4KNTA

Copper nitrite reductase from nitrosomonas europaea ph 8.5
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
285
Chain Sequence
KTVQVTLHAVETDVAYDNKGSTYRAWTFDGKVPGPVVRVTEGDTVEFTLINDKNSKNSHSMDFHAARLDVVEDFESIKPGETKKYTFTADNPGVFFYHCGSDPMIQHIARGMYGVIIVDPKDANALPKADREYVLIQAEHYENPDDKTAMMQNKWSNVVFNGGVFKYDPVHDSEATSWLQAKPGERVRIYFVNAGPNELSSLHPIAGIWDRVYPSGNPKNVQYALQSYLIGAGDAATLDLISPVEGANAIVDHSMRHAHSGAIAVIMFTNDADPEAGRGENILIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Multicopper oxidase type 1
publication title Characterization of a nitrite reductase involved in nitrifier denitrification.
pubmed doi rcsb
total genus 89
structure length 285
sequence length 285
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kntA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kntA01
1PCSA 2HLEB 4G7SB 4DP9X 3CDZB 4DP4X 3ZBMA 4HHGA 1NPJA 1XB8A 4ENZA 2IWFA 3QJVB 1A8ZA 1NTDA 1ZPUA 4BK5C 2FT8A 5I6OA 4G72B 3SQRA 4HAKA 3FU8A 1XB3A 4BDVB 3IN2A 1PAZA 4DP2X 2JFCA 5I6MA 3PAUA 3AZUA 1L9OA 2XUWA 2FNWA 1QHQA 4A2FA 2XU9A 2VN3A 3AG2B 5I28A 3PCYA 3X1GA 1OCCB 1PZCA 3NJLA 4M3HA 1J9QA 4HCFA 3ZDWA 1M9WA 2LLNA 1KDIA 5IY5B 5ANHA 1T5KA 3IN0A 1J9SA 1BQ5A 3RYMA 3NSDA 3AG4B 2BP8A 3HB3B 1URIA 1A4CA 1OF0A 2UX6A 3TBBA 4DP8X 1L9RA 3DIVA 1BQRA 2VW4A 4AZUA 3EH4B 1KDJA 1M57B 2GBAA 2Q9OA 3EHBB 4F7KA 2BW5A 5LDUA 4YSUA 2CJ3A 2AZAA 2TSBA 2JXMA 1SFHA 4HZ1A 4EF3A 2HX8A 4DP5X 3NJMA 4GXFA 2PLTA 1SF5A 1KBWA 5AFAA 4GP5B 2XYBA 1I53A 2XV3A 7PCYA 3OQRA 3UABA 5B7FA 4DPAX 2J5WA 3X1FA 1HAWA 5B7MA 4PCYA 1OE3A 3FPXA 3EF4A 2UXVA 3NJIA 4Q8BA 2PCYA 1EHKB 1SDDA 3T6XA 3WNIA 3MX0B 3N2JA 1JZFA 4W1TA 1ET5A 2XV2A 1NIBA 2XVBA 1X9RA 1J5CA 3NSYA 2OJ1A 1YLBB 1JXFA 4BWTA 3UAEA 2BW4A 4DPBX 3FU9A 2VSMB 4KO9A 2CBPA 4TXVB 5E9NA 1MG2C 2HZHA 2YQBA 3BQVA 1GS7A 2B3IA 5B1BB 3FS9A 3IBOA 1E67A 1WA0X 1E5YA 4G7QB 4YSCA 1ZDSA 5I5IA 4DPCX 1JZEA 3T6ZA 4A2EA 1TU2A 2R7EB 2UX7A 3OM3B 5TK4A 4AX3A 5A7EA 2XXFA 1OE2A 2XX0A 3NJHA 2W8CA 1MZYA 2FQFA 4NAJA 1AS8A 2PP8A 4JKNA 1ZIBA 4F2EA 4G71B 4F2FA 1GR7A 2GB2A 3UAAA 1BQKA 5D4IA 4A2GA 4E9XA 5B1KA 1JVLA 3IEAA 4HCIA 2EIJB 2WO3B 4HCGA 1AG6A 2Y69B 3ABGA 1XB6A 5B3SB 2DY2A 1OCRB 1TEGA 1EZLA 2X88A 3ASNB 3C75A 2E86A 3QJTB 4DP6X 4A2DA 4UAHA 1NIAA 4GP8B 3WG7B 3S8GB 4W9ZA 2H5UA 1ZV2A 1JERA 2JKWA 2N0MA 5FC9A 1ET7A 1FA4A 1A65A 1SJMA 1RCYA 3CDZA 1AG0A 3V9EA 1ASQA 4N4YB 3NJNA 3S3BB 1AZNA 1IKOP 2YAMA 4BDVA 1KCWA 2IDFA 3NSFA 2I7SA 2FQGA 3QJRB 1SFDA 1CC3A 1M56B 4HHWA 3FSZA 5B1AB 4L0PB 3ZIYA 3EH3B 3X2QB 1V55B 3UADA 2FWLB 3PAZA 3ABLB 4P5SA 9PCYA 2H3XC 1GY1A 2QPEB 1KGYE 4KNUA 2BWDA 1F56A 1ID2A 4YSPA 4WKXA 3ERXA 1ZIAA 4UF7C 1AANA 2WO2B 2XV0A 1L9TA 1NIEA 1DYZA 1PLAA 2XLLA 3GXUB 4GY4A 5I5JA 3AG1B 1ADWA 2DV6A 4YSTA 1AQ8A 4AI7A 5F7BA 1MDAA 2VM4A 3NJFA 2CAKA 4E9WA 5I6NA 2RACA 2GC7C 2YAOA 3ABKB 1J5DA 3EH5B 3NJJA 4DP7X 2QPDB 3FYIB 2A3TA 2VW7A 3FYEB 5B1JA 1GS8A 1IBYA 2NRDA 3V9CA 1OV8A 2BP8B 2PPAA 2HXAA 2PCFA 4JHUA 3UACA 2BO0A 3OMNB 4CSPA 2VW6A 2J56A 3QPKA 1HAUA 4WTQA 3T71A 3UGEA 2BWIA 2EINB 3DKHA 3CG8A 3T6VA 1GYCA 2BHFA 4NERA 4KNSA 2Y1AA 3FQ1A 3PPSA 1WA2X 1PF3A 1V54B 2IWEA 1QLEB 1J9TA 3TA4D 3PXLA 1NICA 1IBZA 3WNJA 2BZCA 4YSRA 3H4FA 4A68A 1QNIA 3OMAB 2MRYA 2W88A 2FJSA 3ASOB 4DP1X 1GSKA 2J55A 3WKQA 4YSOA 3FU7B 1AR1B 4P5RA 3NJKA 2BP0B 1E5ZA 2FT6A 3TU6A 1RZQA 2AANA 2HX9A 4BWUA 4DP0X 1W6WA 1NWOA 2YXWA 3FSAA 4QLWA 2GI0A 2R7EA 4AKQA 3JTBA 1BXUA 4FA7B 4YSAA 2GHZA 3IE9A 4KO7A 5AZUA 1HFUA 3CVCA 2GSMB 3QJSB 1JXDA 1BEXA 1A4AA 1TEFA 2TSAA 1BYPA 5PAZA 1X9UA 3S8FB 3S3DB 1V10A 4E9QA 3CZUB 2P80A 3T6WA 4BXSV 5I5MA 3QQXA 1AZCA 2CUAA 3NP3A 2HRHA 2YAPA 1R1CA 1WAEA 4E9SA 2VM3A 4YVUA 1L9QA 1J9RA 1SF3A 4GYBA 3H4HA 3QJQB 3S3CB 2IDTA 8PAZA 4KOBA 2VMJA 1JZHA 1NZRA 1AACA 3SBPA 3MBWB 1NDTA 1IC0A 1DZ0A 1KV7A 1L9SA 2PPCA 4KO6A 5D4HA 3G5WA 3CVBA 2IWKA 2YARA 2AFNA 4KNTA 4Q89A 1PLBA 5F7AA 1L9PA 5B7EA 1JOIA 1WA1X 4K9JA 1A3ZA 1OOWA 2CCWA 3N55A 4HALA 2UXGA 1IUZA 1OCZB 4FAAB 1UATA 3OMIB 4A67A 1A4BA 2H47C 2QT6A 2J57A 3DTUB 1RKRA 4E9VA 1AAJA 3BVDB 4YSQA 3NSCA 6PCYA 2YAQA 3WIAA 1JZJA 1BAWA 3WKPA 2ZOOA 7PAZA 1W8EA 1BXAA 4KOCA 4E9RA 2AVFA 2IAAC 1PNCA 1AZRA 2CALA 1CURA 3U25A 1GY2A 2HRGA 2XWZA 4A66A 2XXGA 2OCCB 2PP7A 4MFHA 1JXGA 1GW0A 1ILSA 3H56A 2QDVA 1ASOA 1E30A 3NYKA 4JHVA 4A2HA 1OE1A 1CYWA 1AIZA 1NPNA 2XX1A 1OCOB 2PPFA 1NIDA 2FTAA 4BWWA 4UANA 3SBQA 1MG3C 4AKOA 1SNRA 3PLYA 5D4JA 3X1NA 4E9TA 2OV0A 4QKTA 4YL4A 5PCYA 4YSSA 2HX7A 1N68A 2WSDA 2ZONA 2IH9A 5AKRA 5I6PA 3KW8A 1ZDQA 1CYXA 2IH8A 3X1BA 1SHWA 1JZGA 2P80D 2PPDA 1AS6A 4G70B 1SHXA 1FFTB 2IDQA 3FT0A 4YVNA 2FQDA 4HIPA 4E9YA 2AZUA 1ILUA 4G7RB 3ZX1A 1ETJA 2EIMB 1PY0A 3D12B 5B1JC 1MZZA 3AY2A 3T9WA 1SDDB 4CSZA 1W6LA 2EIKB 2MTAA 5EHFA 4AKPA 1KBVA 1AZUA 3FU7A 3TBCA 2QDWA 1VLXA 1KYAA 2BP0A 2YAEA 5I6LA 1XMEB 3QJUB 1WS8A 3JT2A 4X4KA 1ET8A 2IDUA 3L45A 2YXVA 2PPEA 3FSWA 3NT0A 3SBRA 1RZPA 3AG3B 3GYRA 2I7OA 6PAZA 3ABMB 4KO5A 1WS7A 3X1EA 1PNDA 2YAHA 1NINA 3NJGA 1PLCA 1BXVA 4ZK8A 2ZWNA 3GDCA 4PAZA 3WI9A 1N70A 2PP9A 1PZBA 1E65A 4NB7A 5I6KA 3FQYA 1ASPA 3PAVA 2Q5BA 3OD3A 3FSVA 1B3IA 2BZ7A 3AW5A 4YSEA 3FPYA 1PZAA 3FQ2A 1JVOA 2GC4C 2FQEA 5TK2A 2FT7A 1AS7A 2DYRB 1GS6X 2I85A 2ZXWB 2X87A 1KCBA 2DYSB 2UXFA 3TASA 3NP4A 2IDSA 2VSKB 4M4RB 1NWPA 5I26A 2GIMA 1TKWA 2EILB 1NIFA 1AZBA 3HEIB 4BXVA 1FWXA 2YAFA 4N8UA 2DWTA 4RH4A 1BYOA 2DWSA 3KW7A 2B08A 3CVDA 4GP4B 2UXTA 1JZIA 1PMYA 4YSDA 1CUOA 1AOZA
