5JOPE

Crystal structure of anti-glycan antibody fab14.22 in complex with streptococcus pneumoniae serotype 14 tetrasaccharide at 1.75 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
208
Chain Sequence
b'EVQLQQSGPELIKPGASVKMSCEASGYIFTEYYIHWVKQIQGRSLEWIGYVHPKTGDVIYNQNFRGKATLTVNRSSNTAYMELHSLTSEDSAVYYCARWDSWGQGTTLTVSSAKTTPPSVYPLAPGTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 14.22 light chain
molecule tags Immune system
source organism Mus musculus
publication title T cells control the generation of nanomolar-affinity anti-glycan antibodies.
pubmed doi rcsb
total genus 41
structure length 208
sequence length 211
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jopE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jopE02
1P53A 1NLBH 4JRYB 1NEZG 3J7HA 2L4OA 3T0EC 3GMRB 3OHXB 5MP6H 4QRRA 4CN4A 4QGYA 2Y7QA 2FJHB 2YD2A 4OLXL 1VFAB 5EO9B 3VFUA 3T3ME 3GHBL 1NBQA 3VD3A 4YDVA 4I2XA 2MCPL 2CRZA 3ET9F 3MGTB 3QUXB 4MDIB 1T7WA 1P7QD 5EU3B 3TA3D 1RJCA 3DSNA 3P0YL 5DT1L 5F1SA 1TJHH 1CLZL 2VLRE 3GRWH 1EFXA 3QZWA 1T1ZB 4QXUL 2G5BB 2PR4L 2X4QB 4S1QL 2A38A 3BN9C 3CX2A 2XN9D 4P46B 4J8RA 2I9LB 4NM8H 1V3LA 5C3LD 1SBSH 4XCYA 5CMAB 2EXWC 3O9WD 4X6FA 1LE9A 3OX8B 4X7TA 3O11B 3V7AG 1JGEA 3DSFH 5ICXA 1WC7A 3VRJA 1XGUA 4YHYB 2WP3T 3QQ9C 5IP4A 3HI5H 1KJVA 4LSSL 1QQDA 4Y4HD 5D7JA 3KXFE 5GGRY 4ETQB 5ICYB 3SDCB 1P7HL 2QADD 5GS3A 3SCMD 3SGKA 1G9MH 2XQBH 4M8QB 5C2BH 2R1YB 4CMMB 2F54E 1OF2A 3KYMB 4BKLA 4HWZA 2PYEE 2XPGB 5JDSB 3MGOB 3G6JF 3MRJB 3QDGA 3MBEC 3QDMD 4FN0A 2HFGL 2WWMC 3IU4H 1IAIM 4DK6A 4Q9QH 4PJIA 2C1PA 4LRIA 4ZAKA 2D31B 1U8IA 3MRPA 5EOQL 1K3IA 1UYWH 3H9SE 3AS0A 3BE1L 3G04A 2ATKB 2B2XH 5L0QB 1QBAA 1IGTA 4LKXA 4XNMA 3MBEA 3CSYB 5DHXB 4A2LA 1EAPB 1XR8B 3D5OF 1F58L 4JFHD 4BSWA 2R0LH 4GUPA 4JRWA 4U3HA 2PXYB 4ZFGH 3DBXA 5EA0H 1G1YA 5JQ6H 5GGVL 3EO9L 2YR3A 3MNWB 2X05A 3KPSD 2KBGA 4ODXB 3R8QA 43C9A 4AQOA 4G6JH 2X10A 3MUHL 3GSNB 2IQ9H 1F2XK 2FDBP 3JVGA 5HI3D 3PP4H 2CKBB 3GNMH 4U2YA 5TFSL 5T1DL 3U9UA 1MFDL 3T2NL 2AI0H 1Y0LB 2MCG1 3ARFB 4ORGA 4C4KO 1CDIA 2W9EL 2Z31C 4MD4B 1KSRA 3T0DA 2BHUA 2ZG1A 5I19L 3TO2B 2NXZB 3MCKA 1I1RA 3RX8A 4MLIA 1VSCA 4TTDD 3OPZL 3DTXB 2YUZA 4AENB 4EI6A 5IEKA 5JUEH 4PY8J 1A6WL 4HEME 3GJEB 3HUJF 4Q9RL 1BLNA 4ODVH 3O6LL 3BP4B 3CPLB 1I7TA 1MI5E 2OZ4H 4LIQL 4YLQT 3ARFA 2NY1C 4I13B 1BD2D 1YQVH 5GJSL 2AV7A 4PREA 3DVNA 1FHGA 4LU5H 1ZLVH 2E9BA 5GJTH 4C56B 2GJ6D 4MCZA 1FSKB 4QRPA 5IWLA 1TIUA 5H2BB 2D7PA 1RFDH 4P59L 5HHNA 5D1QD 3VD5A 3BUYA 4XNZB 3E2HB 4BZ2L 3FN9A 2HT3D 1F3JB 1F97A 5LG1A 2Y07H 1RZGA 3QUZB 4XVJL 5IMKB 1K85A 3GIZL 2YPVL 2Y6SC 3B5TA 3P0YH 3QWQB 3H7BB 4B50A 4LCYA 5KSBA 2R2HB 5KVEH 4M4RA 1QPPA 3IJYB 4LQFL 5KW9L 5IVXA 3DURB 4S1QH 1KTDA 3ESVF 3DGGB 2AK1H 4KRNA 1J1PH 4OCRH 5GGUA 1CI5A 1YPZA 1VGEL 1CR9L 4RAVB 1EGJH 1LP9B 2VL5B 1DLFL 2BJMH 4G42B 3BP6A 1XMWA 2DI9A 3VXPB 2O5ZL 4UZGA 3SDAB 2DL2A 4OLZL 2B8OT 2HT4D 2AABL 4KVNL 4N9OB 3DGGA 3MSPA 5D2LE 4F7TA 1TVDA 1TPXB 4HXAH 3EDKA 3BWUC 1R3IL 1HCFX 1NGYB 3DETD 1P7QB 5IESL 4GRMB 3F5WA 1WCBB 1QG3A 4TNWF 3F7QA 1INQB 3A6OA 4MHHI 1ADQA 4U1SB 5DUML 1LP9A 3V5HA 1IQWL 2AJYL 3O8XD 1OQOA 4OCXL 5C8JA 1FLRH 1OL0A 3HG1E 4QXTA 4G6ML 2EZ0D 5T1LA 3QCUH 1QBLH 4UT6L 4M6OL 5ADOL 1JNNL 3OQ3B 1DQML 1ITCA 5DURB 4V1DE 5EB9A 4JN2A 4LGRB 2XT1B 4HIJB 2AQ2A 1U3HA 4OZFA 1C08A 4ZFOB 3HUJA 5J1AA 4UIKL 1T66D 1U6AH 3G08B 2ZG2A 1BFOA 5C0RH 1G6RB 1OGAB 1FVCA 1MIML 4U1IA 2NY0C 3KJ4B 1D7FA 1FNAA 4IMKC 3RUGA 5BQ7A 3U2SA 2VAAB 3P3YA 3G5XA 4H26A 4XPHH 2YPKB 1SVZA 3PV7A 5EU5A 2W65A 4K7PH 2ZCHL 3MZTA 1Q9KA 4Z18A 5EO0A 2LVCA 2VJXA 5IW1A 1VACB 4OLUL 1BM3L 1NEZB 3PQYA 4JFDD 5C0BA 5J6GA 5HI4D 4GRWB 1BF2A 4J1UA 5F1IA 4TSCH 5KAQF 2JIXB 2B1HH 3MROA 4OD3H 1WWCA 4S11A 3U0PB 3V7AE 3HE6A 2NY7H 3RY6A 1RZ8A 1UB6A 4GMSL 6FABH 4YDKL 4HS8H 1AQDB 3RIAK 4PJ7A 2Z31A 1JZ4A 1JBJA 3BX7C 3Q5TA 2EDWA 5C0AA 1BFVL 4JPWH 4D0BB 1S8DA 4FFYH 3U36A 2VKXA 2Y36L 4M7KL 4QWWC 4Z7NF 1S5IH 4QF1A 5IB3A 5EZIH 4ZXBA 2DJUA 1RY7B 4OZGF 3ZDYF 4YZFE 5I9QC 4OLYH 3ROOB 3T2OA 4JE4B 3X3GH 5HGHB 5FM8A 3U6RA 3AC0A 3OF6A 3MLRH 4KI1A 3C60A 4KI5C 1PVHA 4HG4K 3L3DB 4NGHL 4L4VD 4PLJC 3BD4A 1LO2H 3B6SA 1FDLL 2A73B 3SDCA 1T83A 3QAZC 4MJIE 4RMTA 1ZLVK 3GSUA 3R4DA 4LVOC 4AEFA 1J8HE 1NKOA 3CFJB 5FYKL 3TBTB 5DJ8A 3K4DA 5J56B 3D0VB 4UOJA 4PJCF 2P5WA 3UPAA 3R1GL 3MLXH 5DRXA 1T1XA 3DX7A 3IT8D 2CDFA 2Z92B 4FQXA 4NKOB 2YZ1A 4NM4H 2IBBA 5EUOB 4RNRA 2F8VA 3FO0H 4U6XB 3IGAA 2VZUA 4RGNB 3EDFA 1GGCL 3GHEH 4F9PA 1KTDB 1PG7H 5GZOD 3LKQB 4NC1C 4HH9B 3U7WH 1FGNL 3AS2A 3B2UC 3KLAA 2V2XA 3ZMRA 1BP3B 1LDPL 4JFQA 5KJRH 2HH0H 5H35A 3KPPB 3TN0C 2XZAL 4HC1L 4KRPB 4M43H 1IZJA 1OP9A 3WLWD 4NJAL 4LSRL 4PJ8B 1JPGB 3THMH 4X5XA 2YXMA 3PHOA 1PSKH 4FQ2L 4J3XA 5KOMC 4QCIB 1GRWA 2W0PA 3BPLB 3OKLB 4Y5XB 1HHHA 2DDQL 3VFNB 3WKML 5I71B 5BVPH 4PJGE 3JUYA 1NMBL 5A2JH 1QNZH 2KZ1B 3VA6A 2VOTA 5FM5O 4PRID 4XWOC 1ZHKB 3UZEA 3BDXA 1LD9B 3KLAB 5FECA 5LQBH 3TF7C 1RMFL 5HSFA 1HH6A 5DJXA 3U4BL 2Z35B 4OFDA 2WBJA 5BS0B 4JHAH 2YSSA 3VFGH 4DGIL 3L3IA 1UENA 2FIRT 2R1WA 3DUHA 3MXVL 4NYLB 3NFPB 1K2DA 5C08D 3HNVH 1T5XB 1A6TB 3PE9A 5D7JD 4F9LA 5D7LB 1F6LL 