4LZKA

Crystal structure of inclusion body protein (pixa pfam12306) from burkholderia cenocepacia j2315
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
159
Chain Sequence
b'SINLEKAAQSIQILAVIDTNYIKRSHPNPSLNAQNPTSIPSTALFMLNGHAPGVSSSEGNGNLGLKLNVGDKVSLMGTSLADNSGDAALIYHVQQYSGAQVFAPFTAVTIEQQVFQAFESVAKSAGSEYLATSFALYTRSQNRKSLFGYFFWVWQAAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PixA inclusion body protein
publication title Crystal structure of inclusion body protein (PixA pfam12306) from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Unknown function
total genus 36
structure length 159
sequence length 178
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12306 PixA Inclusion body protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lzkA00
4LZKA 4PIBA 4Q52A
chains in the Genus database with same CATH superfamily
1HJBC 4L4VA 1VGEH 3L7EB 1EAPB 2OW7A 1PD6A 2J1YA 2Z8RA 1JK8A 2OMUB 4Q6YA 1G7HB 2XACC 5HVGB 4K5PA 2E7CA 1AS6A 3W9DA 1U8HB 1BFOB 4KRPC 1RERA 1HDMB 3O8XC 2GTZB 5DVMA 3SYPA 1WIPA 3L5WA 3BUDA 3PWNB 4DEUA 2EYRB 2J4WL 3AREC 4J1UB 4R7NA 4HEPG 1P2CA 4OZ4A 3VWJB 4OCYL 3F6JA 3OZLA 4WHTA 4K15A 1QG3A 4Y19B 5CD5C 2PO6D 1BQHA 2R2BB 4JY5L 2RA1A 5AZEL 1JZ8A 1PDKB 3CG8A 5L0QB 5EZLB 1EBAA 1T20B 2WANA 4HIHB 1JP5A 4HJ0C 5FCUH 2E56A 3EAKA 1RHFA 3T0ED 1SNRA 2UUDK 2ARWA 1IZJA 5C0AB 2LU5A 1E7UA 5F88A 1DL7L 5GHWH 3FUNA 2GKIA 2FUQA 3LRSB 4G80A 4TV3A 3L3HB 1SEQH 5BUAA 2HRHA 4B27A 1XX9C 3BLPX 3C5SA 4Y4FC 3FO2A 1K3ZA 3TPUB 2P45B 3OKDB 4Z77B 4JFDA 1TJIH 4PJEE 4RMTA 2MPAL 4LEXL 2BWQA 1PBYA 2R1XA 3QJOA 5GS0C 1YEKH 4F57H 3MR9A 4Y16B 1K8DB 1PZDA 1ZJBA 3IXAB 4LNRA 4Z0XB 4AIEA 4L1BA 1CFNA 2WVTA 4BWWA 1JZ4A 3MLUH 1M7DB 2BSTA 1UFUA 1BAFL 4NPKA 4NQXB 1UWEL 1B3IA 4R4FL 4BDVB 3VVVA 2VSCA 1WCBB 4M1CD 2NXYD 4XHQA 3V6OE 3WY1A 4EEEA 1DSYA 3IJ9A 2ZUVA 3GM0A 3CFCL 2N56A 4GOSA 5BRQA 2F08A 4S1RL 1TYJA 2Y2TA 3KBFA 3VI4B 3O3BB 3BZFA 3UTTE 3UEZA 2B14A 2YAOA 4BFEA 2P5WE 4DZBA 1HE8A 3DJTA 3QUMB 2JKTM 3H85A 5D7JA 3IDGA 3WD5H 3ZKSD 4ISVA 3K1DA 4YDNA 2GTQA 1CQYA 3KH4A 1G7MA 3PQYB 4U3SB 5FUZL 4ZW8A 2NT1A 4XPAL 3LDBC 2BH0A 3DV6B 4N6QA 3SBWC 2P7TB 4P2QD 4DGUA 2I24N 4KQ4L 3L9RA 3VU1A 4JRFA 4TULH 1DJZA 4QXGL 3QDHA 3ILPA 2EZ0D 1BEYL 4LDLB 2BIQA 4F15C 3UTPE 3HPLA 4HK0A 4N0YL 5F7DA 4ZUSB 4GEJA 1Q8MA 4XI5C 4R4BB 2Y72A 1IAOB 5C07E 3C09B 1JRHI 1PG7L 3WEMA 2N4IA 1ES0B 3HLAA 3JV6B 1QRNA 4WEEA 4ZDHA 3RWHB 4HUKB 4P2OB 5JW4Q 2XZCL 1UEMA 5AOIA 4Q9QL 3RAJH 2G75A 1M9SA 2VDOL 1FFNA 1MQKL 4HPOL 3WEXB 1N59A 3SPHA 3EO9H 2BW4A 3W82A 4ESKA 3I6KA 4WJKB 3QJFB 2CDGA 2E7BA 2KT6A 3B4NA 1CFBA 1J1OH 1UKSA 2HRLA 2Q8BL 2H32B 3HG2A 5IVXB 1F58L 5IJKC 2YPVL 1NC4A 3HHMA 3MNVB 1E9PB 1LK3H 2D7TH 2OA9A 3D69A 4QHLB 5EB9A 1NMCB 3T3MB 3L5XL 3DHUA 4OFIA 4JFHE 3VD5A 2FJFB 4OZFA 3VQ1C 4WW2B 4WFGE 2FQFA 1H6EA 2Q7YA 3CDZA 4OZFH 2CO3A 3QI9C 5E5UB 4A6YA 5HVHB 4J3OH 4A6YH 3QJVB 2V7HA 2GAZB 4BK5A 2HH0H 1UJ3B 2F53E 4P99A 3ZDZB 1A3ZA 3HC3H 5INCA 2O93L 3CLEH 1R9FA 1OAUH 2F54D 3O3AA 3IGAB 2EE3A 1GMEA 1JPFA 1ZHKA 1QVOA 1YEIH 4LO9A 4WO4B 5EUKB 5IBUB 2R51A 4Q2ZB 3RY6A 2I27N 3HLKA 1YPZF 4KO5A 2IF7A 4OLVL 3K72A 3P4OB 1O7DE 5IROA 2NY7H 3F62A 1BJ8A 3O2WH 3IKKA 1X3DA 3N40F 3OXRB 3ZR5A 1KDIA 4M61B 1L7IH 4YX2H 1AI1L 2QV2A 4UMSA 3T8MA 4AIXA 1E5BA 4OKVA 1AHWB 3WS6A 5LVEA 4PP1C 4K3GA 4L29A 2QADC 5ACLA 4L5FL 4UTBA 3MFFA 2JJVA 4JRXD 4UTBH 4UYQA 1ED3A 5LWYH 4Y5XC 2ICEB 4H20L 1I75A 1KFGA 4B5EA 2OS7A 4PM1A 1A7QH 4GFTB 2KMWA 3RZWA 3NFPB 5B1KA 3T0VA 1F42A 2AK4D 3SEPA 3SPVB 1DSFH 1L9MA 2WBJA 3LYRA 4JY4B 5D4JA 5EA0L 4N8CH 3OB0K 4O02B 5IQ7L 2P5EA 2B0SL 3L95B 4TQHA 4Y9FA 5AYUL 4N2KA 5HHNB 4GT0A 3S96B 2ESVA 4B6ZA 3M17B 1CYWA 2VR7A 3QIBA 3TJHC 2WUCH 2F6AA 2E6PA 4L9DA 2XOTA 3VXOA 3LZRA 5ICYB 4JDZA 4KXBA 7FABL 1MIEH 1V10A 1I9RH 2GHWB 1I1CA 1N68A 1RL1A 4RNRA 2QQNL 4MCYA 4WVRA 1MG2C 1WLHA 5LG6A 1OOWA 2H26B 4XNDA 4WFED 3DX6B 2WXQA 2JELL 4KVCH 4AYFB 2FO8A 4XVJL 1TU2A 2CBOA 3MLTB 2DI8A 3Q9QA 4NIYE 4S10A 4FJYA 4URTB 4WUUB 3S3JA 2WVVB 1FFOA 4JO1H 1DBJL 3LAFA 4L4TE 3TN0D 1KY6A 1U8NA 2WZPD 3NIGF 3WFCL 1WO2A 1IC0A 3ALWA 3W11D 1HC1A 5I5MA 3CZFB 3KVDD 1CVRA 4HC1L 5A3ID 5KS9A 2VE6A 3IDUA 2ZUSA 4GKNB 4IU2A 2O5ZL 5BUPA 1RUMH 3QCVH 1JK9A 5C0GB 1SEBB 3MLPA 3GK8L 4LKCB 1J1XL 3CVHA 3H42L 1A7PL 4XPHL 3UZVB 4W9ZA 5GSVA 1DQMH 2XIIA 3CVHH 1G7PA 4AZUA 4LGRB 5CN2A 1OWRM 1CL7L 3QHZH 3SCMB 3V55A 4MVBC 4NCC2 2BFVH 4N2IA 1ASOA 5G55A 1UXLA 4LHUD 2FTAA 2XXGA 3NIDE 3HS9A 1SUHA 2AKRA 4G9FE 1A6AA 5DD3H 1AGDA 1RVFH 1L9SA 3OJVC 2XPGB 3MGAA 4F7TB 3SE8H 1IGJA 1FZJA 3SE6A 3H9SD 3BAEH 4Z8FH 1OLLA 2B59B 2GT9B 5JW5B 2R29L 2WCSA 1LP9B 2PTVA 1Y18A 4ZK8A 4ONHB 4MAUH 4TUJA 2WLMA 3KAAA 4EKXA 1MHPL 1B4RA 4KHTH 5A2JH 4PRIA 1CGXA 1IC1A 3FU0A 2IH1B 3PP4H 2A83A 3L3JB 4PJ6A 3CFMA 4U1IA 1V55B 3KWUA 5CCKL 3LKQB 1UADC 2A0LD 1CO1A 4QHKJ 3ILEA 1USZA 3C60D 2LQRA 4AM0A 1U8KB 3ZUCA 1CPUA 3MQIA 2QJDA 4G6FB 3RE0A 3TFKC 4P49A 3X17A 4ALAH 1UTDA 1T2QL 2YIHA 3Q6GH 5B1JC 2GSIA 3EHBB 5B4MC 3QEHA 3DLQR 4HJSA 2F1BA 3AAZA 2R59A 3EYVA 4MQ7B 1YNTA 2C7UA 4AIZA 4FG2A 1EXUB 4XMPL 1QYGH 4WJ5A 5DUJA 1OK0A 1HZKA 3MBWA 1U3HB 4EN3B 2D8KA 5IB4B 4MCZB 3Q13A 