4KNTA

Copper nitrite reductase from nitrosomonas europaea ph 8.5
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
285
Chain Sequence
KTVQVTLHAVETDVAYDNKGSTYRAWTFDGKVPGPVVRVTEGDTVEFTLINDKNSKNSHSMDFHAARLDVVEDFESIKPGETKKYTFTADNPGVFFYHCGSDPMIQHIARGMYGVIIVDPKDANALPKADREYVLIQAEHYENPDDKTAMMQNKWSNVVFNGGVFKYDPVHDSEATSWLQAKPGERVRIYFVNAGPNELSSLHPIAGIWDRVYPSGNPKNVQYALQSYLIGAGDAATLDLISPVEGANAIVDHSMRHAHSGAIAVIMFTNDADPEAGRGENILIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multicopper oxidase type 1
publication title Characterization of a nitrite reductase involved in nitrifier denitrification.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 89
structure length 285
sequence length 285
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kntA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kntA01
1A4CA 2UX6A 4Q8BA 4YSSA 2IH9A 1L9OA 5I5JA 2TSBA 2FT6A 2FQGA 3ZBMA 5LDUA 4KOBA 6PAZA 2FQDA 4DP4X 2BP0A 1A3ZA 1VLXA 3FSWA 5I5MA 3D12B 3CZUB 1JXGA 3AZUA 2VN3A 2BW4A 4KOCA 3FSZA 2J5WA 2YAEA 3BVDB 2HX8A 4E9YA 2MTAA 3OMAB 1OE1A 3WKQA 3EH3B 1ZDSA 3FPXA 1N68A 3KW8A 1KDIA 2PPCA 2XU9A 5I28A 3DKHA 1ET5A 3NP3A 1ID2A 3FYIB 4HALA 1W6LA 1I53A 1PY0A 3T6ZA 1BQ5A 1KBWA 1PMYA 3NT0A 1JZIA 2BP8A 3N2JA 3FPYA 4QLWA 1TKWA 1JVOA 2IDSA 2GHZA 3BQVA 2VM3A 5PCYA 1OE3A 2BW5A 2DV6A 3ASOB 2CAKA 2J56A 1AS6A 2QPDB 3GXUB 1AAJA 1E67A 4DPBX 1FFTB 1OCOB 2ZXWB 2NRDA 4K9JA 3CVDA 1CUOA 3EHBB 5AKRA 1J5CA 3T6VA 9PCYA 2VSKB 4Q89A 2H3XC 4HHWA 1PCSA 1BXUA 4ZK8A 5D4IA 4W1TA 3H4HA 1SF3A 3TU6A 1TEGA 2DWTA 1URIA 1QLEB 1W6WA 1SFDA 4CSPA 3NP4A 2HLEB 1NIBA 4FA7B 4KNUA 3X1FA 5B1AB 5F7AA 1J5DA 3H56A 2VW4A 4GXFA 5EHFA 4A67A 3NJNA 3SQRA 4AKPA 2R7EB 3NJIA 8PAZA 2I7SA 1MG2C 4HCIA 1CC3A 1KGYE 4UANA 1GYCA 1WAEA 1JVLA 5D4HA 2UX7A 5B7FA 3FSAA 4DP7X 2YAOA 1JERA 3WKPA 1YLBB 4A2GA 4E9SA 2H5UA 3HB3B 1BAWA 2XUWA 2XWZA 5B1KA 3MBWB 3SBPA 2X87A 1NIDA 3RYMA 4A2FA 4AX3A 2DYSB 2BP0B 5PAZA 2IDUA 2YAMA 7PAZA 5TK2A 4DP5X 2Q9OA 1HAWA 2YQBA 2GIMA 2HZHA 2QDVA 3WIAA 4F2FA 3FYEB 1M9WA 4TXVB 4GYBA 1DYZA 5FC9A 2AZAA 3OM3B 1AACA 2DYRB 1X9UA 1UATA 4HCFA 4QKTA 3FU7A 2MRYA 1JXFA 4YVNA 2W88A 2E86A 4YVUA 2QDWA 3TA4D 1OE2A 1M56B 1ASQA 4RH4A 2XX0A 4AZUA 3WG7B 2W8CA 3AG1B 3NJJA 2YAFA 2XYBA 3UAEA 3JT2A 2BP8B 2ZONA 2FJSA 2WO2B 2FWLB 2Y1AA 1JZEA 1SDDA 4WKXA 3T71A 3X2QB 2PPDA 1TU2A 5I6NA 1RCYA 1X9RA 4KNSA 5D4JA 1ADWA 1NIFA 5I6OA 3X1EA 1GY1A 2GC4C 2CUAA 3S3CB 1AS7A 3TBBA 1E5ZA 2FTAA 3U25A 2PP7A 2XX1A 2HX7A 1JZHA 1JZFA 3IBOA 5TK4A 4PCYA 4E9XA 3MX0B 2XV2A 4BWWA 1AG6A 1GS8A 2UXFA 3V9EA 4NAJA 4ENZA 1V54B 3FSVA 1PF3A 1XB8A 1OCCB 2A3TA 1PZBA 4YSUA 1PNCA 5I6KA 2XV3A 2P80D 5AFAA 4JKNA 4W9ZA 5E9NA 2IH8A 2UXVA 1MG3C 3AG4B 2FNWA 1KBVA 1IUZA 3IEAA 2BWIA 2HRHA 1ASPA 3N55A 2JKWA 1E65A 4BXVA 1AANA 2AVFA 1HAUA 4UAHA 4BXSV 3OMIB 2BO0A 4DP6X 5I6MA 2UXTA 2GB2A 2AZUA 1ET7A 1KDJA 2BZCA 4G7QB 2PPAA 3ZX1A 4X4KA 1CYXA 3X1GA 1IBYA 4E9WA 1J9RA 1AG0A 1NICA 2PCFA 2PCYA 3NSCA 4UF7C 1ZIAA 3UAAA 3AY2A 3PAUA 4A2EA 1ILUA 2XV0A 3GDCA 3PAVA 2X88A 4G70B 2PLTA 1OV8A 1GS7A 2GBAA 2VM4A 1XMEB 4GP5B 3L45A 1EHKB 3PXLA 5B1BB 5B7EA 3HEIB 4BDVA 3ERXA 4YL4A 3AG2B 1AQ8A 2GSMB 2WSDA 2EIJB 3CVCA 1F56A 3FU7B 2GI0A 3IN0A 2AANA 2PPFA 1GR7A 4A2DA 3EH5B 3NSYA 3KW7A 3JTBA 2Q5BA 1M57B 1ETJA 1RKRA 2IWFA 5A7EA 3WNJA 2LLNA 3G5WA 1PZAA 4P5RA 1SDDB 2J55A 3AW5A 1ASOA 4NERA 5I6LA 1V10A 1BQKA 3NJHA 1WA2X 4GP8B 3ABKB 2IDFA 3IE9A 1SHXA 4A68A 4AI7A 1OOWA 1J9QA 3NJKA 3NSDA 2DWSA 1KV7A 2BWDA 1MZYA 3T6WA 4KNTA 4BWUA 3PLYA 2IWEA 4GY4A 4F7KA 3IN2A 4E9VA 2HRGA 3V9CA 7PCYA 3CVBA 2RACA 3DTUB 1T5KA 1PLCA 4N8UA 2IDQA 1MZZA 2ZWNA 3OD3A 3QJQB 4E9TA 2N0MA 2ZOOA 1WS7A 1J9SA 2CBPA 4JHVA 2GC7C 1OCZB 4L0PB 2YARA 3S3BB 4A66A 1ZDQA 4KO9A 3SBQA 2Y69B 4FAAB 2H47C 1L9PA 4YSQA 2I7OA 1JZJA 1L9SA 4E9RA 3ZIYA 1ZPUA 1B3IA 2YXWA 2TSAA 4YSRA 1BXVA 1GY2A 1RZPA 3NJMA 1MDAA 2IWKA 1NIEA 1OCRB 4PAZA 2PPEA 3EF4A 4BK5C 2AFNA 5F7BA 2DY2A 1AR1B 3CDZA 3EH4B 3QJRB 2OCCB 2PP9A 1KCWA 1OF0A 1AZCA 1E30A 4YSAA 1L9RA 3UADA 1NTDA 3ASNB 3WNIA 2J57A 2YAHA 1ET8A 4DPAX 2IDTA 1QNIA 2XXFA 3QQXA 2HXAA 1L9QA 1AZRA 4DP0X 1JZGA 1ZV2A 1BXAA 2CALA 1IKOP 3NJFA 5ANHA 4AKOA 2BZ7A 4BDVB 3FU8A 5I5IA 3PPSA 3X1BA 1NDTA 4G7RB 3NJLA 1HFUA 2CCWA 1SFHA 1WA1X 4CSZA 5I26A 2PP8A 4KO7A 2BHFA 3QPKA 4N4YB 2QPEB 1JXDA 2FQFA 1PLBA 4HCGA 3QJTB 1TEFA 1A4BA 2FT7A 2YAPA 5B1JA 1GW0A 3FS9A 2HX9A 1FA4A 4MFHA 4YSTA 1IC0A 1FWXA 1W8EA 1BYPA 1QHQA 3S8FB 1PNDA 4DP1X 3S8GB 2B3IA 4NB7A 3FU9A 2FQEA 5I6PA 1GS6X 2EIMB 1PAZA 3NJGA 4YSOA 1V55B 2OJ1A 4EF3A 1BQRA 2IAAC 2UXGA 1ZIBA 4GP4B 4HAKA 2I85A 3ABLB 2CJ3A 2EIKB 1BYOA 4AKQA 1N70A 1NPJA 1WA0X 1KYAA 2XLLA 4G7SB 1AZBA 4DP8X 1AZUA 2OV0A 2QT6A 3SBRA 2YAQA 2XXGA 3UACA 3T9WA 5AZUA 1A4AA 3ABMB 3FT0A 2VW7A 1J9TA 1NPNA 2WO3B 4YSDA 4G71B 3GYRA 3S3DB 1SHWA 3UABA 3QJSB 3FQ1A 4BWTA 1AZNA 4KO5A 1NWOA 2VMJA 4DP2X 4HHGA 2B08A 2EINB 5B7MA 3C75A 4YSPA 4F2EA 4M3HA 4HIPA 4M4RB 1GSKA 3FQ2A 4KO6A 1NZRA 3FQYA 2FT8A 3TBCA 5B3SB 1WS8A 2P80A 1R1CA 1XB3A 3H4FA 1JOIA 4WTQA 2EILB 1L9TA 5B1JC 1IBZA 3ABGA 4A2HA 2JFCA 3ZDWA 1BEXA 3CG8A 3QJVB 1KCBA 1NIAA 3PAZA 3CDZB 1PLAA 4HZ1A 2XVBA 3DIVA 3NSFA 3T6XA 4P5SA 4G72B 3AG3B 1NWPA 4DP9X 4JHUA 1PZCA 1CURA 5IY5B 2VW6A 1SNRA 1XB6A 3WI9A 1CYWA 1A65A 4YSEA 3PCYA 1E5YA 3QJUB 1EZLA 2R7EA 3OQRA 1ILSA 1AIZA 3UGEA 1AS8A 2VSMB 1RZQA 1AOZA 1SJMA 1NINA 2YXVA 4YSCA 1SF5A 1A8ZA 4DPCX 3NYKA 3TASA 2JXMA 3OMNB 1DZ0A 4E9QA 3X1NA 6PCYA
