4KNTA

Copper nitrite reductase from nitrosomonas europaea ph 8.5
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
285
Chain Sequence
KTVQVTLHAVETDVAYDNKGSTYRAWTFDGKVPGPVVRVTEGDTVEFTLINDKNSKNSHSMDFHAARLDVVEDFESIKPGETKKYTFTADNPGVFFYHCGSDPMIQHIARGMYGVIIVDPKDANALPKADREYVLIQAEHYENPDDKTAMMQNKWSNVVFNGGVFKYDPVHDSEATSWLQAKPGERVRIYFVNAGPNELSSLHPIAGIWDRVYPSGNPKNVQYALQSYLIGAGDAATLDLISPVEGANAIVDHSMRHAHSGAIAVIMFTNDADPEAGRGENILIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of a nitrite reductase involved in nitrifier denitrification.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Multicopper oxidase type 1
total genus 89
structure length 285
sequence length 285
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kntA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kntA01
4GP4B 5I28A 1BXAA 1PZBA 3AZUA 8PAZA 4DPAX 3X1BA 3S3CB 1V55B 2RACA 2R7EA 2YAPA 1IUZA 4G70B 4YSOA 3TBBA 4TXVB 1E5YA 1GY1A 2VW6A 1J5CA 2IAAC 1SF3A 3PCYA 4UF7C 4NB7A 1ZV2A 1CUOA 5LDUA 1OE1A 1SFDA 1NWPA 4PCYA 2XV0A 1A65A 3FU7B 3ZIYA 2MTAA 2PPEA 3T9WA 4E9RA 2QT6A 1A4BA 4DP8X 3ZDWA 3CVCA 2BHFA 4JKNA 2FQFA 4DP1X 2OV0A 1XB6A 1SNRA 5B7EA 4GP8B 2CALA 1PCSA 3ZBMA 3FPXA 1L9TA 4KO7A 2BP0A 2AVFA 3FSAA 3PAZA 3AG4B 2YAFA 3WIAA 3NJKA 4YSAA 4UANA 4N4YB 3FQYA 3OMIB 4E9VA 4KOBA 3SBPA 4YSRA 2N0MA 3OQRA 1EHKB 2DV6A 3S8FB 1N68A 3PAVA 4HHGA 1ZDSA 5AKRA 1AOZA 3TA4D 5F7BA 5F7AA 1NINA 3NJJA 4NAJA 2BP8B 1ILUA 1L9SA 2YAHA 4ENZA 3FS9A 2CAKA 2QPEB 1AG0A 1PLBA 2E86A 2YARA 3CZUB 3ABLB 1GS7A 2W8CA 1BQKA 2WO2B 3NJMA 3OM3B 4E9YA 4HZ1A 1BYPA 4X4KA 1AZRA 5ANHA 4DP2X 4KNTA 2I85A 3JTBA 3IEAA 2BW5A 3NJLA 6PCYA 1PF3A 5E9NA 2GHZA 1OCOB 1L9PA 4DPBX 2LLNA 1AIZA 4BXVA 3S3BB 2GC7C 3T6VA 1OF0A 1KBWA 1AANA 4YSTA 1AG6A 3NSCA 1JZEA 2ZOOA 3AG2B 2AZUA 1SHWA 1L9QA 1NIEA 4HHWA 4Q8BA 2BWDA 1MDAA 5B7MA 1JERA 4DP5X 4JHUA 1A4AA 3QJQB 4BWWA 1KDIA 1F56A 1JZJA 3IN0A 1HFUA 3QJTB 1DYZA 1SJMA 3HEIB 4P5RA 4N8UA 2HLEB 2VW4A 2BWIA 1NDTA 2FNWA 4G71B 3G5WA 2J56A 4KOCA 4W1TA 3FT0A 3UABA 4YVNA 1KYAA 2UXGA 3U25A 5AFAA 1AZUA 3IBOA 1M9WA 2EIKB 4RH4A 1EZLA 1WA2X 3DIVA 5AZUA 1SDDB 1AZBA 3ABGA 4L0PB 1OCRB 3EH3B 5I6OA 1ET5A 2Q5BA 3WNIA 1IC0A 1KDJA 2VN3A 1MZYA 1PLAA 5B7FA 1PMYA 4GXFA 1IKOP 2J5WA 4HCGA 1QNIA 1NWOA 2VM4A 1AZNA 2EIJB 2X87A 5I5JA 4F2EA 1X9RA 5D4HA 4GYBA 1PZAA 1X9UA 1M57B 1ET7A 2H3XC 3NJNA 1ID2A 1BAWA 4YSCA 1B3IA 3MX0B 1WA0X 1KBVA 4W9ZA 4A2FA 4P5SA 1XMEB 3X1FA 3RYMA 1J9QA 2HRGA 3KW7A 1XB8A 4G7RB 2CBPA 2TSAA 