5JOPE

Crystal structure of anti-glycan antibody fab14.22 in complex with streptococcus pneumoniae serotype 14 tetrasaccharide at 1.75 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
208
Chain Sequence
EVQLQQSGPELIKPGASVKMSCEASGYIFTEYYIHWVKQIQGRSLEWIGYVHPKTGDVIYNQNFRGKATLTVNRSSNTAYMELHSLTSEDSAVYYCARWDSWGQGTTLTVSSAKTTPPSVYPLAPGTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 14.22 light chain
publication title T cells control the generation of nanomolar-affinity anti-glycan antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 208
sequence length 211
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jopE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jopE02
1CVSC 4ZPVA 4JN2B 2BRQA 4K7FA 2E7MA 1T0MB 4KV5E 3EO0B 4WEBH 3VXSD 1Z5LB 5EBMB 2DQJH 4N8PA 3SDXA 4KZDH 3VG9B 1DBJH 1XF2A 1WUNT 4HIIA 4M02A 4PRHD 4PP1C 5MEND 1LE9B 5E8PA 2NY4D 3K81A 5B8CB 1WZ1H 3JVGA 3EDDA 4DN4H 1PLGL 4BK4A 4X4XB 1T03H 3IDNA 5I1IL 4JFXB 5EIIA 4HC1A 3WBDA 3V6OE 1IJ9A 3LN4B 3VFSB 4M5ZH 3DX8B 3VFUB 1NEZB 2UUDH 1A6AB 5F9OH 1OAXL 3DUHA 4M3KB 2NNAA 4GRWE 2I07A 1A7PL 3U0WL 4WV1B 3CFBA 3GMRB 3TJHC 1RK0A 3ULVL 1MJ7H 4XHJC 1A2YA 2P5WB 2EDRA 1DE4A 3R8BB 4L8DA 5CD3A 1VSCA 2LV4A 3QXDB 4HH9B 4LSVH 3QIBB 4IMKA 4OBRA 2E7HA 4U1IA 4XPBH 1CT8B 5HVHB 3HRZB 3P9LB 1VGEL 1DZBA 4JRYD 1RMFL 5EBWA 3HI6H 3QPXH 4YHML 1RAMA 1AGBB 2BY2A 3T4AA 4RWYH 2BC4A 1H8NA 1ZLWH 3FO1A 2ADFH 2Q7NA 2VXSL 5EA0H 1CFSB 3KYKH 1I7RB 3HMXL 5IKCA 4IRJC 1CK0H 3I9GL 3RVWC 3BZDA 5F89B 4WI5A 1D9KD 2XWTB 5DT1L 4QHNB 3X3FL 5HYIA 3KLHD 3L3KA 1T83A 4HJJH 5E2TH 1G7MB 3NFSH 5FGRA 3V6ZB 1EAJA 3C6LC 4FOMA 3SDDD 5F71A 3QZWA 3CZFA 2NTFA 2A6JA 1V3MA 3AY4C 3QUZC 3T3MF 3EAKA 3ARGD 4ENEC 1BLNA 1S5HA 2QL1A 2FX7L 1MVUB 4PJIA 2XRAL 2BNRA 1JWMA 3DURB 2VYRE 3VFTB 1S7VA 2DM4A 2BVYA 1OWRM 1CICD 3MLUL 4PGJA 2UY6A 4X9HA 1D5BA 5J6HA 5DMJB 4OCLC 3UZEA 5J0BA 4M62L 4ZNEE 1C08A 1UJ3B 4LARH 2VTFA 5I9QB 3N1GC 2CIIB 5FK9A 1RK1B 1N5YL 2P46B 35C8H 4ZTPH 1TQBC 1CXIA 1LEIB 3D85B 2LTQB 3KYMB 2PN5A 2ZNWA 4QOKB 3NTCL 3FFDB 4MXWL 3RVTC 3H6JA 4X4YB 3DBXB 4HUUA 1I1FA 4D0BA 4OCRL 4YX2L 4K3DH 2IF7A 1NAMA 1DTUA 2AJ3A 3MMEA 2V7NB 1CGXA 5GXBB 2EEBA 1OAUH 2OSLA 2AEQL 2NY3D 2VAAB 1SYSA 5FAAA 3SGJA 1PG7X 5A43C 5FO8A 3FO0H 4OTXL 4IOFD 1B4RA 4W68A 1ZWIA 1WT5A 2W0FB 3HZKB 4ZUWB 3BN9D 2YXFA 3WS3A 5HHOD 2ZSWA 4I3RL 5ACMA 3ZKSD 4YHPB 2EDKA 4L29B 2P5EA 2MCG1 1OTTD 4IRZL 3OXRB 4HJ0C 3FB8B 1JHKH 4XVUD 3EYOA 5HY9B 1W72B 3SJVE 2DQTH 5I30L 4JO4H 3Q48A 1IKFL 3RTQB 3ARZA 3TZVD 1MIEL 4Q2ZA 1JTPA 4JFFB 5JW4R 2CKBL 3HMWL 4LU5L 1G6VK 5LVEA 1VFBA 4KKCD 1RUMH 4K7FB 3HPLB 5JOFA 1IGML 4N0FB 2EXYD 3AXLB 4L3ED 1JTOA 1XF2B 5LAXA 1DVFC 3ARYA 2CK2A 2P24B 4HIIB 3RWEA 2YRLA 3QI9C 2APVA 1T04A 1ZLSL 3UEZA 3GI8L 4EIZC 4HGKC 5CIPH 2CO7B 5A2JH 5HDQL 4FG6C 1OPGH 2J1KA 1RI8A 1YJDC 3EJJX 3IDNB 4YH6A 5T3XE 4KMTL 4K8RL 5E2WH 1M1SA 4QRUA 3ZZ1A 5I1DB 5F7MC 4R26H 1JK8A 3MV8E 1CL7H 1YYMH 2J5LC 3QCVH 1UWXH 1NEUA 4W4NA 5DRWA 4F58L 4L9LA 3LKOB 3EFDH 1FORH 5D70H 3CFBB 3BE1H 5E2VL 1HKFA 1RK0B 4U3HA 3RWIB 4Z7UE 3ZKXB 2VLJA 1FRGH 4OI9A 1INDL 4KUCD 1FZOB 1ED3B 4R4BB 4L8DB 4YR6B 1ZGLP 1IGFL 2X1QA 3N1MC 1JYNA 3DHMA 4M48L 5GGTH 4U1IB 4N68A 2R69L 1FLTX 1H5BC 5M94B 1WAAF 4KI5C 4M93B 1I7UA 1OW0C 2YBRB 4K7PH 1HXMB 3QUYC 3WJLC 5DHYA 4QRSB 3ARFB 3HC4L 3QEQD 3U82B 4Y16C 2CLZA 4MAYC 2VH5L 5KVMC 1URLA 5DZOA 1NLDH 3D2UD 2FGWL 1XH3B 3K7UA 2JIXD 4MCYB 1II4E 3L3KB 3ARBA 4X9FA 3W0WD 4Z77A 3RNQA 3L5XL 3OHXA 3CZFB 3DRQB 4AMKL 1FFPA 2A6JB 4WI7A 2A6DB 1FNSH 4WHDA 4LOUD 1RZGA 2VDOH 3VGFA 3O8XA 4PJIB 1JWMB 3TO2A 4C54A 3RX7A 1S7VB 2Z8VC 3DSNA 5GRJL 3E0GA 4TTDD 5F72S 1DQMH 5EO9A 4YC2C 5L2JA 1CE6B 2X4RB 3G6DL 5SX5K 1HSBB 4MJ2A 1C08B 2ZCLH 1YPZA 2RBLA 3IAQA 1KT2B 5H2BA 1NBVL 3HMXA 4L4VA 2EH8H 3I6KB 3MYJB 1I1FB 4D0BB 3OKYA 4XPHL 1SY6H 2WBKA 3QULB 5DEFA 3MLZH 2AJ3B 5E5UB 3MMEB 5LGKA 4N5UA 1RUKL 5I1CH 3OX8A 1EXUB 2OSLB 4OIIH 1GGCH 1SYSB 3AREC 3OR7A 4XT1C 3IU4H 4HCRL 4PYHA 4UT6L 5C08E 1CDUA 5E2UL 1UZ6E 4HWZA 2D03H 1LP9E 4NNPH 3GHBL 4QXUL 3TBYB 3WS3B 4PB0L 4OI7A 2ZSWB 4OKVA 4M43L 1OOAA 3RP1A 4JO3L 1MCOL 2P5EB 4JY4B 4IRSB 3GJFH 1QRNA 3EYOB 1INEL 3V5DB 1NLBL 4HT1L 4DUVA 5CJ5A 4Q2ZB 1DBAH 3A67H 2P5WD 3QNYA 3KPPA 4FTVA 3SCMC 5JOFB 1XEDA 3QDGE 3B9KC 4TUOB 1ZLUH 4Z8FH 1KELL 3QIBD 4PJ9A 2AJVL 3TVMA 2R29L 1NANI 3VRLF 3H9ZA 5LAXB 3FT4A 4BFGA 5FUCC 5DJZB 4F7TB 3WNOA 1CDJA 4B0MM 1UM5H 3MBXL 1GYAA 4AEIL 3T0DA 4QF1B 5J7CC 1U3ZA 5CKGA 2H6PA 3QPQC 2PR4L 4HJGB 5SWZE 4AEHL 1QA9B 3S35L 2Q86A 4ZQKA 4F7CB 4XP1H 3QA3B 1BZ7B 1FL3A 5ADOH 4D0DA 1IC4H 4WDIB 5GRVK 5H94B 5IK3B 4MB5A 1A7RL 3V0VB 4L9LB 2CKBA 2CJUL 3MLVL 4LRIC 3LAFA 2W0LA 4CMHB 5CZXC 4OFIA 2NCMA 3DROA 3MRHB 4GW5A 3Q5TA 3MUGB 1FZJA 2I5YL 3U0PA 3V52H 1BWMA 4YHIA 1PSKH 1A6UL 5CIPA 4KAQL 3KYNA 3GMOB 4WFFE 1MPAH 1F3JA 4XMPH 4ZNCD 1I7UB 4W4OC 4NQUA 2F54E 5DHYB 3D85D 3VG0H 4QOKD 1I7ZA 5I17B 5DJYB 4UMGA 2N7AA 4OFVA 4PD4J 4AM0B 4KI5F 3Q0HA 5HYEA 5L7XL 3MCLH 4TRPH 4NRZA 2O26U 5J1SC 3ZYIA 1YEHH 4O00A 4LLYB 3IJHA 3RNQB 1GOHA 2RQ8A 3T08A 1FFPB 3I2CL 5E00A 5IB5A 3BPCA 1WSST 1CDCA 1TDQA 5IB3B 4DGYL 4L8SA 1T5XA 4I4WB 