3ZO9A 1CFTA 4PWJA 1ORSA 4JB9H 3MV9B 2K8QA 2WLYA 3VFSB 1DBBL 4JM0A 1HYSD 3CFKB 2FH8A 2ZWSA 4CAGA 1XSJA 2VLKE 1PAMA 3D3VD 3BO8A 1EO8H 1NGPL 5E8DH 5A2AA 4FX5A 3RBGA 1HHHB 1TITA 1GPOH 3CDFA 2ZUQB 5ALCH 2CLRA 3GYRA 3MRNB 3WS6C 2EDFA 2AZUA 1D9KA 5D7SH 2ZX7A 1YYMH 1INQB 1MN4A 4D94A 2C3XA 5E99L 2QSCL 2LE9A 3EJZD 1S9XA 4RIRA 5AWNL 2F7IA 3L5HA 5D6DA 1DEDA 4I3RH 3WUWA 1WAAE 4HUXA 2X6MA 4NQCB 5HHQB 5TTRA 4PJIE 4YBQD 5BZWB 3HVNA 4GRLB 4M6MH 1S78C 4N8VA 3HMWL 2KL6A 3ARDD 4L3CA 2B1HL 1HL5A 4HDIA 1AGBB 3UAJD 1C1EL 3CZSA 4YDJA 3LQAL 4Y2DA 1UEYA 5FHAL 3HZVB 5D7IE 3DETC 4BIKA 1VAHA 2OMZA 2VAJA 3B7YA 3LIUA 3CZNA 4UT7H 3UX9B 5JPMB 4KKBC 1Q0EA 5A43C 1FYTA 2AGJL 3J2PA 3H9YA 4JDTL 5AW5B 4N2GA 4KV5E 1T5WB 3R06A 3RUGB 3R7QA 4MJ5B 4PGCA 1TJGH 3HCVA 1AO7A 3LEXB 1RY7B 1THCA 1AACA 4CMHC 5T3XE 1EANA 1UM4H 2DMHA 2NOYA 3ZRFC 3ZZ1A 1XH0A 4XN2A 3LH2H 3RGHA 4ATWA 4ZPVB 1OQXA 3FTXA 4WCYH 4FI6A 5IMKA 2NXYC 4FNQA 2GFBB 3TYFA 2XJLA 4OJCA 3QXUA 1KPVB 2VN5A 1TCMA 3NTCH 4CU7A 1BVLB 4U1NB 2QVIA 1A9BA 2IBZY 2R9HD 1PQZB 2UXGA 3OAYH 5EUOE 5KJ7E 4NCDA 4N20A 2EXWD 4DSYA 3CSYB 2GUOA 5KVEH 3FS9A 1W8OA 1FZMA 4BZ2A 3TT1H 4Z7VF 4YHKL 2YGOA 2OR9L 5E2VH 4BZ2H 4AX3A 3FTYA 3RU8L 3H2PA 4YE0A 1U58A 3QAZB 2NX5E 3I9GL 2J1ZA 2QPSA 3K3QA 1UB6A 2Y2WA 4QWWD 2FRGP 4Y19D 4DPAX 2Q10A 4JFZL 1MCOH 3BZ5A 4RETB 2VMJA 4LGPB 4OZIF 3VW3L 2V17L 2F1EA 3BEWB 2E6QA 1C5DA 2YMTA 1GYVA 3QSKB 1KNOB 1WGVA 2NYYC 4U1GC 4WFHE 4X80H 1HIML 3GQFA 4WI8A 3CN4A 3ZSSA 3RPKA 3FXIC 1QLEL 1VLXA 4IGBB 2PR4L 1N6UA 4I77H 4N3TA 2G5UA 3HFML 4RWYH 3HUJF 2Y06L 4XXCC 2Z92A 1FFRA 4K3DL 3GZOA 2NY4D 2R23B 1X7TA 5D4IA 4F7MB 3LN5A 4G7VL 3OR7B 3VI3E 1J5HA 3ECQA 3FO9B 1XD1A 4JDVA 4PJEB 1AD0B 5HD8D 2GJ6E 1FAIH 2X1PA 4B3EA 2HLFC 1KIRB 4OFYA 1SOQA 1HEZA 4Y16D 3H3PH 1T1WB 2QQLH 2YN5A 1JNNL 4HJJL 4EIZC 2FJHA 2FEDD 3BIKA 4LE8A 3U9PL 4HZLA 2FEEL 1EIBA 5AW4B 3PGDA 2Q76A 3PXHA 1MCRA 4A2HA 3I75A 1U93A 1JRHL 3DGGB 5E8NA 3UTTB 3VFVB 3LPGA 2P80A 1BSIA 1G7IA 5ACZA 3FCSA 5L88H 1QACA 2P5WB 3SE3A 2PTTA 3HE7D 3WAJA 1NWOA 1LK2B 1YEDA 1EMTH 4EI0A 2VW6A 4XCEA 4X7CC 1F5WA 4KJYA 4FNLL 5DRXA 5C0EB 3X1GA 4CSZA 4HLZH 4HWEL 5GRXG 5BZZA 1BFVH 1UA7A 2VLLB 4OCWH 12E8L 3X13B 3BRDA 3D08A 5EDSA 3T2OA 1BXUA 3VFNA 2X05A 2E47A 5TE6H 3SBRA 4I88A 4AC4A 3EYUH 4PH8A 3DMMB 1T22B 2LFEA 4RX4A 1MIMH 1ZGLP 5I1HH 1GZPA 4A63A 2NTFB 5KYUB 1OPOA 1ZT1B 3NFNA 5C07B 3R8QA 3I02B 4HU8A 5JHAA 4B9FA 2YSSB 2OX5B 5AVVB 3JWDL 2WO4A 1F45A 2LAAA 3PL6A 2HG5B 4JHAH 5LJYH 4P2OD 5EC2A 5K93A 1BF2A 1DUYB 3EFOB 2BSEA 1L9OA 3LS5L 1IAIH 1UWYA 4UQBA 1YSOA 3MACH 3LCYA 3B9KA 3TURA 3AQZA 1GGCL 3MRRB 2O26U 3GGWA 3AACA 5LUMA 1BP3B 5JOEA 1F4HA 1BZ9A 1ZLWH 2AV1B 5EU6E 4KJQD 3WIFA 1S9KC 2P9RA 2X12A 2CO7A 3EYOA 4R90L 1WEJH 3IFOB 1JZHA 3OPUA 1VEPA 4PV8A 3ZTCC 3TOPA 2YD0A 1OTTC 3MLXL 5K9KB 4NKDA 1QSEE 5HJDA 4U6VL 5KUMA 2HVJA 4L37B 1R6VA 3SQBB 2F53B 3AWEA 3CK0L 3GINA 4FI7A 4JVUA 3L13A 3JV4A 1SLWA 1AFVL 3UPAA 2RB8A 4XP6H 1SF5A 1X5AA 3ARFB 3IEAA 1OARL 2BSRA 2FJUB 1HNGA 3GJEA 3IFNL 4H13C 4PJ8A 5DU7A 4CVZA 3BGFB 5T3ZD 3DC0A 1WHPA 1KLUA 5GSRB 2F19L 2AQTA 2C3VA 1Y1UA 4KXDA 4XX1G 1T5XA 5I2IB 3WS3B 3OC8A 1BVZA 1XXFC 4MLIA 3SKUD 2VDRB 4AJVA 1WT5C 1Q0YL 1JI1A 4WHYH 2ISDA 3MKGA 1I85C 4AYDC 4L23A 1A6UH 1O7SA 4NN7C 3FQTA 4DVRL 2D3JA 4QRTA 3AB0B 4OIBA 2IGTA 3AG2B 5IQOA 2VXTH 2PYEE 5F93C 1TQCB 2XETA 5HHMD 4WAFA 3BPCA 1BQSA 2CHXA 3UERA 5AUMA 5L2JB 2JKWA 5CUSH 2W65A 5C0IA 2FYYB 2HJLA 5HHOE 2EECA 3SKOA 1A1NB 4KROB 3VFOB 4P4KD 1WFIA 5H35B 1KJMA 3QK0A 2VABA 1PIGA 4U1SA 3VX1A 4G71B 1AQDA 4LSRL 4DKTA 4JHUA 4NYLA 1RJYA 2FHFA 2OAAA 5E94A 1WFUA 2TRYA 4UB0L 5AB1A 4BUGA 2JIXB 4Z95H 4M7ZB 4DN4H 4GH7B 3L2NA 3KPQB 2K4AA 5KYXA 5MHSE 4LPVA 4NP9A 1MVUA 5DYOA 2WIIA 1LD9A 3VD7A 4X8CA 6CGTA 4HPYH 1DFBL 3BCFA 2C9UA 2Y5TA 3MGTB 4PGDA 5F3HA 3WFBL 3VFMA 2DM7A 1DCLA 4FE9A 4H1LG 3ZTNH 4HU2A 4XVUD 2DYPA 1Q9KA 4P23D 1KZYA 3WTTA 3UC2A 3D0AA 4TF4A 5L7XH 2RQEA 1SQ2N 3CFTA 1CDGA 3AMKA 2YOCA 4XMZA 3CX5J 2MCG1 4HGKC 3RA7H 2XA8L 4S1QH 4MNQE 1DQLL 5KYWB 2X09A 5AVRB 1IFHH 4H8WC 1X4XA 4L4TB 4N0FB 4WUUD 3M6DA 1KDJA 4JAMB 3EOAA 4QXVA 1BD2D 2YOAA 3GI9L 4MJ6B 2BPBA 1NFKA 1ACCA 4G11A 2NQDA 3QAQA 4DW2L 2A9CA 2W91A 4P06A 4YZFE 3GXFA 3FRPG 3QPXH 5FOBA 1KV3A 1FL6B 3VXRA 1WBYA 4YQXL 3GSUB 5AVZB 5CU5A 2OJEB 3P0YL 3VM5A 3UBXB 5JIQA 1A25A 1AZUA 2APFA 2ZF9A 1K6QL 1UM6H 5T1MA 3FT2A 1E3FA 1PU0A 2EVJA 1QI5A 4NENA 1ETB1 2Z8SA 4FQPA 4GQ9L 2ZQKA 4K23H 3B9AA 3NG5A 5H4ZA 2AJ3A 2FD6H 1UD2A 4X83A 3APDA 4HIEB 4O58H 4DKFL 2GI7A 3SCMD 4N0RA 2V0AA 5CZXC 3LNIA 5L9DH 1CZ8H 5DD6A 3QDME 2VSMB 1CVSC 1NJ9B 4NQDE 2C1OA 3NIDB 1R34A 1Q4NX 4HUUB 4G9FB 1NAMB 4XH2B 4F2EA 4PRPA 3QPQC 1MI5A 3TWCL 2M1KA 3GUTB 2X4QA 4YBHA 4KNQA 1UOWA 2UZIH 5CJOH 3V8CA 2MEJB 4J3WA 5TF1H 2XLLA 4B9PA 1JGLL 4YDIH 4YR6A 4JGMA 4XZUA 3E6FA 1DVYA 4GB9A 3FN0H 3HZYA 4S1DC 3WMSA 3VXTB 5K59F 4XAWH 2EIKB 3RGVA 3MV01 2C34A 3X1EA 4LLVB 1XDTT 5MEQA 1BIIB 5ILTL 3MX0B 3WSQH 1PZ5B 4NQTA 3BKML 3RWGB 1XGPA 2WN2A 3BIBX 3X14B 4H0HB 1KXQE 3MCKA 1E9OA 1IQDB 4BH7A 1J05A 4DP4X 3KNBB 5KVGL 1WZLA 2OMWA 3OZ9H 2W92A 1ZAGA 1Y07A 4G6FD 3NJJA 4Y5YA 3TGXA 5DO8A 4YMPA 3OLDA 3PIQB 4HX1A 2EO7A 1U92B 