2X88A 4AKQA 1AQ8A 2GB2A 2JKWA 4HCIA 1JVLA 1ET8A 3H4FA 1WA1X 4HIPA 2PPDA 4BWUA 3NYKA 4E9WA 1L9OA 2I7SA 4AKOA 3AG3B 1PNDA 2XX1A 4KO5A 5I6MA 3PXLA 4YSUA 3OMNB 2PLTA 1QHQA 3BVDB 1GR7A 4HALA 3FU8A 5EHFA 2H5UA 1A4CA 2J57A 1RZQA 3NSYA 4KO6A 1NPNA 2XVBA 3CDZA 2ZONA 3PAUA 2XLLA 4G72B 1ZPUA 3KW8A 1M56B 2HX9A 4BWTA 4A2DA 2HX7A 4YSEA 1NIFA 2QDVA 1CURA 1IBZA 2YQBA 1T5KA 2XX0A 2XWZA 2FQDA 1OV8A 3FU9A 4GP5B 3V9EA 4BXSV 3QJRB 1GSKA 1VLXA 4QKTA 3FSZA 2AFNA 3FYIB 3NSDA 3QJUB 1ZIAA 3FSWA 7PCYA 2YXWA 2DYRB 1YLBB 1HAWA 1V54B 1ASQA 3GYRA 3EH5B 3QJVB 3TU6A 3HB3B 2PP7A 1E5ZA 3NJIA 2OCCB 2CUAA 2W88A 1RKRA 4DP0X 5A7EA 1AAJA 2VMJA 4E9SA 5I5MA 1PLCA 1MG3C 1AZCA 3EH4B 1FFTB 2CCWA 4YL4A 1E30A 4KNSA 1ZIBA 1I53A 4EF3A 1MG2C 3UAEA 3ZX1A 2GI0A 2R7EB 3SBRA 1TKWA 2EINB 4M4RB 1W6LA 4A66A 1NZRA 1TEGA 1QLEB 4F2FA 4PAZA 3S3DB 1AS7A 4AKPA 3H56A 3V9CA 2BP8A 1J9RA 4GY4A 2AANA 4YVUA 3ASNB 5I6LA 3CVBA 2BZ7A 3WKQA 1KV7A 2IDTA 4A2GA 3WG7B 1JXDA 3DTUB 2FTAA 3AW5A 2YAOA 4DP9X 2UXTA 1XB3A 2VSMB 2Y69B 4A67A 1OOWA 3UAAA 1L9RA 2ZWNA 4AX3A 4BDVA 1BQRA 4E9TA 1URIA 3IN2A 4KNUA 3X1GA 2BP0B 3TASA 3MBWB 5D4JA 3NP3A 1ETJA 3NSFA 2UXVA 3L45A 2B3IA 1AR1B 1NTDA 1FA4A 2PCFA 4HAKA 2HRHA 4Q89A 2GC4C 3NJGA 5D4IA 1ASOA 3WNJA 3UADA 4UAHA 5B3SB 1RZPA 1JXFA 3T6ZA 1IBYA 2WSDA 5TK4A 3EHBB 3UGEA 4AZUA 2FJSA 2PPAA 4G7QB 4A2HA 3S8GB 3EF4A 7PAZA 1NIDA 4CSZA 1SDDA 4FAAB 4DP4X 3NJFA 1E65A 2P80A 2XV3A 1SHXA 4JHVA 3AG1B 2HXAA 5B1JC 2IDFA 1PAZA 2PPFA 1NIBA 3ABMB 1AS8A 3QQXA 3PPSA 1JXGA 2IDUA 3WI9A 3X1EA 2TSBA 2QDWA 2DYSB 2XYBA 3OD3A 1NICA 3SQRA 3N2JA 4YSPA 4DP6X 1R1CA 3OMAB 2VSKB 2PP8A 2IWEA 4YSSA 2A3TA 1OCCB 2ZXWB 1BQ5A 1CYWA 2PPCA 3JT2A 2FT7A 1ASPA 2HZHA 1SF5A 1HAUA 3C75A 3QPKA 3WKPA 2EILB 2UX7A 1SFHA 2YAQA 4FA7B 3N55A 2FQEA 3ABKB 2JFCA 1CC3A 1JVOA 1JZHA 2EIMB 1V10A 1ADWA 2J55A 2XXFA 4YSDA 4BK5C 2IWFA 1KCWA 1JOIA 1WS8A 5FC9A 1BEXA 5B1BB 5B1AB 5I5IA 2Y1AA 2OJ1A 3H4HA 4WKXA 5IY5B 3TBCA 3FYEB 2FWLB 4A2EA 1MZZA 2NRDA 1KGYE 2VW7A 5I6PA 1PZCA 2VM3A 5PCYA 1ZDQA 2PCYA 3T6WA 1OCZB 1DZ0A 1W6WA 4WTQA 2P80D 1WAEA 1PNCA 1PY0A 2JXMA 5PAZA 2BZCA 3IE9A 6PAZA 3FPYA 3GXUB 2BO0A 2XXGA 3PLYA 2IWKA 3CG8A 2GIMA 2IH9A 1CYXA 4QLWA 1TEFA 1OE3A 2H47C 3T6XA 4HCFA 4NERA 3CDZB 4YSQA 1FWXA 5I26A 1GS8A 5I6KA 2GBAA 3NP4A 2PP9A 2IH8A 1BXVA 2XV2A 1E67A 1GS6X 3ERXA 1NIAA 1OE2A 2FT8A 2YAMA 1WS7A 3T71A 3X1NA 1NPJA 1A3ZA 1AS6A 3FU7A 4K9JA 1N70A 3SBQA 1JZIA 2FQGA 1BXUA 1KCBA 1BYOA 4ZK8A 3BQVA 2XUWA 2BW4A 4AI7A 3FQ2A 4F7KA 1J9TA 