLWA 1PG7L 2LGNA 4HLZG 2VLMD 3V6FA 2O61B 1HZLA 2DS4A 4H25A 4J3WA 3IDIB 4DTGL 4JG5A 1P69B 5BCAA 1CE1L 5A3ID 3TFKD 5IHWA 1A3RL 3WGVB 3D2UB 4YXLH 1FVCB 4OM1H 1B2WL 2HJLA 2Y1VA 3RIFK 5KJ7E 1FGNH 4UMSA 1PZ3A 3K2IA 1BYPA 3MRRB 1FIGH 2V2WB 3GSOA 2ZOWA 2WPGA 5HHVH 5E70A 5C07D 1FLTX 4MQTB 4Q7DA 3EOYG 1YEDA 1A7PL 3MRJB 3CN4A 1NBVH 3PP4H 4HHGA 2VC2B 3FQRB 1PBYA 1I1YA 1QTSA 2LE9A 5IVXB 4WV1B 3P30L 4PR5A 3GPSA 4I9XA 1TVBB 3OMIB 1HIMH 4QRTA 2Q7NA 5E8DH 5AENA 1F3JB 2C9QA 4GEJA 4DKDC 5KG9A 4P8QA 4QXWA 5FYLE 1MAML 3BCFA 4OCYH 3AT0A 1E4XI 4JHAH 4KJWD 5T5FL 4EDWL 1RLBA 1MCIA 1QRNB 2PCFA 1OCWH 3GMMB 1IAOB 3KLAB 5EOCH 3II1A 2C3HA 3HE6D 4FJYA 1XVSA 3KPOB 4IBWA 3FOMB 2TAAA 2WMPA 3DVIA 1CURA 5A43C 1MRFL 3N41B 2P24B 4GRLB 3EYUL 4K07A 3TX4A 1YY9C 2HN7A 1BD2A 2XRAH 2QKIC 4P2QD 3RZCD 4NWUH 2GY7B 5JOEA 4ELMB 25C8L 5D1QB 1NC2D 4G7YL 4M5ZL 5JZ7C 4XBEL 1G6VK 4IBUA 4LSUH 4AM0Q 1U41A 4OFYD 4ABWA 3GM8A 5DLLA 5BV7H 2P4AB 3PF2A 2TSBA 1QZNA 4ZT1A 4CVXB 3ALXA 4F37F 4PJIF 1UYWH 1I75A 3APMA 3BN9D 5HD8C 5B3NA 1BVNT 2O72A 4B7LA 2Y36H 1EAJA 4DAGH 1G9EA 1OCZB 4U1SB 1N4XH 2IFGA 1JGEA 2XVBA 5CIPA 4MQ7B 2A6DB 2ENJA 5D7KE 5EEZA 4Q6KA 1QLEB 4XRCA 4XCYB 5GHWH 2OJ1A 3QUZB 5I6OA 2CCWA 4M62L 1JVLA 1OAJA 2FYYB 3FT2A 1AR2A 3ZZSA 1Z9SB 5JIIA 2BCMA 4KDTA 5FECB 4NFCA 1QTYT 4FQIL 1YYMH 3VXMA 3B37A 1TJXA 2DD8L 4AX3A 5J5EA 2F7OA 3B9DA 1AD9B 4YHOL 1AKJA 3WIIL 2UY6A 5C09D 1M7IA 3CN0A 3K4AA 3TU6A 4HJ1A 5EPMA 2DIBA 3H3BC 5KOVC 4RAVA 5HGHA 5D9SA 1A5FH 3DIFA 1F2QA 1RZQA 4BZ2H 4YDIH 2UXFA 3LPPA 5TFSH 3ZDZB 4CILA 3T6VA 4FZ8L 4ZO6A 5BXFA 2H47C 1P5UB 3BT0A 4XP9H 3GUFA 3ZTNH 1RZGB 5DD6B 3T6QC 1ZHKA 3CHRA 1SEQL 5LBVA 2NXYB 4IKNA 4Y9EA 2YGPA 4TPRH 3KLDA 1MFEH 4I1RA 5DK3A 4XMVA 3N85L 3ILQD 2WIIA 4Q6YA 4J4PC 3OR7A 1MFMA 2P8PA 1YEGH 1A9EA 4AY0A 5A16A 3L4VA 4CN1A 5E2JA 5DRWB 5EFIB 4ZFFA 2XWBB 3MZTA 4OQTH 2DDQL 4JB9L 5TE6L 1QSFE 4Y16B 4RMQA 2HT3D 3NPZB 1ESOA 3SPVA 3BRFA 5KUKA 1CXEA 3QCUH 3LRKA 2ATPB 3JTTB 3TO4D 3W9DB 3BPOC 5JHDD 3R8QA 1HOCA 4FAAB 3B1TA 3ZR5A 2NX5D 2P47B 2DYPD 5IROA 2ZWYA 1KTDB 3L5HA 5G5DB 5CGYD 4Y2NA 4B7IA 4HD9A 1ZWIB 1IM9B 3WDHA 1ZHBB 2X42A 3V4VB 4BFFA 1RJYA 4Z5RB 3IJ7A 5CS7A 1N3NB 2E27L 5KSAA 4ZRGA 2QPUA 1NGXB 2XPYA 5D7JC 1E5UI 5EOCJ 2IANB 3IXAA 3MA7B 3NUKA 2XPZA 1W8OA 5FC9A 2NY2C 2CAKA 3RWFA 4QEGA 5DHMC 4N2NA 1PVHA 3V6ZA 1UD5A 3T1FA 9CGTA 4PP1D 3GBDA 1AGEB 1J8HD 2C9XA 4JG1L 3FONA 4LP4A 1L0PA 5J6GB 4GLRH 4HXBH 1DJIA 1MFUA 1DBAL 4DP2X 2BWQA 1U8JB 2O5NA 1RK0A 1NAMA 3FO0H 2OL3L 2WXMA 4GMTH 5F9OH 3HG3A 5DSCB 5D2NE 3QWOA 1RZFL 5DUPH 3AXLB 5F44A 1E6OH 1P7QA 3QNXA 2GITA 1I4FA 2NY3D 5DS8B 2B0SH 4Y5VB 3WN5C 4JRWA 1WZKA 2ZXQA 1MI5D 2BVQB 4FXLA 2ZG1A 4FGMA 2F5BH 4OVVA 4QTFA 2Y07L 3S96A 4IRZL 6FABL 5DD3L 2A77L 4QRPB 4OM0L 5T8IA 4EI6A 3WENA 3CHXA 3DYMA 3SDCC 4G43B 3PU7A 5FHAL 5T5NG 1WBXA 2XZQL 2DWXA 4HISA 1ODUA 1VKXB 1A02N 1BX2A 4F8PA 2VLRE 4HULB 1R3IH 2QDVA 2IWGA 3FQYA 2F0CA 3LEXA 3QIUA 4J1UB 4JQXA 4MXQD 3EYQD 1ZLVH 3KCPB 1MWAB 1I85A 3BISA 3FW6A 4FQLH 5FUZL 5D7SL 4K9EC 2VKXA 4U6TA 2VH5H 4WNQA 3MNMA 5IQ7L 2BP0B 2JIXB 4MJ4A 1L5GB 3GZQA 2C9AA 4HQQL 4HC1A 5EZIL 2R29L 3WY2A 2W60B 4AIOA 3QQNA 4HK0A 2LFGA 4X42A 3DSFH 3M8OH 4KKLC 5DI8B 4WFGD 5LO7A 4PCTA 1N5YL 4YHYC 1UJ3B 4AUJA 2VDKB 1IBGH 3FO9A 1U8LA 3QDJA 4PJ5A 1UT1A 3EBGA 3M17A 1RQ5A 1RPUA 2VTFA 4P4KA 4JMNA 4BSVB 3AWEA 1T5XA 2CRIA 4QRUB 3I9GL 3BZ4A 3RKDC 1VCBC 4L29B 1PX3A 3FCSA 2AP2A 3O6LH 1OWRM 1CFMA 5ESQA 1FGVL 5I1LB 1CD1B 1XCWA 4G7QB 3GSQB 4GKZA 4Y89A 2CHXA 2AJXL 4I3SL 1IC5L 1Z32X 1KV7A 4JZJC 2ICCA 3IFLH 3F7LA 4LNRA 5E0FA 5EBMA 3TA3B 1S9KC 3OZ9L 1XF3B 1SM3H 5D5MA 4ODUA 2EE9A 5HYJD 2X7LA 5HHXL 1IIKA 3MX0B 4EEEA 5IMMB 1ADQL 1KZQA 4LSSH 1TETH 3OAZH 4BGLA 3L2MA 2B1HH 4ONOA 3W0WD 4GBXD 1BQUA 2XSKA 4JFEB 4HKZA 1CXKA 4LLMB 2VMEA 2V6HA 3A5VA 4OTXH 1XIWA 2XN9A 4K9EH 4NGHL 1GGIL 4P5RA 1X4YA 3TH3T 3HZMA 1WAAE 3PGDA 1X7SA 2WBKA 2XNAA 5AW7B 1LEGA 2F53D 1A6PA 3ZLQC 4LPXA 2RQ8A 4F20A 2ZAGA 4WW2F 1NANH 2NDGA 3UH8A 1FL5B 1PNDA 4PJDE 3AS2A 1F00I 1LQBC 4HOWA 5I6XC 1XL4A 2Y06L 3NIGE 5DJAA 4BEIA 1RZ7H 1X5XA 3UAJA 5KS9E 4QLRA 3DMMC 3PWVB 4JPQA 4L3EA 1QVOB 3FXIC 4HIIA 2BJMH 4LK4A 5C6WH 2IBZX 1R3JB 1U8NA 5I1IL 5T3ZL 1EMTL 5E7FA 5KSBB 4HCRH 5T1MA 1GPOL 1YDPB 4NOFA 4GO8A 1A1NB 2VQTA 4QXTB 3REWB 5DHYA 4R3SB 1FFOA 5FA4B 4NN5C 5AW9B 4WSJA 2YRLA 3RGHA 1E4KC 4BXVA 3EIFA 4PJCE 2YUWA 5FO9A 4P3CH 5EBWB 4L8CB 1ETZB 1W72A 3TV3H 1QP1A 1OSPH 3VE0B 5CEZE 2QV4A 2FSDA 1SJVA 1YYLL 2CRYA 4UQEA 1OY3B 1OIOA 3EUDA 1J0IA 5DO2D 3MLYH 3GM0A 4UQAA 4MNQE 4GG8A 4K73A 2AK4B 5GSRB 1JV2B 1YYCA 2VAAA 3GLAA 3OR6A 1IGJB 3PHQA 5JHBA 1VHPA 1BD2D 