3WGVB 3CDGA 4LL1A 1V27A 3PDOB 2LGNA 3LHPH 3P30L 5SWZD 4M29A 1FVDA 3C8KB 4HD5A 3FJTA 4XCYB 3VM7A 1FG2A 4JFTA 4FXKC 3E38A 4U0RB 3I9IA 3ZU8A 1D6VH 1R4XA 3H53A 2IGFL 3CQPA 3GMMA 4EN3D 3ATBA 5EBWA 1IKOP 2ADGB 3L3IA 1ORQA 2VXSL 3BMWA 5EZOH 1R0AL 5IB3B 4ZUVA 4HVBA 3T04D 3RNKA 1AQ8A 1F8TL 4G42A 3PV6B 3OPZL 4K3HA 3N85L 3ZE0F 4LSQL 2VLKB 2KHAA 5AD0B 1R3KA 4XPBH 2W9LA 4WU7A 4WEBL 4ENZA 3DTXB 3QNYA 4X8XA 3FYIB 1VFBB 1MCDA 2HX8A 4L1DA 4LT7A 1AH1A 3TH4T 1E90A 4ZPTB 1G7LB 2ZAGA 3B2XA 4L1HA 2D7MA 3ASNB 2DYRB 3BP7B 5F1NB 4HALA 2XN1A 5C0ND 2D31A 3RQ3A 4P46B 2AZAA 2YLHA 4PJIB 5GGRA 3OJMB 3S5LG 1E27A 3HNVH 4JFQA 1JYWA 4W9CC 4GRLD 3V5KA 2X0UA 5ESVA 5JIKA 3T0WA 1QFWM 4CADA 2OLDA 3D48R 1G7JB 4UQ2B 4BKSC 3BI9X 3LEYL 3LV3A 3QORC 5D7IB 4YLQT 4W9LC 2IXQA 5DA4A 1BM3L 1N9PA 3CFNA 2DQMA 1VRSA 4G7SB 4LLYA 1ZT7B 4UQAA 3IDMB 3VQMA 3FK3A 1KTCA 1AYOA 2V2WA 3KYNA 1OXYA 4KPHH 4X5LA 3UTSA 1TQWA 3CLFL 3SOTA 2HFEB 3I3BA 5KBNC 1NCUA 2FL5A 4KO6A 5AENA 1IL1A 2BCKA 1Z9LA 4WEMB 4WK4B 4ZO6A 1YA5A 2ZOOA 1UVQA 3N42F 4G3YH 5HJ3A 2V33A 1PPIA 3AG4B 5DUMH 3SDAD 5C08D 4FL4B 1T4WA 2FEDC 1VKXA 4JFYB 1NH6A 4Z7QE 5TPWH 5JOFA 1NLBH 2DLEA 1DO6A 1H8LA 1MUJB 3PJLA 1RZFH 2LTQB 3EF7A 5JW3H 3VSUA 3L6FA 3ZHDA 2YO3A 5H94A 2AQNA 3WIHL 2WXKA 1PJWA 3C5JA 3MLYL 2CJUL 1MRDL 4FNSA 3QNFA 4R96A 3OWEA 2AEOA 5FHBL 3S3CB 4OJYA 2Q7NA 3MUY1 4OIAA 2AEPH 2BP0B 4W6YB 1K4DB 2VXUL 5ANME 2XXMB 3EOTL 4TQEL 5EIIA 1FVEB 1MY7A 5BNXD 3LXAA 4K3EH 4P3CL 3WXVL 2NX5B 3KCWA 1KB5A 1FH5H 3LZOA 1BJ1J 4P5TA 2WQ8A 3MU3A 5FUCC 1KB5H 1GYCA 4PJCA 1A0QH 4KFMA 3I6SA 2QMKA 2VDKH 1S8DA 5F7AA 3BAWA 3SE9H 1COBA 1SZNA 4BWUA 2HMIC 3NEOA 4EQ2A 3IMSA 5DK2B 3V0AC 5IJBC 4PCYA 4I8DA 3BWUC 4OF6A 4ODTH 4OZGE 4GUPA 4DGVL 4Q9RL 5B38A 2X4OA 4KUCF 5DK0A 3DROA 4IGBD 4MAYA 3RHWF 1NPUA 4OF3A 4ZFOB 1KYOK 1DFXA 4B9KC 2Q1EA 5E9NA 3AT8A 3VCLB 2YPKB 5KBKA 3E6HA 1K9TA 1YEEH 4F92B 2ZXWB 4WNQB 1RZJH 4WTZG 2KDYA 5CINL 35C8H 5MP6L 3VI3B 2HG0A 3MOBL 3NIFE 3FTZA 4FQ2H 3P0VH 4Z7WA 1KSRA 2GJ6B 3V0FA 1IEAA 2X7LA 4OJAA 3PUUA 4ZRGA 4X99A 4HHAB 5FO9B 3P77B 5B39G 1LNUB 1J1PH 3PABA 5DJYB 3SZ6A 1T1YA 2OK0L 2X4TA 3B37A 1MQ8A 1T0OA 3QG7L 2OTUB 1U8IB 1EZLA 1XD0A 1YNKH 3IMUA 4JVPA 1VADB 4PU2A 1BAGA 5T5FA 2VJ0A 1YY8B 5T5FH 2ICWA 3A6CL 4IDJH 5D5MA 4HFUH 4Y5YC 4OY9A 1BA9A 3BZEA 1OKEA 3OF6D 4K5NA 5CILH 4C59B 2P5WD 5IB1B 4K07A 1KYDA 5C0RH 4X5QA 3RVVD 1UD4A 1YUHA 3FPXA 1GGUA 4ODSL 5H2BB 1NBQA 5IR1B 4ELDA 2GEQA 1XGUB 2GSMB 1LM8V 1KJ2A 2NRDA 4J3OF 1KJ2H 1BXVA 2CKBB 5BOZG 4UU9B 1OCWH 5CKAA 2Y5QA 1I31A 1B2WL 1I7RA 3BPNB 1ZEAH 1OT1A 2VJXA 3LKSA 4IBLT 1ZGLA 4ENED 2EDXA 4MB4A 1GS8A 5I8KL 1NFDA 3UTPD 5BZXA 2FR4B 1BBDL 1URZA 4G6JH 1N5YH 2YWYA 1EGJL 4NUGH 5I8EB 3MV8D 1A7OH 3MRPB 1AZCA 3U2SB 2BVTA 2C26A 1IC5L 1QUNB 4GXVH 2XV3A 4RQQB 3TIDA 3ZZLA 5JPNB 3RFZA 4N22A 4QXTB 1Z66A 3B5TA 25C8L 5EN3A 3VH8B 5BS0E 3D05A 3UIYA 1ZV5A 2FUTA 2VDPB 2EYTB 4P4KC 1X5GA 3RZCD 5D70H 2GCYA 4I18B 3L7FA 4X5PA 5EU6B 1RPKA 3MBXH 1QKZH 2ITDA 4Y1AE 4AY0A 2A1WL 4NP4H 4Y1SA 5DHYA 1RK1B 5C92A 4NT6B 3VWKA 3P9MA 4JFHD 3SZKC 3CFQA 4UIMA 2X89A 3BH4A 3M88A 3VSTA 2QTVA 3VG0H 3UACA 2LU7A 4HWZA 1QSEB 4R0LB 1BZDA 5FCSH 2ZJSL 1FNSL 3WDJA 1YEGH 1TDQA 3FUIA 3IETB 1J9QA 1T0MB 5FO8A 3T2NH 2F53D 2XNAB 5MI0C 4F7CB 5HDQL 1MFAH 2F1AA 5DYFA 4PJXA 3TBWA 4GEIA 4RA0C 3ATEA 1UASA 2I60L 3ARFD 1UA6H 1PGRB 2ADJB 1TO4A 1URLA 2VISA 3TLRA 1RZIB 3VJ6B 4B9GA 5BXFB 4CVXB 1WQVT 1Z9SA 1XQ4A 3V4LA 3T0AA 1GC1C 1KBGL 2GJPA 2VQ1B 1XR9B 2VDMB 2J6EA 4LLWA 3E80A 4ZSOA 5IFJA 3CIAA 2J6EH 2W0FB 1P7QD 1CF8L 4BQCA 1I1FA 3AXHA 4HXAH 5KSUA 1OGAA 1T2JA 1FAKT 2PR9A 5E1HB 2OTWA 1RK0A 1NCTA 5KBDA 2ADIB 1DDTA 1MCPH 3EO1B 2ZPKL 1HYRC 4Y4KA 3S36H 5I1DA 2PYEB 5KS9F 4JRLA 4GIPD 1NDTA 2GY7B 2R2HB 1RD6A 3O3EA 1YDPA 5HHOB 3AU1B 3DUUA 1IAMA 2OMVB 3JTSB 1LO5A 1U0QA 1WA2X 1KGWA 3JSSA 4KROD 4HGWA 4OD1H 2A9AA 1W72L 3B3IB 2BNRA 1MFNA 3B2UC 1KLGB 3RY5A 1M7IB 1IGYA 3TIEB 4GG6E 3GF8A 2WSPA 3NZUA 3GI8H 2BIHA 5JUEH 3BWAA 3FN9A 4G8FB 3KXFA 1MFDH 1RZJC 3C6SA 3G5VB 4N5UA 4ABWA 5DJAA 5K39A 1NSNH 5ADPL 1WFTA 2CCLA 4GMTL 3EJRA 3JT0A 3ZTEA 1YN7A 5TDNB 1AGEB 4HCRA 1JHKL 3CHXA 4JFEA 1B9KA 4HCRH 4QO1B 5DD0H 4M4RA 3LXBA 1KYAA 2VR6A 1QR4A 2R2EB 4QTHA 3W2DH 4BM7A 2EVGA 3BN9D 1CGTA 1PLCA 4ACPA 4HAFA 4KK8D 2W60A 5KAQF 4MNQB 4F7EB 5LGJA 2YS4A 3SOBL 1T1ZB 4RFNC 4HOZA 4IEFB 4P05A 1WAPA 2CXKA 2QQKH 5H8DA 1S9WA 2ZYSA 3MNWB 3QUXB 4GRMB 3LKOA 4M9PA 5DWPA 4EAEA 1J8HA 2X4PA 1BQRA 4Y4HB 2PLTA 2NZ9D 3LRHA 5EEWA 3LX9A 3V4VL 1ZSHA 2VWEE 3MLWL 4EI5C 5LQBH 1IU1A 1OY3B 2ZX6A 4DPCX 4R8WH 4XXWA 2JCCE 5D7KE 2FK9A 4JKNA 4MWFB 2VQUA 5JW4M 2CBQA 4XNQB 1XHHA 4PJ5A 4RMWA 5SX5H 1SOXA 5HYSG 2WV3A 1NEZA 5EU7C 4F33B 2D3NA 2O72A 4B7IA 2RGSA 3PWPA 4GMSL 1X4ZA 3QDMB 5DMGD 1YNTF 2R39A 4PB0L 4NQDB 4ICXA 1NANH 3DX8B 3ULVE 1M3IA 1A9EA 2BDNL 1VCAA 2ID5A 4JPKL 4G8GA 1R33A 1ONQB 5DHMC 3DX7B 3BFOA 3OMZA 3LSOB 5J57B 2TSBA 4J5VA 3DGDA 4UINH 4X8GA 4GP4B 1QX1A 3UXFA 5I6XC 4RWHA 4X4ZA 1QLFB 3VB8A 1UGKA 4MJIE 3QCTH 2PPCA 3JXAA 5KOVC 4NN5B 2Z31B 1ZE3C 4TLTA 5JHLA 3VG9C 5JHLH 1CU4L 4GUCA 1PW3A 5DI8A 2FQDA 3Q2LA 3VDCA 5FGSA 1ML0A 2CA4A 2J56A 2VDNB 2EYSB 4N5ED 5JR1L 1BQHG 1EDYA 1VF5C 