5JOPE

Crystal structure of anti-glycan antibody fab14.22 in complex with streptococcus pneumoniae serotype 14 tetrasaccharide at 1.75 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
208
Chain Sequence
EVQLQQSGPELIKPGASVKMSCEASGYIFTEYYIHWVKQIQGRSLEWIGYVHPKTGDVIYNQNFRGKATLTVNRSSNTAYMELHSLTSEDSAVYYCARWDSWGQGTTLTVSSAKTTPPSVYPLAPGTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 14.22 light chain
publication title T cells control the generation of nanomolar-affinity anti-glycan antibodies.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 208
sequence length 211
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jopE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jopE02
4HUNB 1U8HB 4PJBA 1FZOB 4OZIB 2X9XA 4LRNH 4L3CB 2PO6B 2XNAB 4ZUSB 4PG9B 5C9JA 2BHZA 2YD6A 3KPSE 5E6YA 2C1PA 5ANME 1U8KB 3HI1B 2VDNH 4XNXH 2Z93B 3BIAX 4ZAKC 1UXWB 2FHFA 5J11C 2YPLE 5L2KE 2FX9H 4P2CG 3LV3A 4NQXB 2CKBB 2IPKB 4K55A 4RNRA 5F7YC 3E2HC 5ETUA 4J3UA 4LAQL 4JY6A 2NTSP 4UV7L 3H42L 4LLAA 2NXZB 3VDCA 2HFFA 2X4NB 1JPFA 3VFMA 2V17H 2VLMD 2PXYB 3TBVB 1E4XI 4TNWF 3VCLB 3CDYA 1IAMA 4GG6F 5SX4I 1AQKH 5DUML 3W9DA 1YNTB 2NW2B 5JR1H 1D5ZB 4DUXA 4XP4H 1LHZA 1F11A 4OLVL 2HG5A 3T77B 1LO5A 5CMAB 2Z8SA 5FCSH 3D3VB 5KVFH 4OM0L 5HHXH 4YHNB 1CDIA 3BP7B 3MROB 2JCCA 3ARSA 4HG4J 3ULSB 4H20L 2BSSB 2VISA 2GY5A 2V9QA 2ESVE 1ZVHA 1OAYL 5CSBA 3L5XH 2NXZC 4FFYH 4S0SD 5BQ7B 5E56A 4MB5A 4E9LA 1UM6L 3EW3B 2WIMA 4JLRA 1T6WA 2EXYC 3AM8A 3CMOL 1E28B 4X5WB 3MFFB 1FNEA 5C07E 1MFDH 3QUYA 2H2SC 3E3QC 3G6JB 3MV8D 1S78D 4JFPA 3TIDA 2N7AA 4K94C 1AY1L 3ARDD 4LFHG 3D39E 4B7IA 3B43A 4HS8L 5DQDL 1QEWA 3UJJH 4U1GB 1P9MC 1MHEB 3O4LB 3IB4A 2IPUG 4HWEL 4R0LA 3WS3A 4TOYH 3BP6A 4S11A 3FO9A 3FFCA 4X6EA 5HHOB 1MF2L 3T0ED 1PY9A 4PJGB 5KW9L 1DZBA 1NMBL 3QIUA 1VDGA 3ROOA 1EAPA 1D9KD 5CHNA 5ESQB 4PBXA 3NH7H 3RZCD 5LBSH 4JG1L 4HJJH 4TVSa 5HGAB 5LWYH 4P2RE 4X6CA 3WNMA 4QXGH 5JXEA 3HC0A 3SGKA 4NQCB 1WBXB 3U4AA 2ID5A 4PJ8C 3EZJB 4JPIA 5I74C 4P5TD 4U1GC 5KOMC 5CUSL 1EERB 4R4BB 3V4VL 1LO2L 4DKFL 4QRRB 5DO2C 5E9DE 4WI4A 3LKRA 4M61A 2Z4QA 5DUPL 1NEZA 1OD9A 1AXSA 3MV9A 3QUZD 1UJ3A 5IB2B 4G6KL 5DTFB 2ZCHH 4MAUH 4NZTL 4F8QA 4QHLA 2DL2A 3OR6A 4QRPA 1XF1A 3TYGL 3GHBH 3MJ8A 2G75B 3LY6A 5EBLB 3TIEA 2HJLB 4WWKC 3RVTC 1HH9A 5HDQH 1A1NB 4RWYL 3P2TA 4V2CB 3D2UB 4NSKA 4ONFL 3VMNA 4FABL 5I1HL 1SBSH 2JB5H 2E6PA 4J3TA 5JOPD 2WM0A 3MRKB 4KHXH 1U2HA 3PGFL 4G6JL 4X9HA 3VI3F 3KYKH 1T89C 2IPUK 1MLCB 4ZXBD 4L3EB 1EIBA 4YBLC 4UU9B 3RPKA 5F6HJ 4YDKH 1JRHH 1KPUB 3QBTB 4G8GB 5IB4B 2OM5A 4DEPC 1IQWL 4NUJB 4DVBB 2F19L 4MLIA 3AY4C 1U3ZA 1MCPH 2NY0D 4NP4H 4G6MH 2HKHL 4TSCH 4RBPK 1NEZG 2VXTL 3MLRL 1VA9A 3D85B 2ZOKB 2CRIA 5ELIA 4KDTC 1NPUA 1A1MB 3DTXB 1ZE3C 2VC2L 4HIIB 4S10A 4Q97A 1HZHH 4BFEA 3PWLA 5E2UH 1S7WB 1M05A 2IH3A 2X1QA 2AQ3A 4ENEC 2PYEE 2OZ4A 3CNKA 2BXZA 3U4EA 3JV6B 4ONGH 4NRYB 5HHME 1K8IB 2BNRE 2PCPA 3DIFA 1MCLA 5MERA 1AO7B 5M95B 3D9AL 2EDLA 2MQ3A 5FKPB 5FGBA 3HZKA 5TDOB 3IRZA 4KVNH 3HI6L 1I1AA 2VE6A 2YKLL 3BKYL 4RFNC 5DMIH 3TBWB 5BV7L 4H5SB 3HLAA 5IMKB 2Y36L 2AEQH 5D2LB 1DBMH 1ND0B 1YNLH 1ORSB 4GMSH 4FQ2L 3ZT5A 1NGQH 3GJFB 1P1ZB 4WI8A 5DD0H 1GZPB 1QG3A 4LHUA 2UV3A 3MJ7A 2ZUQB 3LRGA 1S9KC 1N5AA 4YWGH 5AUMB 1P7QD 4YNYB 2OTWB 3C08L 3ROLB 1DUYB 1CE1H 4HWBH 1MPAL 1AR2A 2IPTL 4EN3D 1HWGB 4IS6B 4HGWB 3IETA 4P46D 1WSST 3FOMB 3LN5B 5ICZA 4BJLA 3CVHA 3V95A 4PG2A 4H26A 3CLFH 5JA9A 4HUUA 3BOVA 2VQTA 4TVPH 1R3HA 5LAXB 4YJZL 1ONQA 4POYA 4XPHL 2YA2A 4M7ZB 5AYUH 4PJ9B 3G6AB 2YMXL 5FO9B 3TBTA 3R8QA 1BFOA 4PUBH 1KV3A 4IIQC 1EZVY 2ZUQC 1QBBA 1A8JH 1VGKB 5JDSB 1HHHB 1T3FA 3TVMA 3PXHA 2FECL 1A7RH 2FB4H 3JTTB 4NQDD 1YY8B 4PRPD 2JELL 3OAZH 1SHMA 2QQKL 1KTDA 2IWGA 4APQA 2Y72A 5FOBB 4JFDA 1AD9A 2OJZL 2ZNXA 3L5HA 3W0WB 1ZA6B 1TVBB 5AZEH 1D3CA 1CXKA 5TE6L 4RZCB 4Q58C 3LKPB 4YAQB 1QRNB 3ZT6A 2W60A 3MTRA 4M6OH 2OBGA 3X3GL 3GI9L 2GJ6B 4CNIA 2Q7YB 4ZYKB 4AT6B 3MRJB 2JB6A 4YO0B 3KPSB 4M7ZC 3KYNB 2D7QA 2X1WL 1RK1B 4K7PH 4PJ9C 4PRDB 3FOLA 2ZOLB 4NOFA 3EYFA 5IOPB 43CAA 3QIBB 4PR5A 3HG1B 1G7MB 2VLJE 1YMMB 1V8HA 1YN6A 1WAAF 3BQUD 4HGKC 3T0VA 1IGJA 4D0BA 5GGVL 2I27N 5DMGC 5CCKL 4X6DF 4CGTA 2RJMA 2ZP0T 1JNJA 2YXMA 1T21A 5IESH 3GMMA 1GXEA 1RZJH 3HUJE 2QADC 4BUGA 1A2YA 3H9SE 1TQBB 1U92A 4EOWL 4EI5C 4G6AD 3ZYZA 1GPOH 4OT1L 3VXRA 3OR7B 4YDLB 3AUVA 5IQ7H 4HBCH 1HDMA 4NQUA 4QWWD 3GHEL 1HQRA 3QH3B 2ESVB 3L3DA 1KENH 4NZRL 5JHLL 3MLUL 2VDKH 3VD9A 5GGRY 4LFHD 1UB6A 3EBAA 4MCYA 3V0VA 5IFJA 2DBJA 4KJQD 4OCMC 2Z31B 2AQ2A 2YN5A 4PRIE 3SDYH 1OGAE 4UTAL 3QZWG 4ZFFB 1FNGA 4ZPTB 4K23H 4XP6L 3ETBF 1P4IL 4Z7VE 1OARL 5EH1A 4ZSOB 3WIHL 4NCC1 3SE4C 1D6EA 1TQBC 3WO4B 3MXWL 5ITFB 3U7WL 1DSFL 4GAYA 4YHLH 1TENA 4Z7WB 2NY5C 1S5HB 4YDLC 1I3RB 4Y5XA 5IT2L 4MQXD 5FYJE 2I9TB 3A6CH 4A2MA 4UTBL 2ZSVB 4OCRL 5D6DA 4P4RA 4XPGH 4Q6IA 4U05A 4CVUA 4KTDL 3FQNB 2YPVH 2OL3B 4IMKC 2Q86B 4QTHA 3QUYD 2Z31C 3BGFB 2X4RA 4JFOB 2P48B 4OI9A 5ICYB 3P4NB 5F8RC 2R1WB 4FXGB 4NWUH 2R0ZL 4XPFL 3B3IA 2ITDA 1ZS8A 5TQ0L 4AG4H 2BSTB 1UEYA 4Y2OA 4EUPA 3DMMA 4HXAL 1SMAA 3MRFB 3WO4C 5C6WH 5H2BB 1A6WL 3LMJL 5J12C 1ZHLA 4DKAA 1QBLH 3IFNH 