5B1KA 5I6NA 4E9XA 1TU2A 5TK2A 2YAEA 1JZGA 2DWTA 1UATA 2Q9OA 4BDVB 5B1JA 3ASOB 1J9SA 3NJHA 2DWSA 2IDSA 2YXVA 1W8EA 4MFHA 9PCYA 2UX6A 3QJSB 4KO9A 1GYCA 4M3HA 1A8ZA 4CSPA 3AY2A 1GW0A 3GDCA 3D12B 2XU9A 3FQ1A 4DP7X 2HX8A 3UACA 2UXFA 3X2QB 3CVDA 1J5DA 2CJ3A 2IDQA 4E9QA 2GSMB 1RCYA 3DKHA 1JZFA 2AZAA 2QPDB 3FSVA 1GY2A 3NT0A 2WO3B 4G7SB 2DY2A 1AACA 4DPCX 2MRYA 2B08A 4A68A 2I7OA 1ILSA 2FT6A
chains in the Genus database with same CATH superfamily
4Z0BL 2FX7H 5AYUH 4BCXA 2IAMA 1R9FA 3OJMB 2PCFB 3EYUH 4APXB 3LV3A 4ZTPH 2NXZD 4HBQA 1F4XL 3O3UN 4N2FA 2PYFA 4WK0B 1LWJA 5KSAD 2ESVE 1SJVA 1WTLA 1RFDH 1RJZB 2WMPA 1GPOL 1IRAY 3IJSB 1UCTA 2OTPA 2BDNH 5JXEC 1YEKH 4LOUC 2UYLB 4PRIB 4HWEL 3CFUA 3BWSA 4XXDB 2PPEA 2FX9L 5C0AD 2XIDA 2YPLB 2PO6B 4XI5C 2NZIA 5EEYA 4GBXB 4NQEE 4OF0A 3HBZA 1CLYL 3MLUL 2ZPKH 2IPKB 4JKPH 3HAEG 1RIUH 1A66A 4PJAF 3DGDA 4KX8A 5FKPB 4HEPA 1I3RA 3QUMA 4N0YH 5B21A 4JDVB 1IGJB 3C5ZD 3AABA 4R2GD 3ZBMA 4AK1A 1TZOA 4GSQA 4L3EE 5B3JF 5EORH 3FSAA 4TSAL 2CQVA 4APQB 2OSLB 2FIKB 1D5MB 3B3BA 4EZMA 1WZMA 2X3BA 2YN3A 4H88L 1CFQA 3MX0A 2RTTA 3VTAA 2ZOWA 4FZEL 3HMXH 2DV6A 5IESH 4JKLA 3Q8EA 2WXFA 4P2RA 4MQTB 2VXUH 3PAVA 1G9MH 4PJ8B 3UMTA 4DHLA 3F12B 5A2KH 1MHEB 3CU1A 1S7XA 3D0LA 5ENWB 3WEXA 3G04B 4G5AA 4RCAA 3L5WB 3M1BB 4KH2A 1MW0A 5L9DL 1MUJB 4R8WH 2F53D 2E9JA 2JE8A 4F7PB 5CF3A 2CDGA 3VXSB 5CJOH 4PB0H 2HTLC 2I9TA 1U2YA 4Y4HC 1NUDA 1AZRA 3T2QA 2NOYA 2VRQA 5BVPL 4L3CB 3PWPA 5GZOD 4F5CA 2KS0A 5LCVH 3GMMA 4U1GC 1S7SA 5DEGB 5DJ0B 2JLLA 1LEGB 5E9DB 2ZKYA 1BD2E 4XP6L 4Q9QH 4MMZA 1EXUB 4LKCB 2GC7C 1E4KA 1A5FL 3WFBL 5T3XD 4PJ5B 4F7MB 5F9WC 4N1CA 4QJ3B 5LLIC 1FV1B 1GGBL 2Z1KA 4OGXL 4HVBA 1Y0LA 4X6BA 1RU9L 4RGMC 5B7MA 1H3PL 3TEZA 4QD2E 5TFSL 5DJ8B 3S34L 3U0PA 4L4VD 2A5UA 4XXCC 2J1XA 2GITA 3PQYE 3QJTB 1U8KA 3L4WA 3MV7E 5LGYA 4RFNB 1SXBA 3H3KA 3HMWL 1NDTA 2DICA 3EFOA 4TYUA 2ZUSA 4D0CA 2OL3B 3G5WA 4LIQH 1T21B 3MGOA 5E2VH 4DO4A 3QJHB 5E5MB 1OHQA 5DD5L 2UV3A 2WUCH 5E8DL 3RVWD 3UABA 4WWOA 1Q8MA 5GRWA 3K2MC 1ZXKA 3O81A 4ZW8A 3RWGA 4MXVE 7FABL 4XCFH 5C2BL 2NXYD 1CXLA 5JHLL 4KFZC 1LE5A 2GTWA 3WNIA 1EHXA 3UO8B 1E2WA 1UM4H 3CPUA 4WEBH 2NCEA 3ULUE 4LARH 1DBMH 1Y18B 4GAYA 4LBEA 3SKUD 5DGQA 5ETUB 2NUPB 3BW9B 5BZWA 3V5DA 2EIJB 4BBWA 1KCUH 2AJ3A 2IV9A 2X7LB 3ZYZA 2HKFH 3DX1A 4RVBA 4X5WA 3UTPD 3PHAA 1X9UA 1WE5A 4JPVH 5FV2A 1K6QH 1P7KB 4RMQA 1BAWA 2UZYA 4NENA 1TMCB 3EFFA 4A6YA 1KBVA 1LEGA 4GQQA 3L5IA 4NRZB 3PV6A 2EYSB 4XP4L 2HSIA 5E1AA 1XB8A 2QPSA 3QIWC 5E5RB 3HCVB 