4XGZB 2PCPA 2JTYA 4FXGB 1QLRA 1S9YB 4NWUL 1JZ3A 3AS3A 1S7SA 2GG1A 3NDZE 3ETTA 3F7YA 5E4AA 1G9MH 1SXCA 1TTUA 1E5ZA 4LVEA 4QUOA 1WTGT 1KBKA 3QC6X 1WZ1H 4JE0A 3GSOA 3UZEA 1CT8B 1DVZA 5F21B 1DVTA 3V0WH 1MHCB 5ETUB 2Y6SC 1DJWA 4AW4A 3BYYA 1KXHA 1ZCRA 3PAVA 3N91A 2Y7QB 3PV7A 1F18A 4D0BB 3SDAC 2I5YH 3A4DA 1Z1WA 3T1WA 5FV2A 4QYOA 4JZNA 4ZFGH 3K71A 1BZOA 2A6DB 2CUAA 3Q7JA 4DZ8B 3FO1A 3NCXA 2RH0A 8CGTA 4ZXBD 1QFWI 3G5YB 1QO3A 2IQ9H 3MLVL 4FKHA 2X44D 2CDEA 2DDQH 3QFGA 2WQXA 3BVTA 5SWSA 5BQ7B 3KPNA 3L3OA 3WYRA 4OLWH 3QCUH 3GBML 4UYPA 3SN6N 3EGXA 5IVNA 1G9NL 3CXFA 2DWXA 2HT3C 2BFGA 5CMAB 4YHIB 1OPGL 1FL3B 1RK7A 2B1AH 2EO9A 1IT9L 2PUQT 3LKRA 4NO2B 3Q01A 5FK9B 4EIBA 1E8XA 5E9DE 3ZTDC 2ZKHH 3F7QA 4M48L 1XGQB 2CCVA 3P4MA 3FHQA 1X5XA 4LU5H 2EAEA 5CP3A 4P46D 4KI5C 4NO3A 4U6YA 3QA3A 4MD5B 1AGCA 5CP3H 2XBDA 1AKPA 4NNYB 3G5ZA 2DRUA 2E8YA 2ZOWA 4LK4A 4TPRL 5HI5D 3SDDD 2ENJA 5TFSL 4AG4H 3BT2H 3QUYB 4FNRA 1BWMA 2ENSA 2FJGB 2F7OA 3SGKA 2Z64C 1NKRA 5I1IH 2SEBB 5ABDE 2RJMA 3V8OA 4TUOA 5F0PB 3W57A 1IEBB 1GL4B 2V9TA 1MWAB 3IAQA 2VM4A 4XC1L 1JPGB 3CHRA 5FYJE 3JWNG 1BZ7A 4H25B 1DQDL 5SWQA 4OV5A 4GG8A 1ZWIA 1JF5A 1LEGA 3HZKA 4PGEB 5EOQH 2Q8BH 2Z1PA 1MH5A 4MX7B 3TA3A 2WYTA 3R18A 1ZVNA 4QT5A 2FGZA 3FB5B 4XP4L 4IBVA 1KOAA 3BN3B 1KGUA 1INEH 4XN9A 5K9JL 3IF1B 1KPUB 3MLRL 1KF9B 2AI0L 3K6DA 3GNML 2PCYA 4APXA 1QNZH 4Z7QB 2I9TA 4HJGB 3D52A 1OAXL 1RUPL 3FHEA 1KCRL 1KPRA 5MENE 4HUMB 3FYEB 5EPMA 2LHAA 4DO6A 1REIA 3FO0L 2Q6WB 2XVLA 5CP7B 3ETBJ 1OSPH 5GISH 3ZKQD 4P57A 1EFXD 2WXGA 1GJUA 3F7KA 4OH2A 1BMGA 1XF4B 1QOKA 2AXGB 3MODL 5KVFL 4UM8A 3PDDA 2PWEA 4OZFG 5T33H 5ANMB 3CBJB 5GJSH 4FG0A 3VXUE 3BSGA 3NJMA 1E6JH 3FOLB 1JZGA 3FW6A 4J3OG 1T4KB 4RAHA 2EE2A 2NX5D 3E2HB 5DEFA 5GZND 1DVFB 3RTQC 5E1GA 2O6EA 4JS7A 5DS1A 5EZJA 4WSGA 4G7YL 4PY8J 1ZT4B 4BKLB 4FFYL 3V0VB 1Q9WB 1R3JB 3RDTA 4JG1H 4I5BA 4WI6A 2AABL 2NYKA 3TZVD 3O6FC 2JK5A 2X0WA 1HAUA 2DWEB 3KW8A 4RSYA 2VLMD 5CNHA 1C7TA 4OZGB 2VZTA 1N18A 2BSSA 2PXYA 1EHLH 5DJ2A 4IRSB 3KPSE 4UWQB 4MCMA 1ADQL 3LZPA 2WNKA 2VERN 4H8UA 1GGIH 5CGTA 4K94L 1ZMYA 2CR6A 4ZMYA 3QJQB 3T4YB 3NIFB 2J88H 4XNXL 5IREA 2QV4A 2GJ6D 3O6KH 1V3MA 3PJSB 3QZLA 4N0UE 4KK5D 5EA0H 3ZT6A 3WE6B 3HC4H 2B0SH 1MPAH 4OGQC 4WU5B 2AK1H 1R5VB 2ZUUA 1G9MC 4TNWF 4XPFL 3OKOA 4CBZA 1CE1H 2J43A 2PW2B 4N6RA 5EIVA 4JANB 2ZAIA 2PO6A 1A6WH 4M7KH 3X3GH 3SGJC 4XT1C 1ID5I 4LSPH 1CGSL 1ZOXA 5E8OA 3UZEC 1P5VB 2WINB 2BVEA 1HHGB 2X53A 2OZ4A 2ZSVA 1DN2A 2DQIL 2OZ4H 2OP4L 5FYLH 5KVDH 1VFAB 3RLSA 1B0GB 4FFZA 1JVLA 5E6IA 5C09A 3NPSB 2FH6A 4FFZH 1J0HA 4D0DB 4HJ1A 1HL9A 3STLA 3LQMA 2I07B 4FFTA 1YECL 4GAGL 4JKPL 1CD1B 5CCGE 2BVQB 3BUYB 3ZQXA 4PI0A 5LGHL 5IGXH 3KJ6H 4ODBD 1KEMH 4EZJA 4M62L 1XB8A 3ZT5A 4BCZA 2KS0A 1XAKA 4Z7NF 5FF6A 5TDPA 1BOGA 3B7TA 3U0PB 2YK1L 3O0LA 4N1CA 4ZD3H 4WK2B 1FCCA 3DYPA 1M1XB 1CLZH 2BZCA 5EBMA 1PLGL 5DVKA 4ZMWA 5HYFA 4RDQF 3HJ0A 2EICA 3SDXA 2XWBB 2CM6A 2WVUA 4OI9A 1D7CA 2X4UA 1XL4A 2CE6A 5BS0B 1TVHB 2W5PA 1KIPB 4NBYB 4G5AA 3M1CA 1WWWX 4OJEH 4MS6A 3BPOC 2C9AA 4MMXB 4BKTC 5I28A 4HUVA 4JPIB 4I9WD 1GS7A 1RJZB 1IVTA 4Y1AB 3SGKC 2NY5H 1ZLVH 2ZX8A 4Z76A 3IJ7A 1DLFL 2VMCA 2YA1A 3LKPA 2KZKA 4YXLL 1W8NA 3FOMA 4QKTA 1JPST 3TCXA 1WFMA 3JWOH 1QSED 3OAYK 3UGEA 5GRYA 4N2FA 2JB5H 3AFLA 2QGEA 5D55A 2CRIA 1PX3A 1DBML 1F6LL 3FCTA 1MFCL 1YYCA 4TUKL 2MNUA 4AT6A 1RCYA 2QBWA 4PW4A 3FONA 2AHIA 4QHNA 5KAQG 3CZLA 3WL9A 2X4RB 4X6BA 3O45B 3L3GA 1DVSA 4UQ3A 4PG2C 4CL7A 1S6NA 1N26A 1G0YR 1ZIAA 2B39A 3TCLB 5BZDA 4NO5B 1SBSL 4IS6A 1U2HA 1JMZA 3UROR 4IK6A 4DF9A 4ZMLA 4IMLA 1B9ZA 1CDYA 5I0WA 2EJ1A 1WG3A 1XSIA 2ZWKA 2VITB 2KUTA 3W9EB 4M00A 1A3LH 2XU9A 2IH3A 2WP3O 4TVPE 3IBOA 3JVGC 4PN6A 4FTVE 3U82B 3D87B 3OHXB 5C3TA 4OSUL 2QHLA 1R3LA 5F89B 5CGMA 4M5ZH 3PYCA 4CGUB 5IOPB 4G2AA 5F6HJ 1I3RA 2PYED 4XNUL 4ZQKA 3C5ZB 3KEDA 3SIKA 4V1DE 2YUXA 3EJYD 1JV2A 3GXDA 3EYQD 3FH8A 3LJ3A 3RDTC 2J25A 3LN4A 4JG5A 2DWDB 2NTSP 5IEKB 3NJVA 2IQAB 5HHOD 3DX2A 1JDAA 3L4XA 1GY2A 1JV5B 4ES8A 2XN0A 4XAKE 3FT3B 3BDXA 4FJZA 4OF8A 2ZX9A 4B60A 3BD4A 4GG6B 1L7TL 1QFPA 3S37L 4U31A 1NZRA 2ZCZA 3HBPA 4G6KH 5KBLA 4P5KB 1OSYA 1WZAA 3O9WD 5B3JF 2ERJB 1C8QA 1E4WL 1R1CA 1JCKA 1T89A 2NY2C 3VMPA 2K8MA 2EADA 1TPXB 2VGLM 5I1LA 2EILB 2XWCA 5FM5O 3AUWB 2GHZA 4X9GA 2FECI 1DQVA 5DWUL 1U95A 2FX9L 1X5MA 4ZFFA 3VXSE 2ZF8A 1WZKA 1HN1A 3WUWG 3VD3A 3DTUB 2FGWL 2NDFA 3BAYA 5HGAA 4NOBA 1WC7A 2Z8VC 4MNQD 2JKRM 3C9NB 3G6AB 3MXWL 5DRNA 2PNDA 4YPGB 4N8VG 5IFAL 1NKGA 3GZQA 3OR6B 1IBYA 4J4PD 4J6RL 2AEQH 4JRXA 4A7QA 5HHPA 5EF3A 4PVMA 1JNLH 1LE5B 3DBSA 3F12A 4FC3E 4HQQL 1I7TB 5AVYB 3KPLB 4A7SA 5F6IB 4Y4HD 5TE7L 3MBEB 4X6CE 4NQSB 3HA0A 2WTOA 2AK4A 2VKXA 1EEYA 3GSWB 3Q6FB 2JCCB 1TZHB 5F71A 1QI3A 3IS1X 1GGYA 4NFCA 5E6IC 5FYKL 4AKPA 4TSBL 1N5AA 1JHTB 5HYQB 3MI6A 1X5YA 5EDXA 3ZQWA 1QSVA 2WM0A 1WAEA 5A16B 4IMKA 2Y9RT 5TH2A 3U30C 3RX8A 2YD9A 4TN9A 3JV0A 3QDMD 1BW8A 3N55A 4WW1A 1YJDH 3SDYH 2QPFA 1ZLWK 4HFWA 3HBGA 3EGDA 5IIEB 1BPVA 1SHWA 2BY3A 3CLWA 5IP4A 1BF8A 1MZYA 3D85B 2XWJA 3PU7A 3ROOA 3BQUA 2EH8L 5DD1L 2N0MA 2Z4TA 4MJIB 5D4QA 2Z65C 1V7MH 2DQTH 3JYCA 2FNWA 4EOWL 4JVWA 5I75C 4AGPA 4QOKE 1Z9NA 5JXED 3TN0A 4DP0X 