chains in the Genus database with same CATH superfamily
1IGML 2FSDA 2GIXA 1EZVY 5MEOB 5C3TA 3QJVB 4P5MB 3O4LA 4NXSA 1GZPB 1COBA 2G0KA 3BWUF 5F7MC 4WI7A 1ZLSL 4AENA 5KVMC 5IHZA 4PVMA 5E4IA 3ZVVA 2MQCA 4LMQE 5IHWA 4PJDA 2AEOA 1T1XB 3OPZH 1T1ZB 1VACB 1ADQH 4JKWA 1QHQA 3Q13A 3VG9B 5I0XA 4UB0H 4XVUD 2Y7QA 3ZGIA 4K15A 4LEOA 2Z91A 1BWWA 2UZYB 3X13A 4QWWD 2VJ8A 4XCNA 5IY5B 5E1HB 2DLTA 2P5WB 3CFKB 5DGQA 5H37A 2DLEA 1G6VK 3E38A 3AG4B 3FTYA 5FAAA 1URIA 5FUCC 5J11C 5HSFA 3VFPB 1BQRA 3DBXA 2VW4A 3BH9B 3CMOH 5C07B 3MLXL 2NY6D 1KPVA 3NIDF 4MAYD 7FABL 4W4NA 5L0QC 3K74B 5DF0A 2DS4A 5F3BA 1KYUA 5HGDA 4F7MA 1T1WB 5LBGA 1IO4C 2NXYD 3KYKH 1JWSB 4HZLA 4ANVA 3VD0A 3EOTL 1R3IL 4DP5X 1MWAL 2R4SH 5IVZB 4Z7IA 4NYLB 1NC2A 3HZVA 2UZXB 1HXKA 3C60C 5HDBF 5FKPB 2X5PA 1JK8B 4TNWK 2NR6C 5EUKA 2V2WB 1DSYA 1NUGA 5D96B 2ZKWA 1QR1B 2XZAL 2Y7MA 4H1LB 1UACL 4EOWH 1RJLA 4HF5H 5DJYA 1T4WA 4QRSA 4M93B 4NRZB 4Q8BA 4ACTA 2C9SA 2B14A 1FN4B 1OAZL 3FCSB 4Q6YA 4ZT1A 3T2PA 2J8UE 3VB8A 4NWTL 6TAAA 3OKOB 4OI7A 4K2UH 4GW5B 1FFOA 3UEZA 2DMCA 1OT2A 3HI1B 4JPKH 3TBWB 4AQEA 2PKDA 4XPHH 1U8MA 4DUWA 2BIMA 2CO4A 3C6SA 3CFQA 2BW4A 1ESOA 1RH8A 1P7KA 4RRPG 4YH6A 4EN3D 1GPOH 4KO9A 3CFUA 5DJZA 3F7KA 1ACZA 5DI8A 2A6IA 3KLSA 3C08L 4Z7WF 5B1BB 5I6XB 3WELA 1CDYA 1AY1L 1TZAA 1EHLL 3ZSTA 2E46A 2PCPA 2W60A 4OI8A 1ORQA 1ZA6B 3F85A 3SDXE 2AXJA 3QUKA 1ZDSA 2NTFA 2FEDC 4KJPC 1TETH 2APBA 2V33A 4LVHB 2E6QA 4PJCA 4YN3A 5T3XD 2YMXL 4BYHA 3FSOA 5HHVH 3VD4A 5TFSH 2ZWSA 4L4TD 1A6ZB 2QQLL 4HIHB 4AL8H 2F8OA 4JFFE 4OCXL 1BQHA 4TN9A 1QLRA 5F7NC 4C59B 5EC1B 1T04B 4N2EA 5AZ2L 4XCYB 2AABL 4OCYH 3GXPA 5MENE 3EYQC 1EJOL 3VX1A 4ONHA 1SPDA 3MGOB 5JQ6H 1SMAA 2ZPKH 3AU0A 4BZ2A 3ARDA 4N2OA 4U0QB 3EYVB 5B3SB 2F5AH 2W0FB 1R3JA 1Z5YD 1VCAA 4KXZH 4ZFOA 3QRGH 1A66A 5I0YA 4FFZH 1XZ0A 3LPGA 3P9WB 4U6TA 3BH4A 4XP4L 5K9KA 2B1HL 4QRPE 3NACL 2LR4A 3TJEL 4EIZC 5FO7A 4X4YA 2EEAA 1ET7A 1FVCA 3SQBA 4WUKH 3DXAE 1R46A 5HDOA 3N41B 4Z3JA 3TGXA 2WLLA 1MHEB 3QCTH 1QW9A 3SDXB 3EUDA 1F4HA 2HKHL 5DO2C 1AZNA 4K7PL 2HT4C 1ZKAA 1U91B 2FK9A 1TOXA 3ALXA 3NFNB 4X6DF 3BSZA 1CICD 1OO2A 2GCYB 3CK0H 2NNXA 3C9NB 4FTVE 4QF1A 5C0EB 3NTCL 4P2QE 1TZHA 1XD0A 1M56B 2CK0L 3M07A 2W9LA 5ENWB 2OL3B 3L7FB 3L3JA 4JFFB 5E94A 8FABA 5L2JB 4F2MA 1NC4A 1YEGH 5MENB 3BZDA 1BWMA 3QQ3B 4YSPA 1JYXA 4QT5B 2CRMA 4ZMPA 5CBAA 1ND0B 4LFHG 3U6RA 4AC4A 4PJGA 3WL9B 4PLJC 4GO9A 4A38A 5G2NA 1KFAH 3GXUB 3Q8CA 1AO7E 3CV5A 3TIEA 4AI7A 4XX1G 3GS7A 2WW8A 3BPOC 3TCLB 4NOBA 4QRPB 4Y88A 5F21B 4JRFA 2HFGH 2XICA 4E9WA 1RSFA 2X7LB 4CMHC 2RACA 1CR9H 3WMQA 5IJCC 1C5DA 2XG4B 3DXAB 3EH5B 3NJJA 2P5PA 3JV6B 4DP7X 1BREA 1XV8A 2ENPA 3O3AB 2CO7A 4NENB 1DEDA 5IQ7L 5DK0A 3Q43A 3KPRE 3V9CA 3DOSB 5JHBA 4JHUA 2HUHA 2IC2A 4FTVB 1KELH 3HG3A 5FA3A 2FX7H 5A2CA 1DN2A 3VFMA 4P2QB 3CAFA 4NZTH 4X80H 1F3JB 4XPBH 5GZOD 2IOMA 1LEKB 1M6OB 1RUKL 1MVUA 2I9LA 4YEFA 2HRPH 2APWA 4PTTB 2AXGB 3OR6A 1X3DA 3DKHA 1OAQL 3ULUF 3B9KB 1A7RH 3HBQA 1ZTMA 1HESA 1A7NL 1CDGA 4PW4A 2Y1AA 5DJ0B 2UVEA 4BQ9A 3IDIA 1WA2X 3ECUA 3CIAA 2KDYA 2YD4A 1U8JA 1GHFL 3DMMD 4AV5A 2FH6A 3LKQB 3MREA 1OTUD 4GBXB 3VSQA 2V0AA 2NMSA 3ZQ9A 2MRYA 3MLUL 1SDYA 3LXUX 4MRCA 4XO5A 4CDGC 4HEPG 3MRHB 3O0RH 4PLKC 3H7BA 4ONGH 5BQ7A 1GSKA 4G9FA 3WS6C 1XGYL 2V7NB 4P5RA 4Y9EA 1SOKA 2F7PA 5HGAA 4XPTH 1OF2B 4AMXA 5I8OH 3KPRB 1I7TA 1QLEH 3EDKA 4P4RA 1IC4H 3GEFA 3EYOB 4XH2A 3FUHA 3DX3A 4LSDA 1H8OA 3EYUH 3ESPA 3FTVA 5JXEC 2EIZB 2VDNB 3PREA 4EUPH 2YD3A 1LK2B 4ALAL 4NGHL 2EC9U 1HCFX 5D7JA 3PUCA 4Y4FA 1MRDL 1BIIB 1CLZL 1L4IA 2R0WL 4G6ML 5DFTA 1KN4H 1WZLA 1VAHA 4KPHH 1GCFA 4OLVL 4QNPF 5F2FA 2BS8A 2ZOKA 2JCCA 5ISZB 1P4BL 4XXWA 3BP4B 5AUMA 4OFQA 4PJFE 1JXJA 5GS2H 5CLXA 4MDIB 1UUSA 5B8CA 3ZTEA 5EIIA 5C07D 5FYLD 4G7YH 3TYGH 3B3IB 5J1TC 4LPXA 3DVNA 1UH2A 2QTEA 1RK0A 1U92B 3A24A 3BIKA 3F83A 3VXTA 4A37A 1G1KA 4QRTA 2ESVA 1FYHB 2N56A 1SLVA 4GO8A 2J8HA 4XC1L 5G4NA 2DD8L 1T0MA 2PW1A 1UM5L 4NM4H 5T8IA 1P5UC 4C4BA 4HJJH 2JE8A 4YEEA 4BA0A 3AS3A 1X7SA 1QACA 2IANE 3GLEA 4HC1H 5LGKA 5D5MA 4LHQB 1NBYA 4GKNA 3PNWB 5AL8A 1D9KC 5I76B 3O0LA 1UGKA 5GSVA 2SEBB 3FH7A 3U0PA 4ZW3A 5BRQA 2ADGA 3QIWA 3ZJAA 1OCZB 5JO5B 4RNRB 4K71C 1BZQK 3FF7A 3L3GB 2QT6A 1Q9KB 3BAXA 3B3BA 1IBGH 4OGYL 3FQTA 3JV5A 5EN2A 1AAJA 1O6SB 2H2SC 4M7KL 2H9GB 4IJ3B 2WWKO 3PWNA 2ICWA 1J0ZA 2FATL 3EGSA 4KRLB 3L3OB 5TPWL 3E2HC 4PJFB 2AVFA 3W2DH 4YX2H 1D5XB 4CBZA 3D0VA 3VM7A 1OLLA 4DGIH 1EMTL 3VFOA 5HXMA 4H8WC 5F7DA 2X44D 1DVYA 4JKPL 3U4BH 4FQ1L 4PW3A 5C0FB 1AHMA 3O3BB 3F7VA 5IB1B 4MCNA 2VNCA 4ORGA 4WI8A 5DEFB 4TYUA 1PG7L 1WCBA 4FFWC 1CYWA 4A39A 1DBMH 1G7JB 4PI0A 5ETUB 5SX5H 3U7YL 2RCSL 4LGPB 1J1PL 3WMPA 3VI3A 2IANB 3SKOA 4NJAL 3GSXA 1MREH 5L9DL 3V7AG 3JT0A 3D69B 3GB7B 5E2WL 1TJHL 2HX7A 1XCQA 4LSTH 4XPGH 1TLMA 2DIEA 4JG9A 4FZ8H 1JGVL 3UO8B 1NCHA 1HI6B 4KK6D 1E7VA 3ZR5A 5CILH 2K0RA 3TFBA 3CD4A 2HG5B 2O5XH 2IDQA 3EO9H 4AYMC 3VXRA 3BZ5A 1HILA 