1B0RB 2VDPH 3FFCD 4GRWH 1IBGH 1BD2E 1FYTB 3QIUD 3JTSB 3K4DA 1Y18A 5DRXA 5JW4Q 4JM4L 1TIUA 4HKJB 4MD4B 5DJ2A 3TO4B 2N1KA 5FYLE 4XCCL 5CGTA 4HIEB 4K7PX 3UJTL 4RMRA 3BGFC 3M8OL 1R5VB 5KSBA 4WO4B 1HNGA 4OZ4A 2P46B 5AAMA 1R5IB 3DV6B 1ZOXA 1S9XB 1QKZL 3GSWB 3ILQC 4N0RA 5FKAA 3L7FA 1FORL 1FFPA 3CJJA 4OF7A 2DQTH 3R1GL 1NGYB 5C0AA 2F53E 4HFWB 3LQAH 2VLLB 3RJDA 3ESUF 1YJDC 2LU7A 2UZXB 4EUPG 2X05A 4F15B 3MV9D 3OKMA 4JFFA 3TCXA 4ACPA 3GEWB 4ZUTB 2YA1A 1KJ2L 3O3EB 1L6XA 2P5EA 2NY3B 5IW1A 3AB0B 2BY3A 3QHFH 5D6CA 1P6AB 4MA7H 4WJ5A 3TWCL 4WO4C 1L7TH 3FQTA 3IKKA 3JVGA 3QHZL 5CJQL 5HPMA 4YH6A 5EO9A 4HS3B 1PG7L 1JV5B 1LO4H 3FRPA 2ERJB 2CKBL 4LLWB 1T7WA 3F58H 5B39B 2PUQT 4YC2B 1TTUA 2BCKA 3KR3L 3VGFA 2COQA 1CD8A 4JFXA 2EH7L 1LK3H 4LSVH 4S1SL 5I1IH 2ITCA 4K8RD 2PTTB 5F7EH 2JJSA 4EDWH 1C5CL 2QSCL 2NY3C 4K94L 2YSSB 4OGXL 3ZKQD 3AB0C 3VD7A 1AGDA 4M6ML 4EDXA 3ZTNL 1IEHA 3VG0H 5IK3A 5D1ZB 1JPGB 3BD5A 3H7LA 3F6LA 1NDGB 2XOTA 4MZ3A 1HHIB 3QNYA 4JM2A 5IGXH 2ERJC 2IH1B 5CEZH 3G5ZA 2EEAA 2GFBB 5DHYA 3N1QC 1P4LA 4YC2C 1RU9H 5HHNB 2VLKB 3U36A 3G5XB 1LD9B 3IAGC 4GOSA 1MHPH 4FMFA 1CICB 3FRPG 1G1CA 3DSFL 4HXBL 5D7LA 2Y5TA 1JK8B 1V3KA 2FEEI 4KGLA 3HNTL 3U9UB 1KJMB 1BGXL 1I8KA 2CQVA 4YFLI 4U0QB 3VD5A 1I1AD 3C5JA 1ZHKB 3FQRA 2W0LA 5EBMA 2DBLH 4LU5H 1F3JB 5D7IB 1H0DA 1U58B 1NBZB 4G5ZH 2FZ3B 2BFVL 3QUXA 1LE9A 3O45A 2IGFL 3IDGB 2OXGA 1IGIL 2HAZA 4Y1AA 1BQLL 1EZVX 4MJIB 3AMKA 1UA6H 1EGJH 4GW5A 5F3HA 3SQOH 5IQ9A 2Y7QB 5IHBA 1FO0B 2XFXA 2J8OA 3QCTH 4GW1B 1R0AL 2B2XH 2OK0L 4NKMB 4PGCB 1CICC 3MLTB 2Y1VA 4HKBA 1MEXL 4D9QD 4B53A 1NFKA 1HK6A 1MFEL 4FP8H 4PD4K 2WINB 4TUKH 5C0CB 2C4FU 4ODSL 3UTPE 3DX7B 1ZANH 4PTUA 4TTDD 3EDFA 5A16B 4LSSL 2YZ1A 5FO8B 2VXQL 2NX5D 2R56L 5E5RB 4AQ1B 5DC9B 4HMCA 4UMGA 1M7DB 2WWMD 1NGXB 2QHLA 5HGDA 4PJAB 1NC2A 5EIIA 3HMWL 1A7PH 5DYOB 1WUNT 2QL1A 3WIHA 3DSNA 5ENWB 3GBML 4QGTA 4X7SH 1MRFL 1BLNA 3MQIA 4NRXA 5EU7C 4NKOB 1MCSA 2O5YH 4APQD 5C0JA 4JFDD 1HEZA 5AWNL 1BP3B 5F7FA 4YUEH 4MXVF 2YD8A 3INUH 4OCXL 1YECH 1YPZE 3NOIA 4LCWA 4OGZA 1QD0A 3TJHC 3TYFB 1F97A 2YHGA 4ZS6D 3RNQA 4Y5VB 1D5MA 4ZQKA 1EVTC 5FB8A 5CLWA 5IVXF 4N1CA 2K1MA 5DMKA 3KDMA 3U2SA 4XP5L 3NZHH 2GK0A 4CU8A 4RMVA 5GZOD 1T04B 1CGSH 4ZPVB 4XXCA 4J3SA 5T3ZL 1JNNH 5BZWA 2FECI 1FIEA 3VWJA 5GJTH 4WUUB 2D9QB 2AXFB 2XTJB 2VDRH 5DD5L 3NA9H 3U4BL 3OAUH 2HMIC 1II4E 5DK2B 1A4KB 1AGFB 1VESA 3PV6A 1I9IH 4Z7VB 3NIDE 1FL6A 1PKQE 1QSEA 4IRSA 1D5BA 2HRPL 2MWCA 2Q7NA 2XPGB 4HPOL 5KANG 2EE9A 4JE4B 3CFJB 4ALAL 2L4OA 3R0MA 4FQHA 3F7PC 3BRFA 2JF1A 4ZD3H 1CE6B 5B8CA 1MCDA 1IQDA 3KPPA 2YRPA 5JUEL 3VXTB 2HVKA 1IAIM 1NUFA 4NC1C 2ATKB 3EGSB 5BOPA 4PJDB 3KYMA 1NBYB 1KULA 3QXAA 3RWEA 1KJ2A 3L1OH 2H9GA 1MCKA 3ES6B 4W6YB 4Z5RA 3G5YA 1U8HA 1IGTB 3CFKB 1FZOA 4L8BA 4OLUH 4OZIA 4L3CA 4MZ2A 3PL6B 2PO6A 2XNAA 4ZUSA 4PG9A 4WIQA 4LPTA 1PY4A 1U8KA 3HI1A 2Z93A 4KK9D 1FG2B 3KJ6H 1UXWA 1PZUB 1SY6L 1NCTA 4NQXA 2CKBA 2IPKA 1NBVH 4PRHE 1DFBL 1OQOA 3ECBB 2WBWB 3QG7L 3RHWK 5DJDB 1NCUA 2AGJH 2DD8H 3STLB 4DK6A 1B4JL 3KPOB 2YN3A 1CI5A 3UZEA 3MUY1 5AG9A 3P0VH 2PXYA 3TBVA 2E7LC 3U0TB 2YPKB 3DMMD 4LLDB 1JHKH 2CLVB 1N64L 2DIJA 4WFHE 1YNTA 4LSUL 2NW2A 2GSIB 1D5ZA 3GKWH 3BZDA 4XCFL 4NOBA 5C2BL 1XCQB 3GMNB 3PL6C 1JFQH 3T77A 3FJTA 4PJCE 5CMAA 3CX2A 3QIWB 3D3VA 4YHNA 3WJJA 5KANI 4XWGH 3BP7A 3MROA 5T1DL 2MMXA 4KJWC 2CUIA 1YEIH 2NNAB 3ULSA 4BZ2H 4M43H 2BSSA 4M48L 3O3AB 1CFTB 3S5LB 3UAJC 3WUZA 2Y06L 4EEEA 4GG6E 5BQ7A 5IP4A 3BZFB 3LOWA 2RAMA 4MGXA 3FT4B 3BUYB 5I8KH 1E28A 4X5WA 4R2GD 3MFFA 1Q9WB 2RR3A 4X4ME 1MY7A 1NMAL 1XGUB 3G6JA 5C0AD 1SBBA 4Z7QF 4K9EH 1XR8B 3K46A 2WQ8A 2EYRB 3EYVB 1KN2L 3RIAK 3TT1L 5D1QD 2V5TA 2W92A 2P5ED 4FRWA 3PWPB 1MHEA 3SDDD 3O4LA 1KCRL 4JHAL 1MIML 2HJFB 2HYMA 5D7SL 5IIEB 1SQ2N 1CF8L 5IBTH 1MELA 4HDIB 5HHOA 4HK3N 1A0QH 4PJGA 1HHJB 4HZLB 1NLDL 1QSFD 1JTTA 3K1KC 1XIWB 3D18B 4WU5B 3KPRE 4LGRB 5ESQA 2X41A 2NY5L 3O41B 4XP9L 5SV4A 3BPOB 5HGAA 4U6VL 3C8KA 4JDVB 4DN3L 3SE9H 4NQCA 2F9BT 2HP4A 4YXLH 1NANI 1WBXA 2I5YL 5JA8B 2UYLA 4C55A 1AKJD 1HN1A 1VB9A 2EECA 1JGVL 4FQQB 4NO2B 4QOKE 1CVRA 3NCFB 4R4BA 5F7WC 2R69L 3V9FA 3BEWB 5B38B 4QRRA 4DVRH 3MOBH 4X0KB 2J8HA 4XAWH 5EWIL 3DGGB 3T4AB 2AP2A 4HT1L 1ACZA 4UOW1 1KB9J 1N7ML 1A6VH 4KRMB 4P9HH 3AS2A 2V6HA 4TSAH 1GIGL 1QP1A 5IB2A 3AY4A 5DTFA 2HTKC 3N9GH 4RMSA 1BJ8A 4AJ0A 3TFKC 4KPHH 3LD8B 4OZGE 4X5LA 3BPOC 1YZZA 2G75A 2LU4A 5EBLA 3V52H 2HJLA 4X7TB 3BHBB 1A1NA 2DL9A 5D7LD 3D2UA 5HGGS 2OL3L 4LMQE 4LARH 1NCWH 4GQ9H 2YD2A 2IFFL 4EVNB 4YHMH 1CDUA 4G8EB 2Q76B 1OAXH 4U6HB 4LSTH 2X44D 2YZ8A 4UU9A 3WS6C 1QNZL 1KPUA 2VZSA 4G8GA 5IB4A 2X5PA 1CL7L 1G84A 4WEBL 2A77L 4NUJA 3EHBD 4DVBA 4XAKE 4DGIH 4FMKA 3WKMH 4X9GA 3VGAC 5C08E 4F58H 1X5KA 4LVOC 2E9IA 4OCYL 3LD8C 3TESA 3CSYB 3KXFA 1A6UL 3D85A 5BS0A 2ZOKA 3B9EA 4FNLH 3U82B 1OWWA 3U79A 1A1MA 3DTXA 4JKPH 4HIIA 4RFOL 3L3HB 4Q6YA 3KWWB 1AGEA 4IHOB 3SE3C 1S7WA 1CLZH 1G0XA 4P2OD 2V2XB 3JV6A 1Z5LB 5IMLB 4NRYA 1FFNA 1K8IA 2FD6L 1AO7A 3NFSH 5DWUL 1FGNL 2EIDA 5FKPA 5TDOA 1J11A 1CU4L 4Z0XB 5EU6B 5JQ6H 3QRGH 1I3GL 1MAML 3TBWA 4JKLA 5FECB 2KPNA 5HPOA 3W39B 1BOYA 4H5SA 4DZ8B 3VW3H 5IMKA 1IRAY 4POUB 1WT5C 