2TSAA 2YR3A 3B5GA 5F9DC 2X2JA 4PJFA 1MCWM 3LN5A 4YLQT 4JGMA 1AFVL 3RI5K 4GW1A 4HS3A 2R2BB 3K2UH 1UZGA 4OCLC 2FH6A 2P5PA 5TDOB 5LQBH 1RFDH 3FKUS 2OJEB 4LSTH 1KV3A 1QABA 3DROA 4KQ3H 5T1DL 5I16B 2QTEA 1N6QH 1UD3A 1WAEA 3AS1A 4G7RB 1HCVA 1KIUB 4QKTA 1O5DT 4QCIA 4RMTA 4R7DA 1BJ1H 1KB9J 1ZE3C 2ZZUT 3QEHA 4BQBA 7PCYA 3WTXA 4LSQH 4Z95L 1CDHA 5I2IB 2EH7L 3GRWL 2OR7A 1OCCB 2WUBH 1QUPA 5IJBC 2CHDA 4IOFD 3SODB 3E8UL 5E4AA 2HZHA 4GKLA 1UUSA 1UD8A 1IE5A 4YSTA 4XHJD 4Y4HD 3F6JA 1ZT4B 2NY4C 3QPQD 4BIKA 4F1SA 2X1QA 1KTLB 1PQZB 3LIZH 1K8IA 4FLOA 3VXMD 4ENZA 1HH9A 5FDYA 2R59A 1U58A 4X6DA 4FG4A 2BP3A 2X88A 1J9QA 2HT4D 5E00B 3QUKB 3THML 1RIUL 1AKJD 4EOWH 5DRNB 5KANI 2OJZH 3HBPA 3L4WA 4L9LB 1LDPL 4O2CA 1E3ZA 3TWCL 3MKKA 4XI5D 4ZNCD 1RUAH 4JGNA 4QOKB 4X4XA 1ZA3A 2VZSA 1K8DB 4NCC2 4NRZA 4Z7VE 3ETTA 1K72A 3JXAA 5CP7B 1KIQB 3KGRA 5DEFA 2F5AH 2ZYSA 3F85A 1FFNB 3BH8B 2DYRB 1TG8A 4CL7A 4YX2H 1PW3A 3M7FB 3OMNB 4RBPK 4DO4A 5IB4B 3SY0A 1BBDH 4MCMA 1LWHA 3BP4A 3IU4H 5F7BA 4P5TD 4PV1C 1ZHLB 3VFWA 2EDWA 1WUZA 5SWQB 1ZE3H 3OKEB 1HI6B 2EECA 5ESAB 4PGZA 1COBA 4U0RB 1U8HB 2EDJA 4Z6AT 4NSKB 2DQTL 4R97C 4O02L 1MEXL 3E6FA 1VACB 3VI3B 1BVOA 3D33A 3RNKA 2CRMA 1HT6A 1LO3H 4RFEA 2JI1A 3U1PA 4IK7A 2P49B 5IROD 2V2XA 2X4UB 3QEQB 3IPBA 3QVAA 2QSCL 3V55A 1MPAH 3JVGC 1ZLEA 3K80A 4NO5B 2PTTA 2WYTA 1E30A 1GIGL 1JGLH 3CIQA 5D1QD 5GRYA 4WUUB 3U4EB 4N86A 1VDGA 4G6FD 5IQ9A 2EH8H 2AJUH 1AZRA 1W0YT 2E4TA 3JT2A 3CFIC 5E94B 1P7KA 3UEZA 2VABA 1BLNA 1PZ5A 2VN3A 2HRPH 2ADFL 2AI0H 3DLQR 4HGMA 5LB1A 3GHEL 2F1EA 3FCGA 2D7MA 4HUVA 2EYTB 4Y2DB 1GZHA 1UEYA 4X6EA 1A2YB 2UV3A 3EG9A 3OGCB 3SDDB 4CSZA 1UWGH 1BQRA 1MFBL 3H3KA 1AG0A 4NQEE 5I5IA 1ILSA 2AS5M 1J1XH 1L9NA 5D2LA 1G7LB 1KT2B 1WD8A 4KZ0A 3DSNA 1QFUH 3CFCL 3DXAA 1RULL 1A6ZA 1URLA 2Y23A 1P7QD 2HLAB 3KPNA 4K7FB 4B9ZA 4NJAL 4X7CC 5HDLA 4PJ8A 3GMPA 4KPHL 2NLJB 1BM3H 4RMBA 1AHKA 1IQWH 2GJ6E 3F6IA 2X4OA 3PGFH 2YQ3A 3DGCR 1RHHA 5LGHH 2HFEB 1FNHA 1IFRA 2VDMB 4NN7C 4U6XA 2ENQA 3A4AA 4MA8H 5D4HA 3ZY7A 3IWVA 2EKJA 2X4NB 2AEQH 1EHXA 4DP7X 2IWFA 3MCG1 3ZXAC 5J12B 1PY0A 1MVYA 4R96B 4JN2A 3GXDA 4RGOH 2JKTM 4YSCA 4XOBA 3RGBA 4F1ZA 5DJXB 4JZOA 2HG5B 2O5ZL 1QBAA 3CG8A 2CM5A 5AAPA 4DVBB 1A7NH 5C0CB 3K1KC 4YHMH 3UROR 1T4KA 1NFDA 1X5LA 1IUZA 3F7QA 3HI5H 4JQVA 5GGVY 2PO6A 4D9QE 4J2XA 3SD5A 4QXVA 1M1XB 2OMTB 1WWCA 1GYAA 4KX8A 3VYNA 5M94B 4OUUA 1FA4A 4N8VG 2B15A 4RGND 3PWPB 2B1OA 1F45A 2CO2A 2VDNH 2ZNWA 4W6XB 1J5HA 1QPXA 4BZ2A 3UJJH 3MGOB 5D7JB 3VD7A 5DHVB 1CF8L 1OGSA 5MEOA 4M4PA 4MJHA 4P4KD 3VM5A 2NY2B 2PXYB 2IAMC 3GIZH 3O11B 4WJKB 4ZMYA 1UGNA 2NY5C 5BUGA 2GJJA 1NA8A 5EO9A 1KBWA 3AU1A 1SBSL 3SDAA 3QQDA 1T20B 3ARQA 4MB5A 3DWTA 2XWRA 5C6PB 1KB5A 1G9HA 2YD7A 3Q6FB 3BDBA 2JE8A 3GGWA 3GHBH 1YMMB 2EDFA 3L81A 3RWEA 2YPVH 4I0KA 1I9IH 2XX0A 4NKQB 4OF0A 4D0BA 5DA4A 1G6RH 4F91B 2IQAA 4R9HA 2V9TA 1DANT 1QLRB 4QF1A 3TCXA 5C08E 1G94A 4JO1H 1E9PA 2A9CA 2VO8A 4POZC 4X99A 4L8SB 1H9DA 2BSCA 2O6CA 4OFDA 4KO9A 4POUB 1KXVA 3EYOB 1CGTA 3SBQA 1EXGA 2H6PB 3CFQA 3TFBA 1NBQA 2EE6A 1XIWD 2XN9D 1AGCA 1HINL 1OSZA 1VPOH 2XACC 4LSVL 4ZYKB 5K1NA 2Q7YA 1TENA 2Y22A 4I4WA 3P2TA 1YEKH 1OALA 3SPCA 5FCSH 5J3HC 3VVWA 2ZCKH 4E2OA 1TQUA 4CRPA 3FSVA 1P4LA 1NCCL 4ZNEE 2RACA 1J48A 2VN6A 1E6JL 1AACA 2VIRA 3DOIA 4JPIA 4KNUA 3UAJD 1D5BB 3EYVA 5FAAA 3ZJAA 4JFHD 4TQIA 4L3ED 1NCAL 3EYFB 3FTZA 5FYJE 1QR4A 1PX4A 2JI2A 1C5CH 5JDSB 3QYNA 1QUNA 4H8WC 2NY5H 4NKDA 2CO6A 2LU7A 2ZCHL 4N8CH 4WI9A 4YDVB 1P4UA 5KYXB 2WWOA 3A3YB 1K5NA 2MQGA 1OGTA 1E8ZA 4HJGB 4M4RA 4J4PA 4MNHB 4NUQA 3SHSA 4Z7NE 4HMDA 1BVKB 5FLVA 4NZRH 4X5XA 2CDGB 2GAZB 3VFGL 3JUZA 1B4JH 1CXFA 4LIQE 2VMFA 2A0LD 1JPSL 2YKLH 4JFVA 2X4SA 4DCQB 3BN3B 3IMWA 4L37B 1G7JB 4JY4A 4JGJA 3KYOB 4KI5D 4AT6A 2ZCLH 5CR1A 1WIPA 4JGUA 1LMKA 1XO8A 4F93B 2YJLA 2WCGA 3QZWG 4JFZL 3WLWD 3AB0C 4AKQA 3V5HB 1U8KA 3HE7C 4NKOB 1S7XB 2D31B 5I76B 1UJTA 3CXHJ 3H7LA 2AZUA 5CD3A 3QZBA 2WQWA 3QHTC 1P7HL 3Q9PA 2XT1B 4MJJA 1WPCA 3OJMB 3PS6A 4LCWA 1MRCL 3GXIA 4E9WA 2YAEA 5D5MF 1HDMA 2APVA 3PNRB 1C1EH 5DR5L 1LEKB 5IUSA 4LVNC 5DC2A 1ACYL 3SPGA 4RA0C 3L08A 1SDDB 1QX1A 2WTRB 1BZ8A 2CA4A 2DMBA 4O00A 3F2LA 1JGVL 2B77A 2OR9H 4HHAA 3TA3D 4KJYA 3Q06A 5HXMA 3GUTA 3MRMB 1DVFD 1MG3C 4H8WH 5FHBL 2JKRM 2IDFA 4YSUA 1YUHA 2VE6B 4YUEL 4DO6A 2O6PA 4XMTA 5EU3A 4AQ8A 1HS6A 3LQZB 4Y19E 2CIIA 4G8IA 1K3ZA 2NY0C 2HWZH 1Q38A 3RX7A 1CFQB 3T6XA 2JNZA 4Q9RH 2HXAA 4YXKH 3O6FC 4YHPB 3GBEA 3CVDA 1AIZA 1C12B 3OPZL 3S48A 3WN5A 1HJBC 5I6XB 3AG4B 4A7QA 4Y88A 4QMEA 1LD9B 2ADJB 2UX7A 4P3DA 4U1MA 4DK5A 2Y7NA 5FA3B 3MJ6A 2IBBA 3OZLA 3ZDWA 1TQBB 3CVHB 3PUCA 4AZ8B 5L2KA 3RX9A 