4QTIL 2EDYA 5IBTL 3MLWH 2APXA 3TO2B 3RUGE 3QQ3A 1S8DA 1J1OL 3SQOL 4OJFL 1A47A 3K1KC 5EO9B 1HQ4B 3FOMA 1T6WA 1TJHH 4D9LL 3PUCA 4LSPL 3PL6B 4E5XA 5F7DA 5T1LA 4JFFD 4P2RE 5GS1A 5IR1B 4M9OA 4PJXA 3V6OC 3N50A 4GQPH 4M6NH 1P4IH 4J4PA 4YDKL 2ARJA 3LIZH 3VE0A 4NSKA 1TJGH 4MA1B 1V7NH 2K7QA 4UNTA 1G7LB 1LO0L 1W0WA 1MRFH 4JJ5A 3OX8B 4XNUL 5CGMA 1CTOA 3STZA 2A6KB 1YEDB 4OGXH 4ZPTA 3EJYC 3SDAA 5DS8B 1GXEA 5ACZA 2Z92A 3WS6A 4JGMA 2WP3O 4HWZB 3C5JA 2WWMD 2MCPL 5MERA 5DD3L 5BMFL 2J8UF 3LEVL 4U1NA 4O58L 5ESVB 3PV6A 2DQGL 3VH8G 4Y5YC 3RIFF 1NGWB 1QBLL 5D93C 3ZE2E 3HAEA 5CSZA 4JY5H 1Y6MR 3NMEA 5CCKL 2BFVH 1QRNB 2F8OA 4OZHB 5DUBB 4HPYL 4B53A 3VA2C 1P9MA 1QSVA 3HE7A 3SKOA 3MV9E 2AABL 4WEMB 5TE4L 4XCFH 4XPFL 3F58H 1HXYA 4FTVB 4EBQL 3O6FC 4I48B 2DQHL 2NY1C 3IFPA 4LCIH 3GRWL 2VDRL 2D7MA 3TVMB 2QSCH 3T0EC 4FFYH 3OAYH 2QSTA 4HCRA 5H35A 3L95A 4BSWA 2D2OA 4HKZB 3ARFD 4OLXL 2ZUWA 3G5XB 3D5OF 2IQ9H 3CPLB 4L3EE 5TPWH 4LHUG 4P2OB 1BVLB 3HG1E 4LEXL 4QGTA 1FAIH 2Q86B 4ZQKB 1CFBA 2C5DC 2A1WH 1KSRA 2OXHA 1FL3B 3KNBB 3CNKA 5A3ID 3UPRA 3MSPA 3U1SL 3C2AL 3RGVA 4UV7H 2OL3H 2CKBB 3E1F1 1KN4H 2FL5B 4KK6C 1NDGB 4ONFH 1LDPL 3TJEL 1TJIH 5C86A 1FZJB 4HK0A 3IKKA 5DJCA 3U0PB 3LS5L 2YD9A 3DX6B 4OD1L 4YHIB 4NRXA 3S6CA 3G5VB 4MLIA 3GSOA 3KYNB 1ONQA 2J4WH 3IYLW 3V95A 1EEUA 3DSFL 2YOCA 2R9HC 1RUAH 4I2XA 4Y5XA 3HE6C 3WFHA 1BFTA 4PJDF 5F7WC 4PJHB 1I7ZB 1U8JA 5E1AA 3P4OA 2UVEA 4WGVB 3MRLA 1YEEH 1EO8H 4Y5VC 3SDCA 4NRZB 4CADA 2BVUA 3U83A 4ODXA 3WUWA 1L0QA 1BD2E 5EULV 2B0SL 3ETBF 3PQYA 1BBDL 1FV1A 3QIUB 4LSUL 2BVQA 3FT3A 4AEFA 4KVCL 4P57A 2DDQL 5DJXA 5E00B 2UWEF 5IB5B 1UGNA 2XZQH 1FBIL 1F4XH 1T5XB 2C4XA 1G9MH 3NPSC 3ZHKA 5IROC 5JZ7C 1VENA 3QQ3B 4PS4L 4F33A 2PW1A 3QRFM 5BVPH 2L7JA 4KV5F 4XPTH 3L1OL 4I5BA 4X6EA 1G7IA 4WO4C 1TETL 4P59H 2P5ED 4PRAB 4YXHL 1EHNA 5J12C 5J3HD 3N1FC 5DURB 3VGAC 2BVPA 3WJJA 4HS8L 2YD1A 3EOBB 5F7DB 2VISB 5HVGB 3V5HA 1RUPH 1DEDA 5IW1A 1YEFL 2ZUTA 4F9LC 4EXKA 1BPVA 2FIRT 3FQXA 1VFMA 1F6AB 4XI5D 1J12A 1MCCA 3FO9A 4ZUSA 1Z9LA 2B1AL 4GG6E 1EJ6A 1TCRB 3QEHB 3HB3D 5FCSH 3NFNA 3B9AA 4E9LA 3STZB 3IDGA 1QG3A 4OCSL 4GRWF 1FL6A 3MV7E 3QDHA 5GSRB 5MERB 3S96A 3DUSA 3HPJB 2F9BT 3W82A 3EFFB 3EO1A 3KJ4C 1XCTA 1YECL 4HKXB 4U1NB 2IC2A 3SHSA 5JPMA 3BP7B 5I66B 4JDVA 2QADB 1U3HA 3MLRH 3BKYL 3HAEB 4XP9H 1QKZH 4OD2B 1BJ1H 2CQVA 4X8XA 3BH9A 3HE7B 3SKOB 5GQBA 4PLKC 4TVSa 1LGVA 4BFIB 4LVNC 5JDSA 5BS0A 5T5FH 1HXYB 1GH7A 1PG7H 1IGJA 4I18A 2N56A 1ITCA 4QYOA 1UG9A 3V0WL 4J3TA 1BZQK 3V4VH 3KAAA 4XX1G 5DQJB 5F97E 3T8XB 4ERSH 5GS0C 1NGZA 4FFZH 3W5NA 1YMME 1CQKA 1TVDA 4Z7OE 3KDMA 4XCYA 3FOLB 1FQ9C 4FZEL 3IFOB 4D8PA 1JGDA 4OUUB 5DD0H 1NFDE 1TVBB 1UKSA 4JPKL 3GMMB 5A1AA 4UDTA 5C0BE 5EO1A 3ULVD 5IJVB 4X7FC 5D4QA 2KZWA 4AJ0A 4QHMB 1KEGH 1FG2A 4B7LA 3O8XD 4OSUL 1S7WB 4HK0B 3U7AA 3O3EA 3GRWA 4ZSOB 1CDGA 4LSTL 4YNYA 1A4KA 1ONQB 3TT1H 3JUYA 5EU5B 3MJ6A 2JB6A 2AJSL 4U05A 4LK4A 1KEML 1MNUH 4I2XB 1R5VA 2KPNA 3PL6D 4L4VD 4UT9L 3RKDD 1BVKA 2A9NL 1DANU 2HT2C 4UT7H 2JJWA 5DD5L 2WUBL 3IDIA 4NJ9L 4HFWA 1U8JB 3T3PE 2YWYA 4LDLB 3ZE1E 2QHRH 4GAFB 4U1HA 3W5MA 2FH6A 4OLVH 2A0LC 3DHJA 3V2AR 4D3CL 4OM1H 2EC9U 5EPMA 1A7OH 2AAVA 1A9EB 3RVXC 2GSGA 3RL2A 1N2RA 5C0JA 4QEGA 1A6PA 5C0NC 4KGJA 4X9IA 1UB6A 4TPRH 5L9DL 3W9DA 2APFA 3ULUC 1WITA 4YDLC 4OZIB 2J8HA 4F33B 2PW1B 2VR9A 4MHHI 4G5ZH 4RMUA 4KZEH 4JFHE 3WNMA 1ZLWK 1G7IB 1K4DB 1NCTA 3E2HB 3TPUA 4DEPB 4K3EH 1DQLL 2P4AB 1QRND 1FNAA 1FGVL 5F7NC 5AEAA 5K9KB 1F4WL 3V5HB 2NY4C 3FFCE 1JGLL 2RB8A 4Q74A 5KS9A 5IW1B 5DJ0A 3T0AA 1CLYL 1OAKL 4FTVD 3HNTH 1N7MH 1F6LL 3F8UB 4KWUA 5JO5A 1PJ9A 3TVMD 3FO9B 5IMMA 2OZ4H 2E27L 4H1LG 4CN1A 1A7QH 2IBGA 3AC0A 4UBDC 3P77A 1NGXB 1CG9A 4L4TB 3U36A 2DIJA 1B2WL 5AYUH 3SDXE 4RRPG 1J8HE 1FVEA 1QFUL 5DVMA 4TTGA 1HZHH 3S96B 4P2OD 4Z7UF 3HNSH 3KLAA 2HFFA 3VRJB 4UU9B 2BMKB 4C58B 3BHBB 5JR1L 2GCYB 3BH9B 3MYZA 4OFYA 1WWCA 2E3VA 4RIRA 3FCTA 5C0RL 43C9A 2FHFA 4GS7C 2XZAL 2AV1A 5BS0B 5IOPA 3IDJA 4I18B 3DGCR 5D1XC 4JPWH 3P4NA 1D9KC 5MP6H 5FYKU 3LQAL 4LPXA 1DFBH 1WIUA 1Z0MA 2FX9H 1JGUL 5TQ0H 3IU3A 4G8EB 5LG1A 4ZO8A 2KKQA 5HHQA 3ESVF 5TJWK 3QG7L 3DI3B 1XGQA 3TWCL 1VDGA 2CD0A 1E4WH 4DTGH 3PP3K 4K8RD 5ICZA 1RHHA 5DI8A 5EC2A 1RZJC 4P4RA 4FQQA 3S35X 3IFNL 1CICC 1JGDB 3FQRA 1JP5A 1KB5L 1NCBH 4MNQA 3QIUD 4GMSL 2QBWA 3LOWA 4UDTB 2PO6A 5DC0A 3WNPA 2EDNA 2RCSH 3V4UH 3ZE0E 4KJPC 3LHPL 4N0CD 2R0ZL 4JG1H 2WZPD 2NXYD 1S7SA 3BVNA 5A2IH 3DLQR 1FJ1A 3C09B 4X4MA 1FC2D 4M1DL 4YNYB 1MCLA 2BNRE 2JB6B 2NY3C 3FONA 5DURD 1R5VB 2X6MA 5T1LD 1BVKB 2BJMH 2EDHA 3D9AL 3IDIB 4P2QE 1ZA3A 4H20H 1EV2E 4J4PD 1UZ6F 1ZXQA 4LEOA 1LP9F 1ZT7B 5D5MA 4U6VL 1XT5A 2X41A 3BN9C 2CIKB 3QFJA 1PKQA 5D9SA 4MD4A 4XPGH 5EPMB 2ED7A 4F3FA 3KLSA 1MFAL 2ZJSH 3UTTA 3RL2B 4GW4B 1EO7A 4NQDB 3ZLQC 2AK4B 2IMMA 1DL7H 5CHNA 4APQA 3VGDA 3HRPA 1ETZA 2X4OB 1UYWH 3TZVC 1HWHB 3W9DB 2GTZA 3LV3A 3GSUA 4AIOA 1MI5A 5C3LD 4G80A 5BW7A 5SX4H 2CR6A 4NHCH 4G6MH 2QADD 4OZ4A 3X14B 5JIKA 3TPUB 4YHYB 1G9NH 2NY6B 4HF5L 5FM4A 2O93L 2EXYC 3U0TA 1FNHA 1OGAA 3HE7D 4GAGL 2XKSA 4OCWH 4X7SH 3O2WH 5CD5D 2A74B 3MOBL 5DUPL 5KS9B 4JFQA 5DJ0B 4HUVA 5CWSA 4NKDA 4HULB 2V5RA 