2BSRB 2DJUA 3U1SL 5D2LA 5A2FA 1NC2D 1VADB 4Z0BH 2R0LL 4FN0A 4FZ8H 1ND0A 3IDMB 3DXAE 1ORSA 4P3CL 5E2WH 3GJFA 3P0YL 1BECA 1DANT 1P1ZA 1GZPA 3RGVB 4U0RB 2JJUA 1KN4H 4FG6D 5E8EB 5AUMA 4YNYA 4EBQL 2OTWA 4LCWD 1S3KL 2X1OA 32C2A 1DUYA 1T2QL 1MAKA 4X4XB 2D7TL 5JW4R 1SY6A 4IS6A 4HGWA 4XI5D 2P5WE 1TZGH 5SV3A 5BO1L 5ILTL 3FOMA 3LN5A 3W11C 1CK0H 2WWKO 3RU8H 3EJYD 4OTXL 5LAXA 1XGYL 5F70A 1I7TB 5KVGL 3VWJD 4LNVA 3G6AA 3QXUA 4GG8B 4U1HA 3GK8H 4G7VL 4BK4A 4JAMB 3P11H 1F4WL 3CDCA 5GRJL 2OR9L 3E8UH 4U0RC 1MJUL 1CR9L 3B9VA 1H3VA 1VGKA 2XZQL 5JDSA 1HHHA 1PEWA 4N0CC 1WVZA 2VXUL 3JTTA 4FZEH 4WFFE 1LILA 1YY8A 2BVPB 4OV6F 4U6YB 4G7YH 2P49B 5FOBA 4IRSD 4D3CH 4QF1A 1B2WL 3Q6GH 1ZA6A 3W0WA 1Z2KA 1O7SA 1TVBA 4RZCA 3QWOB 3LKPA 4YAQA 1QRNA 2WNGA 4RX4A 2GJ6A 2Q7YA 4ZYKA 2XRAL 4AT6A 3MRJA 1OB1A 2EDHA 2HFEB 4NDMB 4YO0A 3KPSA 3KYNA 1RK1A 4PRDA 5K9KB 1MCBA 2ZOLA 1JZ2A 4HMEA 3BGMA 4F2MB 3BKML 4I0PB 4LBEB 5IOPA 1FGVH 1A7QL 3QIBA 4OIBA 2ENYA 3HG1A 1FZKB 1G7MA 4HK3J 4UOW0 1YMMA 4P23A 1T22B 5I2IB 5I1GH 1AQDA 5GXBB 1P84J 1JWUB 5CZXC 5H8DA 5ISZE 1FO0L 4PY8I 4WI6A 4UNTA 2PO6D 5D8JH 1D5IL 1JE6A 1A3RL 1QFWH 3SE4A 2YD1A 3B4NA 3GI8L 1T7XA 5JIIA 1O7VA 3OR7A 2PN5A 4Y8DC 5IFAH 2UZIL 1ZT1B 4OFPA 4I0PC 3P4LA 5IBUG 1UWXH 1K3ZA 3QH3A 1IAIH 2ESVA 3JWOL 3DBXB 4M5ZL 5GS0C 2PXYD 1DBBH 4GG6B 4GBXB 1IAKB 3B5GA 3RQ3A 2VN7A 2Z31A 1UWEH 2F54B 4WCYH 1GGIL 4NZDA 5A2JH 4ZFFA 4ZPTA 1FC1A 1PW3A 1S5IH 1OAQH 1CFQB 2DS4A 4ZSOA 3D3VD 1ZLSL 5KTEH 1TJHH 1FVDB 5GGSY 3KLHD 4Y4HB 3F7YB 4GFTB 3QQ9C 1CFBA 1G9NH 1S7SB 2ZUWA 4WUKH 5C0GB 5ITFA 5SWQB 2VRAA 5HBBA 5HD8D 2FLBT 3CZJA 2RCSH 4Z7WA 1S5HA 1I3RA 1RIUH 1AD0B 1IL1B 1B3JA 4JO1H 2I9TA 2A83B 1I1RA 3GMLB 2DQUH 1TPXB 1KNOB 2ZSVA 3B5TA 1NL0L 2NY2B 2CPCA 2DI7A 3GJEA 4OLWH 5FYKL 5GGVY 3FQNA 3EO9L 2OL3A 4TVPE 4GBXC 3C6LC 1G6RH 2BY1A 3UTSE 2Q86A 4XCYB 3HC3L 5JHDB 2HT2C 2O61B 2DM2A 1QR1A 4ODTL 4XH2B 5FCUH 4JFOA 5ICYA 2X2YA 3P4NA 2R39A 4JFZL 5BRZE 3KYOB 2R1WA 5KSUB 4FXGA 3U0WL 1RIVL 5T5FH 1HIML 3GMQB 3MRFA 1TJIH 5FHBH 5GS2D 5H2BA 5CSGA 1P69B 4MDJB 5E6ID 5HVHC 3O4LD 2ZKHL 3LKQB 4QOKB 4MD5B 4AH2B 3KHQA 2VDML 3V6OE 1GAFL 1B0RA 4NKDB 3DECA 5HYSB 1BFSA 4J8RB 5HHOD 1FHGA 1HINL 4FQJH 1UVQB 1QVOB 3MGAA 1FYTA 2NY2C 3JTSA 2XN9D 4QHUB 2KUTA 4J1UB 4HKJA 5TE4H 2G5BB 2BVUA 1GGBL 4MD4A 3VI4F 1RMFH 3TO4A 1IM3B 4NM8L 4RA3A 3ISWA 4HIEA 1UEMA 1IGCH 5TF1H 4WO4A 3N85H 4N9GB 5FYJL 4IOSD 1JN6B 4NQCD 3ZDYF 1R5IA 3DV6A 4BM7A 4FQ1L 2XZCH 1S9XA 5JORB 1Z0NA 5DGRA 2E27H 3VD4A 3CCHB 1B0WA 3QEHB 3KLDA 1XGQA 5BJTB 4QRRD 1NGYA 2EZ0D 4KKBD 4Q9RH 4RFEB 1PBYA 1JHTB 3RVVD 2VLLA 5B4MC 2XXMB 4H88H 4U3CA 3O8XA 2F8OA 2H32H 3ULUH 2MCPL 3QEGL 3ZE2F 3FT2B 4ZUTA 4XT1C 2D7PA 4NQSB 3O3EA 1A64A 3RA7H 3LB6C 4X6FB 4JPWL 1I7RA 2P8PB 2F5BL 4XXDB 5FUZL 1LP9F 1TMCB 1OTSC 5HYJB 4AYFA 1R3IL 4G3YL 5E8DH 4YBHA 1CDHA 3AMLA 5D5MB 4QKXB 4M1GH 4Q0XL 4L8DB 3BSZH 2X4OB 1F4YH 1JV5A 2ADJB 3BKCH 4LLWA 1GHFH 1UM4L 4S1RH 3QDJB 2WUBH 5B39A 5L9DL 4OKVB 4ENED 3UROR 2C3XA 5FAAA 2EIZB 5FDWB 1RUML 4M5YH 4OCSL 3RX5A 5T3ZD 1MJ8L 4JDZB 4G8GD 3KGRA 2CRZA 1B90A 2PTTA 2J88L 5C0RH 1D6VL 1LEGB 3LN4B 4JO3L 2YSSA 1Z9SA 2NLJB 4OKDA 5DD1L 3KXFD 3V6ZB 3D85D 5BS0D 5D1ZA 3EOTL 1JPGA 4CJ0A 2NY1B 4BELD 1T2JA 2DMCA 1NDGA 1JP5A 2Z9TA 1HHIA 5JTWA 4FA8A 2JJTC 3N06B 5ADOH 5JW3H 2Q1EA 2IH1A 4N9OB 3UPCA 2GFBA 4ERSH 1FVCB 4HQQH 2HWZL 1FG9C 5HHNA 2VLKA 4LQ1A 2HT4D 3G5XA 1LD9A 3MLVH 3NACH 3TBYB 3DWTA 4LSQL 1CICA 3UJIH 5IMOB 1AO7D 1T20B 1JK8A 1CL7I 5B39G 3WFEL 1DL7H 3U9UA 1KJMA 3LS4L 3BAEH 4L4TD 2EKSA 2A1WL 5DA4A 1ZHKA 3BDYL 1F3JA 4M4PA 4LDOB 5D7IA 4R26H 1U58A 3WLBB 1NBZA 3O6KL 2FZ3A 1RUAL 3IS1X 1JBJA 3RX7A 3IDGA 4JPVH 3AREC 3M1BB 3TPKA 4M62L 4GRWE 4MJIA 3T08A 2E5EA 1XZ0B 2NY6D 1F90H 1J05B 3ZT7A 4AMKL 3UTTE 3TGXA 3ULVL 2Y7QA 4DQOH 3MLXH 2I60H 2QR0B 4OFKA 1FO0A 5DJAB 3T0XA 3TN0B 1BM3L 1PFCA 3S37H 4KHTH 4AM0B 4GW1A 1X44A 1BVLB 1GOGA 1UM5L 3OAYK 4Z77B 4NKMA 4PGCA 1H3WM 3MLTA 2EO9A 3GB7B 1XGRB 3QDGE 2BERA 3WSQL 3MACH 5L7XL 2WINA 3BO8B 1WEJL 3JV5A 1TNMA 2EYSB 1FFRA 3EYOB 4U6XB 5C0CA 2Y07H 4JGUA 3DX7A 4OGAD 4NNYB 1FAIH 2IBGA 5IROC 1VFOA 3UC0L 2FX7H 5A16A 1JZ8A 2A73B 5FO8A 1HXMB 4ZO6A 4JN1H 5B3JE 3O4OB 1RUKL 3WV0A 3HE7D 3P30H 3O3UN 4JFQB 2FBJL 1M7DA 1P5UA 1NGXA 4Y19E 4ELME 4HAFA 1S7XB 4PJAA 5DF0A 5IWLA 4YR6B 3D0VB 3MLZL 5DYOA 1YDPB 3RNKB 2AJYL 5ENWA 3DRTB 4NKOA 5DDHB 1Z0MA 1LDPL 5MENB 3VXNB 3W0WD 4TULH 1N0XL 1KCVL 2QQLL 1ZLVK 4KMTH 2Q3AA 2ORBL 4J2XA 1QRND 5D70H 4RX4D 3TYFA 2GJZB 5JQHC 3W82A 4Y5VA 3QDMB 3KPSD 3LHPL 1UH2A 3S3SA 1A9EB 2YPLD 3O4OC 3V6FB 3EJZD 2HJKB 3MJ9L 1T04A 3QIBD 4ZPVA 3FO0H 4OSUL 3HG1D 5C09B 5D7JB 1OTTC 1LE5B 5H37G 1YMMD 4GMTH 4P23D 1EJ6A 4BH8B 1EEZB 1G9ML 5BOZG 4KQ3L 4X6DB 2HKFL 3CFDB 4WUUA 4MXVE 4NC1E 2AXFA 3ARZA 15C8L 5CEZE 3KLAB 4XMPH 3MRDB 1ETZB 1F4AA 2ZJSH 3F7VB 5FA3B 2GAZB 1A4KA 1AGFA 4Z7VA 3TNMB 25C8H 2WP3T 1ZLUH 4QTIH 4NC2B 3VXUE 5DEZA 3SOBL 4YX2L 4EXPX 5IHLB 4UQ2B 3MRRB 3OJ2C 4WHTB 5KOVC 2CMRH 2IANE 4WTZG 4U1MB 2XPGA 1DQDL 4MA8L 3GDBA 5ALCL 2ESVD 3CFJA 4KFZC 4CDHA 3BYYA 3FHAA 4PLNC 4KI5D 2DTMH 3GM0A 3CFIC 4NUGH 2B1HL 1CE6A 4OZFG 4HBQA 4XGZB 3UXFA 1GGCH 5FHAH 