chains in the Genus database with same CATH superfamily
5B8CC 2WZ0A 5I71C 1A7RH 2D4DA 4NI3A 5F1OB 3MYZA 1E4JA 2BSTB 4CC0A 1U2HA 5C0IA 3MNWA 1NBVL 2IANB 4HJ1A 4DP4X 4Z7QF 3W11C 3HNSH 3IDUA 4HLEA 2VZSA 5C0EB 1I1AD 1YEIL 2VDRH 2WCGA 2CHXA 1JV2A 4PJ9A 1XGZA 3O3AB 5J9PA 1LQSR 1T21A 1G5AA 1OT2A 2R51A 4Z3JA 1MY5A 1WK0A 2MTAA 3KGRA 3F2LA 2AQ3A 3HVNA 1KCUL 2O93L 1KGJA 1DDTA 4NM8H 5KS9A 2GSGB 1FYTB 1KTRL 4ZFFA 4PS7A 4ZO7A 3A22A 5AOZA 5CGMA 1OAZH 5CFHA 1KB5A 4ZTOL 2J1XA 2BVQA 2PO6A 4MJ4A 4WI3A 4BQ6A 3FYIB 1W6LA 5BRPA 2OI9C 4OGAC 2GHWB 5C1MB 3ZVVA 3EOTH 3LPGA 5C08D 4CGTA 2ERJB 1YZZA 1CBJA 4LSRL 3EHBD 3RDJA 1KLGB 1OAKL 4XO4A 1BQLH 5E6UB 1H5BA 3AU1A 1PU0A 4WJKB 5IHLB 1AQKL 5PCYA 4CADA 2BW5A 1S5HB 4JDZA 4RFEA 3GSWA 3MBED 2G30A 4U3SA 4P9HC 1E4XL 3PQYB 4EI6B 1KXQA 5C0BE 3RE0A 4IDLA 3ZSSA 3QUHA 3RIAK 3SDAA 4PJFA 4TQEL 4GI8A 1PCXA 3QIWD 2W0KA 4K9JA 1CUOA 5F3FA 3ZKMD 2VSDA 2XWCA 1O7SA 1EHNA 1JTPA 2D7PA 3KBHE 4M5YL 3UTQB 1C5BL 1MI5B 3QDGD 1UXWA 1G1OA 1NMAH 2EO9A 2Z93B 1GH7A 1DO5A 1BFTA 4I3RL 1ZGLM 2D7OA 3C6LB 4LPXA 3WOVA 4HFUH 2WY3B 4LKCB 2ENYA 3DOSB 1U30A 4HS3B 4ELMB 5LGHL 1KPRA 4R7DB 3AB0B 4RRPG 4HWUA 2ATKB 1UURA 2R1WA 5E1QA 5J4MA 5C71A 2WVVB 3ARBD 5L88H 5E00A 3OJ2C 4KAQH 2K6WA 3S34H 5HHVH 4P3WA 4W9DC 1YNLL 3KGUA 2H2PC 2VQ1B 4KPHH 4XH2A 3HLAA 1NDGA 1X7QB 3NTCH 4HK3N 1FVEA 5IVXA 1CLOL 1VIWA 3BGFB 4DVRL 4PRHE 3BIBX 3UOAB 4IU3B 1RHHB 3R0MA 1E7UA 2Z35A 3PHQA 1YLBB 4A2GA 4NKMA 1NEZA 1LWHA 25C8H 4MD0A 4LLVB 4N6RA 4X6EA 3SBPA 4ZYKB 2XKNB 4MAZA 4OZGE 4OZHB 2ODHA 5DQJB 4LT7A 5E2TL 3VXTA 5I2IA 1T6VN 4ZOCA 3P40A 1BVLB 3RJQB 1BF2A 1P5UB 2NT1A 5DEGB 4C56D 5FYKL 1B4TA 5HDBE 3B9KD 1I7TA 2KH2B 1JUFB 4OQ1A 1WFMA 4ALAH 4XCNA 4NKOA 1OSPL 3E9UA 2GJPA 3ROOB 4JG9A 5I75C 1R3IL 3LZNA 4LOUC 4O02H 3F7LA 1PYWB 2E86A 2ZG3A 4QRQB 1NSNL 4CRPA 1AIFA 1KGXA 5MEOA 4Y1AB 4M5ZL 5FFOA 4TNVK 4RH4A 5IW1A 5DT1L 4MYPA 2QPSA 4JZJC 4JHAL 4AQAA 5T5NF 1PX3A 4UT6H 5LNDA 3SE3C 4U1NA 1MCWW 4WEBL 1JNNL 1S7XB 3ARFD 4MWFB 2GBVA 1QHOA 2YAFA 4J8RB 3GKWL 2IBZX 3BUTA 3G6DL 4OI8A 4TSCL 1F45A 1NGWB 5ACLA 3ARDD 4RVBA 3PWPD 4LQFL 1IL1B 2YD0A 1MNUL 3K0YA 1DQQA 1ORSB 3Q2LA 4QDGA 1U8IA 4KNSA 3GXDA 2BFVL 4X8GA 1FHNA 5CEZE 4OV5B 5ABZA 3MLXH 4Z5RA 1IVTA 3E0GA 4FQXB 2OQJB 1KGCE 1M6OB 2DQDL 3IKCA 3JWDL 4DKTA 4F8NA 2HVJA 3GGWB 3DMMD 2HTKD 4JS7A 5ICXA 3S0PA 4GKNB 2FJHA 2XOTA 1B2YA 2JTYA 1PSKL 2XV2A 1FORH 3RGVA 1VFAA 1P4UA 1I8KA 2APSA 5BZDA 1SJXA 2OP4L 2PXYB 2YEZB 2BMKA 1ZMYA 1V7NL 2R56H 2J6EL 3TWYA 5CEZH 5C0CA 3QQ9C 2CQVA 3CV5A 1NCOA 1BCIA 1QUNA 3N0AA 4APQD 1HYSC 2ENSA 1T2JA 2OMUB 4AT6A 3T2NH 1AOHA 4PGCA 4CU8A 3TYFB 3SQBA 5FO9A 5H94B 1LLAA 5EIIG 1VSCA 4EI5B 1I7RB 4N2EA 1A4JB 3EG9B 4G5AA 3L5XH 4C54A 3W57A 1WITA 4KQ4H 2IOMA 4M3JA 3CUPB 1XCXA 3RIKA 2OK0L 4JW3A 4OKVB 5D72H 4GBXC 4OQTH 2O6FA 4F1SA 3O9WC 3DETC 4PJ6A 1M05A 1BZEA 2E5EA 4HHAA 1J0YA 4XWOC 3HZKA 3U7AA 2WKOF 1QNZL 4UINH 2W07A 1YYLH 4WW2F 3VXSE 5HHOD 1JNHA 1Q1JL 1USQA 3AY2A 1LM8V 3E2HC 2XSKA 3CFUA 4JFHD 5CD5D 2Y2TA 2OYKA 5K59F 5J3HD 4EIUA 4UTCA 3K6NA 2OMWB 2FX8H 1GA2A 2VZ1A 2X28A 4NKIL 2WNXA 3LD8B 4B50A 3RPIB 3Q9QA 3D0LA 2AV1A 4DCQA 2PNDA 1MH5B 4NP4L 1LP9E 1ACZA 5F88A 3QZLA 4IJTA 4DESA 2EVFA 2BSSB 4RMTA 2KLSA 1OO2A 4XNYL 5ETUB 1Y6NR 2R4SL 2R2CA 2W65B 3ATFA 4HH9A 3AT0A 2LLNA 3QFDA 2PW1A 3M7OA 3NPZB 2PCXA 4UQ2B 3CQPA 5FGCE 2GAZB 4Z3GA 2GY7B 1FSKC 2DJUA 3EUDA 2RCSL 3O8XD 3CIQA 2EE3A 4UIKL 3WEXB 3GNMH 1Z3RA 4TTDD 3T8VA 1KENL 43C9A 4HJIA 4QT5B 3LPPA 2YEQA 3QDME 4JGJA 1V5JA 2R69H 5E6YA 2WLZA 2X1QA 1QRNE 3X14B 2A9NL 1MI5A 2YSTA 3BX7C 3HHRB 3VFSA 1Q0XH 4F9PC 3FQWB 3WIHA 2X89A 1YHPA 2CBMA 4DUVA 4Y4FD 2VDLL 2VQUA 4R7DA 3UYOD 5KTEH 5F0MB 3C6EA 4NCC1 4HOWA 5CBAA 4J2XA 4FZ8H 2F19L 3S3BB 3EJZD 4XNMB 1H8OA 3LVEA 2AEPH 2EDHA 3Q6FB 4L9LC 3HAEH 4K23L 4QXUL 4CVZB 1IM3D 3EO1B 2R29H 4Z7QE 2NY5H 1E4KC 4WRLA 1G84A 2A9AA 5DSCB 4N90D 5FGRA 4AG4L 3VFWB 1JF5A 4YSRA 1LK2B 4AEIL 5LQBL 2EXYC 3CSBA 1UC6A 3LZLA 3LKOA 4RA0C 1BGXH 3FU3A 2FLRT 5EUOF 3AXLB 1JXKA 5H35A 4TQPA 4ZX3A 1CFSA 1SOKA 1UM5L 1R3KB 5F7HA 5LCVA 5TH2B 4YHOL 4YDMA 2PABA 4NZRL 5IMKA 1HHKA 1HINL 4KRPD 4DZ8B 5HYEA 3KJ4C 1TSHA 2UY6B 3MRCB 3EOAB 1NTDA 1MQ8A 3L3KA 4PQXA 1JPFA 1KFAH 1L9QA 3BSZH 3K74B 5L0QB 3GJFA 1OGPA 5EZOH 1IKOP 3S5YA 5DO2D 1CICA 4WTWA 3MLUH 3K91A 4KTEH 3TVMB 4Y1AA 2A6IB 1TFHA 4TMPA 5FAAA 5D1QD 4UB0L 4NI6A 4A7VA 1NANH 2B1AL 2D73A 5A40E 2X6VA 3AWFA 2PP8A 1GHFH 1KBGH 3QPKA 2J4WH 5BQ7A 2OR9H 4I4WB 2EH7L 2HKHH 1HHGA 4IS6B 3KPRE 3LPFA 3RWHA 5LUMA 3ULVL 3RNQB 2HX9A 5HHPA 1SVBA 3ZUCA 1U36A 1N0LA 2Y07L 1ZKAA 2Y36L 4AL8C 1WZMA 3O81A 2IG2H 4OGZA 2BVOB 3AITA 3QPQD 2SODB 5E1AA 3FU9A 2VLMD 5C3IA 3P2DA 1M7IA 1UACH 3U0PA 3JV4A 4JY4A 1AHKA 2NY4C 4X7TB 3COOA 3ZKXB 4GP4B 3FCUB 4S1DD 2CJ3A 1WT5A 1CBVL 2E27L 4XODA 2Y6SD 3VB8A 3VFVA 2W9EL 1DBML 4GKNA 2ZOWA 4RQQA 2EZ0C 1NCAL 4Y7OC 3T4AB 1LD9A 2XTSA 4LHUG 4PV8B 