2JJWA 2JQAA 5GHWL 1TQCC 4IS6B 4A7GA 4XZUB 1QTYT 3MLYH 2CHWA 1XAUA 1TVHB 3CBRA 1QFWM 1YNTA 1MZZA 3SKMB 1W6LA 4KKCC 2HT2C 5EBMA 1WV7T 4L8SA 3T8VA 4RGNC 3WLBA 5CF3A 1KTBA 3BVVA 4HS6A 5L6YL 3SDAA 5BV7H 3U9UA 2WVVB 4F27A 3JT2A 5IOKA 4TULL 4D9LL 4LCIH 2WHVA 2CIIB 5ERWB 5H94A 1F58L 4GG6F 1XGRA 2H0EA 3IGFA 2FEEL 5C70A 3HW7A 3LH2L 3CHXA 3NEOA 2WVTA 3IGAB 2ZX5A 1RUPL 3H2PA 1KPUA 1T80A 2Y1YA 4RAUA 5FOBA 4JFFD 1N6VA 1BAFH 1H3PH 3M1BA 4U1JB 3BEWB 1ETA1 4ZMOA 4OBRA 2AEQH 4PN6A 3BDYH 3G6JB 3NIFE 5DLML 5MEND 1AD0B 1BEYL 5DD5L 1GJUA 3WMSA 3P9MA 3GJEB 5BZXA 4BKTC 3OD3A 3PJSB 1B3IA 3AW5A 3K8KA 1D5BA 3AQDA 4JE0A 4NZRH 3OZ9L 3X3FL 4RA0C 4OJDH 4WU7B 1N59B 2A6DA 4HUWA 3RPIB 3L9RA 4QRPD 2A73B 2I85A 1M3JA 2DQIH 2VKWA 2ZKMX 3D4GA 5KS9E 3ENEA 1YCSA 2HAZA 2R0ZL 5JPMB 3MDJA 5A7BA 4LKCB 3L3KB 1H6FA 1Z66A 4JHWH 4XPFL 3LRKA 5EU6E 3RVTD 1E6OL 3DXAD 1NLDH 3P3RA 1W80A 3QNYA 2PTUA 5EZOH 3GIZL 4UWQB 1D5MA 4UZSA 4N8UA 4Q9QL 2BVPA 2D3VA 2DH2A 4OZ4B 2AXFB 4Z3HA 1GKEA 1KB5B 1N67A 1T7WA 2VAJA 4ZO7A 1XF3B 4FTVD 1IAIH 2XTJC 1VPOH 4C4KT 1R4XA 3HPLB 4J3XA 4LL9A 1BVLA 4P2QD 4WLCA 4XE5B 1XB8A 3MV9B 3UYPB 1A2YA 2ENQA 2C4FT 2IWFA 4OM0L 3BMVA 3N42F 4LESA 1USZA 1ZPUA 2E8YA 3C5XA 1SJEB 3P0VL 3PWVB 3ZHFA 4B95C 4Z3TA 1JPGA 2RR3A 3B9KD 1OP4A 3NIFB 3R06A 2PETA 1Q8MA 3WGUB 2BNQA 2IGTA 3B2UC 3PNRB 2PWHA 1N2RB 5EF0A 1KCRH 4XNZC 4BUHA 5CD5C 1CFNB 1MCSA 4X5XA 1AO7D 4U33A 3AG2B 5IGXH 3GKZA 1UOKA 4HT1L 5KYUB 4JUSA 2IH1A 3ECVA 1HYSC 1I4FB 3LIZA 3ZDXF 5C1MB 4GRWE 1RZJC 3QXWA 3SPIA 1J9SA 4KZDH 1BQ5A 5CXPA 1KCVL 1RURL 2UYLA 5ID1A 3OKEA 4XZ4A 3IDXH 1I85A 1MCQA 5HGBB 3U2SB 1FNGA 2P44B 3KPRD 5CJXA 3FTSA 4PJ8A 4WNSA 4M56A 1A0QL 1NBZB 1WZAA 2WANA 4ADGA 5D4QA 4PJXE 3IF1A 1M57B 4HIIA 4PV8B 1VFBA 2CZNA 4MA7H 1G5AA 3N1PC 5AAWC 1FJ1B 4TLTA 4GEIA 2FJFA 2VDNL 2OI9B 4TL5A 2ZYHA 3AB0C 4PQXA 3UO1H 2P8LB 1IKNA 2CH8A 1I53A 5KSVB 3ZRCC 4O02B 4IBQA 2HFFB 3D0LA 4OF7A 3LRSB 3LSOB 1HCYA 4LLWB 4BGDA 4UT7H 2O5ZH 4TQPA 5GS0L 2Q10A 4L8BB 4HKJA 3M17B 1X6NA 2GAZA 2VJXA 1U8LA 2BMKB 1JN6A 2DMGA 4ODUB 4PGBA 3FL7A 5B4MC 1V3KA 3WHXB 4N0RA 1WFTA 3N2JA 3CDYA 2IADB 4W1TA 3DHPA 4GRWB 4XNYL 4JRWA 3U2IA 1Q90A 3IU4H 2QQQA 1X5ZA 1XEDA 1XCXA 2PTTB 5EO0B 3V7MA 4L2YA 5KVFL 5CFHA 2X28A 1HHKB 5T1KA 4POZC 1AGCB 4HV8B 3CNKA 1OIOA 4YL9A 4KWUA 3S88L 4HUCA 3GK8L 1E67A 4MRBA 3ZW3A 3ZT5A 3RY6A 4IRZL 4WCYL 3W39B 3ARBA 3LEYL 1W72A 3QUXC 1TU2A 1KCKA 3OM3B 4F33B 1GYWA 4WWKC 1C7TA 3QXAA 1NCOA 2D3LA 3TWYA 4AQAA 5GS3A 4M61B 1J05B 2AQ3A 2C9AA 2F15A 1E9OA 3OJDB 4M1DL 3SKNB 4U3CA 2NYYC 2VH5H 3K0WA 4CW1B 2Z7ZA 2R39A 3WN5B 4A2GA 5B1KA 5B39G 3N44B 2EYSB 5BNXD 4TUOA 3RTQC 4AYDC 4UINL 1MCIA 2QVFB 3P30L 1L6PA 1OCRB 1EZLA 3QJHA 2P47B 1EH9A 5JW4M 2AITA 4I4WB 5E8OB 5EZLA 1ZVSB 4HPYL 3NFPA 4RGOH 4MNQA 4NQVA 4W9ZA 1UCBH 2IAND 3CUPA 4TQEL 3KH3A 2O6CA 4KI5C 1JERA 2HG0A 4L5FL 1FA4A 3VH8G 1MQKH 1B2YA 1EVTC 5DWUH 1L6ZA 1G7IA 4G5ZL 5GGRY 5C0ND 3U9PL 1O9VA 4NO2A 1DSWA 3V9EA 5IEHA 2EXWC 1RU9H 4GAGL 3AWEA 3WTUA 5CP3H 1LO0H 1Q9WA 1UJTA 2LFEA 4PIBA 3RZCC 3IKKA 4RVBA 3TBTA 1LDSA 5KBKA 4JO4H 3K72A 2CDFA 2J4WH 3FQNB 1XHHA 5IF0A 3K91A 3X2QB 1DVFB 1ETZB 4B9KC 5EA0H 2FO4A 1GTNA 4HUNB 1S9XB 2VL5A 2BWDA 2HH0H 2EYRA 3AACA 4Q74A 1RUAL 1SXBA 4OFYA 2A0LD 1LO3L 2XV0A 4XVSL 3E6HB 1P7QB 1A6VH 1X9LA 4K3DH 4PGZA 4PJ7A 3RRQA 5JNYA 4M6AA 3HCVB 3MNMA 4YSTA 5TGBB 4CGUB 2ZWYA 3CLFH 4F7PB 1SBBA 2VXTL 1C1EL 4JRYA 3FB5A 5TQ0H 4TOYH 1HWWA 5I17B 3RDTD 1A3RH 1FGNH 2PXYA 1LP9B 3F8UB 3P2TA 3GEWB 1J5DA 2H0PA 2X4SA 3BKMH 4GXVH 1XL4A 4X50A 4YWGL 1UD5A 4ZYKA 3TO2B 1XCTA 3Q01A 5E24E 4R4FH 2QPDB 4PJBF 3QG6B 3E1ZA 4NNYA 3LOWA 5AW9B 5KAQG 2VE6B 4KC3B 1QLFA 3DV6B 1JD7A 5I1IL 2C1PA 5KANI 1KPVB 3GMQB 3K2IA 4UQ9A 4F9PC 2VW6A 2EICA 3KPPA 3MRBB 1J9CT 1DJHA 4LBEA 4F7MB 2J6EL 4X6FB 4WTQA 1A6PA 3TF7C 1RHHA 2QLVB 3B9EA 4R5TA 5K1JA 3W81A 4U3SB 4I3SH 4CUCA 3WO4C 3R4RA 4PJCE 2WQSA 4LSPH 1KG0A 5JW4R 1J9TA 2WYIA 4M29A 1RZKH 3RUGA 4N6QA 5EZIH 2QVKA 3LEXB 1BJ1H 4YXKH 3SPVA 1M2OA 3V5DA 1RJLB 2DTMH 3MCLH 4QRSB 5KEZA 1RUQH 3OMAB 2ZSVB 5E6IB 3ASOB 1JZ8A 4I13B 4U1GB 4PTUA 3VNYA 1KB5L 2YD7A 3FUFA 4FJ6A 5I23A 1ZHLB 1AR1B 3QHZL 4KK8C 5BUGA 4D0BA 5GS1A 4QGTA 2EADA 2AJSL 4I1PA 4KUCD 3FSAA 4P9HC 3Q6GL 1VA9A 2CJSA 3RFZC 4LVNB 4W9FC 2ZX9A 3DX2A 1E4JA 1MHCA 2JK5A 1Y0LA 2FJHA 2ITDB 3CVCA 4P4KA 4DGVL 3IJEA 4UUJB 4EDXA 1BYPA 2BOLA 2UY6A 5DJ2B 2ED9A 2WIMA 4YIQB 2P7TA 3QUKB 2NTFB 2I9TB 4MNHA 4NZUL 2FCBA 1H0DA 1MFEH 1B88A 2VR9A 5DJDB 4QYAA 2W5PA 1CQYA 4XCCL 1KZQA 5EU6D 1RMFL 1HS6A 4CU8A 5DRXB 3JYCA 4HSAC 4N22A 4OFKA 5KBLA 1J9RA 1QEWA 4GMSH 1CXEA 2OJZH 1BQHB 3CQFA 1OD7A 2ZCLH 3FOLA 4NNXA 2DQHL 1L0YA 1CE6B 4Z8FH 3BKCL 2P5EA 1BFVL 3V0AC 5AQ0A 4OFIA 4PJGE 2X0WA 4O4YL 3SBPA 3M8OH 3LYRA 2XRAH 4Z7UE 1SEBB 3WXWL 5G4OA 1XZ0B 1HINH 4L3FA 2OBGA 2PPCA 4FQLH 1TLKA 3VFVB 1L7TH 4TNVK 1JGUL 1TJGL 3IM1A 3JWNG 4O02L 4X4XB 2G75B 4AW4A 2CCWA 2B16A 1P53A 3LKPB 2D73A 3NDYE 4HU2A 4P2OA 3TN0B 3PL6D 4JFXB 4JM2A 1E4WL 2IIJA 2ZOWA 3DIFA 4IK7A 2YQGA 3JWOC 4JJ5B 1U95B 4PRHA 2P24B 3Q8AA 3JWDL 5HDRA 1YQVH 2ISDA 4ZAKA 1NGQL 1ZTXE 1IE5A 3Q2WA 1PY9A 1LMKA 4HXBL 4WNQB 4RWYH 5F7HA 1TQBB 5I66A 3N43B 2MIZA 4XO4A 4ZS6D 