4KNTA

Copper nitrite reductase from nitrosomonas europaea ph 8.5
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
285
Chain Sequence
b'KTVQVTLHAVETDVAYDNKGSTYRAWTFDGKVPGPVVRVTEGDTVEFTLINDKNSKNSHSMDFHAARLDVVEDFESIKPGETKKYTFTADNPGVFFYHCGSDPMIQHIARGMYGVIIVDPKDANALPKADREYVLIQAEHYENPDDKTAMMQNKWSNVVFNGGVFKYDPVHDSEATSWLQAKPGERVRIYFVNAGPNELSSLHPIAGIWDRVYPSGNPKNVQYALQSYLIGAGDAATLDLISPVEGANAIVDHSMRHAHSGAIAVIMFTNDADPEAGRGENILIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multicopper oxidase type 1
publication title Characterization of a nitrite reductase involved in nitrifier denitrification.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 89
structure length 285
sequence length 285
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kntA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kntA01
8PAZA 1TEGA 2FT8A 4KO5A 1OE3A 2IWKA 3EHBB 4DP2X 3X1EA 3NSCA 1ZIAA 3NT0A 1AQ8A 4E9TA 3ASNB 2GIMA 9PCYA 2XXFA 4AKPA 3NP3A 2IDQA 2YXVA 3BVDB 1JZFA 2Q5BA 3TU6A 5I6KA 1FA4A 3N2JA 1OV8A 1SHXA 1GW0A 3NJNA 4JHUA 4HCIA 2HX8A 1BQ5A 2I85A 3FSWA 4N4YB 4KO6A 1RZQA 5F7BA 3EH5B 1BXVA 1NWOA 2PCFA 3FU8A 1WA1X 4G70B 4GYBA 4UANA 2E86A 3PAZA 3IEAA 2PP8A 1NPJA 2IWFA 3C75A 1J9RA 1MG2C 3FU9A 2GSMB 2FWLB 3KW8A 3ZX1A 1E30A 1V54B 2FQGA 3CDZB 4DPAX 2YQBA 2MTAA 4AKOA 3X1BA 4E9YA 1RCYA 1M56B 3UAEA 1AZBA 2FQFA 5PAZA 1QNIA 1KBVA 5B1AB 3TA4D 3X1NA 4YSQA 2WO2B 3S8FB 1NIEA 1OCZB 2HX7A 1KYAA 1NPNA 3OMAB 2AFNA 1GS8A 3TBBA 4YSDA 2EIJB 3NSFA 1CUOA 4F2EA 3IBOA 2BP0A 1MG3C 3WNIA 1FWXA 6PAZA 5TK2A 1BQRA 3UGEA 3FYEB 4YVUA 4YSAA 1JXDA 4A2GA 2BP8B 5AFAA 4BDVA 1FFTB 2YARA 1JZIA 1NIBA 3QJTB 4KNUA 2UXFA 3WKQA 3FSVA 5AKRA 3S3DB 3AG4B 2XV2A 4P5RA 3T6ZA 3UABA 2BHFA 4DPBX 5LDUA 3ZIYA 2BO0A 3ZBMA 3QJSB 1J5DA 3ASOB 4YSCA 2BWIA 4Q8BA 4YSEA 4FA7B 1WAEA 1F56A 1ET5A 1ZDQA 2Y1AA 4BWWA 1HAUA 1BYPA 3FT0A 4NB7A 3EH3B 3DTUB 2B3IA 2GBAA 2TSBA 3NJKA 2JKWA 1W8EA 2GHZA 3FS9A 2BW5A 2GC4C 1NIAA 3ABKB 3IE9A 4AZUA 1IUZA 3OQRA 1E67A 2P80A 4K9JA 1AG6A 2FQDA 1PZAA 2QPEB 4YSTA 3SBPA 2QDVA 1EZLA 1OCOB 2YAPA 2YAHA 1IKOP 2H5UA 3DIVA 3G5WA 1T5KA 1TKWA 2DV6A 1E65A 1JVOA 1L9TA 1ZDSA 3H56A 4GY4A 4HHGA 4DP0X 4BWTA 2VMJA 1CYWA 2N0MA 4ENZA 2DWSA 4GXFA 2J56A 1A65A 3AG3B 1JXGA 1CURA 1OCRB 1A8ZA 5F7AA 5A7EA 4PAZA 1OCCB 2BW4A 4MFHA 1ZPUA 2FTAA 4P5SA 4M3HA 3CVCA 3FPYA 1BXUA 4EF3A 3OD3A 3QJRB 3FU7A 3JTBA 1NIDA 1SJMA 2FT6A 1SHWA 4WTQA 4KNTA 3NJMA 1M9WA 1E5ZA 2FJSA 3EF4A 2PPEA 3ABGA 2BP0B 2FNWA 4DPCX 3ERXA 4DP4X 3NSYA 4DP1X 1XB3A 3NJFA 2XUWA 1ASOA 3T9WA 1URIA 3SBRA 3CVBA 4BDVB 2EIKB 4FAAB 2WSDA 3CZUB 3IN0A 2UXVA 5B7EA 1NINA 5D4IA 5I5MA 1MZZA 3QJVB 2IDSA 3ABLB 2LLNA 1A3ZA 4G71B 2PPCA 4YSRA 2VM3A 1ZV2A 2W88A 2UXGA 3FQ1A 4E9QA 1AOZA 3S8GB 4DP5X 4E9SA 1PZBA 1JZEA 3PAUA 1GR7A 2YAQA 3PAVA 4W1TA 2I7SA 3MX0B 2CUAA 1TEFA 2ZXWB 2H47C 4AI7A 2Q9OA 3QPKA 3SQRA 1SF5A 3OM3B 4AX3A 1J9TA 3T6VA 3WNJA 2J5WA 2X88A 1TU2A 4L0PB 2VW7A 3PXLA 5AZUA 2JFCA 1SF3A 3TASA 3T71A 1X9RA 3AW5A 3PLYA 1L9RA 4UAHA 2R7EB 5IY5B 5I26A 1CC3A 4QKTA 3UADA 4DP9X 2GC7C 2YAFA 1I53A 4E9RA 2IAAC 4BXSV 4YSOA 5D4JA 5I28A 1WS8A 1NTDA 1A4AA 2W8CA 1RKRA 4KOBA 1GY1A 1AS6A 1ID2A 3WG7B 3FQYA 1PZCA 1HAWA 1OE2A 2BZ7A 7PCYA 1AZRA 2HX9A 4HHWA 1SFDA 3BQVA 2VW4A 2YAEA 1RZPA 2ZOOA 1ETJA 1AZCA 3FU7B 2FQEA 3TBCA 1J5CA 2RACA 1KV7A 4KOCA 4A68A 1L9SA 2FT7A 3QQXA 1SFHA 4BK5C 1BQKA 2DWTA 3U25A 3N55A 1L9PA 3NJGA 4GP8B 1SNRA 3HB3B 2CALA 3PPSA 1NDTA 2HZHA 3ZDWA 2A3TA 1X9UA 2ZWNA 4WKXA 2CAKA 2VW6A 5E9NA 1QHQA 4X4KA 4GP5B 3CVDA 7PAZA 1V55B 3CDZA 5B7MA 1QLEB 2AANA 2GI0A 3T6WA 1JZJA 1KCWA 2XXGA 4YSUA 4G7RB 1MDAA 5I6NA 2PPDA 5D4HA 3AG1B 2EINB 2PCYA 3GYRA 3NJIA 3OMNB 3QJUB 4Q89A 4A2HA 1KDIA 3D12B 6PCYA 3L45A 1AS7A 1WA2X 2B08A 2XYBA 1AS8A 1ILSA 3V9EA 2XX1A 4F7KA 1AIZA 2VM4A 1BEXA 1E5YA 3WKPA 3DKHA 1AANA 3V9CA 3KW7A 4YSSA 1DZ0A 2PPAA 1N70A 1IBYA 4A2DA 2J57A 1BAWA 3JT2A 4YL4A 2JXMA 3ABMB 2AZAA 1GYCA 2OV0A 1PAZA 1CYXA 1WA0X 2OJ1A 2HXAA 3UACA 5B7FA 1IC0A 1J9SA 1NICA 3HEIB 1HFUA 2UX7A 1JVLA 1XMEB 2YAOA 3X1FA 1PLBA 1JERA 2XV0A 1UATA 2YXWA 1JOIA 1KBWA 3S3CB 3RYMA 4BWUA 4N8UA 4UF7C 1V10A 4HALA 3MBWB 1KGYE 1L9QA 1VLXA 3NYKA 2QPDB 1IBZA 1W6LA 4KO7A 1PNCA 1OOWA 2X87A 5ANHA 2XVBA 4ZK8A 1JZGA 2PLTA 1BXAA 2YAMA 3CG8A 1GS7A 3S3BB 1AR1B 1NZRA 1SDDA 5B1JC 2CJ3A 1XB6A 5FC9A 1AG0A 1ASQA 3GDCA 5PCYA 4A67A 4W9ZA 3FYIB 2EIMB 5B1BB 2VN3A 2HLEB 2MRYA 2CCWA 2HRHA 5TK4A 4CSPA 3AY2A 3OMIB 2DYRB 2AVFA 1A4BA 3AG2B 1MZYA 4HCGA 1YLBB 2HRGA 2H3XC 4KNSA 1PLCA 4RH4A 4GP4B 2AZUA 2UX6A 3QJQB 5B3SB 1GS6X 2XU9A 2OCCB 2WO3B 4JHVA 2ZONA 1GY2A 2DYSB 4BXVA 4DP7X 1PCSA 3NSDA 2IWEA 1ZIBA 5I6MA 1ET7A 4YSPA 3PCYA 4HIPA 1N68A 1KCBA 5B1JA 3GXUB 3WIAA 1WS7A 1EHKB 3EH4B 2BWDA 3FQ2A 2NRDA 3FPXA 5B1KA 4KO9A 4YVNA 5I6PA 1ILUA 3IN2A 2XWZA 3AZUA 1NWPA 1M57B 2XV3A 1PF3A 1PY0A 3NJHA 3H4FA 1GSKA 1PMYA 2QDWA 3SBQA 4NERA 3UAAA 2IDFA 4E9VA 2XX0A 1ASPA 3X2QB 2Y69B 4TXVB 1AACA 4G7SB 1J9QA 4HCFA 2QT6A 1BYOA 4DP6X 1XB8A 3NJLA 4PCYA 2IDTA 2IH8A 4F2FA 1PLAA 4A66A 5I6OA 2XLLA 4CSZA 1AZUA 3NJJA 4E9XA 1ET8A 1JZHA 1OE1A 4E9WA 4JKNA 5I6LA 1DYZA 3FSAA 1R1CA 3NP4A 4HZ1A 2VSKB 2UXTA 4QLWA 1ADWA 4G7QB 3T6XA 2PPFA 2I7OA 3H4HA 2P80D 1KDJA 2GB2A 5EHFA 1SDDB 2DY2A 4HAKA 2EILB 5I5JA 2IH9A 5I5IA 4A2EA 1AAJA 2VSMB 4A2FA 1A4CA 4M4RB 2CBPA 1W6WA 2IDUA 1AZNA 2R7EA 2BZCA 2J55A 4NAJA 2PP9A 4AKQA 1NIFA 2BP8A 2PP7A 1OF0A 3FSZA 3WI9A 2TSAA 1JXFA 1L9OA 3X1GA 4DP8X 4G72B 1B3IA 1PNDA