3FQXB 3VXTA 5C07D 4MB3A 3RHWF 4DGIL 3ARBB 4K3DL 1UFUA 2ATKA 4K3HA 3BKJH 1PLGH 3GIZH 3OZ9H 3EGSA 5L6YL 4PJDA 3S37X 1H9VA 1NBYA 1E6JL 4PRNB 3D39D 1JMXA 1VENA 3SCMB 5I0DA 5IFHL 5I1AB 5EZOL 4ODUB 1RURH 3ES6A 1IGTA 3CFKA 3PL6A 4KY1L 2A0LC 4O51B 2J6EL 1ZLWK 3K8KA 2WLYA 1P4BL 3SKNB 1FG2A 2E9WA 5D7KD 5GISL 4K71B 1WV7T 3FO1A 4MNQE 3T2NL 3WLWD 5A1AA 3ECBA 5DJDA 3WEXB 1WZKA 4C58B 1FBIL 3EIFA 1EHNA 3GSOA 1A5FL 5CSZB 2B0SH 3KPOA 3STLA 3TZVD 3WN5B 3GSQB 4P2RD 4BUHA 3NBNA 5E2VL 4YDVB 1HSBB 3VFUB 3U0TA 2YPKA 4LLDA 3WE6B 3SCMC 2CLVA 1U9KA 4Y2DC 3HI5L 3IJYB 1X7QB 2UUDH 2GSIA 5IW3A 1XCQA 3TF7C 3GMNA 3LZFL 3QIWA 5EBGA 4KZDL 3NFPA 1I75A 2FATH 1FYTD 4DN4L 1PG7W 3RIAF 3UYRL 5E6ZA 3RKDC 3BMWA 2NNAA 5ID0B 3TO4D 3RTQB 5BVPL 4K71C 4XPTH 4P48A 1WWWX 1H15B 4B5EA 3O3AA 3QR2A 1CFTA 4WO4D 3S5LA 3S34L 4NO3B 3CXDH 3BZFA 4Z95H 1T1XB 3FT4A 4O9HH 3SDAB 3PG2A 4LEXH 1FC2D 3WN5C 3BUYA 3VFOB 4HPYL 4FQLH 4K2UL 4OCWL 1Q9WA 2FX8H 2ICWB 3WFBL 1XGUA 4H1LH 2R1YB 4ELKB 4OD3L 4TNVK 2XQYG 2IF7A 4YHZH 1OCWL 1XR8A 5CIPB 4M1CD 5GRVK 3O8XD 5GS0L 3F5WB 2EYRA 3EYVA 1Q9LB 4MA3B 1UCBH 3PWPA 2C5DC 2BVTA 3RTQC 2HJFA 5IIEA 5LGHH 1NGPH 1ZT4B 5MEPB 3VFWB 1QYGL 4HDIA 3DUSB 5E08L 4LLMB 1E6OL 4QGYA 5LCVL 1HHJA 4HZLA 3VFPB 5I1KL 1UKTA 4Z7UE 1XIWA 3D18A 3OKYA 4WU5A 3HN3A 1F3DJ 1BVKA 1M1SA 1MLBB 2I24N 3O41A 1ZKAA 3V4PH 5KS9E 5DVNA 1HKFA 1KELL 4JDVA 5ALBH 2VH5H 1HHKB 4P9MH 2PYED 1NFIB 3QPXH 1C5DB 3NPSB 4NPYB 3QDAA 2BNRD 1VEPA 2NXYB 1W8OA 5CS7A 2OI9B 4NO2A 4FQQA 1W8NA 3DURB 3F65A 4DGVL 5FA4B 3BEWA 4ZFZB 2X4UB 5B38A 3PWNB 4PJFE 2L7JA 5GRUH 4FHBD 4X0KA 3H9HB 5EA0H 3DGGA 2NZIA 4RISL 3T4AA 4B50A 5D1ZD 1MVUB 1Q8MA 2UZYB 3MXVH 4JB9L 2AABH 1CDJA 2ADFL 1DCLA 3O6MH 1RZ7L 5C0BE 3RAJH 2DM3A 2DWEB 4KVCL 3UTTB 2W38A 2XQYK 2VLKD 4JDTH 5CJOL 4HZAA 2O5XH 1CICD 3BHBA 1NBQA 3BN9D 1REIA 4NKIL 1SEQH 3NPSC 4KV5F 2F5AH 1JTPA 1KEGL 3ARDB 2OI9C 3G9VA 4EVNA 4G8EA 1T5WB 2Q76A 2YD4A 2ZG2A 4U6HA 1WTLA 2VL5B 1WZ1H 3N1GC 4HKXB 3MJ9A 2XKUA 1ADQL 1NCCL 3QQ4A 4R3SA 4OLZL 4JY5H 3SJVE 1E4XH 5E0QA 4MJID 4PS4H 1CFVH 2YK1L 1WT5A 3CSYA 3U0PB 1CS6A 3RZCB 4O4YH 1EBPA 1RJYB 1XFPA 3MLYH 2B4CH 4UINH 2E8YA 1S78C 3KWWA 4IHOA 3ARDC 4OIIH 4N5ED 3HB3D 4PYGA 4RGOH 1JWSB 4QRUB 5DQJB 2V2XA 1Z5LA 5IMLA 3RGHA 1UKSA 4XX1E 1J18A 4U2YA 1INQB 5JOFB 5GSVB 5I1DB 4YDIH 3MRLB 4KJYB 3BJLA 3FZUD 4L8CB 4Z0XA 5EU6A 1B0GB 1C8PA 3MV7E 5I1CL 5FECA 4EZMA 3W39A 3QUZB 4DZ8A 1KFAL 2BSRA 1CLYH 1A1OB 1D9KC 5GGRB 3SDXF 1UWGL 1VADA 4QXWA 3RZCC 3C60B 3LIZH 3IDMA 3DYMA 3H3PL 2VLJD 5TJWK 3SQBA 1RZGB 4MA1B 5EU5B 5HHXL 3SKJL 1UENA 4YQXH 3RGVA 4TRPH 4DKDC 2G60H 2NMSA 5ITBL 3EOBB 5E8EA 2UWEF 1JNHB 2J6EA 4P5TC 3EOAB 4JCMA 4X4XA 5FYKD 5AEAA 1BFVL 4EKXA 5IVXB 1EMTL 4HAGA 4Q9CA 4L9LB 4DGYL 3GMOB 3VXUB 4GAJH 3QUZC 1MQKH 4C56E 2OYPA 1MFDL 3CLEL 1ODAA 3MFGB 3S88L 2EDRA 4Y16B 2LU3A 1I7TA 3SKUD 1BWWA 3L5IA 3GBNL 2E3VA 2VQ1B 4HH9B 4GG8A 4WUUD 2ICES 2XTJD 4JAMA 4MA1C 2EC8A 4XHQA 5EN2B 3UJJL 3LEVL 1DE4B 5EIVA 2ZUXA 1IKFH 3BVNB 2CDGB 1S7UB 2GCYB 5KSVB 1GC1C 2BVPA 2HLFD 4U6YA 1A14L 3U6RB 1OM3H 1LO3L 2SEBB 2APVA 3PABB 1MFAH 2R8SH 4Z18A 1GJIA 2YOCA 3JSSA 3QWOA 3QEQB 4S1QH 2ZPKL 5EORL 5FYJD 4JPKH 4OF3A 3F8UB 2VDLH 2NYYD 2NY0C 2HFEA 4MQ7B 3EYQD 4QXGL 3WFZA 5K9QG 1Z3GL 1H3PH 3UBXG 5K9KA 4PJ7F 3UDWC 5E2TL 4F2MA 4P49A 4LBEA 4I0PA 3O81A 1FZKA 4XVTH 3FONB 1T22A 5I2IA 4M93B 4OQ1A 1JWUA 4IBLT 4PJ5E 1ZAGA 2EH8H 1ZGLP 4FXKB 3JWDL 3B2VL 1XCTA 2XI9A 5CP3H 1X5FA 2AJVL 4NM4H 1OT1A 4P46B 2H1PH 4I4WB 3DYPA 4P0DA 4KJWD 4Y88A 1JYXA 1U8OB 1IGML 3TPUB 1FQ9C 1ZT1A 4MB4A 1OAZL 3P9LB 2ZCLH 2QSVA 4OF6A 4GKNB 1GZQB 3B9DA 5C86A 3DBXA 3SDCD 4NBXB 4GG6A 4GBXA 1IAKA 4M93C 1RAMA 3FAWA 3U9PH 5HI3D 2BRQA 1J8HE 2F54A 4NQDB 2XZZA 4PRPB 4WW2F 4NQEB 1J8KA 2B4CC 4KK5C 1CFQA 3QIWD 1MCPL 1QZ1A 4KKCD 4EN3C 1OHQA 2BP3A 4HK0B 4P46C 4Y4HA 1ED3B 5SWSE 3F7YA 5SWQA 5C0GA 3NTCH 4QHMB 1HSAB 3EUUA 3L3JB 2W9EH 2VLRE 1G6VK 3V2AR 5EO0B 4Q9QH 1T1WB 1AD0A 1IL1A 2DLFL 4XWOD 2A83A 2OTUA 3HR5B 1QFPA 5F93C 4WI5A 3GMLA 1KNOA 4ISVB 1OTUD 1EHLL 1KXVC 3GSXB 4XCYA 5JHDA 2O61A 4GAGH 4XH2A 3HFMH 4GS7C 1BIHA 3KYOA 5KSUA 1MFCL 1ADQA 1RHHB 1CGWA 4AK1A 4DKEL 4NGHL 1AXTH 3GMQA 2EDTA 4PJBB 3T3MF 1QPPA 4MDJA 4OM1H 3PWPD 3ULVD 1J1PH 3LKQA 4QOKA 4MD5A 3WUWG 4AH2A 2XZAL 4OB5H 5DK0A 3MA9L 4NCDA 4NKDA 4QXTB 5HYSA 1I1YB 4J8RA 1JZ7A 2PETA 4XVSL 1UVQA 4ODWB 2IJ0C 1XIWD 4QHUA 4ZUUB 4J1UA 4ODHH 5DJXB 5GHWL 3VFMB 1IM3A 4UQ3B 1VPOL 3BQUC 4YDJB 2WW8A 4N9GA 1JN6A 3IVKB 5GGTL 2DKUA 5JORA 2DRUA 3VMOA 2XA8L 3CCHA 5HHVH 1U93A 5C70A 5BJTA 4NWTL 4K3EL 1LO5B 4I3RL 1YQVH 4RFEA 5DJYB 1JHTA 5DZOA 2UVEA 1EAJA 4RAUB 4CVXB 1QOKA 4ODXA 1MIEL 3QG6B 4LSPH 3WKNA 1UC6A 1WFTA 5DT1L 3FT2A 4TPRH 2AVGA 2DQJH 1QBMH 2AEPL 2BHUA 4X6FA 2VZUA 4WRLA 4CJ1A 1A7RL 2P8PA 2OZ4H 4XXDA 1OGTB 4HJ0D 4TNWK 3O0RH 5HYJA 4YZFE 4KJQC 1MRDL 4YHPA 1UH4A 4L8DA 1VSCA 2X4OA 2JJTA 2ADJA 4Z9KB 4K3JL 1XAUA 5F6IC 3QDJA 4XBEH 4OKVA 1QEWB 2NQCA 4UIKH 2EIZA 3P40A 3MX0A 1B88A 4K7PL 3WDHA 4JDZA 4O02L 3ARQA 5F9WB 5JPNB 3UTPD 2FO4B 4MQXC 1H5BB 4OF5A 1LEGA 1XF4B 3LN4A 3OX8B 2EDXA 4PB0L 1EEQA 4F7EB 3IDXH 3V6ZA 3AM8C 3MRGA 1U8LB 1ZGLB 1SJVA 1QSZA 5EOCL 