4WUKL 5DLMH 2PUQT 2UVFA 3SO5A 5IMMB 2VUOA 4JG0L 3O4OC 2ZOKB 3P77B 4YDIH 3MRGA 2CUMA 3BPNC 4PJEF 1KC5L 1AKJA 3VD7A 3WXVH 4PREA 5L2KB 4GMTH 3UROR 5D72H 1BAFH 1OB1B 1RPQA 5EBLA 1U95A 2R56H 2Y6SD 2BERA 2V5TA 3IRPX 5E2JA 5D96B 5IJKC 4F2MB 5A16B 4FQ1L 2N4IA 1AQKL 1UM6H 1GOGA 5ICXA 3S5LB 4RIRB 1YEKH 1PQZA 5HPMB 3OAUH 4F37K 4WEUD 4I9WD 1EUUA 4IOSD 5IOPB 3L6FA 4OB5L 4R4ND 3IDJB 4E41A 2P42B 3P4NB 4YE4H 5KSAA 2VLJE 5I74C 5FGSA 5CLWA 4FQLH 3IU3B 4QHKI 2FD6L 1IGCH 1NMBH 5JW3L 3UO1L 2NR6D 3PDGA 3TBSB 5GISH 4HMDA 4NBXB 4JFDE 3KPSE 3QUXB 1NMCC 5GJTL 5CJOH 4KK9D 2HVJB 4LOUC 1RHHB 5E4EC 15C8H 4BFBD 3GJFK 1ZTXL 3RUGF 3T2NH 3U7YH 4P4RB 4FQQB 5C6TH 5CINH 1QO3B 3QHTC 4WU7B 5ESAA 4D9RE 4HS3A 4LCYA 4NKIL 1A6ZA 2PO6B 1KCUH 3VFRB 2YPLB 3MO1A 1S7SB 3BVNB 1G7QA 4TVPL 1FJ1B 4ZS7L 4O2CA 5D2NE 2A2QT 3GO1H 1IMHC 1CBVL 5JW4Q 1MEXL 3QP3A 3QJHA 2EE3A 4X83A 4K9EC 3VXTA 4KDVA 4OCYH 3NZHL 5A2FA 4YPGA 1JMXA 5ALBH 3FONB 2J88H 1B6DA 4QGYA 1LQSR 5I1IH 4P5KA 5B8CC 5K9OB 2I25N 6FABL 1ZA3B 2OTWB 1DBKL 1PBYA 2JTDA 1YPZE 4NDMA 5HGBA 1KB5A 4L5FL 12E8H 1HWGB 2VRAA 4OQTH 3HZMA 3EW3B 4MD4B 4F3FB 2EDBA 3ZE2F 3DMMA 3C2SA 4EDWL 4L4TD 1J1PL 2X4PB 5GRZA 5CHNB 5C09A 1TVHA 2JE8A 1ETZB 3FN0L 4NPYB 5DMGD 1QEWA 5T1MA 2PYEA 2FJGB 4HMCA 4G80B 3QQ4B 3GNMH 1IZKA 5EFIA 1CGSH 2GY5A 5C07A 3QIBC 5E94A 2QHLA 3P9WB 4DKDC 1UCBL 2X4NB 3U0TB 1D5MA 4YBLB 4QRRB 5F44A 2FLBT 1Q9LA 1KCVL 3AM8C 4PP2A 4JFQB 4HXBH 1A3LL 5BS0D 4HFUH 4HUVB 1S9KC 4NKDB 2ZKHL 1B0RA 4B50A 2HJKB 1FYTE 1JIBA 3HZYB 3S36L 3G04B 3MRGB 5HHMB 3O41A 4PREB 4RSVA 3MNZA 4XMLL 2HVKA 1L9MA 4OGAD 1G7JB 1U95B 1MJUH 4FQCL 5E6ZA 4Z5RA 2YPKA 3BEWA 3FB6A 1TIUA 5C2UB 5JOPD 3WD5L 4ZFOB 1H3TA 3O2VH 1YNTA 1J1XH 1KLUB 4Q9QH 2F58L 2FEEL 2EKSB 2Y5EA 1PQZB 3CSGA 2HYMA 1GIGH 4G7YL 1H9VA 4W6YB 5CJQH 5SX4I 5KVEL 3ILQD 2VLKA 3C87A 3L6FB 3OKLA 3ZSSA 4MXVE 4DKAA 4UTAH 5IMOB 4XXCA 4ZXBC 5HHNA 3SE8L 2D4FA 2FSEB 3GBNH 5KSAB 3MGTA 3VWJC 2BSSB 3NA4A 4AQOA 1QYGL 1T22A 1KCSL 2GIYA 4DCQA 2IAMA 3NOIA 1L6ZA 1MSPA 1ZE3C 5F88A 4DAGH 3STBA 3RRQA 4LBEA 5DVLA 25C8L 4F9PC 5HYQB 2VOTA 2P8MA 2HFGH 4S1DD 4G7VL 1X5GA 4JPIA 5CBAA 4X5WB 5BV7B 4LCYB 4WFGD 3QXVA 1A6ZB 2AK4D 5I8CA 3QEUB 3O3BA 3QXUA 3MO1B 3Q6FA 3INUL 5D7JB 2Z35B 1G7QB 3MXWH 4WJ5A 2ADIA 3P40A 1JF1B 2YD6A 1XR8B 4FQIH 4O2CB 2NX5A 2B4CC 2G2RA 1F42A 5J11B 1L7IH 5IFHH 4QNPE 2NY6D 3CFIC 3VXTB 2VE6A 4GG6F 3GSRB 4MJIA 2IEPA 3TNMA 1ZLVH 3UYRH 3V8CA 3IRZA 3BP5A 1AR2A 2OJZH 3MRNA 4P5KB 4PGBA 3LMJL 1DUZB 4X99B 3JVGC 3DXAE 4WTZA 1TQCB 4LGRB 1A6WL 2XWBB 3KXFB 4NZDA 4NDMB 4YXKH 1Y18A 1LK3H 5D7IB 1DBBL 2OX5A 5CEYB 2XIDA 2X1OA 4BYHA 3PWPA 2V2TA 4PJXE 4OM0H 1T2QH 4LIQH 1KPVB 4NGHH 4LSSH 3S3JA 1A0QH 3MRIA 4NRYB 1TVHB 3MNWB 3ZKXC 4MAUL 4U2YA 5T1MB 2FO4A 5DR5L 4JHZA 3G6JB 5DXWA 4MQXD 4EQ2A 3GBML 5C8JB 1LK2B 4IMKC 2C26A 1MCFA 4PJBB 4FFVD 4GOSA 1J11A 1HHHA 2VLLB 2YS4A 2YUXA 3SDYH 1P4BH 3IXAB 4ESKA 1MAMH 4OQTA 5I1GL 3KPLA 4ZYKB 4ZAKB 4EI5A 4LRNL 2NY0B 2KQMA 4Z7OF 3AVEA 1T3FB 4X98B 3NGBB 1DQQA 5L8KB 4PJFB 1T83C 2AJYH 1ITBB 4C56A 4RAHA 1NFDF 5A3IC 5GGUA 3ECBB 4ELMA 2DTML 1IFHH 2ZNXA 1FGNL 2D9CA 3O41B 1I3UA 3MRCA 1MWAL 1A3RL 1FO0L 3Q6GH 2CO6B 3LZFH 4Z5RB 5GJSH 2ILLA 1IC5L 3BEWB 5F7LB 4MNQD 4NM4L 1S3KH 1MHHA 4N1CA 2PO6D 2R2BA 4NNYB 4XMKL 1NPUA 2YRZA 4Y2DA 3ZKND 2VITA 3K1DA 2DMCA 3ESUF 2B8OT 1HHIA 1Q94B 2WAHA 2GT9A 1BFOA 1RUKH 1KCRH 1KTDB 1BZ9B 3OKLB 3T3PF 3GSQB 3ZE1F 4UV4L 5EUOA 4PJ5B 3PHSA 1EZVY 5IGXH 5HYFA 4N0UA 2OJEA 2P44B 4ONGL 3MGTB 4I9WE 3WNNA 3MA9H 4DCQB 1DQDL 3SGJC 1JPGB 4BSVA 4PB0H 1RZ7H 1PYWA 4UOW0 3ARPA 4M43H 4Z7WA 1ZSDA 1WT5C 5FHBH 3CMOL 3JWOL 4LBEB 1ZEAH 5JUEL 4EUPB 1AHWA 4JLRA 1OY3B 2H45A 5CBAB 1TTGA 1WFUA 4S1SH 2M1KA 4LQFH 4ODWA 3O6KH 3KPRB 4QRTB 3DIFA 5J3HC 4APQD 2PXYA 1RY7B 3Q6FB 4O9HH 5JNYA 1NQBA 4BUHA 4JDZA 1DBMH 2YPVL 1CU4H 4WJ5B 2ADIB 3PQYE 5KJRH 3TFKD 3GIZL 3K4AA 4YEFA 1FFNA 3MBXH 5D1QA 1IAKB 5HDBE 3V6BR 5ID0B 4XI5C 3U7WL 4DZBB 1XIWB 4U4BA 4CN4A 2VE6B 3PABB 3W39B 4TNVK 5AG8A 4KXZH 1RJCA 3TNMB 4BZ2H 1I9IL 3HB3C 5JPNA 2D7OA 4JCMA 3MRNB 4N9GA 5KVDH 3MLSL 2O5YH 4PLOB 3SDXF 4G3YH 2GQHA 2JB5L 1Y18B 5D6DA 1NKOA 3MRFA 2W9EH 4MA3A 2NY2B 4M1GL 1F4YL 4YFLI 4AENA 2Y9RT 4Z0XA 5HHMD 4RCAA 2I5YH 4L9LC 2W60B 5ESQB 4CMHC 1S7UA 2FECL 2X4UA 3QO1B 4ISVB 4U1LA 1A22B 2IFFL 3E3QC 1N4XH 1S7QB 2R39A 5DC9B 4KRPC 5C0CE 4DOHE 4EVNB 1T7XA 3LRSA 1WAAA 4RGNE 5IVZA 5EWIL 2X89A 3KPLB 1OP3K 1A64A 3WDHA 3RIAK 2F5BL 2O5ZH 4G8GE 4NFBA 4AG4H 4E41D 3T77B 4V1DA 3T2OA 2P8LB 3VXRE 1XGUA 2W59A 3P9MA 1F6FB 3IDYB 5KSAD 1QTYT 5GS2D 1P84K 4NJAH 3ARBC 2HRPH 2QLVB 1QSEA 4C56B 5C71A 4FQJL 3NCFB 5GGUB 3V5KA 1M7IB 3ZE0F 1G0XA 2M8XA 3ULVC 3WIFA 1XAUA 3MRCB 3TN0A 3PNWA 5LBSH 1U92B 3FHAA 1ORSB 1U8PA 3O8XC 2PTVA 1XF3A 5SWSE 2CPCA 1NGYB 3BGAA 1TXKA 1OHQA 3SY0B 3VMPA 4Q7DA 2AV7A 5B39A 2E7LA 3O6LH 1SYVA 2SEBA 5DHXB 2R2BB 5FCUH 3G5ZA 2WM0A 4PJIF 1H3WM 4Y2DB 4YDKH 2VWEE 5D7JD 3RKDC 1HHIB 5JOPE 3E6FA 2GT9B 1F3RB 1QLFB 4XNUH 4Q9BA 4MHHG 5EUOB 1EMTL 4MA1C 4N0UB 2O61A 2OJEB 1OGTA 4YGAB 2DQUL 3BQUB 2ZUQB 1R3KA 2F19L 3GSWA 3MRBA 3IS0X 4BH7A 5CKAA 2WBJB 5JXED 1M6OA 1UACL 5IMKA 4BSVB 1MWAA 1Q9KA 1BFSA 1PYWB 