chains in the Genus database with same CATH superfamily
3FT2B 3MNZA 3NCJL 1U8JB 1QBBA 4GXVH 1NC2D 1AD0B 4CKVX 3FRPA 3NEEA 3D3VE 4PJGE 2GIMA 4LRIC 2BVOB 3DV6A 5I5RA 2Z35A 2G3MA 2JK5B 2SEBB 3VVWA 2BLFA 5ERWA 4N3TA 4UILL 5LG1A 4F3FA 4Z0BH 3EBGA 3LIZA 5DDHA 4QHNA 3WKNA 1G1KA 4LGRB 5E4AA 1S78C 4G1MB 4YUEH 4FQLL 1IV8A 2CRMA 2IGTA 4R7XA 4QRFA 4J3VA 4MJHA 1ZT4B 3MRKB 4AYEC 2VXVL 3L9BA 3PAZA 4XZ4A 1WEJH 1Q38A 3HE6A 1TQBC 3OJ2C 2NR6D 1NPJA 1X7QB 2VQ1B 2IWFA 3C75A 1TJGL 3FN9A 1IE4A 5IB5B 5ID0B 2LU4A 3KW8A 4MNGA 5GRXG 3ZX1A 3MAWA 5DYFA 4YHNA 3AY4C 3D9AL 1K6QH 4M03A 4KJYA 1YEIH 2LAGB 3BDXA 4K9EH 5GPRA 1TXKA 1YYLL 1B3JA 3I74A 4YSQA 2EDOA 1Z9SB 2E6JA 1F41A 3VGAB 3QDAA 1JWSA 1WCQA 1RIVL 3CN3A 3I2CL 4IK7A 4PRPD 4G11A 1HEZA 2OR8A 1IM3B 2VABA 1GS8A 1S9XA 3MRIA 5F1SA 2OA9A 2J4WL 3KWWA 3DHJA 1NBYB 5FS5A 1OM3L 1QKZH 3VXUE 4GW1B 4RMBA 4WO4C 5IKCB 1L4IA 1GGIH 1TTFA 3EHBD 2J12B 3HI1B 4BSWA 2OMTB 4NUJB 2BDNH 5JPMC 3IMSA 4G6AD 3HZ3A 4JPWH 4OZGB 1QTYT 3D69A 4JJOA 3QUKB 2GVYA 2W0FA 4FC3E 4JY4A 3FFCD 4OZFA 3VUAA 3PIQA 4XN1A 3S3DB 2OL3B 5I1IH 3T6ZA 4KUZH 4XVSL 4ABVA 1H5BA 1F86A 3SE4C 2NLJA 4HEPA 3TBSB 3C09B 5ADOH 4Y16D 5ICXA 4XPGH 1MNUL 5FA4A 2D3VA 5C08D 5IFJA 1TZOA 1U8MA 2XZZA 1AO7D 1UXWA 4LHQB 2AJUL 2VZOA 2Y1AA 3DUSA 5DFVD 1BAFL 3LN5A 3M1BB 3WFDH 5INCB 3RY6C 5D8JL 4FMVA 2K6YA 1MJUL 1JZ4A 4YDKH 4BYHA 4QPEA 3LKRB 2HJFA 5KJ4A 2G75A 5FO9B 3IKCB 4WEBL 3X12B 4ODVH 4J3UA 5A16B 2PCFB 3SPVB 3UMNA 1EBAA 4HBCL 1TO5A 3AM8A 4NO3A 5IESH 1OCOB 2XWTB 4OTXH 3DX8A 4I0PB 5D1XA 4NN7B 1IKOP 2E4TA 1YEFH 1UB5B 2BSEA 1A7RH 1OAKH 4CILA 1TKWA 5JW4R 4GO9A 3QDJA 3H56A 3O6FD 4I9XA 4F27A 4HMDA 5J11B 1JZ7A 2OSLA 4LSVL 2NQCA 4XCEA 4LSTH 1D9KA 4N6RA 4MKMA 3GK8L 1MHHB 3BKJL 4HD9A 2IFGA 4QRUB 2DWDB 3FOMB 5E8NB 1D5XB 4JY6B 4Z7UF 4MA3B 1XZWA 2F54D 5LGHH 3SYQA 1INQB 4CVXA 2FT6A 1IKNA 4V33A 2C9AA 7CGTA 3KH3A 4KI1A 2UUDK 1BQHB 1IGYA 4GSDH 3IJSB 2PPEA 1NH6A 1SJHB 1NCBL 1P4BH 4POUB 4OCRL 5D5ME 4DP1X 4G5ZH 2NOYA 3IK2A 3DJRA 4N24A 3UYRH 3WUWB 1A4JB 3IRPX 4A7SA 3APNA 1A3RH 4AL8C 1A9EB 3B2UC 4H26A 3BOVA 3L3JA 4FLRA 4CVUA 2WQVA 3O8XB 1CGYA 1AQDB 4P06A 4AE1A 3ZHDA 4X7TB 5C8JA 5F7NC 3X14A 3FU0A 4BUHA 5MEOB 1SJEB 3JUZA 4MJ6B 4NQCD 4HMCA 4N0YL 3STZB 1IC4L 4AT6B 4XAKE 3W39A 1NINA 4IRSC 5D4IA 3IFNH 4FQIH 1ZE3C 3JV4A 3QFGA 4WFHD 5GZNA 5LHDA 4HT1L 4WSKA 4GQPH 2W07B 3EYQD 3LRSB 1LJMA 1Q94B 4U7SA 4QRPB 4PS4H 1PG7X 1A7QH 1I3VA 2JLPA 3C5SA 4UNTA 1ORQB 1HNGA 2QSCH 3G9VA 4ZAKA 5CJXC 1THCA 1DTUA 2AXGB 3UC0H 4C83B 3BP7B 3MX0B 2ZXWB 5HVFB 1FZKA 4EBQL 5DR5L 1I8MB 2H0PA 4J3WA 3SQRA 3U2SA 1KCVL 4FG4A 5IOPB 2CU9A 1U3ZA 4PJ9C 4WUUB 5DVPA 4DKFH 5EF3A 1ACXA 4BQBA 5TQ2L 3BWAB 3RIAF 3C6LA 4WHDA 3ZTCC 4EOWL 4HETA 2HJKB 3CQPA 2OZ4H 4HC1L 1QFPA 2R7EB 3RI5K 4PJDA 3GMRB 4HIJB 2CO1A 1CBVL 4PG9A 3WN5B 4JVUA 4UIMB 4E41B 3BYYA 3EO9L 3L1OL 4BXSV 2JTYA 2QGBA 4CW1A 1S7XA 2JKTM 4KGLA 3BESR 1HSAB 1J0JA 1WAAE 3MACL 2BZ7A 1DCEA 4KK6C 4YGVB 4Z5RB 3BO8A 2NY6B 4ZUUA 4Y4HD 5ESAA 5LQBL 1LE9B 2L7QA 2EACA 4GRLD 4HKJA 4ZOCA 2OLDA 4FA8A 3BAKA 2DKSA 2FYVA 3QQXA 2YLHA 3R4RA 3OSVA 2I9LB 3UERA 3MCLH 2EZ0D 4PW3A 4U2YA 4I89A 1QI5A 2DIBA 4U1MB 4U6VH 1PAMA 1NDTA 4WI8A 1OTUD 3TIEA 3BH9B 2VERN 4WKXA 3MBEB 3MHZA 1MCQA 4X9YA 2NY3D 3MRJA 4NUGL 5F9DC 1KLFA 2DWEB 5E9NA 1QSED 3TJHC 3BN3B 2K8MA 4TUUA 3BSZH 4L5FE 3IB4A 4W9CC 2CIKA 2UVFA 1V55B 3FO9B 4XCYA 3CU1A 3U30B 1FYTA 5CJOL 3TTYA 1AJ7H 3WTXA 4L29B 2XG4A 5AVSB 2J1WA 1MDAA 2APTA 5D1ZA 4EQ3A 4OB5L 2N1TE 4LP8A 2DQJL 4XPAL 3DGDA 3D34A 4PJ6A 1U8HB 3ULVC 2Y23A 1MFCL 2YD7A 1IEBB 4HX1B 3LZPA 2NW3A 1AS8A 1KEGH 1HESA 3GZPA 4FG6C 4PREA 2I69A 1BZEA 3TH4T 1N19A 2XQYK 3KMDA 2BRRL 3QO1B 2C3XA 4R97B 3MRNA 1BV8A 1K8IA 4PJEB 3ARGA 3L3KB 1TSHA 3MRGA 1TZHB 5JUEL 2JXMA 1KB5B 5K1VA 2BSDA 2O1AA 1JK9B 5C9JB 3MLWL 2HTLC 2OV0A 4JJ5B 5IMOA 1NBQA 2C34A 4R8WL 4WTXA 5GRUL 4Z3HA 5HYIA 1A6VL 1OF2A 2RD0A 5CMAB 2QADC 3L6FB 1W0VB 4FF9A 1P4IL 5IIEB 2XBDA 4FLHA 2YXWA 3ZXAC 1GGTA 4TSBH 3S3CB 5IUSA 4XOCA 4UINH 1R3IH 3MLUH 3W0WD 2ZF9A 3KGTA 2HFGL 4N8UA 1EVUA 5GRYA 5KZCB 3MBWB 4JFPB 4ZFZA 5L7XL 1GTFA 2JELH 4K23H 1JMXA 4N28A 4Z7NF 4N2BA 2B39A 5EIIA 4G6FD 3ECWA 3WS6A 1VFAA 1FGVH 2GYSA 5GS1C 5KW9H 3EGXA 2F8VA 2BVPB 1RAMA 3R7RA 3GGWA 1BM3H 2VR6A 3OLIA 5E2VH 3S3JA 3WSQL 4KGJA 2IPKB 1X9QA 3NTCH 4RZKA 1PGRB 4Y5YA 1RIHL 3F85A 3ABZA 3UDWA 3UTPE 5FWQA 1YMHB 4KK8C 2ADGB 4KUCD 2NCMA 4ZQKB 3DIFB 1PG7L 2X4UA 3TFKC 2DYPD 4FZ8H 2HLEB 3ZRFC 4EIUA 1EV2E 4L8SB 4JO2H 4CSPA 5KBDA 4IGBC 5AOZA 1RSYA 2PMZA 1U93B 4AUJA 4FMFA 2DLHA 2VSDA 1MZYA 1IFRA 3LHPH 3BYTA 1JGLL 1RZ8B 3HC2A 1BWMA 1R19A 2WO3B 4QCIB 2UY7B 3BIKB 1MCKA 2PW1A 3IWVA 3NSDA 2VL4A 4P2CG 1A14L 4L4VA 4GUCA 4PJBF 3IXAB 1WPCA 3PL6A 2M26A 4PJ8A 2XA8L 5DUML 4LL9A 4NI3A 1CU4H 3FT2A 1YQVL 1U8JA 3CTTA 3GSVB 2ZIDA 2MQGA 4FZEH 2OM5A 5E7FA 5D1QD 4R6UA 4YDIH 1AGFB 5DD0H 3UAJA 4YHIB 3VXRD 2NRDA 2BVOA 2ZP9A 