3U2SA 4H20L 5T3XE 1TZIB 2WW8A 2OXGA 1JS4A 4JL1A 1AHMA 5GGVY 3V4VA 2ZG1A 4Q9RL 5DXWA 4KJQC 3TYFB 4M6NH 2DWYA 5FYJH 3DJ9A 4C4KO 2AQTA 3Q2WA 2NW3B 3SDCC 3HS8A 3ARBC 3KLQA 4HAFA 4YSUA 2MQGA 3BUYB 4IHOA 2WAQA 4JFEA 2F5BH 1GR7A 1BIIA 3RZCD 3C5ZA 3KL5A 5EO1B 3CH1B 2W91A 1WJ3A 5DO8A 2IPUK 2R83A 3CX2A 1FG9C 3NH7L 5IJKA 3GRWL 2HYMA 3Q01A 3LRSB 4G72B 3FTWA 4RRPM 3QJZA 3WJLA 5LGJB 2EP6A 2F19L 4GSDL 3OHMB 1IBZA 4FYTA 1WGOA 4GG6E 3B2UD 3L7FB 4X5QA 3RDTD 3FFDA 3QZWG 1G0XA 4YWGL 4PJ9D 5FKPA 3VUAA 4ZUVA 3L9BA 4A1RA 4QWWD 4IOIB 2VAJA 3TCTA 3WDHA 1M1SA 1MRFH 3IDJB 2X44D 4PVBA 3L4YA 3OKLA 1T7VA 5IV2B 2ENPA 3V5DB 4O9HL 3F7PC 4P9HL 4NO5B 3O9WA 4O5LL 1B3JA 3FH7A 3NCFB 1FE8L 2WUBH 1QASA 5F3FA 2JB6A 4DCQB 3VD1A 3HI1B 1SHMA 4N0YL 2BS8A 4KQ0A 5BZDA 3K8KA 4W9IC 3X11B 2CR3A 1BBJB 3NPZB 2FO8A 1EFXA 5IBLD 4JQVA 2MPVA 4HWBL 1AR1C 1PLCA 2QVFB 1G9NH 4JVUA 1J8HE 1MFBL 1ECYA 4BH7B 3HNTL 2GI0A 1MUJA 1GCYA 2DLEA 2ZNXA 1TKWA 3DRTB 3I3EA 1K3IA 5BV7C 2J8UF 1QLEB 4FKEA 4WWID 3S96A 3AY4A 1T2XA 3FOLA 3QUXB 3WIIL 4PD4K 2B9BA 1TTRA 5J1AA 1AGFA 1HH9B 4OLYL 5BOJA 3RP1A 3TP4A 1T2QL 4GKZA 4BCZA 2FEEI 5DURB 3RL2A 4AL8C 2AANA 1TNNA 3LH9A 2F9BT 4JGUA 3I9GL 1FNLA 3TXAA 4KVNL 2CKBL 3QORB 1NEZB 2CGZA 2OCJA 3DTUB 3FQXA 2EH8H 3GGWA 4ZPTB 3AW5A 1IC4L 5EBMB 2YAOA 4TVPL 4HIJA 2UVFA 3U9UB 1RSYA 2GJRA 4RAUA 4X9IA 1YPZB 1B6UA 2CHWA 2JJSC 3PWJA 3W82A 5IMKA 1BQRA 5LG6A 5GGRY 1H5BB 4KNUA 1IAOB 2G5RA 2ZOLA 3QXWA 3NP3A 5K1VA 5I76A 5LGKA 1HTYA 2WSKA 1UB5A 3D4ZA 5SX4I 3FQRA 1DVYA 4EN3C 5I1EL 3LZFL 1AR1B 3EJJX 1SBBA 4Z3GA 3FOMA 4JJ5B 3HE6D 3HRZB 4HULB 3LKRB 3P0GB 5D7KD 2YA2A 3RWFB 2WIIB 2WOYA 1W0VA 5DQJA 4A6YL 4AYSA 2FZ3B 5BQ7A 2B2XH 3QP3A 4YX2L 1HEZA 3U46A 4ZW7A 2WO4A 1PG7X 2FSDA 3CQPA 1WF5A 3E1ZA 4D0DB 1RK1B 3MV7B 3PUCA 3SQBB 4MD5A 3QHTC 3F7RA 2K3TA 3N42B 1DQLL 2L7JA 1T7WA 1ZA3B 3DMMD 3CZSA 5ADPL 2E76C 3VD0A 3MTXA 2EDWA 3KLKA 5GRJL 4U0RB 1R19A 3W9DA 3CN1A 4CVXB 4MASA 5C70A 1LXMA 1XCTB 4QXGH 1MY7A 3MV9B 1PCXA 1CDCA 2YUWA 3LNFA 3SQRA 5ABDE 4NHCL 1MNUH 3RL2B 1QLRB 3S3SA 1JMZA 3U7WL 4L8SA 3MV7A 3B6SA 4AMWA 2ZUTA 4X4YB 1BQ5A 2EDJA 1KLFA 1RZ8A 4K7FA 1QBLH 4U7KA 3N42F 4ZZKA 3KLAA 3DGGB 5CR1A 1OB1B 3T1FA 4B9FA 1CI5A 4K3JL 4JM0A 4WFGE 1XF5B 3DMMA 5EFIB 1TJXA 2W9EL 3VXPA 4MBRA 5K1NA 2B0SL 3BPCB 4P57B 3JTTB 1BEXA 2EE2A 2C8NA 2B20A 3NDYE 4JQIH 4R90L 4L4TD 2WYTA 2H9GA 5T5FA 4NPYB 5TH2B 5J6HA 3HG3A 5I6PA 5D1QB 1V3MA 1W9XA 1WWWX 1CFNB 2BLFA 3S36H 3VXUA 3FQTA 3WNKA 4Z5RA 1F58L 2P5WA 4Y1AE 4NYLA 