1EBAA 4K3DL 3O6MH 5E2UL 2QQLH 5GZND 3QRGL 4K3JH 3L6FA 3RWDA 1TJIL 1I9EA 1KCVH 3NFPA 3WNMA 2G75B 5MEPB 2DKMA 1NGWA 5FHAH 3VFTA 3X3FL 3A6CL 4NC1E 2CR3A 1AKJB 1S7TB 5I1HL 1MFBL 1DUZA 1JV5A 3HE7D 5F3BA 2X41A 1UZ6F 1FG2B 4IOIB 1ORSA 1EFXD 4UOW1 1N6VA 1MJJB 4PD4J 3DUUB 4OKVA 5MEPA 1J87A 5A16A 3FO9B 1JTPA 5LWYL 4TULL 1IGIL 3HE7B 5I76A 4RIRA 2E8ZA 5EZIL 1JYXA 1PLGH 4U1NB 3GM0A 4AG4L 3IKCA 4FTVA 1A5FH 1SY6H 1FORH 3D25B 5H35B 5LCVH 1S8DB 4LPCA 2YC1A 4KKCC 4OZHF 2RGSA 5CGYC 5IM7B 1UJ3A 2XQYK 1CGSL 2AK1L 4QHMA 3MOAH 1ACYH 5EZJA 4R96A 3BT2H 1NLDL 3JV4A 1JZ8A 4LLYA 4JJ5B 1FVEB 1QRNE 3BPCA 4K7FB 2HVJB 2G60H 3VGGA 4U31A 3MJ9L 3O4LE 1PG7W 1NUNB 3GSOA 4Z7QE 2NY6C 1J0YA 3RBSA 1FFRA 1NAMH 2BC4B 1PZ5A 4JO4H 2P8MB 1JZ2A 2DLHA 1A7OL 3M17A 1NCUA 3UYRH 3D25A 3V0WL 4I9WE 5EIVA 3EYQC 1GGIL 4JG0L 5B8CB 1OAXH 4JFEA 4XVSL 1G0XA 4UV4L 1UZ8B 1ZVSA 1FZOA 1B9ZA 3HB3D 4LIQE 2ARJB 2K7PA 5FKAB 4LFHD 2DN7A 2VXSH 4JVUA 1QA9A 1A6ZA 2Z4QB 1A4JA 4OF8A 2IJ0C 3RNKB 2QR0A 4L3CA 4ONGH 1P69B 3EOAB 5C07B 4YHNB 1QVOB 3S37H 4EI5C 2X1PA 2IBZY 5DD6B 1PY9A 1NUDA 3EYOB 5JR1H 3VGAC 3MJ8B 1FV1A 5IV2B 3MBXL 5D5MB 3TN0A 1W0YT 4P23C 4DZBB 3TBSB 4UAOC 5KVGL 4JFDB 4EN3B 5IFHL 3BHBA 4Q6YA 4GBXD 3L3JB 4JFFD 3BYTA 1PQZB 1GOFA 2DKUA 2EDNA 2AGJL 2OJEB 3WNLA 4FQIH 4IIQA 4R2GC 1KEMH 2QQNH 2VDQH 2KKQA 3NA9H 1FNEA 2WBJD 3CSBA 3DX9B 3FRPA 1U8LA 3DX6B 4ZNEE 4XPHL 1FVDA 4J1UB 5F1IB 4GMTH 1RZ7H 4L4JA 5I8OL 2OK0L 2GSGB 3MLSH 2VXVL 4HWBH 1NMCC 3O6LH 2COQA 3WEXB 4MX7A 3RWHA 1FZJB 3OXRA 3SKOA 4RRPG 3SHSA 3OG4B 4DUVA 5C71A 2BY3A 4JDTH 3PDGA 1AO7E 4D3CH 5KZCB 4MXWL 4XH2A 4X5WB 2AJ3A 2AJZB 3NCJL 1N6QL 2WWMD 3K0WA 1HILB 2OBGA 4KROD 5ICZB 1T21B 2X4TB 5HVFB 2FX7L 4HBCH 5IB3B 4LKCB 5J6HB 3QPQD 4UT9L 4FQXC 1K6QL 5EORL 5IMKA 2BHYA 3SDXE 5I73C 1FNSH 2F54A 1G0YR 2HFEB 4OQTA 4HIJA 4HIIA 4NNXA 1HXYA 1X4XA 1AXTH 1C1EL 4F15B 3KNBA 4FQJH 3FB5A 4WU7B 3SCMB 3C5ZC 3UTQA 4PY8I 1FL6A 3NABL 1ETZA 1FO0H 2DMBA 2DQHH 3KWWB 3NTCL 3LKSB 1PJ9A 4LPTA 3BH9B 2BMKA 3WDHA 1FJ1A 2P5WD 3DV4B 1A3LH 3RZCB 1SBSL 1J1OH 4DZ8A 2ZP0T 3T65A 2MSPA 1T0NB 1OGAD 4HWUA 1EH9A 5K9OA 5IBTH 3F62A 3FFCB 4HKZA 2UVEA 1TZIB 2OJZL 3MA7B 4H5SB 4GLRH 3MRDA 4F2MA 1EUUA 1TZHA 2AP2A 4N0CC 5C0FA 1X9QA 1FL6B 4CVUA 5D5MA 3TN0B 2R0ZL 2VDOL 1RZJL 5F6HJ 5CCKL 2SEBA 4L4VE 2VDLH 3FFCD 1A21A 1KFAL 4XBPB 4LBEB 5ISZA 4Q2ZA 1FJ1B 1WTLA 2CMRH 3IDYB 2HWZH 4ENED 3QQ3B 4OQ1A 2A83A 3UJIL 1OTUD 2AK4B 5GGVH 5M95B 1MFCL 2F15A 1MVUA 3ME0A 3JTTA 1Z5LA 4WWKD 3UBXA 1W72H 1UH4A 4PJ9A 3ARDC 1RHHA 4D94A 3NIFF 5AUMB 3NZ8B 3Q6FB 1CT8A 1YEJL 1MJ7L 4EI5D 2D9CA 3W81A 4PJ9C 5T1DH 3IDIB 3T1FA 4D8PA 1WBXB 5DJ0A 4M3KB 1BBJB 4RAUB 4L9DA 3BIBX 4TSAH 5GPRA 4OJFL 3CU1A 5ICYA 3MQIA 5C2UB 3BISA 5HYFA 5F7KC 1OAUH 2C1PB 2HLAA 4JFEE 4L8BA 4XBEH 5CIPH 1RUPH 4NO2B 2R2BB 5TDPA 4M4PA 3FQRB 2OTWB 4JAMA 1OM3H 1RZKL 3ZT6A 1FIGL 4WI6A 4EI5A 4DKDC 3QFJD 1JVKA 5AYQA 3LQZB 2VLMD 1ACZA 5IVXF 4OLUH 1ZOXA 5DA0B 4BFIA 2VLRA 5E8EB 1C7SA 1RHHB 2PYED 3HA0A 4PJ9D 5KSAB 4IBLT 2B1HL 3ZE1E 4Z95H 3VXRE 2MPAH 4JN2B 3EYUL 1CE1L 3WCYA 3S36L 6FABL 3MA9H 3OZ9H 3AU1B 1P4IH 4B53A 2F5AL 4D3CL 2E5EA 1XF5B 1PQZA 4ZOCA 4Q6IB 4K3EH 3PL6D 4KQ3L 4MNQA 1YYML 1YY9D 1NSNH 5ISZD 3QFDB 2D9QB 4TOYH 4J3TA 3TZVA 1A1MB 1SMAA 2XKNB 1OP3H 1TJHL 2BOBA 4KZEL 1J0KA 2ZUWA 3LQZA 3NFNB 5JHLH 1U8HB 1AXTL 3QHTC 4X6EA 4KK5D 4BSVA 4KV5E 4Z7VA 1E28A 4YO0B 4POYA 1ADQL 3PWPD 4NUGL 2V5MA 2SEBB 4QHNA 3ARQA 2EDKA 4GQPH 4M8QA 3DMMA 1UM6H 1AFVL 1YUHA 5DJZB 4G6FD 2ILLA 1I1FA 2N1KA 4FXLA 2DLFH 1IC1A 3TO2A 2XZQH 1UEMA 4HWZB 4QNPF 4S1RH 4V1DB 4YE4L 4X80H 4M9OA 4YFDB 1B0WA 1BZQK 3FOMB 5KANG 1NGQL 1I7TB 5E99H 3QULA 5K9KB 3GBMH 1MRCL 3H42L 1XGRB 4BZ1H 4MQ7A 5C7XL 4WI7A 1W0VB 1R3IH 4PJBE 4N90D 3BKJL 2QSCL 4LLAA 5CS7A 5DYOA 2OTPA 1MCOH 4NQXB 3KWWA 2XY2A 5D7KD 1MHCA 5HDQH 3T3PE 2BVYA 4JFYA 2YN3A 4RISL 3QXAA 1E6OH 4QTHB 1ORSB 3VXMD 4ONHA 3MV8E 3R8BB 3CH8A 2GJ6A 2EH8H 4M6OH 5ADOH 3QI9B 2W9DL 4ZG1A 4O4YL 1X5AA 2V6HA 1FLRL 3KPQA 1J05B 5DRNB 1P4LA 4AZ8A 5INCB 3SDDA 5AD0A 2BSRA 1CLOL 4S1DD 4G6FB 4H0HB 3I2CL 3EGSA 2VLKE 5EBMB 1NMAL 2CXGA 3V52H 3DROB 1SYSA 3TVMC 1KCSH 3N50A 4JJ5A 4HH9A 3VFWB 4POZC 4R3SA 5TQ2L 3W0WE 3V4PH 2Z91A 4F7PB 1O7VA 1J0HA 5D1ZD 4U6XA 3PNWA 3KJ6H 3ZKMC 1F90L 3D9AL 2Y7QB 3MLYH 2RB8A 4JCLA 4N0RA 1TETL 4PJAF 3ULUC 3U4AA 3GI8L 4RGND 1S9XA 3CFEA 5B38B 3TN0D 3DXAA 1CYGA 3U1SH 4PJEE 3EYFA 4EBQH 4N8PA 3IU3A 4L3ED 5C07E 5TH2B 1VEMA 5I6XB 1R5IA 5DSCB 4N5ED 2X70A 3AFLA 1KCKA 1WBYB 4PJ5E 3TBSA 2NXZC 1FZMB 4MJ5A 4JM2B 5FAAA 2HJKA 2OYPA 2EC9T 1A47A 5LXGH 2R4RL 5ADPL 4JFZL 1T7YA 1E6JH 5LGHL 3LV3B 1TCRA 1YPZE 4NKQB 5HY9A 5I8CB 3EZ8A 1JYNA 1KGCE 3MNWA 5HGAB 1RZIA 4A6YA 2HAZA 1X7QB 1HSAB 5D9SB 2HT2D 1C5CH 1BVKB 4AJ0A 3DRTA 4JFOA 2Y5EA 1WBYA 4OGXH 5L6YL 4ALAH 1MF2H 5KSBE 3SDYL 5F7DB 4JKLA 4G6KL 4MMZC 5F9OH 3EYFB 2C7UA 2YPLB 4RFEB 2F74A 2V5RA 4TRPL 5D7IF 2CIKB 4ZYKA 3BW9B 4WW1A 1NEZA 3PQYB 5J6GB 4J7RA 4RA3A 1BZ9A 3K80A 1AO7B 1KEGH 1JPST 3WFEH 5CP7B 1OF2B 5CP3H 3MOAL 4HUWB 4M7ZB 4PYGA 1EGJL 3VFMB 1XF4B 4PJGB 4OFVA 4O2FB 3B83A 1MCEA 5EU4A 1INDH 4FQQA 3JZ7A 4M9PA 3EDEA 3R1GH 2O93L 5J12B 4I18B 5FUZH 5AD0B 3V5KA 