3ZTJG 3SGJC 1T5WA 2N59A 3SDCA 4Z7AA 1KCUL 5G4MA 2HVJB 3VXRB 1H0DA 1L6PA 2XVLA 2YXFA 2WC7A 4N8VB 3QWRD 4LOEA 5A2LH 1K6QL 1AR1B 4NENA 5IOPB 1UCBL 4UIKH 5DFTA 1KTRL 3GI8L 2J7LA 2R0ZL 1E43A 1L9SA 4DP4X 5IM7A 4JPKL 1WITA 1U8IB 4ZOEA 4L4VA 3BO8A 3N2JA 5MERB 5TTRA 1PF3A 4M03A 5HYSG 3KHQA 2CGYA 4HUNB 3IS0X 4PUBH 5GGRY 5SWSB 5CBEA 2BVOA 4TUOA 3D4CA 2JQAA 3VW3H 2IAAC 3T2PA 2FJFA 1I7UB 1GSKA 4LKXB 4FFZH 3D0AA 2CALA 1DN2A 1UQSA 3VXSE 4UMGA 2J1WA 3U0PB 2PW2B 4FJZA 1XZ0A 1IC4L 1RVFL 5HHOA 3UPCA 1BM7A 1ZA6B 4R2GD 3LRLA 1ONQB 1SJEA 5ECJE 2IGLA 3O8XC 2ITFA 3RVWD 4E41E 4R8WH 5J9PB 4KK9C 4W6WB 4DOHE 1B88A 3KLKA 5CEZH 5FYKE 5I71C 4JJ5B 2ZUWA 5ICUA 3V6OE 2OMNA 2MH4A 5E56A 2QFRA 3BPCB 3RVXC 3EH2A 2WB1A 3S4SB 3NIDE 4Z77B 4QHNA 1JNJA 3FQXB 1NCUA 4RWHA 2QGBA 5BJTB 1U3JA 3LEVL 3D85A 3WFDL 5KVEH 3IDNA 1T0MB 5SV3A 4IW4C 1NSNH 5JQ6H 2PCXA 3U30C 3GSVA 3L3GB 3QJZA 1OQXA 2BP8A 5HGAA 3DOSA 5IVZA 3RUGA 1LP9E 4FP8L 4HPOL 4JG0H 3U9PL 4YDLB 3RWGA 1I7RA 5H4YA 5DEGB 4O58H 1T1ZB 4WFFD 4XVTH 2NT1A 1FUNA 1YPZE 2OW7A 5CLTA 4LVHB 1G84A 4C56E 1IBDA 3SPJA 4DEPB 4TKWA 2V33A 2XIBA 4X6DF 3RVVC 1N8ZB 1BG9A 2UYLA 4QYOB 3ECWA 5GZOC 1YQ2A 3D0LB 2CPUA 1KCRL 1Q0YL 4OD3H 2C8NA 5D1XC 5A7BA 2ZKMX 2OSLB 1Q0XH 4OZFH 5FO7B 4J23A 1P1VA 2GIMA 3HNTH 4JFPB 1ERNA 2Q0ZX 1FZMA 3P4MA 4HP5A 1T7VA 2LU5A 4JRXA 3B2DC 5KYUB 3DMMA 4Z7UE 2BERA 1GGCL 4Z18A 1KENL 3Q2NA 4JFYB 1FO0B 2OP4H 2WVVA 2HTKC 3L3IB 3NN8A 4R7NB 4WQOA 4NCDA 4V1DE 4HPYH 1ZOXA 1FIEA 2CDFA 2PWGA 3HG1A 3W56A 4A38A 3EZJB 4DT2A 1MCHA 5IHZB 5IMLB 5E2WH 1OM3H 4MNGE 3QZWB 4U1JA 4C59B 3BZEA 1KLFA 5JOFB 4KJQC 4IBQA 4ZUVB 2CWRA 4TNEA 5AW4B 4AVKA 2Z7YA 1J5OL 3VFSB 2FT8A 3QUYA 1ZGLP 1E4KA 3ARBB 3LMJH 4YFEA 1OOWA 2BPBA 4OLZL 2MOQA 3GZPA 3FB8A 4JKMA 4U1KB 1JHTB 4YO0A 4PIRF 3U0TB 4FNLL 1TO5A 3SZKC 1EA9C 3G5VA 4R97B 2PO6D 3OBAA 2DLFH 3L3KA 3STZA 4BQCA 5FX3A 2HYMA 4M7KL 4AYSA 3MMEB 2VC2L 3E2HB 3P9LB 4IK6A 4RQQA 2YHGA 3NSCA 3L6FA 2ITCA 3KHOA 1YY9D 2A1WL 4JCMA 1KBBA 3L2NA 1OE3A 3MBWB 2AKRA 3L5XL 4UDTB 1ZGLA 2OK0H 3H4HA 2COVD 1OHQA 2BIMA 3B9KC 4AW7A 5JZ7D 4OLYL 5CHNA 2FX9H 2ZF9A 4P99A 5F88A 2OYLA 3KWUA 5IJKC 3I9PA 1Y1DA 2DIEA 3BDYL 1PG7W 1IEAA 3KYMB 1S6NA 1FRGL 4PJAF 3I6LD 4K3JH 4Q9BA 2XX1A 4K8RC 4Y5YC 1JCVA 1HHIA 3ZT7A 4XPBH 1CFVL 2XKUA 2VMJA 4MA1C 1F3DJ 1TZOA 3LKRB 1KMGA 5F0PB 2X0WA 1RCYA 1M2VB 3DRQA 2P80A 1NEPA 4HJJH 2A74B 2EYRB 3RFZB 2AJYL 1PEWA 2CBOA 3EGXA 4W4NA 1MQKH 4N0CD 3Q2WA 2X9WA 3EJSA 4G42A 1E4JA 5D2LF 4BKLA 1G0YR 1MFAL 4NRXA 4NDMB 4MVBC 4I2XA 4APXA 3ILPB 1FORH 1QSFB 1FDLH 2P8LA 4TVPH 1UXWB 3CFEA 3H1ZA 3I6GA 1NC4A 5I8KL 3WIFA 2B5IB 1DUZB 4UUJA 1K4DA 3MRCB 1O7DC 1RZ8A 2KI6A 2QPSA 5HYSB 4WEUD 5E4EC 1WE5A 2A6KA 3B8SA 3MODL 3GKZA 3N1MC 4NZTL 5BO0D 2EVHA 1AH1A 3S36L 32C2A 2XKNA 1U8PB 2WN3A 2LLLA 5EZJA 3RA7L 4ZMLA 5B7MA 4FYQA 3V5KB 4FA7B 3IJEA 3KPTA 3SYAA 2WXLA 3QDGA 3IMRA 5LKNA 3WEMA 3C87A 2QQKH 4TTDC 4NQQA 4IRJC 5FB8B 4PRIE 1YEIL 3QG7L 4KVNH 5E08L 3ABMB 3EO1A 2DQDL 4K8RH 3VACA 4IBZA 1FC1A 43CAA 1DQLH 3K72B 1BMWA 1ZHNA 4J4PD 1KNOB 5LG6A 4YE0A 4KI1A 4IEFA 3CZKA 4LLVB 5AL0A 4GI8A 1F56A 4NYLB 5D2NB 1LO4H 1XAUA 2PWFA 4W9CC 3N3EA 3BGFC 2RFXB 1E3FA 1IGTB 4BDVA 3RURA 3BVNA 1BZ7A 3FPYA 3E3QC 3NCBB 4NQXB 4NJ9L 3Q01A 4RGMB 2WLZA 2AJVH 4P49A 2VM4A 3NSFA 1NEZG 4FQJL 3CFJB 1JMZA 2R83A 1GXEA 1JTTA 4HIXL 2F19H 5DURB 3WFHA 2CO7A 2X4RA 2P48B 1SPDA 3PWPD 1K2DB 1YN7B 3QEGL 3VB9A 4MWFB 5JXEA 1F58H 1NCBL 3KWVA 4OZFG 1UB6A 4LCWD 2C26A 4YMPA 1TKWA 2W9DL 4XB3A 3EO0A 3L5JA 4U49A 2UZIH 2VLRB 5DJ2B 4HWEH 3SE9H 4NP4L 4S0SD 2ZOLA 2P43B 3L3DB 3ME0B 4ZQKB 2WBJC 1FFPA 3GIVA 3AAZB 3TS8A 2IFFL 5E1GA 2W5PA 5JLZA 2CIKB 3WLBB 2C3VA 1YMMD 3FH8A 1AIFB 1ZV5A 2ZP9A 5DMIH 2FJGB 4RSYA 5AZEH 2PW1A 3RL2B 5CJXC 3ZUCA 2NUTB 2MHAB 4NRYA 1DEDA 1BMZA 4FS0A 3F3HA 3LHAA 4HCGA 2WWMC 4ZZKA 2BWIA 4Q6IA 3RBGA 3HFFA 4Q0XL 4PI0A 1AHWB 1AZZC 3WY3A 4AGLA 5ICZA 2EO9A 4N4YB 3O3EA 3BAIA 1HQRA 5DJYA 4A7GA 1D5XA 3GPEA 4HOXA 1RIHL 3IGAA 1CLZH 2EKSB 3VFRA 1CL7H 1AD0B 1MVUB 4HV8B 2J5LB 2GJPA 4FQQB 3ZL4H 5L2KD 2XXGA 3B83A 3MV9A 4Y2LA 4HJEA 3QUXC 2R56H 2EXWC 1EO5A 1KJVA 2ROXA 1G6RA 4ODXB 4YAQB 3SDCD 3T2LA 5IEHA 2CKBH 1EPFA 2NTSP 4GXUN 1I3GL 1T1XA 2YK1H 1FJ1A 4QJ5B 1KJ2B 2V7NB 1BFVL 1OL0A 1VRSA 3SCMC 3BFOA 4OJEH 4ANVA 4PCYA 2ICEA 3UGXA 5JMOC 4L3AA 2F58L 2WBXA 3QXWA 1PZBA 4J39A 1XGYL 1G1KA 1DBBH 2RCSH 2H6UA 1PZSA 4MBRA 4YDMA 1E4XL 4KRNA 3WL9B 1FL6B 5CMAB 4AQ1C 5TH2B 5BOJA 2HX8A 4KO6A 4KKLD 1KGUA 3F58L 1WK0A 4ZMAT 1KLGB 1S7WB 4LIQH 2KHAA 2ODIA 5JW3H 2BMKB 4GQQA 3KPMB 4PJDB 1MCLA 2CG9X 4TSCH 4YDJB 5KOMC 3NIGB 4BQ8A 3U1SH 1MWAL 2APXA 2Y6TE 3E1ZA 2IAMA 3DC0A 1NZRA 