4UT9L 3KLSA 2AK4E 4YXKH 4BFBD 1GRWA 3JUZA 2AAVA 1FVCA 4UV7H 4CU7A 1WIUA 5DJ8B 2DWDB 3TBYA 1K6QL 3I75A 5IMOA 1T20A 1U3JA 5F9WC 4M61B 4ZOBA 3WXVL 5DUMH 3C87A 4IOFD 1H5BC 5EU6D 1KENL 1NEZB 3NCYP 1OL0A 4ZTPL 3WLBA 3QIUC 3RL1B 1OP5H 5IROA 2FDBP 3SDYL 4LPYA 3M1BA 4N90E 1LEKA 3THMH 4TSBL 2J4WL 4ESKA 4WV1B 5J4MA 3SGKC 4H20H 2QR0A 5HHQB 4XNMB 4J4PA 4QCIB 3RGVD 4OD1L 5DJAA 1OAYH 3TN0A 1A7NH 4AM0A 2J8UE 4Z77A 1JYNA 1BVLA 3DGCR 4N0CD 1VFBB 5E4IA 4YHLL 2VDQL 3GB7A 5IVOA 4LDEB 1XGRA 3K2UL 3CMOH 2JJWA 3X13B 4UOJA 4LMQI 4XPGL 3BO8A 2EYSA 3GIVB 3MRBB 3DOSA 4U6XA 4KMQA 1AY1H 1KG0B 5F9JB 1UJ3C 3B9KA 4NNYA 4HS8H 5DQDH 4WTXA 3IDNA 4BZ1L 3ULUE 4NCC2 1UXSB 3V4UL 4WV1C 2AI0H 1RZIB 1NCNA 4HWEH 4JFQA 4WW1B 2IAMB 2AQ1A 4B7LA 4YR6A 1MF2H 3D0VA 3S35X 5KW9H 1YDPA 3RNKA 1NMBH 3H0TB 3TBSB 3DRTA 4MS8D 1QBLL 3IFNL 2VDPL 5DDHA 1KTRL 1JPST 1KYOK 2ZNWA 4JG1H 1EO8L 5MENA 3VXNA 3BN3B 4K8RC 3T2PA 2PW1B 4E5XA 2V7HB 1I1AB 1V3MA 2GJZA 1BIIB 4IOIB 2V2WB 4LPUA 3QDMA 3MUGB 5CUSH 3BIBX 4C54A 3NCMA 3V4VH 4L5FH 1LO2H 4FTVE 1A9EA 4DKFH 5SWZE 1U95A 3V6FA 4WU7B 2HJKA 4PRHD 1XF2B 2DI9A 1U8IB 5D7JA 5E8OB 2FL5B 5I75C 2DQGL 1LE5A 5DUPH 1WAAA 3SGDI 4BH8A 1EEZA 2ZUVA 1YA5A 4X6DA 4G6KH 3CFDA 3O2VH 1UZ8A 1QFHA 4NZTH 3T8XB 4XNZB 2XY1A 3TYGH 2I07A 3DO3A 3GKZA 3KLAA 4WFHD 2BOBB 3CVIH 4DFIA 1J8HB 3MRDA 3RUGE 1ETZA 3F7VA 2MKLC 5FA3A 2GAZA 4RGNE 4RWYH 5JNYB 4ONFH 1I1AC 3VFGH 4FABH 1G9EA 1RIHL 3CVHB 3QQ9D 3TNMA 3ZDZF 1EVUA 3PGFH 4G6JH 3AGVA 2X9WA 1KCLA 4UQ2A 2WK2A 3MRRA 4WHTA 5FM5M 3V7AE 1ONQB 5HGBB 3EOYG 4U1MA 4BH7B 2R4RH 3V5DB 2DKSA 2NX5B 4E0RB 2D03L 1YEHL 5GGTA 5AAWA 1N6VA 4HIXL 1MCEA 3QNZB 4U1JB 5KVMC 1IQWH 4EUPH 5L2JB 2F19H 4XGZA 3FQXA 2F54D 2BX5A 4BSVB 4JHWL 2CXGA 3Q5OA 4U1IB 1WWBX 4XNZC 3ARBA 2VXTH 3MJGX 3VRIB 5IEHB 1PX3A 1MFNA 4PRAB 3QUKB 4OZHE 4PRNA 4RIRB 4Y4HD 3SCMA 2VC2H 4GSDH 2CUHA 2D7MA 5I1AA 4GLRH 4ODUA 1MJJB 2GTWB 4G9FB 4JGMA 3GGWB 4TTDC 1RFDL 4O51A 4RMTA 4YFDB 3HUJF 2NY2D 1T7YA 1GC1L 3D9AH 4NFDA 4OF8A 3SKNA 4JN2B 1A02N 3OPZH 1RU9L 5CBAB 3ESVF 5JHDD 1JRHI 2WWMC 3HI6H 3QZWB 2YKLH 3BKYH 2XWTB 1HI6A 4PLOB 3EJJX 5BV7H 1KJ3H 3WEXA 2Y36H 2K7QA 4D0BB 5CSZA 2P4AB 4Q74A 4APQC 3VGGA 3GSQA 2X09A 1BEYL 2DBLL 4YDVA 1HSBA 4HEPG 3VFUA 2NPLX 3WE6A 1KT2B 4I0KA 4FXLA 4FQ2H 1L0XA 4YBQD 1JZ6A 3IJYA 1X7QA 1MCQA 4WGWB 2R0KL 2X9YA 4Z7NE 4QOKD 3G6DH 1LO0L 4PYHA 4TNVF 1J12A 4RRPG 3H7BB 3C08H 5DS8B 2Y5EA 2BNQE 1RZFL 2F74B 3LKNB 4M8VA 4EIZC 1IKNA 4U2ZA 2BNUA 3LB6D 2IPTH 5GZOC 2AJUL 1YEKH 5ID0A 4FFWD 3RTQA 2MKWA 1G1YA 3C5ZD 1H15A 1MUJB 1FFOB 3ZDXF 1OTSD 4PJIE 4FP8L 4L9DA 4NO3A 3QPQD 1T1XA 3SDAA 4XPHH 3VFOA 4GW4B 2YMXH 3GM8A 2E7MA 4JFEE 2ICWA 1ZANL 3QB7C 1R24B 1JI1A 2R1YA 4ELKA 5DXWA 4LSDA 1F02I 1DUZB 3VGBA 2A38A 5CIPA 2GTZB 3F5WA 1BBDL 2JELH 1Q9LA 4MA3A 2QQKH 1BREA 2OJZH 1T83A 4XAKD 1Q38A 3W5MA 3ZSSA 1LP9B 1NAMB 1KIUA 1TVDA 1VERA 5C08D 1ZT4A 1V7ML 5TE6H 3VFWA 5HYJD 5MEPA 3O3BB 2O5YL 2FNBA 4LLMA 1J0HA 3GI9H 3HZYA 3VFPA 3QDHA 3HMXL 1H3UA 1YECL 1MLBA 3QDJD 2CLRB 3B3IB 4X9BA 5MP6L 1HHKA 1G6RB 2IQ9L 3LSOB 2YR3A 1NFIA 1A7OL 4PJHE 4JRXE 1C5DA 1ZHLB 3NZHL 4NPYA 5DJ0B 3A67L 5CCKH 3OAZK 4HHAB 7FABL 3DURA 5D93C 5FA4A 4ZFZA 2X4UA 1F45A 2W1NA 3PWNA 5DA0B 1QLFB 3EDDA 4KK9C 5GSRB 5GJTL 5B22A 4Z7OE 3H9HA 1MVUA 3FN3A 2NY1D 2E7CA 5I9QB 4QHKI 1DBKH 2CH8A 2GI7A 4R97C 2EE2A 4OT1H 3CK0L 4N8CH 2DLIA 4H25B 1QACA 1I9IL 3OBAA 4E42B 3HTLX 1MHHA 2DWEA 2YC1A 3KHOA 3UTTA 2WMPA 3MV8E 4QHNA 3GHEH 3DMMC 2CR3A 1BF2A 2BZDA 4NZRH 5JHLH 1NJ9A 3MLUH 1X5JA 1A21A 5C0AB 1OP9A 5KZCD 1T5WA 7CGTA 4BQCA 12E8L 2YA0A 3VRLF 2VL5A 1K4DB 4C57C 4UTAH 3B8YA 4J6RL 1C5BL 4HKXA 3ZE0F 4U6TA 4TYUA 2N4IA 3QFDB 4XP6H 5D1QB 2D0GA 2M26A 1P4IH 1OARH 2F58L 4HKZB 3SDDB 1YEFL 2VWEE 3WIHH 1S7QB 1WWAX 3ARWA 5I9QC 3T0EE 3W81A 3MXWH 1DSFH 2XXCB 5MHSE 2BVEA 3IDYC 5IT2H 4J4PD 1PD6A 1HQ4B 1QSFB 3HC4L 3TN0D 1O0VA 4G43B 3U0PA 4D9LL 4UTBH 3RZCA 4R2GC 4NN7B 4OCRH 3BXNB 4M3JA 1RJYA 4P4KB 4KTDH 3G5VB 2ARJB 2PR4H 5BV7C 3WD5L 2PTVA 2ICWI 4NN5B 1JWSA 1IC5L 2EIBA 4QRUA 5DQJA 1AKJB 4HD9A 1NBVL 5D1QC 2R0ZH 4XPFH 2FR4B 3B9KD 3BH9B 4JG0L 3X14B 1INQA 2AJ3B 3CC5A 3SDDC 4LIQL 5TQ0H 5GSVA 1NLBL 5I1DA 3PHOB 3MRLA 4KJYA 4HXAH 4EQ2A 4CN1A 5BMFH 4L8CA 4CU6A 3LMJH 4OV5B 3JVGC 3REVB 2JIXB 3QUZA 3I6LE 5F1IB 1A1OA 5GGRA 5EG6C 4JR9H 1RULL 3C60A 3TEUA 2Q6WA 2W65B 4P4KC 2WIIB 3QT2A 5DLML 3C8DA 1JFQL 4JM4H 3OGOE 5JOPE 1ZHBB 5EU5A 3MC0A 4NYLB 3IRPX 4NN5C 2VZ3A 3DNKA 4XCCH 3EOBA 3M8OH 5L88L 1NGWB 5ISZD 1JNHA 5F7MC 4NNPL 1YEIL 1FZMB 3EOAA 5GGSB 5IB5B 5C8JB 3I2CL 3EFDL 3X3FL 1N26A 1QKZH 1J5OL 3TC9A 3QDMD 5IVXA 4JKKA 3ZKXB 4L9LA 1FORH 3GMOA 4KQ4L 3R1GH 4W68A 3VXUA 2D7OA 5MI0C 1A22B 3ZKSD 4NN6C 4GW5B 5D7JD 4O58L 4Y16A 4MCZB 3P3YA 1I9JL 3QHTC 2VQ1A 1KJ2H 4HH9A 2ATPA 3UDWA 1TNNA 5EN2A 4JO2H 4RMUA 1DE4A 3TWCH 1U3HB 3BVNA 4M1DL 1AGBB 2CDGA 1S7UA 1PG7H 2GCYA 3L3GB 5KSVA 4P2OB 2HA1A 1FIGL 3DX8B 3U6RA 4XPBL 2CKBH 1QQDB 2BOCB 4DW2L 2SEBA 3ZKXC 2QSTA 3PABA 3QQNA 4I1NB 1YPZF 3QEQA 3OWEA 1Q1JL 4X4ZA 4S1SH 3BGAA 4Y7MA 4MQ7A 5IV2B 3NGBB 4GXUM 4PFEA 5KVEL 5FM8A 3UTOA 1C5CH 1A3LL 3HNVL 1JGLL 2QSCH 4K94H 4OGXH 4KKAD 4HUVB 3ARBD 4M6MH 2R2CA 4PJXF 