1FPTL 1ZY9A 4LEEA 2H9GB 3QUGA 2AP2A 2KYIA 1Z32X 4RZKA 4WWPA 3Q1SL 2NY1D 4X7TB 2IDSA 5JNYB 3C2AL 4NQEE 1A65A 2AJZB 2NY5C 5EU5B 2PCFA 5FYJU 4X4ME 1IAIM 4WY7H 4J27A 3UYPA 3U1SL 3CGTA 3WTWA 4AOFA 1T1XB 4ETQA 3A6OA 3EADA 4HUWB 2N0KA 3BGMB 3QHTC 1HQRA 2H7WA 4IRZA 3JWOC 5AG8A 2LLGA 4IRZH 3DO7B 5GRJL 5D7LE 4L8SB 5FECA 1M6OB 2GIMA 2YUVA 1GSKA 3QE5A 4KVPA 4KTDL 3D30A 4QCIA 3SY0A 3ZYOA 2OQJB 5A6IA 2PPEA 2YMXL 3QIUD 1F4WH 1I8LA 1L0YA 4KTGA 1HWGB 5J3HD 4MMYB 2EVFA 3KLHD 3PWLA 2CHWA 5DZJA 5I18H 3D4CA 2GJJA 3L5IA 3H9HB 5GQBA 4OJFH 2EIBA 4OCNC 1N67A 2AQ3A 3DPDA 3P11H 2OJZL 1P1ZB 1WITA 3DUSB 4P3DB 2CIKB 3C6LA 4V2BA 4Y5VB 4AWJC 5D1QA 5BW7C 3HMXL 3GC3A 5I73B 1A1OB 4GO8A 4UDTA 1XEDA 2EC8A 4QNPE 2WGXA 2A4EA 3QR0A 3COOA 3Q06A 2WTRB 3RVXD 2W0KA 3WIIL 2NW3A 4N2AA 4NUPA 4V11A 2ZCLH 3CFBB 4YEFA 4AITA 4Z7UE 3HTLX 3BP6B 1FIGH 4NI6A 2CO2A 3MCLL 5E9DB 4PJGE 3DWTA 4YAQA 1DVQA 3QT2A 3GMOA 4PGBB 4OD3H 1NCAL 1TZIA 5LNDA 5L2KD 5DRWB 1U8MA 2WOBA 4NUJB 5FR3A 4KK9D 1FJ1B 3A22A 3HB3B 3M7FB 3MRLA 4YE4H 4HLZG 4Z7OF 1HHJA 2XZQL 2XX1A 2JVUA 2R7EA 5ENWA 2Y7SA 4PJCF 1BF5A 2V5TA 43CAA 4FQXB 4YUEH 5C0BD 3QUYD 3CQFA 1J5OL 4KTEH 1C08B 1CXHA 4GAJH 2IADB 5CN3A 1MRFL 5HTSA 1OAKL 3LS5H 4LLQA 4MJ2A 3WDIA 2UZYA 4XNAA 1SQMA 3H7BA 2AXFB 3FPYA 3SYQA 4PBDA 5DT1L 5FOJA 5DSCA 1T89C 3OJDB 2CMRH 5AZ2H 4POUB 2QZ5A 1OGTB 1GW0A 2QLYA 1XZ0A 4GRWE 4J6IA 3MMEA 5DHDA 2BSBA 3KS0H 5IBLC 3I2CH 4X4YB 5I30L 1W0WA 3WJLA 1AC6A 2ZAHA 1AIZA 2BOBB 3WNIA 1I9JH 1N6QH 1G6VK 3V4PB 2G9HB 4NGHL 5CSGA 3RPBA 4R90H 1PNDA 3D3VA 4TTDD 2P8PB 4F37F 1I1AB 3FHAA 3UYRH 5MENB 2VT0A 4YIQB 3LQZB 3TNNB 2DJMA 5GS0L 4NXKA 3NRPA 2I7SA 1T21A 1E6OH 4IBTA 2ZXBA 3CK0H 3EH1A 4PRHD 2G3MA 1X7SA 3KLAA 3RVTC 3DJSA 5K9OB 2E9BA 1AQHA 3VXUB 3HS0B 4QHUB 4CC0A 3BIAX 4HWNA 1BJMA 1FGNH 2N7AA 2NYZA 2XVKA 3IMVA 1UC6A 3UH8A 1Q94B 4GIOA 2YD6A 3TBSB 5D5MF 4GBXD 4PRDB 5EORL 4MJ4A 4KX9A 1K8IB 3RNQB 3V7AG 1SFDA 1GIGH 5BOPA 4I1RA 1KWKA 4GAYB 2IPKA 3H56A 1NC2A 1NGQH 2BC4A 2VC2B 3A67L 4JFSA 5LBSA 3G6JE 5DJZA 3ULUH 5LBSH 3ML8A 3RP1A 4NZTL 5JO5A 5I74B 4KXAA 3ARSA 3K81A 4UV4H 4DVRH 1CDHA 1J10A 2VDQL 4RDQG 3WNJA 4IBSA 3S88L 5IT2H 5KN5B 4GW5B 3KPSB 2ZOKA 3VRJA 5ISZE 1ZTXH 3HI1B 1LO3L 1PNCA 3FRUB 4K71C 1U41A 5IHLB 3L7EA 2IH8A 1NFDF 1EAPA 4WHYG 4DFIA 3SJVE 1DVUA 3FF7A 3TT3H 3ZN6A 3IFPA 1KN4L 1GGTA 4MJHA 5F3BB 4W93A 3ARRA 2OMUA 1G7HA 2IBGA 2NDGA 4LSRH 2FB4H 2GBUA 3W5NA 1K4CB 4N0UB 5AAPA 3U2IA 3WHE1 5JMOC 1U8HA 1BFOA 5KOMC 2QQQA 1HDMA 1W15A 2GTZA 3MLZL 1CI3M 3PWNA 2EYRA 2FEJA 4Q74A 2CG9X 3OMIB 3SSGA 2HPTA 4J1UA 1UH4A 1TFPA 2ZD0A 3VWJA 1XXDC 5EU4B 2Z91B 4Y19A 4R4ND 4PMFA 5IVZB 1HCZA 2WP3T 2J71A 2R2BA 4CJ1A 3NPZB 4X5WB 3CUPB 3IJEB 1PDKA 5I8OH 3KGUA 1F02I 1RIHH 4LIQE 4BA8A 1C5BL 4HS6B 5EZLA 2XV0A 3GRBA 3K5SA 1I8LC 1T20A 4YHLL 4HIHA 2H3KA 2NR6D 4Z7AA 3QEGH 1AXTL 4OQ1A 2ZWYA 3U0WH 4UQCA 5C0AA 4OFDA 3ZHNA 4ELKB 2J8UE 3NK4A 4AVKA 4TTGA 3LRSA 3EH2A 3L3HA 2OXHB 3N41B 3C6LC 5AVQB 2AJSL 4PJXF 4JM2D 2WN3A 5IB5B 5J7CC 1DJIA 4HZAA 1VGEL 5FA3B 3X11B 3U48A 1JAEA 4FG6D 1PKOA 4YQXH 4IOSD 5EO9B 1SMDA 2AJUH 3IRPX 1E3ZA 1BPLB 1E8ZA 3TPUA 3OKDA 5E9AA 4Z77A 1ND0B 2HN7B 2ZKXA 1K6QH 2NXZC 3QUZC 1V7NH 1OAYH 2W80C 4EMZA 4Y16A 1K8DA 2NY0D 2XTJC 3IXAA 4Z0XA 5J13C 4DK3A 1CG9B 2ATAA 1M7DA 1SN0A 3K8MA 3EJYC 4NQXA 3V9CA 4BDVA 1WCBA 4KKAD 3E8UH 5CAYB 3V2AR 2Y07H 1QA9B 3NJIA 3VI4A 1DQTA 3O3BA 4X4XB 4F8LA 1GHFH 4NERA 4OCLC 3JWDC 2UWEE 1PVHA 2IWFA 3UGUA 3ZKXC 3QUMA 4DGIH 2YPLE 4UMGA 3EJTA 2Y24A 3QUMH 4UANA 1JGLH 2BIIA 4LZKA 3VTMA 2GK2A 3PQYA 3MOAH 4FYQA 5LNGA 3NA9H 4U3SA 5FCUL 4G7QB 1IX2A 5FDWB 3DV6A 3OKMB 4NNPH 2P7TA 4N2OA 3PLYA 4X2UA 5D1ZD 4G8EB 5EN2B 4MRBA 2VH5H 2GW5A 3FQWB 4HIIB 5GHWL 4NNXB 3SD2A 3WJLC 5JIMA 1QPKA 5BUGA 1KXTB 1SEQL 4ZUSA 4CKVX 5D1XD 4JO4H 4R4BA 1ZDSA 1V3LA 2YA0A 3TVMC 1EZVY 1DANT 3MRHB 1TJIL 2ZKYA 4XWGH 1ES0A 3JV6A 4J4PC 1YEKL 3RWHA 4F57L 4P2OA 1ZJAA 5KBMA 1YEHH 3ZE2F 2F5BH 2VSDA 1XF5B 3QH3B 1P7BA 3CC5B 3MLUL 4PFEA 3WEXA 4CRPA 2XV2A 1TTGA 2NNAB 3P30H 2A6JB 1JWUB 3QJFA 5LLIC 2HYMA 4LCCB 4FTVB 2ALWA 4K7PH 2H32A 2PWFA 3ZKMD 2H32H 3GSVB 4FOMA 5DZ9A 4E9LA 3AM8C 5IVXA 2FECL 1GTFA 3MNVA 1E9PA 4QHLA 4V1DB 1M57B 3V0EA 2Z1KA 2BMKB 4UT9A 2FJFA 4WW2A 3KPMB 4UT9H 4F37K 2WB1A 5D7HA 3ULUC 2AJYH 1D5IH 4DESA 5F0MB 4M8UA 5HDLA 1A21A 2MQGA 2K6YA 2EDJA 2HJKB 3GHEH 2GAZA 3N40P 1T0NA 1UJ3A 1PSKH 4TULL 4UUJB 1I7ZB 1CICB 1MCNA 3I9AA 1MHEB 2WKOA 2D9CA 2V2XB 3IGAA 1AMYA 4WO4A 1M71B 5EUKA 1HXYB 3MFGB 3BXNB 2J1WA 4Q2ZA 2OZNA 5T3ZH 1T7XA 2HSIA 3GS0A 3P4OA 2A9MH 2L8AA 4OGAD 1Z5LB 3LEYH 2ED6A 3VXSB 5DO2D 5J6HB 1U4EA 4OCRL 3AWGA 1R24A 3RAJL 3KPRE 3Q8AA 4BFIB 1VIWA 2DN7A 4Z18A 3F7VB 1RFDH 4M61A 4ZZKA 3EO9L 3ML9A 1DE4B 2ZYIA 3ARBB 1AHWA 3MJ9A 3VWJC 3OAWA 1RUKH 4HG4J 2BK8A 2RBLA 1J1OL 3MJ9H 4WTWA 2TAAA 3G5WA 1T7ZA 2LR4A 2YXWA 1EUTA 1F3DJ 1UYWH 3GB7B 1UT2A 3BAXA 5AOJA 2ICEA 5AQ0A 3HR5B 3WKMH 2VR4A 1JTPA 1LWRA 4LLDB 5HPOA 3EDDA 1LK3L 3D4YA 4X6CB 1QSFD 3MBED 4ZODA 3BJLA 3NFPA 4B7LA 1ET7A 2VLJD 4ZX6A 2QKIB 3KLHC 3REWB 5CGYC 3SPVA 5I5RA 1FFPB 2IAMC 3ZDXE 4JFDE 3BVVA 5JHDE 4JY4A 4OTXH 2IANE 2HKHH 4A6YL 4AQOA 4O02A 3GXMA 4UM9D 4KY1L 4WI3A 3QDJE 4EDWL 