5DC0A 3CH1A 5TE6L 4Y4KA 4GXVH 1I1FB 4M5ZL 2AKRB 2YPLE 4NQDD 2FHCA 2VLME 4XPTL 5AZ2L 4KJWD 3VG9C 1MHPL 3ZYIA 3N1FC 2AJVH 2VDLL 4UILH 5GISH 1LDPH 5KJRL 4XX1E 1DBKH 1YUHB 4IOIA 1CCZA 3L5XL 3PDOB 1QD0A 1ZANH 5CJXA 4H8WC 5DZLA 4JHBA 1QZ1A 3WKMH 3BDYH 3LKOB 4DKEH 1FAIL 3K7UA 4HGWA 2KDGA 4LSDA 15C8H 3TC9A 1QNZL 4O2EB 3PWPB 2O26U 1B0GA 2R29H 4FA8A 3KPOA 4ZMAT 4LVEA 2OR9L 2DQJH 4U3CA 4V1DD 3CFJA 3TBTA 3ILQD 4W81A 4KKLD 1VADB 3HR6A 5FYLD 1HE7A 4HIHB 3KPMB 4UIMB 3VXNA 3SDAA 1EJOH 2VDNH 2A0LD 4CW1A 3ZKSD 3V4PL 3QUYB 5CLTA 3RWIB 5D6CA 4F37F 4GT7A 3BQUA 1WBZB 1ZHBB 4X6DE 1CU4H 2ARJQ 1BHGA 4M43L 1L7TL 3RNQB 3PGCB 3WNKA 3FQWB 1S9WB 3VXOA 4G8EB 1JZ3A 4AIZA 4DN4L 4RGMB 2EH7H 5DQ9B 3L5HA 3CXHK 1T7ZA 1UACH 2R0LL 5E8NB 4YNYA 5DMIL 5F6HI 1OGTB 4N8VG 2H9GA 4BUGA 4P99A 4RAUA 3C2AH 5J1AB 1KV3A 1K6QH 2C26A 5EORH 4AH2A 3ES6B 2ICEA 3WSQL 3QUYC 1EJ6A 1UXWB 1A9EB 1EO8H 3GI9H 2CK0H 2X5PA 2P7TA 4FXGA 1R3HA 3HUJB 1A8JH 4WVRA 5KVDL 2EIBA 3ROLA 1YEHL 3MLWH 3CFEB 5B38A 5E8NA 3RAJH 3L9RB 1CXKA 4UDTB 5E4IA 1AHWA 1T1YA 1XIWB 4X6CA 1Q9KB 1AC0A 3HI6L 5IFJB 3N1MC 4LCWA 3AREB 3NTCH 5FYLH 3WMSA 2HG5B 3U2SB 4JB9H 1QHPA 4NRXA 1ZHNA 1W0WB 1Q9OB 5CILH 2OK0H 4MHHG 4JY4A 4LHQB 3MA7A 5B21A 3T4AB 1CS6A 1W2KT 4E41D 2R56H 3IFPB 3FT3A 3H3KA 3KPRB 1OD9A 2PO6B 4H0IA 4L4TB 1U92B 1IGJA 2H41A 3GEWB 2IFFH 4G9FD 3QRFM 3GKWH 3LD8C 1CFNA 1W0WA 4UDUB 5D7LD 1O7SA 5SWZE 2YHGA 2CPCA 4QT5A 1X5HA 2A83B 2MWCA 4LSVL 5LVEA 4G6AD 4HDIA 2XKNA 4UV4H 3S8WA 2AJYH 3RQ3A 1I4FA 1UCTA 3OKNB 4L3AA 1HWHB 3FB5B 1RZKC 3P4LA 2BCKB 4GLRI 4FG6D 3OKKB 2V5SA 3QCUL 1AGFB 3VH8A 1CDBA 1F6FB 5I1DA 4NN7B 1RK1A 2AQ3A 3SJVE 2HFFA 3SO5A 5FGCE 2JJSA 1XGYL 2NXYD 1J1PL 3OXSA 4Q0XH 4O9HL 4OLEA 5JW3L 3BZ4A 4YHKH 4NPYA 3PQYD 3UXFA 1F45A 4FQXB 4NKOA 2Q8AL 4KI5E 4M5YH 5IB5A 3IXAA 3MRCA 4IOSD 1WIOA 2AABH 3SE9L 2JJSC 5BRZA 3KPSE 1ZEAH 4WNQA 2Y5TA 4PTUB 4N90E 4NWUL 3SJVA 5L9DH 5L8KB 5FXCH 5B39A 4HUUB 1QYGL 1D9KA 3O2DH 5GHWH 4G42A 4P5TD 1HYSD 1HHIB 3DURA 1JRHH 1WTGT 2VZTA 2YRPA 4QRTB 5B39G 1DTUA 5GGUB 3UTTE 5JIIA 4C54A 3BD5A 4PB0H 5FGCB 4HX1B 4R7DB 1T1YB 1XIWA 5TDOA 5KN5A 1KC5H 4R90H 4PJAB 1AE6H 2BVOB 5GGSY 3AMKA 3BGFC 2AERT 4R8WH 2DB8A 3S36H 3LB6C 4ZUTA 4X98A 5C6WH 3WD5H 5KANI 2MKLC 3WNPA 4PP1D 5DQJB 3O8XA 3HMXH 4JQVC 1K4DB 3LKNA 5ANME 5KOVC 4X0KA 4IRZH 3MLZL 2Q76B 5DUBA 4KHTH 3B9KA 4DOHE 3EOTL 1E4KC 4GW4A 4U1GC 5D2NB 3CFCL 2JCCE 2J8UA 3O8XC 1AC6A 4Z77B 5EU7E 5E5RB 1WT5C 3FQTA 1K5NB 3V5HB 2CK0L 4NZRH 1WAAE 3MBEB 5H37H 2W38A 2DQCH 2VR5A 1AGCB 1S9WA 1LK3L 2W65B 1Q0XL 5EO1A 4OJFH 3TV3L 1Q72L 2VDPH 3GBNH 4BSWB 1QFWL 1Y6NR 1T04B 2ED7A 4RGNC 2R1XA 1Z3GH 2CIIA 3SGKC 3VGHA 1SQ2N 3FKUS 5K9OB 2WQRA 3VXSD 1DVFD 4LSTL 3LVEA 1YECL 1G1CA 3WS3B 2B5IC 5AZEH 3GUTB 4MAYB 1MEXL 5ID0B 5T3XE 1YMME 4HKBB 4DEPB 4XBGB 3X3FH 1T0PB 1YPZB 5CJQH 5I30H 1AXSA 2R23A 5M94B 2FO4A 9CGTA 1LDSA 1P6AB 2XY1A 3LRSA 1JNLH 4TVPL 3FN3A 1MJUH 5T1KD 1NCDL 5JW4N 2R0ZH 1JJUA 1SEQH 1LO5A 5FUOL 4ZS7H 1KN2L 4F9PC 1JI1A 3ARUA 4OCLC 4KDVA 5HDOA 1P6FA 2QR0B 4L3CB 3KHQA 4PRHD 3U0WL 2UZIH 4XPTH 5AZ2H 5T3XL 2B1AH 5F6IB 2V2TA 3QQNA 1A7PH 2IGFL 1QRNA 3MJ9A 1OWRM 1ES0B 2M1KA 3IFNH 5GRJH 2F53B 4NHCL 3KNBB 3H0TB 3HMXA 4NFCA 1XR9B 1XF3B 2BXZA 1PYWB 4Z7WA 2IPKB 1GJIA 4GRLA 2EDJA 4I0PD 4PREB 2CRIA 1XCQB 3FT3B 3KPRA 4JDVB 1QFUL 3V6ZA 4XZUB 5IVOA 4MDIA 1DL7H 2G2RB 3P0GB 4WENB 3X11A 5FIEA 1Q9LB 2GTZB 2NY4B 5FYJH 3TBYA 2VH5H 1CLYH 1MPAH 3JV4B 1AO7D 3TFKD 2C3VB 2W60B 5C0EA 1LO3H 3BPCB 3F58H 1PG7L 1KB9J 3DI2B 1KIRA 2FO1A 2AGJH 5DLML 3O2DA 4C56D 3VFOB 3VCLA 1Y0LA 3C08L 5IHUL 4X6BB 3EO0A 4KMQA 3RWCA 5JMOC 5GHWL 1HZHL 4UBDC 5BJTB 1ZLWK 1BJMA 4EDWL 5FB8A 1A7QH 1BQHA 2FATH 3MLSL 4L8DA 3FQXB 1C5DB 2CMRL 4EOWH 3ARBA 3X13A 5EPMB 5C0DA 2Q8BH 3P77A 2EYRB 1PFCA 2EO1A 3MJ7A 3WFHA 1YDPA 5EU3A 1NFKA 3OSKA 1A9EA 3EYOA 3LEXB 2B4CH 3OAUL 5FKAA 1NMBH 4JFZH 1UVQA 3L1OH 4N8CL 5HYJA 3WD5L 3DMMC 5I75B 1U95A 1P4LB 4KHXH 4XNMB 5C0RL 4FS0A 3X13B 4AL8L 2LU4A 4DGVL 1TVHA 1Q94B 4M1CC 3GK8H 3MRPB 2Z31B 4MWFB 4W70A 3QI9C 2JJVA 1EV2E 5E9DB 2LTQC 1J11A 1LEIA 3EOTH 3QIBC 2CQVA 4FXKB 3N1GC 4HHAA 1MAJA 1MWAA 4F80A 1S9YB 3VXRD 1F4WH 1KXTB 3MOBH 4PJGA 5CUSL 3WS6A 3PNWB 4JPIB 1Q72H 2YBRA 1FNHA 3QUYA 1T89A 1G6VK 2YSSB 5A3ID 1RQ5A 1WLHA 3C6LD 1NLDH 3MGAA 3SBWC 3B9KC 4DN3L 4X6FB 2VKWA 4Q9CA 3FFDA 4Y4HC 1NGQH 3O11A 5FECB 2H6PB 5JMRA 3CVIL 1EHXA 3N9GL 2ERJC 1AXIB 1S9YA 1U8OA 2ITDB 3RVXD 5I17A 4X7FC 2F5BH 3C6LB 5KS9A 4XP1H 2CJUL 1FG9C 4P3CH 4RMVA 1DBML 4KK6C 1AKJD 3O2VH 4YWGL 4JZOB 3T0EA 3VRIA 2BNRB 3GSNH 4JFDE 2IWGA 1MQKL 3LH2L 3QIUA 4KDTA 2GUOA 2W0LA 2YUXA 4YHYC 4HWNA 4DKFH 2PYEB 4XMKH 4U6TA 2QKIA 3H9HA 1D5IL 3ILPB 5DJDB 2L7JA 3LKOA 4KDWA 1CQYA 5HHPB 1QSFD 4Z7VB 1KTLA 2A6IA 1U8IB 4XVSH 1CXLA 5E9DD 5DEFB 1HXMA 3H9SB 4LF3B 1KLUB 5IMLA 3D39B 2XFXA 1L0XA 3JSSA 2VXUH 3LB6D 2EXYC 3VRIB 4AG4H 3DPBA 4GKOA 2KQMA 1NGWB 3VWJC 1YMHA 1UWEL 3MV7A 3FQNA 3MV01 3BVNB 2FH6A 3UTPE 1I9IH 1VFAA 3UTSB 1H3XA 1CLOH 1RJYB 3O41A 1T0MA 5D70H 5DFVC 3LQMA 3LS5L 1MRFL 4P9HL 3ZTJH 4WFHD 1WZLA 3HAEA 4OZ4A 5JNYB 2VSCA 1NAML 4LLVA 4JRXD 1RZJC 3V6OE 4Z7WE 1YNKH 3MV7B 4O51A 3V9FA 1S9XB 2FGWL 1XF2B 1BEYH 