1ZHNB 3T9WA 1G0YR 5D7KD 1FAKT 4UZSA 2R0LL 3K6OA 2YEZA 3VGAC 1TJHH 3GXPA 4G9FD 1EDYA 4GSUA 5KVGE 1FVCB 3QJSB 1RVFL 5I19H 3TCLA 4KI5D 7FABH 5EBLA 4UT9H 3IDNB 2VMJA 4DKFL 5C0AA 2YGQA 2HFFA 3P4OA 4KMTH 1R24B 4YSPA 1R75A 2IC2A 4M3HA 5I0VA 3UTTD 4Y2DC 1A4JA 1YEWA 2W0LA 5DZPA 3ZU8A 5AB9A 2YLKA 2B77A 5KWYC 1KG0B 3LB6D 3B9KC 4PJHA 3CZGA 1WBXB 3I2CL 2Z9TA 4AGPA 1SPDA 5ISZA 3N40P 3ABGA 3MZGB 4GW1A 3QFJD 4P3DB 2WCSA 1U8HB 1IEBB 3U7YL 1BLNB 3G7TA 4Y2OA 5H2BB 1GGIL 1AZVA 2J20A 3BKYH 4Z95H 4D8OA 1NWPA 1LO4H 3QS3A 1RPKA 2XXCB 3KL0A 3NFNB 4P46B 3WI9A 5JPMB 1WZ1L 1NGXB 2KDGA 4HKZA 3BPLC 4F20A 3N3EA 1CFVL 4WWKD 1T83C 1NM4A 3GRWL 3PCYA 4YMPA 3VFPB 1IAOB 4URKA 3Q05A 3GK8H 1HU8A 2ZOUA 5CSBA 3ARDC 1RFDL 1AS8A 2VSMB 3N50A 3WFCH 2BOBA 3EKCA 3EGDB 3MV01 1ZTXE 1SF5A 1T04B 5ESAB 3HOGA 3HPLA 3AWEA 3OMNB 2W65A 3ILQD 3BPNB 5DWUH 1CDJA 3FKUS 1V3MA 4EUPA 1NANI 1EZVX 3D39D 1A4CA 2NY3B 2IALA 4HPYH 4YBLC 5C70A 4FGMA 1XWVA 2XNAA 1SVZA 4P5TA 2HTKC 4R7NA 4ZG1A 4HJTA 3SQOH 3W0WA 5KSAB 3FUIA 2GI7A 1WBZA 4I0KA 4Y19B 1CQYA 3UZVA 2RB8A 1B6DA 5MENB 3QORD 3DO7A 1ZTXH 5I15L 1JGEA 4OLUL 4E9YA 4K8RH 3Q1EA 4D0DA 4XAKD 2O30A 1GC1C 4WJG3 3ETTA 2MNWA 5ITBL 1YEKL 4APQC 1X7SA 4PJ7B 3GI9L 4TUKL 3FQWA 1INDL 1VA9A 2YD5A 3T0EC 1I9RH 4B5ZA 4HALA 1DQML 4OCSH 1DBJH 1RU9H 2EDDA 5D5MB 1BQ5A 1UKSA 2CSPA 2HH0H 2X4PB 3FFDB 3U6XS 2ZOTA 3UZQA 2E7MA 4ES9A 4WFEE 1KJVA 1JPEA 3BQVA 4I1RA 2VDQB 3Q6FA 3OXRA 4HUCA 4PJBF 2J8OA 3AM8A 2WC7A 1TT6A 4GXVH 2BS71 4G80A 3QEHB 3MYJA 3OR6A 4FYSA 5K1NA 1PKQB 1U3HD 1FG9C 3F7VB 1AAJA 5J3HC 1IC7L 4AYFB 5HD8C 3B7TA 5JZ7D 4JPKH 3T6QC 4PP1D 1SOXA 1ZA6A 1X44A 5F9WB 4ADGA 5T3ZE 2VSKB 4Z7UA 2MNUA 5EIVA 3MRFB 4YIQA 5DTFB 4OW6A 5TH2A 1S4IA 4DZ8A 2ORBL 3SO3C 1N7MH 4PTUA 1XTLA 3EDFA 4FQJH 43CAB 1NIBA 4FA7B 1EFXD 1KJ3L 1SHMA 4X7SL 5C6PB 1FFQA 2UWEE 2WWNA 2HFGH 4PJDF 3OKMB 3KXFD 1RUQL 4IBUA 1YA5A 1CTNA 5FCSH 1F4YL 1B0IA 5T3ZH 8PAZA 3K4ZA 3VRIB 2DLEA 3OKNA 3VWJB 2DLFH 5JW5B 4OCXH 5EWIH 2G3NA 3O8XC 2FJFB 1JNJA 4QF1A 5F7WC 3LH2H 4JRFA 4P57A 5DK0B 4I4WA 1EMTL 2CUHA 2P5WB 4S0TD 5EOCH 3RPBA 2GIXA 3QC5X 2QJDA 3PNWB 3P4MA 1RMFL 4HS8H 4KRLB 3LIUA 4BRJA 1O9WA 2NY1D 2ZXCA 2WZ5A 1YY9C 2X87A 3K4DA 3IDIA 2DYSB 2APTA 4DK6A 1QLEH 4OJYA 3F65A 3N85H 4UV4H 5FF6A 4HJUA 5CLTA 1M2VB 3QDJA 3EOYG 4Y4FC 4FERA 4X7TA 3HE6D 1TJMA 4MA3A 5EBWB 4ONFL 3WTVA 3ZOAA 2BS8A 3OKYA 1EFQA 3X3GH 4X7DC 2C7FA 1MFBH 4X9GA 2N1KA 5TQ2H 2WM0A 4GKSB 4HJEA 2Y06H 1ORQA 3LSOA 4C4KO 3DOIA 4BK8A 1L7TL 1ZHNA 1ND0B 3LKRB 4UQDA 1K8DB 3TZVB 2VLRE 4AZUA 3BDXA 2D3JA 2I25N 2W8CA 2X2IA 3LZPA 2IGFH 3EYSL 2EYRB 4J12A 4X8CA 3V6OE 3JT2A 4O51A 5CR1A 1A14H 1MCQA 2CWRA 2FJSA 3MXWL 3T65A 1EJOL 1MVFA 2CDEA 3BUBA 1PY4A 3CN3A 1TNNA 3QIBD 5DLML 3T71A 4AZ8A 4OF6A 4UIMB 2Q8AH 1WDAA 3KBPA 1EVTC 3SOTA 5CGYC 2WXPA 4H8WH 2VITA 3SDCB 2FEDD 1A7NH 2VUKA 3X1EA 2OW7A 5JUEH 1MVUB 2XVKA 1JWSA 3LRSB 4HH8A 4M00A 4FTVE 1QATA 5HHME 3L4WA 4PJXF 2Z31D 4RAUB 4BE6A 2J88H 1IEBA 3D05A 4XN7A 1OEZW 1SEBA 5D7IE 4BSWB 2BINA 4XXWA 2J5LB 2H6PB 5I23A 1GIGL 3DHMA 1UT2A 3MX0B 4KK6D 5AZEL 3K2UH 1P4IL 5DC4B 3QUGA 3Q6GH 32C2B 1BAFL 5JOPD 1HILB 2CH8A 5BRZA 2XV3A 4JDTH 4NNYA 3BHBB 2P42B 1A4KB 1IAOA 2VC2L 5JLZB 3OJVC 2FNWA 4ZTPH 4X4XB 4YX2L 1QEXA 4XTRD 4YDKL 4NWTL 1IUZA 4NM4H 4G8FA 1KEGH 4QJ3B 3QPQC 4HWEL 4QHMB 2CHDA 4S1QH 5ESAA 4MLSA 4NO0D 4OLVH 2M8XA 4QEGA 1W91A 4LZKA 4OGQC 3CFNA 2VE6A 3IM1A 1S5IL 4M62L 4OGXL 3VWKD 5LBSL 2C1OA 3FHEA 3WFBH 3TO4D 2ZSVA 5JDSB 2Y24A 3GZKA 5FCUH 5IM7B 3WN6A 5FGBA 5I0ZA 3MXVH 4G7QB 1Q0YL 2Y6SC 4O9HL 5L2KA 4UQBA 3X1GA 1MAJA 3VX1A 5IEHB 4HMDA 1LO2H 3SE8H 1NFDE 2EP6A 2QQLL 3Q8EA 3SGKC 3UJJH 4PCTA 4EDXB 5MENA 2V5RA 3G5ZB 1HJBC 5C09E 3UYPB 3S5LB 1FL6A 4L8SC 5K9QG 3HB3D 1C8PA 4PJGF 4BDVA 4MDJB 2EC9T 1X3DA 3MHZA 4MAYD 4BFGA 2DMBA 3PWVA 4K7PL 3TN0B 3RDTB 3PV7A 1XGPA 3O6KL 2Z34A 4A2DA 2I9TB 5FB8B 3MUUA 2AI0L 3A0OA 4JRYD 1IMHC 4KKBD 1MCPL 4C4BA 1CB4A 3QUMB 1QQDB 3TOPA 3LZRA 4JFDA 3DDGA 3BT2L 3MROA 4I48A 3WTWA 3KDPB 3BPCA 1QSFA 3N1FC 4ZQKB 3G5WA 2VO5A 5A2IH 4P23A 1L9MA 4NERA 1ASOA 4I0PC 1ADQL 1NCUA 2VN4A 2XFGB 4ONGH 3H9YA 3NJHA 2FH6A 3V5DA 1VAHA 4HIHB 1UOWA 3IE9A 3ZDXF 4J27A 4F80A 1J9QA 5KVFL 3GMNB 1WIUA 5KYYB 3PFQA 5AUMA 4WWKC 2GJRA 5BZZA 5B4MC 1DDHB 2A73B 3KLAB 4IYKA 3SDDA 3FQRB 5CCJA 4JG1L 3RFZB 4QMEA 4IKJA 4YDLB 1UA3A 4EBQL 3BGAA 2RA1A 1NBQA 2P44B 4FNTA 1PFCA 3QJQB 2J1KA 3RVTD 5KANI 3ILQC 2VDML 5F0LB 3U30B 4B41A 1LE5A 1WS7A 4JHVA 4G6FB 3L1OL 1EEYB 5AOMA 1F6AB 5GGSA 3VFMA 1D5IL 3PL6B 3M46A 4HAFA 5D1XA 2XQYA 3RWDA 3K71A 1IZKA 4XOEA 2P7TA 1L9SA 2OZ4L 3FF8A 2KPNA 3VXOB 5JR1L 5IW6B 2L0DA 2F8XC 4TNEA 4ODVL 1GY2A 5I1EH 2E9BA 4YDZA 4KTGA 2XN1A 2PN5A 1OXYA 3Q13A 3LEVL 5CZRA 4CDHA 4P3CH 4OIAA 5E0FA 3X12A 1I3RB 2VABB 3IE4A 4J5VA 2PP9A 1A7PH 4IGBA 5EV7A 3VTMA 4H8HA 3MGTB 4HIIB 4DPAX 4ONHA 5E8EB 2AJZB 4AXWA 3NBNA 1KT2A 4JDEB 1UG9A 2XN9B 5E2WL 4HP5A 3DBSA 5EUKA 5AD0A 3TL5A 5C0DB 2NY7H 4PJBE 1K85A 5DJ2B 1ND0A 1NDTA 1V7MH 1K8DA 2YBGA 4XCCH 4HULB 1CLZL 1D5ZA 5DMGC 2CCWA 1N3NB 3CMGA 1YRKA 4TLTA 3S37L 4WI8A 3BEVB 1KN2L 3VB9A 4JAMA 1JXDA 4KI1A 5IESL 1JYWA 1LL1A 3H2PA 2VXVL 1NMCB 3OAUL 3Q2WA 2CIKA 2DYPA 1DQJB 1M4KA 