3RPIB 2GBAA 4HMCA 1TT6A 3RKDD 1UD6A 2VLLA 1UA3A 3QUGA 2UWEA 4KX7A 2A9ML 1T1YB 4PSPA 4EXPX 4OGQC 2J88H 3C5JB 1YEFH 5GIRB 4AG4L 1LE9B 4DETA 3G08A 1M71A 3D85D 3MN8A 3T4AC 4A2HA 5BS0A 1WYJA 3FB5B 4MJ6A 3HMXA 4OV5A 4F15C 4DUWA 3BSZL 3S3PA 3FK3A 5GGTA 3O2WL 4EN3A 4GW4B 3DGGB 3R4DA 1AGBB 3WKYA 2NY0B 5I1HL 3UEQA 4MDJB 2P8MA 4PJCB 4ZXBC 1WDAA 3KWWA 3L3JA 3MVSA 3QISA 3FU6A 4FQ1H 4X6FB 2IH1B 4I0PB 4NO0D 5IWLA 2X4QB 1T2QH 4S1RL 3ISWA 3MBXL 2DQCL 4CW1B 3FH5A 4XZ4A 3QJFA 1JXFA 1JV5A 1OZTG 4YSRA 5GGUB 5D8JL 3NBNA 1ZLVK 4MNQB 3MROA 3N06B 4HKJA 3UMNA 3ARGC 3CJJA 5I0VA 3HZYA 3SKMB 2FZ3A 1MREH 2KZBA 3KBPA 3HRZA 4YJZL 4MGXA 4N9OB 3QZOA 5BRPA 5DUBB 5DVNA 1ULVA 4JRXD 1SYVB 3VFTB 4M5YH 3DMMD 4BRJA 2D9CA 3EDDA 2B1AH 1V7NH 4P23C 5C1MB 5KN5B 2OKMA 5LN4A 4BSJA 1DUYB 3U4BL 1ZT1A 4AENA 1OD7A 3HG1D 4FXTA 4YK4B 3WE6B 1L4IA 2GJZA 1G7QA 3CLEH 1ZKAA 5I30H 5AOZA 3MOBH 3B5HA 5DK0B 5F7WC 4DJMA 3AQYA 4UTBA 4HLJA 4AYEC 2NZIA 2JJUA 1KB9K 1NGPH 1HVXA 2H6OA 1NOLA 1J1PH 3LS4L 3Q8AA 4NC2B 3PJSB 4Z7WE 1XGPB 5FKAA 3CSYB 3D3VE 3VXQB 3DJTA 1IBZA 3BDXA 3GQFA 5FGBC 4LSPL 4WFHE 2R4RH 4W9KC 3RB5A 2A6JA 5TE4H 5E6IC 2ILLA 1QR1A 1VA9A 1BZQK 1MIEL 4UCFA 2O93L 5JW4M 1X5MA 5FUCE 5F7HA 4KK5C 3VI4A 1MWOA 4OLUH 1BP3B 2A9NH 5DT1H 5HGBB 3OAZK 1CLYH 1E7UA 2E56A 1U2YA 4HMEA 5I71B 1WRFA 3P2BA 1XSIA 1AQDB 4PS7A 3SOTA 1TJIL 5J11B 3NIFF 3IS1X 1EEYB 3ARTA 4RAUB 5FXCH 5IK3A 5L9DH 3HI1B 3I75B 1XH0A 1Z9PA 5B22A 5TE7H 1G87A 2IDSA 2XPGA 2Y5EA 3DJZA 3ZRSA 4CU8A 2K70A 4FYTA 4YXLL 4OM1L 4BCZA 1Z9MA 1OM9A 1FGNL 2JQMA 4P04A 1RK7A 2XVKA 4PGEB 4Z7VB 3WFEH 5I6LA 1QEWA 3MI6A 4PGDA 1FIGL 1XF4A 5HHVL 2HVKB 1NBZB 2GEEA 5FYKH 5I5RA 1OP5H 5GS2H 3T04D 5GS0C 4NT6B 1NBVL 3PP4L 4JFDE 1EDHA 1CICC 3X13A 2BS71 2P80D 2EVJA 2QR0A 3DX3A 3PL6A 1F6LL 2MFNA 3FHEA 4X6BA 1HIML 3H3PH 5E8DL 5I73C 3CZFB 1E5AA 2C1OA 1H3GA 4OCYL 5K9QI 5K9QG 4D94A 3DKHA 3UO1L 1RUQH 3MREA 4JHAL 3VXNB 4AEFA 1TYJA 2NY4D 4CA4A 5B8CC 4L8DB 1NC4D 1TUPA 1XTMA 1OCWL 4MZ3A 1Y6NR 3ULUF 1U30A 4OT1H 1ACCA 5EOCL 2Q87A 3LXCA 3X17A 4RZCA 3OAUH 2ZX9A 4C47A 5HGDB 1RZJC 1T7ZA 1ND0A 3HIZA 2NNAA 2EP6A 4UM8B 3UYPB 4ZUUB 3DX7B 2HUHA 2XRAL 4NO2B 2AJZB 1IM3B 1TVHB 2C34A 3C5ZC 4NWUL 3QXTA 2PN5A 4L4JA 1U3HB 1ZIAA 3TGXA 1QACA 2YRZA 4N3TA 1J8RA 3A6CH 4P57A 2BNRE 2EUXA 3BAJA 2F2HA 3I84A 1TITA 2X9XA 3O45B 1QBLH 1UYWL 3FQRA 3LN4B 5IVXA 1LLAA 1AQ8A 2YEZA 3SN6N 4IJTA 3TNNB 1X5AA 2BFGA 2Y36L 4DAGL 3MRDA 5FGCE 4NQEB 1N4XL 4U2YA 1F3JA 1IE4A 2X2IA 4OGAC 2XQYG 5GS0H 3L7FB 1KCSL 3H55A 4KGLA 2OS7A 1VGKB 3BUYA 2YXWA 4EIUA 4GI9A 5IJCC 1VZIA 5GHWL 3L9EA 3GMMA 3C6EA 3KLAA 5FUOH 2WQSA 5BZDB 3FBQA 2GJ6B 5J06A 4BELD 5DMKB 1NM4A 5GRUH 5D6CA 1EXUA 1YYML 4GRLA 1KIRB 1FV1B 3OX8A 4K55A 2WSKA 4MA1B 2D2OA 3TYFA 5HHME 3EFFA 4FADA 2PTVA 1N10A 5JXED 1BZOA 1RZJH 4F92B 3OHMB 4ZPVA 2WKOA 4D0DB 1YRKA 4PGBA 4AYBA 2WNXA 1A5FL 4M1DH 4HGKC 1EAPA 3CV5A 3BD5A 4BZ2L 4YDIL 4BYHA 4LT7A 5F97E 5TFSL 4CVXA 4Z78A 5ACZB 1SZNA 2J5WA 1FSKC 4XP9L 3ZTNL 2EUVA 2P5WE 3DX9A 4ZAKC 2YS4A 5IQNA 1A8JH 2CR0A 2IOIA 4U1SA 1BZDA 1UHVA 2AGJH 4TPRL 1OP3H 2SEBA 1MFEL 3D09A 3KL3A 5EU4B 1SF5A 4HVBA 5AKTA 4AUYA 1YEGL 1QYGH 5E4EB 4K94C 4YN3A 2HJKB 3UZVB 1R19A 4PRAB 4XCYA 2DBJA 2KC0A 4G71B 2UY7B 1M42A 4UAOC 4D8PB 5EUKB 1KGXA 4FHKA 1BVLB 1SOQA 2GQHA 3PWUA 4IBLT 4OQTL 4QT5B 1NM9A 4HJIA 1J5CA 4X5LA 5FECA 3QCUL 4LDLB 3T65B 4OF7A 3FT4B 3V9FA 2XQ0A 2OMXB 2CUHA 3T0EE 1JZDC 2RALA 2CA3A 4MZIA 1T89A 3MV9D 4UBDC 4EI5A 3G04A 2QLVB 1QFOA 1ASOA 2CUIA 1FG9C 1WA0X 4PTTA 4YHLH 3DO4A 2R69A 1AS7A 4UILH 3HUJF 3GMLB 1BQSA 2GFBB 5GRJH 1MHPL 1J0ZA 4HZLB 3UXFA 3GMNA 3GSNB 4RFNB 1HH6A 3KPPB 2A99A 3S3JA 1R5WA 1U95B 5C08B 4CSTA 5DWPA 1IO4C 2VKWA 4PV8A 2H45A 4LLDA 5JIMA 1U8QB 5F7KC 4HWBA 1OGAE 4NIYE 3UTZB 2EC9U 2J8UB 2XIDA 4AQEA 1D5ZB 1TTBA 2VDML 1FZJA 2Y7QB 4N20A 4HXBL 5DD5H 3TESA 4W93A 4NQDA 2VR3A 5BUAA 2N7BA 4OFPA 1ZVSB 3QO0B 1OWWA 1UB5B 4K0OA 4XPTH 3TBSA 2CKBB 2HFGH 3FO0L 3RWDB 4GMTL 5F9OL 5E2TH 1MH5B 5EFIA 5ESVA 3OPUA 3CDGA 5JNYB 2F8VA 4P48A 3H9HB 5L2JB 5DUPL 2WYZA 3ESVF 1CCZA 4K94H 3B9KA 4M3HA 1E6OL 4IOSA 4Z0XB 2EIZA 4WU7A 2XKSA 2PCYA 2FK9A 3JTTA 5E6SB 3TBYA 2B0SL 4W81A 2IAMD 3V0AC 1OTSD 2F5BL 1OF2B 1ET8A 5DURD 1E90A 2CO3A 2VDQB 2ZJSH 3V4VA 3GXTA 3QE5A 5J13C 1TLKA 2DWSA 1Y6KR 1NGXA 1ZS8A 4EKXA 4OZ4B 3D39A 2E7DA 5J6HB 4Z7NB 5E9DA 1I1AC 1U91B 4Z3JA 3ZZ1A 2BNUB 5BS0D 2N56A 3FTGB 4WUKH 3EJQA 4CMHB 1BAFH 4APQC 1I9JH 1S3KH 4B3VA 4DN3H 1R3IL 1V8HA 4P46B 3VGBA 1K4CA 2H0JA 3JYBA 1IKNC 1LK3H 3RE0A 3BWAA 1AGEA 2FT7A 1QEXA 3TIDB 3WO4C 4FQLL 2XBTA 4WO4A 4F2MA 2YZ1A 1JGUL 4A7GF 4LVOC 5ISZE 4JK0D 1ZTXH 3ECBA 1X9UA 3QORB 