1YJDH 1VFBB 2VDRH 3I3EA 2DJSA 1NGPL 2XN9E 1RUPL 4OZIE 1BMGA 2EDOA 4MWFA 4KMTL 3KVQA 2FZ3A 3M1BA 1XCQA 4UV7L 5DHVB 4OCXH 4WO4C 5H8DA 4ISVB 2X1WL 4OV5A 1VEPA 2GTWB 2QLVB 5EWIH 5DFTA 3D2UA 1A7QL 1HOCB 3RX5A 4JO3L 4I77H 2QSVA 3PL6B 2DYPB 3U79A 3TYFB 3W0WA 2DLEA 1PX3A 3EDDA 2HVKB 5FO8A 4U1JB 2MFNA 1BOYA 3DX8B 4PJFF 5D71L 3QPQC 35C8L 4S10A 3WSQH 4C83B 5J0BA 3ARBB 4R4NC 43CAA 3O3EA 1F11B 2VL4A 4PJDF 4PJXA 4QRQB 2M8XA 3GMNB 1QSEE 1FIEA 1IFHH 4U33A 3GSXB 1K9TA 1TQCC 2PKDA 4DWHA 1JNHA 1G7MA 2F9BT 1SBBA 5CEZH 3HUJE 4XNXL 1OP3K 1WCQA 5TDOB 1G7LA 4XWGH 5E70A 5DZOA 2BDNL 3DXAB 1GCFA 3QIBB 1X4YA 1N7MH 1FYTD 3PG2A 1VPOH 1F3RB 4PG9B 1DQLL 3QUXD 1MCJA 2ADIB 4HV8B 5IGXH 2CO6B 1T6WA 1A22B 4LSTH 4PTTA 1JNJA 4XAWH 1EEQA 2HYMA 5IBTL 1A6VH 1DVFB 5E2VL 3E0GA 2R4SH 4LCUA 1FPTL 1YMHB 2CLVA 3LEVL 3O6FB 1NDMB 3MV11 4I0KA 3FB8A 4Z77A 2E7MA 3BGMA 1N2RB 5F1OB 4F33A 2IH1B 1U91A 4K9EC 4OV6F 1U8NA 3Q3GB 4O00A 4ODUA 4YHOL 1J05A 1RIHH 2ICWI 4X83A 1NL0L 1XR9A 2Y06H 1KULA 3GJFH 4PJEA 3HZKA 1HKFA 2QQKL 1HINH 2YD9A 5KVDH 1IL1B 3SDYH 1ED3A 1WCBA 3P40A 3UTTD 1OSPH 2MKWA 1Y6MR 2PTUA 2CH8A 1HIMH 1LO4H 1N59A 3QJHA 2NY5L 3EUUA 1FDLH 4K8RH 3GM8A 1W72L 4KK6D 5SWZD 1J86A 3C5SA 3QYCA 4RGOH 3MFGB 5E4EB 5HYSB 4X9GA 5E2TL 3HKFA 2DD8H 3CDGB 3SJVB 3BZDA 3W9DB 3GSRB 2BSSB 1M7DA 5TF1L 3ZKXB 3D69A 1KIPB 1WZ1H 1U92A 5FYJL 4HPOL 1LEKA 1QBML 1YEDA 1AIFB 3L3DA 2QQNL 1U3ZA 3LQAC 4ZO6A 3HRZB 3QEHB 4DZ8B 1KIQA 4LLYB 3FO1B 4LSQL 4OM1H 5EU6E 4MJ2A 2GAZB 1Q38A 3V8CA 1MWAH 3SE8L 1C5BH 3CNKA 1SY6A 5IM7A 4RMQA 5L2KD 3LDBC 4U6VL 4AENA 4JQXA 3ARGA 2EH8L 1TFHA 3BI9X 2XWTA 4Z8FH 1IC5L 4OCYH 5EDXA 3TNMA 3BMWA 1T80A 4CVZB 2PTVA 3OL2A 5BO1L 1RUQL 4Y16D 4YXKH 4IS6A 4HZLA 4Z0BH 5EWIL 1VB9A 1C7TA 5DK2B 3U30B 1CVRA 1KB5A 1FBIL 1RZ8B 1UB6B 1JRHI 2YEZB 1IT9L 3G5VB 3RU8L 4LMQE 3QEUA 5I1GH 5DO2D 4N8VA 4F3FB 2HTLD 4MCZB 1NJ9A 2FB4H 5MEQA 2IC2A 4M5YL 4DTGH 5D71H 3BO8B 5TQ2H 2I27N 3QQ4A 5DMJB 3TNMB 4K9EH 2WIMA 3FB8B 3W5MA 4PJFA 4HFUH 1MCBA 1T4KB 3IRZA 5CD3B 1F90H 1I8IB 5HHVL 1JWSB 3FQUB 5IW3A 1UCBH 4JQIH 4G6KH 5D6CB 3QWRA 5L9DL 4MXVE 5C0JA 4LPVA 5B4MC 4UIMA 5CSZA 4OF7A 4MAYC 5T33H 1CE6B 1WBXA 4K23H 1CFSA 3AB0B 4KTEH 5LGJB 3RWIA 4RWHA 1EEZA 4L4TD 4AIOA 4K8RC 3A6BL 1JFQH 3VFSA 1LE5A 3MMEA 2VL5A 3K8LA 4G3YL 2QEJA 1UKTA 3BIAX 5AG9A 1WSST 4HULB 4Y5VA 3DYMA 3L3JA 4Z7NE 1GPOL 4ODHH 3HCVB 5DWUL 1UXSA 2FYYB 3WV0A 1CD1A 4Z7OE 2PCPA 3NCEB 3E8UL 1RZFL 1OGTA 3T0BA 3QJFB 3VFPA 1ZLSH 3OWEA 1S7WB 3LMJH 4ALAL 4OCNC 4X7TB 3KXFA 2GT9B 3MYJA 3H7LA 2OI9C 4Y5XA 1TNNA 4PP1C 1H9VA 4EEEA 2FX9L 2FWOB 3HI6H 1W8NA 2X89A 1HCVA 3EIFA 1CGSH 3P4OA 1FG2A 4GAJL 4FOMA 2A9NL 5EC1A 3W5NA 2ZNXA 5ESVB 3K1DA 3O6FA 1UB5A 3BEWA 4M62L 2BFVH 4N0FA 5E7FA 3T4AA 3I2CH 5HPMA 4KPHH 3D87B 4RDQF 3MLUH 5E99L 2AV7B 3E2HC 4G9FB 3BUTA 5EO9A 3CFKB 3DETC 3VFUB 4HAFA 3RL1A 1IEBB 1KCSL 1WBZA 4BJLA 1AD9B 1R5VB 1I7ZB 4QRRB 1MCHA 1W8OA 2FX8L 2EDBA 4EXPX 1RIVL 1ED3B 3OR6A 1NFDA 1H3PH 4N9GA 1ETZB 3DARA 1OM3L 1FN4B 4XI5C 2VLJD 3C08H 4OTXL 5E8PB 3STLA 1GHFL 1X5YA 2YC1B 5JIHA 3WXVL 2EKSA 2Z8WC 3V79C 1E27A 4J8RB 1AI1H 4MQXD 4M93B 4Y1AA 2LABA 2LE9A 4UU9A 2F8OA 5KBNC 3UJJH 1MJ8L 4JY5L 1RZIB 5T5FH 5JLZA 1WT5A 2X4QA 1IQDA 3RDTD 5IVZB 1R3HB 2IEPA 5DEFA 3LDBB 5D5ME 1XFPA 3MRRB 4YC2C 3GSQB 4Z6AT 4KQ3H 5F9JA 3QEQA 4XP4H 4APQD 5ITBH 1WIUA 4UAOB 1KUMA 1JN6B 5HDBF 3GMMB 3IJHB 4JG1L 4N0UE 2R2CA 4ZO8A 4B5EA 5JHLL 4CN6A 5KVFL 2NX5D 1W72B 4QGTA 1C12B 1EJOL 4YHPA 3H3BC 3GMRA 4WTZG 2UZXB 3CVHL 1LO3L 3IFOA 2D31A 4XC3L 5F7UA 1CD0A 1YEKH 3W11C 2VXTL 4HIHA 1RUKL 1ZA6A 3UBXI 4XCFL 2FSEA 3KPMA 1GC1C 5IKCB 3L3OB 3L95A 2E9JA 1KN4L 4Y1AE 3JV6B 2I5YH 2FD6H 4QOKA 1FVEA 3VFWA 4DJMA 4NO0A 3T3MF 2WBJB 4GKNB 1ZSDB 3NFSH 5JUEL 4MAYD 2PETA 4LSUL 5IROA 5D4QA 3A6CH 4P5KB 4WI2A 1U8PA 5HXMA 3GMMA 1R5WB 3H3PH 3LKPB 3OJDB 5DI8A 4ONOA 4ZO7A 3RKDC 5DRXB 4XVUC 2J4WL 5HYJB 3UYPA 3OX8A 2Q1EA 3MLTB 1G6RA 1LO0L 5MI0C 3T04D 1FYTB 4PRNA 1HXMB 4OAWB 3GKZA 3FT4A 4P2OA 3VMPA 4ZOAA 3IXTA 1A1NA 4Y8DC 5H94A 5T3ZE 5GS0L 4U3XA 4PJ7F 5CIPB 3L5XH 2Q6WA 1IGFH 1NL0H 3UAJD 3QO0A 3MRKB 5CZKA 1KF9B 2HKFH 3LHPL 2EEAA 1U8MA 2R9HD 4X9FA 5ESQB 2XPGA 4H20H 1FO0B 4U7SA 3PV6B 2EEDA 4U1HA 5T3XD 4U2ZA 1ONQA 4A6YL 1NCBL 3BKYH 5DJYB 2R1YA 5SWQA 1A7RH 4BQ8A 2NTFB 1BREA 3OHXA 1YECH 3WFEL 2PTTA 1ZLUK 5J3HC 1QFUH 1WEJL 1UFUA 2R0WL 5DD0H 5JO5B 1Q9OA 4RX4D 4PIRF 1CICA 1FE8H 4R4BB 1NANI 4JKPL 4XPBH 3GMPB 4OBRA 1G9NC 3MREB 4OF3A 5DMGC 4X8XA 1F4HA 1S7QB 2LFGA 4KGJA 1Z9OA 3C5JB 2VDRL 3DI3B 1KB5L 4LLUB 2V9RA 3WXWL 3FO9A 2NW3B 5C0IA 1VFOA 2P1YA 4P23B 1OTTD 2GFBB 4QY8A 2YPKA 4M7JH 1M1SA 2R8SH 4F7MB 4LOUC 4OD2B 3U6RB 1ZE3C 3C60B 3PIQB 3Q1SH 1XF3A 15C8L 1C8PA 3MNZA 4X4XB 1CGYA 3CC5B 1XGTA 4R4FH 4QXGH 3TT3H 2JELL 5GIRB 3VI4F 3VXUD 1A3RH 2NY3D 3SQBA 4FFZH 4XNUH 4NDMB 1N5YL 3RWFA 3FOLB 3BDBA 3GMOB 3MRLB 1XIWC 1MREH 1BIIA 1JPTH 4DQOL 5E24E 1U2HA 1KCLA 3QFJE 1R5IB 5DSCA 2WUBL 2YD7A 1NMAH 4OBSA 1CTOA 2MHAB 1ZK9A 3K8KA 2XG5A 3TPUA 1NFDF 2UWEE 1MHCB 3CAFA 4HS6A 4G8IA 5D1XD 3LOWA 3TJEH 1LEGB 3CUPB 1IRAY 3LAFA 3C9NB 4NZUH 4I1NB 2HJLB 3OJ2C 3IF1A 3P4NB 1RK0A 1E27B 4UI2A 4JPIA 1R3JB 5EBGA 1I85A 3SKNB 