3LQAH 3MXVL 4QTHB 4ATTA 3TO4D 3GMPA 5JA8B 2F74B 4A66A 1N6QH 1NC4B 2EXYC 3KM2A 5DYOA 5A3ID 1E5BA 4JREC 4JQVC 3BOVA 1S7UB 3B8SA 5IMLB 1ZOXA 2RA1A 1ASOA 4AVIA 3WFDH 2JQZA 4A2HA 3TFKD 2X70B 3UC2A 1ZT7A 2WCSA 4QHMA 4Z7UB 5FUZL 1WFOA 5IM7B 4RMQA 5CN3A 3PUUA 4NO5A 1NFKA 3NQIA 2ARJA 3COOA 2DQTH 1CZ8L 3HBZA 3OR7A 2FX8L 5J6HB 4YHZH 5KVEH 3K6NA 3KDMA 5C8JA 2IH9A 2EEBA 1ZLDA 4KQ0A 3JWNC 1R34A 3BAEH 2O6EA 2ZQKA 4LIQE 5DZOA 3NH7H 3REWB 3VGGA 3BIBX 5JPNC 4G70B 4MMXA 2XT1B 5J0BA 1N8ZA 4PG2C 1UWEH 3NCXA 2A4ZA 3L5IA 4KK5D 4LQFH 4MAUH 1A6AA 5D93C 2Z7YA 1PY0A 2E0PA 4R2GC 3D12B 4N87A 2ZE0A 2ZAGA 3T0WA 3H2WA 1GIGH 1LNUB 3N06B 3OPZL 2V9RA 1U93B 4Q97A 1ADQL 1LQSR 1B9ZA 1ONQB 2DICA 2Y24A 4UB0L 4EI6B 1KPRB 5I74C 4PWGA 3RKDC 2VXVL 4U1SA 1ZGLB 4ODHH 1U8JB 5AALA 3FRUB 4NI3A 1Q9LA 3UX9B 2IDUA 2IQAB 2ZICA 2Q3AA 4HGMA 4DK5A 5I71C 3NT0A 3QFDA 4E0RA 2IFFH 4POYA 1NPUA 5LO7A 3MO1B 4ADIA 1WZ1H 4F15C 3BYYA 1DQVA 1EFXD 1ACYH 4X9YA 4YBHA 5EU7C 3NJGA 3CMOL 2YEZA 1FZJA 2R1XA 1E3ZA 1T22A 1SZNA 1DVFD 2ILLA 2ESVE 2ZWNA 2AEIT 1PZBA 5LUMA 1AHKA 2AJUH 2UUDH 5HHPA 2APTA 1AC0A 3BGFC 5IFJA 2ATAA 3KYKL 4V2CB 4TRPH 3PPEA 4LB8A 3OKLB 4XMLH 2R4SL 2HMIC 5G5DA 1JXKA 2JI3A 5KSUA 2FQEA 2ZCHH 2DYPA 1WUNT 2R2EA 3UTTA 4RSVA 3WAKA 2Z1PA 5C0CA 1UXWB 4EOWL 4HF5L 2XPYA 4FDWA 2X87A 2BIHA 5I1AA 2B9AA 5F1KC 4C83A 1G7LB 3D1MC 2O4EA 3IPFA 3PGCB 5JIQA 1KGXA 1NBCA 1TKWA 2EILB 1UKSA 3HEIB 1VEOA 1FWXA 3VTAA 4MA1B 5I82A 5CR8A 2LW3A 4K2UL 3B9DA 4QXTB 5IV2B 1JDCA 4LSUH 1VZHA 4N0UA 4PV9B 1V3JA 4JPKL 5CNHA 5I5RA 5IB3A 3FCUB 4XPHL 5FYJU 4JRXE 2DL2A 4ZBJA 1OCWH 1GW6A 4MD5B 4DP9X 1RK0B 1NPJA 2D9QB 3MRNA 4C56A 4MMZA 5E8DH 1GPOL 1PSKH 2ESVB 3F2LA 1OTTC 2OMVB 2OXGA 1UA6H 3D85A 3RVVC 2VT0A 3VXQB 4JHBA 4AXWB 4K55A 5GJTH 5DRZA 1NC2D 4H20H 4JLRB 4QHUA 1KTLB 5LGHH 3V5HA 2BNRA 4DP2X 2D4FA 3VGBA 3UP1A 2ZZUT 1UD3A 5I6MA 1RXLA 4JCMA 4PWKA 1TETL 1UKTA 3DYMA 3SDDC 1F42A 1JV2B 4HGWB 2BSTA 2ADGB 4CNIA 5HHVL 5TFSL 4FLSA 1GSMA 4F8NA 5FO2A 5E4AA 4EQ2A 3FW6A 3F84A 1P6WA 5E6ID 1KXTB 4AL8L 1CDHA 3GS4A 1YEDA 4FLOA 5EN2B 1TQWA 5ANHA 2B4CH 3IN0A 3PWNB 5FHAH 4OCYL 3HMWH 1GXEA 4GOSA 2N1TE 3HB3B 3WJLA 2UX6A 5JQ6L 4R7NB 2ZPKL 1CFTB 2F5AL 5I0VA 2Z92A 3UCRA 3EH4B 3GTTA 4LLQB 5BS0B 5FFGA 4H0GA 1HQ4B 3QRGL 1HHHA 2C9UA 4NRXA 4FFZL 4JRXB 4MASA 3QAZC 5F7DB 3R19A 3IU3A 5FWRA 2B77A 4X6CF 4L1BA 1PTZA 2TSBA 2NX5B 1MFVA 4NN5C 3SY0A 1JG9A 1HH6B 2LU5A 4CC4C 5BV7B 3MV8E 5C3IA 4ZJ9A 5AFAA 2FBOJ 3FUJA 5HI5C 1GGBL 4WUKL 3QZWB 4KVPA 5FKAA 2R2BA 2R1YA 3H3BC 3QCTL 5D6CB 1RK7A 1UUNA 4R4BA 1HAWA 2MNWA 4BQCA 3REVA 5C0DB 1O6VA 2OQJB 2VMEA 1OE3A 1TENA 2A9NL 3EF4A 5KG9A 3Q5OA 1BZOA 3CK0L 3K81A 1A9VA 1LWJA 4GPVA 3LRLA 4HKXA 1YC7A 5CGYD 4FFVD 4LSVH 2ERJC 2YPLE 2WNGA 4S11A 3K71A 3SZ6A 1INDL 3FNKA 5B3JE 1YEGL 3HZYB 1J86A 3EJUA 4JPSA 3QJFA 4F7EB 1H5BB 5JW4N 2H1LM 3H2QA 5HJ3A 1YNTB 4IKKA 1KFAL 3MGTB 5D1ZI 3DO7A 3IETA 5D2LF 1O75A 2AGJH 1R19A 5FO9A 2HZHA 1QRKA 4ANKA 1UOVA 4FNLH 1EWHA 1B3JA 5F1OB 4W68A 2GFBB 1WA0X 3IXAB 2HFGL 4Z7NE 2Y3AA 4ZX5A 3SDAB 4FHJA 1CR9L 3MV8B 5IBTH 4I3GA 1ZHNA 5LN8A 1Z5LA 5DHVH 5IVXE 4WI6A 2BVYA 2UX7A 4G8AC 1XGRB 2CUIA 3LPPA 4AX3A 3V0DA 4Q9RH 4XNDA 3U46B 5SV4A 5D2NA 1FIGL 4P46C 4PS4H 3HNTH 1CXIA 3BWUC 1KELL 2LU7A 3IJ9A 5FOBB 15C8H 2ZSWA 4KROC 3SGJC 2IMNA 4FYQA 4NZTL 2WQAA 4X80L 1BQKA 4XPBL 3V4VA 1YEWA 2F9BT 1NC4D 4G9DB 3TC9A 4LK4A 5CCGE 2HRPL 2YPLB 5EDXA 2HA1A 3S5LA 2H32H 3TBYB 4RCAA 3P9MB 5HHNA 2QHLA 3EO1A 1RQ5A 4ZDHA 5L4IA 2E86A 1A7RL 2D7QA 5AZEH 3VRIA 1I7RA 2XACC 5LNEA 4BK5A 1NIAA 2WOYA 5EU3B 3SGKA 4QO1B 3D9AH 3OSKA 1PIGA 4F93B 1X7TA 4NQDA 3S97C 4G80A 5EU4A 1M1SA 3U30C 3KS0H 4PRBA 1ASQA 3QNYB 4JW3A 5F0PB 3O0RL 3HBPA 3UZQA 4Z7NB 4YO0A 4ONGL 5DVKA 1XSKA 1QA9A 1IKOP 3CH1B 5IVXB 2JB6B 1E28A 3UAJD 2V3FA 2V9QA 2VXUH 4DVRH 3P1VA 4QXWA 1S4IA 4XPTL 1D7BA 3VXUB 5I8OL 4HHWA 1NEZB 1QLEL 1A6TB 4G6KL 3ILQC 1T2QH 3FFCA 1IC4L 4HVBA 2COQA 2EDJA 3B34A 2H3XC 2O1AA 3B5HA 1FL3A 4N9GB 3EYUL 2NW3B 4G8IA 4QYOA 1JYNA 2CR0A 3DUSA 1XH3A 4AK2A 2CKBH 2DOCA 4U6XA 5HY9A 3S48A 3RHWK 2R2HA 4B7LA 2OMBA 3KYMA 2WJ7A 1HDMA 5T3ZE 1KN4L 4AM0Q 4KPHL 4PR5B 2O6PA 4CVXB 5BZDA 2XJKA 5I6NA 1AKJB 3P3SA 4RQQB 2X4PA 5GS2D 3CZFB 3O3DB 4QRQA 1HT6A 3GHEH 1DL7H 1X5GA 3D3VA 1X5JA 4HOMA 1FL5A 4G7YL 4G9FD 4UDUA 3BN3B 3HUJE 3IPBA 4MA3B 3TYGL 3GBEA 2Q87A 2UYLB 1DQJB 1JPFB 3OKEB 3S6CA 3MNVA 1P9MA 4KH9A 1R17A 2PCFA 1UG9A 4BSVA 3UACA 4HSQA 4PJ8B 1ZHBB 1KBPA 4PBVC 4NM4L 3VO0A 3WIIH 4HJJL 3KGUA 4HC1L 4PB9H 4V33A 3MRJB 3MR9A 1OP5K 4X6BA 4QHLA 2WZAA 4XTRD 25C8H 4DO6A 4N86A 2UVFA 1OOAA 4NERA 3V6OE 5E9DE 4QCIB 3R0MA 1JGEA 5JIMA 4XGZB 1UM4H 4V1DE 3K1DA 4LPTA 1IBGL 4Y5XB 1WFMA 3H3KA 1EGJH 3FT2A 4XRCB 3BPNB 1MHHA 3IDMA 1BGXH 4HWBA 4XBPA 4WSJA 5C86A 3OG4B 1JN6B 4JG1H 4QRUA 4AT6A 1S7SA 2HYMA 2BVQA 5T5FA 2VR8A 3F58H 1P84K 1L7IH 1T89A 3CZEA 4YX2L 2BC4B 3QIBA 3O2VH 3TTYA 3W2DL 4DGIL 1YZZA 3NJKA 4D7BA 3U4BL 3HUJB 2XN9A 3VWJA 3J7HA 5FV2A 3VU2A 2ESVD 4HU8A 4XMKH 2YXWA 4YDIH 1A1OB 2VLJA 3L3HA 2O61B 4LPCA 4AKQA 1BQUA 4MNQE 2DWDB 2LT9A 1DBML 3IE9A 4KDTC 2B3RA 1NSNL 4L05A 1P6FA 1G9NL 2OMWB 4QOKA 5J12B 2CBQA 1UB6A 1OGAA 1MREL 3WFHB 4AGOA 1JWUA 2Q6WA 1JHKH 