3ZTNH 1IJ9A 1MWAH 3FONA 4LLYB 1LMKA 4O2CB 4CMHB 4DAGL 3OSKA 5CEXA 2MCG1 3SCMD 4P2OC 3WNNA 4XAWL 5T1KD 3OXRB 3OG4B 4FXKA 5EUKB 5BVJB 1FCCA 2YRLA 3NAAH 4TSAL 4ORGB 1YYLH 3N9GL 4K7FB 5A43C 5J3HD 1DQLH 4E41B 3DSFH 4HXBH 3NIDF 3UMTA 3T1WA 3VWKB 3ZHLA 2B7DT 3HNTH 3HZVB 3HMXA 1BGXH 5K93A 2BNQB 3TPUA 4K8RL 3RY6C 3P9LA 4GQ9L 2CJUL 2YUWA 3LQZA 2BFVH 2IGFH 1GZQA 3IJSB 1FVEB 1IGIH 1WC7B 2MOVA 1BQLH 1Z6JT 5GS2H 4FG6C 5FYKU 5JIPA 4RA0C 4BSJA 1KEML 3TO2B 4NQDA 4PRPA 4C4KT 4NQEA 4L1HA 1IGYB 1PZ5B 4M7JH 4ZOEA 5E2JA 1R0AH 2OK0H 4HK0A 4XI5C 1MEXH 4KWUA 1ED3A 1F3DH 3MLWL 3VWKC 1S9YB 1ZTXL 3I6GB 1BPVA 1I4FB 1CT8B 4QHMA 3MRCA 2IMMA 4XVJL 4XXCC 1HSAA 3RTQD 3L3JA 3EJYC 3VGHA 5DFVD 3VFSB 1T1WA 5ACLA 4JKPL 1RZKC 3HR5A 1BMGA 4KK6D 3L3IB 4QY8B 4ODSH 3FKUS 3VWJC 5ID1B 1S9WB 1T0NB 4ISVA 5B8CB 4BZYA 3SDAD 1CLZL 4AEFA 4JQIL 4JZJB 1SVZA 4X98B 1OSZA 4CADB 2VXQH 3GSXA 1RUPL 4NQVB 3K2MC 2DF3A 1KXTB 5IHZB 3IXTA 4OGYL 1JPSL 1FN4B 3CMGA 1WBYB 5FO7B 1RHHA 1X4XA 4L4VE 3HMWH 3I6KB 1INEL 4L8BB 3GBMH 4Z8FL 3VW3L 3MNVB 4A2LA 1MQ8A 2E7HA 4HCRL 3R06B 4POZD 1PG7X 4JFYB 3VFRB 1L4IA 2XY2A 3HPJB 4R7NB 4GKZB 3V5HB 4U3XA 4PJCF 1KGCD 4QXTA 5E2WL 1I1YA 3O3DB 5B8CC 4ODWA 3CVHL 3L3KB 4JZJC 3FFDB 5J0BA 1VGEL 4ZUUA 1R3JB 5DJXA 2W91A 4UQ3A 4XP5H 1BZ7B 1NKRA 3VU2A 4MAYD 4YDJA 3T3ME 1VACB 4UBDD 1WBZB 3DRQB 5T3ZH 3IVKA 3SKMB 1KC5L 3G6JF 4W4OC 3TH2T 2LFGA 1X4ZA 2NXYD 1NCBL 4WHYH 2R2HB 3QO1B 2PO6C 5DEFB 3WMSA 4RSVA 5DJYA 3PQYB 3V0WL 6CGTA 4JFHE 4RAUA 4CVXA 1BQUA 1ZHNB 3QG6A 1D5XB 3IGAB 4D8PB 4ODVL 5FOJA 2WBJA 3DVFA 1RVFL 2HH0L 4UT6H 1FP5A 1Q72L 1S7RB 4MNHB 2O5ZL 1OGTA 2HRPH 3UTTD 2PXYC 1JGEB 4KC3B 2WZPD 4W4NA 1BX2A 1T5XB 3BWUC 4ALAH 4A6YB 4JHBA 2P47B 5I19L 2V9TA 5F9OH 1V05A 3MCKB 5JUEH 4N0FB 4GKSB 2Y23A 3MRNB 3WJJC 3KLHC 1Y0LB 3N1MC 4K3GA 2MHAB 4WI9A 5E6IB 1FNLA 5HD8C 4H1LB 3FFCE 5JPNA 2FO4A 1ZVYA 1H5BA 3PV7A 3LDBB 1XF4A 3GJFH 4G9DB 3OX8A 4J3WA 4R4FL 4F7EA 1JGDB 2IBZY 2XN9B 1DN2A 1U8LA 1ZGLA 2FLRT 4X6CE 5KJRL 4JCLA 4Y19D 1OAKL 2OXHA 4WI7A 1UKQA 3C8KB 4NBZB 1SY6H 4XP1L 4I2XB 4KXZH 4OZGF 1JUFB 1DFBH 1QR4A 2UYLB 4U7KA 2XWBB 5DJ8A 2DWDA 5FFLA 1B4JH 1OP3H 5E6IC 1PJ9A 3X11B 1NC4B 3MV9E 4WNQA 1N64H 2A74A 4LSUH 3BISA 2CLZB 4G8IB 1KPRB 2DJSA 3MLSL 4PJEF 4XCFH 5C2BH 6FABL 2JJVA 3RL1A 5TE7L 5IHUH 3MUJA 3SDXB 1IMHC 4QRPE 4KROB 4XX1G 5IB3A 4HWNA 3C60D 4LAJH 1T7ZA 2EC9T 1KCUL 5T1DH 4IRJB 3C2AL 4WV1A 1OAQL 5KTEL 3NCBB 4R6UA 4MSWA 1MCHA 5DURB 3LPFA 4M48H 5HHQA 4XNMA 1IT9H 4QCIA 4K7PY 1NAML 2UWEB 4FQPA 4LVEA 2P8MB 1FZJB 2Y06H 1VFBA 4BFGA 4PIRF 1J86A 3PNWB 1TETL 3MV11 2EZ0C 4KKBC 4W6WB 5F1NB 5C7XL 3X13A 2V2TB 3RVVC 4IJ3B 1HWHB 1NMAH 5CP7B 3GIVA 4JRWA 2DJ4A 3MRBA 1YYML 3VXUD 2FEEL 5B3NA 3IJHA 1G6RL 5EBWB 1KG0A 5F9JA 5CLTA 4KROC 4QYOB 4Y16D 1CZ8L 5DHXB 3ZTJG 1X5XA 3QUMB 3HE6A 1KN2H 3TT1H 3C6SB 3KXFB 1EUUA 1UXSA 5BS0B 4P5MB 1KCRH 1RZIA 3ALWA 3O6FB 1MIMH 1U8MB 3DX6B 5TDNB 5D7SH 1GGYA 1L0YA 1CF8H 2IAMA 4J7RA 4WW1A 5FHBL 5DSCB 3VRJB 4UILL 1AGEB 1DQJB 1IGFH 3HS0B 3DETD 1NLDH 3H0TA 2NW3A 3TBSA 3O2DL 1G7IB 1MJ7L 3RZWA 3ARUA 5J6HA 3SE8L 1FFNB 2NY5H 4XP9H 3FB7B 4IJ3C 4PJ5A 3VXQB 4U6VH 2FJHB 1G7PB 5F9DC 3QEQD 5TE4L 5HVWA 2PW1A 3UTQB 2V7HA 3QFJE 4L4TB 2AS5M 4IOIA 5JPMB 1BIIA 2QHRL 2I5YH 4DTGH 2V2WA 3D1MC 3HAEH 3Q1SH 4MMXC 2GK2A 3MUGA 1JGVH 1WFOA 4PJ7B 1N3NB 4GO6B 5I6XB 1CFNB 2R69H 4L3AA 5TH2B 1UH3A 4WU7A 1XF2A 2NY6B 1U8IA 1BJ1J 5E8OA 2FL5A 5EWIH 1WWCA 4HT1H 1GIGH 4V1DB 4BA8A 3OKNB 4HCRA 4H88L 2HT4C 32C2B 3T8XA 4X8XA 2GKIA 2IBBA 3H3BC 1C12B 2BOBA 5D2NB 1J8HA 3QULB 4KK5D 4WHDA 2KQMA 2OS7A 1VKXB 4P57B 5JNYA 2OL3H 3FQUB 5DHVB 3NCEB 2ZG3A 1F3RB 2IFFH 4P2YA 5FGCE 2AJZB 3CD4A 1M6OB 5HGBA 4BH7A 4J12A 3BKCL 3K1DA 4PGEB 3OMZA 3V5DA 1QNZH 4U1HB 2NY6C 2NX5A 2VXSL 4E0RA 1JZ4A 3B9AA 3QNZA 1CL7H 4I0CC 4U1JA 1F8TH 4WEBH 3HE7B 2A77H 4KAQL 5L2JA 5J7CC 3P73B 1HYRC 4DOHB 4N0UB 4BSVA 1YY9D 4OCYH 4U1IA 4WW2B 4JFDE 4NQED 3EDEA 1A6UH 5D2NC 3VRIA 1YJDH 5IEHA 3ZDZE 1YN7B 4PRAA 2IFGA 2FIKA 3QUKA 4KRPB 3IFPB 4QF1B 4RIRA 3EDKA 1KIPB 4L4VB 1T4KB 1MJJA 2GTWA 2X7LB 4G9FA 4OGAC 3ARTA 5IBUB 3WJLA 5D4QA 2V5YA 1OB1B 4LCYB 3GGWA 3GSUB 2FD6H 4I9WE 4AEIL 5ANMB 4HQQL 1NAKL 2YPLB 3BGMB 4JN2A 5L2KB 1FGNH 2V9RA 4JEGB 1FL3B 3HE7C 5EPMB 5CBAA 3I9GL 3QZWA 4HLJA 1I3GH 2XWTA 1MAMH 4P23B 3F62A 4WW2C 3TLRA 1AQDB 2R29L 4LVNB 1LGVA 3Q0HA 3U1SH 4NIKB 4OJFL 2R0LH 1P53A 3FT3B 3JZ7A 4KRPC 1KT2A 4UDTB 1EEYB 1AFVL 3P0YH 5C0FB 3WFCL 5KVDL 3VXRE 4EJ1C 5DFTA 1F90L 4AL8L 4EBQH 3H7BA 5DS8A 1S3KH 1T2QH 3DX9B 2F74A 1MCFA 3LKNA 4GXVL 2D7TH 3S37L 3EJZC 3QIBC 2DQEL 5BO1H 5ILTH 5CZKA 2YUVA 3T3PF 1MUJA 1FFOA 4P23C 1OY3B 4XB7A 4LVNC 1FLRL 2L0DA 4OTXH 2CSPA 3VXME 1XGYH 5DD3H 3CU7A 5C07B 4GW4A 4C4KO 2VZTA 4G7VH 1R24A 1U91B 1HNFA 2FX7L 1MCJA 2QQNL 2VR5A 2OR9H 3BPLB 3D39B 1MJUH 1DUZA 2XZQH 2GTZA 2R0WL 2D31B 3QO0B 2VXUH 1CGUA 2Q8BL 5F7LB 3ZDXE 2IBZX 2WBJD 2M8XA 3L3OB 1B2WH 1LP9A 3GJEB 1NAMA 2FGZA 3D25B 1J1XL 2QEJA 4KI5C 1H3TA 2C3GA 3O3BA 1W0VA 1F4HA 5I66B 1QTYT 1WISA 1V3JA 5HDLA 1QR1B 2XRAH 3P77B 4HJGB 1WGOA 5HDBE 1SEBB 2CLRA 3TZVB 5F3BB 1YEJL 3FL7A 4P2RB 3BKMH 2CIKB 1RZKL 3KYAA 2F8XC 2UVFA 3T0DA 1A7QH 3VG9B 