3UTSD 4Z7VE 3F5WB 2BDNH 2AEPH 5I16B 1RULL 4HMDA 5CBEA 2QL1A 1QR4A 1CTNA 3VCLB 5K9QI 3K74B 1F6AB 5CILL 2RFXB 4WHCA 3PJSA 4MXWH 1G7PB 3BOVA 2LU3A 3SCMC 5IBLD 5M7QA 2NY5C 3QFJB 3Q6FA 1R0AL 3D39D 2YUVA 4F58L 3I6LE 2D4DA 3FZUD 4TQEH 2AXJA 1UVQB 2NZ9C 1FNSL 4QHLA 4OD3L 1J8HB 4K2UH 3TCLA 1J8HD 1ZHKA 3GSNL 1BFOB 1DEEB 4WW2A 3WFHB 4HZLB 3CZFA 4XB8A 4XHQA 3ULVE 1IM3B 1YEHH 3MLWL 2PW2B 1IAIL 5J11B 2I07A 1IGCL 3I6GB 1V05A 3HLAB 3HNSH 3O6KL 4Y5YC 4JPWL 3U0TB 2DJ4A 1S7UA 1QFOA 4NBXB 2ZZUT 5IQ7L 1NPUA 4UQ2A 4WCYL 2O5YH 2AKRA 2AXFA 2BSED 2NXZD 4JM2C 4QTHA 4NJ9L 4YHIA 3BEVA 4EVNA 5IHLB 1ROWA 3LY6A 1ZV5A 1KJ2L 3ULVL 3JWDH 4YJZL 3TA3C 3MXWL 1DQQB 3G6JE 1GIGH 4Y5VB 1M71B 2DQDH 4H8WH 1HDMA 1F00I 2JIXA 4HUUA 4KY1H 4Z0XA 4ELKB 5D2LF 4Y19D 1HH9B 1QLFA 3ILQC 4EQ3A 1AXSB 4QEGA 2QHLA 3RGVD 3WS3A 2IMNA 3MCG1 4LPYA 5C0ND 1XGQB 2VH5L 1MRCH 1CT8B 5FDWB 3WIFA 1P4BL 1FL3A 3VJ6B 3TESA 5ANMB 4I4WB 4OGAD 1JWUB 5E6ID 1QR1A 4JY4B 2XG4A 4AIXA 1OLZA 4I18C 5J11C 2FWOA 3AS1A 4M1DL 4LSPH 1OAYH 3SPVB 3UBXG 1NC2A 1N0XL 2V2WA 3ZDXE 1C5BL 1ES0A 1I4FB 3CDFA 1CFVL 4LNVA 2LQRA 3IJYA 4KKAD 4HK3J 3TH2T 3VDBA 1IILE 1HKLH 1H3UA 1UACL 3O4LA 4LSRH 1XAUA 5D93C 3S6CA 4DKEL 4JHWL 5MEND 1JCKA 2EXYD 3OGOE 5JQ6L 3I50H 1T1WB 4MJIB 4A2MA 4OIBA 4CBPA 3BPNC 1XGPB 1CG9A 4L3EE 5C07D 3EAKA 4M6AA 5GRUH 5F7HA 3KLHC 3TZVB 5F71A 4HKJB 3BH8B 4WHDA 1CD9B 1D3CA 2NTSP 3VDCA 3GI9L 2X9YA 1XF5A 3OAZH 5DZNA 4HKZB 3QIWC 4CJ1A 2BVQA 2IANB 4HH8A 4DVBA 4F7TB 5TFSH 1J8HA 1CZ8L 1KB9K 1E4WH 4I0CC 1T20A 3FO1A 2JK5B 5IVXE 1HHIA 12E8H 5C6PB 2I9TB 2X4PA 2W60A 5C0EB 5I19H 1FFNA 4LLDB 5KZCD 4U1MB 3MXVH 3QQ9D 4PGBB 2B0SL 1SJHA 1I9RL 1BQUA 4Q9RH 2EIEA 5EBWB 5IK3B 5D8JL 2P5EA 2ZSWA 3HNVL 1ZS8B 1VPOL 1L7IH 3EGSB 3QHFH 3IXAB 4NNPH 1T20B 2E7BA 1IVLA 1NCAL 4IS6B 2MHAA 2CK2A 2QQLL 3V0VA 4JREC 4QYOB 1BVZA 5I0DA 3FHAA 2IAMD 3KHOA 2LTQB 1TJIH 1LEGA 3MLZH 3LN5B 3NGBC 1UWXH 2Q20A 4PJIF 4XI5D 4K71B 2YK1L 1YMMD 5CEXA 3PHSA 1C5CL 4P4KA 3QXAB 4KTDL 2YEZA 1ZHLB 4MD0B 1OTSD 2C5DC 2UZYB 4UNVA 4KK8C 5DT1H 3NAAL 1AQKL 3I85A 3WYRA 2ADFL 2P8PA 4WU5A 3T1WA 4S0TD 2EE6A 3T0XA 3B3IA 3RVXC 1FYHB 5EBWA 5IK3A 1NAKL 2G5BA 3TO4A 3G5ZA 1LO4L 4XNXH 3ZYOA 2CUMA 2DQCL 3ZT7A 4PJCE 1ZT7A 2BSTB 3KPNA 2YPLD 4YQXH 1XZ0A 5DDHA 3OMZA 5I66A 1JHKH 3GMLA 3RVWC 1A6WH 1UH2A 2HLFD 3OR7A 4PJHE 4WUKL 1I1YB 4GJTB 4ODWB 4OM0H 1SVCP 3HPLA 2BVTA 2ADIA 2ITDA 4HV8A 4ESKA 4PV8A 3AM8A 1MRFH 3H9YA 3LEVH 2GK2A 4GH7B 4EQ2A 1FC2D 1GGCH 5D1ZC 5SX4H 4UQ2B 3W2DH 2NY0D 4NRZB 2NY0B 3RWEB 1MFEH 1FO0A 2PXYD 4WU7A 3SGJA 1UKQA 2C4FU 1U42A 2XTJB 4WW1B 1JI2A 43C9B 3H9SA 4PUBL 4KMTH 3P9MB 1FC1A 4LSPL 4HT1H 2QQKH 4YFEA 1ORQA 4FTVB 1A7PL 2IGFH 2ZUQB 5HGDB 4NJAH 1M05B 3H9HB 1AY1L 5EA0L 2VABB 5ENWB 4NSKB 1YEFL 1IL1A 5B3JF 2A6IB 5I1JH 1J7VR 3CXDH 1X5GA 2O5XL 4N1CA 3IDMB 1XGYH 4XH2B 2X4NA 3NPSC 2VRAA 2VZOA 3CH1B 4NN7C 1JHLL 3DSFL 3RWDB 3QXTA 3LRGA 1AH1A 1I1AC 3JTSA 5IFAL 3KR3L 1QSEA 4PJ5D 3P11L 1NC2B 4LNRA 3LEYH 3RTQD 4ZFFB 4LVHB 5I1EL 2X40A 1F8TL 2D7TH 3FMGH 5BZDB 4WGVB 2DKSA 3QIWD 3PWLB 4U6HA 1B6UA 5GS1C 4DEPC 1WWAX 3B9VA 2DIBA 5DEZA 1QFHA 4HUWA 1AD0B 4MCYB 4RFEA 4ETQA 4ZOBA 4Z76B 1KN4H 4NO0D 4E5XB 4ZPTB 4GAGL 2QADB 3FB6A 1QTYT 1CDCA 5DMKA 2B7DT 3MRLA 1RURH 3ZDYE 2VC2H 4TSCL 1CN4A 5I74B 3A6BH 2ZNWA 3NPZB 4ZUUA 2E6QA 4HPYH 2XXCB 4FMKA 4OLXH 1EPFA 1UWGH 3FAXA 1KELL 2ZUXA 3HZVB 3MJ8A 3G6DH 5ERWA 5IV2A 5KSVB 4UTBL 1ZT1B 1MLCB 5JXED 3T08A 4C83A 3W0WB 3IJHA 4CU6A 3B5HA 3V6BR 5DQDH 5DWUH 3FFCE 2FB4L 3O3DA 1NAMA 2J1KA 4NCDA 3BQUB 2E7LA 3LKRA 1U8KA 3HZMB 1NMCB 3LPFA 1FYTE 4P3WA 2YD6A 3X17A 5F96L 2BNQA 2RFXA 3VWKD 2VYRE 3X12A 2G5RA 3LZFH 5HD8D 2VZ1A 2O5YL 4ONHB 4H1LG 4CMHC 1PLGL 1L4IA 5D72L 4DVRH 3IB4A 4JB9L 1BIHA 1PD6A 3HAEB 4OZ4B 4ZQKB 1TTUA 4YK4B 3RVUD 1OW0A 3WHXA 1XH3A 1O0VA 4Z7QF 1PZ5B 4Q6IC 4YPGB 4JPVL 2DQDL 4XPFL 2GY7B 2JKXA 4JVPA 5KG9A 2WMPA 4JZJC 1JGEB 5ICXB 4CMMA 3TFKC 4WUUA 5DMYA 2ESVA 4IJ3C 5EBMA 1JPFA 3KLDA 4K71C 3VFVB 2D3VA 5I18H 5I15L 3GSVB 3LH2H 3KJ4C 2BNQB 3GJFK 4P2RD 4D9RE 3SQOL 2ITCB 3VXSE 4XXCC 2DMKA 2CKBL 1VCAA 3OR7B 3JUZA 4PJ8C 1FNFA 4YDIL 1MQ8A 2Q7YB 1MSPA 5DJXB 2HP4A 3VGEA 3CVHA 1MAML 4YAQA 3VW3L 3QO0B 2Y1VA 5JOFA 1IQWH 2NLJB 4OCWH 4JQVA 3OKMA 4CVXA 4P2YA 3HLAA 4OAWA 1D5ZA 3Q1SL 3R06A 5GS0H 3BAEH 2PF6A 4JGJA 1NANH 3GMOA 1GOGA 3L5WA 3AAZB 4YXLL 3TT3L 4MA7H 3FHQA 3SE4C 4WO4A 4OI9A 4OZHA 5D96C 3PWUB 5IJVA 3IDYC 3UJIH 4JRXE 3OAYK 4XP9H 3DVGB 5L2KE 1RUAH 4OCMC 5HYQB 2ICWB 4WJ5A 3ARGC 5DMKB 1JNNH 1U93A 3D18A 2C4FT 3SGJC 1F42A 1GAFH 4XB7A 3MJ7B 2X1XR 5E5UB 1G9ML 5TE4L 4HKXA 1VACA 2UV3A 3GNML 6CGTA 5FEBA 4Y4FA 4LCIL 3EYVB 1JZ5A 1S7QA 3F58L 1FN4A 3S5LB 4UMGA 2ATPB 3VWJA 2R9HC 4WI8A 3MOBL 5I2IA 3VFRA 1MHEA 5CHNA 2VAAA 4Y4FC 3VXQB 3C5ZA 5AAWA 5D6DA 1RSFA 3HZMA 3UX9B 32C2A 4P9MH 4F8QA 3PGFH 4DFHA 1HI6A 1PZUB 1P5UA 1IAII 3K4AA 4P48A 1F4XL 1RZKH 4IOFD 2VE6B 4JGMA 5F8QC 3P9WB 2IG2H 5HGHA 4D0DA 5EOTA 3TO4D 1YZZA 3U7YL 2NPLX 3DVFA 5JDJA 1F3DJ 4WNQB 2J88H 1HH6B 3DHJA 3OKOA 1WWBX 3AS3A 3OAUH 1LO0H 3CJJA 5HVHB 3MO1A 5DMGD 3NIGE 5MEQB 1MUJB 2GI7A 3HC4L 4GBXB 2OS7A 2WK2A 4FQPA 5BVJB 1KPVA 4URTB 5A3IC 1FFPA 3RPIB 4ELME 3ALXA 1XT5A 