3O6KL 2V8LA 2JK5A 2SEBA 4ANWA 3N42F 1GYVA 3GRWA 4JFFB 1OTSC 3LS5L 3CBKB 5JMOC 4U6XA 1IAII 1CWVA 1FE8H 2IQ9H 2JJVA 5DA0B 3UZQB 3CFNA 4XVJL 4LSSH 4YFEA 2EDLA 1ZLWH 3RVWD 2R2CA 4L4TD 3ZYOA 2GJ6D 1AACA 1LO3L 1XIWC 2QSQA 5E8OB 3NK3A 2ICWI 3E9TA 4JFSA 3SZKC 1AKPA 1F1AA 3T65A 4KY1L 1M71B 2O5NA 1X7QA 2VQ1A 1DUYB 4GKSB 5IHZB 5IB5A 2IH8A 2NZ1A 3P02A 1AC6A 4CSZA 1H3UA 1BQUA 5E5MB 4RDQG 1D2OA 1OE1A 3ZHLA 5I16B 3QIWC 1QSEE 1ZTMA 3HHRB 1NANI 3FSAA 3K6FA 3DECA 5E8EA 2VIRA 2BSBA 2CO2A 1PTZA 5H4YA 5JIIA 1CF8H 4R4FH 2O5XL 2LU7A 2P80D 1Z9SA 3IDJB 4FP8L 2WSPA 1G7QB 3UTOA 3IETA 1SDDB 3SPGA 3IXTA 3LIZH 4P59H 2E8YA 5FA3B 3MC0A 1IJNA 2D8KA 5IREA 2DH3A 5ICYB 1CD9B 4P5TA 3W81A 1IM3A 2ROYA 1RK0A 5DD6B 1NAKH 4M4RB 1VFMA 5HDBE 2EUWA 1NBYA 1U8PA 4AL8H 2WNKA 3GSNL 2N7SA 2OJZH 4F93B 5GHWL 2VZTA 1A6TB 2OMTA 5J8OA 1NIFA 2UWEF 4NUJA 4OI7A 3QUYC 3IFLL 3H1ZA 3UFIA 1AGDA 4OZGA 4XI5D 2OL3A 1ZE3H 3GUTB 1O6SB 1MCBA 1DDTA 1ZIAA 3CHQA 3P69A 1AQ8A 2MCPL 5C0JB 3K2UH 1MFVA 2GJPA 4LK4A 4M48L 7FABL 1H8NA 3LB6D 3OXRB 3M1BA 5INCA 4FQQA 1JGIA 4B9GA 4PWIA 4H7VA 3PWVA 1FA4A 3LKRA 1T6VN 4HCIA 3IKCA 1TMQA 2B1OA 4ALAC 3MJ9L 3X12A 2W9DL 1RZQA 5A16A 2XQBL 1NWOA 2PCFA 3GB7B 1QBLH 3NIDF 4H13C 4OFYD 3SPVA 2E46A 4YX2H 1TENA 3ZDZF 2XWTA 5DD3L 4I0PA 3EOBB 4LSRH 1UB5A 3RDTD 5I18H 2R15A 5FWRA 2VDNH 2YQBA 4FTDA 3W5NA 5EF2A 2YK1L 4RAUA 2XTJE 4MAYB 1DZBA 1YEHL 5CD5D 1UH2A 3QW9A 2YJLA 1LD9B 1MHHA 1F4YL 1JGUH 2G2RB 3M17B 2BC4B 4QRUA 2DWDA 3FOMA 1WIPA 5E8NA 1D5XA 1W8OA 3P3UA 2O6CA 1IQWL 2ESVE 4JY6A 4UQBA 4MA3A 3NQIA 3B8SA 1INQA 3AUVA 4FNSA 2BNRB 1J8RA 4HP5A 3L3DA 3SKJH 1QLEL 1BQHA 4Z18A 2AJVL 2VXQL 4W93A 1S9WB 4AEEA 5FLUA 4P4RA 1SJHA 3IBOA 2PYEB 3OR6A 1BFVH 1GCYA 3WUWA 1DJSA 4OZHE 3CX5J 3FYEB 1H0DB 3SGEI 2WXLA 3O8XA 1AQDA 1J1XH 3DMMC 4JQIL 5DK2A 4XB8A 3W11C 4X7TA 2AV7A 2I5YH 1SJEA 4MJ6A 3QR0A 4EE2A 4L4TE 3MLRH 4AT6A 3ARBD 4UM8B 3HPLA 1T0OA 4AXWB 4OCYL 2KERA 3SDAC 4BQ6A 1A1MB 1KNOB 2AXFB 1RZ7L 2NY0B 3PUCA 4DQOL 3BKYL 3TF7C 3FHQA 2DS4A 3ULVH 3H9HB 2HWZL 5K9JL 1Q94A 2NY4D 3VGAC 4QRPA 1S7VB 1EO7A 1NJ9B 2DBLH 4A7QA 2WZAA 3AMKA 5CZXD 1N6UA 1YPZE 4UDUB 4RMRA 4G8FB 2AXGA 2DAVA 4C83A 3MX0A 3FS9A 1I8MA 5GIRB 4XOAA 3CV5A 4WUUA 2C4XA 1JJUA 5DZAA 2EEDA 5HDRA 4PJ7E 1KBKA 4I3SH 3BWAA 4P9MH 3U0WL 5T33L 3L16A 1MREH 5AVVB 1ODUA 3G5WA 2MIZA 3Q44A 1I1CA 4G42B 3GMRA 4HIJA 4NZFA 3WN5A 4UIMA 3ULUC 5T5FA 5IT2L 2VB5A 4I1RA 4J3XA 3SD2A 4ENZA 4LDEB 2EDTA 2WINB 3H9SD 1HSAA 4WFED 2D2CC 1G9NC 5GRJH 4YGVA 1F1GA 4Z5RA 5G5DB 1H19A 5J3HC 3JZ7A 4X9BA 5A3IC 1UQSB 4UYPA 2D7TH 3S36L 1LE9A 1DBML 4NN6B 4AE0A 4I4WA 2LQRA 3HI5H 3L5IA 3O9WD 2HFTA 1KCUL 2GTWA 4ZZKA 2DQHL 5BXFB 5KVGE 2V37A 1QR1B 1E5ZA 4M5ZL 1OGPA 2I9LA 4KVPA 3GJFB 3HUJB 4PJDF 1E27B 3QARA 4IDLA 4X6BB 4HOMA 2F7IA 3GSWA 1XCWA 3QHFH 2AK4D 3O2WH 4JM2C 4X7DC 1AQMA 1RUPL 4UT6A 1C8QA 1EDYA 1MRCL 2FB4H 3VI4E 2NQ3A 1SXNA 3BVXA 3WNPA 5F8RC 4DGUA 4M62H 3O4LD 4NFDA 4AGOA 1FC2D 2EIZB 3ECQA 1GIGL 4BRVA 3SBRA 3BVTA 1JFQL 2ZG3A 4LNRA 3AREB 4GLRH 1N12A 4XXCC 4KTDL 1SJVA 1EZUA 3FO9A 1DVYA 1ONQB 4C4BA 2OP4L 2X89A 1SYVB 3LH9A 4MNHA 4MZIA 5MHSD 2VN7A 1YNLH 3ABLB 3APFA 4L29A 3TESA 4W81A 4PJFF 2YPKA 3WIIH 4YEFA 2PPCA 5FM4A 5TE7L 4HX1A 1IEBA 4JFDE 2MCG1 2QEJA 3TO4B 1L9MA 2H6UA 4M7LT 2Y7MA 1TQUA 3SDDB 4DEPC 1E4KC 3TT1H 3QO1A 1NOAA 2BHYA 3EXLA 4AX3A 1XD0A 3V4UL 4PJEA 3L3KA 3C5ZB 1TU2A 1KB5A 1JGVH 1JTPA 4LFHD 1JK9A 4FJZA 4R90L 5C9JA 2Z7UA 4JJ5A 4M8UA 4JNXA 3E9UA 1IGCL 1ZANL 3CBRA 3ZTEA 4WV1B 3L6FA 1W0VA 4KQ3L 1PZUB 3FHEA 3F7VA 4GS7B 2JCCE 4G8IB 4F80A 1DCLA 2YEVB 4FXGB 5IZ7A 2FLBT 3MA7A 2C1OB 1UT9A 2FGZA 4H1LA 1INEH 1AS6A 2XZQL 3T2NL 3N06B 4ANUA 3ETSA 3MBWA 4JFPA 4NRXB 4ZDHB 3SDYL 3RI5F 1RPQA 2VDQH 3H6JA 1ITCA 4ZS7H 3CWGA 2ZUTA 3D3VB 5IK3B 5A2CA 3PUUA 4FFZL 4PJGB 1UGKA 2BVPA 1F4XL 4X6CB 1J11A 3FUKA 1NMBL 4KWUA 3KYMA 4OZIB 1XAUA 2ADGA 2Q8BL 3HG0A 4BE6A 4HUVA 2OXHB 4MSWB 4PCSA 1BFOB 4Q56A 4ZQKA 2Y7LA 2Z31A 2GJZA 4LDCA 1SM3H 1F6AB 3OKKB 4L8SA 4LCWD 1LL1A 4S0SD 2VM9A 2IQAB 2ZWNA 1LP9A 3NEXA 4XCCL 1U93A 1WFIA 1UOVA 4YLBA 3TCXA 5HHQA 4CDHA 2IMNA 4NM8H 3AITA 1RZ8A 5DVKA 3FL7A 1JWUB 1EDHA 2FWSA 2UY7A 5C09B 2QLYA 1JZJA 1CDYA 1Q8MA 4YSUA 3UBGA 2XIDA 3UGXA 3IXAA 4HDIB 4KVCL 2NY6C 3QJUB 4WKZB 1IGIL 1UC6A 4EDWL 4KUCF 2ZAGA 5CZVL 4DGVL 3GSVA 5JHLL 4J3BA 1IVLA 4AIEA 3X3GH 5FPIA 1AIZA 1AGFA 3D2UB 4HQQH 3DC0A 4MDRA 2PTTB 2NT0A 2YA1A 4R7NB 4JFFA 4R7DB 4DAGH 5B4MD 4K8RH 5EU7E 1FAIL 4YXKH 2IFFH 3DX9B 3UZQA 3BAJA 3Q8BA 1PAZA 3KBPA 2O72A 4GG6F 3MBEC 3QEUB 5DZOA 4FXTA 3F62A 4IS6B 1OSPL 5K69A 2UX7A 2HPOA 4MMZB 2YKKA 1M71A 2AK4E 4ANXA 2ZXBA 3I6SA 2ICWB 3RYMA 4APQD 1DUYA 5IHHA 4YBQC 5BOPA 1T7VA 5IHZA 3LZFL 1RUAH 2DQCL 1G7LB 1TVHB 5E5MA 4XPFL 4XP4L 5CHNB 2ZYHA 5KVGL 2GJRA 4GI8A 4W70A 1BBJB 5I16A 2VYRE 3F7YB 4XNUH 2YBRB 1UYWL 4NAMA 5KVDE 4DNLA 1HCZA 1JZGA 1UD2A 4ZO6A 2WTPA 5GJTH 2HRLA 4U3HA 5C0RL 1GC1C 4UZSA 4GAYB 3B5TA 4GG8B 5DD1L 4JB9H 1SDDA 1J8HA 5FYKU 4R97C 5FA3A 3U4EA 5I1JH 4J6IA 4XODA 4KKZA 4PN6A 3QJXA 5ICYA 4NQSB 1BVZA 2JI3A 2E9JA 1OHQA 2VN3A 4FOMA 4O9HL 2BNQD 2I60H 2JSFA 1IFGA 3N43F 4WHCA 3HCVB 4M4RA 5LWYL 3EDJA 4LDOB 4JKKA 2JI2A 1A4BA 1QSFB 4TNVK 5HHOB 