4Z7WB 2PYFB 3KXFD 3UAJD 4PGDA 3C6SB 1IC7L 1MFCH 3PP4H 1WWWX 4Y19A 2XA8L 5BZDA 5HJ3A 3IVKA 1HH6B 3OPZH 1G1YA 2AABH 5FKAB 4G8FA 4OD3H 4XB8A 4ODWB 3L3IA 3U46B 3UTSA 3M07A 2EO1A 3I50H 4UDUB 1MIMH 2EEAA 1KN2H 1S7RA 3NH7H 1H15A 1VACB 3OJMB 4KJWD 4I8DA 4L8BB 4RNRA 5C09D 5JNYB 4JB9H 1SJVA 4OT1L 5FA4A 2PYED 2XKNB 3GSVB 1YDPA 1YEGL 3CD4A 2R4RL 1FZKA 5C07D 4PJ9C 3M8OH 4V2CB 1HKLL 3X3GL 3TVMC 2QQKH 3I3BA 4WHCA 5I1HH 3IDMA 2XQBH 1RZKC 4CVXA 4BH8B 3UXFA 4FA8A 3W9EA 4LEXH 1HDMA 4N9GB 4HQQL 1ACZA 4OZFB 2WLZA 3CVIL 1DLHB 1IEAA 4NWTH 4XC1H 3EIFA 3FT2B 3WDIA 3CFJA 1JPFB 4MA3B 3NAAH 3DETD 3RY6A 1WJ3A 4G9DB 4U6HB 1KIRA 3WFEL 5ITBL 1LDPH 1JNHA 2E7CA 4NC1E 2UZXB 4JANA 2W9DL 2F8VA 3BYYA 4JY6B 4JQXA 5HVWA 5EU6A 4EOWL 2OR9L 4GJTB 5FUZH 4HGWA 2X4UB 2ADGA 4M7LL 1UWEH 1WZKA 5D2LA 2R4SH 4RFNB 2C1OB 1MCWM 4RMSA 3RBSA 1U8OB 4RZCB 4Y1AA 4GAJH 1DANT 4HWEL 1BQLL 5I6XB 5L6YH 4FABL 3AU1A 5GRWA 3TBWB 4R8WL 4QCIB 2VDLL 1OAYH 3FRPG 2B0SH 2C4FU 1XGRA 1AE6H 4W81A 2EC9T 4A6YH 1P6FA 4KXZI 5T3ZH 3BIKA 3RWGA 4KHTH 4CGTA 1IRAY 1QSEB 4UINL 4CNIA 3QWRA 3I02A 2IAMD 1NBYA 4KKLD 3S36X 3CFEA 5GRUL 5B3NA 1FLRH 4N0CC 1ZANL 3RY5A 2NXYC 3BKML 3C5ZA 5E8OB 2X7LA 4Q9CA 3AUVA 4R7DA 1XF3B 3SN6N 1IQWH 4F8QA 4HUWB 2VXUH 2AV7B 4HZLB 3QT2A 4HS8H 1SYVB 3SKUD 1PX4A 2MQ3A 1UKTA 4XBEH 1KG0A 5J13B 4MNGE 3QUZB 3W2DH 3G5ZB 1TTFA 3FAXA 1NDMB 1MREH 1UXWB 3RL1B 5E08H 5IFJB 4MNQE 5GS1C 1NEZG 3DTXA 3E6FB 4ODTH 2B1AH 2XY2A 4XZUA 4J4PC 4UAOC 1YPZF 3WXWL 4G6JL 4UQ2A 4XAWL 5FYKH 1RFDL 1KB9K 1XIWD 1YN7A 1OGTB 2O61B 3DV4A 2XFXA 4MJID 1LEKA 3MLXL 3PWUB 1TQBB 3GSWB 3MRBB 4PJGA 4G8IA 5CEZH 3QUKB 1EEYA 3SDAC 1MWAB 4I3SL 4NNXA 1KJ3L 5J4MA 3MRJB 1FO0B 3U4AA 1L7TH 3WS6C 1HEZA 1RU9L 2IQAA 2R0LL 2YK1H 5TE7L 2JJSA 4U1GC 4Y19B 1JZ4A 5ANMB 1IBGL 5J56B 2CUIA 32C2A 3HC0B 3LPFA 4S2SA 5BZDB 1MY7A 5HJ3B 1PEWA 3IVKB 2QADC 3H9YA 1C1EL 1I9RL 3SKJH 1SQ2N 5D5ME 2ICWA 1WBYB 2VZTA 3OGOE 3UTSB 4BKLB 4U0RC 5IBUG 3BXNA 5F1KC 4RNRB 1H15B 3QFJE 4TVPD 2MQCA 1PKQE 1IAIL 4H25B 1P9MC 5AUMA 3HE7C 4BSJA 3SGEH 1FDLL 2E9WA 1YNKH 3TBVA 4CRPA 3EYSL 5FA4B 4PTUB 5EIQA 2BHZA 1A6TA 1TCMA 3UTTE 2IMNA 3TT3H 5DD6A 5BZWA 2VLRA 1GGTA 2QV2A 1ZOXA 4KMLB 4NQCA 3IDXL 4WNQA 1MI5E 3LPGA 1MFNA 5CS7A 5T5NG 5CILL 5HYJA 3RPIB 1VFAA 1D3CA 5IHZB 4CVZA 1QPPA 4LVEA 4ETQA 4EI5D 3VWKA 2FX8L 1YUHA 1OGAE 5DTFB 4ZOBA 2Y6SC 3NABL 2ZP0T 4NOFA 5KAQG 1JWSA 3L3JB 2YUZA 3O45A 3UC0L 2B2XL 4C56D 4Q9RH 1KIRB 4ZFFB 3EYFA 1W8OA 2F15A 3RGVC 1KJMA 1S9XB 3PGFL 4NFCA 5F7EH 3QCUL 2E9JA 1F97A 4JANB 3VI3E 2APBA 5ETUA 4JN1L 5HPOA 2GJ6E 5E95B 1OL0A 3U9PL 2VR4A 4R4NC 5D2LB 2GTWB 4MXVF 2J5LB 1JZ5A 1EA9C 4AYFA 4HIHB 3DPBA 1YY9C 4X6CA 2D0HA 1MCEA 1JWUB 1TNNA 3UDWA 4DW2L 4Q58C 4HX1A 4Y1AB 4Y2DD 3VGHA 4NYLA 4Y5XC 4KKBD 5DFTA 2NR6C 2ZSVA 2VDMH 1U8IB 1T6VN 4NO2A 5EORH 1A1MB 2H3NA 3UTQB 5EU3B 1GGBH 4KK9C 1LMKA 5ISZA 1IM9A 1OQOA 3SDCC 1H5BB 2AXGB 1KBGL 1T1ZB 4HHAB 3RWGB 3BIKB 4PJ7A 3BQUD 3QH3B 1S5IL 3QUYB 4CNIB 5HYSA 5T3XL 2V17L 4YZFE 3F62A 1CXLA 4Y16B 4MAYB 4AL8L 5I1EH 1Q0XH 1BFVH 2PW2A 1ZA6A 3X12B 3C5ZB 4WI9A 3N9GH 1J5OL 1VESA 4JEGB 2JJUA 5C70A 2X7LB 2F53E 2DD8L 3LSOA 2EE9A 3EO9L 5SV3A 4QNPF 4DEPC 3VXUB 1KG0B 2DLFH 3PHQA 4JZJA 1CLYH 1X5KA 1OAKH 4YPJA 3EZJB 4KJYA 4JFPB 2PXYD 4J6RL 4WI8A 3WJJC 4R90H 3S3PA 2IH1A 3JWDH 3MJ9H 4PB9L 1VFOA 1DEEA 1NCNA 4DJMA 1GC1L 4YC2B 5GS2H 2EICA 3LH2H 3BP4A 5C0DB 2PETA 4UQ2B 1B2WH 2V2XA 1ZVSA 4M1CD 1LEKB 4PJXF 5DWUL 5IP4A 1R3IL 2VB5A 4YUEL 3H9SE 4G8IB 5IESH 4NNXB 1RIUL 2F8XC 4UI2A 2R2EA 4JFOA 4N9OB 1HEZB 1JZ6A 4N0YL 4R7NA 5DMGC 2IQAB 5IQ7H 2DBJA 1WCBB 4ONHA 4JZNA 5BV7H 5BQ7B 2Q7YA 3RVUC 4S2SB 2J8UB 4RGNC 3T0BA 1AIFA 1U3HC 1XF1A 3AREB 1BM3H 1NJ9A 2VDPL 3ZTNL 3BT2L 3OTTA 2H32A 4HBCH 5I15H 2CRZA 3EDEA 1Z2KA 5AUMB 2WIIA 2I9TA 3LKRA 1H8OA 3TBVB 1J0YA 5EOTA 5D71L 5EU7E 1RSFA 1A6TB 3VXOA 4OCXH 2YMXL 4DGVL 1UA6L 2JELL 4I18C 1UWGL 2VLRB 5C09E 2C1PA 2NW2B 3RA7L 3CX5K 4NC2B 2PYEE 1YMHB 3PHOB 5CJ8A 5DVOA 2ATPB 3BKCL 5C07E 5KN5B 3H0TA 4JRWA 2X89D 2VXVL 4CVZB 4OGAC 1I8MA 4GMSH 2EDQA 1V3KA 1YUHB 4NUGH 3O3AB 5D7KE 4WCYL 1J10A 1H3GA 5CMAA 5DHVB 1QSED 4YHNA 3BZFB 3HUJA 5CSBA 3DJ9A 3BRGC 5HGDB 1RD6A 3MRPA 3TN0D 3SOBL 3NACL 1U58A 3MRMA 1OARH 1S7TB 3LS4L 3C09C 1IILE 4LF3A 4QTHA 2H26A 3QRGH 3SGKA 4WFHE 3ILQC 3SKMB 2WANA 2VXTH 3VU2A 3MREA 2A77L 4OIBA 5HGAA 3D9AH 5ERWB 3QUZD 4HX1B 4XNZC 4Y4HA 3SGEI 4ENED 4P3CL 4NYLB 5F9JA 2J6EA 5E99L 1QVOA 1RZFH 2NY7L 4QO1A 2ZSVB 1M05B 2QQNH 4WI4A 3ZYJA 4MNHB 3QUMA 2M26A 1F00I 1S9WA 4J3VA 4PJDB 3QDJB 2MHAA 2VQ1B 3IETB 4X8JA 5JA8B 4OFKA 3LKNB 4S1DC 1VADB 4WENB 2HJLB 3D25A 2CXGA 5HYSB 1QQDA 2VLKE 3S34H 5EOCH 5D8JH 1HILB 5FO7A 4OGYL 3RVTD 1HE7A 3BWAA 4NM8L 1CFNB 2PW2B 3QFDB 4QXGH 5I1JL 2UWEB 4XNXL 2CRYA 3B3IB 3GSNH 4L8CA 4Y19D 3GMQA 1JNNL 3WFBH 1U41A 5ALCL 5F7FA 1RVFL 2AEPL 5HDBF 3RJDA 1FCGA 4YHYC 3MOBH 3TLRA 1XGTA 1KJ2L 3UTSD 5IMLA 5FO9A 4KJYB 1D5XA 1YNLL 1T1WA 2I24N 5JHDA 1NCCL 4KK8D 3VXMA 2BSTB 5INCA 4ZFZA 1E4JA 1T20B 4YEEA 1CXFA 4MCZA 2BVOA 2RFXB 1MLCA 4WW2F 4I13B 5SWQA 3OR6A 1BBJA 1T7VA 1ZVSB 3ILPA 4NN5C 2NX5E 1GJIA 2VL5A 3U4EA 4ZFGL 5IT2L 2EYRB 5BCAA 3LKPA 3T2QA 3P3YA 4HWUA 