4KU1A 3GIZH 2BCKA 5FYKE 5C0GA 5DFVD 1GH7A 4FQJL 5DRWB 3O3AB 1QFWH 3EBAA 4KJYA 3C60C 3MLRL 3RTQB 4Y0GA 3FZUC 4L8SA 1JF1A 1OPGL 5EUOF 1S5HB 1AD9A 4KRLB 1GZQA 1RUKH 2JTDA 4K8RL 4BFIB 3Q5YA 1TITA 2YA2A 3LKQA 5I1IH 5CKGA 1YMMB 5L2KA 3QXVA 2X4PB 1HHJA 5FYKH 5DVMA 3Q48A 3BPNB 1DQLH 4WEMB 4P5MB 3STZA 1JGUH 4BH8A 1KNOB 3GSUB 5I6XC 3FO0L 3G5XB 4H26B 5DJ8B 1K8IB 1LNUB 5MP6L 3BP7B 4WO4B 1FZKB 3EW3B 3MRCB 4P23D 2EE9A 3IDNB 3WNOA 3BPOC 4ZQKA 3MRIA 3PWVB 5FK9B 3SJVD 1X6NA 2P8PB 1KXVC 2H45A 3MV9D 4KAQH 1NCNA 1YC8A 4RIRB 1MVUB 3U7WL 5E95B 4OFYD 2R1XB 4FQHA 4XWOD 1RZJH 5EU6A 5CIPA 5TF0A 2Q6WB 3RL2B 5CEXB 4GW5A 3IFNL 3SKJL 4HMCA 2WINB 5MEOA 1WF5A 3U82B 4YGVA 5FO9B 3UTTB 1X4ZA 1N59B 3QJHB 1NGXA 3GSVA 3S7GA 2E8YA 4D0BA 3EJZC 1Q9WB 2C3HA 1LO5B 2D7QA 4PGCA 2NY3B 3E6FA 4FHBD 2ZUSA 5T1LB 5GRUL 2FO4B 5E6IC 5L0QC 1BWMA 3U48A 1CDYA 3B8SA 1BPVA 1WFOA 4WWKB 3BP5A 3L6FB 1MCWM 3KLSA 2VIRB 3RY5A 4UIKH 3WIFB 1RUML 1IFHL 2ZUYA 1N5AB 4NM4L 5DJCA 3WKNA 2EEBA 2AJZA 5FYKD 4LARH 5HHOE 5CEZL 1RAMA 3FRUA 4KGLA 3IU4L 1D6EB 2H2SC 5MENE 3MV9E 4JQIL 5J1TC 2VUOA 2UY7A 4H1LB 4TPRH 2RBLA 1KOAA 1EUTA 3UTPD 1AGCA 5EO1B 4HFWB 2DLGA 3ZE1F 2CLZB 5EZLB 4X6CB 1BWWA 5GRVL 3UROR 5JORB 2J6EA 4R97C 1G7MB 3NFNA 1I3RA 4DGYH 4OFIA 1CGVA 4LHJB 3O3AA 4KTYA 3CDGA 4AT6A 2C3GA 2FECL 1FQ9C 1BECA 2AQ1A 4BK4A 5A1AA 1H8OA 1CFTB 3HB3C 3QEQB 2K1MA 5I8KL 4HKXB 3G5VA 3NH7H 4P57B 3O45A 4LAQH 4GG6B 4ONGL 3QUZA 4PJ7B 2VSDA 5IVZA 5KS9E 3DBXB 1T1WA 1JGLH 1X6LA 2DI8A 3H9SD 1IGCH 1MIEH 3H7BA 2BY2A 1UQSA 4DGVH 1BD2E 1V3MA 3BH8A 4PJAA 4YUEL 1BIIB 2N4IA 2PR4H 4HBQA 5IQ7H 1R6VA 4J4PD 4FFVD 4M03A 4QT5B 2FR4A 2W59A 1H5BC 4JAMB 3ULUH 1MCFA 4QNPE 5KW9H 5T33L 5IOPA 2BOCB 5IF0A 1KJ2B 2IPTL 5K59F 4F37K 2HKHL 3ECBB 4NHUB 5DD5H 3QZWG 2AEPL 4NQSB 4AEIL 1I8KA 5D72H 4OCRL 4PY7B 3WFDL 1IM9A 2OZ4L 4LIQH 3BT2L 4NOFA 4PGDA 2BFVL 4JFFE 4B41A 2BJML 3KYNA 1AR1C 1XGQA 3O6ML 4WHTA 4PJ5B 3C5JA 3D3VA 4EDXB 3NPSB 3ULVD 5IB4A 2HTKC 5ANMA 4N0YH 4R26L 2O5ZH 3VRJB 2YD8A 3GSWA 1UM5L 2HMIC 1HSBA 3GMNA 5DD0L 1JGUL 3DRQB 5I9QB 3HNTL 3T3PF 4PJ9B 5KSAD 4JKPH 3L3HB 5DD6A 1JWSA 3FQUA 3MRBA 1CWVA 2P46B 5T1MB 1MFBH 2GJZA 3P9MA 1FV1B 4BZ1L 3NIFE 1C16B 3VXMB 3VMNA 1FL5A 2X4OB 1AR2A 1QBBA 2IAND 4WFGD 1IGML 2V7NB 1H8NA 1MFNA 2E7HA 4AEHL 1F3JA 3ETBF 1ZHLA 4JFFB 3PV6A 3SKJH 4BFGA 5SX4I 4PJHA 2BNRD 2CRMA 1FBIH 1DBJH 2IBZX 1EA9C 3BD3A 4ZUWA 2OXHA 3RL2A 1ACYL 3FO2B 1WEJH 2R0WH 1D5BB 2IH1A 5JHDD 2H9GB 3PP4L 4UBDD 5BS0D 1AGBA 3QIUD 1FE8L 1HDMB 4QLRA 1WZ1L 1MFDH 3T2NH 3DVIA 4TVPD 2YMXL 2A6JA 5HYJE 1OTSC 1IKFH 1HH9A 1F6AA 4G8EA 1DZBA 2VLKB 3BZFA 3MCKB 4H88H 4IDJH 3W39A 2HH0L 4NKIL 1QFWM 4OM1L 4ORGB 1EVTC 2WIIA 2P49B 2DM7A 1I7UA 4XCFH 2FATL 5ALBH 3DX9A 4NQEA 1K2DB 4KROB 2A1WH 5F7DA 3OGCB 1A2YA 1FLTX 3HZYA 4ZTOH 4MSWA 1DE4B 4YZFF 3S4SB 4DFIA 4NNXB 4OGAC 1YPZF 4HJGB 1GGUA 4D9RD 4UQ3A 4W4NA 2X44D 4GSDL 3FT4B 5DJAA 3HMWH 4LDOB 5E6IB 2EDHA 5HHOD 4HKJA 4W68A 1NBYA 3WIHL 3V4VL 3MRMB 1WJ3A 2GIYA 4G6JL 5KSBF 1S9VA 1ZVSB 2E6JA 1T1ZA 4WJ5B 3U30C 2V5TA 4GXUM 4MA1C 1BFSA 2XWBB 3HC4H 4XXCA 2AXGA 2DM2A 3QHZL 4JFPA 3EOBA 4NFBA 3V5DB 2UUDK 4X6DB 1TMCB 1EK3A 1NCBH 3BKYL 4L3EA 3RNQA 5JPMA 1T5WA 4PJBF 4XNYL 1G6RL 4K3DH 5SV4A 3BP7A 4G8GE 4MD5A 1W0VA 3L3IB 1KEGL 3H3PL 2NY7L 1SYVA 5D7SL 2JCCA 4NNPL 4XP5L 3C8DA 4ZUSB 3OB0H 2E27L 5C09A 3K2MC 3X11B 3V6FA 5D1ZA 1S7SA 2IALB 2FL5B 4LL9A 3TIDB 1WC7B 1QEWA 2UYLA 1QSED 4X4XA 2CUHA 1IJ9A 4NQCA 4NT6B 3RJDA 5TE6H 4KJYB 3RTQA 3OKMB 1WZKA 4JLRB 3SE3C 2L7UA 3WXVH 4W4OC 3QP3A 1JK8B 3CX5K 1UA6L 5LBSL 3FAWA 2G9HB 4WEBL 2XN9B 4OZIB 1Z0MA 3BXNA 3UJJL 4OCWL 3K2UL 4OZHB 5D6DC 3ULVC 3M1BB 1X5XA 3EO1B 4I3GA 1N4XL 2YRLA 1RD6A 1L6ZA 2BNRA 1MCNA 1PKQB 3CZJA 4XP4L 4DAGH 1MI5D 4XP9L 1QSZA 5CBAB 2FBOJ 4PJAE 5D70L 3VGDA 5KG9B 3TIDA 4NBZB 4OLVL 3L3HA 3VXOB 3IU3B 5L2KB 1JTTA 5CGTA 4JANB 1I8LC 3TEUA 4PJEF 3LN4B 2DM4A 3BIKA 5IFHH 3TJEL 2RR3A 3VWJD 2LU7A 4MNGE 2FX8H 3QDJB 4X6DF 3VXQA 5KSAA 5DS8A 2DQEH 2VXTH 2I26N 5DFWH 2OJEA 3SQOH 3FO2A 2VDQL 4PRPE 3G5YA 3NA9L 5LJYH 1QYGH 3O2DL 2AXGB 2APBA 2D03H 4I2XE 1OTTC 4IMLB 1C12A 4MVBC 4XMLL 5HDQL 3QXDB 2RQ8A 4RDQG 2CIIB 4CN1A 4DCQA 4R4FL 1FFOB 3IFOB 4X8JB 4IOFC 2IAMB 4M1GL 2C7UB 2YPLA 4LRNH 1E28B 4GMSH 4NKDA 1QBLL 4FZEL 2KZWA 4N68A 1FCGA 2ICWA 1JV5B 3DLQR 5I1JL 4OLWL 1A6UL 1JUFA 3ARBC 4QHUB 4PPTA 5I1GL 5GQBA 4IM8A 4KDTC 1Q1JL 1OW0C 1IAIH 2WUBH 5D1XB 3HMXL 3BJLA 3S4SA 2LAAA 5LAXB 1DN0B 2EIZA 4MDJB 1GGTA 3MLVL 3HS0B 2W91A 2BERA 2WLZA 3I84A 3QUZD 3QXDA 1NBYB 2AEQH 2CLRA 3ARDB 2EDYA 4HSQA 4NT6A 1ADQH 4D9QE 4MCYA 4OF6A 4LP5A 3ORJA 1BJ1H 2LVEA 4WUUD 1M4KA 1XIWD 3TPUB 3FJTA 4K7PY 4H1LA 4PP2B 2P5EB 4GG8A 2ZSWB 2F53E 2HVJA 1YN6B 1HSBB 3DECA 3R0MA 1AD0A 4HIEA 1KCVL 1AFVH 1JHKL 4OCSL 3EOBB 3CCHA 2HLAB 4GG6E 5DJ6B 5J9PB 5CLWA 3BVNA 4K2UL 3BWAB 1QFWI 4ODHL 2CDFB 3C09C 1S7XB 2Z92A 5EN2B 1P4IL 5FHAL 3SDDB 2OMBA 3SO3B 4D0CB 5E94A 3IDXH 4XP6H 5IBUG 2PN5A 4ONFL 5I18L 1PYWA 3QB7C 4Q97A 5I1DB 2VMFA 4YDLC 4BSJA 1G7QA 4S1SL 4EUPH 3PHOB 5INCA 4JFQB 5C8JB 5HYEA 2X4NB 3U46B 3DXAE 1V7NH 1YJDC 3WN5C 1OAXL 5GRXG 1NAMB 1FORL 3I6KA 4MD0A 2EKSB 1NCCH 1WFUA 2ZPKL 3IJSA 4QXWA 2CGRL 