2FO4A 5JIIA 3VACA 3WUZA 1LGVA 3P54A 4MMXB 4MXWH 3HI5H 3OKLB 4N0FB 2CO7A 2ZXGA 5KBMA 4TQ8A 1W16A 2KLRA 5E8PB 2G60L 1A7QL 3DNKA 3EH2A 4W6WB 3UGXA 2I85A 4XOAA 1LK3H 3PHAA 4KHTH 4MMYA 4RAUA 5IMMB 5C6WH 3VW3L 4JVWA 4H88L 4PJDE 4OZIA 3P0YL 5J12B 5SWSA 1HSAA 1PEWA 1X9LA 3MPCA 3VXQB 1ITCA 3SBRA 1RI8A 4FNQA 2P46B 3HNTH 3US0A 4FYQA 4GAGH 2P5ED 3OR7B 2UYLB 1WE5A 2WO3B 1J88A 2AK4D 2WTOA 3BHBA 1MCNA 2CDGB 3V0IA 1H0DA 1DN0B 4GUPA 2ATPA 3DRTA 1RJLA 4RNRA 1H6UA 4PRPA 2BNRD 5CILH 3IDMB 4XP5H 2VLKD 3DX1A 2X1PA 5B7MA 2AV7A 3DROB 4XAWL 2W80C 5IVNA 5KUKA 1F8TL 4PB0H 1DJIA 1GSKA 3FQ2A 2OA9A 4OJAA 1WS8A 4WTQA 4PTTA 3B9DA 4BRVA 1DL7L 3WFEH 4XPAH 1BHGA 1E9OB 1ECZA 5AAPA 2WMPA 3OKEB 2B0SL 4JO1L 1PLAA 4LLAA 4NQSB 1IC5H 3DIVA 1NMBL 5EMYA 4EQ2A 3V4PH 1Y6MR 3UYPA 4BFIA 5EU6A 3VI3B 1BOGA 3IJYA 2ZNWA 3WNLA 3JZYA 4FP8L 1NFIA 3JYBA 1BF8A 3SN6N 4RFOH 4MDJA 3AU0A 3BKCH 1EBPA 3V5HA 3F6LA 1PLGL 3QIBC 5DC9B 4MA8L 1MSPA 4FCAA 2I9TA 4HBCL 5FB8A 1E2VA 3QZBA 5FDYA 4GFXA 4EN3C 1NGZA 4ZFOB 3DWTA 1DANU 1QQDA 4GUCA 2HVBA 2JTDA 3QE5A 3SKNB 2VN5A 3IJHB 4EEEA 3UTSD 1MCEA 3WMQA 3S4SB 1IBDA 4JY6A 3SCMD 2TSBA 2AXGB 1PFOA 2D2CC 2FQGA 3R18A 3MRJB 2HN7A 1DUZB 2MH4A 1YCSA 2EDNA 1G7IA 1MUJA 2BP0A 2FQDA 3KPSA 3QXDB 4HC1L 4QO1B 4ZSOE 4HSQA 2QFRA 2BRRH 3DX4A 3I84A 2I32A 4IM8A 2QADB 2GFBA 2DI7A 1VCBC 4Q6YA 1ZVSB 4KK6C 1NC2D 5F7MC 4GRLB 3JUZA 4PBDA 1I7UA 4M48H 2ZICA 4A6YB 2RR3A 1DDHA 1XF5B 3FULA 1OGAA 3KW8A 4P0DA 1KIQA 4TPRH 4WI2A 5I18L 3QSKB 5H4YA 1ID2A 2UVEA 3GM0A 3WHE1 1MFVA 3JXAA 1CN4A 2LU5A 5IFJA 1Q0EA 3HZVB 4GEIA 4P2RB 4X98A 1H3PL 1I1YB 2ICEB 2DQGH 1YPZE 1HOCA 3VWKC 3CC5B 1EEYA 3EW3B 1F6AA 3TO4C 2GJZB 4JUSA 4HD9A 2YMOA 1TCRB 5K9JH 3C09B 1JIBA 4FQLH 1OVZA 1QO3B 4JZOB 4OAWA 4FQQB 1M3JA 3FQNA 3H0TA 3Q8AA 1R3LA 3ESUF 3FU0A 1D2OA 2XV6B 1T89A 3GXTA 1FNSL 3J27A 3MCKB 1TDQA 4WI6A 2V5SA 1DTUA 1HKLH 4XNDA 3ARTA 4KC3B 4N85A 1S7WB 1CVSC 1NA8A 4GAYA 3VFRB 2VZTA 3HB3C 2FBOJ 5KVEL 2QGEA 4OBRA 4H8VA 4LKXB 1BW8A 4A04A 4AQOA 1PAMA 2DQEH 4FNLL 2H3NB 4I7ZC 2VABA 4HT1H 1HL4A 1QPXA 1I31A 1A7RL 1HI6B 1K3IA 5C08E 3VG0H 5IK3B 4CKQA 2Z1KA 3CD4A 4KKBC 5M94B 1NFKA 2PW2B 4ODUB 4KNUA 5F3HA 4KKCD 1P84K 2OX5B 1PEZA 4LNVA 2VDRL 2YOCA 5E8NB 3L48A 3VYPA 4A67A 4PLOB 2A6DB 1DBKH 3L9RB 3RL2A 2FUTA 2JKJA 1IGTA 2ZKXA 3LHAA 1RJYA 1NC4B 4M6MH 3FO1B 3MCLL 4NM8L 3C5SB 1HSBB 4HCIA 3VXUB 3IDGA 3HVDA 1U4FA 2DBLH 1YG9A 2J2ZA 4HLJA 5DMKB 1WAEA 1OAZL 2F5BH 2VERN 3ROLB 3ZDXE 4J7RA 2CPUA 3MJWA 3QDGE 1IT9H 5C0GB 3QAZC 2WVSA 1ZPLA 3Q01A 3EOTL 3D25A 5B1KA 4NZJA 3W5NA 5AAMC 5GGSY 3KBEA 4R4NC 3FN0L 3BWAA 1QI4A 4LRIC 1DCEA 1NKGA 4N0FA 4M9PA 1SYSA 1E90A 4QCIB 4XC3L 4LLDA 2JNZA 2Z7WA 3FZUC 2OKMA 1P1ZB 3MJ6A 1A1NA 4F2FA 2XVGA 4K94H 2AZAA 4WV1B 1W0YT 1PKOA 2IQAB 4XNBA 1AKJD 4KKPA 3TA4D 1ZSHA 1O5PA 2VH5H 1FO0H 2GG1A 3B3BA 3CGTA 4KI5F 5I1CH 2DIAA 2GY5A 4RWYH 1OP4A 3OR7A 4AYDC 3D3VA 4Z76B 3NESA 1NMAL 4HA1A 2MJWA 2DWXA 3CDYA 5KOVC 3STLA 3HI1B 3MV9B 3W2DH 5JHDB 1WPCA 4HFUL 3FB8A 1SDDA 1TO5A 3MRHA 4GPVA 4WU7A 5I1KH 3KPMB 3ECVA 4PR5A 3WMPA 4F8PA 3QCVH 4X4ZA 4R83A 3B7RL 1XH2A 3RPKA 1UHVA 1X9RA 4PJIF 4U0RB 5L88L 4KAQL 2OSXA 3S34L 5DYFA 3RZCD 4K7FB 5HHVL 2YXFA 1JWMB 4O5LH 5HYQB 3ARGA 4KPHL 1A3RH 2BY3A 4PP2A 4UAOB 3NTCL 3AS3A 2QMJA 2NX5B 5E08H 1W2KT 4HIQA 1W15A 4JLRA 5EF3A 4TSBH 1WWAX 2PP7A 5K5YA 1EZSA 2FYVA 3GSUA 2VISB 4PCYA 4TSAL 1OALA 3C60B 25C8L 2XG4B 2YRBA 3L3DA 2C9AA 5BMFH 3O4LA 4RZCA 3QDHA 4K5LA 2G0LA 4LSVH 3VI4E 3VVWA 3QUXC 4W9ZA 3PABA 2YN5A 5TE6H 3LV3B 3PRZA 5GZOA 2Y0SA 5JXAH 1G7LB 1SLWA 2H32B 4UM9A 5C0FB 4E0RA 4Y4HD 1G6RB 4ALAL 2YSSA 4XE0A 5I8KH 4F2ME 4PJ8B 3RL1A 2H0FA 1I85A 4O02L 5D70H 3WGVB 1LO3H 2AVFA 1MCRA 1A1MB 3S2AA 2YO3A 5T1JA 1BSIA 1VDGA 2EDWA 4DK5A 3QARA 2OAAA 3KMDA 1IGYB 1WQVT 3NZUA 4L1SA 3BVXA 4JFSA 2W60A 3GBML 1O7DC 1CYXA 4MJIB 2PWFA 5TDOA 1FN4A 3MLWH 1QRKA 3DHPA 1U93A 1AG0A 3JYCA 5ES4B 3UAAA 2PCYA 1UYWL 5FOBA 4H8WC 3CLEH 1KGIA 4G8GB 1HQRA 5FM5M 2G2RA 5CR8A 4K3HA 1L3NA 4UZGA 2Y7NA 1AP2A 4GP5B 4OJFH 1H3GA 4FFZL 4GSQA 5TDPA 5IBLD 2OYPA 4PW3A 5JPNC 3E7JA 2EIJB 4MCZB 3MLXL 4O58H 4F7PB 5BUGA 2AANA 3FONB 3UPCA 4GG6A 3HZVA 2DLHA 1QOKA 3MRPB 5A6MA 2X4UB 1OLLA 4U1IA 5IB5A 3ZIMA 2WQWA 2VDPB 2WXIA 5ANMA 3FT4B 1RZFH 2FJGA 1QSZA 5I1AA 5KSBB 1QO3A 2PYEA 2H0EA 1ZTMA 4WU5A 5HHOE 5IUCA 1KLUB 3VGDA 4B3EA 4JFHE 3N43B 2R56L 4PY8I 1DJZA 2H8PA 4PJAF 2PO6D 4F15B 5CEZL 4AIOA 5IWLC 3O4OC 4E2OA 3UBXI 4EQ3A 4ZOEA 3O6FD 5MHSE 3T2NL 1KV7A 2F7IA 4RMWA 5EZJB 4AE1A 1V3JA 2ILLA 5CEYA 5G55A 3L5XL 3LQZB 3CBKB 1K5NA 1LO5B 4M61B 5DS2A 1WVZA 3S5LG 4BH7B 5CD3B 4LRNH 5D72L 3EFOA 1QA9B 4LGSB 1MZZA 2WBWB 4OQTL 3WIHH 2GTWB 1KIPB 2CRYA 2YPLD 4E9TA 4ODUA 4KVNH 1O0VA 4I3SH 1ZA3A 2OX5A 3SKUD 3AMKA 3RWCB 3PY9A 3TF7C 4UINL 1XSOA 1YYLL 2Z4QA 5E8NA 2C9UA 2OMBA 3DYPA 2JI2A 3QIUD 4LCUB 3WLBA 3MRRB 2A6DA 3L9RA 4TVPD 3EBHA 1BWMA 3L5HA 1N4XH 5DRWB 1DN2A 1Q72L 2EH8H 2FX8L 3FO1A 3P0VH 1JI1A 3D69A 4M8VA 4QRRB 4XBGA 5AZ2H 2I7OA 4GMTH 4Z77A 4E9RA 4HUVB 3FTYA 4AH2A 2YXWA 5B1CA 1X5MA 4V1DB 5I16A 1MDAA 2JIXA 4JFEB 4LHUD 3AAZA 2IIJA 4Y16C 1WZKA 5F7UA 1BQUA 1QBAA 1A6UH 3TLRA 2B2XH 2J71A 2FAUA 2Q3XA 1B0WA 3CVHH 3VMOA 2VDLB 3BH9B 4ICXA 