4LSTL 4XPGL 5AOKA 5FDWA 1QSVA 5E9DB 4ICXA 3CVIH 2BVUA 2YAPA 1R1CA 1WAEA 2KYIA 4JQXC 4V1DB 5CILL 3VI4F 5B38G 2GT9B 2ORBH 2FYYA 4OZHB 4X0KA 5EBLB 3VGDA 1BXXA 1E2WA 1M2VA 4RAVA 2O5XL 5TJWK 4AQAB 2BIOA 4RZKA 3EO9L 3ARYA 3HB3D 1JYWA 2FIKB 5DZVA 3MNWB 5IBLD 3JVFC 3MLYL 2JJSA 4FXKB 5CIPH 1P0SE 1T3FB 4JRXD 2WWNA 3AU1B 4M8UA 4J39A 1QUNA 2D8KA 1B6UA 2X41A 4JPQA 1JZHA 1NZRA 1YEEH 2WYHA 4PJ7E 1J87A 3AXIA 2NOYA 3TESA 1FFQA 5DXWA 1KEMH 5A6MA 5EZLB 4JZJC 5JLZB 5BV7L 3QSKB 1U3ZA 4JRYE 1MXDA 2YBGA 4LCIL 4U1LB 3P4OA 1IUZA 4HOZA 3US1A 1NAMA 3RNKA 2VDPH 2RFXA 3UTZA 3PP3H 2H47C 1HYRC 3T0XA 3IMUA 3UMTA 2J57A 1CIDA 4U0RC 1JZ7A 4FHKA 4UU9B 1BAFL 1H3PL 1JZJA 1CTNA 1NMAH 2AEQL 4A7VA 3BDYL 5IF0B 3FTXA 3WUWB 1KLFA 3QUZB 3VWKB 3LX9A 4YFLF 3PP4H 2X6VA 1UXLA 4Z7VF 1U8KB 2XWJA 3ULUC 2D31A 2FO4B 1M1XB 3WE6B 5F7YC 1IEBA 2PP7A 2VL5B 3N3EA 2XZZA 3AAZB 4JO5A 1EA9C 3DJSA 2Z0UA 3UTPE 2JKJA 3B1TA 1F1AA 5F1IB 1NPNA 2DQIL 2XZQL 1QPXA 3AS0A 3QEQA 5D1QA 3SDAD 1RJCA 2OX5A 5DHXB 1FLRH 1R75A 1YDPB 2YD5A 3MV8D 2X4QA 4JHWL 3S36H 5F0LB 5HYIA 5JHMA 2XKNA 1NLDL 1ZLEA 4I48A 5EZOL 2WLJA 3FB5B 2Z35B 4KXBA 3V0VB 5ABZA 3F04A 2PXYB 4Q9BA 1V5JA 2NY2B 2B1OA 2Q2EB 1IAIL 1VPOL 4CA4A 4XB8A 3RWGB 4GKLA 1WFIA 5K9JL 5H37H 5KUMA 5C0AE 2YPLD 3C8KB 3SYPA 2V5YA 3MUY1 3OB0H 4BFFA 1TPXB 3HI5H 3EFFB 4H2CA 1FLTX 3B83A 1KIUB 5B1JC 1N9PA 1F41A 5E00A 1ZSDA 4FJZA 3QPQC 4TSBL 5IIEB 1KCRL 4Y19E 4ZI8A 2QDWA 3KLHD 2CLRA 5IGXL 4Q58C 4F9LC 4ICWA 1RZ7H 3U0TB 5JIPA 4L0YA 5KJRH 4CU7A 2VRAA 4KK9D 3H9HA 4JN1H 1IC5H 1E2ZA 4HPOH 4XOEA 1HSBA 4N2HA 1NBQA 4KZDL 1A9BA 5KYXB 1BQLH 4LCCB 4YHIA 2VAAA 5L8KB 1WS7A 4P57B 1Q1JH 1FVEB 2Z4TA 2D9CA 3OC5A 4OQTH 3QDGA 4J3TA 3KVPA 4PBWD 3WI9A 2A9AA 2PP9A 1EJ8A 2JVUA 3U9WA 3IGLA 3W37A 4D0BB 2UWEE 3DV4A 3X11B 2YMOA 1RIVL 4MA7L 3HIZA 1XTLA 3MRKB 5C0AB 4DO4A 4ELMA 2Y1VA 3FSVA 1UASA 3UO1L 5DHYA 4TPRH 4EI5C 3MRLA 3ZE0F 1EEQA 4IOIB 5F9JB 1QHPA 2FJHB 4Z7AA 4P4KB 5GGTA 3IJEB 1BF5A 3RGHA 4N2IA 4YHLH 1M9SA 2AQTA 4N0YH 1GS6X 4M00A 2O5ZL 4UT7L 5J6GA 2R27A 1AKJD 1NCNA 3EYSH 3V2AR 4XWOC 3EOYG 1MNUH 4Y19B 5EEUA 4MSWA 4WFGE 3O8XC 5HYQB 3QORA 1NWPA 1MI5A 2EZ0C 1S3KL 4H88H 5A16B 4NAQA 5CGTA 1F1GA 4BSWA 2EDDA 1BMGA 3M6DA 5E08H 2WQUA 1RJZA 1TSRA 2WINA 4L8CA 2A9BA 2V5MA 4PJ8D 1G1YA 3DRQB 5J3HD 5DJ6B 3LNHA 3KHQA 4EKJA 3QA3B 5C97A 4FF9A 1KEGH 2QL1A 3F12A 2A6KA 1EAPA 1SHMA 4HUUA 1LD9B 2UWEB 1FL6A 1JNNH 4FQIH 4ZW7A 3WJMA 4YOKA 4HZAA 1FPTL 1HSAB 5DQJB 1DJIA 1QPPA 4XO8A 2J2ZB 4R7DA 5CP7B 2KPNA 4LCUA 2EEXA 5EOQH 5IMKA 1MCKA 5T3ZD 3SE3C 2DMHA 1U2CA 4Q7DA 4RGMC 4S0SD 4Z76B 1NH6A 3BYTA 4LLUB 2QZ5A 3QEGH 2Z3FA 2EABA 4Y2DB 4AW7A 2VH5L 3ZDWA 1BVOA 3EW3B 1KDIA 5DD6A 4OIBA 3BP6A 2XWCA 3RYMA 2RALA 4Y89A 3TOPA 4EJ1C 2JIXA 3BSZH 4IDLA 5F88A 3MRFB 1L9RA 1EO8H 4FI6A 4GG6A 1T7ZA 1BFTA 4N2NA 4XCEB 3GSNA 4NCC2 4MMYA 1J88A 2Q76A 5FWQA 1CFVH 5LDUA 1UENA 1EDYA 3LZQA 4RGOL 1UCBL 2FZ3A 1DHKA 1ZXKA 3LY6A 3SJVB 2CLVA 2HTKD 1MQKL 4QHMB 4GP5B 5DWUL 5LQBH 5KZCB 4HMDA 3ILPA 5ECJE 2AJ3A 1MFNA 4NUMA 1RSYA 2XWTA 5E9DD 3ARBD 4CVWA 5B7FA 3WS6A 1NDMB 3B9VA 1ERNA 4U3XA 5C0IB 1RU9L 4N2KA 4XWGH 2FJGB 4V1DD 1KJMA 4L1DA 1WWWX 4X7EC 3FRPA 2IDCA 4GFXA 1AXSA 4XP6H 5F7LB 5ACZA 4ZXBA 4NCC1 3O6KH 4JO4L 3M7OA 4ES9A 3CZLA 5LXGH 1SQ2N 2J4WL 4X83A 4H4NA 1KENH 3V0FA 4H40A 4XCFH 4WENB 5EA0L 4UNVA 4X4MA 5CEXA 1N8ZB 5DK2B 2HH0L 4IRSC 1M05B 3TS8A 5D1ZB 2IJ0C 2QKIA 1A6VL 2NLJB 4K3DL 3UTTE 4NQXB 4HJTA 2XFXA 4MNQD 3LPWA 4UQ2A 3CLFL 4R4ND 1IE4A 4OCSH 4TOYL 2HVKB 5TQ0L 1E5YA 1T21A 2ZXGA 1A3RL 1DUZA 4FQQA 4TM9A 4AMKH 1FGNL 1GGUA 1OXYA 2BXYA 4AVHA 3BKML 1Q9LB 5CKGA 4QEGA 1DDHB 2FGZA 3WLWC 3QQ9D 3Q9PA 3QFDB 4N0UE 1D5ZA 2HTLD 3PV7A 4R4FL 3TA3C 3F00A 3MODH 2H0JA 3LN5B 2HLFC 4APQC 3DHUA 1DJZA 4MJ6B 3GLZA 5FGBA 2XV6B 1UQSB 1U21A 2Q7YA 3GXDA 3VWKD 3DJ9A 2OSWA 1TITA 3N0PB 3QIUC 4KTGA 5FFLA 5EF1A 1CVRA 5LXVA 3BESR 4OF6A 4HIEB 1D9KA 3ZY7A 2FL5B 4QD2E 2IPKB 2GI7A 1BZ9B 2BNRE 4OFYD 5DDHB 4I3SL 4PB0H 4DP6X 1I9IL 3PGFH 3OAYH 4LSPL 4E41A 3W38A 2DYPB 3AABA 3UTTB 1RZKL 1PD1A 2EO9A 3KPMA 4L3EB 3NK4A 5EZIL 3TT3H 3GSUA 4JRYD 1TJIH 5F89A 4YXKL 4PSRA 5CU5A 3LZPA 4KZCA 4F91B 5GS0C 2DTML 4TVPH 4L9LC 3CDZA 3MCLL 5IB2A 1RUQL 1YVLA 2PXYD 3LS4H 5I1AB 4C83B 1OHQA 4N4YB 1LO4H 2H3NB 3L1GA 3LXCA 4BZ1H 4PGDB 3VI4E 1UT9A 2PNDA 2KZ1B 3L9BA 4A2LA 3GO1H 2FR4A 4NQCA 2W59A 3ML8A 1XIWA 1JDDA 1KLUB 1IBFA 4OCRH 1SLXA 4OZGA 4NBZB 4W4OC 5CN1A 5DJCA 4P5SA 3RX5A 4F1SA 2XWRA 3PGDB 3PF2A 2J8UF 2OXGB 2QR0B 5HVGB 1RP9A 4GRLC 1X6LA 3BPCA 1UXSB 1WWAX 4I0PC 2EH8H 2BNRB 3UTPD 1PLAA 1HZHH 2BNUB 5F0MB 5D8JH 2OCJA 2VOTA 1MFAH 1CIUA 1MFEL 1AGFB 3C5ZC 1NCJA 3K4ZA 4F3FA 2BSTB 2G0LA 4X7TA 2CO3A 4JANA 5AVYB 1T2JA 3MUGB 1UFUA 1X4ZA 4KKBC 4B97A 2C9VA 3IDJB 5LGYA 1MUJA 3GZOA 1YYCA 4GMSL 4M9OA 5JQIB 1WQVT 3HE6A 2OJZL 3O6FB 4EZMA 3FT1A 1X5IA 1VCBC 2ZCLL 3QDAA 1U3HC 4L2LA 4H8WH 3CZSA 3FYEB 4P59L 3SDXF 3UIZA 4F7TA 2CNYA 2D3JA 5LAXB 5IEKA 4Z8FL 3VI4B 2R56H 4MYPA 2ATKB 2V5TA 2Z92B 3M8OL 4AIXA 2JTYA 2HPOA 2XRAL 3CN2A 5C0AD 1IC1A 2Z31A 2VZ1A 4UQIM 2VMFA 1VADB 1IGTA 1HINL 4JVUA 1NGXB 4FQLL 3UZVA 2H6UA 3L95A 3F7PC 1L7TL 4P4KD 1DJWA 4N2FA 4HOXA 1VJSA 4WDIB 4YQXH 5FLUA 4HDIA 