2J8UE 3BDYL 1AY1H 2NY1D 3S36X 4G9FE 1G7IA 5JZ7D 1JGDB 4HUXA 2O5XH 5DUPL 2Z9TA 2EDQA 3MUGB 1TZGH 1NC2D 2WV3A 5LQBL 1XEDA 4RGNE 1GAFL 4QTIH 4HK3N 3SE3A 1LK2A 5HHXL 4C57C 2VLKA 3BZFB 1ZTXH 2DQGL 1XZ0B 3L3KB 3BGMB 4ZSOA 1N6UA 1MCWW 4LHUA 2F19H 3P4OB 4BH8B 1I7UB 2IQAA 1F8TH 2D7TL 2FEDD 3N1QC 1AJ7L 5EZLA 4ELMB 5DD3H 3IDGB 5HYSA 2DF3A 1M7IB 5TPWL 1T0NA 5IR1B 3REWA 1H5BA 3SY0B 5IEHB 2VLKD 8FABB 5TDPB 4PRIE 2YD1A 3DX6A 4MS8C 3WN5B 2FBJH 2YUWA 2YA1A 2IG2L 4G5ZL 4PYHA 5DUBB 4KJQD 4QHKI 4KVCL 4ZTOL 1JF6A 5ACZA 2P24A 2FYYA 4P3DB 2BVPA 5F7FA 3ZLQC 1FNLA 2DTSA 4MNQB 2HRPL 3ZL4L 5ALCH 3MC0A 3QAZB 4JHWH 5SX5K 4R8WL 3FT2B 4F57L 3RVUC 3J8F7 4PJHB 3OKLA 1HXYB 4Y1AD 3VMOA 2W9LA 4R0LC 1ERNA 3VG0L 4PGCB 5E56A 4FP8L 2DL9A 1JMZA 4M02A 1OAZL 4OIIL 4X7CC 1YEJH 1UGNA 4JG1H 3U0PA 2W0FB 2B39A 2R29L 1ZMYA 2XWTB 1X3DA 3GB7A 2VLJA 4POZD 3MRHB 4DUXA 4ZUVB 2BNRE 1FRGL 1H15A 3RVVD 3AROA 4XC3H 5EUKB 4F7CA 1FO0L 4UDUA 4ZFZA 5IG7B 3RWJA 5HD8C 1YY8B 4PGDB 1FFNB 3HAEG 1AGDA 5C3TA 2VN7A 2R23B 5T5NF 1CFQA 1CFBA 1QPXA 3P30H 1JTOA 3QDME 4I0PC 3RZCD 3BO8A 3HAEH 1NBVH 5EUOA 1J1OL 1TVBA 1FZKA 1IBGL 1IEBA 4WTWA 4HFWA 4PJFB 1YYLL 3VXUE 3C5SB 5DC9B 3RKPA 5GRZA 5D1XC 2BXYA 5DK0A 2EDLA 5ISZE 3QHFL 5HPMB 4GBXC 2ZOKA 2MQ0A 1D6VH 1CXEA 5DK3A 2J4WH 1U9KA 3U7YH 1S7VB 3I02B 5IT2H 4C58B 2EYSB 1DN0A 4M3JA 2ENSA 4JDVA 5J4MA 5FV1L 5JW4M 1KIPA 3NCJH 3QNYA 3WFBL 2HJLA 3MUGA 2OLDA 1MCIA 2IPUK 1BQLH 3ARWA 1ZA3A 3MTRA 4U0QB 4GBXA 5LGHH 3KS0J 3P4MA 2BY1A 3V4UH 3VE0B 1JNLL 2ERJB 1TDQA 4TVPH 5E2JA 3VH8B 3OAZK 1LVEA 4L9LC 5DEGB 1U8JB 2BVEA 3KG5A 3O6KH 1VKXB 1NGXB 5E0QA 1FZOB 5LKNA 2ZSVA 1YEEH 3QG6A 1U93B 3D18B 4OGXL 4EXKA 2QV2A 5L6YH 4HIIB 3Q6GH 1KPVB 3MR9B 4DVRL 4D0CA 1FCCA 1PDKA 3DUUA 4OKVB 3P73A 1UZ8A 4Y2DC 3VE0A 4M62H 2H26A 8FABA 3D3VD 4PJCA 1DBJL 4FMFA 4NQVA 3DVNB 4D2NA 5DJ2A 1D9KB 5FGRA 4L4TA 1MCSA 1TQBC 2BRQA 1ZVYA 4JM4H 2Q8AH 2PUQT 1CFNB 2NX5B 3FRUB 4KVNH 1OVZA 1MFAL 1ZEAL 1N3NA 3MRIB 3ARXA 3PWVA 3ZE2E 1BQHG 1T2QH 2R2BA 1RUMH 1EO7A 4NC2B 2J12B 2R2HA 5EU7C 1KBGH 5EOCH 2W0KA 4TNVF 3VXNB 3IJSB 2CSPA 4IIQB 4IRSC 3N1PC 4EKXA 1MAMH 2X7LA 4KI5D 3VW3H 3QBTB 3N06B 3U9UB 5T5FL 2AJXH 2FSEB 2JCCF 2FEEI 1XF1A 2FJGA 1MI5A 2VXQH 3AAZA 2PW1A 3WS6C 1YNLH 4CADB 1BF8A 2B5IB 1FFPB 3RPIA 3WUWA 4XNUL 3ZDZF 5I8KH 1J9CT 3LCYA 5E9DA 1QSFA 4GFTB 2UWEB 1ZS8A 1A6UH 2JB6A 3WUWG 1BJ1J 4ZNCD 2GK0A 1VA9A 3RNKA 5E08L 1TCRB 1OARL 3DO7A 1Z9LA 4PG9A 1MVFA 4EJ1C 1UJ3C 3O3BA 4K3GA 2ZJSL 3E6HB 3PWNB 3KJ6L 3QIWB 3DIFB 5E1HB 3ULUL 2H1PL 4JZJB 3KYKL 3ZHKA 1RULH 3KLHD 5FYLL 2FZ3B 3IFPA 3QUMB 5E9DE 3F6IA 2RCSH 3F8UB 4QOKD 4MQTB 2DLFL 1EO5A 1MNUH 5HDLA 4U6HB 1R0AH 2ZCLH 3GSOB 3VXTA 5FM4A 4XP5H 1KELH 4PJBA 3HNTH 3L7FB 3WLBA 4S2SA 2VDKL 1UJ3B 5I8EA 3CVIH 5JO5A 3CUPA 3N9GH 4TOYL 3UTTA 4R96B 3U9PH 4G43B 4I3RH 4MJID 5FGBC 3HC3L 3NCYP 5F9AC 1JF5A 4U1JA 5EU6D 3TIEA 3Q5OA 4XPGL 4OFYA 3QEGL 4JKKA 1P7KB 2ZCKL 3DWTA 1EXUB 4YEFA 1U41A 2MTPA 3B9AA 4WEBH 4Y4KC 1TLKA 5I1LA 5SV3A 2A6DA 4MNGA 5DHYB 2DBJA 2R0KL 4MZ2A 3MRJA 5CFHA 1A64A 3Q6GL 1T7VA 5DJ6A 1NCWL 4LLVB 3WO3B 5JLZB 5GS1B 4YE4H 2PO6C 4O51B 5DC4B 3STZB 1XF2A 4K94L 2NY5H 4PS4H 5FA3A 3MGTA 1WWWX 3QUXA 3LKPA 3OJDA 1CGTA 2AV1A 5CGMA 5GZOC 2Z91B 4F7PA 1IKNC 3O6FC 2J5LB 3I75A 5D7SH 1UXSB 1CLYL 1L9MA 5IB1B 3F7YB 3MRGB 4YXHH 5E5MB 4P5MA 2OR9H 5F7NC 2E3VA 1A6PA 1KCUH 1ONQB 1FNEB 5KVMC 1AO7A 1MCQA 1YEIH 1KB5H 1PG7X 4K7FA 1IMHC 4HPOH 3FOMA 1QBMH 4AM0B 4XHJC 1M6OA 4B0MM 5DHYA 3F12A 4U4BA 2VDNL 4P46A 4TNVK 1CICC 5TPWH 5HHPA 1T66C 2AJVL 4BFEA 4Z7WB 1HZHH 5BS0A 3PGFL 2ADJB 4ODUB 3B6SB 1FH5L 4NQCE 1LWRA 1DDHA 2XKSA 3DIFA 2DTML 4P2QD 1U3YA 3EOYG 4TN9A 1LP9E 1J12A 4HF5L 4P46C 4ETYA 4HIXH 4FXKA 5BVPL 2X4SB 3JWOH 4QHLB 5D1QB 5AWNH 1AP2A 3FONA 1BOGB 1MFCH 3VXUA 1TJGH 5AYUL 4AH2B 3DVGA 3RZCC 4FQLH 2V9QA 3LV3A 5HY9B 5I8CA 5BW7C 3CSPA 5D7IE 1NFDE 1FZMA 1V8HA 1ULVA 3V4VH 3KXFD 4P2QA 5JPNB 3VXTB 3HCVA 1D5ZB 1P9MC 1IGTB 1D5XA 3RA7L 4Z7UE 4RGMC 1M05A 3O4OB 4P2OC 4LCIH 1HEZB 1MRDH 4XBGA 3RGHA 2YMXH 4PJXE 3HZVA 4NZTH 4P46D 4Y19B 4YDLB 2ATPA 2V7HA 4BUHA 1LE5B 1T5WB 2WLYA 3SE4A 5C0CB 4M6ML 3G5YB 4YBQD 5JOPE 1TQCB 2AEWA 4M00A 4DK3A 3SO3C 1KXQE 1JRHL 4E42A 4JEGB 4P5TB 5EU4B 5F9WC 3TA3B 4PB0L 4P9ML 4MNQE 2DLIA 1KPUB 1IM9D 3FQRA 3SBWA 5CP7A 1I75A 2GK0B 4WO4D 4EBQL 5BQ7B 3QWRD 5F9JB 3VU2A 3IETA 3IKKA 2D2OA 1G84A 3GGWA 3RKDD 2R4SL 4F3FA 4HAGA 1WGOA 2CKBH 1T2XA 2R4RH 5ADPH 2G2RA 4YBLC 3VDAA 1OHQA 3MRMA 3AVEA 3GMQA 5DVNA 3QNZB 3WIIL 3O45B 5T3ZL 4S1SH 1CBVH 2R2EB 4L8CA 5IIEA 3FB7B 5HGAA 4PRAB 4PRPB 2H26B 1OPGH 2V2TB 5J3HD 2ZCKH 2DQHL 4KJPD 4YXLH 4AM0A 4MJIA 3O9WB 3HN3A 2ZPKH 3JV5A 3QIBD 5ITFB 4KY1L 4MJ6A 3CFDA 4HQQL 3WFDH 1RUAL 3ARGD 1NDGA 2G75A 1MCLA 5SX5H 1AQDA 1UWEH 5DHVH 5E8DH 3QNYB 1SMOA 4XXDA 1HN1A 1DUYB 3U7AA 4YHKL 4X7EC 4XRCA 3DMMB 3MFFB 2GAZA 2IQAB 1U8QA 3V8OA 5ILTL 1D9KD 3HI5L 4LSSH 3MLUL 4JO4L 5EIIA 4DVBB 3ZDXF 1I9JH 1KJ3L 1S78C 5AUMA 3V0WH 3BWAA 3D6GA 4LHUD 4YBLB 1J88A 1I1YA 4ODWA 2AW2A 1KNOA 1KBGL 3S34H 5IVXB 1QSVA 2G9HA 3TH4T 2H2PD 4U1IB 3PABB 3QUKB 2OR8A 4YHIB 2PYFB 4G7YH 4JLRA 4LRNL 3QSKB 3NCCB 3C6LC 1MH5A 5I1AA 4QOKE 2X4RA 4LBEA 2VXUL 5JR1L 