3LS5H 5D7JA 2PCFB 1CQKA 1Z5YD 2H26B 3T8MA 5F2FA 4I2XA 1EO8L 5GJTH 3ZDYF 1A9BA 3HZMB 5F72S 3BMVA 3GNML 4IOIB 3GJFH 5A2AA 2F1EA 4LDLB 1D5MA 3BN9D 5IQLA 4ZXBD 3VE0B 1PX8A 3Q7JA 4WEUD 1KIRB 4M6OH 3RVVD 3GUFA 5C8JA 2R69L 1N26A 2VZUA 4H7VA 4AQ8A 3NJLA 1T66D 5E8OA 3VFUB 1TVBB 1WA1X 5DDHB 4QXTB 5T5FH 5I26A 1FFNA 3SJVB 2VDOB 2EDOA 4W81A 5GSRB 1Q0XL 5KN5B 2R1XA 1YEDB 4FHJA 1PLBA 1VJSA 4D0BA 1TEFA 2R8SH 1VPOH 4IHOB 2GABA 5E23A 5DWPA 5HJBA 5E5MA 4ZAKB 1XR9A 5KTEL 1F3JA 1U91B 2ITFA 5L4IA 4DKDC 1PZUB 1JK9B 4FZ8L 3QZOA 4XZUA 1XCTA 3LN9A 4HV8B 1MHEB 3C87A 3FFOA 2B3IA 4K7FA 2JK5B 1KXVC 1MCWM 1MF2H 2AEPL 2FQEA 1J7VR 1PAZA 1UM4H 4NIKB 3NJGA 3WO3B 5JXEA 4FNSA 4AEFA 1XIWA 1CFQB 2R29L 4G6JH 2NY5L 2ADGB 5D1QE 1T22B 5EIQA 5CHNA 3HJEA 4LP5A 3JT0A 2VM9A 4I18A 4AK2A 2XFXB 4IOSA 4JFYA 1BGXL 4IKLA 1AYRA 1AZUA 2X2YA 5GGVL 2XXGA 2JWYA 1B4RA 3WJJC 4YSDA 5IBUB 1A8JH 1TQCB 4WHYH 4XB7A 4N2CA 1DJWA 3L4CA 4YQXH 1Z0NA 2Z8RA 3SE6A 3LV3A 2WPGA 1HCVA 3BLPX 2XN0A 4NC1C 2VJ0A 5FUZH 4FRWA 4L2LA 1T03H 3WY3A 1Y07A 5F89A 2FYYB 1KFAL 2VLME 3MMEB 3BSZL 3LNHA 3SYQA 2BNUA 5EZOL 4PYHA 3MLUL 4N1CA 5BXFB 4KTEL 4KO6A 1O6SA 2RGSA 5AW8B 3TBYB 2OL3H 1MCBA 3PWLB 2YZ8A 4JFFA 5FO2A 4PRIA 5KSUB 5CLZA 3APCA 2A4CA 1GHFL 5A3IC 1KBGL 1LDSA 5IB1A 5MI0C 2O61A 2CE6A 4NBZB 1A1OB 3BP6A 2OR9L 2IPUK 3MNMA 3OKDB 5D7KE 1ZGLP 2HKHL 2FO1A 4HZ1A 2QHRH 3MOQA 3QXAB 4DVBB 2BRQA 2F58H 4P5SA 4G9FE 1WIPA 2LQRA 4DP9X 2J6EA 3K6FA 4KI5E 5IY5B 2VW6A 2IG2L 2XPZA 1OPOA 2FWOB 3BFQG 5A16A 3CFEB 3QC6X 4GIAA 5B38B 3IWVA 1UACL 1DJSA 2IAND 4F7PA 2F08A 4PS4H 4YE4H 5F1KC 1GAFH 3KWUA 3T1FB 4ANVA 4J3OH 2NY6D 1J8HE 4PJIE 3DPBA 2DWEA 5FKAB 2XA8H 3QFJE 5EUOB 1INQB 4XP4H 4EUPH 4ZUTB 4ETYA 4WUKH 4ZMTA 3QHFH 2IH9A 4DERA 1E9PB 5CN1A 4MRCA 1FFRA 3FTSA 4MZIA 1KMGA 1TJHL 2XKSA 5I1DB 4EN2A 3FSWA 5I19L 1HH9A 3JWOC 7FABL 1AMYA 4UT9L 1MCSA 2AABH 2BW4A 4OI9A 4XHQA 4OZ4B 1CE6B 1Q9LA 2ITDA 5I9QB 1YN6A 4UYQA 3EGSA 1CFTB 3LKNB 3BVDB 1UJ3C 1TOXA 3PGDB 3OF6A 4U1HB 4X5WB 1I75A 3U2IA 1BFVL 4U6HB 5E9DE 7CGTA 2Z7ZA 3KZ8A 1KJMA 4AQ1B 4XMVA 1ZLSH 5CD3A 3BPOB 3PQYD 2DLGA 2VCOA 3WJLA 3D39E 5KVGL 1EEZB 4N28A 2EDRA 4CJ1A 1E0OB 3V9FA 5J57B 4Z7VA 4J2QA 4XNQB 4P4KA 1H9VA 1FLRH 4ZW8A 2YIHA 3BKYL 4Z95L 2FATL 4OB5H 2VM3A 5B8CB 5I71B 1LO4L 2ALAA 3IJSA 2OMVA 1C5DB 3QWOB 1MI5D 4EZLA 1H19A 1EV2E 3KYOB 1BDYA 4HUVA 1PPIA 2APFA 2B39A 3C6LD 1A0QH 5FYLE 3S4SG 1S8DA 3HUJE 2F74A 2B9BA 1HYRC 3BYTA 5F7NC 4JKKA 3VFOB 1EZUA 4XBPB 1B6UA 4PG9B 3WFCL 1WISA 5AKRA 2JB6A 5KYWA 4HJGA 5FO7A 2ICWA 5ICYB 5AVYB 5IBLC 3REWA 5DC0A 5DWUL 3IJ7A 1JG9A 2OXGB 1OWWA 3IMBA 2QQNH 3ZKSD 1IC4H 4KDWA 1GZHA 4PD4K 4P2QE 4UQ3A 3HCVA 4LEEA 2OI9B 4PJ9C 3SQOL 5FYLH 1NH6A 4L3EA 4OFKA 2LW3A 3HZMA 2Y2YA 2A9BA 3X1FA 4HX1A 5MEQB 4H25A 5F7AA 4RWHA 3EFFA 4RRPM 2H0JA 1TEYA 1ZTXL 2NTFB 3NJNA 1ZCRA 3C9NB 3SQRA 3PGCA 4JO5A 1U3NA 1C08B 1BBJB 4K8RL 4Z0XB 3ILDA 4MSWB 4RDBA 5GRXG 3BGMB 1TVBA 2P3YA 3BVUA 2PO6C 2A74A 3MV8E 4QXTA 3UDWA 1C12B 1CC3A 1GYCA 5DZNA 4H4NA 3OAWA 4E42B 1UZ8B 2JXMB 1I9RL 4BINA 4ZMYA 2ZCKH 3QXUA 1VCAA 4OCSL 4ZAKA 2H5UA 1RU9L 1H5BC 1QFWM 3OHXA 4DWHA 1CICD 4HFWB 2HH0L 3THMH 1LQBC 3SKMB 4ICWA 2PMZA 4Y1AD 4X6CA 1B0GB 1BMZA 1S7SA 3ES6A 3T3MF 3SGDI 4FQCH 1XCQB 1G1KA 1FL5B 2JVUA 3CN0A 3IJEA 4GXVL 1I8LA 1F4WL 1JZ2A 3SDAC 3KXFE 1Z5LB 3ETBJ 3ATEA 1I3VA 3GSXB 3LRHA 1DQDH 4P9MH 4YHPB 2DYRB 1DJGA 4ODTH 2M26A 4JPKL 4NS0A 4JHWH 4ZO9A 3HS8A 1PS3A 1MCOH 2A7BA 3IDJA 4G8IA 2H9GA 2ADJA 5DHMC 3WG7B 5EU7E 5I0WA 3LRMA 4X6DE 3VSQA 4ZUVB 1N5YL 4FQXD 2JKXA 4GT0A 3O0RH 4DKAA 2XJKA 1N7ML 4HIXH 3BAKA 2Y1AA 3FO9A 3ZTJH 4FQJL 5FKPB 4HWNA 3HC2A 3MMEA 1IEHA 1A3LH 4N2OA 1D6EA 3H3PH 3RGBA 2CRMA 3DIFA 5EC1B 5I6NA 1JXJA 2HFGL 2JCCA 4DK3A 2WQ8A 2PXYD 4KX8A 4WTZG 5T3ZL 2ZT9C 1RLWA 2CO2A 1C7SA 2GC4C 2Y72A 4F5CE 1A6ZA 2DLFL 2HLFD 3BD4A 3O11A 5EWIL 3ZZLA 2HYMA 3H7BA 3W81A 3QUZA 3BN9C 2BIMA 2HX7A 4ZXBC 4LEOA 1JZFA 5EOCL 5GIRA 3RVVC 3QXAA 4BUGA 4E9XA 4YFLI 1G7JA 4XMXA 2C9QA 3NABH 2EE9A 1GS8A 2VXTH 4R4BB 1ZY9A 1V54B 3MV7B 1OCCB 2FWOA 1QLEL 4FD0A 3CFEA 4XVOA 4UV4L 3BIKB 1OY3B 5ISZD 3LNFA 4ACPA 1FG2B 4ZX4A 3VXRA 3D2UA 3DX3A 4HIEA 4RSVA 5HYJA 3IEAA 5DF0A 4KWUA 2ZD0A 3N55A 1U8KB 3T1FA 5D6CB 3RI5K 3MREA 3X3GL 5AWNH 1MFBL 3AADB 5JHAA 1UFUA 1AO7A 4MNHB 5H4ZA 2Y06L 1AMXA 3RP1A 1LWJA 4U6XA 3RUGA 4BXSV 1RJZA 4PRNB 5KOMC 1L5GB 5CLXA 2CIIA 3QQ3B 4TNWF 2IGFL 4GQ9H 1ZXKA 3F6JA 4Z3TA 1QVOA 4GFTB 1EWHA 1KN4H 3GSNL 1A14L 2X40A 2F9BT 4KBPA 2BM3A 4RCAA 3HFMH 3M6DA 4DW2H 1BAGA 3GRWA 3GT6A 3RB7A 1KCRL 5BVPH 3GJFK 1OV8A 2VM4A 3PGDA 4H40A 2WOBA 5DQ9A 2Q8AL 3SKJH 4CW1A 2LLGA 4LCWB 4GRWE 4QOKB 1XBDA 2F61A 1A7NL 2FX7H 3AG2B 1UGKA 1AQ8A 2GSMB 3S5ZA 1DQLH 2OTWA 2VL5B 1H15A 4HMEA 3FU7B 4LB8A 1I8IB 1U95A 3OZKA 5AKVA 1SQMA 4PRBA 5MERA 3ZQXA 3BCFA 1EEZA 2J88L 2BS9A 3KW7A 2AF2A 4OLWH 4XB3A 3RGVC 4POZD 4Q58C 3CFIC 3W37A 3DX8B 5JMRA 5E03A 3I9AA 3DVIA 4G83A 1VGKA 3VD3A 4DZBA 1JD7A 2VLLB 5CIPH 2MPAH 4F92B 3NCXA 4IKIA 3NPSC 4YHIA 3PWJB 1U8OA 5HBBA 1NGYA 5J6SA 2QPUA 3OBAA 4GBXB 3AY4A 3Q6GL 3ZE0F 4P5MA 4UZUA 2R4RH 4JDTL 3VM5A 1E27B 1U8LA 4DN4H 1IVLA 2ZUWA 2VRAA 3PUUA 4ZTPL 3WTTA 3C08H 4LARH 4A39A 5D7LE 4L0ZA 2EUWA 