2OTWB 1UT2A 2Y25A 4QPEA 5IW1B 4ANUA 2FWUA 3CCHB 5DJXA 1HL5A 2NY0C 3MX0A 2MH4A 4Y19D 3MUJA 5DHVB 5MEQA 2XG5A 4YDVA 3RL1A 1VB9A 4LOVA 5DLLA 2BK8A 4LHUG 3ZMEA 4WW2A 4IRJB 4PJAA 5D2NE 4PGCB 3DWTA 4PJHE 2PWFA 4P5KA 3L4UA 1QZNA 2CCLA 3PRZA 1YQVL 4PBDA 5HYSG 4IBWA 2GHWB 1G87A 2NY4B 3CBKB 4W9IC 4ZMNA 5ICYB 2J55A 3DOHA 3H54A 5KW9H 1OM3L 3LQAL 2EDBA 4IBZA 4N9OB 1HNYA 1RIUH 1OP3K 4AZ8B 4ZMVA 2AANA 2H32B 2HX9A 3DSFL 2WC7A 4J7RA 5EULV 4ZUVA 3TNMA 5CKAA 4GNKB 1NWOA 5SV3A 2Z93B 2R7EA 3WFDL 2C9XA 4NP4H 1HXMB 1CDJA 2YD8A 3BVXA 1U8QA 2GSMB 1JDAA 3LRHA 5TTRA 4NQDE 3C6LC 3GMMB 3N9GH 3PDDA 5EIQA 3P73A 1V10A 2DQTL 4XBEH 1U8PB 5M94B 3ROOB 2WXJA 4J1UA 5CZKA 5D6DC 1ZHNB 4PD4J 5IW3A 4YHZL 4FFTA 5KVEL 2CDGB 1BJ8A 2FECL 4ZSOE 5ICZA 3R4DA 1YAIA 4Y2DD 4HUVA 4LPWA 3RWCB 4Z5RB 5AENA 4WFGD 3BAEL 3NH7L 3L4CA 5JQHC 1Z7JA 2A4CA 1KXHA 4ZAKD 1NEPA 4FL4C 3BZEA 3FFCE 1R3LB 1UWEL 4PJHB 1J0IA 4YZWA 4OJAA 3S35H 4R3SB 3FQRA 4LQFL 2ZUVA 4MAUL 5EDSA 3K6SB 4KOBA 3RPKA 4PJ9A 4CKQA 5AD0A 1F4YH 3FQUB 1W8NA 3P02A 5C9JB 4HPHA 4Y5VB 3S5LB 1GIGL 2ED7A 2ZG2A 3EBIA 4K4KA 4ODWA 5AOJA 4ZPTB 1F6AB 1HHIA 3VRIB 1I7RB 4YHYC 2FB4H 3I75A 1FUNA 1Q9OB 3C2AH 1QASA 4ODHL 4M1GH 4MJHA 1OOWA 1OTSD 4ZMLA 4GKOA 1NFDB 2IFFL 3GBNL 1WZ1L 1BM3H 4DNLA 5AWNH 1ACYL 3UZQB 4DAGL 1XR9B 2CBMA 4E9VA 3HHSA 3VXPB 4NRYB 4ZSOB 1S7TA 4J8RA 3WIAA 1ZS8B 1PKOA 2VITB 2AJUL 2ZOOA 4LCWA 2IO5A 5AAWA 1A21A 1OW0C 4LKXB 5FM5O 3KEDA 2LHAA 4LGRB 3FFCB 4DW2H 4AYID 5D1ZD 4XMLL 1AZRA 3CFMA 3DX0A 3ZTNH 4UV7H 1GY2A 2YO3A 4EQ3A 1W15A 2ZCHL 3ZE1E 3FT4B 4YS4A 1BA9A 3LZFH 2WKOF 4FG6D 3QI9A 4P5TA 2XQBH 5TE6H 1OE1A 2BXZA 2W65B 4JUTA 4GQRA 5GPRA 1NEUA 4AMWA 5L4JA 4M8QB 4Z9KB 3VXNA 4WW1B 2AJVH 2E3VA 4OLWH 1EQWA 3TCTA 2VC2H 1RZJH 2GBUA 3LZNA 4P2RA 2Q8AH 5DRWA 5AB9A 4J5VA 3CVHA 3QXTA 4HLJA 3VFNA 3ETSA 4LSUL 1X7QA 5AKRA 3S5YA 4MB4A 4H0IA 2E75C 1UA7A 3F5WA 2IALA 4MKMA 4RBPH 1AQKH 3ESNA 2XN9E 1OCWL 1Y6NR 5DA0B 3EFDH 5J9PB 3ZKND 2RTTA 5TDOB 1RZ8A 3FHEA 5E8DL 4BSVB 2GUOA 4YPJA 5I24A 4F20A 1UA6L 4AM0A 1INEH 2IBZX 4I18A 2XBZA 4PJFF 3EOAA 4I9XA 5GJTL 1A22B 4H20L 4HWZA 1F11B 4HOWA 4XMTA 5LGHL 5EG6C 3G5XB 1DANT 1I1AC 1OGAE 2JNZA 2C9PA 4L23A 1EBPA 1SDDB 4YNYA 2DYPD 3UTTD 3BFWA 2MTAA 4L0ZA 1Y6MR 2H1PL 1H8LA 1F5WA 2APVA 3QHFH 3ZE1B 3OBAA 1JGEB 4JAMB 5EORH 5FECB 1IX2A 1KYOK 3GSWA 4BD4A 5I6LA 3Q2VA 1I8LC 3ZYIA 1JCVA 1A25A 4JHZA 4NO3A 2IXQA 2O30A 3HAEA 5HDLA 3NK3A 3SBRA 2B4CL 5FHAL 3WCYA 3HMWL 3JWDC 5CJOH 1YMHB 6PAZA 1XGTA 2VSDA 3W5MA 3AWGA 4YMPA 3WFBH 2XVKA 3IWUA 3CHSA 3DDFA 1IGYB 2HPTA 3QZLA 5CIPB 1OT1A 4RFOL 3V0IA 4MLIA 3G6DH 2OJEA 2K7QA 2XN9B 4N90E 1I3GH 3ASWA 1QSZA 1YEKH 4Y4KA 4DZBB 1IU1A 1E65A 4YLQT 1YC8A 1EEZA 4PWIA 3PAVA 1WFNA 5GRVL 4ZX6A 2Y2YA 3KEHA 2P42B 3H6AA 5L2KE 2BNRD 1CXKA 5TDNB 3FQ2A 5HHQA 5I8EB 2CR6A 2KLRA 4RIRA 5TK2A 3TONA 2F53A 3N91A 4AUYA 5FUCE 1UB6B 4W9CC 4KKZA 1L9NA 4JK0D 3RZCA 2ZUYA 1JWUB 2VDPB 2JKTM 1GA2A 2ZXWB 4YHPA 5AVVB 5FYKE 2GTWA 2CHZA 3HPJB 3IMBA 3GMNA 1U8OB 3O9WA 3GI9H 4HKZB 1D6EA 2PR4H 3O6FD 4O9HH 4U1MB 1M6UA 1W72H 4UAOC 4LSVL 5DMGD 4X0KB 4S1RH 3LQZB 4RAVB 2DWSA 2BH0A 3OX8B 3FQXA 4Q6KA 1RP8A 3BRGC 5KVDE 1PW3A 3RVUC 2HLEB 5J1AB 4MGXA 4CJ1A 4HHGA 3KPSE 1MIEH 2NY5C 2AGJL 2C7UB 2VQTA 3QEQE 3QARA 2KQMA 3HZ3A 3QPXH 4B9PA 1CB4A 4FNLL 4WHTB 4Y5YC 2X3BA 2YA0A 5CJ5A 4JDZB 5L2KB 5IBTL 1FVDA 3VQLA 3KVQA 1I31A 3PAUA 1M7DB 1ZVYA 5E70A 1CFSA 1L9OA 1TMCB 1SM3L 4XC3H 2NYKA 4IRJD 5J11B 2XU9A 3SE6A 1NAMB 3MACH 3RNKB 2E27L 4B53A 3PCYA 4Q9RL 2Y23A 3AQYA 4HG4J 4M3HA 2NY4D 1QSEA 1ZAGA 4PS4L 5ELIA 3HNTL 3G5VA 2YK1H 5L0QB 3RL2B 4PJEE 3BW9A 1XF5A 1W0VA 1E27A 5AVTB 3R8BB 15C8L 1YNKH 1JMXA 3BUDA 1RPQA 1EZVX 3FZUC 2ADIB 5IBUB 1CGTA 1MF2H 2OMXA 2WQVA 1WBXA 1IB5A 4ISVB 1GC1H 2XWJB 3C60B 4XP9H 5AZEL 3NIGE 1IEBB 1MELA 4OGAC 3CFNA 4K3EH 4PFEA 4AQ1C 3KPSB 4A7SA 2YGNA 1A7QH 4KUCF 2BRQA 3OSVA 3QEQB 1QD0A 1P4IH 2O6FA 3EYFB 3NIFF 1MVYA 3F64A 4F1ZA 1CBVH 5E9AA 1DJGA 5FEBA 1DN0A 4U1KB 1H3UA 1EHAA 3QZNA 1JTPA 3OXRA 5IESH 5EZJA 3WSQH 3NJIA 2PYFB 1NJ9B 1WITA 4DVRL 2H6PB 3BQUC 3PDOA 5KS9F 4Y1AE 3D2UB 4NUJB 1DR9A 3MTXA 1T2QL 1RHFA 3SDYH 4UZGA 1T83C 2WXQA 4PJEB 1NIBA 1X9RA 4A6YH 1IBDA 4PLNC 4PRNB 4KY1H 1PKQB 1EHNA 2CKBL 1BBDH 4Z0XA 4OD1L 5HI4C 3SDCA 1ZSDB 3DPDA 4OU3A 1MG2C 1BIHA 1JWMA 1S7RB 1GS7A 3HS0A 3BWZA 2O5NA 2ZX7A 1XVSA 1H3VA 4NQDD 3DRTA 1SQMA 3CHQA 1MI5E 3U1QA 1NMBH 2W95A 5ABAA 4H2AA 5LBSH 1TXKA 1UOWA 3GHEL 5C0GA 3MXWH 4AL8C 1DL7L 4DQAA 5IB5A 1DVUA 1Q0YH 2VL4A 3JVGA 1XGPA 3U6XA 2PO6C 4C4KO 3LXAA 2DJSA 4NAJA 4U31A 2DF3A 3SKUD 3MAWA 3FFCD 4TNEA 1QWHA 3WIIL 1E90A 4ONFH 4M3JA 2EDOA 2GUYA 4Y1AB 3DETD 3EJZD 2FUQA 5F72S 3AT9A 4PB9L 1GKOA 4N0CD 1AG6A 3GS0A 25C8L 3UP6A 3QRBA 1C16A 4G7VL 2IAMC 1LTXA 1I8MB 3PWPA 1DQQA 2P45B 2X3CA 4Y9GA 3MFFA 3GPEA 1UM4L 5INDB 5MI0C 2MPAH 1J8KA 1LO5A 1I1FB 5I19H 1EGJL 4EEEA 2G2NA 2N0MA 4PJXF 3CZGA 1C7SA 5E2VH 2CUHA 1D2PA 1BGXL 4X6CA 1YYLH 5F7KC 4NDMB 1YMMA 3CE1A 4JG1L 1T5WB 1HHGB 1NGYA 2FX9H 3F58L 4GI6A 1L7IL 3S4SA 2WN3A 2BSSA 1A9EB 2ZUUA 2QEJA 3GM0A 3O2VL 2CJTA 3CLEH 5E5RB 5ESAB 3NN8A 2GY7B 3ARVA 4PEEA 4L8CB 4XMKL 5BJTA 4YDIL 3ZIYA 3DC0A 4XP1H 3FO9A 3MLPA 1S3RA 2NPLX 5KSAC 