5LJYH 4NWUL 3VD9A 3IAGC 4MJIE 5ILTH 3BEVA 5HHVL 3E6HA 2IPTH 4GRWB 4R7NB 5K9JH 2VLMD 4ZD3H 1FSKC 2B1HL 4IDLA 2W92A 4WRLA 1AGEB 4M8QB 5JA9A 1HH9A 1NUDA 1AXTH 1EUTA 4W70A 2CGRH 4IDJL 2Y06L 5INDB 1ZV5A 1LO3L 1FPTH 1W2KT 3IF1B 1TZHB 5FGBA 2H32B 1U42A 1XMWA 3PWPE 4KTEH 2WIIB 4R4FH 2I9TB 3LKRB 1XF5B 1P53A 1ZHNA 1AGFA 5C6WH 1R0AL 3ARDA 3DX7A 2QR0B 4FZ8L 2FD6H 5C0AE 1X5HA 5EDXA 3V7AG 4GKSA 4NQEA 2GAZA 1OVZA 4X0KA 2YD7A 3BW9B 4M3JA 2WUCL 1CF8L 4Y1AD 4HAFA 3U2SB 4PG2A 3WHXA 2DM7A 5IW6A 1EGJL 2EH7L 4JJHA 4XXDB 3EDJA 3MNVA 1G7HB 3V6FB 3O6FB 1EAPA 2NY1B 4XP4L 5C2BH 2C7UB 3WHE0 1C16A 4XNYL 4CW1B 5TQ2H 4KRNA 4S11A 5F7YC 3ET9F 3V7AE 2NXZB 5GSVB 1V7MH 2PO6C 5JW5B 4Y16D 2AJXL 4UIMA 4MAYD 3ZKNC 5AWNL 3MRPB 1FN4B 1NCUA 3JV6A 3V79C 3C5ZD 3TO4A 1IC1A 3NIFE 4XCNA 3DOSA 1JNLH 4XVJL 3MC0A 3CFDA 1WCQA 4ELME 2XN9E 2NLJA 2AKRA 1NUNB 1QD0A 3MREB 4KVNH 2GK2A 2C3VB 4ZUVA 5HGAB 5IWLA 3VXUD 2EEDA 3L5HA 3QWOA 1A9BB 2VMFA 5FKPA 5EG6C 5JOEA 2AXFB 1QRKA 2OR8A 1OF2B 5DEGB 2G60H 3KYOA 1PDKA 4ODUA 3MACH 1XZ0B 4EDWH 2XTLA 4X8JB 3IXTA 1LD9B 2AQ3A 4M7KH 1LP9A 5IQ9B 4HK3J 1D6VH 1H3PH 4NQVB 3D25B 2WLYA 4ELKB 1QQDB 3HE6B 2Q8BH 1G7PA 5FYJH 3WCYA 3ISWA 3CCHA 3HNVL 3CDYA 4P3DB 4PGZA 5FO7B 1GVIA 1WFNA 2IPKA 1T0NA 2YEZA 3AAZB 3BAEH 4HW6A 5F3HA 4APQC 5C3TA 1WEJH 2FBJL 4L3CB 1NBZA 4Y5VB 5KVFL 4OLYH 2YKLH 3O2DH 1PVHA 3TIDA 1MFEH 3SJVB 2OP4L 3DUUA 4GSDL 4BELD 4XC3H 3TFKC 4E42B 4LCUA 5BW7C 2AI0H 4WHYH 2LVCA 3ARED 5H8DA 1QSFA 3RZWA 1HHKA 4HDIA 1PZ5A 4Y4FA 2HKFL 1XGTB 1T5WB 3TH2T 2GITA 1T1WB 5E8EA 3MCKA 1I9EA 3NPSB 5CP3H 2XWJB 2CLRB 4PGEB 1YYLH 1JHLL 4ZFZB 5HGHA 4MCZB 2BVOB 2VLRD 4WO4B 4DZ8A 5J12B 1UB5A 3OR6B 1BBJB 1CFVL 2GI7A 5TDOA 4ALAH 3VXQA 2FH8A 5KS9F 4D0CA 5DVNA 3VGAB 2UZYB 1C5BH 3GSNA 1B0GA 4HPOL 3MV8B 2DJSA 5SX5H 2ADJA 3LKPB 5KG9A 1CE1H 1MLBB 2AJZA 4RBPH 3BEVB 5ENWB 2R8SL 3F6IA 3VW3H 3QCTL 4OLZH 2ICEB 4XH2A 4Z7UB 3S4SB 5CGTA 4OFDA 4WW1B 4WHTA 4YHZH 5ABDE 5EC1A 4DGIH 4TSBH 1WBZA 4LP4A 5KVEH 4Y8AA 4N1HB 3GK8H 2R1WA 1MJ8L 3WIHH 5F8QC 2X05A 5T33H 1QFWL 1ZHNB 1N8ZA 3DX7B 3QHFL 1CWVA 1RURL 4GKSB 3FTGA 4IHOA 3EOYG 5JHLL 3OKNA 5KSAC 2FR4A 5CBEA 4CU7A 3TH4T 1XF4A 3WHXB 1LO4L 4OZFH 4LVNB 4UTBH 3MNVB 2EIZB 3C8DA 2V2WB 1FG9C 2G5RA 4J3SA 4NZRH 4Z76A 1EAPB 3QDJD 3I3DA 5T1KA 1L4IA 4XGZA 1WC7B 5AZ2H 2MKLC 1C16B 1IT9L 1KLGB 43CAB 4K9EL 2VDKH 2DBLL 4LIQE 4KHXH 3RUGA 3HLAB 5F96H 2W65A 4V1DE 3D69A 3RAJH 4UIMB 2X4TA 1Z3GL 4LKCB 4YK4B 1NUGA 1VPOL 2XTJE 3P11H 5C9KA 4XPAH 4XCNB 3K4ZA 4JHWL 1GGUA 1RIHH 1E28B 2NLJB 3LQAC 2NYYC 4P2RA 2AKRB 3CVHH 4KQ4H 1D5ZA 5EZOL 2GY7B 3WV0A 4ZUVB 4O02H 5HTSA 1J05B 3J7HA 5FKPB 3OZ9H 3PWVB 5GGRA 2CK0L 1P1ZA 2DQEL 1QBBA 4ODHH 5FOBB 3J8F7 2W38A 4NKQB 4H8WL 1A6VL 3MFGB 3OV6A 5I1KL 1P7KA 3KYOB 3GZKA 2AVGA 4ODUB 2VZOA 4JKPL 4GXVH 5F6IC 3UAJC 1E6JH 2EYTA 3ULSB 5ADPL 3DVGB 3IXTB 1F5WA 5C08B 1N3NA 3B8SA 5DSCB 1R24A 1EBAA 1EJOL 5F1OB 2I60L 1LP9B 5EOQH 3G08A 1E4XL 3DMMC 2A9MH 1G7PB 4MAUH 4O5LH 5EU7C 4JFZL 5C0FB 4P4KA 4UB0L 5D5MF 3OJ2C 1TZGL 3PWNB 2IPKB 4HWBH 1O5DT 3GBMH 1NAKL 2FJHA 3DV6A 3TIDB 5FHAH 4EDXB 4MB3A 3CH1B 5HD8D 1QPXA 1F58L 3MV9A 5DK3A 3VMOA 1ZVYA 2R2CA 3VXNA 4HV8A 1LILA 4Z6AT 1CGWA 1HHKB 4YDVA 4K23H 1PZ5B 4Y4FB 5ICYA 3QDGB 2YZ8A 1JPTL 4XP5L 2VDNH 1WIOA 3DVNA 5B38B 1NSNH 2OQJB 3IJSB 2CLVA 5E8EB 3MCKB 1SM3L 4FXGA 3B43A 1EFXB 1NCDH 4YDLB 5E8NA 3CLEH 3F7PC 5C0GA 3MRRA 3VH8A 2L4OA 4UQ3A 2Y7QB 4L9DA 3B2VL 1OSPH 1QBML 2DTMH 3NGBC 1SMAA 1UB5B 5TDOB 5SWZB 2DQFB 4G6KL 3HG1A 3O2DA 4JQIL 3FB5B 4H26B 4MQ7A 5TE6L 4KUZL 4XCEA 2E8ZA 1KENL 3NN8B 2ADJB 1B0WA 2ORBL 4N8VG 2AJZB 4LAQH 3SKNA 3O6FD 4XVSH 3ZYOA 5JXAH 1G9NC 3BN3B 5T5NF 5IUSA 3VI3F 1MY5A 5I0DA 5DRZA 1NL0H 2NTSP 2XPGA 4PJCA 3HC3H 4U1JA 3S37H 2Z91A 1KJ2B 4ODBD 1FE8H 2NXZD 3EOTH 5DQ9B 5EC1B 3WE6A 3ZDZE 4LHUA 5KAQF 1CFQA 2X5PA 4U1SB 2R1WB 4NN6C 5D7SL 4UV4H 3EOAB 2LAGB 1N8ZB 2EO9A 2F54B 4LCCA 4XXCC 1RJLA 4MGXA 3FTGB 4IHOB 2K1MA 5EU6E 3OKNB 4BZ1L 2FR4B 3CMOH 4N8CL 2IAMC 4NHUA 1KXQE 4KKLC 2HP4A 1G6RL 4GS7B 3WL9B 4YZFF 3FKUS 4ZTOH 1BD2A 2DYPA 4OBSA 4X7DC 5D1XB 1KPRA 4Z76B 2DOCA 5FOJA 3AS1A 5FYLL 1EVUA 1HI6A 4XGZB 2HAZA 1REIA 5IEKA 2Y07L 3H7BA 3MCG1 2HT4D 1P7HL 2R9HD 1N59A 3D0VA 1YJDH 3RUGB 3QG6B 1WICA 1NKRA 2ZWLT 4X9BA 2GJZB 1N26A 3DVIA 1AQDB 1CIUA 3S3SA 5JQ6H 2G9HB 3MJGX 4GKNA 3SE9H 1BF8A 1GRWA 3SJVD 2HFEA 4YXLH 2IBZX 1ORQB 3VD5A 4P2RB 4FFWD 5EN2A 2GUOA 2LU4A 1D5ZB 1E6OL 1IQDB 5GGRB 1P1ZB 4UOJA 3A6OA 3IKCA 3VFVA 5JZ7D 3VGBA 4R0LA 1VEOA 3VXMD 3KJ6L 3BWUC 1X3DA 5TFSH 1R24B 4POZC 4M4RA 5T3XD 4I0CC 4I77H 3GKWL 2KH2B 4P2CG 3TP4A 4JKMA 5TF1L 1FNGB 1MVFA 3GI9L 5K59F 1N64L 4JZOB 1BQHB 1UVQA 2DQCH 5C7XL 3DV6B 3SPVA 1VEPA 3CGTA 4PJGE 3ZT5A 5JIPA 4KI1A 4LP5A 4CUCA 2QEJA 3MV9B 5L88H 3QAZC 4HV8B 3MLTB 1BREA 4YDVB 2FB4H 1M71A 5ICYB 2I9LA 1UZ8A 3FN9A 5IBLC 2B5IC 4FQXA 3LKSA 3R1GH 1CLOL 4FXGB 4PUBL 2C4FT 7FABH 3RY4A 5C0GB 4OLUH 2N1KA 4MS8C 1ADQH 4UQ3B 5DMIH 4EI5C 1OP5K 2R0WH 3CLFH 4X80L 1X5YA 4NZTH 4LASH 1Q72L 1YMMA 4P9MH 4TYUA 4L3EB 3LPWA 5I8OL 3MGOB 2PCPB 3IDYC 3H3PL 5KVGH 4S1QL 2DS4A 4M5YL 1KJVA 2DMBA 3HG1B 4HIEA 4PLKD 1CS6A 1T80A 4MQ7B 3SQBA 4F8TA 2W07A 5I16A 