3M1BB 3MGAA 4LL1A 1EHLH 3W39A 3E2HB 1B4JH 3LXCA 4JN1H 4S1QL 1WFIA 4YHYC 4OLVL 4D3CH 3L3GA 3G5YA 3RHWK 3AXIA 3S97C 1K5WA 2OXGA 5CJ8A 1NLBH 3B43A 3L4VA 1X9QA 3WFBL 3BT0A 3HN8A 3O41A 3ZO9A 2EADA 5FCUL 3FTUA 1JAEA 5BZWB 2MCPH 2I5YH 3MXVL 3B3IB 5ECJE 1MWOA 5LGJA 2NY6C 1E8YA 1LO2L 3SE8L 4WJ5A 3F12A 1ULVA 1G9EA 1CDGA 4L0PB 3UJJL 5KG9B 3TNNA 4YLCA 1N6VA 1WAAA 1M7XA 1H8LA 1HDMB 3MLSH 1TUPA 3LN4A 4RMBA 4XVJH 5IR1B 5IEKA 3ET9F 3IMSA 2WLNA 3P3YA 1HEZA 4APXB 1FSKB 4LSSH 4PSRA 1B3IA 3G6JE 4HMCA 3GSRB 1IKFH 1OGTB 1SBBA 2JSFA 2Y7QA 4PJXB 3S36X 4E42A 5C3LD 1VACB 1DJXA 2IWKA 3VXMA 2XG5A 3KLHD 5IVZA 2PF6A 2HJKA 2WBJB 1OCRB 3NIFE 3TVMD 2DY2A 4AV4A 3CDZA 1FJ1B 2L7QA 4YAQB 5FW8A 4ZBJA 2VDMB 3IAPA 2V7HB 3L9BA 5DJ8A 4EO5A 2XICA 2J3SA 1NCIA 1OP3H 1YEEH 1U8JA 2W0PA 3QZMA 4O2EB 5DLLA 5T5NG 2ESVB 4ONGL 3DX9B 4N8VB 1ZV2A 1JZGA 1ES0B 4U1KA 4DP0X 1R5VA 2VIRB 5CP3A 4QRPE 1FH5H 4PPTA 3NEOA 1R47A 2MTPA 3VGGA 1IBHA 3IFPA 4L9LB 3LZFH 1W0WB 4UDUA 1E40A 5H37G 3QR1A 3QDJD 4N4YB 4Z7WE 1T2QH 4MKTA 2IXQA 3FB5B 4HCGA 4C83A 4FFTA 4HUUA 4U6YA 2X12A 3ZT6A 3CQQA 5E9AA 3IK2A 5GS0H 4MNGB 3Q43A 5DJXA 3NRPA 5BS0B 3K0WA 1KCKA 1AZZC 1BYPA 2B15A 2XZCL 4KXBA 4F27A 2MSPA 1CU4H 2FR4B 3OQ3B 3BGFC 4Y5YB 3EJYD 3L3IB 2FIKA 2KS0A 3DXAA 4PJGB 5SX5H 4JFXB 2XZZA 3KJ4B 3MRIB 1HWHB 4XO9A 1AHMA 3FT3A 4IDJH 3BQUA 4X9IA 4C47A 1QBML 2KLTA 4XVUD 5I1EL 4BYHA 1RP9A 1DQKA 2CXKA 4OV6F 2DB8A 4HUXB 4HKBB 5INCA 3MFFB 4P3CL 4Z8FH 3IVKB 4N0RA 1E28B 2NUTB 4AYBA 4N8CH 1NPNA 2DQFB 4JZNB 4G71B 1TZGH 4YDVA 5FECA 3BIKA 4L4VA 3UP6A 2EIZA 4EIBA 4NNXA 1A7PL 2FSDA 4BFNA 5EPMA 1CICC 4PMFA 3DGGA 2QSVA 2ADYA 1KLFB 1OSZB 4NC0B 5CUSL 2QBWA 4F2EA 5KVMC 5KYXB 4S0SD 3ZPDA 4JE0A 4X6BB 1CE1H 3C8KB 4XN1A 3T3ME 3PHSA 2NY7L 3DARA 1V7ML 4XCCL 4NCDA 4YFDB 3E3QC 4AGNA 4ZTEA 1MXGA 2NY4B 3KCPB 2EILB 3VU2A 3V52H 2NYYD 5GRVK 1BEXA 1BBDH 3WDJA 4WI7A 2HVKA 2AK4E 2BNQA 5CWSA 4PW9A 5EO9B 2HFEA 1FZKA 1MRDH 5DA4A 2BNRE 1XB6A 1YN7B 4LCWA 5J13C 2VLKE 4IBTA 2ROYA 4MXWL 2NY3D 3DUUA 5DVOA 3HI5L 3VGAB 2CMRH 8FABA 1P7QB 1QWNA 2PTUA 3SBWA 3WUWA 1WT5C 1MDTA 4PY7A 4UWQB 1EAPB 3NZHL 5HI3D 5KSAD 5IBUG 5HYFA 2X4SB 1IM9B 1LK3L 1NCGA 2OMYB 4KHTL 5I8EB 4N0UB 5LBSA 5KS9F 5MEND 4DPCX 2OJEB 4Y2DB 1WGVA 4RAHA 5F8RC 3MAWA 2R9HD 4M7ZC 4M8RA 4ATWA 4C56B 1Z66A 2PWHA 2HLFC 4YS4A 1I82A 3B9KB 3HNTL 3MBWA 4GAGL 2EICA 2VN7A 1HHIB 4AIZA 5AW9B 1FZJB 2Y3NA 3BZEB 2WWKT 4N5ED 4WEEA 3L17A 2OPCA 4G11A 1QR1A 4XP5L 3AQXA 1EO7A 1A25A 4HZLA 4EZKA 5E2UH 1HHHB 4IU2A 1E43A 2HRLA 3GMMB 1Y18B 2X7LA 1HHJA 3CDGA 4P2OA 4JFDD 1B9ZA 3DJ9A 4PB0L 3I6LD 3NFPB 4URTB 3WKQA 1QSFD 3BPLB 1XGUB 5DRNA 3SDXA 5E51A 1VFBB 4PJFF 3JVGA 2ISDA 3V8OA 4EKJA 2LTQB 3PWPB 4OKDA 4NWUH 3B3IA 1MLCA 1A7BA 4LOEA 4XPAL 3UTSE 1GPOH 4R4FL 5B38G 1JD9A 2NZ9C 4HIJA 2DDQH 4BGLA 4BH8A 3LNDA 1IC5L 5LN4A 3VDCA 1TKWA 1ADQA 3V4PL 4HEPA 4Z7OF 5LKNA 1CT8B 3EO0A 3I9PA 4JRXB 4NQCB 4CILA 1C1EH 2NLJA 3PIQB 3SE4A 3I50H 3EBAA 1XSIA 2WNGA 3ASOB 4PJEF 3BKCL 5EEVA 4FFYH 2BSBA 3B6SA 4HEMA 4NO5B 3WU1A 2NY0B 1I1FB 4J3OC 1F00I 1YEFL 2Y5EA 3QQ4A 3WKMH 2WBJA 1ZT1A 1JHKH 2L4OA 1U92B 3B83A 3U2JA 5IVXF 5F0PB 4NJ9H 5F6HJ 1LEKB 5BV7H 3NCCB 4FQHA 1U4EA 1BXUA 4P5TC 5D1XD 3LKSB 4YAQA 2E8YA 3VWJD 2L7UA 1FFPA 3WS6A 3WNNA 5IIEA 5IG7A 1SF3A 2BDNH 2WLHA 2DWTA 2V7HA 1ZJAA 3KGSA 5IQNA 3T0EB 2ZX7A 5K69A 1NCTA 2V5TA 3GPSA 2IFGA 2EXWD 3OAYH 4WNQB 2YQGA 4POZC 5I0XA 1USZA 1IGIH 1U8NB 2P5WD 3OTTA 3CWGA 1C5CH 3DVNB 3KS0H 3HMXH 4TRPL 2NW3B 3FQTB 4WSGA 2VIRA 3ZGIA 1QFWH 1URLA 1QD0A 4RX4A 2OZ4A 4GXFA 1KJ2B 1D9KA 3RFRA 4HQQH 3LIZH 2R7EB 3NJIA 1MOEA 3GPEA 4Q74A 4PJCA 4Y5VA 4V33A 2BIHA 3FU6A 3JBG7 1WIOA 3MLTB 4TPRL 1RQ5A 1XSJA 3A67H 5D4HA 3AACA 3BVTA 1FGNH 3FSAA 3I85A 1JERA 1CDCA 4NPJA 1G7MB 2F53B 4ZX5A 3DSNB 2G4EA 2K9FB 2QFPA 2ZXEB 4DTGH 3AM8C 3RX7A 2WBXA 1F11B 1RERA 3I6SA 4IK6A 3TZVD 3CSYB 3FFCA 5K9JL 2YAMA 1HL9A 3GWJA 4FQLL 2YPKA 5DHYB 4DP5X 4OF7A 3SO3B 2YKLH 4BFBD 2VDRB 2WAHA 3WIAA 1K8IB 3SY0A 1SUHA 1MPAH 2C1PA 1FNLA 5DJ6B 1MFCH 1ROCA 4YHKH 4MHHI 3ARZA 4U1LA 4QKTA 1JXFA 3IRCA 3WSQH 5DHXB 1BQHA 2DYPD 4XMKL 2HJLA 1RD6A 3AS2A 1IFGA 3PJLA 1SRDA 1BXXA 4CNIB 4HKBA 3TM6A 4N68A 4F37F 3LRLA 1ZS8A 1NDMA 3O8XB 2W94A 5K33A 4HT1L 5F1IB 1AC6A 5DS1A 1KTJA 3KLHC 3VG0L 2BP8B 2ZSWB 4ABVA 5JHLL 2F7OA 5ESQB 1J1XH 1IKNA 2EO1A 4YZWA 3IDYC 3VD4A 4DUXA 2PPDA 4FZEH 4KVCH 1OM3H 2GEEA 5HGDB 3VTTA 3AROA 3OV6A 1BVNP 2CDFA 1DBKL 2F15A 5EBMA 4MQTB 4GOSA 1MLBA 3P4NA 4M6ML 1NGPH 4HG4K 3TJHD 5HGBB 4TUJA 1AS7A 1AD9B 1W8OA 2DBLL 2CLZB 3EJSA 1E5ZA 1SN2A 3QEQA 4FHKA 2F5BL 1QSEA 4Y4KA 1KYFA 5DVNA 4YR6A 4JX0A 6TAAA 1YAIA 1IT9L 4QGYA 4NENA 4XXCA 4F7MB 2EJ1A 4FXKA 4LIQE 3QH3B 2ZCZA 1MCDA 3RX5A 1XAKA 3TBWA 4YSUA 1GZPB 2ZPKH 1OQOA 2WTRA 3ZKXC 2WP3T 5JA8B 3O3BA 3O3DB 4PREB 3Q2VA 1RK0B 5DVLA 2QKSA 4PG2A 4YXKH 3M8OL 1IQDB 4X5XA 2Z64C 2VSCA 4K94L 5HJ3B 4XNZC 2A9MH 5I8EA 1F2QA 1IGJA 2K3HA 4OSUH 4OZFB 5TD4A 3F84A 4Z0BH 3QI9A 5T1LA 1R3HA 2VH5L 2L7EA 4PS3A 1FO0L 2K6ZA 3V10A 5G4MA 5I1CL 4RWYL 4OUUB 4UUJB 1AY1H 2AJVH 3DRQB 2SEBB 1UVQB 3TA3A 4YUEH 3A4DA 1Y0LA 4XVUC 3LRGA 3TN0D 3HC4H 1VEPA 1H6TA 1OP3K 3W2DL 1RZJH 3NSCA 1CGVA 1ZT7B 2DH2A 4CVWA 5I1KL 1Y18A 3QCVL 