2F19H 2HN7A 3BPOB 3F12B 5A2KH 3PXHA 4R0LA 1PL3A 2X4RA 3VXME 4CMHB 4XX1E 1FV1A 4ANXA 1FO0H 1JHKL 4IEFA 1G9HA 3L2LA 5EU5A 1UADC 2KC0A 4UIKH 4HBCH 3CHOA 1TNMA 1AGBA 1IT9L 2ICEA 2NQDA 3NJFA 5IWLA 1N3NB 2ORBL 3IMRA 3ZDYE 1QWUA 4X7SL 5AW3B 2X9XA 1KN2H 3FU0A 3K7UA 4EUPG 2ZKYA 4K5OA 1J0JA 3QIBD 5AAPA 3ILDA 5I15H 2DWEB 1KT2A 1QFPA 2R0KH 2XETA 2XN9D 3KD4A 1YEEL 1N0XL 1OGTB 4YBQC 5BZWA 3RVWD 1KEML 4R5XA 4KKAD 5JORA 3NCBB 3VSTA 3W0WA 2VM9A 4QOKD 4OY9A 1BBJA 3HS8A 4OLUH 1U4FA 1OGAD 1G7MA 3FULA 5E8PA 1DEEA 5CMAB 5CEZE 4H26A 3VXMB 2AJ3B 2VDPL 1PF3A 2LU4A 2YRPA 5ABDE 3PWLB 4G6AC 4CL7A 1FAIL 3KPOA 3MLVH 4PJDF 3SE8H 2WVUA 4A7TA 3JWNH 1OWRM 2EDEA 2OAAA 4UILH 3V4PB 5BXFA 4UOZA 5TD4A 3AITA 4ZXBB 1LM8V 1RFDH 3QXDA 1HEZA 3GUTB 5DUMH 1CS6A 1NMAL 3ZDYB 4JFDA 3VFUB 3HZMB 4WTZG 5IG7A 5B21A 4YUEH 5GRJH 3IDGA 3PP4L 2NZ9D 4F57H 3SZKC 3QWOB 1FI8C 1MDTA 4NO0B 4KJWD 3BRDA 3AXLA 4P9MH 4N90D 2GJ6A 1XF4A 4E41E 2QKIB 1UVQA 2UY7A 2WLIB 4FLRA 1MJJA 5DHMC 5E23A 3LEVH 1SEQH 2YC1B 4JFWA 3KWTA 3WAJA 2XFXB 4OD3H 3QUYA 4IJTA 5L2KD 1FLRL 1CLOH 4KTDH 3S36L 1CI3M 3CDGB 3K2UH 3UG3A 3H3PH 5KBMA 5J8OA 3UDWA 2KT6A 2FGWH 3BXNA 4IDJL 4IHBA 3SGDH 1T21B 3EGXB 2P80A 4WZ9A 3SIKA 3WXVH 1DUZB 1RPKA 5HGHA 4BFBD 4WWOA 1KGWA 2NY1C 2ZOTA 4ZTOH 4AYFB 5FYKD 4NQCE 3SO5A 2BJMH 2F0CA 2GJRA 5FYKL 4DT2A 1VSCA 4OZGE 3UOAB 2MHAA 1KWKA 5FR3A 1BF2A 4RFEA 3HI5L 2NR6D 3WIFA 5I1DA 2PN5A 3GI8H 1D9KB 1HH9A 2WZ5A 5KVDL 3DLQR 1AACA 4FYRA 3KXFA 1NDTA 3NCMA 2ZP9A 3KPSD 4K71B 4OZFG 1QQDA 3D4ZA 2B39A 4WAFA 3QEQD 2RQEA 1RZ7L 5KJRL 2WLZA 3P77A 4M3KB 2DMBA 2AFNA 3QCVH 5DUPH 1PLBA 4JN1L 1E43A 1IC5L 4HPOL 3RURA 4UMSA 2JMRA 3UZEC 1CCZA 4XVJH 4NJ9H 4LPUA 1IGIH 5IB2B 3UYOD 3E2HB 1BQLL 5F3HB 1CD1B 3GXMA 4UQAA 4J2QA 2FLRT 1Q1JL 2R4RH 1T0NA 4NFCA 2K4WA 4PJCF 4FMKA 2L7UA 3DX6A 4OQTL 4UT9H 1AQDA 2JJUA 3VD1A 4RGNE 3MCKA 4XAKE 1VFAA 4MCYA 1CN4A 3BWAB 4NIKB 4MX7A 4NQCB 3SE4A 4GMTH 3JTSB 1KJ2A 4JGUA 2C1OB 4OZGB 1PNCA 4DN4L 4P23C 3HMXH 2FEDD 4KJPD 3HKZA 3RU8H 1W8OA 4LBAA 5ACMA 3X14A 4N0YL 5AW1B 2XX1A 3QXUA 2IBGA 3V7AE 4R7VA 1YY8B 3EYSL 3VW3H 1G7HB 1MNUL 4U2YA 1ITBB 3RWIA 3PFQA 2VXSH 2K4AA 4A55A 4APXB 4ZW6A 4E5XA 3EYQD 1LEIA 4H88L 4QKTA 3SYOA 2QFPA 4YL4A 1RLBA 2EKJA 3B5TA 1TQCB 3MV11 4HFWA 4IIQC 3K6OA 5E08L 2FWOB 4BQ6A 1PZ5A 3NA9H 1QVOB 4MCZA 4Q6IC 4Y1AD 2ZF8A 1O7DE 4JHAH 2CLZB 1JF6A 2LLGA 4I8DA 1KEGL 1LEGB 3Q5TA 3MRCB 4FQHB 1TCMA 4RGNB 4Y4HC 5DTFA 4FQIL 1JNNL 4J6RH 3AROA 4KGLA 4FLHA 5JIKA 5KVGE 1GAFH 3P9LB 4Y16A 4JM4H 4LARL 3RX9A 4QJ4B 4ZFOL 1M3IA 1QI3A 2HT4D 2VABB 2HCZX 4F5CA 5EOQL 4U1IA 5GGSB 3OHXC 4PGEB 2YSSA 4PJGF 2XG5B 2X4OA 3V8CA 4RMUA 4XVUC 1FNEA 3OXSA 3QEGL 5AEAA 4B9IA 5F3FA 3QORD 1MI5D 4UM8A 3DECA 4HX1B 5F7EH 3KPLB 3DUUB 1RZPA 3AG3B 5ES4B 3MV7E 1SXCA 3BSZL 3VCLB 3IMVA 3G04B 2N1KA 1MWAA 1EO8L 5D7IE 2CO6B 4PLJD 2WUBH 5DS2A 4JGNA 4X5PA 3FC8A 5T1LB 2C5DC 4MQTB 2VLKA 1CFVL 3ZQWA 5CEYB 4NB7A 4ZUVB 3NEXA 1D7CA 2WY3B 3T0EC 2NXYC 2FHBA 5AW5B 3PAYA 3MLTB 3M45A 2Z65C 3QDJE 5LQBL 4OCLC 5ID0A 1JVOA 3JQOB 4N8VG 5KYWA 1OGPA 1U8QB 5DEZA 3UGXA 3QEUA 4XXDB 4Z7VA 1ZHKA 3ARPA 4XWGL 3BVNA 2ZT9C 4GQPH 3SPCA 2WQRA 4XP6L 4GQ9L 1R3HB 3T09A 2XTJB 1TYRA 3IAGC 4BH8A 4JS7A 4YPGA 1B0GA 3NP4A 2JB5H 5LXGL 5AW4B 3Q05A 1KENL 4XCFL 2AC0A 4WEUD 1RK1B 2E4FA 3INOA 4G6FB 2Z64C 1U3NA 2DQFA 3MJ9H 4TV3A 3MV7B 1CDBA 3VE0A 1CDUA 4J3SA 4G7SB 4OD2B 4DP4X 1SXSA 5AD0B 5D7IB 3HJ0A 3V4VH 3D87B 4JDEB 4XNZB 5F97E 1A8ZA 1CGVA 1NTDA 4AGNA 2EVJA 4EN3C 4HAKA 1OSPH 4YDJB 3TBSA 4OV5B 4JY6B 4OCSL 5FA4A 4OCNC 1CG9B 4L4TA 5INCB 3VXMD 4PLKD 4P2RE 1WG3A 4AMKL 2VC2B 3QDJB 4J4PC 3OKNB 5GGVY 2XUWA 2Z9TA 1CVSC 1KFGA 3CZKA 3N1QC 4PP2A 3RGVC 3G3LA 2A83B 2B0SH 4DKFH 3FQWB 4ZXBD 1U58B 3MODL 4X6EB 3V4PL 4W70A 1HZLA 1FE8H 1EZUA 5DR5H 2ODHA 4UYPA 2LLNA 2AKRB 4J8RB 1V7NH 2HB0A 4UNIA 4ZUUB 2V3DA 1X4XA 2VMDA 1ZGLM 2BP8A 4QLRA 1A4CA 2X10A 4NO0D 3AB0B 4LF3A 3MUUA 3SD2A 3VM5A 3MRRB 2X40A 4EZLA 1MCCA 5GRWA 4PH8A 3KLKA 4UM9A 1JK9A 2BOBB 3TT3L 4AIOA 1TJIL 3I02A 3NEEA 5LWYH 3FCGA 3BUTA 3UPAA 2D0HA 2KUTA 4TVPL 4XR8C 5I1GH 1CICA 5CEZD 2K3TA 5D5MF 4ODXB 3KGSA 1TCRA 4W9HC 2OR8A 1HEHC 4BZ1L 2NY3C 1PG7W 4A04A 1U2YA 3K5RA 1NM9A 2WWMD 2UXVA 1JHTA 3GO1L 1IEAA 1TVBA 3I6GA 3U83A 4OCRL 2GKIA 3BLBA 1K2DB 4KI5E 3EDFA 1DLHA 1D9KD 1NGZA 2NDFA 1KIQB 2X2YA 3NSYA 4WUUE 3NZ8B 5IR1B 1RL1A 3ZKMC 2Z4QA 1YLBB 1U3JA 2F53E 4HWZB 2EH8L 5FHBH 2K8QA 4S1DC 3UAEA 3QUXB 4E41D 1HZHL 5ESVA 4BK4A 3F7YB 2AJZA 5D8JL 3WS3B 2H2SD 1MFAL 1V3LA 3IJSA 4WWKB 3QDHA 3T3PB 1U8CB 1HCZA 1T4KA 4RZCB 4Z77B 4WV1C 3D39A 1A4KA 1B9KA 4ZQKA 2EDLA 2V6HA 4NKIH 2VUOA 3OAZH 5L8LB 3O41A 1AXTH 3QZOA 1OZTG 3KH4A 5TK4A 3LTVA 3U36B 1Y18A 3K6IA 4H8WL 3RTQB 1OE2A 3GTVA 4TNFA 5A2AA 3D4YA 3QUMH 1XGTB 2W8CA 4NQCD 1XIWD 5E2UH 4HWBH 1AS8A 1B4JH 2H2PD 2R56L 4F2EA 3FQ4A 1JFQH 1IARB 2R1WA 4FHBD 4F2FA 4GAYB 4JZJA 5DD0H 5SX5K 5IW6A 5AL0A 5D4IA 4O51A 5A2JH 4XVTH 4HCIA 4IGBA 4XNMB 5GZOC 1I7UA 3ROLB 2VDMH 3LKNB 3RWDA 4YQXL 2AV1B 2EQDA 1TEGA 3DMMA 3FB8A 4A7GF 3JTTA 5IB4A 4WUUB 4DPRA 1A1NA 1GMIA 4GW4B 3MBEA 1YNTF 4Y1TA 2WD0A 4WJ5A 5IKCA 2IGLA 4FXGC 3RZCB 2YA1A 3II3A 3WY4A 1R5IA 1QSEE 2KS0A 2X1WL 2GTWB 1JNHA 1OTUC 