2HH0L 4O02H 3SQOH 3TYGH 1CTOA 3ZGHA 3L95A 4WO0A 4G1MB 2FYVA 1W16A 3HC3L 5FYKU 5HHNA 3S96A 1IAII 2APTA 3CLEL 3M17A 1OAUL 4PJ7E 4BFBD 3OLGA 1EEQA 2DICA 3ULVD 1YEIL 1HKLH 1MFVA 2EIMB 5ICYA 3I9PA 4ZUTB 4AZ8B 2BJML 4B9IA 4JZJB 3DIFB 3D85D 1QBAA 3QHFH 5FM5M 1ZXKA 2G3NA 4IOFD 1BQ5A 1MXDA 5CCHE 1V3KA 2H26A 2NY7L 2VXVH 3K6IA 3DX6A 4JBSA 3O2WL 4AYFA 4F27A 4QOKB 4TL4A 1B88A 3HG4A 1MJUH 3MLTA 1INDH 1KG0B 3ES6B 3P2TA 4WUUA 1L7IL 5EIIG 5HI4C 2WVVA 4ADJA 4I1PA 3DPBB 2ZKWA 2HTKD 2ICES 3NFSH 1JZ7A 1NQBA 1SLVA 3O6LH 4X50A 1JGDA 1NIAA 3CZFA 4K9JA 5EBLB 3VGFA 3ESUF 4UTBL 4MRCA 4GKNA 3FT0A 3APCA 4F7PB 2O5YH 5C0GA 1A7QL 2EEFA 1JF1B 3L16A 3IAGC 2XWXA 1SEBA 1KCUH 2AV7A 5BV7B 4WFFE 4YHNB 4LKCA 2OKMA 4Z78B 4ZS7H 3H6JA 3HIZA 3UZVA 5EFIB 5B38G 3FUKA 3PG2A 5DRZB 5D7LB 4NXSA 2HVBA 2YD5A 4JPSA 5DEZA 1G5AA 4CC1A 3GXTA 1N64H 4N8CL 4P5MB 1QRNE 2EIJB 3SCMA 3D0LA 3ZIMA 2EVHA 4L05A 4QRPA 3Q44A 2VLRB 1DP0A 5I6MA 3S37X 5FV1L 2GIYA 4WV1B 3FT9A 1TF4A 1YY9D 1IB5A 2WLNA 3FCGA 4L3EE 4TTDC 1QTYT 2WUCL 5F1IB 4ELME 4L9LB 4WIQA 3TTYA 2XPGA 1MIEL 1I9RL 1VGKB 3U46B 1MVYA 4F7TA 1MCQA 4U6HB 3F8UB 2WHVA 2UY6B 1SVZA 2BCMA 4KVCL 4OIIH 8PAZA 5DJ0B 1QWHA 4NBXB 4A39A 3B9VA 2GT9A 5JW5A 5CBAB 3S98A 2RCSH 2VOTA 3CDYA 3G9VA 3GO1H 3QZOA 4FLQA 4XPTH 2IIJA 4MQXD 4JO1L 4TSAH 2Y36H 3WCYA 4DEPB 3STZB 2OMBA 4Z7UB 3UMNA 2GJZB 3QR1A 1KY7A 4PJGB 4LASH 1I8AA 2IH1A 3D1MC 5E9DD 3ZTJH 3L3JA 2UVFA 4P04A 4RCAA 1DTUA 2ILLA 1RUML 4HKXB 4O5LH 3QCVL 2ALAA 3LKQA 2XRAH 3FU7B 3HE6C 3QJSB 5FGCE 4Q9CA 5DFVD 3HB3D 3MXVH 1U8KA 4N8UA 4S2SB 4OZHE 1DQML 3CVHL 4XODA 4RMRA 3ZYJA 3Q3GB 3D2TA 4ANUA 5JYMA 4E42B 1UJ3C 3ZXAC 3QHZL 4FP8H 4N9GB 2PN5A 1EPFA 3VGBA 1PAZA 1BZQK 1MOEA 1CDUA 25C8H 2BFVL 3U79A 4BGDA 4MQ7A 2UVEA 3U25A 4XTRC 5FYJD 1AS8A 3P3UA 1EXUA 2FBOJ 4WO4C 1MEXH 5DD3L 5E7FA 2Q5BA 5DC4B 1RVFL 2R0WH 4GRWB 2JKJA 1U3HA 4I0PD 3L4VA 5IB4A 4MCZA 4NJAH 4EN3A 1IBBA 2DQGH 3LS4H 3MV9A 3V0IA 3VFSA 1A5FH 1BECA 2HPOA 2R69A 5MEPB 1Z0MA 3CFKA 2R69H 2QTEA 2AAVA 3X12A 4Z8FL 3TS8A 4HSAC 4NI3A 4JFFD 2YGPA 3QW9A 3V9FA 4FMKA 1HHHA 4HA1A 2H0PA 4TQIA 2CDFB 4X4KA 3MRNA 4MAUL 3VFUB 4E9TA 1HZLA 5T1DH 5D71H 4HZ1A 4IKIA 1INQA 4KHTL 3CXHK 4LDOB 4XR8C 2ICEC 2ADFH 1UKQA 1T83A 3FZUC 3PP4L 5F7MC 2IWEA 4NQCA 5HHQA 1NGWB 2L04A 3VXUD 5BZWA 4GRLA 1H6TA 4UDUB 3SPCA 1RURH 2MWCA 4X6EB 3VMNA 2FVNA 2J12B 1X44A 3S2CA 5CZVH 1AGBA 1TZAA 4AENB 4ALAL 3HZVA 4X5RA 1JYNA 3T65B 3SO3C 3ATAA 3GBLA 5JPMA 1IGFH 1PD1A 3KYAA 2B4CH 1X5HA 1PEZA 3G6JB 4FG6C 1WFOA 4IU3B 1T5WA 3RUGA 3VFWB 1QYGL 4YEEA 4MJ5A 3ZK0A 3IRZA 1EK3A 1JZFA 4FQLL 3LEXA 4G8AC 3BKYH 4PTTB 2X41A 2NY0C 2EP6A 5ISZB 4WUKH 5F72S 4JB9L 4M9OA 5DUBB 32C2B 3BOVA 3FF8A 4XNMB 1SXZA 4ZPVA 4LOUD 3AREB 3SJVB 5F7BA 4ZMTA 1V54B 5BJTB 1SJXA 1J9RA 3PAZA 2YHGA 1EO8L 5E8DL 3P40A 2Z7WA 1C12A 1GPOL 4PTUB 4L0ZA 1KPVA 1V8HA 3TEZA 1NMBH 4U1NA 2EXTA 5D96C 2XFXB 5D7SL 1PQZA 3SDXF 4KZEH 2JJSA 1YYML 1PEWA 3CSYA 2B20A 3OL2A 4K5LA 1HNYA 2V2TB 2JI3A 4F58H 2X6BA 4L48A 4I3RL 2GJRA 4UAOB 5C9KA 3SDCD 3O3UN 1NEUA 3AY4A 2FX7H 3D2UD 2YKKA 1TEFA 3WO3B 5DMYA 15C8H 4M6ML 4LCUB 4H8HA 5ADPH 5I15H 1XH3B 2ENQA 5EOCH 5TDOB 5M95B 2MNJB 1H3XA 3B3BA 4WI0B 3BEWA 1KNOA 4UT7L 3BHBB 1XF3B 4Y4FB 2CU9A 1ZSDB 2R1YB 2XQYA 3QZBA 4M7LT 5DQDH 4IGBA 2L7JA 3S34H 5ICUA 4C8XA 1R19A 1OTSD 4X6DE 1EEZB 4A66A 1FV1B 1TJGL 2J8UB 4EZMA 4QRQB 5CN1A 5HDWA 1SHMA 1XCQB 2JV6A 1ZLSH 2GEEA 4PRIE 1WWCA 1UM4L 3Q05A 2R23A 3JUZA 1DJYA 3LH2L 3V0HA 4F7MA 3OR7A 1FGVL 2R56H 4WCYL 7PCYA 4NRXB 4PJEA 1AD0A 5KZCB 1KIRA 1NCHA 3N0PB 5E2WH 3ZKMC 4DT2A 1T1WA 2VMDA 2XN2A 5ELIA 5DZOA 5HDBF 1TTFA 4NWTH 4BQBA 5F7HA 5E1QA 5E0FA 1KENH 5I1AB 3U9PH 2P24B 5KVEL 2VUOA 2F5AL 1BYNA 3TT1L 1MKFA 3LIZA 4PGJA 2F54E 3B5HA 1CXKA 1IIIA 5E2VL 3V6OA 4BZ2L 3LIZH 1RULH 3E3QC 3WGUB 3BRGC 3LDBB 4XWOD 3CE1A 4DP5X 1IBHA 1A4KB 3DGGA 1KIUA 4Z3HA 3UTTA 3FQRB 2YWZA 1EO5A 2NNCA 3OF6A 3VFVA 1AANA 1CD0A 1NEZG 2UWEB 2BNQD 4HF5H 1USQA 1UG9A 1ZS8B 1LK2A 1MCOL 2YPLB 4F15B 5FM4A 3MRGB 4YHPB 5E4IA 2RALA 4X80L 4BUQA 2A3TA 3JQOB 4DN3H 2Z35B 5C0EA 2E4FA 1DDHB 4I77L 4F9LC 2VLLA 3X13A 5DURD 4B0MM 4RWYL 1RUAH 4G6AD 3MRJB 1R3HB 4JY6B 4AUYA 2E7LA 4GAFB 5HGHB 3DMMA 1T22A 4WWKD 3MV11 4JUTA 4WNSA 5AB2A 4MSWB 2Z3FA 4PWIA 3RFRA 1A4CA 2NTFA 5KYUA 4UNVA 1ZT1A 2NZIA 2H41A 5C07A 2XT1B 3I02A 2YSSA 2OX5A 2F58H 1FAIL 3I74A 3X1BA 5HGBA 4L8CB 3FB6A 2HG5A 3APFA 5J4MA 3H3PL 1DUYA 5JTWA 2QQLL 1U9KA 3EFOA 5HHXH 4BHUA 2VDLB 3FBQA 3LNFA 4TM9A 4XVSH 4LSUH 3TBTB 5FB8B 4AW7A 1HCFX 1T83C 3RVWD 4HK3N 4MMZA 4TVPD 3QDGB 3MRRA 4PYGA 4HAGA 4FTVD 4PJ9D 1S7UB 4DQAA 4PJBE 2X4NB 1P9MA 4Z3JA 2Z0UA 3K7UA 1RLWA 1JFQH 1WBZB 5EOTA 1HJCA 4HIJB 4I48B 4AQAB 4V1DD 5L88L 1CURA 1AR2A 5F9WC 3IFOA 3SKMB 5DVNA 1EHKB 1EMTL 4ZTOH 2R15A 4U3XA 2B4CC 2MKWA 1J9CT 4NRYB 2D73A 2ZWZA 2ZCKH 3EDFA 5DCCA 3KD4A 2PETA 4N1HB 3F3HA 5K9KA 2NW2B 1RZGB 4HWBA 3TO4D 3NQKA 3LNEA 4GT7A 4Q58C 4XAKD 2A77H 4HWBH 4L37A 3N43B 3SQBA 2W07B 2F53A 3L2MA 1AP2B 1BFVL 4OCWL 3MN8A 1CGUA 2F7QA 5HYEA 1CICD 1JD9A 3J07A 5BPPA 3VVWA 3ARFA 5GS1C 4UNTA 5TE6L 4A2MA 2HP4A 3EYUL 1JPEA 2I85A 1MIML 5I1HL 3H4HA 3OGCB 2QADB 5GSRA 3TM6A 2GI0A 3QR2A 4PS3A 4HH9B 5EF2A 3PWVA 