3QUMH 2WVVB 3ZOAA 3LDBC 5A16B 4CADB 4CU8A 3FQXB 2C4FT 4ONOA 1RVFH 12E8L 1S7TB 4JRYD 3SKMA 2QHRL 3VXUD 2GPZA 1LO0H 4BFOA 4IMKA 2Q2EB 4M5SA 4NQDD 2ZX6A 1XSOA 5JOFA 4R4FH 1BPVA 3RU8H 3SPJA 5ILTL 4MQ7B 1FVCA 2DW5A 1OE3A 1A7OH 1U8PA 1WEJL 3KS0J 4FFZL 4UIMA 2QPFA 1X44A 3EXJA 3REWB 1JZ2A 4JO1L 4CMMB 5EF2A 5HDQH 2VLRE 3G08A 1RPQA 2IJ0C 1KFGA 3L13A 1QI3A 3OX8A 3M45A 3B7TA 4XNUL 5I1DB 3KPNA 2ITCB 3GTVA 2YD8A 3CFCL 3DETD 3X1NA 4AXWA 2F54E 4OZIF 2HTLD 1OSPL 4XPHH 1UG9A 3QQDA 5KVGE 4XOBA 4OF3A 5DRWB 3LXCA 5JHAA 5FUOL 1EAQA 4CNIB 4HEMA 1RH8A 3QIUA 1BVKB 3C60A 5I6NA 2AXFA 2BVPA 3BKMH 1SM3L 4K3EH 4IBVA 1CDGA 3LKSA 2Y4SA 1I8IB 5HD8D 5DF0A 2PUQT 2R4RH 1A8ZA 4PJ7E 1QFUL 2R0ZH 4F2MA 2EACA 1ORSA 4LFHD 3B56A 3O8XA 1D5BA 3QORA 4LDOB 4MQXC 5MEND 5DFVD 3K1DA 4LF3A 4WV1B 1EHNA 3A6OA 4FG0A 4I3GA 4GQ9H 4QF1B 2XQBL 1BQUA 3FFOA 4LPWA 4QO1B 3GUTA 1KLGB 5D2LA 3PGFH 5JR1L 1KXTB 3BH9A 3UC2A 2MRYA 2HRLA 1O6SB 1PZ2A 2I5YL 4XO5A 3MNMA 1QR4A 1NCCH 4DPAX 4OD2B 4GO9A 3WIIH 4K71C 3WUZA 4MS8C 5G5DB 1RIVH 3TM6A 1UZ8A 3EG9A 2NY3B 5CGBA 4EJ1C 3ZTJG 2ZKHH 3PP3H 1WV7T 2F1BA 4BZ1L 1BD2B 3FO0H 3O6FD 3WOVA 1IEAA 3L1OH 3BH9B 4RISL 1LEIB 5DVLA 4WO4B 3D5OF 1QSZA 3QE5A 4APQC 4Q52A 4TNFA 3MCLH 3BT0A 3A22A 3NZ8A 3NAAL 3ROLA 2QR0A 3E8UL 3LNDA 3KPLB 4CADA 1EUTA 2OYLA 5CD3A 3RVTC 3RIAF 4DP1X 4ETYA 1U8JA 1WWBX 4GAGL 1CL7L 1GJUA 5BVJA 1QO3B 3BAKA 5EZPA 1BQSA 2KL6A 1W80A 2Z0UA 3MLXH 1VFOA 2O1AA 4P2RB 4PREB 1YEDA 4ENED 4K9EL 1KN2H 4YHPA 3MV9A 3K72B 3PWPB 5IFAH 4G9DA 1ZRUA 3NZ8B 1I8UA 1AKJB 3BISA 4HWZA 5A3IC 2R0WH 4XC1H 2Y6SC 3VFRB 3KCWA 5E8EA 1E6OL 3MLZL 5E08L 5FO9A 1REIA 2WXLA 2Y5TB 3PIQB 1ILUA 3L6FB 3UG3A 1SYSB 4FCHA 5F7MC 1H15A 2YARA 3WTUA 3HC2A 4J3OG 4EXKA 3INOA 3OGCB 1FVDB 4NC2B 3O9WD 4KKAC 2WGXA 4AJWA 1J8KA 1SN5A 3VWKB 3OG4B 1T4KA 3BPCA 5G4MA 2YPVH 1FO0H 2AJXH 1C1EH 1U6AH 2OW7A 4P5MA 2FHFA 4G8IB 4K3JH 6PCYA 5I23A 4PGCA 2WANA 3M6DA 2CE6A 5C0FB 4JKMA 2FL5A 4LMQI 5LG1A 4MCZB 4ZMLA 1PW3A 3T6VA 2O5XL 2R29H 1KPUA 1RURH 1AANA 1QBLL 2AQ2A 1X7SA 4M1CD 2HB0A 3L4ZA 2DQEL 4F9PC 3STBA 4Z3HA 2Y07H 1LO4L 4JDEB 4V1DD 4N85A 2FD6H 1KDIA 2EE6A 1F56A 2A6KA 1RHHB 4NBZB 3GMQB 1X4ZA 2D2OA 3OKKA 4B9IA 4ODHL 4WFED 3UFIA 5BV7L 3RZCA 4F27A 1A1NA 3L5HA 2BWIA 3NSJA 4A38A 1N26A 4WK4B 1MIML 3GSUA 2CPCA 4ZMZA 5HHQA 4MD4A 2YOCA 4MMXC 5CFHA 1AZUA 3T5WA 5J1SC 5EOCL 4MQSB 3ZY7A 1ICTA 4ECNA 1CFTA 1Y1DA 3EH3B 4W6WB 5EPMB 3QEHA 2J21A 3OKOB 1SLXA 4LRNH 4RQQB 5I71C 5IWLC 4P48A 2QL1A 1MZYA 3AS2A 3RURA 3C5JA 1IE5A 