1YLBB 1C5DB 5F9AC 4IBVA 3ZVVA 3ME0A 2ZT9C 1YJDC 4GAJL 4QI3A 2ZUQB 3IGAB 1JZDC 1RSFA 3SY0B 4JGUA 5F7MC 5KJRL 1NGYB 1PCSA 5AVXB 2KL6A 3GEFA 4NHCL 3E3QC 4HV8B 3NZ8A 1T89C 4X4YB 5BZXA 1KYDA 4KZEH 4WHTA 5FGRA 5DUPL 1T21B 1FLRL 5I74B 1GXEA 4W68A 3GUTA 1O6SA 1E5AA 3KXFD 4GUQA 2CSPA 2P5ED 3U46B 1QSZA 2CR3A 1X5KA 5C0JA 3UCQA 1E5BA 1TPXB 2EUVA 4XAWH 4RNRB 3EYSL 3IN2A 3SDXE 3WMSA 2X1XR 2Y07L 2HTKC 3P0YH 2CMRL 4JVPA 4YE0A 4L1LA 3SBWA 4RWYL 1KSRA 4B6ZA 3OXRA 3MV9E 1NC2B 3VTAA 4WK4B 1KTLA 2DJUA 3B1UA 4NERA 1T6WA 4K7FB 1FFOB 3ZSTA 1ZA3A 4L2YA 3GB7A 4TVPL 2YZ8A 4KH9A 1BZQK 1UM5L 1R46A 3ARFC 5DO8A 4I3RH 4N2MA 2V8MA 3EOBA 4UMGA 3ULUH 2EVFA 3UPAA 2R4RH 1EH9A 2GK2A 2YSSB 4N26A 4WY7H 1SY6L 3GIZL 1G9NH 1CFVH 5ES4B 4MAYA 3NGBB 4AK1A 2Y22A 4Z0XB 4MCYB 1M6OB 1UACL 1P84K 3CPLB 3CFMA 2G2RA 3M17A 4OGYH 4MXVE 3ZL4L 4PVLA 5EBLB 1Q0XH 3WD5L 3H7BB 2PYFB 3ARXA 2BY1A 2BNRA 1O7SA 1T7XA 4KRNA 4M5YL 4TLUA 3OX8B 5FCUH 3LQAC 3GSXB 2AP2A 2WZ5A 3ZKSD 3QQDB 1E7VA 1S9WA 1W6WA 1DQQB 1T20B 4NKOB 4AQZA 4ENEC 1S9YB 2PYEA 1I1RA 2DQMA 2D0HA 3ARDD 3HC3L 3JZYA 2PETA 4PRPB 1H0DA 1QPPA 4F57H 2COVD 5EPMA 3WEXB 4CMMB 4CN4A 4M3JA 3HR5B 3WLWD 3IMVA 1CLOH 3IM1A 3X1GA 3GBDA 2P8MB 4LSPH 4CJ1A 4BFFA 1PNDA 4W4NA 2EDXA 3ULAB 5I19H 4DOHE 3EHBB 4AXWA 5DMGC 3EFOB 5HHME 1IC5L 5BO0D 1A1MA 1KNOA 2AXFA 4M93B 2CE6A 2IXQB 4OM1H 1YECL 4AOFA 2FD6L 1UH3A 4DKEH 4IMKA 4Q52A 2EDNA 4IJTA 1N67A 3H9HA 3ZMNA 3B7TA 5JPNC 3FFCB 1S7VA 5JDSB 1NJ9A 3BVDB 2HVJB 3O2DA 3I9GL 4UDUA 3OAUH 4G8FA 4H25B 1U95A 4ADIA 5FUZH 5E2UL 3QIBD 3L17A 4Y16B 4DN4H 1K8DB 4MGXA 5C08B 2VDMB 4TUKL 1HJCA 4N4YB 5IJVB 1JG9A 2ZCKH 1A6UL 1A0QL 5I75C 4GYBA 3MKGA 3P4LA 2O26U 5D6DC 2OK0L 1XR8B 4XP9L 4V1DD 3O3UN 3GO1L 4HIEB 5C0NC 5J13B 4FJYA 1U8QB 4ONOA 4LASH 1V54B 4G42A 3ZQWA 2PWEA 4MJ2A 4DPAX 4JY5H 3EGDB 3SEPA 1TQVA 2X40A 4HXBH 2WVVB 4FTVD 1I1YB 5C0DB 2YD8A 2WINA 2FQFA 3DVIA 4XNMB 2ZP0T 1DBBL 3X1NA 1NDGB 3LN9A 3O6FB 4ZFGL 2EH7H 4NP4L 2P7TB 2WBJC 5BXFA 4YSDA 5HVGB 3BD4A 4ELME 3AWGA 4JMNA 5J89A 1QR1A 1NSNH 2CXKA 3GJFA 3HUJA 3WO4C 2ROXA 3Q06A 1AR1C 4X6BA 4QHUA 3U9WA 3IFOB 1TEYA 5EOCH 3V2AR 2F54B 1RHFA 3QXAB 4U4BA 2WYHA 3WNLA 5LAXB 4C56D 4H40A 4FQ1L 3TZVD 2BP8B 1O7DC 1OPOA 4OLWL 4AYID 2Q20A 4YZWA 1LO0H 5GXBB 1U8KB 5AUMB 3AREA 3RA7L 4LEXH 1UM4L 5F96H 1XBDA 1ONQA 3UEQA 2GBTA 4OGXH 4DFIA 4IHOB 3PGDB 4DN3L 2AEIT 4N1CA 4ZX4A 3ECBB 4B9IA 3FB6A 3LHAA 3KR3L 4UMSA 5EZOL 3MJ7A 3CMOL 4FFWC 1HC1A 4R26L 3QUXC 1HZHL 4NQCB 5LXGL 4BM7A 3BDYL 2BCKB 3S4SB 1NGWB 2DQ6A 3GXDA 3ZE2F 1KULA 3TO4A 4KI5E 4NT6B 1ZD6A 1CDCA 2V4LA 1KTJA 3BHBB 3SDDA 3TWCH 4AZUA 4JPVL 4NZRL 4WWPA 2VR7A 2FQDA 2TAAA 2WGXA 1G6RH 3C5ZA 3MRHB 1L5GB 5IFHH 1YMMD 5H37A 3I6KB 1EGJA 5DF0A 4X99B 1XH3B 3D85D 1DLFH 2A6KB 4FEMA 5DHYB 1NCHA 3PWLB 1R75A 2Y72A 3QZPA 4WV1A 2DQIL 5HJGA 1R0AH 5D4QA 4G8IA 2V17H 2AQ3A 4FXGA 5BRZD 3HVNA 1F45A 2AJXH 3QUMB 2C1OA 3L81A 4GXFA 1SHSA 3AG3B 4NRXA 4ZDHA 1JWMA 4ZMLA 1FAKT 3FPYA 3D3VA 4HIXL 5IK3A 4PJGA 3TYGL 4BCXA 1ADQH 1GC1H 3GMMB 4TRPL 5IJKC 3PPEA 5CP3A 2XBZA 1KYUA 2PABA 1RZFH 3LPFA 2XXCB 4P2OA 4YBHA 4Y4HB 3UZVB 2OXHA 3G6DH 4MSWA 1BFOA 3G6JE 1TZ8A 1GVIA 3U7WL 2AQ1A 4GFXA 4GRLB 4JG0H 2H0JA 3OKKA 3STLB 2IQAA 1JAEA 4GQRA 1NA8A 2J8UB 1H3XA 1YJDH 5I2IB 3B3IB 5BW7A 1K5NB 1SBSH 3JBG7 5DFWH 1WGOA 2JTDA 3FF8A 3CHXA 5I1EH 1JWUA 5H35B 3TEXA 3RY5A 4J3OF 2UXVA 1LQSR 4R2GC 5C09A 1KN2L 3VAEA 4JDEB 4KKCD 5ETUB 5KOVC 3RIFK 3ARTA 2NY3B 4HDIA 3BUIA 3VJ6B 2RQ8A 1QSEB 5I71B 2ZOUA 4QOKE 1JPGB 1W16A 1JRHL 4NN6C 1YEDA 3RUGE 2IH1B 1LP9F 5TFSH 5T8IA 2O5ZH 4W1TA 4BQ9A 1G1CA 3D2UA 2C9UA 5F9WB 2PTTA 3A6CL 4N90E 4Q6IB 2UZXB 4R7DA 2HKHH 4R7NA 4W9GC 4DHLA 2X88A 1M6UA 4ZPVB 1TFPA 3DX9A 3OAZH 1VHPA 4LBEB 4WVRA 4YLCA 2YGOA 3MRFB 2J6EA 3PXLA 3ECVA 5D7KD 1P1ZA 2B14A 3DWTA 2VSCA 2JF1A 2CHNA 2Q7YB 3W3BA 4N8CL 4UAHA 3Q9QA 3QSKB 2BS9A 1IM9D 4NO5B 4QR7A 4MMZA 4Z7WB 3F3HA 2WV3A 3X17A 2FE0A 2ICWA 4PCTA 3V0DA 1NTDA 2VXUL 1ED3B 3NCXA 3FTGB 3WG7B 2EH8L 4LNVA 3GMOB 2RBLA 1G7LA 1TVHA 4OF6A 1U8NB 3AT0A 5CHNA 5A2LH 2JKXA 3UTQA 1P9MC 2R2HB 1BBJA 4L0YA 3L3OC 2E6QA 2VDKL 3NVQA 2YBRA 3PJNA 1D5MA 1M7IB 3W0WB 4HG4J 2CNYA 4GAYA 4GG8A 3U0PB 2XXMB 4WI5A 1JXKA 4F9PC 1VA9A 2CALA 4G6FB 4NQSA 1N4XH 3DK0A 5L2KE 4ZXBD 3V6OA 4F8PA 3MLVH 2GUOB 4HIHB 3K81A 1JV2A 2XWRA 2CAKA 3QEQE 3ZDXB 2Z7ZA 2AJYL 5EBMB 5FYLH 2DTML 1C5DA 1GL4B 4IRJD 2BZDA 2H1XA 5CN3A 4DO5A 3S48A 4XMLH 2QBWA 3IGAA 2FDBP 3RVXC 3SY0A 3GBMH 1A1NA 2DYPB 1OAJA 5D7LE 4CNIB 3T6WA 4FYQA 5G4OA 1RZGA 1NGYA 4F7EB 3UO1L 5CEZE 1MY7A 2YKLH 1A1OB 4HV8A 5FYJD 2EECA 2XTJB 4X4YA 1YA5A 2UZIH 1T21A 5HYQA 1SVBA 3VU2A 4P07A 2X1OA 1AGBB 1VEPA 1XGYH 3U46A 2G5BB 2XSKA 4I2XE 2O6EA 3VXMD 4RNRA 5ALCH 1OEZW 3FW6A 25C8H 4MX7A 1NC2A 1KGWA 1MI5E 3LS4L 5D71H 1RI8A 2XFXA 4Q6YA 3Q0HA 5D1QB 1FFOA 5I8OH 1KACB 3VXRB 3RGVD 4EO5A 2FVNA 2OTWB 1IC0A 3V0AC 4L2LA 2Y7OA 4I7ZC 3TNNB 3V4PB 4AGQA 2OYLA 5AAMA 4GI9A 1JDAA 3I6GB 5KVFE 5T5NG 3BT2L 4N85A 3HC4L 2M1KA 3VG0H 2QGEA 4D0BB 1JOIA 4FXKB 1S5HB 4Y4KC 4C58B 2BP5M 3H0TB 4A7GA 4L4TB 2GJ6B 4MZRA 1H8SA 2YSSA 1OT4A 3Q05A 3QHZL 4LBAA 3C5XA 2OX5B 4JQVC 3MRDB 4CC1A 4AYGA 2OCFD 2ZWLT 4MCYA 1KJ2A 3ZL2A 4KX7A 2WOBA 5HI3C 