1AE6H 4MX7A 1EHKB 4J4PA 1XGUA 5GRWA 1TZOA 4J1UB 4OT1L 5E0QA 3K6SB 4O5LL 5IKCA 1A3RL 4NRXA 4O02B 3P4LA 1GKOA 1JBJA 2Y23A 3QXWA 2CHNA 2J8UA 4TSBL 3U46B 3GI8H 1BZ9A 5J11C 1BREA 2AJUL 1QPKA 2HKFH 2ITEA 2E7CA 3CHPA 4RMQA 4PV9B 1LE9A 5C0JB 5BMFL 4HC1A 2D3VA 7TAAA 5I0YA 4WUUA 2ZNXA 3G9AB 4MS6A 2CKBH 4CBZA 2Y7LA 2ZF8A 4PJ5B 2NYYC 3HA0A 1OGAD 2AJXH 4LSVL 2J55A 5CBEA 5SX5K 1G9NC 2CLRB 2AQTA 1TU2B 3MUGA 4G9DB 1HE7A 5I8KL 3CFMA 2ID5A 4GW4B 5JQ6H 4IBQA 2DWSA 4PIRF 4L8SB 1ZVYA 3I3DA 3U9PH 5D70L 3WLWD 5J5EA 4M4PA 1LO3L 3CZEA 3EYFA 5HVHC 1D7CA 5FGBC 2P48B 5D2NE 3VRJB 3R7RA 3BKMH 5HI3C 4LSRH 4WWOA 4NUPA 2G0KA 1JZ8A 3KYNB 4OZHF 4MYWB 5IFHH 1P2CB 3MLWL 3CH1B 2R9HC 3N1QC 1GRWA 2R23A 2BLFA 5ITFA 4A66A 3GMLA 2VWEE 5ID0A 3CLEL 1E4XH 4GJTB 3PJSA 4N3TA 2DEXX 4ORZC 3BUIA 4OJFL 2YOAA 4ZMVA 4I0PB 5AG8A 5HHQA 4BCYA 4O58L 2TSAA 2ZYSA 1ETB1 1W9XA 1KCVH 3MRKB 2WINB 2R83A 3PP4H 2XPGA 3APNA 1YJDC 2XN9D 3FUNA 5EEZA 3BD5A 4HUWB 5F7BA 4WWKB 5E6ZA 4P23C 5DJCB 4BELD 2YPLE 4ZMXA 4QHPA 1RZFL 3EH4B 3RNKA 5SWQB 2FLBT 1TJXA 2IADB 2PETA 5ACZB 3FF7A 3E6FB 1EGJL 2Z7YA 5FIEA 1HCZA 2Z0UA 5ERWB 1IIKA 3IXTB 4NT6B 1E4WH 3MRGB 2GTQA 3WO4B 2AAVA 5F9WC 1YNLH 3VQ1C 3RWFA 5ALBL 3QEGH 3KDMA 3QCTH 1KELL 4ZJ9A 4Z7OE 1EXUB 3TCTA 2VXSH 2EEBA 4W6XB 1BD2B 4HLZH 5I5IA 3SDDC 4DVRH 3D48R 5HGHB 3PFUA 1FFOB 1IAII 1LEIA 1FF5A 4KV5E 2CRIA 3DV4A 4PJEE 3EXJA 1KACB 5F71A 4G1EA 3M1OA 3WIHL 3JWNC 2A83A 2AQQA 4ZPVA 2WQXA 3MRQB 4GG8A 1GW0A 2LFEA 3QEUB 4L2YA 3OGOE 4L4TB 4ANXA 3BAYA 4I3SL 1IC0A 3RZWA 1OTUD 1L6XA 3S8FB 5D1XC 1TJIH 3QWRD 3DJZA 4P48A 1QASA 1MY7A 1HL8A 3FUJA 4XE5B 3C5JA 3FB7B 5EZLB 3VDBA 1FDLH 1GS6X 3P0VL 1R3IH 4JVPA 5AZ2L 4YSOA 3W3BA 4GMTL 4MXQD 5FK9A 2J7LA 4PI2A 4EF3A 2MIZA 2CLZA 2F54B 4LK4A 4NDMB 4OD2B 1ZIBA 2D7NA 5BJTB 4I8DA 1O9VA 2IAMA 4M5ZH 2AITA 5ACMA 4JCWA 2Z3FA 1BMGA 3GM8A 5DJYB 5BW7A 2NXYD 4KHXH 3KYAA 1HXYB 1A6UL 1G5GA 2KERA 4N8VG 3SDYH 1HH6A 2WQUA 2B2XL 2F7QA 3CHSA 3CVHL 4IGBC 3RRQA 3ARGD 4HSAC 4JFPA 1M7DA 1CR9H 1J0IA 5C0BA 3S3DB 3MNVB 1LILA 2XT1B 4ERSL 5IBTL 1BM3L 4PJAB 4AYGA 1OAXL 4LMQI 5JNYA 5JORB 1FZOB 2BFVH 3L81A 1XFPA 5GJTL 1FCGA 2I07A 4JGUA 5HY9B 2FBJL 3HE7A 1XXDC 1E4XI 1TQUA 3B7YA 4MCYA 4Z3HA 3JWDH 2G2NA 4M6OL 5BOJA 5E5LA 3MGOA 2EYTA 2Q87A 1OANA 3SPJA 4AENB 4ETQA 4Q9QH 3REVA 1N5AB 1TQBC 1EFXB 1XF2A 1J48A 5T5FL 4PGJA 1X5GA 4UM9D 1WYJA 3RB5A 1WCBB 3NSXA 3Q8FA 1E5CA 5FYKU 3OAYK 1RUPL 4ACTA 4P4RB 4XXDA 1VPOL 2HA1A 1T2XA 1CGUA 3W1ZA 3T6XA 4JPWH 2N7BA 4KMQA 3TIDA 2CJTA 1H3VA 1ZHKB 1CURA 3FCTA 3P1VA 1I1RA 4R3SB 3FB6B 1AD0A 5FYJU 1AVAA 4J1UA 4OD3L 5IHZB 1AR1D 1MF2L 4PRHA 5F7DB 4YXLH 3U9UB 3L7FA 1UM4L 4XGZB 3T4YA 3WAKA 3VGHA 3S96A 4ZX6A 2EDJA 2J5LC 1WCQA 3L6FB 5INDB 2CPCA 3ZYZA 2QADD 1YY8A 1BFOB 3IFOB 4W9HC 3GMQA 4OZGA 3U9WA 1XDTT 2NUPB 3F04A 4B9PA 1FHGA 1ZS2A 2YD7A 3EYVA 2FZ3A 3D08A 3TJHC 3P3SA 5D2LB 4NQDB 1TVHB 1ZE3C 4GO8A 4MXVF 1JE6A 5LDUA 1UWEH 4YQXL 5DMIH 5HGAB 4WI5A 5D9SA 2BVPB 4JEGB 4P2RD 5FUZL 2ZX9A 2Q76B 3ZDYB 4FFZA 4FQ2H 1FVDB 2IANE 5A2JH 1AXSB 1YMHA 3TBTB 1SEQH 3OMAB 1NBCA 1ZRUA 4L8CB 2UZXA 1NOFA 2PYED 4Z78B 1AH1A 3B4NA 3BFWA 3FPXA 2OL3L 3HBPA 3I6GB 1KDIA 4WZ9A 5MEPA 1K72A 1A6WH 2DQCH 3QIBB 5LLIC 1J0JA 3D4CA 5I66B 1PY0A 4JO3L 4EAEA 4EN3B 2EVJA 1FYTE 1QI3A 4NN6C 3WIFA 1F18A 2DWYA 1BZ7B 2QHRL 2F58L 3FW6A 5T3XH 3HC0B 3MRBB 4H0GA 4FYTA 4NHCH 1UD3A 3R06B 4UIKH 3TN0C 2CAKA 1U8QB 5DURB 5TDNA 4LSPH 3EXLA 4PS4L 4NUQA 4YE4L 5F9AC 5AVSB 2WV3A 3MRKA 1FFTB 1O6VA 5DI8B 1GAFL 1NCBH 3WE1A 3PQYE 4HUWA 3JV6B 1EBAA 4YJZL 2FD6H 3L4UA 4LCIH 3OB0H 1Q9WB 4HHWA 3LS4H 2XA8L 3OLGA 1NC4D 2PR4H 1J8KA 1R5WB 1GZQA 4WUKL 4NQEB 3TU6A 4F7TA 1ZVHA 4ZMOA 1N59B 2F19H 4NUJB 1WBYB 4NO0B 4IRSA 5GGRA 3RY4A 1MI5E 1G0XA 2XYCA 2Y5TB 3G5XA 4GI9A 3V0GA 4AEHH 3VWKB 2AABL 4OCLC 5AW7B 5LGYA 3CXDH 3HG1B 4AM0Q 5HGHA 4AKPA 1FFOA 4ELME 4D2NA 4X0KA 1MREH 1MQKL 2C3VA 3EYOB 4UANA 1NCJA 2X0VA 1ZLSL 3AREA 4QYOA 3VXSA 5E70A 3VVVA 3MRQA 3QEUA 3OX8B 2WGXA 3WLWC 3QA3B 3HB3B 4LCYA 5ENWB 5FWRA 1T7VA 4LLWA 1QP1A 4XBEH 5T1DH 1FLRL 4Q4EA 4MQSB 5DJ0B 3ZZSA 3APMA 1KPVB 2IDUA 3LKPB 2R2BB 1T89C 1XV8A 4Y2LA 1G7QB 4X5PA 3FBQA 3SKOB 4JDVB 1VADB 1TCMA 2LGNA 4IMKA 4OZHE 3MV9D 5JHDD 1ZK5A 1A0QL 2BOCA 2M1KA 2XWRA 1ML0A 3G3LA 3GMPB 4TUOB 3PWNA 3OM3B 2Y25A 1M71B 1JYNA 4ZS6D 4KJYB 2LU4A 4H2CA 4PRAB 4UU9A 5JOFA 5EDXA 5FYKD 2VKWA 1OE2A 3IAQA 1BG1A 1ASQA 2XX0A 2C8NA 2VLJB 2YJLA 3HHSB 1F1AA 2DQMA 5JXED 1LJMA 2HT3C 2NX5D 1X5YA 4K3DH 1XIWD 2VRKA 3FH5A 1IC4L 4M8UA 5GRVL 4Y1AE 4FNPA 1SLUA 3QAZB 3NIDE 5FYLL 3H9ZA 3HAEA 4JR9L 4IOSD 1QRNA 4G2AA 4XO5A 1RP8A 1NUGA 1TZHA 1IE5A 1ZGLB 2HPOA 3P02A 4YHNA 2E75C 4U1SB 2CXGA 4M7KH 2BHZA 4KROC 4NKDB 4KJPD 3ESPA 2UZPA 2VR9A 3DOHA 2FTAA 1I1CA 3I3EA 1F6LL 1OM9A 1S2EA 3D4ZA 3BZDA 3IBOA 4MB3A 2HFTA 1MAML 5F7LB 3L3JB 4FJYA 3S36H 3SOBL 1WFJA 4Q2ZA 2DOCA 3THML 4EJ1C 2OYMA 3QZPA 4YHLH 3MR9B 4MJ6A 1RUKH 3MJ7B 5DFWH 1A22B 1GL4B 4KZCA 4JFFD 3X17A 5IHZA 4UBDD 4WDIB 4FQCL 3U9UA 4JKNA 3BSZA 3US9A 4LVOC 5KYUB 3DX7B 2DI8A 2UXVA 1A6AB 3GDBA 4OJEH 5CU5A 2X70B 5K39A 5JO5A 1BIIA 4MJID 4GQZA 3L6FA 1CI5A 2H2SC 4UOW0 4GI6A 1OTUC 3VM7A 3IFOA 2HRHA 4P9ML 1DQDL 3WXVH 2EDLA 2JKWA 