4XCEB 1S7XA 1Q0YH 2BXYA 2ED9A 3SKNB 4NQCE 5JLZA 5DUML 5C0BA 1IL1A 4C55A 2A38A 5DRZB 5HYJE 1NAML 1I3VA 1SJHA 1OAQL 5GS3A 1IM3A 3O4OB 2Z91B 4S0TD 4QRPE 3GUTA 3RWFA 3BUTA 1CXKA 4U6XB 3FO2B 4YHOH 3WE6B 4Q6IA 4Y2DC 2ITCB 3MR9B 1Q1JH 3P30L 4KKBC 3GMLA 1NGQH 3HA0A 4OLWH 4KRMB 4U1KA 4RGOL 1J9CT 4LCCB 4HH8A 3QHZH 1RJLB 1WV7T 5GGSB 1NMAL 3RU8H 2XI9A 3P0YH 3A6CH 5BRZA 5MEOB 2OMBA 2MPAH 5GGVL 4NHUB 3WFZA 1HNGA 4GQ9L 2R0KH 1BD2B 4X6CE 2DYPB 3LN9A 4DUWA 4NO0B 4PRBB 3OKOA 5F1SA 5DHVH 2NZIA 4NZUH 1AHWC 5C08D 5I74B 5IEKB 9CGTA 3JUZA 5GIRA 3G9AB 1N59B 1CD0A 5HSFA 2EC8A 2HT2D 4PYGA 4E0RB 5ISZE 4JO1L 3PDDA 2XY1A 1GPOL 2PXYC 1RUQL 2R4RH 3IFLL 4WI2A 4PJ7E 1HKLH 3F7YB 5EUKA 4GKNB 1QNZL 1RULH 2OTUA 5HHXL 4NO3B 4DKFH 4Z7VA 3ZL4L 2HFEB 4Y88A 1HYSC 3RI5K 5D1QC 1QSFD 1HINH 1QZ1A 3WFCH 4Y4FD 2IFGA 3WEXA 5IG7A 1HSAA 1R6VA 1X5JA 4ZOEA 1G6RA 2MOVA 3S7GA 4XP6H 5I18H 4GG6B 4WEBL 2AK1H 3JWNC 1EFXD 4RAUB 2IG2H 3VFNA 2DQJL 4KZDL 1WTGT 4R0LB 4KJQD 1DBJL 1UM4H 4MJ4A 3WFEH 5L8LB 3S5LG 5D6DC 4Y4KA 3MV7B 4LVOC 5T3ZE 1J8HA 1WZ1L 2ZG2A 3FN3A 4DN4L 5SWZD 5E7BA 5DMYA 1U8QB 1T03L 2HG5A 1KXTB 3F5WA 2XXMB 4M7LH 1UVQB 1I8LA 1A7BA 2Y36H 3Q1SH 4M5ZL 5F9OL 4H1LA 2EIBA 4N5EC 3TA3A 1ZHLB 2RR3A 2CDGA 3R06B 4M61A 1EHLH 4UBDD 4WVRA 5F7KC 3EYUH 1XGPA 1EERB 1ND0A 4RFNC 1MJ7L 4RWHA 4LSRH 2XNAA 3ES6B 4RRPA 3VI4E 3MOAH 4IMLA 2P47B 4OF8A 4CMMA 3MRDA 2WBWB 1QHOA 4WFFD 3LKSB 5MEPA 5I6XC 2O5XH 4LFHD 4LSVL 3GB7A 3VD4A 5TH2B 1HCVA 3VRIB 1R3JA 2F54D 3KPNA 1I7TA 3HI6L 3QPXL 3CX2A 3BKJH 5FA3A 4RWYL 5J89A 1YMMB 2FJFB 5FYKE 1VKXA 4Z9KB 4KTYA 2ADFL 1CGUA 2OR7A 2X09A 3KYKL 1CXEA 2XTJC 1CK0L 4M03A 3BKMH 4G9FA 4ORZC 3EZ8A 4XWOD 4HIEB 5CEZE 3BP6A 5I16B 3ARUA 1OP9A 4J7RA 1S7XB 1NFDB 2DF3A 4HJJL 4PJAA 5E2TL 3WLBA 3TN0C 3NFSL 2WWKT 5D1XD 1B88A 5C0BB 3NIFF 3STLA 2GEEA 4ELMF 4B7IA 3BPLC 5JDJA 2E7LC 1YEJH 3V0AC 4XTRD 3RWFB 4MB4A 2GYSA 4POYA 2FECI 3WKMH 5J13C 4Q6IB 3UJJH 5L8JB 1GAFH 4P23A 3D0LB 1OCWH 3TH3T 2LU3A 3K2UH 3GMLB 1KNOA 1ES0A 3HUJE 2BRRH 5E9DA 1FZMA 4PD4K 4LARL 4MD5A 3FQWA 5MEQA 4GRMB 4P2RD 4K3JH 3ROLA 35C8L 4ZTPL 1F8TH 2PF6A 4P2QA 5A2KH 4RFOH 3FMGL 1NANH 4KJPD 5FXCH 4L1HA 4YLQT 4YIQA 3UJIH 4K3DL 2F5AH 4TSCH 4MSWB 1LWRA 1NBQA 3KPQA 4LVHC 5EUOF 2DWDA 1MCBA 3NCEB 4UIKH 1OAUL 4ZXBB 4HUXB 1I9RH 1SJEA 5K9QI 3U4BH 3MRQA 4TNWF 3BI9X 4JVPA 2IGFH 3VWJB 3S88H 4FXKB 3L7FB 4Z7WF 5BJTB 3DO7A 3L3OA 3QDMA 1RZKL 3VCLB 3TV3H 2Q20A 1CDIA 2Y23A 5CUSL 1RJYA 4Q0XH 5DK0A 3UMTA 1OD9A 2VSCA 5EUKB 3A6BH 1KPUA 4KK8C 3DNKA 2BK8A 1JHKL 3KPMA 2A6IA 3MV9D 4GG8B 4PV9A 3FFCB 3PP3H 2DQTL 4JO4L 4TQEL 1WISA 4TSAH 2YD3A 3WIIH 3OJDA 1U93B 5IG7B 3UTZB 1HSAB 1U8MA 4MA8H 5C92A 1RUML 1G6RB 4YFLF 3JZ7A 4WY7H 2H9GB 4F7PA 4PFEA 4HLJA 3VFNB 3JWOC 4ZPVB 3I6LE 2HFTA 4FP8H 4K71B 3HFMH 5T1DH 4Y4KB 3SDXB 5JHDE 3TBTA 5MHSE 1J8HB 1OPGL 4KGLA 3OSKA 3RY6C 3HG1D 3VXME 5IIEA 5E8PB 2HG5B 1H3XA 3PGCA 3B2UD 4J8RA 3W11D 4ZUUA 5E2WL 3PGDA 1MRDH 5I8KL 4R26L 1CL7L 1YYML 1YQ2A 4P46A 4JQXC 3QCVL 4UOW1 5HGGS 1EX0A 2E9IA 4H1LB 5EIIB 3ARVA 1MQKH 5AAWA 3EFDL 1FORL 5D70L 5EBGA 3BE1L 1XGPB 1ND0B 2NNAB 3V7MA 5GGRY 1FRGL 2I07B 4IMLB 4O51A 4DN3H 4QXTA 1KFAH 4WWKA 1A2YB 3GB7B 3QQ9D 5GGTL 3PV7A 1DE4B 5CD3B 4WUUE 4K7PL 5C0EA 1FFOA 4JFDA 3KPSA 1FNLA 4RGMC 2V17H 4HUKB 4CBPA 5EBWB 5LGHH 3OMZA 3T4AB 1J5OH 2BC4B 4OLEA 3K8LA 1NLDL 3FO1B 4DVBA 1T89A 3MA7A 4NQEE 5IKCB 2QKIA 4JQVA 1BD2D 2DYPD 3MRKA 1DLFH 1J0ZA 4NO0D 3C5ZC 4TUKH 5ITFA 5DQDL 1B9ZA 4ZO6A 4EN3A 5HI5C 1LO2H 3UP1A 3KWWA 1FNSL 3SEPA 4QKXB 1VHPA 3QZWB 5D2NA 2NTFB 2COQA 8FABA 5H37H 4HKJA 1SEQL 1BLNB 5D1ZA 2FATH 1S5HB 3NCJH 4K55A 3C8KA 5K93A 4H0GA 2BNRB 5D7LA 1KNOB 2FIKA 1FZMB 3FQWB 5DJ8A 5MEQB 4P5TA 4AIXA 1D5BB 5J6HB 1MCPH 1UH2A 5CZKA 4P2QB 3PDOA 2BY1A 1WGOA 2AXHA 3QR2A 1AI1H 2EH8L 1F90L 1UENA 5FK9B 4RBPK 3MLPA 4GXUN 1FAKT 3HI1A 1DN0A 1N6UA 2JJTA 1C5DA 1SY6L 4YJZL 3KPQB 4JAMA 4DFIA 2Z93A 1INQA 4HUUB 5I1CL 2EDOA 2EIDA 1NAMB 4OIIL 1GGCL 4X7CC 1SJEB 5BO1L 3MUHL 2JJSC 3IU4L 1KGCE 3MV7D 4LLDA 1JV5A 2CXKA 4I3GA 5GS0H 5KSBA 3OB8A 3SE3A 5I0ZA 2YD5A 2D03L 1P5VA 1UKQA 4NNPL 5FO8B 2GSIA 1ZWIB 4PY8J 1WQVT 2V9TA 1FC1A 2VZVA 1QLEL 1I9JH 3WN5A 4M9PA 1KPUB 4W6XB 1FVDA 2DI9A 2A6IB 2AEWA 5GGSY 4M6OH 2EYSA 5JIHA 1CYGA 3BO8A 3OJDB 1DBAL 1LEGA 3A67L 4ONOA 5FUOH 5DA0B 3RFZC 2VSDA 1VGKA 1SBSH 4K2UH 2HLAA 4EI6A 1OAZH 1U9KA 4Z8FL 1JGVH 1VFBB 1QSFE 3VXPA 1FYTA 5LKNA 2NQCA 3VWKC 1UM5L 5JW4M 4GKZA 2NW3A 1YMMD 1T66D 4QRQA 4RDQG 3ZHLA 2C3XA 4O2EA 3RWEB 1T04B 1KIUA 3OKEA 5IIEB 3DX9A 3BYTA 3PGCB 4J8RB 1U8KA 3ZDZF 4ZUUB 3PGDB 1AP2A 4XP1L 5ADOL 2HA1A 4G43A 1CFTA 2A77H 2CH8A 4P46B 1IEBA 1IC4L 5C0BD 4QRUB 1IGYA 3GFUA 1JK8B 1HHGA 3LRGA 5DGRA 1WZLA 4PIRF 3RNKA 2R1YA 2NY7H 1IZJA 4DVRH 1OTSC 3ULUH 4EUPG 1AO7A 4LKXA 1V8HA 1D5IH 3UDWC 5DRWB 2DLHA 4Y2OA 5DMKA 4QXTB 1PSKL 5D2LF 2VLJB 2VC2H 3H42H 1N6QL 1MPAL 3IB4A 4PJ5E 3DRTA 4XMPL 4URTB 1O7VA 3BSZH 4S1RH 1FFRA 4P5MA 3QEGH 3MQIA 4JFDB 3KPSB 4LCWE 1L9NA 4KRPB 4QHUA 3VG0L 1GSMA 2X44D 1NGPH 3FZUD 3AROA 1DSFH 4WIQA 3MCLL 4TRPL 4DVBB 4KDTA 2DJ4A 1WZMA 2XICA 4QHLA 2CLZB 3HI5H 2QKIB 4LGSB 5JORA 2B7DT 1YEHL 1QFPA 4ZXBD 2OCFD 2DLIA 2BCKA 3ARBB 