1BXAA 1JPFB 2QPUA 4ORGB 4X9FA 1I7RB 4XP1H 3S3BB 2XWJB 1JUFB 2BVYA 2XN2A 4GXUM 4J8RB 4JHBA 4K3JL 5EORL 3MA9L 3H7BA 1GPOL 1QFWI 2PYFA 3SE6A 1XCQB 2ZSVA 1WITA 1MCWW 3RWEB 2ZXAA 3GSXA 1ERNA 4CMHC 2CCWA 3QQDA 4GEJA 1T20A 2NZIA 3CFCH 4NKOA 3TEUA 3MV8E 1S9YA 2WWMC 1AXTH 3N0PB 5G4NA 2PWDA 4PRPA 5MENE 2BXYA 4PRHD 4XN8A 1WIOA 4QTIL 2ID5A 2QVIA 3L5JA 1RUKL 1E8WA 3WEXA 3CLEL 3OPUA 4LE8A 4OIIH 5C0AD 3FO0H 2FX9L 2P8MA 2P26A 1RJLB 1W2KT 4TNVF 5C07E 5LBVA 1WBYB 2EC8A 2CKNA 3PCYA 1XWVA 1MLBA 1KIPB 1UWEH 1WAAA 1FCCA 3EFOA 3TNMB 3JYBA 1LILA 3CNKA 4NYLB 3MNVB 4RBPK 5C0FB 5FUCC 4HPHA 2D3JA 2EJ1A 5TGBB 2E9GA 1YNTF 2RGSA 5JDSA 5I6XB 2E3VA 2HVJA 2EDRA 3BP4B 1KXVC 1PMYA 2QKIB 2J1YA 2CM6A 4H25A 2H1PH 1MFEL 2XX0A 5E95B 5KBPA 3P9WB 2J3SA 2Y69B 5BVPL 3FFDB 1GGBH 1K8DA 4NBYB 5C08A 5GGTH 1Q1JL 2CGRL 3HRZC 1U4FA 2E27L 1LDPL 5EEWA 5GGRY 2QT6A 2ZUQC 3JWDC 4AQ1B 5KJ7E 4KKRA 1XR8A 5DEJA 4XPTL 1OALA 3VG9C 3UPRB 4F2FA 4AGMA 5AD0B 2BRQA 1HYSC 1FORL 2XLLA 3EUDA 4QGYA 4Y9EA 3L4VA 2FJUB 4WTZA 2BIHA 3IAPA 4OD3L 4XXWA 1PS3A 1I1YA 2XZCL 1S7QB 3GWJA 4FQXD 4M5TA 4HZ1A 4NN5C 3BPCB 3FCGA 2CKBL 4XNMA 2LABA 3LAFA 3ZTJH 4OKVB 1FSKC 2X4RB 3KE0A 5F7EH 3B9AA 4HJUA 1WFJA 3L4CA 2P7TA 4Z7OE 4HSAC 3EJZD 3QORC 3MLYL 3VI3E 2ICEA 3RVVD 5CZRA 3IFOA 1UD4A 1KN4L 3FB8B 2F54A 3GFUA 5CEZL 5HHXH 5GSVB 4I77L 1A6WH 5LAXA 3QNFA 1DP0A 1U3NA 5CWSB 2BP8A 4N2IA 1WJ3A 3VQ2C 1DQDH 1U8KA 5AUMA 1PIGA 1G0DA 1ICTA 1FL5B 1DBKL 3LY6A 2JIXD 3C08H 4A1RA 1YNKL 2JJWA 3EG9B 4IHOA 4K71B 1PX4A 4KPHH 2NR6C 3ECBA 5D2LF 4BFGA 4N1EA 3IBEA 2YN3A 4ZPTB 4PVBA 5C2BL 5ANME 1CB4A 4NQCA 3DX0A 5HI5C 5MEPA 1MELA 2BCKA 3ARBB 2P44B 3H3KA 5K39A 3HIZA 3S4SA 3GJFH 4HUNB 3LJ3A 4TPRL 4CSTA 4HKXB 4NT6A 1FO0L 3VD9A 1ZVSB 3BHBA 5KVFL 1KY7A 5J06A 3C12A 3WS3B 2OPCA 5FDWB 1YY9C 2NY4B 5E08H 5F0MB 3CFQA 2F5BL 3AQDA 5F7DB 1FL3B 4G70B 3T0AA 2E86A 4D8OA 1RUQL 3NIFF 4X99A 4ONFH 4X6DE 4CU6A 1XH3A 1X44A 3AFLA 4L18A 2A6KA 2HLFC 2KUTA 5DHYA 3RG1C 4YHMH 3WKML 2O6FA 3ISWA 4H0IA 2BOBB 4JM4H 1E30A 3OZLA 3DJTA 4PBVC 4EKXA 3HMXA 2CLRB 3QJFB 2WXNA 2WZ0A 1QMUA 5KBKA 1ACYH 5J1TC 2DLFL 4NZUL 3QUMA 2BPBA 4X5XB 2YO3A 1F6FB 4G3YL 4EZMA 3DSFH 5K33A 1OK8A 4P9HC 1MRDH 43CAB 2ZUWA 3OGOE 5DC4B 3RU8L 1E5UI 4DUXA 2WCPA 5DHVH 1IGFL 5J1AB 5C0AE 5IQ7L 2Z6FA 3NA9H 3GMMA 4O4YH 4DUWA 1NUFA 2X4SB 3VFTB 3H9SB 1BZ9B 4OJAA 5E1GA 1A7OH 2FHFA 2YQGA 1OO2A 3VACA 4B41A 4UZGA 4Y16C 3FQNB 4DGYL 1MG3C 4U6YB 4Y4HA 5H37H 3UZVA 4BSVB 2VJXA 1M2OA 1Q72L 2DKMA 1IBDA 3DOSB 1BQRA 1Z5LB 3FONB 4GRLA 4GNKB 5KS9E 2QQKL 5T3ZE 3O9WB 3STLA 2PNDA 3TJPA 4BGLA 2FECL 4C55A 2J8UA 2ARJB 5I2IA 3B3IA 1K5NA 4R7VA 2AK4B 2AEQH 3OBAA 2NY2D 2FEDD 1AH1A 1LO4L 5GISL 4OCLC 4P5RA 3V0JA 4XPHL 4JDEA 5LCVL 5I73B 2YBGA 3S97C 2MHAA 3O4LB 3RY4A 3TP4A 3L8QA 4RISH 4K7PH 4ZZFA 4HK3N 2BJMH 3CH8A 1QSEA 1BLIA 1J5DA 2NTFB 3CXFA 1VPOL 2BWIA 1JPGA 2V5RA 3ZMEA 2LTQC 3O6FC 3T8XB 32C2B 2IH1A 3QR2A 1Z2KA 3QDMD 4M6NH 3OJDB 2H41A 4NB7A 2VDPL 1AHKA 2Y4SA 1JGDA 1KBGH 4YHYB 1MCWM 1IIIA 4Q6IA 3ABKB 5DJZA 2AJSL 1J48A 4K0OA 1TJMA 3QFJD 3IMBA 3TBTB 4OIFA 1PZAA 4ZPVA 3FQUB 3L9RA 2RTTA 4LBEA 1F58H 3MRFA 3MXWL 3VWKD 2Q7YA 2WNGA 2YFNA 3H6AA 1WV7T 4NO5A 3C8DA 4Z7WA 2WXRA 4YAQB 4OT1H 1O9VA 5L88L 1UUSA 2E8ZA 1ZLUH 2N0MA 2IG2L 2L4OA 2MMXA 2J56A 1ED3A 2YLKA 3GT6A 1WC7B 2QPFA 3VFUB 3FTGA 3PP4L 5I8KL 1ZCRA 3ECUA 2FATH 4EI6B 3BKCH 4P5SA 4FN0A 2R2HA 4U3CA 4UNIA 1DJIA 3BPOB 3FRUB 1AZZC 2Z4TA 4X0NA 2H9GB 2VLKD 3UJTL 5ADPH 3VWJC 4UQCA 4ODTH 5BQ7B 1DQTA 3SDXB 4LLMB 1C08B 4PLJC 3EF4A 3TO2B 2VLRD 3U0PA 4L8DB 2D9QB 1RZKH 2HA1A 2CR6A 1WCBB 2D7MA 2FNWA 3EYQC 4K3DH 4U3XA 5HPOA 3S88H 1E9PB 1KV3A 5I9QC 4TSCL 3FQ4A 3FTUA 1IAIH 5BOZG 4YS4A 1ANUA 2GUOA 4HIHA 1QZ1A 3T0EE 5EBMA 1CLZL 2Q0ZX 2WXOA 4N0RA 1UT2A 3LMJH 1S6NA 2WBXA 4TOYH 2Z91B 5C6WH 2DYPA 1UA6H 4PJIB 1I9IL 3U6XS 4CNIA 4LCWB 5EUKB 4F7EA 3BVNB 2MPAH 3P30H 3MUGB 5CBEA 1A1OA 2WWOA 2Y5TB 4HCRL 3VFWB 3BLPX 3KLHD 1OPGH 5KSBB 2UXGA 1NCWH 1MXDA 1ZPLA 3S8GB 4WJKB 4BA0A 4QHPA 5CILL 2G5BA 4TF4A 2WLIB 4EZKA 3RIFF 4XR8C 4OLXL 1D5IL 4OSUL 3WFZA 3VD4A 1FZJB 4P4KD 2VDOB 4XXDB 1RH8A 3IU3B 2NSXA 5IBUB 1IBBA 4GKZB 1RK1B 1IO4C 1Q9OB 4GB9A 4JN1L 1X5AA 2F58H 4RX4A 4E5XB 4OZHA 2OTWA 1CK0H 4HIIB 3TNNA 5AYUL 3V4PA 3PLYA 3JWDH 5HGHB 5MI0B 1T4KA 2ENPA 3I6GA 2APWA 2X2JA 4Z3IA 4D0BA 5F21B 4YZFF 4FXKA 5D2NE 3MYJA 1OTUC 3BQUA 2ZZUT 2XFGB 4KROC 3T4AB 5AVUB 4L4TA 4NO2B 4DOHB 2GJ6A 1CDBA 2X6UA 4LAQH 4P49A 4B9KC 1RU9H 2VJ0A 2ZKMX 4YDVB 2OX5A 1CI3M 1RZPA 1SMOA 3KBFA 4TUJB 3D50A 1AZCA 3D0LA 5D5MF 1UUNA 3BPNC 3CD4A 5AVTB 3RVUC 4APQB 5IG7B 3RX8A 4N5UA 3S5LG 4A55A 1UFGA 1ZGLB 4KHTL 1BZ8A 1I7RA 4TQEL 2XWJA 1JUFA 1WGVA 3FN0L 4HFWB 1L9PA 4J8RA 4XBEH 3MUY1 4QAWA 4KMTH 2Y6SC 1WD9A 1XCQA 3PPSA 3UBHA 3UTZB 3RWEA 3AQYA 3ES6B 4XTRD 4KZDL 4K7PY 1ZEAH 1K4DB 1RP9A 1DQKA 1Q4NX 2JKSA 2O5YL 3PHOA 3QI9A 1EJOL 1SOXA 2VR5A 1WWCA 4JFXB 5EB9A 4WNSA 4PJ7A 3MLTB 3QPXL 1SXSA 2OR9H 3LRGA 7PAZA 2BOCB 3CDZA 1U36A 3MBXH 4UTCA 4C4UA 3UJIH 1PFOA 1LHZA 2BNQB 1QTPA 1WUZA 2MNWA 2XXGA 2J71A 5J6SA 3UTTE 1OAZH 4XMKL 5E0FA 2ADFH 3KM2A 4AVJA 1RJLA 5DK2B 1KLUB 1O6TA 1Z9LA 1I3UA 1WBYA 1I85C 3ZDYB 5LVEA 4LOEA 1KIPA 3TNMA 3L45A 