3BPLC 2VMFA 4KUCF 1J87A 1G6RA 4U3HA 3LSOA 1K2DB 4ZFGL 5DJ0A 1P7HL 1EO7A 3FO0L 4MLSA 4HHAA 5E9DB 5EZIL 1FO0H 1QO3B 2PNDA 3ARGB 1QLFA 5GSRA 1D5IH 4XCNA 2APFA 5KSBE 4PGJA 1A3RH 3JXAA 5T1MB 1FPTL 1ES0B 3WLWC 5I8CB 3O2DA 2EXWD 1DBAL 3P4OA 4HFUL 3QCVL 1F58L 1CIUA 1WFUA 4H25A 2UZIH 4JVUA 3TZVC 4E42A 3ZHDA 1UG9A 5EO1B 5JXAL 2XKNA 4ZO9A 4M6NL 1XF3B 4QTIL 3WFHB 3VG9C 1XGQB 1NDMB 1DVFB 3JWOH 3TA3B 4BSWB 4M5ZH 2IEPA 4P99A 3NIGE 1P7KB 1CLOL 1MRCH 4JFFE 2ZCKL 1W0WB 1B4RA 3O8XB 4HG4K 1KTKE 1K4DA 1GGIH 2P5EE 1A6TB 3QFDA 5D1QA 4JHZA 1ZLSH 4LCCB 4HKZA 3SDDA 5FHAL 1I7RB 1QBAA 1S7QA 3TO4C 1T1YB 4C56D 1XGTB 2HN7B 1K4CB 4W70A 1QLRB 3QXDB 5D71L 3CUPB 4JVPA 2EYTB 1QFWI 1BOGB 5I71B 1HQ4A 1QSFA 4G43A 1Q0XL 3IDUA 5E70A 3M45A 5KN5B 4WI2A 1UWXK 3BXNA 3P0GB 1NL0H 4P4KA 5K9OB 5FYKH 3G5VA 1WQVT 3EO9H 2IALB 3TM6A 3VRLE 2ARJA 4MJ6A 4JO4L 2H41A 3ZE0E 3DV4A 1IAII 3HC3H 2PYEB 2VO5A 4M1CC 2LV4A 4ODTH 2YUZA 3O8XC 5HHMB 2BNRB 1AKJA 4JFZH 3NMEA 4F15C 3DO7A 2GW5A 43C9B 5GGQL 1RIVH 2FR4A 3BH9A 3X14A 4LCCC 2AJ3A 4DFHA 1WIPA 1HIMH 3HE6D 3PHOA 1ZWIB 3ZYIA 1XF5B 2V7NB 4OV5A 1I85C 3BESR 3REVA 1W0YT 2JIXA 2XG5A 4LGSB 5ESAB 2Q87A 1WIOA 5F1IA 5I71C 3MNWB 2VDMH 3WFDL 1GAFH 2IAMD 4DCQB 1VFAB 2RHEA 1YNKL 1J1OL 1HINH 5FDYA 5BZDB 4XNUL 1DEDA 4GRWF 2W65A 2MNUA 2WIIA 5D7LE 2WQRA 3U30B 1ZHBA 1PSKL 4NM8H 4NYLA 4PJ5D 1YUHB 5DJZA 4YIQB 1NGWA 3BEVB 5GGSA 3BIKA 1FZMA 5IB5A 4HUXB 1Z9OA 2EKSB 4FQ1H 4XPTL 5C8JA 4AEEA 4A6YL 1Y6MR 2FBOJ 4X80L 1K3IA 1DEEB 3RDTB 2JLLA 5JIKA 4DUVA 1JHLL 4Y1AE 2WWKT 3HZMB 5D1ZC 2HT3D 4JRYE 2EEBA 1B6UA 4KKNA 4M7LT 4NRZB 2MCPH 3MSPA 3DLQR 4R8WL 4MCZA 1G7LA 3QEGH 4V2BA 3I50L 3BD3A 1NUGA 5B3JF 4JPWH 1F6AB 2R2BB 3WHXB 3B2UD 3MYJB 3BN9C 5FUZH 4ELMF 1J8HD 2C3WA 1R3IH 4G3YH 1U3HA 1AGBA 1GOFA 3L3GA 3S3JA 4P2OA 3DX8A 4ZS7L 3RWDB 5F6HI 1WZLA 1QQDA 1UM4H 2BOCA 1DQML 3VGEA 3WHE1 3STZB 4XTRD 1E4WL 4OCSH 4Y0GA 3V4PL 1MJ8H 4UUJB 5IV2A 4LLUB 3TV3L 2J88H 1D6VH 5C6TL 1IFHL 2FJFB 4JO3H 3TNNB 4F37K 3RY6A 3V7AG 4HUVA 4U31A 2VLJB 5DD1H 1IC4H 3Q6FB 2C3VB 1RJZB 2HFGL 2GSGB 3Q48A 4MYWB 4WTWA 3EOTH 1BZ9B 4QT5B 4LLYA 4O2CA 1KCSH 4N5EC 3HB3C 4ZTOL 2ZSWB 4LCWE 5I1JL 5GRUL 4M6AA 3OXRA 5GJSL 5TPWL 1DLFL 5EUKA 5BVJA 4UNVA 2EDJA 2HWZH 4G9FD 1F4XL 3JWOC 1R3LB 4ORGA 1Y6NR 2ZUSA 2R9HD 4K7FA 3HUJB 4OI7A 3FZUC 4LSQH 1I9RH 3H9SB 4E41A 8FABB 1SM3L 3F7RA 3VWKA 1JNLL 3HZVA 2P8LB 4OZFB 1MAJA 3LS4H 5EU3B 5J1SC 2BNQA 3IKCB 4PJXE 5BW7C 2A1WH 3QI9B 4TTGA 5IWLC 3BDYH 2F5AL 1U42A 5EU4B 5LGJB 5ICXB 2AK1L 4FS0A 3IJSA 1FVEA 1WZ1L 1WC7A 3QUML 4MXQD 4M62H 1F6LL 4PRIB 1OGAB 4AMKH 3ULVH 3TO2A 1FL5B 3OB0H 1QSEE 5TGBB 1IGYA 1BM3H 1PZ5A 3LN9A 4Y5VC 1UM5H 1CFVL 4CVWA 3LPWA 2VQUA 1S9YA 3CSPA 3I6GA 1I4FA 1CT8A 5FV1L 3WSQH 3UPRB 2OP4L 5L7XH 4JKMA 1WEJH 1X5AA 3MLYL 3VFSA 1KLGB 1N0LA 4QY8A 3L3IA 5ID1A 1S9WA 3BT2L 1T0NA 3GO1L 3QXVA 2XTJC 3S97C 3UC0H 4JZJA 4X98A 4NHCL 4CADA 1RK0B 4NC0B 2BRRL 1ZSDB 3FB8B 4RDQF 1QHPA 5KAQF 5DUBB 4PY7B 1UCTA 4NQVA 3RWHB 2H6PB 3SKOB 1RUKH 2CIIB 5IHZA 2CDFA 1FN4A 1WBYA 2FBJH 3FB6B 4I3GA 2HLFC 5FO7A 4OZIE 3GRWL 1INDL 3MLZH 2W9DH 4W4OA 3I6KA 4QRSB 2AJYH 3RVXD 4CN4A 3MNVA 1RD6A 5E8PB 3R06A 3QJHB 1LDPH 2X40A 3BUTA 4JFYA 3VFRA 1N0XH 1KCVH 2NYYC 3HPJA 1XGPB 4GKZA 4R7NA 2ORBH 3V5HA 2F8VA 4YE4H 4LLQB 3EYQC 1BD2B 3NIFE 3QXTA 3O3DA 3FO1B 3EKCA 5F89B 3REWB 3BDBA 3L3KA 1F13A 3FFDA 3M07A 3LHPH 1R3JA 3GSOB 3ALPA 2AK4D 4Y89A 3SDCB 4KUZL 3E3QE 1BZ7A 3MJ9H 3IXAB 1VACA 1AJ7L 1WBZA 1UYWL 3DRQA 3SKMA 1I7UB 3ZSTA 3I3BA 3PWUB 4KQ3H 2B1AL 2HKFH 2R2HA 3QO1A 1T0PB 1RI8A 2R2EB 5DEFA 2F53B 5GRXG 3NFPB 3VA2C 3T0AA 15C8H 3PQYA 1KJVB 2VITB 1EFQA 1KBGL 1ZHNA 3H2WA 4KK8D 1D5XA 3IGAA 5JW5A 3ZO0A 4HLZH 4D8PA 4R7DB 3VJ6B 2DDQL 3GSNB 3WHE0 2WLZA 5F8QC 4YX2H 3CDFA 4N90D 1T03L 4R90H 1S7RA 4MNHA 3SDCC 2VTFA 4ZO7A 3G6JE 1OM3L 1JGEA 1DQDH 4MA8H 4OBSA 1T5XA 5HI3C 4A6YA 4Z7UF 3X12B 5IJKC 3MODL 4LKXB 1SYSA 5C3LD 4JQVA 5KS9F 2A9ML 2B1HH 4O5LL 3MCKA 3MRIB 2EDKA 2GEEA 5F7DB 2VDLL 3QIWC 4KKCC 4N0FA 1S7VB 4GKSA 1GOHA 4XRCB 3G9AB 3MRNA 4OQTL 3O4LE 1Y0LA 4K3DH 2GQHA 2MHAA 1YQ2A 5E6IA 2PW2B 5L6YH 4H1LA 5E7BA 5HHOE 4HV8B 2BY0A 3B5HA 4W6XB 5D1XB 4PJGE 3AROA 4XVTL 3EDJA 4XWOC 5IFHH 3IU3B 4G9DA 4QXUH 1ZLUK 3ULUD 4PJFF 1JPTL 3CDGB 3TJEL 5IMMB 1OTUC 3DYOA 4OLYH 5HI4D 1JGDA 4KY1H 2XN9A 5ABDE 2J6EH 1BVKB 5HYFA 4CMMB 2X4QB 5CZVL 4P4KD 5EOQL 1P4BH 4NQCE 3QXWA 4RAVB 1YEDB 3AS1A 1NGZB 5GISH 3S96A 1HYSD 1HOCB 4I2XA 2IC2A 3T2NH 1JUFA 5HYQB 4WGVB 2XWBA 4QRRE 1FBIH 2R4SL 3CH1B 1F2QA 1A5FH 3Q5YA 1UACH 3ULVC 5E2VH 2CK0H 3X11A 1NC4A 5D1XC 2PYFB 2WBKA 1AE6L 1C08B 4I18B 3HNSL 2CLZA 3HI5H 4G8IA 2E6QA 2JIXD 1KPRA 1IILE 5J13B 3RJQB 1R5WB 2CKNA 4FTVD 1EPFA 4H1LG 3SDXA 1MI5E 5AZ2H 1XIWC 3VFNB 4DK3A 3LZFH 3U9PL 3PHQA 3H9ZA 4JRYB 4KZDH 1NSNL 2FH8A 2QJDA 4DN4H 3UYRH 1FE8L 4HC1L 3S98A 4IRJA 4XVUD 4PV9B 4U33A 3BD4A 1G7JB 2UWEA 4OUUB 3SY0B 2P8MA 1FZJA 3NA4A 4D94A 4L3EE 4YLQT 4WFGE 2W9EL 2QKIB 4U1SB 3PNWA 5T3ZE 4N8VG 5KSAB 4HPYH 5H94B 1CCZA 1XT5A 4G8GE 4RGND 4OCWH 4PJEE 5F1NA 5C9KA 4R3SB 3QQ4B 2V2TA 3WFBH 3V5KB 1IC7L 4I18C 1IZKA 4M03A 3NN8B 5CP7A 5CD3B 1I7ZB 1FSKB 5MEOB 4R4ND 4LRIC 2UUDK 5T33L 4IM8A 