4GKOA 3VWJD 4Z77B 5J1AA 1P7QA 3OHXB 4YDJA 5D2NB 8FABB 2ZG1A 3KR3H 1U8NA 3MLWL 3MZTA 4U1MA 4JZJC 2ICCA 4JFHD 5GGTA 1U6AH 2ZPKH 4RMTA 3LDBB 1BIIA 2ARJQ 1RZGB 2HWZH 4JRXE 1KACB 3O8XB 3BGFB 2FIKB 4AH2A 5B21A 1TJHL 5IVOA 3FFCD 4F9LA 5L2JB 4WI6A 3CJJA 3DXAA 2H1PH 4JHAH 3MGAA 1YPZB 2VERN 2HT3D 4M6NL 5GHWH 1P4IL 3QO0A 5H2BB 1DN0B 4L4VB 3L5IA 1NC2A 3LIZL 2HN7A 1WFOA 2BNQE 2QSQA 1TJGL 1V7NL 4LMQE 2XZZA 5E7FA 5FYLD 1MRFL 1CD9B 1U8LA 4DKEH 3FQNA 2K9UA 4IDJH 2Y06H 1X4ZA 5DEFB 4OGXL 1LO3H 4PJGF 4Y4KD 1J18A 1JFQH 4LLAA 1J8HD 5HD8C 5AZEH 3OKMA 1NCAH 4L4JA 1Q9OA 3OR7B 4ODSH 3T1FA 1B6UA 2VKWA 2JK5A 2YRPA 1GGIH 1RZJH 4DUXA 4P0DA 5KW9H 2GJJA 4JY5L 1X5XA 3OBAA 4OKVB 4GUPA 1CF8H 2BFVL 3RWJA 3TA3D 3G5YA 4GXUM 4Z95H 2EYSB 5A2LH 1MCNA 1CZ8H 1LEGB 3UZQA 3RHWF 4XCFL 4F7MA 1SY6A 1VGKB 3F58L 3X11A 5IF0A 4MVBD 1A5FH 2HLAB 4EI6B 4D94A 3MODH 4LCIL 3O6MH 1FYTB 2QSCL 3PG2A 3QNYB 5F9DC 3KPPB 4FFYL 4LLWA 4WHYG 5ID1A 2F74A 4DQOH 2D7TH 3ELAT 4PJ9B 4GW1A 5LWYH 3UCRA 4GKZB 5J6GA 4QRQB 3FT4B 4Z0BH 5AWNH 1I1YA 4G9FD 5TPWL 4X6BA 4BQCA 1QR1A 2NXZC 3DX9B 1Q8MA 5FYJE 1U8KB 1KTLA 3QNZA 4LLVA 2A1WL 3NCBB 2H6PB 3QYCA 4U7MA 3GJFA 1CFTB 1IEBB 4FRWA 1IGYB 4UV7L 3SGKC 1HHGB 4MXQD 4D0DB 2OL3L 5IFAH 4PRPE 1KN4L 4JO2H 2X9YA 3RNKB 2R1YB 4ONFL 1B4JH 1TLKA 2MMXA 4NCDA 1TJIL 2D4DA 4WFEE 4Y4HC 2EDXA 4PJCE 3ZDXE 5DO2D 3DROB 4JFEE 3T0VA 4GW5B 2BNRD 2XZCH 4X6CF 2J4WL 3DRTB 5CIPB 3S9DB 1RUAL 4P2QD 4YO0A 1F3JB 3GKZA 5D6CA 2FRGP 4YQXH 3VFWA 5F3BA 3O4LE 2HT4C 1IGIH 4K94H 1HNFA 3OGCA 1YEEL 5A40E 1EO8L 1OM3H 3VFGH 3RWDA 1PFCA 3OL2A 3REVA 5FDWA 2H2SC 1S9VA 4PLJC 4PJ7F 2V5MA 4KQ3H 4AK1A 3TYFA 4RA3A 2XZQL 2PTTA 3GSXA 4MMXC 3ALWA 4X7EC 4FFWC 1F4XL 3IJHB 4JM4H 4OZFG 1G9ML 3BPCB 1U8NB 4OFPA 1T21A 4L8SB 2NXYB 4PRHA 1H0DA 4XPTL 5BVPL 1UEYA 3AFLA 3UBXI 4P59L 5K33A 1S8DB 4HLZH 5DYOA 4KTDH 1BP3B 4DK6A 3E8UH 1FHGA 1RQ5A 1MRCH 3DXAB 4HPOH 2X1XR 3PJSA 4KPHH 3FOMB 3UJTH 1RUPL 2HH0H 4LPCA 4WW2A 2B39A 3ARSA 5DD1H 4E5XB 5T1LB 1K6QH 1UADC 5GS1B 2EXWC 1B3JA 4PJXB 2JLLA 4NQSA 1BX2A 3MJ8A 2R23A 4UAOB 2K3TA 4G6FD 3RIFK 2ARJB 3VE0B 1L6XA 3VGGA 4NSKB 2DQIL 2DLGA 3T0WA 1W0WB 4JJ5B 1AGDA 1C8PA 4WI3A 1F11A 4ZPTB 5I8EA 3BPOC 3SDAB 4PTTA 3PWJA 4PRIE 3JV5A 5E8DL 5ACZB 3IDUA 3VI4F 2JK5B 2Z92B 3H9HA 5FGBC 4IOIA 1Y6NR 3C5JB 4P46D 3MLRL 1JMZA 4XP9L 4AZ8A 1QKZL 5C0CA 4U1GB 1GC1C 3ARDC 4GUPB 3RWJB 1YC8A 1CD1A 1M7DA 3PV6B 4U6YA 4H88L 1JN6A 5CSZB 4H5SA 5CJBA 4MA7H 4U0RB 4G8GA 1CI5A 4F7MB 2CMRH 5T5FL 4RQQA 3VXRA 1PG7L 1AJ7H 3SDDA 4PG2C 3ZT6A 4NUJA 5HDLA 3V4PH 2EIEA 2VLJD 2Z4QA 3FB7A 1YY8A 4LLWB 5GRYA 1KTRL 3ARGA 3V4VL 1OSZA 3IFPB 3R4DA 3QXAA 3CU1A 3L3DA 4JFDD 3KPSD 4KRPD 4ERSL 1I1AA 2OK0H 4FFZL 4IJ3B 5H35B 3C08H 1UCTA 3L95B 4BSWB 5SWSA 3MXVH 1QR1B 1S9YA 4ZDHA 3WYRA 4LSQH 4MWFA 3T2PA 5LGJA 4D9RD 1E0OB 3MROA 4YK4C 2VKXA 5DD0L 2BXZA 3TO4C 1A02N 5LXGH 3HUJF 4JGUA 5DZNA 4CVUA 3ARBD 5AYQA 3FQTA 5E24E 2BZDA 5GGVY 3UPRB 1U3JA 2YA0A 3RGVB 5CJXA 5IWLC 4BUGA 1KEGL 3HTLX 4XB7A 4M7JH 4AY0A 2H2PD 1QSZA 1T0PB 2P43B 3MZGB 1G84A 3FRUA 4XX1E 4NT6A 3BZEA 1ZT1A 5TDPA 5KTEH 3TT1L 5DJCB 4NRXB 3L9RA 1MNUL 3GSOB 3MV11 4KY1H 4K7PX 4UT7L 5HHOA 1U8HA 1MH5A 1XGYH 4LPYA 4U31A 5D6CB 2JCCE 3VFWB 5F3BB 4TULH 5IVXA 4Y5XB 2ZCKH 3WKNA 3OGCB 3WFHB 2QHRL 2UV3A 2R15A 3GMPA 3U48A 3GHEH 3RWDB 1J0JA 1TZIA 4LDOB 2Q76A 4OLVL 5DDHA 3TYGH 5BRZE 4OM1L 5E1AB 2VABA 3P4OB 3MRLB 2AXJA 1EPFA 1N0LA 1A7OL 3SDCB 4UILL 2OL3A 4CADB 2Y4SA 1OP3H 4ODXB 1M7XA 3WUWB 2D7PA 5IHUH 3CDFA 3PQYB 1FV1B 1AC6A 5GGQH 1CD8A 4TPRL 2BVQB 3FT3B 4P57B 5DJXB 4M6MH 4Y4FC 4NFDA 1T21B 5FECA 3AB0B 3ALPA 3HHRB 4G5ZL 4KZEL 2IANE 4OGZA 4EIGB 4YHLH 4K3EL 4AIZA 4KJQC 5DYOB 4I5BB 3KG5A 4P3WA 4X6EB 5JQHC 3CFCH 1A7NH 3PJSB 2ORBH 4JREC 4PGCA 1CCZA 1DJSA 1MFDH 3PXJA 4WW2B 1W0YT 2L7UA 4EQ3A 2BVPB 4Z7VE 3X17A 3HNTL 5I1LA 2AQ1A 1YEIL 3BESR 1JPSH 4NCC1 1AY1L 1FYTD 1KIPA 3CIQA 4NQSB 4XRCA 2OZ4L 3QQNA 3AMKA 3ZSTA 1A7QL 1P6AB 4PJ9D 3FQXB 3RBGA 4ZUSB 1CLZH 3UPAA 3NFNB 5AYUL 1AGDB 3FHQA 5FYLE 2FEDD 3IDGB 4NC0B 1F11B 1P4LA 3PWJB 1YA5A 2BY3A 1FL6B 2HKHH 4IOIB 3HNSL 1S78C 3DUSB 2J2ZA 3EO1B 3QEQA 1XCTB 5C0CB 1SVCP 4DOHB 2VXQH 1X5LA 4XWGH 5JPMB 1M7DB 4RGNB 4JDVB 2BDNH 4CL7A 1U3HB 1JN6B 1W72H 1V3JA 3OXSA 4N90D 3U6RA 4G8GB 4HS6A 3JTSA 4HKBA 4XWOC 1BMGA 3VXRB 3W0WA 3KHQA 4NP4H 1MHPH 2Z31A 2B4CH 4CN6A 4LHQB 4JPWL 4HIJA 4X6FA 5MP6L 3THMH 5JDSB 1DFBL 2Y07H 2AJUH 2FX9L 1IGJB 1JF6A 1UEMA 2DN7A 3PIQA 5TQ0L 4POUB 4QYOB 1OSZB 3QXAB 5J9PA 3B4NA 1I1AB 3LQZA 1HQRA 3CUPA 5JMOC 1E4WL 4DTGL 2V7HA 4O4YH 2FWOA 4XTRC 5FM5O 5SWSB 1HIMH 4ZDHB 3D39E 5IB4A 1NGZB 4O2FA 2Q8AH 4MWFB 2ESVA 5LGJB 1FFQA 3FRPA 3LN5A 4P2YA 3D18A 5JMRA 3KDMB 4HC1H 4XCYB 1NCBL 4MNGA 4G9FE 5K9QG 3ZO0A 2P8PA 1OLLA 3V4UL 4D8PB 4JN2A 1GZQA 4F57L 1T0MA 3RQ3A 3EO0A 4U3CA 4JG1L 4PJAE 1QFWI 1Z5LA 5EBMA 4JR9H 5EO1B 2XQYK 5IB2A 4EJ1C 1FG2B 4JDTH 1PY4A 1PY9A 5E6IA 3O3EB 3L9RB 4GLRI 5B3JE 4X4XA 3VGEA 3DXAD 4JFXA 1A4KB 4FQ2H 4NO5A 2BJML 1U8HB 1MH5B 4RMWA 3RX5A 4XNZB 4H20L 5E9DE 4MX7A 3LN4A 3VFUA 1I85A 1NEZA 4AQ1B 1NC2D 2HJFA 1A6AA 1CGYA 3GMPB 1TZIB 2X1WL 2Q76B 3KS0J 4OF7A 4HFWB 4WV1A 3CK0H 5E03A 4XPGL 3MLYH 4U1HB 1L0YA 