1CZ8H 5ISZD 4JCWA 4GBXA 2DEWX 4NYLA 3L08A 1AGEA 3MNVA 4C47A 5C0FA 5FGBA 4AEHH 2ADJB 1MAJA 3BAEL 2YXFA 5TGBA 3D48R 4L1BA 1WTLA 4KK5D 4ELMB 3MTXA 1GA2A 1FBIH 1BAWA 3BP4A 3E8UL 3ML9A 3KXFB 3K8KA 1U33A 1E9OB 4Y5YC 2P5EB 1QNZH 5F1NB 3UDWC 1TTUA 1BVOA 1AI1L 4ODHL 4PBWD 2AXHA 2NY7H 1L0PA 2FO8A 2LFGA 1I4FB 2WB7A 3FFDA 2FIRT 2YRZA 2ZP8A 1E28B 3TT3H 4C57C 1WAAF 1G0XA 2YAOA 1DJWA 3H7LA 1R5WB 2XBTA 2WCGA 4HZLB 1NAMA 1YUKB 4HWBH 4AQ1A 4DETA 1NCJA 4TNFA 3EYOB 1BX2B 3A47A 3FK3A 4NZTL 3UPRA 1NMCC 3UG3A 3S35X 5AD0A 1UZ8B 3SKOB 1UOKA 1U6AL 2XI9A 1V3LA 4P5KA 3NYKA 4P9HH 1S7QA 3MZTA 4AH2B 1HH6B 1MCHA 2HKFH 3ASWA 5AOJA 3BPCA 3MGAA 4OKVA 2X4RA 3R1GL 3FJTA 5LNEA 5BVJB 4QXUL 1BMWA 4OF0A 4CU7A 4RZCA 4FHKA 3Q8CA 3TJEH 4B53A 1CDIA 3DRQB 4UNVA 3QCUH 5BV7B 4P23C 5SX5H 2PN5A 5IM7B 1HXKA 2HRHA 3CFJB 2IAMA 4KKPA 2X1WL 3ENEA 1RZJC 1N0XL 2A4EA 2VDMH 5D1QC 4N0UB 5B38G 1FG2A 3FB8A 3CFIC 1JD7A 5GSVA 1HWGB 1WZAA 5DC9B 4Z3FA 1GS6X 5CIPB 2D7PA 3SZ6A 2DYSB 5CWSA 1WICA 1I82A 3U83A 4M4PA 2WLYA 4WFGE 1MHCB 3DO4A 2BIIA 3P1VA 2DM7A 5EEYA 3MFFB 4BZ2H 3ARDB 4MWFB 4QXWA 3IGFA 1F3DH 1MCJA 3TYFA 3C87A 2HLAA 3EG9A 3HI6L 3LH2H 4X50A 3RB7A 4FFTA 3KYAA 1GW6A 2I07B 4R84A 4NLAA 4LVHB 3U82B 5CN1A 1VGEH 2BWDA 2G5RA 3P54A 4ODXB 1Y6MR 2Y25A 1N6QH 1FFNB 2ZKHL 4R4ND 3NDYE 3W9DB 3AZUA 4K5NA 4RQQB 3JWOC 1E8XA 4L9LB 2XV3A 3SBQA 5IGXL 2QVFB 3F6IA 3OJVC 4HKXA 3VRJA 1ZVSA 5DJAA 4B9FA 2VDRH 1ASPA 1DL7H 2CK0L 3G6JB 3GI9H 3ZU8A 2VLJE 2HFFA 3WS3A 4A38A 4AUYA 5FDWA 4G7SB 2AK1L 3DJSA 2L04A 2W9EH 4JAMA 4HKBB 4YWGH 5F7DA 1FL3A 3DO7B 4UT9H 3NOIA 5TF1L 4NWUH 1MN4A 5K1JA 3QIBB 1XBRA 2XICA 3EZ8A 2CLRA 1U21A 2PO6A 3SE8H 4Z7QE 4WHYH 4X5XA 2FSEB 4WO4D 3G5YB 2EAEA 4G6KL 5KYXB 2FUQA 3A22A 2AQNA 1JNNL 1U0QA 4NGHL 2WUBH 3ARZA 1JI2A 3R06B 4J12A 3RUGB 5JOPD 5J1AA 4Z1PA 2DY2A 3TGXA 2X0WA 3H8NA 5FW8A 4FTVB 3HNVH 2N1KA 4G1EB 2IBBA 2X4SA 1K6QL 3VFTA 3H9SA 1BZ9A 3BAIA 2QKIC 1E2WA 1YEIL 3BE1H 4ICWA 1C1EL 2QSTA 3KPNB 4N2AA 1N6VA 3FQNA 3HS0B 4U6YA 3T3ME 3MRQB 5E2TH 1M53A 3DOSA 1MWAB 2BZCA 1Z5LA 4NAJA 1FV1B 4X9IA 2ZCLL 3O9WA 1W72B 5EWIL 3V6ZA 1MCOH 4HU2A 2ARJA 3H55A 4YE4H 3NCMA 2AK4A 3TONA 3QUMH 4NJ9H 1B3IA 1YQ2A 1WVZA 3F12B 4ONGH 3WFBH 2YD5A 4OVVA 2N4IA 1SBBA 1ZJBA 4C56B 3CLFH 3DJZA 1KGCE 3TZVB 5T3XH 4IOFC 3CLWA 1U2YA 3FAXA 2NTFA 3RDTC 1HHGB 3MV7D 1NCDL 4Y5VA 1DR9A 32C2A 2AHIA 5HY9B 2P43B 3X3FH 4X5LA 1CGSL 3OJDA 1DUZB 5CD5C 3GF8A 3G5VB 5I1IL 1EFXD 1JCVA 1XSOA 3RGBA 4JHUA 2DJSA 1BQ5A 1AVAA 3TBTA 3U1SH 4R5TA 4Z7VE 4QF1A 3FQUA 4M61B 3IEAA 3WTSA 4Y9CA 1QLRB 5GS2H 2CA4A 4YC2C 1JZ6A 3R7QA 5SWZD 5C97A 5D7LB 3N1GC 3DHMA 3K2KA 5GS3A 3DTDA 4YAQA 3IJHA 5AZ2H 2A2QT 5EO1B 2L8AA 1YMMB 1N5YL 4R9HA 2QZQA 3VFUA 1WC7A 3D85B 3B2UD 2IPUK 5PAZA 2IPTL 4JRYE 2WO2B 2IANE 4EI6A 3US9A 3QS3A 3BH8A 5HDBF 3V0VB 4OUOA 1HE7A 3T2LA 1OGSA 4OTXL 3CXHJ 3FRUA 5BRZB 2H9GA 1OGAE 1YEFL 2HH0H 3ARBC 2R56H 5I1AA 5BQ7A 5HI4C 2FEEI 4IRSD 5CJ8A 4FL4B 3SDXA 4LLMA 1C08A 1YEGL 4TVSa 1NL0H 3MV9A 4F2EA 4L8DA 2NT1A 1WCBA 2VUKA 4S1RH 1AQKL 1AD9B 3CZKA 3PFUA 4MHHI 4K4KA 2X7LB 3DPBB 5CZXC 2NQDA 2B8OT 3VFMB 4IDJL 2C3GA 1FZOB 5LGHL 2EUZA 3UP1A 3Q6FB 3EBHA 1FFTB 3VSQA 4PWFA 1OAXL 1ACCA 3AU0A 1G9ML 3NIGF 5FW6A 2UXFA 4ZS6C 5AW2B 5CGBA 3QUZC 4Y1SA 4PJIA 4HUWB 3F65A 1P4BL 3AB0C 3GTTA 4PJ9D 4PRBA 5EUKA 3BVNA 4LLUB 2ZCHH 3MUGA 3TC9A 3FDWA 3QIUC 1OLZA 2CPUA 2COQA 3BT0A 3GXPA 2Y5TA 3VFWA 5B8CC 4G2AA 4XRCB 1CTMA 3DVFA 3VYOA 4IKKA 4UOW1 1H15B 3V52H 3S9DB 1TMCB 1YDPB 1LEGB 1A3LH 2A74B 5KN5B 1FZJA 4KK6D 4K5LA 2DDQH 1AG6A 3OKMB 3IU3A 2LW3A 3Q5TA 4GKZA 1RK1A 3MV8B 1BECA 2H6OA 3QNXB 4HPOL 4PS4L 3ZHFA 3IDXL 3W5MA 4E5XA 4AWJC 3I02A 4P3CH 4HIIA 4LSUL 1HIML 3INUH 4MJ4A 4UM9B 1NC4A 5FEBA 2DV6A 3W57A 1OAUL 4UT7H 1L9TA 1X5GA 2R0WH 4GY4A 3FNKA 4KAQL 1PKQB 5D93B 1OKEA 2WWKT 2OMXB 4LVNB 4Y8AA 5C07B 1A65A 1MKFA 2WP3T 3ZK0A 4UTBH 3OB0K 2FGWH 4MNQD 1RLWA 4NO2A 1JNJA 1H3WM 4P3DA 4O02H 3WIFB 4Q9CA 1CFNB 2CUMA 3TJHD 1IM9B 2WO4A 4HGKC 4M3HA 4X42A 4EF3A 4TUJA 2WKOA 4PG2C 1SJMA 4APQA 3K6SB 4OZHF 1ZGLA 2YA2A 3FUEA 1M7UA 4I8DA 3SGKC 4BRJA 1PG7W 3O3EB 5LNGA 2QQNH 2ZG1A 3TN0A 5D7IE 1OP5K 1R34A 4BV1A 1RFDL 2VXSH 2WXMA 3ES6A 3ULVD 1H3PH 3T5WA 5JW4N 2ICES 3N44F 1K4DA 1QG3A 1BD2D 3V4PH 3T1WA 2R0KH 4U1LB 4Y5XB 2J88H 3Q8FA 4JFXA 4OUUB 1OGTB 2QGDA 4HEPG 1FDLL 1P5UB 3SODB 2BOCA 4L0ZA 5AYTA 3B1TA 3MCLL 4ZXBB 2BNQA 3WN6A 2D31B 3W2DH 4PFEA 1IBHA 2FRGP 1YPZF 1KLUA 1A3ZA 2R0LL 4JRLA 2W60A 4ZODA 2QTEA 2YGPA 1NMAL 4IRJB 3LKSB 1E2VA 2JE8A 2QADD 4FKEA 1AOZA 5KSAD 5DHXB 4ZTOH 3FQXA 3QDGD 3EJTA 3BSZL 2EEFA 5C6TL 2R4SH 4POYA 5TE4H 4XX5A 4PJ7F 1QRND 3JWOH 4AYMC 1O9ZA 1EDQA 4F24A 3IYLW 4KVNL 3KPTA 2FLRT 1J9TA 3MKKA 4ELMA 1C7TA 3BPLB 4J3OC 3KXFA 4EKJA 5F1NA 2JJSA 2NW2B 4POZC 3WV0A 3VXMB 2ZXCA 4YLQT 5BS0D 1I4FA 4JDZB 1GAFH 4DKDC 1KEGL 1AE6H 1E28A 4FFYH 4ZO7A 4OJDH 4WI6A 3QXTA 1DE4B 3UADA 3WMPA 4KK8D 3VGGA 1R5WA 4HZLA 2YAFA 2BFGA 1SEBB 2JKRM 4YSOA 2W8CA 3EYOA 3TFKD 1BX2A 4KOBA 5E24E 1CYGA 1UZ8A 3FQYA 2WWNA 1HAWA 1QBML 2XRAH 3RGVB 4IGBD 4HS8H 1DQLL 1NLBH 3SKOA 4P2RD 1F5WA 1SFDA 1T03L 2B4CC 1ZLDA 5CSZB 1HKLH 4JFZH 4DKAA 3ZYIA 1DDHB 4AH2A 3F58H 3BUDA 1FHNA 1REIA 3VI4F 2OMYB 4N6QA 