1E65A 1L3WA 4G8GD 4ODTL 2RFXA 2DM2A 3FMGH 1JYVA 3ESVF 3CX5K 4JHWL 4KK9C 4YGVA 3KPOA 4NQDA 5A2CA 1MCOL 1VKXA 2YD1A 5TF1H 4Q97A 5LBVA 4FDWA 3FTGB 1ET7A 1GGIH 1L7IH 5DEFA 3QNFA 4FL4C 1S46A 3O0RL 4ZUSB 4DAGL 4HIXL 2NXYC 3IETB 1XF4B 3PAUA 3F8UB 3D0AA 4G8EB 2XTJC 1A3LL 4G6MH 4XN5A 3FQUB 3H3PL 4IW4C 3ARGC 1AJ7H 2EDEA 1XMEB 2R2HB 1JHLH 3L8QA 1X4YA 3QUXB 1A9EB 1U8MB 3JZ7A 2WLJA 3I6GA 3H2QA 4JFQA 5T33H 5GZNA 3RX8A 1INEH 3KPRA 2R2EB 3SSGA 4JL1A 4Y88A 3CXHJ 5C07B 1S7VB 4A7SA 5DRXA 1C16A 3HS0B 4JFUA 2KL6A 3MA7B 3HC0A 3MRBA 4UMGA 3NABL 3GO1H 3TO2A 5HGGS 4XR8C 1TPXC 4UT9A 4MQXD 4YLBA 4OZFG 4NPYA 1KIUB 3D52A 2NZ1A 5LVEA 4LCVA 5I15H 3D85A 1T7ZA 1X4XA 2FEEL 1I85C 5DMYA 5DC2A 1EAJA 2VKXA 5BVJA 1DSFH 4WSKA 5DYOB 3MNZA 1ACXA 5ITBH 2GK0B 1FGVH 4P4KD 2C3HA 4PLKC 3IJ8A 2MHAB 3ATAA 5AWNL 1AR1C 1Q9WA 4J3SA 1RZIA 2KPWA 4BWUA 4Q9RL 2XY1A 3L95A 1WWWX 5AVXB 5EO1A 1JPGB 1XGRA 4QRRD 3JTTB 5JPNB 4OU3A 5IT2H 1M1XA 5ELIA 1RZJC 2BIQA 4LBEB 4E41B 4O2CA 4LP8A 4WFGD 4GQ9L 4QRTA 4FG6D 4V1DD 1KN4L 4ZUUA 2V3EA 3QNXB 5GS2D 1LXMA 3WTUA 5D71H 2X0UA 5C9JB 3HFML 4DW2L 3BMWA 4MJ5A 1OCZB 3PUCA 2GEQA 4KXCA 4EMZA 3KHOA 3GIVA 2UY7A 4LL4A 3UYRH 2WW8A 1J5IA 3IMTA 3SKJL 2BC4A 2FX7L 3DGCR 2QLVB 1DQLL 3O4OB 4L29B 2CGYA 2K78A 4LU5H 5SX4H 2ADIB 3UGUA 1O9ZA 3P9MB 5DXWA 5GRZA 2GQHA 5ENWA 4E68A 4K3EH 4OLWL 2PYFB 2Q2EB 4JM2B 3C09C 1TQWA 3M17B 3RWGA 3DVGB 1QEWA 2MPAL 1KPVA 1RZGB 4AJWA 1ECYA 3LKPA 2ZKMX 1FIGH 3EGXB 2R4RL 3CPUA 3GHEH 1KBKA 4DN4L 1RUQH 2IDTA 2YA2A 4JQVA 4LSDA 3C08L 4LARL 1M71A 4MMZA 4NLAA 4KJYA 4ZAKD 1EQWA 5IQOA 3SB3A 4MS8D 1B4JL 4OVVA 1LEGA 1OPGH 3ZY7A 1Q8MA 4JN1L 2NCMA 2VMDA 3PPSA 4D3CL 3KL5A 3OXSB 3Q3GB 4XMWA 2ROXA 5GS3A 1HCFX 4NX0A 5ICZA 1J5OH 1CIDA 1RMFH 3KR3H 2O6DA 1ODUA 4OZIF 4KZEH 1OT4A 3OKKB 5L4JA 1IV8A 2QPEB 4UI2A 4A7UA 1XF3B 4CN6A 5I76A 2FT7A 2I5YL 3RLSA 1KXTB 3BZ5A 4J3VA 1OD9A 2BSED 2YGVA 3QPXH 4Y16B 3ZRCC 2YR3A 1CS6A 4AVIA 3ZGHA 1WICA 3GD1C 1P9MA 4CDGC 1ZGLA 1RUMH 3MLSL 3QNZB 3ULVD 1EDQA 2BCMA 5J1AB 2FHFA 4D9RD 4W4OA 3OZ9H 3K72B 4P07A 3MRDA 3Q2CA 1BYOA 3IU4L 4LHQB 1KYAA 1NCWH 1YC8A 2E9JA 2KQNA 5IP4A 4Z23A 2X10A 4FI6A 3RX9A 1T5XA 3ILEA 2ATAA 4DP8X 4ZMPA 3EYSH 1D7BA 4NSKB 1P69B 3UACA 5D7JC 3MR9A 4RMSA 5AZUA 4KXAA 3QG6B 3F58L 4WKZB 3GYRA 3ZE0B 4RMUA 3C5ZA 1ZANH 5DLMH 4DGIL 3F7YB 2X70A 5HVGB 3VO0A 3ETSA 2AEWA 5TE7H 3QUZD 3Q5YA 4U1MB 5GJSH 2GSIB 3KLKA 3WTSA 2D0GA 4QRBA 4AQ8C 1J05A 3T8XA 4M4RB 2E7HA 5JYMA 1NAMA 2AKRA 3CU1A 1FH5L 3GHBH 1JK8B 4PB9H 3OB0K 4TL4A 3ZHDA 4X99A 3LZFL 1PG7W 3D9AH 3SHSA 4F33B 1FQ9C 4I5BA 2Q10A 3HG2A 1GIGH 3D2UD 1T2QL 2NSQA 5SX4I 1RIVH 2WQAA 2X42A 2UWEA 1MW1A 4DGUA 4XZ4A 5JDJA 1YQVH 5GS0L 2WXQA 4EVNA 2ZYRA 2VO8A 5EZIH 4D0CA 1TZIB 2CRZA 3RIFK 3TT3H 5JXEC 2NW2A 1XIWC 2R0WL 1S7RB 1H3XA 1E5YA 3VD9A 1G7PA 4NQXA 3MDJA 3OQRA 3U2SA 5GGVY 5EFIA 4I18C 2C26A 4IDJL 5DJAA 3MLYH 1SJMA 2XWJA 5DUBA 3HS0A 2D9CA 3BVVA 2X4QA 5IQ9A 3ZE1F 3MA7A 1PDKB 4AK1A 1ZWIB 4G8AC 4KJPC 4ES8A 3GSNA 4Z8FL 5EIIB 2QQLH 1CLVA 4N8CL 3BO8A 3QRBA 4N25A 1TZGL 2A77L 5MI0B 1EAQA 2AXFB 1AKPA 1ID5I 1FV1A 2G5RA 3AT9A 5E24E 3MLRL 2D3NA 2Z6FA 1RZ7L 3JWDC 4KUCD 2AJSH 3EDEA 5KSVA 5EC2A 4PBVC 3RWIB 3F83A 2VLRA 4A63A 1ZSDB 2VL4A 3ISYA 3PREA 3T08A 1CE1L 2QSTA 3O6KH 5DS8B 1E9QA 4Y19E 4YK4C 1UEMA 2PKDA 3V6OA 5MENE 4UILL 2VMEA 4PGBB 1A6TA 1ET5A 1HKFA 2O6EA 4OFYA 4ABUA 3ARXA 3IGAA 3RTQA 4F7EA 1YUHB 1T1XB 2WJ7A 1BBDL 1O7VA 4PU2A 3IF1B 4X7SH 4ESKA 4PJ7E 6FABH 2GCYB 3FPYA 5KYNA 5HI4C 3S6CA 3P77B 1ADQH 1MRDL 1OTTD 3U79A 3WTYA 5D5ME 4FTVA 1AGDA 1I8MA 3T0WA 4HDIB 2CMRL 3D18B 4F9LA 4L29A 5D7IA 3I6LE 2DM7A 2WXOA 4F7CB 3BSGA 1F97A 3RKPA 5TJWK 4XP1H 1UJ3B 4JM2A 3CBRA 3VCLA 1PKQE 4H5SA 5GHWH 2XWBA 3PDOB 1UCBH 3V55A 1TTUA 1UUSA 2X9XA 3D0VA 3H4HA 2IH1B 4QNPF 4ELKA 1FYHB 5SWZE 4D7BA 5ADPH 1W6WA 2A6KB 3D07A 3L1OH 4YZFE 1LYQA 3V4PB 4IRJB 3RVUC 3U4KA 5TGBA 2HLAB 2DBJA 3IBEA 5A6IA 3E8UH 4H8PA 4PM1A 2PCPB 3KPQB 3TBVB 2H1LM 2VDQH 2LLLA 3MRMA 2X4RB 1M3IA 3HR5B 2OZ4H 5E2UL 1TYEB 5D8JH 3G08B 1DBAH 2WSKA 4Y7MA 2A9DA 5EN3A 1KZYA 2WLIB 1HXMA 1WP6A 5HVWA 3WJLC 1HC1A 3TP4A 3ARWA 3VRLE 2KDYA 2XXMB 3NCMA 1NFDA 1Y6KR 2WZPA 3NFSH 1XF3A 3V0JA 3PGFH 5DZJA 4NWUL 1CG9B 4P4KC 3WKPA 1GPOL 1SQ2N 5C09A 1LTXA 2G3MA 2NNAA 3LKQB 5IB2B 5IJCC 2DDQL 1RSYA 3ML9A 3NH7L 3LCYA 1M1SA 3LEXA 4AX3A 4LDEB 2ZP0T 2H2PD 4ZOBA 5C0IB 1KYOK 3MNWB 2P5WE 3UMNA 3QNZA 5G4NA 4Y9CA 1C1EL 5B3JF 3I50L 5J1AA 1DVFA 1FZMA 2WQRA 3DV6A 5LWYH 2GJJA 1JV2B 4PJ9B 5J9PB 3K72A 4FFYL 4JFZH 1T21B 3BH8A 5FC9A 2CCVA 3TBSA 2HTLC 3QO1A 5KS9B 5D1ZA 2ZUQC 2W88A 3WKML 4ZFFB 1JHKL 1I4FA 4NJ9L 4KY1H 1KB5B 1GZHC 5BV7L 2BVQB 3IGLA 3E9TA 2APVA 3Q0HA 5DZLA 4WLCA 2XYBA 1J8SA 1WF5A 3VI3F 4BUHA 2RALA 4LOUD 3MC0A 2GSIA 1IGIL 1H5BB 3AU1B 1C5CL 4FCHA 1KSRA 3HMXL 1CGWA 4WWPA 3LEYH 4JDZB 5FUCE 4M4RA 4I3GA 4RFEB 1QFWL 3GSWB 4Y0GA 3AGWA 4U3SB 3UDWC 1ACCA 2A74C 2NPLX 2Y5QA 5T1MA 2UVFA 3MV7D 3LIZL 1NUDA 4ENEC 2ENPA 3F7KA 4QTHA 4F33A 4FJ6A 3SDAB 3V0AC 3P69A 4PJFB 4BFJA 4XB8A 5IROA 3QGVA 1DQVA 4ZAKC 3A67L 3U25A 3OHXC 1RZ8A 3CHXA 3Q44A 1FGNL 3H9HA 4H1LA 5A43C 4XOBA 5GRUH 1UXWB 4BFFA 3S3PA 1AG6A 4OIIH 3V9EA 1D5XA 4DTGL 4ENZA 1I8LC 2IWGA 3ISRA 1VERA