4JFOA 1JYWA 5DMKA 4GXFA 1FFNA 1INQB 2E7CA 2QGCA 1EBPA 3A6CH 3CHOA 1NC2A 3GSVB 1AKPA 3VXMA 2WBJA 4OQ1A 2VL4A 3FMGL 4S2SB 1Q94B 4GB9A 3ZDXB 4G80A 3D7PA 3IDIB 2NY4D 5FIEA 5HYSA 1OW0C 2P5EA 4X83A 5LBGA 4KKLC 3HNSL 3E9TA 3BWUF 3MRJB 4XBGB 3KPOA 1ORSB 1I1YA 4ORGA 1XX9C 4X9YA 4XNUH 5DD1L 3QEQA 1UADC 4NX0A 1GGUA 4AZ8B 2IH1A 4QXUL 1JGLL 3JXAA 4KZEH 1ERNA 1EAPA 2CBPA 1KPUB 1CYGA 1FYTD 1E5AA 3ZHDA 1KCUL 2GB2A 3DV4A 4JCLA 1L0YA 3ML9A 4YFLI 2IAMC 1ET8A 2OR8A 4J3OF 5DC2A 5E9AA 5T5FL 4C4UA 4Z8FH 1QFWM 4P2RE 5DTFB 3JBG7 4NQVB 1FSKC 5BOPA 3HR5B 4NDMA 5AAMC 3TTSA 1A1NB 3OMNB 1J1OL 2Y23A 2OYPA 5D93C 3U36A 1ZV9A 2G3XA 1JGUL 4Z7QF 4LLMB 4XCNA 4KK9C 5IV2A 4R26H 4AUUA 5IR1A 1M3IA 3C6SA 4X4XA 3KPRD 3TA3D 2Y2YA 2FHCA 4U1SA 5D6DA 3TN0B 4X7FC 3IGAA 1FVEB 3BI9X 4V11A 4OLUL 2RFXB 1P7BA 3C5XA 2EDKA 4NI6A 4BK5A 4JRYB 4MA3B 1KG0B 3UH8A 1M56B 3AM8A 1UWGL 5FV1L 1R3LA 3SN6N 3ZUCA 2IPTL 2OMUA 4X80H 4NBYB 4UV7H 2DYPB 2JKNA 5CWSA 1G7LB 4M6NL 1INEL 3CAFA 3KE0A 2CJUH 3H9SD 3V5KB 1T4KB 4N87A 2QHRH 3A21A 3VSVA 3CDCA 3BQUB 3V0FA 3SGDH 3LEVL 4L3AA 3FFCB 3R0NA 2G0KA 4PLJD 4JBSA 4P5TA 5CSZB 1FFOA 5J12C 3D50A 1ECZA 3SE3A 4ZXBD 3IYLW 3MRRA 2RIKA 2VH5L 5C0BA 4OCXL 5ILTH 3HB3B 2NT0A 3U0TA 1E9PA 1DQJB 3WS3A 4BH7A 1DJSA 3NJIA 3SIKA 2QQNH 2Z8SA 4RZCB 5DK2B 3GXFA 5I8KH 3OR7A 5EMYA 2R23A 2VMJA 1ZT4A 3EOAA 2VXVH 4QLRA 4WHDA 4BGDA 3RVXD 4XRCB 1JWSA 1JDDA 2QADB 5IB2B 4R5TA 1S9WA 4A66A 3D2UA 3OKKB 4XPTH 4ZUWA 4D8PA 1G7IA 4KDTA 4NKDA 1FJ1B 2CKNA 2UY6A 3SD5A 4AKPA 4RSYA 5IM7A 4B27A 5FUOH 3TZVC 1G7JB 4ELKB 1J9RA 4GY4A 5G4OA 2J71A 2Z4QA 3ASNB 3CVBA 4L2LA 5TE7L 3FQWB 4HK3N 5FYKD 1KJ2H 2EABA 4DKFH 4C83A 3D2TA 3S37H 1D6EA 5F7DB 4B41A 2BSTA 4X6EA 4XP4H 1DLHB 4N6RB 4PRNA 4AGQA 2CLRB 1XB3A 2YHGA 3H9ZA 4D3CL 2FRGP 4H7VA 4BDVA 1HN1A 4NGHH 4WI6A 4G9FA 5MI0B 2YPLE 3T8MA 4PJ7A 1F3DH 3TIDB 3X1GA 1AGEA 1XGYH 4KTYA 1TTBA 5LO7A 4ILDA 5KSVA 3HN3A 1NTDA 1RZKH 2EEFA 1UH4A 3OHXB 2CO3A 2VE6B 2IQAA 1LO2H 2WVUA 2GG1A 1VFAB 4JW3A 4U3CA 3UGEA 5E2JA 2V8MA 4N90D 4QR7A 4X4ME 4HT1H 2FBJL 1LEKA 4K8RC 1R5VA 3BSZL 4HLJA 3S37X 5HSFA 4JFDD 4U6XA 2X38A 5DYOA 1MI5A 1J0JA 3BIKB 3GLAA 2CWRA 3R06A 4PTUB 5JHBA 1G1YA 2G60H 2G3ZA 1SHXA 4BZ1H 1A22B 3EUUA 5HJDA 4YDMA 3AREA 1LL1A 3VI3A 2NXZB 2Z7UA 3QG7H 1QYGH 1HS6A 2FJGB 3NUKA 2PPFA 3BRFA 5DQ9A 3VXNA 4UT7L 3F5WB 3STZB 1MELA 1KJVB 2NCMA 2V3FA 2ZX7A 1QLRA 2VN6A 2W1NA 3GXNA 1G43A 4P2OA 5DEGA 3THML 4NQQA 5EBMA 3ORJA 3FUIA 5D55A 1CLZL 4HS8H 4Y4FB 3WE6A 5IJKC 4PJHA 4XCEB 