2XPZA 5F97E 3PABA 4C4KO 5BVJA 2G4EA 2DWTA 3FO2B 3N55A 4JG1L 1R3IL 3MLUL 4UINL 4WJG3 3DRQA 4WHYG 4JPQA 4M7ZB 2WXQA 5IM7A 1QUNB 3CFJA 1X9UA 1FLTX 3PNWA 4N0UA 2X6AA 5LBSH 2DQGH 2YWYA 2P5PA 5EU3A 1NLDH 1DO5A 5IROD 2Y06L 4X6DB 1E4XL 3BEWB 5MI0C 5FHAL 3MUZ1 3EUUA 3NTCL 4MMXB 5MEQB 5CIPA 1OTSD 4F5CA 4QXTA 2VQUA 4PP1C 3CH1B 2V5SA 1EZVY 1MHCA 1SZNA 5BRQA 3T4AC 4PGBA 1EAOA 5IB3B 3MFFA 4MWFA 4XNAA 2PCYA 5BO1L 5JW3H 1CIDA 1IC7H 4Q89A 3GMNB 1XIWD 1FFQA 1KDIA 4DO4A 2D7OA 1EBPA 4PRHB 4BFEA 3LHPL 2I07A 2BMKB 5C0AB 4ODXA 4J28A 1FFNA 2UYLB 2XJLA 3E6HA 4X9GA 4RQQA 3WFEL 4OLVH 1RHHB 2KLTA 4QRTB 1BXXA 1UM6H 4L9LA 4WRLA 4YL4A 2LVEA 3QIWD 2JCCF 3OR7B 6FABH 3CCHB 2FCBA 5D7SH 3EYUH 3G6JA 2DMBA 5CD3B 1P5VB 3TBWB 5C7XH 2CA3A 1JVLA 4BZ1L 3C2AL 1WWWX 2X9WA 5DD0L 3ZR6A 2WUCL 3LKOB 1KTDB 4O00A 3BJ91 3J27A 4XOBA 4R0LC 3BWSA 3QIBA 1FE8L 1RL1A 4P8QA 2W80C 1FIEA 3BWZA 5CEYB 4U7MA 2FSEA 3G5YA 2V5TA 4A6YH 5KYXA 1E43A 3G5XA 3U1PA 3N85L 3LRMA 3QUYD 2CJUH 3R06A 3RUGA 1T2QH 2KLSA 1NZRA 3ULSA 3ZE0B 2XT1B 3AACA 1H9VA 3L4XA 3BIBX 4FQXB 4TL5A 4NQUA 4OBRA 5D70L 4YFDB 3MJGX 5B1BB 1VENA 3KGRA 5JHDD 1K2DB 1P53A 1MF2L 1OWWA 5JXEC 1D5BA 4CRPA 3SBWC 1F2XK 4JANB 1J5OL 3HFFA 1CF8L 1CLYH 4RH4A 1CICD 4WK0B 3NAAL 4HULB 1FV1A 4GP4B 1W72A 3IE4A 1E9QB 4PBDA 3O3AB 3LIZL 2P8LB 4D9RD 1L6XA 4MD5B 4PCKA 3MRBB 1ZHKA 2Z8RA 4UYQA 5HGAB 2EVIA 3KJ6H 3LOWA 3D52A 4MB5A 1GJUA 1UZ6E 4YXLH 3Q2LA 2C1PB 4KY2A 4AL8L 4Q97A 2OJZL 1G1OA 5DS1A 5CAYB 4QXGH 1OSEA 1KENH 4K15A 4Y2DC 1KLGB 2J8HA 2WQXA 4PJHF 1RXLA 4W9KC 1DQMH 3GNML 4IW4C 1UJ3B 1CD1A 4LESA 5HY9A 2JIXB 3PWPD 5EF1A 1UCTA 1DUZA 2NSMA 4XVUC 5DLLA 4DEWA 3G5VA 3D0VB 1GYAA 1M7XA 5TQ0L 1XSKA 1LMIA 3N0AA 1QLRA 4YDJA 2E7LA 3LZOA 1VEOA 4AMKH 2HPTA 4KJWC 1PLAA 3MRRB 3QO0A 1O0VA 2V5MA 5HDQH 1UURA 3NJJA 3BZ5A 1F2QA 2WNXA 5D7LA 3ARDC 2KYIA 3GLEA 4H0GA 2R69A 5EU6D 5EO1A 2Q87A 2BM3A 2ZKYA 3ZQ9A 5C1MB 5FYKL 4HJ1A 4DGIH 1CXEA 3FSOA 3LNGA 2W38A 3D85A 3Q43A 4KRLB 1OP3H 1JBJA 1ADWA 2ZPKH 2I7OA 1P6AB 2B3RA 3DMMD 4LPVA 3FTXA 8CGTA 3W11D 1F4WH 5IB2B 35C8H 1M3IA 4NQEE 2J25A 2D9CA 5JORB 4E68A 1AAJA 2G3XA 5I18L 5K93A 4GRWB 2RALA 2DQEH 2A6IA 3D7PA 1MW2A 3QEHA 4NWTH 1FYTE 4XCFH 3N6YA 1E6JL 5CZKA 2J55A 3QT2A 2WANA 1JGUL 5AB1A 3VFOB 3DPBA 2XQYG 2AGJH 1MHEB 1FZOA 3FSZA 4QHLB 1QW8A 1XMWA 3VDCA 2YRBA 4G72B 2C9RA 4JCMA 4DVRH 3CDCA 3D1MC 2CBTA 3NRPA 8PAZA 5CSGA 4DP2X 4KO5A 1OE3A 4M1DH 4HUWA 5GGVH 5SV4A 3X1EA 2J8OA 2YPVA 1CCZA 3K3QA 1JI1A 3BGFB 3PWJB 4XRCA 2YGQA 1PD6A 3P4OB 1B2WL 1H15A 1HHHB 2ENYA 3MLZL 3SOBL 3JWNC 3ULUD 2I9TB 3OC8A 2EKSA 5C0BD 1YDPA 1BEYH 1SOKA 1LEGA 1O7VA 2JKNA 3AMLA 3N2JA 4L3ED 2A74A 3NJNA 4J3OH 3B4NA 3D2TA 2HX8A 4O2CB 3HS0C 5J3HD 3OKMA 5BUGA 2YUZA 5G55A 1UFUA 3ZUNC 4LLWB 3MV8A 3QNXA 2B59B 3QDMB 1KGUA 3B6SA 1IE5A 1IZKA 1I3GH 4R96B 4NCC1 1GOGA 3IDIA 1DEEA 2YN5A 5TDOB 1BOGB 4UM9A 4PJCB 3QFJB 3SQBB 2A38A 4JM2D 3GS0A 4MXVF 4X7SH 1PKQA 3WFHB 1BVKB 2JQMA 4AKOA 4AQ8C 1QA9B 5BNXD 2OMXA 4TV3A 3VD0A 5C07A 1WZ1H 2J6WA 4I48B 2B4CH 4OJCA 3TZVC 3VWKB 1N59A 3WIFA 1CFNA 2GIYA 2P4AB 1IM9A 4P9ML 5TF0A 3TVMA 4DW2H 3D39D 3PY9A 2WZPD 3DDFA 1KYOJ 2DH2A 1JYWA 1J0HA 3K6SA 3WEAA 2EIJB 5FO7B 3KLKA 3B3BA 5JIMA 2OYPA 4MAUL 1K9TA 3O3EA 1AFVH 4G6JH 4PSRA 5IVOA 3UH8A 2V2WA 4XNYL 1FWXA 4P2QD 5GRJL 5TK2A 3OWEA 3L1EA 1T5XA 2VLKB 3UGEA 4YVUA 4X9HA 4GPVA 3DA0A 2X6BA 1T66D 2QVMA 3VDAA 1X5YA 4U1LA 4Y5XA 5AFAA 2VLRB 3OB8A 2Q86B 4OUUA 5EOCJ 1WBZB 2D03H 3NPSB 1P5UA 4JK0D 4DK3A 3WKQA 1BPLB 3WLBB 4MCMA 4RRPM 3SPIA 4HF5H 4LZKA 4ZXBA 2A9BA 3QHFL 2D31A 3VM5A 2DQFB 3VYNA 3T3PE 3MOAH 2B77A 1OB0A 3MODH 3GBNH 2KQMA 5LDUA 1F8TH 1LK2A 3A6BH 3MRPB 4L9DA 3V5DB 3ASOB 4IRJA 4M62L 3LKSA 4L05A 3LDBB 1PD0A 4J39A 5DLML 1C12B 3S34H 4CA4A 1I1AC 1R3KB 4BWWA 3B2VH 1HS6A 3ZGHA 4AJVA 4BFNA 3PHAA 3QG6B 4AIXA 3P9LB 1NIAA 3IE9A 2GEQA 3TA3B 1D6VH 4JGMA 2F9BT 2VR3A 2NX5D 3K6DA 2B1AL 3VI3A 1QO3B 3I6LD 4BKLB 2NW2A 4P2OC 5E1AB 3VXMA 2XVLA 3F5WB 3MUJA 2F1EA 2A6DB 3VXSD 1MIEL 4RMTA 1U8OB 3LYRA 4NIKB 3IFPB 5ELIA 1UA7A 1DE4A 1G7IB 1JVOA 1XTLA 4P4KB 3A4EA 4GQ9H 4CVZB 2D3NA 4LQFH 4CJ0A 1CYWA 1SEBA 1CMOA 1WD8A 1E7UA 2DQTL 3D4YA 1KJ3L 1PZ3A 4LP5A 3WDJA 4PW4A 2APXA 3MUUA 3JUYA 4Q9QH 4UCFA 1JF6A 4HS3B 4NC1C 1BQHG 5CSZA 5FIEA 3GXFA 1DDHA 1G5GA 4WWKC 3K4ZA 4PV8B 2OMYA 1QYGH 4KKCC 4XHJC 3PDGA 4XVTH 5FM5O 3CVHH 3FO2A 3GKWL 5DWPA 3BVWA 5GGVY 1QUNA 4OZGE 3NJFA 1ZXQA 4LIQL 3MLSH 4H2AA 4LSQL 1TZGH 2FJHB 2MH4A 4X83A 1URIA 4X6DA 2YFOA 3BEWA 4WW2A 4EI5D 4KKAD 4KRMB 5MEQA 1S7WB 4KFMA 3GZKA 4PY8J 3CH1A 3PP3H 4MDJB 2QMKA 4Z7QB 3A4FA 5IB3A 5ALBL 1SM3L 3DROA 4FYRA 3N9GL 1XGUB 4KI5F 5CLWA 3GMNA 5BJTB 4XMZA 1IBGH 3PDOB 2E7MA 3CSPA 4NM8L 5T1MB 4J27A 5F7HA 1EEUA 2BMKA 3RZCD 5C0AA 3TFBA 1MJJB 4WCYH 4YBQD 2CUAA 3AGWA 2Q9OA 1HVXA 2UYLA 4XO5A 1RHHA 3T6VA 3P9MA 4QRTA 4JUSA 2X6MA 4RWHA 1S4IA 3Q2CA 4PB0L 5IHWA 3RFZA 5ISZB 2VW7A 3OR7A 4OBSA 5B39G 3CCHA 4IIQB 5AZUA 3NCJH 3TASA 4UQIM 4NSKB 4D3CL 5CD3A 3AW5A 1P5VA 5JW5B 3TBWA 1YEJH 2X9ZA 4IBYA 1IKFH 3ZE1E 3LKOA 3ILPB 4N2CA 5SWSD 2IAAC 3WXVH 1KTDA 1WS8A 4AQEB 4ZG1A 1Z66A 4JDTL 4K8RL 4WFFD 2FO1A 2LV4A 2IFFL 1M3JA 4NHUB 3IKKA 4ANVA 3ZTNH 4XP5H 2GIXA 3O0RL 1C5CL 