3B6SA 2J8UE 2DM3A 2OL3B 2P5WA 2ZJSL 3TPKA 4HH9A 3WHE1 2GSGB 1N2RB 2QQLH 3SDAD 5C0JB 3P9LA 3G9VA 3WSQH 4PR5A 2ICWJ 5FECB 1AGBA 1UB6B 4YHKH 4NHCL 4G6ML 4YWGH 2HTKD 1G9NL 3QDME 4AIZB 3NPZB 1CFSA 1I7RA 4NBZB 1AFVH 2YD8A 4BQ9A 3H2WA 3TESA 1JRHH 4OCWL 1R5IA 4X7SL 3O2WL 3ARTA 4PBWD 1G7MA 2VUYA 3V6ZA 2NY5H 4HIXH 5DLML 3B2UC 4HAGA 4JKKA 1NAMH 3W11C 2AGJL 4XRCB 1QR4A 3LKQA 4ZO7A 3PWLA 3LB6D 5FUCE 5JO5B 4YDIL 1MVUA 1BHGA 3DURA 1YN6A 3WXVL 4NN5B 4GMTL 5LCVH 1YQVH 5BOZG 3F65A 5D72L 1BAFL 1CG9B 3S98A 2GJ6A 3U36B 2R56L 3BUYA 1UJ3A 4RGOH 1JJUA 1QFHA 4RDQF 1FVEB 2Q3AA 1F3DH 1RK1A 1LEIA 3D85A 3QQ9C 5M95B 1FSKB 2VNCA 1CR9H 2E6QA 3DBXA 1UM6L 1FNFA 4LCCC 3KLAB 2DQDH 2HFFB 2Y5TA 3RGVD 3GDBA 3OAUL 4OI8A 2V7NA 4HS6B 3JTSB 1NFIA 2VAAA 3FCTB 4P9HH 3RGHA 1N0XH 5CZVH 2OZ4A 43C9B 2AV1B 4YE4L 3CXDH 4K07A 4HXAL 1I1RA 4FQLL 3PIQB 1KOAA 2W0FA 1IGCL 1NMBL 1YY9D 1HHJA 4KROB 3LD8C 5GISL 2EZ0C 5DJDA 4P49A 4YHPA 2F53A 3BMVA 1FH5H 5CJOL 2FWOB 5HHQB 4L29A 5IB4B 15C8L 3N85H 4O2FB 1XGQB 3OXRA 1A14H 4XCCH 4R2GB 3U7YL 1W72A 5C6TL 3F6LA 3BD5A 5CINL 1B90A 5ICZB 2OI9C 4MNGB 3RTQA 1MFBH 4JFFA 3SDCD 5DI8B 2C3HA 5EC2B 3UTOA 1QLRA 1KCUL 3FQRB 1GZQB 3KGRA 3HPLA 4MNQB 1JBJA 3PQYD 4Z7QE 4N0FA 1BF2A 3AXLA 4C4KT 5HXMA 1JYXA 4U0QB 2P24A 3GO1L 2IALA 5IB2B 3HN3A 2XT1B 3VFPA 5E6IB 3C8HA 4OCYL 4R0LC 2J3SA 3H9SA 5FB8A 5ALBL 2J88L 3VFOA 1MQ8A 4NO5B 1PLGH 5I1DA 5D7LE 3TF7C 4X5XA 4MX7B 2HJFB 3EYQD 12E8L 3LKOA 4OQTL 4HG4J 4LEOB 1R5WA 5D5MB 1OAXH 2EE2A 3RWIA 3B6SB 3QFJB 3U0WH 1A7PH 1PKQB 5D9SB 1FZOA 1ED3A 2BHYA 2CSPA 4R4BA 4YR6A 1A4JA 3ULVH 3UTTB 3CSYA 5IEHA 3CXHJ 4APQB 3GNML 4H8WC 4LPWA 4PR5B 1CGSL 4FN0A 2YBRA 4FQXC 1HXMA 2VZ3A 5KSBE 2GTZB 4QRSA 3LV3B 3GSUB 3ARFA 1MI5B 5C0CD 1VGEH 1JZ7A 1RMFH 3DGGA 4YHMH 3F7VA 3RVUD 1ZGLA 4RGND 4OZ4B 1U3HD 1P5UA 2FGZA 4ZUTA 2VXSH 1R5IB 1XH3A 4MCYA 1T66C 5IBUB 3HMXH 2ZUXA 3I9GH 4G8GD 4HXBL 1PKOA 1OGAB 4HFUL 3VXRD 5DT1H 3ZKQD 3X3FH 3DRQA 2Z8RA 1LNUA 2A6DA 3T0EE 3LKQB 5CWSB 1KXVC 4R97B 4BQ6A 5HBBA 3PWLB 3L3HA 4LLUA 1I1AD 1YN6B 4HUNB 3QIWA 2FX7H 5SWSD 1C7SA 1CE6A 2GJ6B 2XRAH 2X4RA 3BUYB 1MJUL 1AKJB 1CGVA 1HSBA 5FV2A 1AH1A 4Q6IC 3MLUH 2XQYG 1KT2A 4PJCF 3ZDXF 3D3VE 5EBLB 3H8NA 4M62H 3O2VL 3FMGH 5HDOA 1J1XL 3LEYL 3FAWA 4Q9QL 1N5YH 1T2XA 3I6KA 3MYJA 1ZK9A 2Y5TB 4OF0A 3TCLA 4OZGE 4JKLA 3QULA 4G6AD 3NTCH 2W1NA 4MXWH 2YHGA 1GIGL 2P7TA 1J8KA 1NFIB 4X6DE 5ICXB 4OCRH 3FZUC 1EXUA 2G5BA 5CJQL 4YX2H 3O0RL 4UTAL 2C3GA 5ELIA 3GBNL 4N90E 3QJFA 2AEQH 2GW5A 1AO7E 4E41B 1JRHI 1RZKH 1NCWL 4OTXH 1HHJB 3TBYA 1IAIM 5KBNC 4DAGL 5CUSH 5DJDB 2J12B 4LLMA 2F53B 4MYWB 1CQYA 1VB9A 5C9JA 4FQHA 4JY4A 4IRSA 3AS0A 4JVWA 4I3RH 2HFGL 4EZMA 3DYMA 1JVKA 3V5DA 5GZND 4TQEH 2CRIA 5ECJE 4IRZH 5DEZA 3MV01 1T7ZA 3WLWD 1QLRB 3ZDYE 4KU1A 4X9GA 5ESAB 5I30H 5F21B 1IKFH 1MIEH 4HS3B 4TUOA 2CKBH 1UT9A 3HMWH 4LU5H 4ZODA 3MXWL 4FQIL 2HT3C 5GPRA 5DJZA 2MKWA 4F7TA 1IGMH 2IALB 3BH8A 3S4SG 3MFFA 1L7IL 5IFHL 1WK0A 3GMNA 4N1EA 1KIQA 3VFPB 3GIVA 2ERJB 2Y1VA 3H9SB 3HKFA 4QF1A 1KULA 5FB8B 2IJ0C 3UYRL 1ZLSH 4K71C 3GI8H 4HJGA 5C0IA 3VFOB 1QA9A 2OJZL 3QJHB 3L3GA 4Y4KC 5HDQH 5H37G 5J8OA 4YPGB 4F7CA 5F1IA 3QA3A 5I8KH 3MTRA 4X5XB 1BZ7A 5BVJA 4KMTH 4WDIA 4K8RH 4YXKL 1LK3L 3PXHA 1JZ8A 5H94A 5IK3A 5I75B 3V0VA 3OKDA 1I8LC 5F6IB 1R5WB 1MCDA 5HI3D 5HGBB 2OM5A 1AXSA 4OM0L 3WFDL 1T2QL 4LIQL 3MRHA 4JM2A 4YGVA 1KB5B 4NGHL 4LSSL 1Y0LA 3MUGA 4F58H 3TA3C 1A0QL 2Q1EA 3HZMB 5E2VH 5CFHA 1A4JB 3DMMB 4D2NA 1IEHA 4ODVL 2ZUUA 1INDH 3CSYB 1KYOJ 3GMOA 5IEHB 5C0AA 1IGFH 5C09B 1PGRB 2YXMA 4MVBC 5E5RB 3NCYP 4M48H 1W0VA 1QEWB 2PYEB 2R69H 4UZGA 5I76A 5EFIB 2NZ9C 3DGGB 5I17A 5DJYA 4AM0A 3F7VB 1ZGLB 1MCKA 5C07B 3T0XA 3SDYL 1P4BL 1XFPA 3B83A 5E94B 3HC4H 4ZUTB 3MX0A 1MAML 1HCFX 2VH5H 4OFYD 1D5MB 4JPVL 4LLYA 3QB7C 2FGWH 4DFHA 4RISL 2Z31D 3EKCA 5DQDH 3CC5A 1Q9LB 4PP2B 1LNUB 5IB3A 2AJYL 3L5XH 4I4WA 4AMKH 3L3HB 1B0RB 4LLUB 4KROD 1IFHL 1SEQH 4MXQC 3QIWB 5FYJU 1HQ4A 1MOEA 2XN9A 3Q6GL 1EH9A 3LZFL 1TTUA 5GRJH 2ESVD 3MNZB 4R2GD 5GJSL 2HVKB 4P23C 3PL6A 3PF2A 5DO2C 5TGBA 3G6DH 1S3KL 5IR1A 2V9RA 3HAEH 1F90H 2P49B 2YPKB 3FB6B 1Z0NA 1NBVH 1F4AA 5F9AC 3TCLB 1YNTB 1U36A 4EKXA 1KV3A 1G7LA 2P7TB 2XG5A 2JCCF 4FXLA 4NN6B 2G5BB 4XPHH 1KCRL 5BO1H 3GM0A 2A6KA 1YEDA 3I75A 3UBXG 1U91A 5IGXL 5DS8A 5E6ID 3QJFB 2VLKB 3BOVA 5E0QA 3MA9L 5HHNB 5B38G 2JJVA 4HCRH 4UT6H 4WTWA 3LRHA 1HYRC 1RZ7L 1V5JA 5E2UH 2KBGA 5ESVA 1MHCA 1T22B 1QLEH 1NGWA 4LLMB 5FHBL 3GHBH 2IAMB 1JYVA 1ZEAL 5C9JB 4NCC2 4QXUH 4FQHB 7CGTA 2MJWA 4OZHA 5F88B 5DUBA 3H3BC 4JO3H 1MCOH 4S1SL 4LQFL 3O6KL 2P8MB 3QFJD 1INEH 5F6HJ 1NLBH 4HT1H 4JPIB 2MTPA 3GJEA 5J06A 4O9HL 4I48A 4D9QE 3DO3A 3BISA 3UTTD 3D48R 1DBML 1CU4L 1ZVHA 2DM2A 3ULUE 5I8CB 3O3BB 5KJRL 4Z7VF 1KELH 3BH8B 2AJVH 3MFFB 2R29H 4HKZA 3VXSE 1MI5D 3G5XA 3GMNB 1KIQB 2NX5B 1X4YA 3GIVB 3RVVD 3CPLA 2G2RB 4BZ2L 5AD0A 2FLRT 5C0IB 4P2OA 1BVLA 4PRHE 4AEIH 5MENE 5EOCJ 3L3GB 4LFHG 2Q3ZA 4MJIB 5F1IB 2AEIT 5KVDL 2O5YL 4G3YL 5DFWH 2PR4H 1OGAD 4AEHH 4Q6YA 3BP5B 3KNBA 1BIHA 3S35H 5BVJB 4PGBB 5JIIA 5DRXA 4OCMC 2W9EL 4PJEE 1ROWA 4IS6A 3OKDB 2FL5A 3RWHA 1NDGA 4P46C 1AXSB 4JM2B 3EJZC 4YGVB 4JGJA 1Y0LB 1A7RH