4CSPA 5JIPA 4Y5XB 5GGSB 3UJJH 5K9QG 2EXYD 4G6MH 3WS3A 5GPRA 2MCMA 3VXSD 5IFHH 5F70A 3KPRB 3BDYH 4TMPA 5E00A 4RFOH 1IAIL 4WI4A 2VDRH 3M86A 3MACL 5DEGB 1JPSL 1SDYA 1MCLA 1G7QB 2CQVA 3AY4C 1U91B 5ANHA 3ARBD 3WN5C 4DKDC 5C71A 3BCDA 4ZNCD 3KLSA 1T7VA 3QAZC 4GI9A 1PZCA 2L7UA 3ISYA 1ETZB 3DJRA 4EVNA 3NN8B 4XP4H 5L2JA 4ZMNA 2FYYA 4ONGH 2JFCA 3D9AH 5E08H 1WEJL 1A1NA 4OFPA 3H9SE 3LZNA 1RV6X 3BD3A 1GMIA 3GNMH 3HC2A 4HWUA 4PGZA 3UMTA 5I0ZA 5H35A 3FO2B 1AE6H 4UZSA 3KBHE 1SDAB 3KZ8A 4JFDB 5JHDB 1EQWA 1VZIA 5CJBA 2IANB 3SPIA 2BVOB 5IWLC 2JIXA 3QDJB 3MR9B 4MZ3A 4QGYA 5A7EA 4U4BA 3KPQA 4JR9H 3QQ9D 2OL3B 2J1KA 1J18A 4PBVC 1LQSR 4PR5B 4WSJA 4XP6L 1CJYA 4PJ7B 4XP1L 3MGTA 3U6XA 1D2OA 1X4YA 1ADWA 2K9FB 3ARVA 2AEWA 4YHYC 2JTDA 1UATA 2YEVB 3OKNB 2J6WA 1NIFA 3POCA 4PV1C 1ZLVK 3HJEA 3GSQB 4JRWA 1KJ3H 4XOAA 4Q97A 1A66A 5FEBA 4N90E 3TBVB 1CS6A 4C56D 4WTQA 4QOKD 5J89A 5KYWA 3OLEA 4GS7B 1QPPA 5KSAD 1RLBA 4L4TA 4XNZC 3ZBMA 3INUH 4GXUM 1A6UL 4JAMA 4P8QA 5F9DC 4DPRA 5JA8B 3OMNB 3STBA 3L08A 2JNZA 4MJ6A 1M9WA 2R4RL 2VXTL 5F7KC 3V5HB 4QRFA 1SMOA 4KKRA 2X42A 4NQED 2N1TE 5CUSL 1FL6A 2CR0A 4HP5A 3GSUA 4BUHA 3RWCB 4HK0B 1VACB 2OJEA 2EE0A 3ARZA 1UB5A 2HWZH 3FTGB 3UBXA 4FLOA 2E4TA 4CC4A 4XRCB 2KC0A 3DSFH 3QQXA 2V4LA 3U7WH 4AEHH 3ZIYA 4EN2A 3H0TB 4XC3H 1NCCH 1QI4A 4XZ4A 5D7LD 4I0PC 3OGOE 4HIEA 1QRNB 1LE9B 4DN4L 4BQ6A 4Z95L 4BE5A 1NM9A 2X9XA 3LB6D 3U6XS 5DDHB 5JIHA 2EE9A 1NCBL 1NJ9A 3RPIB 1GGBH 3DMMC 4HPYL 4HUUA 4L3EB 4G9FA 1NAMA 4XH2A 2CJTA 3DARA 4AUUA 1NDGB 4ELMB 1QMUA 1NAMH 2BP5M 3ZTNL 1BQUA 1IILE 3GUTA 3AG3B 5L7XL 2IFFH 4NAMA 4U05A 4B9CA 1O9VA 3OKEA 1E28B 2EDRA 2PABA 3B1TA 1OTUD 2DM2A 4WWOA 4KJWD 3QVAA 4H26B 3RA7L 3VXTA 3BEVB 4S1QL 2Q8AH 1DBAH 2HX9A 2IWGA 3CDZB 4MMZC 4ZOAA 1IFHL 5FYKD 4LLVA 4F2ME 5KSBE 3GUFA 4J28A 1BIIA 3PCYA 4U1KB 4RVBA 4P4RB 3MX0A 2WK2A 1CE6B 1PZ5A 4A67A 3RWGA 1GZHC 4XP5H 3X14A 5EEYA 5GGSY 3KGSA 1DO5A 1U8CB 1YEJH 3ZPDA 1IQDA 4XMVA 1OD7A 3QPXL 1JOIA 4PG9A 3KNBA 4M62H 4MA3B 2XTLA 1ZLDA 4JMNA 5FGCB 2IGLA 3ESNA 3G5XB 4X6FA 5EZIH 5ABZA 4OZHB 1UM6L 2H8PB 1P6WA 2ZOLB 4K73A 4QHKI 4OM1H 5BRZA 4K23L 5DLMH 5IMLB 4ODXB 2FD6L 4O58L 1E4HA 1U92A 3CZJA 3PDOA 2BS8A 3IN0A 2G9KA 4XBGB 1NUDA 2XN9D 3HG3A 1CZ8L 5L9DL 4LF3B 5EO0B 3C8KA 3N1FC 2HZHA 4LOUC 5LBGA 2IFGA 4PVNA 3T8VA 4XCYA 3ULUF 4UQ9A 2A9BA 2HTLD 3OB8A 1G9HA 2AMGA 2WSKA 4EZKA 2DYSB 3FSAA 1AKJD 4KKCC 3MFFB 2ADGA 5CEYB 1F6FB 2K3TA 2UZIL 2IOIA 4QRRE 1H5BC 3BAJA 3IKCB 3PHQB 5CJOL 5DEJA 3PV6A 5TF1L 4E9RA 5LAPA 3LXUX 4YDIL 1P4LB 4NFDA 2VLKA 3FN0L 5AD0A 2BIOA 2VXQA 3L3DB 1X9QA 1CK0H 4XAWL 3MRCB 3WXWH 2VXQH 3DTXA 3F2LA 3HN3A 1XIWC 1ZTMA 1OK8A 2I69A 1VFBA 3MDJA 4ZNEE 3WSQL 2M8XA 2VUYA 4ZPTA 1G7LA 3VSQA 1WAAA 2XC8A 3BP7A 5F1NA 2FWLB 5EV7A 4LCWD 3HZMB 4D9LH 4P46A 4PJIA 3Q2VA 2ZSWB 1NANI 4ZUWB 3OG4B 3WFEH 4HHGA 1AGFB 4J3TA 3SYOA 1FFQA 2QR0B 3OZ9L 2B3RA 3PF2A 4DEWA 3HN8A 1G7JA 4UQ2A 2VMFA 1RIUL 4ZS6D 5D7IA 2WIMA 5DC0A 4J2XA 4AXWA 4CMHB 1JMXA 1A4JB 4U7KA 5DUPH 1WE5A 3LHPL 1ZT7A 1MLCB 1IM3B 3T77B 4MHHG 3EBAA 2JKXA 2NXYB 1F4XH 1FFOB 2HFEA 2M26A 3PFQA 3C75A 4L2LA 1A4AA 1P0SE 4HJTA 4B3VA 1Z3GH 4G7RB 4LMQI 1GYWA 4KRPD 1I82A 3CFUA 3MJWA 5EZOL 3O8XD 5MERB 5T3XH 2NNRA 2J20A 2X3CA 5GRUH 4JFYA 5GGUB 3ARED 4K7FB 3SJVD 1XF2B 2QELA 3FKUS 1MUJA 4L1SA 4LRIC 4XPBL 5IQLA 1HQ4B 5CD5D 5FUCE 4JN1H 4ZOCA 3HNTL 5C6WH 2R1WB 4YL9A 2K45A 3EBHA 3DI3B 5CFAA 2BP0A 4MA8H 1K4DA 4U1GB 4K94C 4ZI8A 5J9PB 1N0LB 1FVEA 3HZ3A 4HJ0D 4EDXB 1AG0A 3HNVL 2AKRB 2NX5A 5GZNA 3VI4F 4KX7A 3UABA 5CJ5A 1IKNA 4PRPE 4F80A 3KL5A 2ICCA 2QMJA 1AR1D 1B4JH 4FKEA 3WFZA 1QD0A 5J11C 2FGWH 1OW0C 5DK2A 4FABH 3P4NB 2EKSB 5DMKB 4ANXA 4OLYL 4KPHL 3CVBA 5GZOA 5KEZA 1E4KA 1E67A 2XSKA 4X6DB 4ZFOA 5GS0D 1J87A 2V7NB 4J6RH 1NGXB 3ZL2A 5I76B 1C7SA 3VCLA 2YPKA 2RHEA 4YDVB 4PBXA 4PRIB 4Y0GA 4G3YL 5IZ7A 5K9QI 5DUML 5TE7H 5DVLA 2A83B 3RJDA 1OP9A 4MXVF 1OQOA 5TPWL 1NLBL 1IARB 1WH0A 2GJ6A 2HRPH 2X2YA 3REVB 1MCIA 4PJ9C 1RZFL 1BXXA 3OLIA 4TQPA 5LN4A 4EF3A 3TV8A 4HHAA 5FO9A 5JW3L 2KBGA 2XG4B 1LNUA 5ITBH 1QZNA 1F3JB 5DJYA 1CXLA 1T6WA 5EC1B 3GDBA 2AEPL 2F54B 2LLNA 1U8IA 3OKLA 1VENA 4XN5A 4DH2A 4YLCA 1VADA 4XMUA 4K3EL 3OXSB 1G4RA 1YY8A 5C97A 1FH5L 4OCMC 2EDOA 5IVXF 1KB5L 2E76C 1A0QL 1IGMH 2C3GA 1KELH 4W6XB 1X9LA 2VDKL 3T3MF 5IB1A 4AQZA 2BW5A 2YPLD 2ZG2A 3SE9L 4AH2B 4AQ1B 4WW2F 2XKSA 1DLHB 2Y1AA 5H2BA 1WUZA 3NACH 3K2IA 4LVNC 1XGUA 4OD2B 4XI5D 2DLTA 4ODTL 1JZ5A 1X5FA 4U0RC 4YN3A 2CKBA 1TQBC 3D07A 4UU9A 3QP3A 2IMMA 2CKBH 3KLLA 1QFWH 3K5RA 3Q1SH 4I4WB 3ZDZF 5HHME 1BAWA 4YH6A 3C2AH 2WKOF 5B39A 3MUHL 1YZZA 5DHVB 4AJYV 1RZJL 2FR4A 3L3KB 35C8L 3FB8B 1QABA 1HWWA 5I8EA 2CM5A 4BV1A 4FQ2L 2R83A 3P0VL 2RACA 4U1JB 1S7WB 3MRPA 4KXZI 5TK2A 4GIAA 2ZG1A 3U2SA 1QUNA 4RQQA 3QG6B 1CD9B 3E9TA 5JPNA 1UA3A 4QXTA 1EZUA 2XPYA 4JKKA 3VH8A 4AQ8A 2OMZB 4P48A 3GKWH 1J1PL 3V0JA 2Y7LA 2BY2A 5DFAA 2EYTA 5AKRA 1GCFA 3QI9D 2VDPH 1YNKL 5AAWA 3H8NA 3ZX1A 4I18A 2CD0A 3R06B 4PJBB 4R7XA 2GB2A 2VCOA 5EU6A 2W9EH 3K74B 4RRPA 3BH8B 5T5FL 4XNYH 4IDJL 4HFUL 5I66B 5INDB 4U33A 1I1RA 1IAKA 1RK1A 2X87A 3L4ZA 3QFDB 4FXTA 4NT6A 1PG7W 4N8PA 2WYHA 3UJTH 5C0RL 4U3HA 1IGTB 4JKMA 4AGOA 5AW8B 