5EULV 3J2PA 2VH5L 1U8JA 2G2PA 2XZZA 5LJYH 5CEYA 1O9WA 1VGEH 2QTVA 4IOIA 1F6AB 1EQWA 1QWHA 4CVWA 1D6VH 5JORA 1EJ8A 4M1GH 2WK2A 4F7EA 1TQVA 5CSGA 5J3HD 4HGWB 2XG5A 3DSFL 1N5AA 1OF0A 3CXHK 3M8OL 2OI9C 2UUDH 3O4OB 3U36B 1UOVA 4JG9A 1XL6A 4X0NA 3GDBA 1IBGL 5EC1B 6PAZA 3V4UH 2BVQA 2EEXA 1ZVHA 4WI0A 3TN0B 2D03H 2HFTA 1IFHH 2VW4A 1FYTE 3HR5A 1IT9H 4I9WE 1R33A 3G5WA 3QFJA 4NHCH 4N2GA 3O6LL 2QMKA 2WZ6A 4OZHA 2IPKB 1XBRA 3STLB 3E9UA 4W9HC 5I1DA 3IFLL 3ZDXE 4YC2C 1SM3L 4S2SA 4Z7IA 4DSYA 2NW3B 1DVUA 1YCSA 3KCPA 4JFUA 1X5GA 2YC1A 3GC3A 4LSSL 1WFOA 1TETL 1RU9L 2G3NA 4QTHA 5IBLC 2B1HL 5BRQA 5LDSA 1ZPLA 3LY6A 5E5MB 5I19H 3DV4B 1WF5A 1HHJA 9PCYA 2APWA 4IIZA 1L5GA 1S8DB 1L6XA 1JDAA 3L4CA 2FIKB 2CLZA 2N7SA 4NM4H 1G4RA 2BHZA 1NCNA 2P5EA 3CZUB 4J3OF 4K9EL 4OTXL 4BRVA 4YHIB 5FV1L 4J8QA 1JP5A 1S7UB 5DI8A 4BXSV 3HE7D 4L1SA 4KQ0A 4GKOA 3QUMH 2J57A 3DX8B 1QD0A 2ZX8A 2P3YA 3WAKA 3ULVF 4ZX5A 1Q1PA 2JB5H 1A25A 1EUTA 4BSVA 2EIEA 1ET7A 2Z93B 1CK0H 4F15B 4X5WB 1XF5A 3AREB 5AW1B 1RZ7L 2WBJA 5C0AA 5CJQH 5F7FA 3GRBA 4OLVH 1YZZA 5I1LA 3WFBH 2XV2A 5D6DA 4YVNA 3SZ6A 4JNXA 4PYGA 4N90D 2W80C 2WJ7A 2CGZA 2H0PA 1GYVA 1P6AB 1MNNA 3MV7E 3BIBX 3MFFA 3B9AA 4HCRL 2OTWA 3ARRA 4PRNB 5FM5M 1R47A 4ZMNA 5CJXA 3QA3B 3U1QA 3MX0A 4NM8H 4ODSH 1UENA 1JSYA 2ZKXA 3TIEA 3DO3A 4OZGF 4GPVA 3FNKA 2NY0D 3H7BB 3ARGB 4M7JH 5EUOE 1JBJA 4OI7A 4JFEA 3O6FD 4KTYA 1IAII 3QFDB 2IGFH 4GXVH 4XNZB 4P3CL 2FIRT 1F4XH 2IWEA 4E41B 4NNYB 2YD1A 3TV3L 2PP9A 2EAEA 4DOHB 3WJMB 1OSPL 3BXNA 1DQQB 3BWSA 4N2AA 3VQLA 2J6EH 1DQKA 3A6BH 1E67A 4CADA 4EVNA 5KVDH 2LHAA 5AVRB 3MLYL 1O0VA 1AYRA 4MS8D 4ZMQA 4XC3H 3MLPA 4TNFA 3SKUD 2OZ4H 3NIDB 4P9HC 3RTQA 3I3EA 4DF9A 5KSVB 4OF8A 4Q97A 4PY7B 2W88A 3K2UL 3ZRCC 4AIZB 3RWCB 3AM8A 4G8FA 5LQBL 3SCMA 3MV8D 5ID0A 1HXYA 1RFDL 4BWUA 1FNSH 1R3JA 4LSTL 4KQ3L 4I18C 4KNTA 4B9PA 2YAMA 5KSBA 1LP9B 1EFXA 1N6QL 3VXPA 3F7YB 4AQOA 2IXQA 2Q86B 1E5BA 4MYPA 3TEXA 2DWEB 4LPTA 1ZS2A 1GW6A 3LKOB 1YPZB 3F04A 2X6BA 4C56B 2B3IA 2FGWH 4LSQL 4YLCA 5T3ZE 1NCIA 4JFFA 2WUBL 3GLZA 2IJ0C 4JAMB 4L8CA 4G1MB 5FYKU 3CHSA 2EDHA 5CU9A 3FSOA 1NCDH 1MUJB 3O8XD 5DGRA 3VE0A 5LXGL 3IU3B 2VQUA 3EAKA 3RGVB 2XBZA 3SYCA 1J0YA 5E9AA 1E5ZA 1HCYA 4Z7UB 1R1CA 4HCIA 3LIZL 3DX1A 3BMWA 2G9HB 4V1DB 5A2FA 4B9GA 3QXAA 4G5AA 1U93A 1XSKA 4HXAH 4P5MA 2VXQH 4XGZB 3RVXD 4A63A 4A2EA 1N59A 1CI5A 4QRRE 4D0CB 2WV3A 4QYAA 4EOWL 3VRIA 1GYCA 5DDHA 1G0XA 2OJZL 3T4AA 1P1ZA 5D70H 4TVSa 1UTDA 2X0UA 4B50A 3CH1A 1Q9KA 2OJEA 5MI0C 5KUMA 1RUAL 4P9HH 1FVEB 1P2CB 3WBDA 4PG2C 4NEHB 2EDQA 5DK2B 4HIEB 5I73B 3KLHC 1OAKH 2O5XH 3GSUA 3OXSB 4ZXBA 2BIIA 4L1LA 3QB7C 2F5AL 4OFKA 3ABZA 1G1YA 2XI9A 1H3WM 1H15A 1THAA 2J8HA 3O2DH 4O9HH 4YX2L 3F12B 1LO5B 1IMHC 1JRHH 3KNBB 4N2OA 4KWUA 4RNRB 1OSEA 4FFYH 4NKMB 3IU4L 4MD4B 3QI9A 3RVVD 2MJWA 4LLQB 5K9KB 2WINA 1ZDQA 1FNEB 1MSPA 1PCSA 3DVFA 1E8XA 3CNKA 3IJSA 4DFIA 5KVMC 4GSUA 4GAJH 5D1XD 1O5PA 2CCVA 2QADB 2YWYA 3UTPE 5J1AA 3EJTA 4ENEC 2OXHA 3C5ZB 1Z5HA 2NR6C 4O2EB 3ASWA 5I8OH 2OBGA 3BD4A 1KTLA 4JFOB 3OC5A 4GRWH 2R23B 1RJZB 2BOBB 5AOJA 3HG0A 4P23A 5GGSY 2HTKD 3CTTA 1CWVA 4QRFA 1LO3L 1K9TA 1R4XA 5HHNA 5DRNA 2Y2TA 2FVNA 3CFKB 5LCVH 3QDAA 1S9XA 1MPAL 3KCWA 5IVXF 1KXQE 5HVHC 3U46A 2R7EB 3LS5L 1JGLL 4HJTA 2DQHL 2E9JA 4MHHI 2QSTA 4QOKA 4MHHG 3EGDA 1K8DA 2EH8L 1HXMB 2AJUL 2VXUH 1K85A 4TVPD 5C2BH 1KIQA 1D9KA 1ZK9A 2HRPL 2AI0L 1TFHA 4NNPH 4XP4H 3TJHD 2VLME 3CMOH 2Y25A 4ONGL 5IB4A 3QS2A 4NQDD 5EEVA 3NCFB 1ZHLA 2QPEB 3SDYH 1UWGL 2NUPA 2FEEI 4BK5C 3N41F 3NEXA 1J1XL 4NSKA 2CMRH 4N5EC 1CTOA 3N1QC 4GYBA 4ELMF 1QFUL 5C07E 3B9KD 4OKDA 5EZOH 1SXZA 5B4MC 3KBFA 1PD6A 3QRLA 1BM3L 2BDNH 5DQJA 3EJCA 2MTPA 1IQWL 3ARPA 3PGFL 1PLCA 3TF7C 4PRIB 3EBAA 5LGHL 2IQ9H 2DI9A 2M1KA 4NO5A 4MA8L 4GNKB 4GO6B 3AABA 2VN7A 4MXVF 2AEQL 4NHUB 5DJ0B 4HCFA 4JFXA 5H37G 1CICA 3WFCL 4M1CC 5E9DD 3QUHA 4Q2ZB 3BAEL 3NP3A 3DVNA 4RGOL 3CFUA 4AQAB 3DUSB 5HHQB 4HOMA 1UZ6E 5E94A 1E2VA 3X3FH 4BV1A 1QATA 4MVBD 5CGTA 4ZG1A 1I8MA 4KK6C 1A7NL 4YHML 3K8LA 1C5BH 4MLSA 4WO4D 4YNYA 4H2AA 3BEWB 5D93C 1AZVA 2H3NA 3CMGA 3GDCA 1A2YA 3GRGA 1NL0H 3SDDA 4DGYH 3OWRA 3MNDA 1JMXA 3HI5L 5FGRA 5IZ7A 1JZ6A 4P2QE 2NQ3A 3B2UC 4GKSB 4U6YB 1OLZA 3MUHL 4ZPTA 1JN6B 3BYYA 4H1LA 1IZKA 3GNMH 3NJNA 2C7UB 5M7QA 4FE9A 2J1ZA 2VDNL 1UKSA 2HLAA 3E9TA 4K7FA 3CBRA 3HFMH 3UJJL 2NLJA 3FQNA 4WNJA 4P4RB 3NQKA 4J12A 1N12A 5F3HA 1H8SA 4ZFQA 4ZOBA 3AQZA 4PJ9A 1XMWA 2HFEA 3GIZL 3QFJD 4TTDD 4IRJD 4M5TA 2DW5A 3K2MC 3V4PB 1A3QA 1P6FA 3PHAA 1JUFA 2MCG1 1HN1A 5KSUB 3NZ8B 3GHBL 2MNJB 1FL3A 3X1FA 5FEBA 2W0FA 2YPVL 2D9QB 1I9IL 3IWUA 3WNNA 3OWEA 1G6RL 1Q9OB 5DD0H 1CTNA 2RA1A 