5DR5H 3B5GA 5DHEA 3AVEA 3WKNA 3OAUL 4OFDA 4FQCL 2E9GA 4BSJA 2N59A 4AEEA 3BKYH 3D39E 3RWCA 2AEPL 1ASPA 2ICWB 4FP8L 3QPKA 1EMTH 4YJZL 2I69A 1UM6L 3PL6B 3AQDA 4AE0A 1ITCA 1NOFA 3QW9A 3TTYA 1FG2B 2P49B 4YBHA 3FMGH 1S9WB 3QYMA 1P6WA 3CZNA 1WS8A 4RMVA 4CJ0A 5CEYA 1FVCB 1NMCC 3MLYL 1I4FB 1MFEH 4RBPK 4HJJH 4OJFH 5IREA 1LDPL 3JWDC 3VA6A 3VSTA 3GSWB 1RUKL 3MJGX 4JFVA 5I6XB 5FM5M 1X6NA 1BZEA 3WS6A 3L9EA 3QUYC 5PCYA 2ENJA 2ZJSL 1KXQA 3OSVA 4P46C 1IBGL 4YEEA 3EJUA 3KJ6L 3KYNB 5H94A 4U33A 1XZ0A 5EF0A 3L7EA 2M26A 3WBDA 4XX1E 5GS1A 3OZ9H 4N1EA 3QR1A 4OZHA 5MEOA 3TEYA 1OP9A 2YGVA 1K5NA 4I87A 5F7UA 3AREB 3K4AA 3GMMB 3U9PH 3D2UB 4JUTA 3KPLA 4BFKA 1KY6A 3ZE1E 3EXLA 4J12A 1NCUA 3AUWB 2QLVB 3FH8A 5DT1H 5I30H 1X5XA 4JEGB 4AQ1A 1HQRA 2FD6L 3RVUC 4Y1SA 2HLFD 2X4UB 3BFWA 4HDIB 4NNPL 2B5IB 2FECI 4MMYA 2J6EA 3CBJB 1NIAA 1BIIB 4FQIH 3DTDA 3SOBH 3MRQB 2X1WL 4WFFE 4WTWA 4LEXL 2FT8A 1WS7A 1S5IH 2DPKA 3NA4A 1K4DA 1NPJA 3C8HA 3WLBB 4YUEH 1KTLB 5DLLA 3GXIA 4JCWA 15C8L 5AAWA 5MP6H 4WUUD 4YNYB 5D2NE 1E5UI 2VDLH 2VJ0A 4PJ7B 3TIDA 3QZWB 4CBZA 2M83A 1NSNH 3KS0H 4J3OC 4ANKA 4L1BA 4AI7A 5JIDA 1WUZA 4O4YL 4WUKH 1IMHC 2AQRA 5HHOB 3EYUL 3PP4L 3VFWA 3FL7A 1JZGA 2FR4A 3CN3A 3VTTA 4UB0H 2IDSA 1HL9A 1ZCRA 1E4KC 5EZIH 1MHPH 2O5YH 5SX4H 5I76B 5KBLA 2WWOA 3Q9QA 3L5XL 2Z4QB 5TDPA 3TL5A 5KS9A 1IV8A 3G6JA 4ALAL 5C0EA 1AVAA 2GJ6B 3QZBA 1KGUA 1ZA6A 4HXBL 4YO0A 3TESA 2KZBA 3IJYB 4WI3A 2YGQA 4R2GC 4PJ8D 4W70A 3KH4A 1NGWB 5C7XL 2NX5E 1OSPH 3MREB 3GT6A 7TAAA 4RFEB 4DGYH 1C8QA 3EJCA 4LNVA 2H1PL 4ZO8A 2HH0H 1DL7L 1XZWA 1S5HA 1R5IA 1S7QB 1AI1H 4AYID 3OPZH 2FT6A 3TPUB 1N8ZB 4A63A 2ZCHL 4FNLL 4GH7B 1MCPH 2COQA 3BVUA 4ZSOE 4TSBL 1J5OH 5T5FH 3S96B 4L8DB 2EVJA 4E41E 3G5ZA 3QXVA 4AV0A 1DN2A 3F62A 3PCYA 4DKFL 4I5BA 2BSRA 5TF0A 4FS0A 4HUUB 1BAGA 1RZGA 1SBSL 4QT5A 4RGNE 4Y16D 3U79A 3ZJAA 1OE1A 4JPWL 4MJIE 4ATTA 2YKLH 2IBZY 4PS4L 3CQQA 3HE6C 5EEZA 4NRYB 4NQED 4MNQE 3ZZLA 5TE4H 4JY4B 2BHFA 2NY2C 2FQFA 1KIPA 2AF2A 2VL5B 5HPMA 1SXNA 4J28A 4GW4A 1HNGA 4GLRI 4O2FB 4PB0L 3EJZC 3AWFA 1PCSA 1BFVL 2YD2A 3VB9A 5FF6A 1EEZB 4JQXA 4OB5L 2LU4A 5C08E 5CU9A 2FGWL 2NY6B 3B9VA 4MXWL 3RDTB 1IARB 1F5WA 1QYGL 1YYCA 5TQ2L 3HJEA 1PSKL 3QIWD 4KOBA 5D2LE 4P8QA 5FGBC 1XR8B 1XGTB 2Q7NA 1U3NA 2DQMA 4QOKA 1CLCA 1PEZA 3RWEA 4ODSH 2J12B 4NZRH 1NC4D 1JHTB 1RHFA 2LVEA 3LEVH 4ONGL 5CLZA 5AW2B 1AOZA 2JIXD 1GYAA 2XBDA 1P9MC 5LCVL 3TWCH 3LPOA 3TVMC 4N5ED 4Q9CA 5CZVL 1DFXA 4WI5A 3W0WD 4QRRB 5IFAL 1BD2A 2Y1ZA 4JZNB 4UOJA 1ESOA 