2EKSB 4U3HA 5I1EH 5MEOA 4P5MA 1E3XA 1F45A 1GZPA 1U36A 2W9EH 5KW9L 2G9HB 1JTOA 5EO1B 1RIUL 2HT2D 4KKCD 2Y5QA 1PX3A 2C3VA 4RGND 4XAKD 4MNGA 3UBXG 4O2CB 1T1ZA 2Z31D 1VACA 1S5HB 4NP4L 4YE4H 5DJAB 1X5AA 2ZUQC 4F24A 3RNQA 1H15B 2UZYA 4B50A 3GHPA 3N9GL 4H13C 2P5WA 4XBEL 3CFKA 2APXA 2R2CA 2XN0A 4U1HB 1P5VB 1PIFA 5D7HA 1QOKA 2W1NA 3VH8B 5SX4I 3VFPA 4AV0A 1TMQA 3BH9A 1ZT1B 4KMTL 4E9LA 1N7MH 2A74C 1XX9C 3G5VB 1JWSA 2YS4A 3L7EB 5F7FA 3W11C 3ULUH 2J7LA 1ACXA 1EXUB 2BCKB 3QWQB 3QXVA 5IVZA 5B1JA 5T1LD 1GS8A 5K59F 4NYLA 4IHOB 4IMKA 2UZXA 1CFQB 1F4YL 2PPAA 3JZYA 2O26U 5FKPA 3UCQA 1JK8A 1SJHB 2V2WA 2PWDA 3GZPA 3ECQA 4TUKH 3WO4B 3OMNB 4F9LA 3IXTB 1QR1A 4H1LA 4HEME 1YPZE 4QHPA 2ADJA 2FB4L 2EO7A 2WK2A 1HAUA 1IAIM 2M26A 3C2AL 4NRZA 4OSUH 1RZKC 4M1GL 2Y7OA 4W9KC 2EECA 1FN4A 3LPFA 3FCSA 3UROR 3V0GA 5CCHE 2EE9A 3E80A 3L1OH 3Q8BA 2C4XA 3OKOA 2TRHA 3PPSA 4GW5A 1BM3L 5AWNL 2J21A 3HI1A 3TBWA 2OP4H 2GY5A 4KTYA 1FHNA 4XNUH 5EZJB 4A7UA 4G6FD 1MCLA 3CN3A 3RFZB 3BUQA 2WPGA 3MV7D 4XN9A 2AQ2A 4LLMA 4DW2L 3FU7B 4PP1C 3ZTNL 5DHDA 4CVUA 4B9GA 1TJXA 2BP0B 5IHUH 1MFMA 1MAML 2KKQA 1ZA6A 3F6JA 5CD5D 5KN5B 3PWPE 4M1CC 4J3BA 2X1OA 5KYNA 2PF6A 3LZFL 4D9RE 1MHPL 2XQBL 1M7IA 4LCVA 4L37B 4QLWA 3JTBA 2Y7LA 1YQ2A 4AQ8A 4YSAA 3QR2A 3FTGB 3T2LA 1CI5A 4MVBD 1PJ9A 5K9OB 2VWEC 1A6ZA 1YPZB 3L9EA 1FP5A 1ZVNA 3QDJD 4PCTA 1TEFA 2WQ8A 3VTMA 1IJ9A 2AJVL 2OXHB 1FGVL 4NC0B 3QZMA 4OLWL 5EC1A 1T04A 1RZJL 1AMYA 2VC2L 3C6EA 4QXGH 4XCYA 2VXQH 2Q8AL 1JJUA 4A7QA 4I88A 3H9YA 4JFQB 4AJYV 2X0VA 3OWRA 4PWHA 3MGOA 5C0GB 3CFEA 3OQ3B 3EYVA 1AQKL 2WOBA 2A6JA 3EFDL 3UJTH 1I1YB 3JBG7 4YDMA 3DX7B 4BHUA 3K2KA 4KY2A 1P7HL 1ZLUK 4DSYA 5FW8A 1INEL 3KCPB 4JJOA 2YLKA 3MRMB 4GO6B 2QLYA 3VDBA 4NHCH 3JV0A 1IGFH 3QI9D 3MBWB 1MHEA 3I6KB 1KIRB 1UJ3C 3PWPB 3A5VA 3JWNE 2LE9A 1A1MB 1DQQB 3QHFL 5J13C 5EORL 1U91A 3NFNA 5D4HA 4JFPB 1D5RA 2GCYA 1C5BH 3C9NA 2WNWA 5I73C 1KY7A 4OB5H 4YDLC 5F7AA 2XWEA 4P2RD 5ENWA 3L7FA 4OJCA 1JUFB 1NLBH 5CJOL 4OF3A 5L2JA 1UZ6F 3WFBL 3UPCA 2ZKHH 3QQ3A 2ZXAA 3MJWA 2BSSB 2KHAA 3UTSE 1ND0A 1CDIA 4JREB 3IKCB 3WL9A 2YKKA 3G6DL 1NKOA 2V8LA 1YEKL 2BP3A 4BM7A 2V2TB 4JBSA 1KJ3L 1L5GB 3W0WE 3TCLA 5F6IC 1K8DB 1A6WH 1HWGB 4N3TA 3FB7B 1AHWC 3I85A 2HN7B 3QUXD 3GDBA 4L9DA 3DGGA 5I18L 2XG4A 2Y6SD 3MRIB 4YHNA 3DXAA 3W1ZA 3JV6A 5EU7E 3US0A 2GBVA 3NRFA 4MDRA 3O3AA 4NENA 2UZIH 2AF2A 1Z3RA 5EU5B 3W9DB 4KZ0A 1MG3C 3DOSA 4O9HL 3GI9L 1UZGA 4MDJA 2PR4L 3DX9B 4FTVA 1W72L 2Z8WC 3X1NA 3WFZA 5JPNB 3RVTC 1AE6H 3OAWA 5H35B 3M7FB 4S1RL 4P2QA 3RTQD 1F3JA 4ODVH 4GKSB 3ZTJH 1YN7B 3B1UA 1M6OA 4FC3E 1LEKA 1WBZA 4M43H 4PTTA 3WNOA 5D93B 1CL7H 1H8NA 2AXGA 4R2GB 4ERSH 1SBSH 3SOTA 3B9KA 4M62H 3U6XS 3UYRL 1QFUH 1H8SA 2GJ6E 3EH1A 3UTSB 4Y4KD 4HIPA 4KI5D 1E5CA 3EJYD 2P1YA 1MIEL 4RMBA 1UZ8B 1Z9LA 2LVEA 1CBJA 2B20A 5I74B 1ETJA 5BZWB 1XSOA 3QPXL 1RJYB 2RJMA 4WUUD 3LKQA 2K9UA 3KGRA 4GBXA 2EXWD 2F53D 3BDXA 4NHUB 5I71B 1LE5A 4C47A 3SY6A 3MRHA 3RZCD 1G7MB 5EHFA 5E8PB 3L16A 4XC3L 4F15B 1AZUA 1VLXA 4H26B 1KXVA 2V7NA 3CTTA 4R97C 1Q94B 4PJ7F 3KPOB 3O9WD 3QIUA 1OF2A 3CXDL 4ZS7L 2YK1L 3KR3H 5BXFB 3BGFB 3EYOA 1YNKL 4W9GC 1MLBB 3EFOB 1MF2L 4OBSA 5IG7B 1KF9B 4JKLA 3WJJC 4DQOH 3EXLA 2EIZA 3L54A 3N85H 3TJHC 3IPEA 3QQDA 4ZK8A 1LK2A 1GC1L 2HJKB 4WI2A 3KXFE 4LGSB 2JKLA 1A14H 3T04D 5CSBA 1BIIA 4FJYA 1GJWA 4GIOA 4DK3A 2EDKA 3FOMB 2Y07H 5I6KA 3ISWA 4IK6A 4K3EL 3RI5F 2GJ6B 2VN7A 2Q5BA 1KTRL 3VYPA 4M5TA 1A7QL 2QGCA 4WI5A 5ISZA 1P4IL 3BP4A 3K4DA 3HG0A 4YDNA 1CBVL 4MDIA 2WSKA 5I1HH 4G43B 1PDKB 3WEAA 3ARSA 1I75A 3DTDA 5FM4A 5HGHB 1U92A 5IESL 4I89A 3WSQL 4QJ3B 4HH8A 3MYZA 3TASA 1QSED 3D08A 2RBLA 1SLUA 4XOBA 2Q3ZA 3L5WA 4ZMZA 1MRFH 3RUGF 3LHAA 2Y2WA 2ICES 3SDYL 4JFOB 4A6YL 1HU8A 3CVDA 1VZIA 4IU3B 5TF1H 5LVEA 2MHAB 3PNWA 4I0PA 4KY1L 5I76A 3EH2A 3U0WH 2SEBA 3WIFB 1F6LL 5I1DB 5AAMC 1BBDL 2W38A 1FHGA 4IRZA 4RNRA 3ULVE 3C5ZA 1WT5A 2Y06H 3SDDB 2UV3A 3L3GA 1Q9KA 3E0GA 4X0NA 4X2UA 4ZW8A 3FU8A 1O6SA 1A6UH 2H9GA 2FEEI 1R5VB 5CBEB 1NMBL 1QBLL 3BMWA 3DJZA 4U1NB 4Z95H 2QZQA 3V52H 3L3OA 4CRPA 3SQOH 5LBSL 2QV2A 1PU0A 2Z7WA 1ULVA 3MXWL 4PJFA 1Q0YL 1D5XA 4A2FA 3BD4A 4YK4C 4EBQH 3APMA 5CZVH 1GGCH 3ZXAC 5C0FA 1CU4H 3O3BA 1KTJA 5IB1A 3RI5K 1SJXA 3AY4C 1CL7I 3QAZB 3WFEH 3H6JA 4G2AA 4ONFL 4Y9CA 5DFAA 2JJTC 3D52A 1G7JA 4FKEA 3IJYB 2H45A 3OKMB 4KVCH 4MS8C 1UWXH 4NN5B 1MXGA 3TX4A 1GGYA 3FHQA 3UPRB 1VIWA 2IANA 2VJ0A 5DMKB 4ZNCD 5ANME 4WGWB 1KDJA 2XIDA 2A9MH 3D69A 3VFTB 3GB7A 4ZMQA 4WEMB 4XN7A 5HHXH 3KBPA 4YSUA 4DIXA 4ANWA 4LU5L 2MPAL 5I19L 5BRZB 3AM8C 1Z32X 5E2VL 4ODSH 2F5BH 2ZYIA 2ENJA 1WFJA 2MNJB 2N7SA 5DVOA 1YYLL 4KKNA 4HUKB 1L3NA 2XBTA 4DPAX 5JXAH 2ERJB 2FX9L 4IS6A 4V11A 3T0BA 4ELKB 3F7LA 3ME0B 1TYJA 4XZUA 1TVHA 1OANA 3CLEL 4HFWB 4X42A 3BP5B 1ZEAH 5I1KL 2CDEA 2PCYA 4JDVB 4AOFA 1EHKB 1VZGA 3SKMA 3W56A 1U2HA 1FNSH 1E4KC 2VLKE 2YZ8A 3T4YB 3WEXB 1HQRB 4XP1L 4ZTEA 2UZPA 2F19L 3ZT6A 4B0MM 2MOGA 1LLAA 2WVVA 1E8ZA 3DPBB 1U8IB 2CIIA 3PWPD 5ERWA 1C12A 5L7XH 1FO0L 1MCDA 2JKNA 3HE7C 4D9RD 2A0LC 5ANMB 4Q0XH 3GC3A 3IGAA 4UIKL 1CFMA 2V37A 4E2OA 4HBCL 1IAOB 2OR7A 4M5YH 2Y36H 5DURD 3EOBA 1PZ2A 2QKSA 1XSJA 4P46B 4U1JA 3BEWA 3QUHA 3RDTC 4NQSB