4IS6A 1L3NA 1BOGB 2ZX7A 4JO1L 1BW8A 1J5DA 4BH8A 5F6IB 4FABH 4C4KO 3UJTH 1MHEB 3DPBB 4L5FE 4RISH 2YSSA 2HLFC 1BXVA 4NNXA 2X1OA 5C09E 1XGUA 2OMUB 2FO4B 2P5ED 1PCXA 4DWHA 1JZ5A 3V8CA 2FEJA 3ZQWA 3TURA 3N0AA 3KXFA 2YKKA 2R1WA 1BVZA 4V33A 1YEKL 1CQYA 5J13B 2ZCKL 1BOYA 4WNSA 3ULSB 5DHVA 1A4CA 4M29A 1LNUB 3BGMA 2FBJH 1KGWA 2I7SA 2Z1PA 4JVUA 1G7PA 1JD7A 2WBJD 5C0AD 3V9EA 1G0DA 1TNNA 3QZNA 1IBYA 1T20A 1MCSA 2BW4A 3Q6FA 2KH2B 4Y9CA 3WO4B 2AW2A 1FH5H 1E42A 1C5CL 4PW4A 4QO1A 2NZ9C 3WY1A 2NY5L 4N8CL 2VITA 1JHKL 5L8JB 1JF5A 4ZW8A 4MAYB 2I9TB 3QUMB 2AHIA 3WIHA 3LKQA 3OLEA 4DP1X 4XP5H 3MJ8B 2I60H 1YEWA 4NZRL 1B4JL 2WAQA 5LXVA 1XSJA 4L8SA 3LNHA 5JHDE 3TEYA 3SGKA 2YPKB 1ITCA 3U25A 2NX5E 1XD1A 3EYOA 1KB3A 2RD0A 1SOSA 3QIBB 3FOLB 2X1PA 2ZCLL 5JPNB 1U8MA 3ZL2A 3WTUA 4S0TD 3DTXB 1JPFA 1U8CA 2VL5B 3ZYOA 3QUXD 2EXWD 5GGVH 3I74A 3IEAA 4KXAA 4IMKC 4OCRH 3WKQA 2CO4A 2CKNA 3UO8B 3RTQD 2R4SH 3IVKA 1J8HE 2V2TB 4L05A 1BFSA 1EH9A 3B43A 4BFEA 3Q2VA 5K1JA 3SCMD 2FTAA 3SKNA 2NXZC 1S9WB 2DWDA 3K6SB 1JDDA 3ES6A 3GMRB 5G4OA 2K6YA 4Q74A 4JL2A 4XZUA 4MSWA 4JLRA 1QWUA 3GS0A 5KYXA 1W8NA 1ETJA 1G7IA 4ZFOA 3LKNA 1KFGA 3D18A 4MNHA 1CVSC 4TLUA 5C7ZA 3KWTA 4LLYB 1XCTA 2EIKB 3K6DA 1BBJB 4ZSOE 4H8WL 3QNZA 4WJ5A 2IO5A 3N42B 4A6YA 1NPJA 2W91A 1I8AA 1SOXA 3ARDB 1MI5E 3FSZA 1YY8B 1E50A 1N2RA 3O2VL 3P02A 4OFIA 2HWZL 3RRQA 1XEDA 3MRQA 4JKPH 3MA9H 4Q9RL 4YXKL 1TTUA 5LGKA 1IGMH 4AC2A 5EBLA 4F5CA 4JZNA 3J7HA 5AALA 1XCQB 5IQMA 1S7VA 3F7KA 2D31A 5I76A 1NUFA 3CFDB 4X7SH 3U7AA 1JPST 3L4TA 2NY7H 1EZLA 5E8PB 5IB5B 2MKLC 3QSKB 1MLBB 2Z35A 4YHNB 1I1AA 1B0GA 4LP8A 4Z7WB 1PNCA 3D3VB 4N2FA 4LU5H 2DEXX 2BSRB 4Z3IA 4OAWB 5FM4A 1FNFA 1ZRUA 3F05A 1NOAA 4I1PA 3MRHB 4PJHA 5J1TC 4R5TA 2B08A 3O9WC 4UIKL 4ZXBD 5FW6A 2JJSC 5IW6A 4NC1E 1LYQA 3V52H 5BOPA 4WFGE 3HPLB 4IMLA 3UZEA 4C8XA 5BPPA 3C2SA 4PUBL 1SXNA 3CC1A 5CM1A 1UXLA 5IIEB 2X2UA 3VW3L 4O2FB 3FB6A 1UEMA 1S5IH 3QI9D 4FFZL 3LQMA 3TBWB 1AO7A 3ARGD 3OAYH 3ZHLA 2W94A 3IRZA 3LZNA 1UC6A 2ZAHA 4MTMA 4YHPA 1Z9LA 2X53A 2MCMA 3MNWA 2ZXBA 1HC1A 1B0RB 1CFSB 3TT3H 3MZGB 5D4JA 4BA0A 1TMCB 2ADJA 4IRSB 2ENYA 2MKWA 4R8WL 3MRLA 3RIAF 4W9JC 2FSEA 3FQWA 3CVHA 1HU8A 4AZ8A 2K9FB 3OZKA 4P23D 2E9IA 1YEHH 4YBHA 5CEZL 5HYJE 2CHWA 3FYIB 3VRLE 1NDGB 5CFHA 5KSBF 2DL2A 4P2YA 2YD2A 4JFDB 5DJZB 1WBZB 1SFHA 3CC5B 3W0WE 3EF7A 4FFVC 3VDBA 3QULA 3H9ZA 1BCIA 3N43B 5KVEL 3QHZH 2DI7A 2HMIC 3ETBF 2BC4A 1NSNL 4CBZA 3KYKH 1T7XA 1JZGA 1MCDA 5JQ6L 4GAGH 1DZBA 3IDJA 5E6ID 3LB6C 3WS3A 2F53E 5IJVB 4JFWA 5AYQA 1HKFA 4KK5D 3FUMA 4JG0L 1UWXK 3SO5A 1T66C 2XQYK 2FAUA 4YL9A 3ZOAA 4LRIC 4KQ4H 4O58L 4XVTL 1G7HA 4F8LA 3RIAK 4C4KT 1UM6H 1AGFA 5TDNB 3NQIA 1EZVX 1CU4H 2ADGA 1XGRB 5AL8A 3D5OF 4PRHA 3UPRB 5KYYA 4OD3L 3SGDI 2VZ3A 1OD9A 1Q0XL 3SDXB 2CLVA 1FFTB 3HNTL 3ZMEA 2B16A 2AAAA 3W57A 4F8OA 1CE6B 1QSVA 4JDZA 3GZKA 4DUXA 4GG6A 3L4YA 2HT2C 2WKGA 3TT1H 5C8JA 5I15H 2BNRB 3D4YA 5K9JL 3FQUA 2OP4L 1OOAA 3B7RL 3FCTA 4HPYL 1T03L 4J3TA 4B41A 3FQXA 5BJTA 2LV4A 2NW2B 4K3HA 5E2WL 4KZDH 1OM3L 1A4JB 1CICD 2YWZA 4GS7C 1T0MA 3DYOA 2ZONA 4ODHH 2H32H 3CLWA 2CDEB 5FGCB 1UG9A 1LMIA 1JK8A 2CCLA 3MRFB 3T3ME 3L3GA 4UNIA 2MIZA 1M6UA 5F1OB 2NRDA 5ITFA 3LMJL 5F7MC 4XXWC 3EXJA 1QNZH 3V5DB 2VM9A 4MAUH 1H5BB 2JELH 3MRKA 3H9YA 5DEGA 4YBLB 1BD2E 1BVNP 3LD8C 5DS1A 1VZHA 3KDMA 2AJ3B 4WK2B 5HDRA 1WJ3A 5EN3A 3IK2A 2VXVH 5A7EA 1SXSA 3TPUB 2W07B 5HHMB 3NCXA 5DWUH 4FQHA 1SVZA 2OSLA 3AW5A 4DPRA 1OEZW 4MB4A 4JFPA 5HVHB 3D69A 1WZMA 2EVIA 2OK0L 1BAGA 3C5ZD 4LHUB 1WD9A 2YQ2A 1UCTA 3BD3A 2QDWA 5KYUA 2FX9L 1H8LA 4GINA 3T77B 5C71A 2X6UA 1EGJH 1FO0A 2YD5A 4OLEA 3ZDYF 2AV1B 4R7NA 3H56A 2RR3A 4R4ND 4W4OA 2DOCA 2PP7A 1IGYA 2E46A 2P5WB 3G6JB 4K3JL 4FFTA 1T4WA 3S5LG 4XPBL 2W38A 1HHKA 2I69A 4PRDB 4ZTPH 2H26B 3CLFH 4GI6A 4E9XA 4BA8A 3EFOA 3H9SD 5AG9A 1DQMH 1DLHA 4M8VA 1GGBH 4KJWC 4HJJL 8CGTA 5IUCA 3ARBA 2XTJC 3W9EA 3L3OC 1MQKL 1JHTA 4AYFB 1OP5K 1NPUA 3VXME 4XBPA 3EF4A 1JF1B 2PTUA 3JBG7 4JDEB 1FORL 4XN5A 1CR9H 1FDLL 4TVPL 1ZK5A 1UGKA 3VI3F 1SMDA 4IIQC 5J89A 4WGKA 3RZCC 3PHOA 5I8EA 5FR3A 4G8GA 3HS0A 4CU7A 3T0EB 2FE0A 5LCVA 4HFUH 2Q9OA 3KXFD 2BVEA 3C6LC 1IARB 1BIIB 2WQUA 2YLHA 4JS7A 3ZO0A 4QJ3B 4R6UA 2FEDC 2VDRH 4FMKA 5IHLB 3QHFH 1I8LC 3QS3A 1IJNA 3KYMA 2R27A 1L0QA 5KJRH 3CZLA 2W59A 4G8EB 3MGAA 2BHFA 1E8YA 1YAZA 5JW4Q 3VQ2C 4DEUA 3LKRA 4ZAKD 1OGAB 3KWXA 2Z7ZA 1GZPB 4KVNL 2BH0A 5D93B 2W65B 3G5XB 4KV5F 2QELA 3S2AA 3IDYC 2Y5QA 4K8RL 1FVDB 1DQLL 3RFZA 3ARVA 2ZXAA 4ZBJA 1DJSA 1F42A 2CJSA 4WW1A 3FJTA 1Z2KA 4ANKA 4OIAA 1KJMA 1LO4L 4L8BB 5CUSH 2VWEE 1F4WH 1FN4B 1IC7H 3APNA 4I0CC 4HKXB 1XWVA 4MDIA 4NERA 3RLSA 