1NFIB 3LNHA 1QSEA 3DHMA 4R0LA 2VERA 3PUCA 1OZUA 1KJ2L 1NA8A 2A7BA 3IETA 3I85A 4YLBA 1UURA 1BD2E 1OCWL 2X6CA 2XNAA 4F7CA 4M3KB 1ZEAL 5I6PA 3LMJH 4GI8A 2H0EA 5HI3C 2UX7A 4YJZL 1NCAH 3TNMB 2ADJA 1QQDB 3VJ6A 2G5BB 5BXFA 4CVXA 3LVTA 4G6JL 2N3JA 3WTYA 1N5YL 4NUGL 4CDGC 4NN7B 4PP1D 4POYA 2QADD 1XR9A 2VQ1A 2LTQC 3TU6A 1YQVL 1A7OL 2IDCA 2VDMH 3HBQA 4EKJA 4JFPA 2EVIA 2AQPA 4GXVL 4FN0A 1ZVYA 2W0FA 1Q9LB 3JTTB 1MFMA 3GXPA 1FL5B 4LHUB 3AXLB 2YAPA 2ADIA 5D70L 4F9PA 2WPGA 3EO1A 5IB2B 2BZDA 2PYEA 3G6DH 4MDRA 1FVCB 3MUGB 1JZIA 2R2HA 3MBXL 2Z7UA 2Z92B 3P3YA 4NP4L 3OSVA 3BRFA 3H9ZA 2V5YA 5HHOA 2P48B 1LLAA 3AU1A 4NGHH 5E5RB 3H9SB 4PV9B 2OMVA 4RSVA 3JTSA 5D2NE 3VXQB 4RAUB 4LVHC 4PLNC 3B3IA 1B0RB 3KBEA 4K9EH 1RJLB 5CJQH 2LV4A 3P02A 4OFVA 1KLGA 1S7VB 1NDMB 2NMSA 4JFDD 4Z7WE 5GZOC 2IAND 1M7IA 5KBPA 3KEHA 3TIEA 4JCMA 1YEGL 5AL0A 4YSEA 5C1MB 1OHQA 3QDJD 3T2NL 3RKDC 3BQVA 1MFAL 1RZ7H 4G8FA 3G5VA 5B1AB 2UXFA 4KJWC 1UA6L 1ZKAA 3Q5YA 3C60B 1AGEA 2ETWA 4OM0H 4C55A 1N8OE 4QO1A 3VACA 4GLRH 1S46A 3IS0X 2J6EL 3AJ7A 3X3FH 3BKJH 3KYOA 4MNQA 1NIDA 1LP9F 4PS8A 4HXAL 2XBTA 5SWZE 4F7EA 4DP6X 1KEGL 4AYSA 3MA7B 4IEFA 5LCVA 5DRXB 4M8RA 1QATA 1MCPL 1J8RA 3Q8EA 5LCVH 5LDSA 4HUNB 3MNWA 3QUXA 4G9DB 5CJXC 3S36L 1SFHA 3VSVA 1G1YA 4Y4HA 1WUNT 2JQAA 4JX0A 2KLTA 2DMBA 2Y1VA 4MVBD 1E4XH 2D0FA 3BH9B 4HD9A 3ZL1A 4DWHA 4BINA 4OD1L 4ADIA 3QS3A 2RR3A 1GOHA 4RBPK 4OUOA 4A55A 4MWFA 2KKQA 5H4YA 4XNQA 2DM3A 2H2SD 5CLWA 2APXA 2PMZA 3UC0H 4F33A 1QRND 4CW1B 3WMQA 3GI8L 5JUEL 4OI7A 2JCWA 3QDMA 4GXUN 5DR5H 4AMKH 4P2YA 4NQDA 3V79C 2WXFA 2R8SH 2G3XA 1LEIB 3X1NA 4GSUA 4L3ED 5IW1B 2WXIA 1NSNL 1PY9A 1ONQA 1IQWH 4L1LA 3LSOA 1R3IH 1NTDA 4BZ1A 1NMAH 4HCRL 4BZ1H 3OQ3B 4AVJA 1Y6KR 4B41A 1NC4D 1B3JA 2Z31A 2ZXDA 3HKFA 3W2DL 4ZAKC 3IMWA 2GABA 1JXDA 3QJHB 4PV8B 5CCJA 1EZVX 1NOAA 4F2MB 4JQVA 1CDIA 5KSBB 2EYSA 4XN8A 2VDNH 4NKDB 1I1YB 1HOEA 4IRJA 4PMEA 5AAWC 4I18C 4J3OD 5LHDA 3ZRCC 3TFKD 4XGZA 4FXGA 2QQKL 4J7RA 1S9YA 5CIPB 2X3AA 1KXQA 1M6UA 1B4TA 1S5HB 2G5RA 4H7VA 4Z5RB 5B4MD 4JZOB 4ILDA 4YHMH 1E5UI 43C9B 3CHPA 4IJTA 1AQMA 2J7LA 4L3AA 3WG7B 5LQBL 5C08E 1JZDC 2VZOA 4TVUA 1MLBB 4R8WL 1YCSA 4FXKB 3ALPA 4ORGB 4CVZB 2XY2A 3R4DA 1CT8A 3IPEA 1MHCA 4Z1PA 2CA3A 5ETUA 5I5JA 3IDYC 4ZSOE 2E86A 2Y7QA 3TH2T 4D0BA 1QZ1A 5T8IA 1F86A 4N1EA 4IIQC 2A6DA 5AOLA 4NSKB 2YEQA 3RUGF 4DZ8A 2MCPH 5AAMA 2OV0A 2YC1A 3SKNB 3GLZA 3G5YA 3O11B 4WZ9A 5JXAH 2G2PA 4E5XB 1ROCA 1KZQA 4CA4A 4UINL 1UD5A 5BQ7A 1F41A 5CEZH 4HBCH 4OIFA 3BPCB 4QRRB 3HS8A 5HVWA 2ED9A 1HOCB 3GJFB 3QCTL 4M6OH 5C0IB 1D5BB 1D5MB 2MHAB 4U2YA 5K33A 1G43A 3VXPA 5I17A 4IJ3C 4LVOC 5JHLL 4LXFA 4KI5E 5CMAA 2JJTA 5KVMC 1GJWA 1S78D 3RJQB 2CBPA 1S4IA 1N7MH 4NO2A 5FK9A 1TZGH 3QORB 3TEWA 1JG9A 5IKCB 2FBRA 3ULSA 4TOYH 3DETD 1AR1C 2NY4B 1XGQA 5I5IA 4HV8B 5KYXB 4KKBD 5TD4A 1G9ML 2V5SA 2WIIB 4I87A 1IVLA 3KL3A 2ESVD 4YPJA 4X8JB 4MD5A 3P54A 5DS2A 4NNYA 1UUNA 1WZ1L 1RU9H 1F3RB 1P4UA 5C7XH 1S9VB 6FABH 4JUSA 3RY4A 3QUYA 5GGQH 5F9OH 1WWBX 1JGUL 2SEBA 4FYSA 3KVQA 3ESVF 3V0WL 2DQHH 3IDIB 3MRDB 3VYNA 1IEBA 4DUWA 3R7RA 5I0DA 1U3JA 1MWAA 1IM3D 1RP8A 1MWAH 2I5YL 4H25A 2OYLA 2YARA 3TJEH 4ZFGL 3FFOA 4PGEA 4DJMA 4NJ9H 4MX7A 2K9UA 4QLWA 3FB5A 4Z9KB 2IQ9L 1OALA 4QRSB 2DDQL 3IF1A 1KPUA 3HE7B 4OLWL 5FOBB 2IWKA 3QCUL 3HI6L 2EH7H 3GSNB 1UT1A 4HJGA 3AT9A 4PJEF 2IG2L 5D9SB 2BP8A 3ARGC 4A7TA 1ERNA 3GMRB 4PJHE 2Q6WA 1GW6A 5CJ8A 5CP7A 2R0KH 4XNBA 3VXNB 2QLVB 2B1AL 2VQ4A 3T6QC 3B83A 4PJ5E 4HHWA 1XF4A 2BLFA 5CSZB 3US0A 2AXGA 3AT0A 4IDLA 2DQ6A 4NO0B 4OF5A 1XCXA 2DEWX 2ZKHL 2NYYD 4P3WA 3W81A 4TSCH 3CHOA 2W88A 3WV0A 4LU5L 3FOLA 3HNSH 1T4KA 1JDCA 3VYOA 5J1AB 4PRPB 3JWNH 1DVFA 1A3RH 3O2DA 3VRLE 3MV8E 2X38A 3O2DH 3JUYA 2FHCA 4M3JA 1ZT4A 3BT2L 2F8OA 3V0VA 5FW7A 1Q9WA 1SLXA 4AG4L 4BKLA 5GXBB 1XCTB 4DK6A 4EZLA 5HBBA 5I1IL 4OCRH 2WJ5A 1SJEB 4NN6B 4CSSA 2DWEA 1UZ6E 5IMOB 1I8KB 3GZKA 1P53A 5IBUG 4OZGA 3IDJA 2Q2LA 1EHAA 4YS4A 4N86A 5EU3B 5B7EA 4IRSA 5EOQL 2HLFD 4QHMB 2DLFH 5ES4B 4GKLA 2C7FA 2ENPA 3QISA 5ITFB 3OTTA 2CNZA 1INEL 4PRID 5BQDA 2JB6B 4Y9EA 1P7KB 2Z31C 1J05B 4R97C 3T4YA 1OAZH 1CFSB 3CSPA 3WHXB 3G04A 5G4OA 1QNZL 2WBWB 3CTTA 4PBWD 3FU6A 1M05B 3MRKB 1JGVH 1ZS2A 1KULA 3PJSA 4M56A 1OSPL 3HI5H 4IRJC 3IT8D 4Y5YB 5GISL 1W0YT 3GXIA 3WE6A 5HPMB 1A6VH 2DV6A 4KY1H 4ODHH 4EDWH 3DVNB 4WU5A 4FHJA 2ADYA 1R5VA 3TESA 4O2EB 5T33L 1VESA 3AU0A 4JANA 5GJSL 1E6JL 1MREH 2DL2A 5G4NA 4AEEA 2BJMH 4PIBA 3U4BH 5CZRA 5DHXB 1P5VA 2Y4SA 2WINA 1MWOA 2FE0A 5B7FA 1JXFA 1HHGA 2GSGA 4HJIA 4N2EA 2NT0A 2ZXGA 2HFTA 4JG1L 5ID0B 1TQTA 1OCCB 4ZUVB 2R4SH 1VFAA 4PJDE 1B0GA 3HRZB 3VNYA 2ED7A 1K2DB 3RL2B 2XV6B 4NDMB 4FEIA 4NEHB 1BIHA 4D0DA 2CO6B 1FC2D 1EHLL 2I07A 3LRLA 1CD1A 2LU3A 3I6GB 1D9KD 4PP2B 4BBWA 1KUMA 2BVQA 2A5UA 3BUYA 4I0CC 5FO7B 1GAFH 1EA9C 5HHMB 3D12B 4OLXH 5I16A 2R0LH 1UCBH 4IOSA 2GVYA 1GGIL 3MRBB 3T0XA 3V5DB 4P4KB 3VA6A 2J88L 3NCBB 5FA4B 3U0PA 3PHOB 2AJXH 3GIVB 3WJJA 1M1XA 3L1EA 4Y8DC 3LEVH 3BW9B 2EC9U 3O6KL 1MJJB 2XWBA 4E41E 3QXDB 5E56A 4GW4B 4NC2B 1SOKA 3HC4L 3CZGA 5JQHC 4NZ8A 1MPAL 2ZG3A 4ZO7A 2AK1L 5BS0A 1TVHA 1KV7A 4XO4A 1KIPA 3D25B 1CE1L 3GIZH 5B7MA 3CNKA 2X1XR 4MMXA 3WY2A 1OTTD