4FQLH 5CEYA 1B9KA 3VFSB 1P6FA 3A21A 4EIZC 1OW0A 3L4ZA 5SV3A 5HYJD 3FU7B 1DSWA 4PI0A 3KM1A 4KOCA 2V0AA 2VXVH 3VRIB 2DM3A 4EXKA 2D7NA 2ENSA 3OG4B 1SLUA 1A3QA 4Z77B 4FABL 3QS2A 1RUAL 3D9AH 3HLAB 5DA4A 5L2JB 1K2DA 2YOAA 4LGSB 2KDYA 2BSRB 5J6HA 1T0NB 1ULVA 4JANA 1U3HC 4JZJB 1QHQA 2JJTA 4GSRA 1GYWA 2HTKD 1PCXA 1I7UA 5EN2B 3GRWL 4JB9L 3MFGB 3NA4A 2P8LA 1KCWA 1A6ZB 4MD5A 1NDMA 3M6DA 4QRPE 5CFAA 2NX5E 3MRBA 3RGVC 1MFNA 3D18B 1XZ0B 3HZKB 5HGAA 2M83A 3D8MA 3V9FA 1L7IH 4YQXL 2J4WH 3NJIA 4A2HA 1OM3H 2PR9A 5CEXB 3FO1A 2C1PA 1WA2X 2YHGA 4LLAA 2FWOA 4KQ0A 3P0VH 2DWYA 2XX1A 4W9HC 3ARFD 4OQTA 2MCMA 2D4DA 1FNEB 1ETB1 3JWNH 1KLGA 4RAVA 3U79A 2VMDA 3E8VA 3JSSA 1UJ3A 3UEZA 4PV9B 2JIXA 2K3TA 5BMFL 5GGUB 4ZW7A 2GY5A 5JIDA 5JYLA 4ISVB 4KZEL 1H3VA 2P47B 1VGKB 1TQBB 1BW8A 1LLAA 1TLKA 1I3RB 2K45A 4Q9RH 2L7UA 4E41E 3D0VA 4H1LG 1J9SA 4NBZB 1MWAH 4RAHA 2EDMA 1XGTA 4JN2B 3GM8A 4KZCA 1FZMB 3QYNA 3TBVB 2MOGA 4MMXC 3KHOA 1SYSB 3CC1A 4XMVA 1BIIB 1LNUB 2AJUH 3A67H 4LU5H 3BN9C 4PRID 3KWTA 4J3OG 3C60C 4WU5B 5D8JH 4ENED 2X42A 4LMQE 4X4ZA 1W6LA 4NRZB 2QSVA 3ARRA 5D7JD 1MCRA 3GKZA 1SEQH 3OGCB 4WJ5A 3FN3A 4PUBL 3VDBA 1FI8C 2JWYA 1T3FB 5J0BA 3DBXA 4HH9B 1KFGA 4HBCH 1GS7A 2JB5L 5AG9A 5IB2A 5PCYA 4I3RL 2JCWA 1B88A 5L0QC 5JORA 4WO4B 4TS6A 3WIHA 1BVNT 5JZ7C 4X5WB 2OL3L 3RVTC 5AALA 4A7VA 2VDLB 5DMGD 4MA7H 1LM8V 5DZLA 3AY2A 1E50A 2QELA 4OFDA 4LSVH 3AG2B 2FX7L 5SWQB 1J12A 1XD1A 3GK8H 3BKJH 4JREB 4XX1E 5IBTL 3VFOA 4ZO9A 1GMEA 3T08A 3QJQB 5KVMC 2OCCB 2XKUA 4QHLA 1ZV5A 2CNZA 4EIGB 2X1PA 3VD7A 1VKXA 3P77B 4UQAA 5D2NA 5DQDH 5ILTH 5GGQH 2BIPA 3D4GA 5TDNB 4KXAA 4OCRH 3OZKA 4PLNC 1J1OL 2YQ2A 3O3DB 1IT9L 1EHKB 5C0ND 3UBXG 3PWJA 4PJEE 1R3JB 4YPGB 4F57L 3P4OA 2H1LM 1HHHA 2WXIA 2I9TA 1LTXA 3V0IA 4FQXC 4DO6A 3GLDA 4LSPL 2WLLB 5EA0L 3C8KB 3RJDA 4M7JL 1NCCH 3UAAA 1JV5B 4MA8H 4N0YH 3SJVD 3ARSA 4E9VA 5I19L 2X6VA 1SDYA 4O2CA 1TJHL 1Q9LA 3LRKA 1Z5YD 3MV7B 4HCFA 4HWZB 4WU7B 4ACPA 4LLWA 1CQKA 2B59A 2CBMA 3KPLB 4YK4C 4QRRE 4HPYH 4R96A 2WBJD 3NJLA 3QZWA 4AC2A 3KDMB 3SY6A 3LEXB 1EFXB 3IJEB 5TDOA 4WI3A 2BFVH 4WLCA 4PJCA 1AR1D 3SQBA 4G7VL 1AIFA 1ET8A 1DANT 1PYWB 5ESVB 3OF6D 1BVKA 2E56A 3SQOL 2DF3A 3UTTA 4F2MB 1R1CA 4HW6A 2OS7A 3LN4A 5I1CL 1WT5A 4O58L 3B43A 3H3PL 3VTTA 1EXUA 1C16B 1ES0B 2EE2A 2VC2B 5TQ2H 5SWZB 4JRWA 5EHFA 5F0LB 4EOWH 1A6AB 1CBVH 1HI6A 4HJSA 1W80A 5FO7A 3L1OH 5DS8B 2QJDA 3MACH 5EOQH 1EAQA 3D05A 1PEWA 2OMZB 1KFAL 2AAVA 3OKLB 4FFWD 3RNQB 1M2VB 3QUXD 3HHMA 4WEEA 5EMYA 3W1ZA 4YDLC 4CDGC 4Y7OC 4IRSB 5LQBH 3ZR5A 2EH7L 4KDTC 1JZ8A 2VLRA 4KH2A 2Q86A 1JXFA 1MFAH 2KS0A 4J6RH 3KPRD 1HINL 3QWRD 1KJMB 5CCKL 5J7CC 2P8PB 2H2SC 1NSNL 3FBQA 1KCLA 3WLBA 1TEGA 3GSUB 2X4QB 3MV01 2YR3A 4E42B 5DU7A 5F0PB 5JHAA 1QZNA 3A0OA 4UOZA 2A9CA 1IU1A 2FBRA 3FUIA 4JO1H 5DT1L 1NFDB 1C12A 3MI6A 1R3KA 5T5FL 2A5UA 1X5LA 2J1ZA 4PJ9B 2DQUL 3PWNB 3ATBA 3WL9B 5E6IA 3P9LA 5IEHB 5FYLE 1OV8A 3Q7JA 3T8VA 3ILQC 3TA3A 2Z1KA 1GMIA 1T1ZB 2ZE0A 2F7PA 2ZX7A 5DZJA 1Y07A 2ED9A 4LARH 4XMXA 1QO3A 2PP8A 5E1AA 3F5WA 1CL7L 4NUPA 2A6DA 2VDNB 3MGOB 4XN5A 4GMTL 4JQXC 2GSMB 1X9LA 3IFPA 4P4KA 4CVZA 3QULB 2BRRH 4UT6L 1I8UA 1QI4A 4JJHA 3X1BA 5DJDB 3S5ZA 4BSJA 4N2KA 1CFTB 1YCSA 2GUYA 4Z7OF 5EEZA 2FWUA 3OXSB 4HS3A 4PVNA 1HXYB 1ORSB 4OIAA 2YPLD 5CJQL 4GAFB 4GAGL 4TSAL 1OCZB 1PZ5B 5GRUH 2ZD0A 5D55A 2NY2C 3VI3F 5BCAA 1XGQB 1J10A 4PV8A 5AW4B 2FYYA 3OMAB 5HHPB 1R0AL 4FNPA 4R2GD 5FYJH 4HJEA 4V11A 4U6TA 3BLBA 4MNQB 1VFBB 1CO1A 2AJXL 3H54A 3MVSA 1O5PA 1WFNA 3H9YA 3PGFH 5BZDB 4NFCA 5IMMA 5IMLB 3E7JA 1R17A 1HCVA 2KKQA 5L7XH 1JYVA 1S9KC 4MQSB 3QYMA 2E9BA 4HSCX 1G0YR 1QOKA 3VX1A 2AMUA 3N41F 5FM5M 2H8PB 2FJHA 5EU5B 1JPSL 5CINL 5EBWB 3WSQH 3LPOA 1QX1A 3MO1B 3ZOAA 2R8SL 3S96A 3RKDC 1RIHH 4WEMB 5DVMA 1S7WA 1RZFL 5EG6C 4EDXA 4Y19D 4G8AC 1N3NB 4LQ1A 3ALXA 1KB5L 3G6DL 1X5JA 4MDJA 1BD2B 1PG7H 4GJTB 1BMZA 5TE6L 5DZPA 5I0DA 4JG0L 2R83A 3SKMA 4C4KT 4U1GB 5BJTA 3PDOA 4NNPH 4PI2A 3KLLA 1N0LA 2GITB 1WYJA 3F7RA 3UPCA 5T1MA 1BYPA 1JGLH 4JGNA 2YC1B 1MJJA 3Q9PA 1UVQB 4KQ4H 2GHZA 4JFQA 4WW2F 4XPBL 1HTYA 5DZ9A 3JTTB 5A2AA 3ZKND 1I9JL 2QADB 3DX1A 1KG0A 4L48A 3C8HA 2OZ4A 2XA8H 3QDGB 1QFHA 5DUMH 4ZMNA 2K9UA 1YQVH 4K3GA 5CKGA 1R3HA 4GMSL 2FIKB 5J6GB 2K70A 1QRNB 5TFSL 5JW5A 1T5KA 5F8QC 3JWNG 2WSKA 2NNFA 2XQ0A 4DZBB 4ADJA 1FH2A 2F68X 4F8NA 3ILPA 3O6KH 3QRGH 3ZJAA 2M8XA 3RBGA 4I18C 2HKHL 1KOAA 1CGTA 4JKPL 4AQEA 3LS5H 3LXAA 1OCCB 5BS0B 2NMSA 4UZUA 5I17B 4NHUA 4MFHA 2BNRE 1ZPUA 1CJYA 2FTAA 3VFSA 2KZ1B 2JKIS 4RLDA 2V33A 3FU7A 4WIQA 1LO3H 2AQPA 4H8WL 3RVXD 2C9VA 1ZHBB 2PYEE 1U8IB 2NXZC 5KS9F 4KY1H 4IGBB 2C7FA 2E7BA 4E0RA 4P2RB 3WGUB 3ABGA 3OG6B 1U3JA 4JFHD 1U58A 2ITCB 3EJSA 2YGVA 5FM8A 5H4ZA 4S1QL 5E4IA 3ZMRA 1XB3A 1PEZA 5CCHE 3Q5YA 5L2JA 3EADA 4HUUA 4P48A 2BSRA 4NOFA 4LPCA 3BWUF 2PXYD 1DEDA 1ZT1A 5A2BA 3CZUB 2O5XH 1TIUA 1IIKA 4JO3H 4F9LC 4FP8H 4XC1L 1G7JB 5KVEL 1A6ZA 3HG1D 3KPOB 5D9SB 2ENQA 4ZYKB 3HZKA 4LRIA 1VZHA 1EAPB 2GJJA 3T77B 2ICWJ 1YC8A 4ZD3H 2Z64C 3BQUC 5CEXA 4N2FA 4N22A 2VH5L 3GSNH 15C8L 1NCAL 1J87A 3ZDXF 2CH8A 5GHWH 4RMVA 3U1QA 4Y4KD 5CLZA 4AG4L 1QBAA 2V9QA 5CF3A 1INDL 1IAKB 4PV9A 4PHXA 1XIWB 1CE6B 2YKLL 5GGUA 5MP6L 2HUEA