3GJEB 2ZG3A 3C8KB 4UYQA 4MB1A 43C9A 3ZKMC 1S7TA 5D1QE 1N68A 1MHHB 2AJVL 2EE3A 2WLMA 3L7EA 2VZVA 3JYCA 3KW8A 5C3IA 4UBDD 2F19L 1EHAA 5EEUA 1UD4A 3VWKB 2YD0A 4GUQA 4MJIA 3QRBA 4BFNA 1F58L 2ZUQB 4XNQA 3V5KA 3NMEA 3BPLC 2UZIL 1CYGA 4HWEL 4MMXB 3FRUB 3G9AB 3SE9L 3L3HB 5C97A 3ILQC 3H6AA 3D06A 1YA5A 4GRMA 3MFGB 5E03A 3HZVA 5DJCB 3DJ9A 3WJLC 1WBYA 5ISZB 3NFNB 5DZLA 5EDSA 1Z3GH 1KG0B 2IPTH 4JM4H 3GXPA 2YMTA 2IVFC 5DMIL 5AZEL 5HJ3A 5JOPD 2HT3C 4G5ZH 4LBEB 3OMAB 3UBHA 5F70A 1INDH 2Q76B 4BK5A 4NYLA 2YD8A 4IDJH 5D2NA 3UBXG 2ZKYA 4BINA 5ACMA 1IGTA 1P9MC 3CN3A 4ICXA 3E7JA 3RWJB 1F11B 3GSNL 4PWIA 1UH3A 4B9FA 4OD2A 4U1IB 2XWXA 1OP3K 3PNWB 3UAEA 4CVZB 3BHBB 4LPYA 4PM1A 3CFBB 4PB9H 1X6NA 4JPVL 1CBVH 4L5FH 5BVPH 4N5UA 3P3UA 1CLZL 1LILA 2BSDA 2G75A 3DTUB 3PWNA 3WMPA 3ZL4L 1JWMB 5BRZA 1YN7A 5JO5B 3OSVA 2C4XA 4XVJH 2XN2A 4TNWK 2R56L 3U6RB 1S2EA 3VG9C 4WK0B 3N40P 4GB9A 4HEME 2CKBL 4N6RB 4R84A 1M7DB 2X2HA 4G1EB 4OJDH 4PP1C 2VLRA 5CKAA 4MLIA 4X80H 1I1AD 1JERA 2FUTA 3MNZB 1D7CA 2YK1L 3ME0A 3MO1A 4APQD 3J07A 5C0GA 1QZ1A 5IHHA 4Y4FC 3A21A 4OH2A 2CIKA 2V37A 4LCIH 5GZNC 2LTQC 4YH6A 3RQ3A 2X9ZA 5KZCB 4OLWH 4FXKC 4RGNE 4K7PX 3RL2A 3FRPG 2NUTA 2RCSL 4H26B 2BRRH 3OLIA 4QD2E 2J1XA 4FQXC 3Q6GH 3DJSA 5LBSA 3S5LB 3NK3A 3ARUA 4I3RH 5IOKA 1RZPA 5I1AA 1AO7D 3NJMA 4YVUA 5H4ZA 4Y9GA 1M57B 1PLBA 3L4UA 4FQ2H 3FU7B 5IW1B 4LIQL 5JW3L 5LNGA 3QR1A 2Z0UA 1UVQB 4TSCL 3U83A 3B34A 1MVUA 4WEBL 4XBGB 3HB3B 1QO3B 4QXGH 2JKSA 3ZPDA 5HHPA 3DHUA 3PIQB 3VRJA 4TRPH 1CGXA 3OKDA 4H88H 4WHTA 3K71A 4Y4KB 4JDVA 5AVTB 2I9LA 1MFVA 3GBLA 3CSFA 4AWJC 4YAQA 4KITB 3MV7B 3EYQC 2JCCE 3GMOA 2J88L 1YEFL 3IPFA 4AM0B 4MQXC 2V7NA 4KTDH 1EO8H 4RH4A 2X40A 1DEEB 3TVMB 3C60B 1MCJA 4CC1A 1VADA 2XN9E 4PW3A 5EUOB 4DERA 2VRAA 4OIBA 5CLYA 5TF0A 5CO1A 4YDNA 5IBLD 3EJPA 4NC1C 2DYSB 2FNWA 2A6IB 4YR6B 5EN2B 3QPXH 4DN4H 4G9DB 4FQ1L 2HKAA 3L4ZA 4MDRA 3MUY1 1KYOJ 3WTVA 1JK9A 3REVA 4BCYA 1T2QL 3OHXA 1XSOA 2OMVA 3VSQA 4LDEB 1XD0A 3MLTB 1UZ8B 2IDQA 2HFFB 2C3GA 3WNOA 1ZJAA 3EBIA 1KLGA 1RZIA 4M48L 1MCCA 1HJCA 2BMKA 4KMTH 4JFHE 4PJEA 4L3EE 4PJDA 2BOCA 4PRHD 1M2OA 1MREL 2E76C 1KPVB 2K3HA 4FHBD 4JCLA 3DHPA 2NSMA 5KS9A 3T0VA 5IMOB 3RPIA 4Y1AA 1W0VB 3BP6A 4M5YL 1MJJA 5D7LA 1AS8A 1HHGB 1KXTB 2H3KA 3RKPA 2B1AL 4P59H 1SXAA 5GIRA 1LE9A 3IMSA 5I30L 3CLEL 2ATKB 3NFPB 3FBKA 3MOBL 5IR1A 1VFAB 4BK8A 4GBXC 1T04A 3FB5A 1GMIA 4GAAA 4HBCH 1NGPL 4KI5E 4UM9D 5HDBF 4ZO8A 1J1PL 1GGTA 3QK0A 3UTOA 1MCEA 2A4ZA 4MDJA 2YEQA 4WFHD 5I8CA 5JPMC 2DN7A 3IJHA 4LQFH 1CMOA 2R4RL 2B4CC 5L7XH 4I0PA 1ZY9A 3PAYA 3WNMA 1P4IH 1S5HA 5HI4C 5TE4L 1CXIA 1A66A 2J73A 2PPAA 2MQ0A 2DQFB 2EIDA 1TTAA 4EF3A 2EEBA 4FQCH 2R51A 3V0VA 1BQHA 1BZ9A 1HESA 2AXHA 2CGRH 3IDMA 4PJFE 5GGUA 3SE4A 5GS1B 1P4BH 4OLUL 1MNUL 2A9NL 5DT1L 4EQ3A 3NTCH 1PSKH 1IEBB 1QASA 1CLYL 4G7VH 4FULA 2WN2A 3BQUA 1CGVA 4AEHL 4QRRB 4XMXA 2ZXWB 3H85A 2WP3O 5AVSB 4K3EL 4P0DA 2IOOA 2EILB 4Q4EA 2GUOA 5BMFH 2FL5A 2F6AA 1SFDA 4QHKI 2V7HA 5L9DL 1L7IH 3VFTA 2QHRH 4G6KH 3EFDH 3FAWA 4J6RH 5TE7L 4YLBA 2C4FT 3AC0A 5KN5A 4PV9B 3VGHA 2ALWA 1LWJA 3GKWH 3VJ6B 5KVGH 2E0PA 4UT9H 3IXTB 3WE6A 5CWSA 5F3FA 4XH2A 1BHGA 1GS8A 3WFEL 1E40A 2XVGA 3QJTB 2ZF8A 3VAEA 5FYKL 1CD8A 1SHSA 4OW6A 3NCYS 5DO8A 4Q8BA 4QAMB 2P46B 4IYKA 4HUUA 1JZ8A 4KUCD 3W37A 4A2MA 3OB8A 3CSYA 3MJ9L 1PS3A 1IRAY 4TM9A 5EU5B 1E27B 4EAEA 4BSWB 2ED9A 3LRGA 3H3PL 1JWSB 3IBOA 4HHWA 5DO2C 3NACL 5MEQA 2Z91A 3WUWG 4X6DE 3LH9A 4XO8A 3CVIH 4E5XG 1LEIA 2AV7A 3NZHH 4JO4H 1IIIA 1RUQL 5AD0A 5I74C 1NBYA 2B4CH 3QWNA 1SBBA 4G8GD 1WQVT 2WD0A 2GIYA 4RBPH 5C2UB 12E8H 2X4PA 4OT1L 3ZK0A 1Z1WA 3OAUL 2XYCA 4U6VH 5FLUA 3AFLA 3FRPB 1KTCA 3DX6B 4NQSA 1MAJA 1XH1A 4QHUB 1OCRB 2CXGA 3HI1A 3I75A 1M05B 4GS7B 2XLLA 4G8AC 4UT6A 3OJ2C 2GK2A 1RPQA 2CBTA 2VSDA 1XH3B 4J8RB 1Z9NA 3WS6A 4AZUA 3VFNB 2GK0B 4PGEA 4Z7VA 3KLHD 3O9WA 4HUMB 1MOEA 1YVLA 2GEQA 4Q58C 5KYWA 2JJSA 3A6CL 5I6NA 3LZFH 1QI4A 2XCMC 4FG6C 1DN0B 1MFDH 3FFCD 2FWOA 4NT6A 5IB1A 4ZJ9A 4HT1H 4FC3E 1QBLL 4HS6A 4L1BA 2AXWA 2FR4B 4N22A 1Z3RA 2F1AA 3H42H 5JDJA 2RH0A 4XHJC 2J8OA 4HWZB 3S3SA 2E6JA 1B6DA 2Z31C 5GS0L 3UABA 2EADA 3SIKA 3HBGA 4KDTC 1A8ZA 3CXFA 4YWGH 1ETA1 1LL1A 4I13B 5F7UA 3KGSA 1WA1X 2EDRA 1KBVA 4XNXH 5C07B 4YIQB 3TEUA 1XB3A 3OKLA 1NCJA 3U4KA 4ENED 3O4LD 2NR6D 4L8DA 1NDMB 2QZ5A 4OF5A 4TNGA 2KQNA 5HYQB 5FUOL 3U4AA 5DRXA 1A47A 2ZWSA 3U9WA 4ODWB 1EVUA 3RWIB 4W9DC 3RDJA 4FLHA 1SJHB 2ICWJ 5GRUL 1YEEH 1FBIH 3RAJL 4UM8A 3HKZA 5J8OA 1I1RA 4JMXA 3MTXA 1WZ1H 4MJID 2KQMA 4OCWH 4OQ1A 4CSSA 3MR9B 4PTUB 3H6JA 2D7PA 1MY7A 1RZJL 2X0VA 2VERN 1U3HA 1KTKE 1ZIBA 1EUUA 3R06B 4H0IA 4M1DL 4ZMPA 3T8XB 