4OD3H 5EBWA 1OCWH 3LKSB 4QYOA 5GS0H 1U8PB 3PP3H 1XH3B 1AR1D 3QUMA 3OXSB 3C6SA 2BVQB 4HJ0C 4UI2A 2A6KB 4P5MA 5ADPL 5HXMA 3O6FA 2FHBA 3DX6A 1U8MA 5TDNA 4NHUB 5A2LH 5DSCA 3VRJA 1QYGH 1QRKA 1U3HD 4GUPB 5D72L 1DQJA 5E08H 5CKGA 5LCVH 3HS0A 4HUWA 3NPZB 5I1KH 1G7IA 3OKOA 5AYQA 2AERT 4YXHL 1CQKA 1FH5L 1OW0A 4N0YL 1A6ZB 3FB7A 3VXQA 5HI5D 2D4FA 1KELH 1FSKC 1YPZB 5CGYD 2FJHA 1G7PA 1G9MC 2LVCA 2FWOB 3UTQA 1FFQA 3GNML 4L4TA 5JPMA 3VXPB 1S8DB 4PJ7A 1N3NA 5GQBA 4YHOH 4DGVH 1CFNA 4I5BB 5TH2A 3ARFB 4PJXB 4QRQB 1HE7A 3MR9B 3GRWA 4RISH 3FHQA 1X5YA 2AV7B 3BRDA 2C4XA 4V1DA 3OKNA 2ADFH 2J5LB 5DVOA 3AXLA 3KPQB 1C12A 3AS3A 2NY4B 4TPRL 3FRUB 5D2NA 2BJML 3QULA 5CJOH 1VKXA 4IOFC 1J9CT 1MVFA 4P57A 4E41D 4PGBB 1PKQB 4NKIH 2B8OT 3FQUA 5DHVA 3UBXB 3VWKD 3S35L 1BF8A 4XC3L 2PKDA 3O0RL 2BNQD 1MCOL 2DQDL 3SBWA 2AJZA 4NJAL 3RL2B 1M6OA 3NZ8B 5J11B 1ADQH 1NCCH 4PGEA 3E2HB 4OLZH 4MJ5B 1W72B 4I48B 3L7EB 2OX5A 4XPAH 3MGOB 3HE7A 3RGVC 1CBVL 2BDNL 3P73A 1DBJL 4R96B 2J5LC 2YK1H 1QHOA 4N0UA 5C71A 4WW2A 4JFED 1KUMA 1NUDA 2K7PA 3W0WE 4YGVB 1YN7A 1QRNE 5TFSL 1A4JB 3BJ91 3IFPA 3IDXL 2GJ6E 1KIPA 4L4VA 1T4KA 5C0IB 3Q2CA 3W5NA 3KPMB 1XMWA 2X7LA 3G08B 1MY5A 1J7VR 4QNPE 2EICA 4LCYA 4YXKL 1OD7A 3GSUA 5IF0B 5ANMA 4X8JB 3MUHL 3HG1E 2YPLA 5L2KA 5CKAA 1YMME 4PRHB 1FL3A 1SJEB 3K0WA 1M4KA 5EPMA 4M7KL 3ARVA 1SJHA 5I1CH 2Z92B 2BY2A 4HS6B 5SX5H 4XHJD 2FSEB 3SPVB 4OQTA 1KFAH 4MS8C 35C8L 4I77L 3LVEA 1UWGH 1T2XA 3BX7C 3RRQA 1R3KB 2IG2L 3FT3A 1WFNA 1XCTB 1N6QL 3H3PH 2EDWA 5T3XH 4JRXD 2X4PB 4UDTA 1EEYA 5CD5C 3SO5A 3MOAL 4U49A 2D9CA 5T5NG 5C0FA 1MWAB 3DI2B 3SKJH 5DRNB 3NCJL 4PJCB 5ITBH 3THML 4X83A 2ZWLT 3LH2L 1CG9A 3DX9A 1HCVA 1UJTA 2J3SA 5CP3A 1BFVH 4FFVD 4ZMAT 4M7LL 4LCIL 1A7NL 1G7HB 1EMTH 5I15L 4KI5E 4DGYH 5IG7A 3QEUA 4UV4L 4AIXA 3OV6A 3CSBA 3FQWB 3KS0H 3CLEH 3S88H 3OF6D 4ZSOE 5C07A 2CRYA 3GBNH 2VAAB 1EJOL 3WUWB 2DQIL 3O9WB 4HMDA 4XNYL 1U91A 4TQEL 4PJ8B 5DC0A 3UZVB 2BHYA 5I74B 3LEVH 3PQYD 3D39A 4Z7WE 2Z91B 1URLA 5CWSB 2AI0L 1KB5B 2D31A 3JV4B 3QO0A 3SGDH 3VFTB 1EBAA 1V7NL 3WDJA 5J06A 5F96L 1CN4A 3T3PE 2LTQB 1A14H 1N4XL 4HC1A 1LO3H 2OTUB 5LXGL 4MVBC 3L3OA 4HF5H 5D7KE 5MHSD 4FFZL 3D25A 2OMBA 1CVSC 5DD6A 2OR8A 2ZPKH 5EORH 5I66A 3DPBA 5HSFA 1KLUB 3KPRB 3P77A 4HJGA 4DUWA 4NZUL 3CFEB 3JWNC 1Z3GH 1SEBA 4PB9L 4WWKB 3GZKA 2DLEA 5EUOF 3ORJA 3TZVA 5F3BA 5E2TH 3O9WC 1TZHB 4P2RA 4I3SL 1AC0A 2CIKA 4Y4HC 2Q8AL 1PGRB 2BVYA 4L5FL 3E0GA 1K2DA 2DN7A 4YBLB 2FGWH 4PGZA 5JMOC 2LTQC 5DK0B 1FYTE 1H3GA 1DJSA 5CINL 5E9DA 5I30L 3JWDH 3B2VH 4DEPB 2YRZA 1TPXC 1CD1A 1QO3A 2AJVH 2DM7A 3ARGA 5GRVL 1QFUH 1FYHB 3O2VL 4CW1B 3I6LD 1PAMA 4M00A 5T1MA 3EZ8A 1MI5B 1ES0A 4MXWH 5I8CA 3C5ZB 3CVIL 4LGPB 3K80A 4UT7L 3CX5J 2YUXA 2DQCL 4OZGB 1IGMH 3VFGL 5D5MF 5EO1A 1UGNA 1OAZH 4YZFF 1XF3A 2EIEA 3WFHA 1U93B 1NDMA 4YBQC 1DVFA 3TA3A 4BSWA 2VSDA 1P7KA 1NC4D 2Y9RT 3ZKND 2R4RL 4PD4J 1W0WA 5FUOL 4ODXB 1QLEL 4LPVA 4PJEB 3DVGB 1A6TA 1ACYL 1BAFL 3FMGL 3ZLQC 2ED9A 2KBGA 4KROD 4RFNB 4LCCA 3GFUA 4FFWC 3EYSL 4JREB 1T1YA 1XGTA 2HN7A 4TUOB 2YD9A 3C5ZC 1K4CA 4KTEH 2OR7A 5H35B 5HJ3B 5C08B 4IRJD 1QLRA 3QXDA 2YEZB 1I85A 1I3VA 3CUPA 4YHPB 5DURD 4X6BB 2EYTA 3QPQC 1BOGA 1DR9A 2DQHL 2DLFH 4GSDL 4LK4A 1TITA 5K59E 5KN5A 3CFCL 1PKOA 3IDIB 5B21A 5K9OA 5J8OA 2IALA 4ZUWB 1EHLH 5FYLL 3FAXA 2ILLA 2PYEA 3GSRB 2BVOB 1CDGA 2RBLA 2BNRA 1YEGL 3OPZL 3TCLA 5INCB 1BJ1H 1MFCH 43C9A 2AJXL 3OKEB 4DKEH 1U8JB 4NGHH 3MCLL 1KJ3L 4JREC 1TXKA 3QFJA 3N1FC 1ZWIA 1XF5A 2V7NA 2AXGA 1MFBL 4KI1A 3MRGB 3IDJB 4JANB 3O6FD 2XQBL 5ESAA 2XZAH 3MNWA 3MA9H 2W07A 4DCQA 1VFAA 2VLKE 3DXAB 4IIQB 5EIQA 4XVSH 5BZDA 4CUCA 1N5YL 3G6DL 3GSNL 5E94B 5GHWH 5JW4M 1A6AB 1OWRM 3I75B 1YUHA 1VPOH 4Y4FD 4PGDB 2J8UF 4YIQA 1RJCA 2J1KA 5KZCB 3BEVA 1YEKL 5D7IE 4HUXA 4M9OA 5GGTH 2PF6A 1KB9K 3SGEI 3QSKB 2XA8H 1DEEA 1QA9B 2P5WB 2DIBA 3RDTA 2W0FB 5CEYB 4NWTH 4K3EH 4MJIE 2D0FA 4I3RH 2IQAB 5F97E 3HZMA 2F15A 2APTA 2NY1C 5JLZB 1LEKB 1H8OA 5I73B 5IBLD 4XC1L 1MIEH 4NRZA 3BH8B 5DT1H 3ULUF 2CO6B 5DVMA 3VGDA 1TCRB 2P45B 5E95B 4V1DD 1DN0B 2AEPH 2H45A 3OGCB 2H26B 5EU7E 4CL7A 1Y6KR 4KDWA 4MWFB 3L95B 1F6AA 2R2BA 4F37F 3WHXA 3MYJA 1AI1L 5EZJA 2DYPD 4LHUG 3MBEB 3SGJA 1MRDH 2ARWA 5C0CE 5F7KC 3R4DA 3RWDA 4K3JH 1JL8A 2AV1B 2QADB 3B9KB 3IDNB 3STZA 4L1DA 4EI5B 1F6FB 5E5MB 4LNRB 2WUCH 4F57L 3VE0B 1FRGL 5I73C 4O02H 4UUJA 4PJAE 3JWDC 4LLUA 4J4PC 4WY7L 1L7IL 3TN0C 5BW7A 1ZV5A 1SJXA 4H8WL 2DQFB 2FJFA 3TNNA 1NCDH 4PB0H 3D69B 2VLJA 1CTOA 3Q6FA 2C3VA 1RJZA 4NJ9L 2GSGA 3MBEC 1BZ9A 4QT5A 4RMQA 1WJ3A 2Z0BA 4KRPD 5EOCH 2ZSWA 4UT9H 3S36H 3NABH 4L4VD 3D0LB 5FYKE 5ISZB 4P3WA 3DVIA 4E5XB 2FEDD 4WTZA 4MNGE 3B9KC 1DBKL 3R0NA 3RUGF 1R3LA 3A6BL 3HUJA 1K6QH 3OJMB 4N8CL 3H9SA 8FABA 5L2KD 1U95B 1H8SA 2P8LA 4OZFA 1J88A 3WXVH 5EU3A 2YS4A 3IKCA 4G8FB 3QI9A 1RV6X 5EULV 4WUUE 2M1KA 2XTJE 4ZTPH 5EU4A 5HHPB 3HAEB 5LGJA 4YEEA 2G9HB 3HKFA 5CIPH 4OLXL 5ICXA 2JKXA 1UZ8B 3TT3L 3QWQB 3WIIL 1ZA3B 4WEMB 3VXMA 2I07B 4R9HA 4TSBH 4PRIA 2J4WH 1OGAA 3MREB 3L6FB 5IW6B 1DQTA 1FL5A 4OD1H 4Z6AT 5TGBA 4X7FC 2APXA 3LS5L 5J12B 4OZHF 2VDQH 5LQBL 3ZYJA 1FNSL 2NCMA 1NFDF 4JFHD 4URTB 3K2UH 3QYCA 2EE3A 3IF1B 3UPRA 3WL9B