3GSXA 3NIDE 1A0QL 4P5KA 1AGEA 2NY2B 1YDPB 3HFMH 3GB7B 3PABA 3QUKA 2HN7B 1YEGL 5LAXA 1Y18B 4OLWH 3EYQD 1JYWA 1ZAGA 5CZVL 1JPGA 4AL8H 1MHHA 4WDIB 3WFZA 3L95B 4YHZL 5IHZA 4KH2A 3VJ6A 3GGWB 4PBWD 3BKMH 1ZWIB 4GRMA 5B3NA 1B0RB 1L0YA 2P45B 5F7YC 4XBEL 1IAKA 2J8OA 4OGYH 2ARWA 4GS7B 3CLFH 4G80B 2CLZA 1MLBB 5A2KH 3P30L 3JTSB 5DJCB 4GKSA 3L7EB 4TUJB 3ARYA 4X6EB 1H5BB 4L5FH 3SY0A 4QWWD 3PDDA 4X4ZA 1JZ6A 2MPAL 3KPRD 5ITFA 3GMLB 1XCTA 4E41B 2I9TA 5C6TL 4OT1L 3PP3K 4FZEH 2YD4A 1PY4A 4P57A 4LDEB 2ESVE 5ESAA 2NY2C 1JGLL 2IANE 3A67L 4WFGE 4JFFA 2J6EL 4XHJD 1WFTA 3NH7L 2IANA 1DQTA 3FQXA 4YUEH 4LP4A 4HDIB 1CK0H 3FT2A 5KSBB 3BN3B 4UTAL 1A4KA 1RZFH 1SM3H 3BSZH 4X9BA 1RU9H 4HK0A 4PB9H 3V0VB 2CR6A 3QFDA 4WWID 4U6YB 4NOBA 1CIDA 4IHOA 4I8DA 2Z93A 5KVEL 3T2PA 4FTVE 1R5VA 5JOEA 1F4WL 5GGQL 5HVHC 4FRWA 3B4NA 3MNZB 3HE6B 2WINA 4PR5B 1TZHB 5ESAB 3M8OH 4OM0L 4WHTB 1NDMA 5BRZB 5DHVA 2X09A 1M7XA 5IW6A 2O61B 2J5LC 3BFOA 4MXQC 3GSWB 2HG5A 4D9LL 5FM5M 3RI5K 2FJFA 3CPLA 3UC0L 2K9UA 5IOPB 4LEXL 3DJ9A 4PRBB 1ZTXL 2DQGH 4LMQI 4IIQC 1NDGB 5FGSA 5ILTH 4J4PA 4OD1H 4I3SH 5C09B 4KAQL 4L1DA 5MHSD 2Q87A 5DLMH 5CGYD 1A14L 3OBAA 4ZNEA 4QRRE 4XRCB 1A6AB 2B1AL 2P8LB 4NKMA 4CNIA 3EFDL 1S7RA 4ZXBC 3BH9A 5DXWA 2DQFA 1YMMA 4Y89A 5B3JE 1H3VA 3QCTL 4U7MA 3WNNA 4MB3A 4JRXB 2I9LA 4TVSa 1HINL 3STBA 4HF5H 3MZGB 1IC5H 2XN9A 4OZIA 4ZFGL 3O8XB 4GSDH 4P2QB 5AWNL 5JPNA 1WV7T 4PGJA 3UJTL 3OJMB 1CXFA 2DBLL 1MJ7H 5D96B 1A3RL 1KTLB 1EEZB 4PTTB 4N8CH 4BQBA 4KHTL 1MPAL 4FP8H 3RY4A 1K4CB 4KK5C 3S98A 4Y4KD 1P7QA 5TF1H 4GG8B 2HJKB 4XGZB 1MRDL 4MX7B 3K1KC 4P2RA 1VGKA 3EZJB 2E9WA 3QUMH 4GAYB 3RDTC 2WM0A 4HIEB 3KDMA 5IEKB 3MGOA 3MRGA 1SYVB 4LLUA 1JHTA 1LK3H 4XGZA 3TV3H 1K5NA 4JHAL 1LILA 1SJEB 1R5WA 2APXA 5I1CH 4YHMH 5GRYA 5F21B 4APQC 2EIDA 3K3QA 4Z7OF 4NKIH 4LEOA 3MJ6A 1G7LB 4DZBA 3PHQA 3OGCA 4XWGL 1UKSA 3HG1B 5IGXL 5BV7B 1F2QA 4OF5A 4PGEB 4JO2H 2D0FA 2YD3A 1D5MA 2N7AA 3NZ8A 4MQXC 5D2LA 4S0SD 1LD9A 3RWFB 2YD5A 1A1NB 4PG2A 5H94B 4LAJH 4UNTA 5J8OA 4IJ3B 1XGTB 3GBLA 4LK4A 5C6TH 2HMID 1Q1JH 1T7XA 3HC3H 3C87A 1OAQL 4XP6L 2APTA 4ZSOE 2AEIT 2MCPH 4YX2H 3GRWL 3CFIC 4IRZL 2A74B 5HYJD 3QEGH 5DGRA 5I1KH 1KLUA 2FCBA 4MNGB 5IMOB 5EOTB 3Q2CA 4WI5A 5E6IA 2AEQL 3ULUE 4R0LB 4LKCA 3RFZC 4YFLI 5HYIA 5FUCC 2H1PH 1NCCL 5FYJE 2FHBA 2VQ1A 3FB6B 4LHUB 1NCWH 2AJ3B 1CXIA 4BELD 1JMXA 4YH6A 1HIML 4F7MA 5HI4C 4O5LH 4TSBL 3VD9A 1NLBL 2JIXD 5DS8B 2XA8H 2HJFB 3S96B 4KPHL 2DQIL 3NMEA 2N7BA 3OXSB 3WLBB 5FF6A 2YOCA 4HMEA 5E8PA 4HJJH 1I1AB 1HK6A 5JXAH 1S5HA 4X7SH 4NO3B 2NW2A 3QIBA 5CJQL 4AY0A 3HI1A 1QSEB 2P4AB 5SWZB 3S9DB 3AREC 4P9HC 3VI3E 1XH3B 4YC2B 4EIGB 3NOIA 5E00A 3U9PL 5L2JB 3IKCB 1YJDL 4RISH 5HBBA 2Z8VC 1D5IH 3U46A 3BHBB 2D03L 4G8IB 1ZLSL 3VI4E 3MRKA 1B2WH 1IC7L 2DQTL 3GMQB 2A6DB 2HTKD 1OAKH 4PBXA 4WV1B 4U1HB 5JA8B 4JG0H 5CJBA 1NEUA 1TENA 4WHYG 4TUKL 4U0RB 2GUOB 3MO1B 4OLVH 2OX5A 2C1OA 3RUGE 1RPQA 3VXMA 1CQKA 2WUCL 4GAJH 3ZTNH 4YHLH 5C9JA 5C92A 1A0QH 2GEEA 3P9LA 4PRHA 3PJSB 4K07A 4U1KA 4GRWF 1QRND 4KK9D 3TP4A 4C55A 4JM4L 1NFDB 2X70B 2MOVA 2XI9A 4FFWC 1K4DA 3LKNB 5CBEB 3BQUD 3WDIA 1IZKA 2P47B 2ZJSH 4FQCL 4MJ5B 3KGRA 4YHZH 2E7CA 5L88L 1URLA 1EMTH 4KZDH 5MHSE 2EYTA 1UCBL 1A6TA 1LMKA 3I75B 2KH2B 3INUH 4OIAA 4H25B 2X7LB 4HFUL 5HI5D 2GKIA 3QO1B 5EOCL 5DRWA 5GSVB 5KAQG 4KFZC 3AY4A 2Y9RT 5CUSH 2AAVA 1MCPH 4KTEL 3VXSA 5JNYA 1ZT7B 2EDFA 5F3HB 1NBVL 4U1KB 5F7LB 4GAYA 3NN8B 5DUMH 2WWKT 3PWUA 4EOWL 4PJ7E 1BVKA 4K3JL 3IDMA 3ULVF 1JUFB 2VUYA 1RUQH 3OG6B 1BBJA 5IT2L 4XCNB 1AP2B 3ZT5A 4P2RB 3WUWB 4ODTH 3VFNA 3T2QA 1YN7A 5C0BE 3U4EA 3B9KD 1BQLL 1FFOA 5A16B 2A0LC 3P73B 4XVJH 4L4TE 3CSGA 3WIIH 4KHXL 4M48H 5T3ZH 3UTZB 4JJHA 2DS4A 2GSIB 4LGPB 3K2UH 4K9EL 1G9NL 4OFKA 3GK8L 1AGFA 4YAQB 4MAUH 1NH6A 5E00B 4H20L 2ESVD 3IVKB 5DYOB 4IEFB 1HQRA 5HGDA 2JF1A 3CFBA 3V5KB 3NGBB 2P5ED 3UPRA 2NY3C 4OZIF 2HT2C 4ODVL 2VWEC 3OV6A 1K3ZA 2V17H 4G7VH 3TLRA 3TPKA 3VXRA 1Q9LA 4GXVL 1J0JA 4HC1A 4R2GD 2IAMC 3VWKA 1N5AA 2OSLB 2BNQD 3NZHH 5ID0A 2IFGA 1A7BA 4KJWC 4NPYB 5F1KC 2XQYG 3QDHA 1I7RA 4P3CL 3MACL 1SEQL 4NSKA 4YPJA 4G9DA 1DLHB 1IAMA 3KPQB 4YO0A 3T65B 3GJFB 5IF0B 1KCRH 1EXUA 2VQ1B 3TZVC 3TYGL 5B22A 1QSFB 4OI7A 3TBWA 4NIKB 1S5IL 4P4KB 4QXTB 1JWMA 3MR9A 1RJLB 2DWEA 1MOEA 3BYYA 4R9HA 4ENEC 4QF1B 1VDGA 1OLLA 5T1MA 4FQLL 3ROOA 3WUZA 5BMFH 3B3IB 4LCCA 3V6FB 3V95A 2HT3C 4JRYE 1REIA 3QULB 1A9BA 4Z7VF 5BOPA 4FQHB 3W9EB 3G6JA 3L5JA 1UH3A 1WFNA 2YKLL 4PJEB 2DD8L 3QEQE 2V7NA 2X1OA 3LS5H 4JZNB 4WFEE 1DL7L 4M61B 2PNDA 5TH2A 2EDTA 2OTUA 4M1CD 3C09B 1SEBA 2YA0A 2AVGA 2XIDA 3VGAB 5JHDB 1SJXA 2CDGA 4GKNA 4JY6B 4YIQA 3ECBA 4NHUA 2Y4SA 4K7PX 1CE6A 1I8IA 3MRQA 5I0ZA 5IEHA 1IM9B 3IYLW 2BX5A 1WIPA 2ZOKB 2NZIA 1LK2B 3OXRB 3SKOB 1QLEH 2FBJL 5C0JB 5B39B 4PJ5A 5J1SC 3C8KB 4KVCH 1RZ7L 5C1MB 5I8OH 2ICCA 2IF7A 1AE6L 5SWSB 1MCPL 4Y5YB 3RWGA 3RTQC 2AXFB 1VEOA 4I0PA 5F7EH 4Y8AA 5EBLB 4LCWB 2ZCLL 3EO9H 4LDLB 2VISB 1IEAB 1TJGL 2CJUH 2V5YA 4I77L 1DQMH 3T1FB 4D8PB 2VDKH 4ZFOA 4UDTA 3VFPB 5IBUB 3UTSE 5C0NC 4E41E 4ONFH 2X4RB 4F57H 1I8LA 5HPOA 1RVFL 5HHOB 4I3RL 5AEAA 2HVKA 5FO8B 1OAZH 4OIIH 4F33B 1T03H 35C8H 1CLZH 4OZFB 3CLEL 4XPGH <