3JTSA 1CS6A 4WFFE 3DETC 3HE6B 1W15A 3FQ2A 3O45A 1MG2C 1KSRA 2QHLA 4NQTA 4J3BA 5CIPH 4M8UA 4HW6A 2IGTA 4IIQB 2WGNB 3CUPA 2C9VA 4HIHB 4AH2B 3RZCB 4P2QB 4K2UH 2AGJL 2VLJA 4YPGA 5GGRA 3TV8A 3QDMA 1HZHH 3L7FA 4LRIA 1VGKA 4TN9A 4EIBA 1NJ9A 1X9RA 4KH9A 3IMUA 1QYGL 1HHHA 2V3DA 3L9RB 3MJGX 5TQ0H 4AVHA 2VWEC 1E0OB 3WTSA 1VEMA 5IROC 4ETQA 4XO3A 3RHWK 1DP0A 1L3WA 3TYGH 2I5YH 5D1ZC 1B4LA 5B4MD 5BZWB 2GJ6A 5KSAC 4UDUB 5DMKA 2XY2A 4MXWH 2EIMB 4A68A 2OYMA 5AOMA 4XMZA 1TCRA 2IH3B 3ATFA 3DHMA 1C7SA 1UWFA 3AQDA 1KIRA 5AAWC 3VQMA 1FV1A 4ZUTA 1UFGA 4XB8A 5BRZD 3RJQB 3QZPA 1YNTB 4YHLL 3IDYB 4ZOAA 1A6WL 2BNQA 4W9GC 2GUYA 1SDYA 4M1CD 4UILL 1NFDE 4EIZC 5FW8A 5GRJL 1JYXA 2PUQT 3FAXA 5TQ2H 3SQBB 3TCLB 4GSXA 2SODB 1QRKA 4PCKA 2QQNH 2JTDA 2GABA 1T3FA 1AGDB 3TEWA 4U7KA 3HZKB 4X5PA 1B9ZA 4TXVB 4JM0A 4TSAH 2Q2LA 5C09B 5EU4A 5DD5L 3B2UD 3T0AA 5HJGA 1X5YA 3MGTA 4DUVA 4M7LH 5B39B 2NNFA 4XPTL 4ZTEA 3OKMB 2HFGL 2WZAA 2FNBA 2Y1ZA 4AKOA 5E2TL 4DKEH 5EUKA 3I6LE 2AF2A 5AEAA 4QT5A 4RETB 1GGYA 4K94L 4S1QH 5EIIG 1GA2A 2GCYB 1II4E 1HSBB 3WUWB 5IEKB 2WP3T 1AG6A 2P7TA 3MRBB 4E5XB 1PD0A 4FNPA 3T9WA 1JZJA 3CD4A 1NAKH 2ZJSL 3QIUC 2ZKHH 4JQXC 5F1IB 2OYPA 1RL1A 1I85C 1YMHB 2C1PB 2OAAA 4NUGH 1F90H 1N0LB 2M2DA 4N1HB 5F9WC 3KPPA 4IBTA 5C08A 1RH8A 4YDZA 5FGSA 2LU3A 4WUKL 1OAXH 1I9JL 1S3KL 3M45A 4DEWA 4HFWB 1UKTA 4DN3L 5ACLA 5JHDB 1E4WH 5EOTA 1XV8A 1LK3L 2NX5B 2DYPB 2F8IA 4LEEA 1I7TB 3MLWH 1NAMH 2HLFD 1IQDA 1ZTXL 3QO0A 3IRPX 5IF0A 1UB5A 2P42B 2EEDA 4KXZI 4WF7A 1VGEL 2E4FA 3B1UA 4ZFOL 4RZKA 4P4KC 1D6VL 4M1GL 3VGEA 5E1AB 4RESB 3QARA 5A1AA 1MLCB 4ZNEA 3AY4A 4I48B 2AXGB 3VSTA 2NTFA 4UQ3B 2R2EA 3MJ7B 4ZS7H 4Z0XA 4OVUA 2ADIA 3C9NB 4W1TA 5INCA 4B96A 1J8HB 3L17A 4LHQB 4NXKA 5AZ2H 3V4UL 4YDKH 3EGSB 4Y1AD 1U92B 2D03L 2VN4A 3IE9A 1IFHL 5D7LD 4D2NA 2XG4B 3WSQH 3RL1A 3CK0H 3ABGA 1IT9L 1CG9A 3KPSA 1KCWA 4F58H 3AS3A 4NHCL 5JW4N 2NZ9D 4AV4A 4OZ4A 1S4IA 2BY2A 3PGCB 3I9AA 3ZHFA 4GAYA 1U91A 2BNUA 4ZSOB 3ROLA 4FQXB 4XMLH 2E47A 1ZT7B 3VDAA 2ARJQ 3RX5A 1XIWC 3FN9A 1HQ4B 1MI5B 4ZX3A 3QJHB 4FL4C 2QV2A 4KKZA 1KCVL 3TIDA 4JRLA 3ENEA 5ENWA 4CBPA 3WIAA 4LLUB 4HC1H 4MMYB 1I8IB 4DZBA 5I19L 4G82A 3T3PF 5F93C 4GP5B 4FXGB 4LCWE 5IESH 4NM4L 4XPFH 4HGWA 1CVRA 3UAJC 3QRFM 3I9IA 3TNMA 3T09A 4FYRA 35C8H 3QUML 4LASH 1X9QA 5JIQA 4BK4A 2YPLA 1JPTH 2XZAH 1LK2B 1RHFA 2BY3A 2FD6H 3VDCA 1GY2A 4UQBA 2JB5L 2LVEA 3ROOA 1WEJH 1SY6A 4M6OH 3G5YB 3SGEH 4A04A 2NXZD 4UIMB 2OQJB 4S1SH 5CJQL 3T2OA 3D08A 2Q6WB 2F7QA 4OLVL 3SE3A 1P0SE 3WFBL 4YGVB 1UUNA 1EEUA 3JV5A 4QRAA 3BESR 3LJ3A 3STLA 1U3YA 1DDHB 1WAAF 2VDOH 2WSDA 1QPPA 4YHZH 4NM8L 4ODSL 1S7SB 5EHFA 3WLWC 1TTGA 5CU5A 2R2CA 5DC4B 5DYOB 2ZXCA 4M7JL 1F97A 3QJOA 4PJDF 2RQEA 2UVEA 5E5MA 3X3GH 5L2KE 3BCDA 4HS8L 2IGFL 4GXVL 3NIGF 4ILDA 5EB9A 1S8DA 5EO1A 3WI9A 4ELKB 5KS9F 3MHZA 4LEOA 4BFIB 1TJHH 4HETA 4P5KA 1S7UA 5C0ND 3X12A 1A4BA 2J6EL 3A6BL 5HYJB 2BSTB 3W5NA 1FHNA 2K4WA 4XHQA 5IBTH 1T22A 1PDKA 2FHCA 4XC3L 1FE8H 4BZ1H 2C9SA 3HJEA 5ABAA 4DGUA 1AE6H 5SWZA 2OZ4L 4HZAA 3W0WB 3EDEA 4GBXB 1IGFH 3GMQA 1XGTA 2R2HB 2YQBA 5KJ4A 4PWFA 1UA6H 5I1KH 4X5WA 3AREA 2VR9A 3N04A 5EU6D 2JKNA 2LFEA 1ZVYA 2E9BA 4ACPA 4Y4FA 3B3IB 1BREA 3V7AG 5EF0A 1R6VA 3BIKB 3FULA 3O9WD 5FWQA 1FNSL 3B3BA 5GZNA 5I24A 3VM7A 2AEPH 3UC2A 2AXFA 5HYFA 3TO2A 5AVWB 2F53B 1M6OB 2MTAA 1BYOA 3V6FB 5HHOE 1F8TH 2YIHA 4H25B 2J20A 5LGJB 1KFAH 5IFJB 3EH5B 1W2KT 1WHOA 3D07A 3VXSA 4UTAH 1U3NA 4N24A 5E95B 3GEFA 1IGIH 5G2NA 1CDIA 1W72H 4HAFA 3ECQA 2FGWL 2HJLB 4FTVD 4N25A 2ZUVA 2GT9B 1NIEA 3O41B 4E41A 3JUYA 3L1GA 4WAFA 1T83C 2QZQA 2WVTA 2IH8A 1F1AA 1GGUA 1NCDL 1PLGH 1Q72H 1YEDB 4WW2A 3M1BA 5DMYA 1I1YB 3HCVA 4EE2A 1FLRH 1A4KA 4PR5B 3V6OA 1WWAX 1KLUB 2DV6A 4W6YB 5CN3A 4TS6A 4QRTB 3BZFA 1AS6A 2VR7A 4HXAL 3V0EA 2VXQL 5KG9B 4J3XA 4FFVD 1UWEL 3PWLA 1JOIA 2WLIB 4OBSA 3GB7A 3RUGE 5C0JA 5D70L 3FO1A 2ICWA 2ZUYA 2HMID 3MBEA 3T3MB 5LUMA 1MQ8A 4XNUH 2BIHA 4P9HL 5KBKA 2Q10A 4GQ9H 3MCLH 1LP9A 1M7UA 3KEDA 1OAKL 4FF9A 3LB6D 4HWUA 1ACZA 1R5IB 3NOIA 2HN7B 1BD2B 4IGBC 3G6AA 5I74B 5CAYB 3LKOA 5J0BA 3O2DL 4R5XA 1A3RH 1T66D 3IN0A 3LZOA 2VLJD 3IAGC 3RVWC 3QDMD 5B3JE 1JRHL 3WHE1 1TQCC 1DBJH 3Q0HA 4FFYL 4JRXE 4JAMA 4WU5B 5FFOA 5GSVA 3TBBA 1SRDA 4Z76A 3W1ZA 3TH2T 2H9GB 2G5BA 5CXPA 4GAJL 3NZSA 3IU3A 4JM2A 3RGVA 3HG1E 3QJRB 4DP5X 5DHDA 4N9GB 3VXUA 4Z7UA 3JQOB 5I8OL 2H1XA 4HSCX 4D7BA 2WXHA 2NT0A 2LOEA 4F57H 3OAYK 2G9HA 2HT2D 3BOVA 4QHLA 4Z7VF 2XWJA 1JGEB 4Y7OC 1U4FA 1JZ4A 3MLSH 2AQ2A 4KTGA 4NBYB 4QHMA 1Y1UA 3LCYA 2WGXA 2EDTA 4IHOA 4MNGA 4C83A 4XRCB 1E7VA 5LCVL 4F27A 2EINB 2AK1L 1XQ4A 2BNQD 2DL9A 1YJDC 3SGEI 3FT2B 1D5IH