2BOCA 3ZZ1A 1OAQH 1TYJA 2A6KB 2V3DA 4KX9A 4U1IA 3UDWA 5CP7A 1R0AH 2ZXGA 5KYYB 4YZFE 4YPGB 4D0BA 1OD7A 2J72A 1WSST 2P47B 2EXSA 1HHGB 2X4RA 3OB8A 4UQ2A 4JPQA 4W9HC 4HWEH 3QUHA 5E4IA 2FATH 3ARGD 2EYRB 4OI9A 1M3JA 1S4IA 3SCMD 5LXGH 5I18H 1Q1PA 3DSNA 5DJAB 1C1EL 1CR9L 4YHPB 4ZRGA 2DQ6A 5J1AB 5KBDA 1ZLVK 3ZTNL 1FQ9C 2X4PB 4UDUA 3IFOA 4GG8B 3ETBJ 3SE9L 3ZKMC 3HEIB 2L7UA 4M1GH 1MKFA 1P4LB 1NH6A 4Z7WA 1CVRA 3OKDA 3Q1EA 4O58L 3ULVL 2FH8A 1MFEL 4OSUH 5AW9B 4YAQA 5TPWH 4LXFA 5ERWB 4TSCH 3TNMA 1A1MA 1IJNA 4LPTA 3U7YH 1QRNA 2G4EA 1F4WL 1M05B 2A6IA 1KYAA 3ECVA 3WO4C 3IBOA 3ZKXB 5D5ME 1TCMA 4OFYA 4IRZA 2XG5A 2PYFB 3FN0H 1V3JA 2ALWA 4F33B 3T1FB 3WKML 1N12A 5DT1L 2KZKA 5I30L 3DUSA 1OCRB 4Y5XC 3T8XB 4RZCA 4YBLB 4JO3L 3V4LA 2RGSA 5TDOA 2VDKH 1EJ6A 1QZ1A 2ADYA 2KLSA 4W9LC 5GGTH 1HHIB 3I50H 4W4OC 3EO0B 4AM0A 1OGTB 1TTFA 2AEWA 2ZUXA 3EHBD 3CZLA 4PJAE 4XGZA 5IB1A 3OWRA 5BVPH 4IKJA 1CLOH 4ZZFA 2EZ0C 3EYSL 4OFIA 5KVEL 1AZNA 5C0CA 4M48L 3NRQA 3BVNA 4NO3A 2AQQA 2W0FA 4X42A 1QEXA 1FZOA 1M42A 1DVFC 3L3IA 3P2DA 1YEJL 4NZJA 3ZYOA 3NJNA 1ID2A 4I3RL 4IRSA 3VMOA 1MLCB 1F4YH 1WA0X 4IMLB 3PQYD 5SWSB 1GMEA 2HRGA 3A4AA 3LSOB 5EEVA 5EOCH 1QPXA 3WEAA 1HCVA 4WGKA 4GBXC 4ADIA 4W9KC 3SDDB 1J7VR 4KTEH 2Z31C 3OKEA 2VAAA 4E9WA 2F7PA 1RULL 3BN9C 1E8YA 4HLEA 3DOIA 2ICCA 4N5UA 3ZL1A 3ZSTA 5CBEB 1RUPL 4HJGB 1KEML 4JZNA 4OZHF 3VQLA 3MV8E 2GJZB 1AGCA 3PXLA 4B5ZA 1QTSA 2J5LC 1F45A 5C8JB 4XN2A 1DANT 1J8SA 1FLRH 2P9RA 4P3DB 5A43C 3IWUA 3CLEH 2B1AL 5C09D 1OSYA 2BSSB 4APXA 2VE6A 4HW6A 1ROCA 2AAAA 3TNMB 3PV6B 5DRZB 4XCFL 3MLWL 1I75A 3U0TB 1JGDB 3O3AB 4GQRA 4F2MB 4AYFB 3KW8A 2YD9A 1S78D 4PBDA 3JV0A 4ZOEA 1FZKB 5HI3C 1OV8A 4G8EB 2IIJA 3OLIA 4OIAA 4AT6B 2H2PD 4PGEA 2FO1A 1S9VB 5JW4N 3QDGA 4MKTA 4OLYH 5IG7A 2QBWA 5EIQA 1J8HA 4NIKB 4HMCA 4Y5XB 1ZAGA 3GHEH 3UROR 4FTVD 1DQDH 4OLWH 5A16A 4H26B 1K3ZA 2QLYA 4PJ5A 4ELKA 3MKKA 4YHNB 4GO8A 3VW3L 1IC4H 1MVFA 3RUGF 4OLUH 3MV8A 4AYBA 3CFNA 2QVTA 4FABH 3HPLB 4XVSL 2VNCA 1EFXD 1MSPA 3U36B 2LABA 4KNSA 1X7QA 4EKJA 4H8PA 1U8PB 3QUKB 2CGRL 3VD4A 1DBBL 2A74A 3OC8A 3VNYA 1C08A 4M62H 1MCNA 4M3KB 3CZKA 3JWNE 4R0LC 5J57B 4UTBL 1MCIA 3LD8B 3B5HA 1ZGLB 4XPFH 4U6HB 1MJJB 4FCAA 3IMTA 5KOMC 4HOMA 3V6OE 1O7VA 3FRPA 3NIDF 2WM0A 1ZVSA 2Q10A 4JZJB 2ICEA 3VXSE 4PLNC 3RWHA 2XN2A 1A9BA 1PKQA 1G0DA 2YUZA 4XMWA 2E27L 4JHAL 2ZCKL 3QCVL 4M8RA 3QARA 4DZBA 4A2GA 4LSPL 5KVFL 5F6HI 4GRMB 5F9OH 2R4SH 3D85D 4K7PL 2VMFA 2WQ8A 4ORZC 5AB2A 2Z35A 3JWNG 4EI0A 5C0ND 4MRBA 4YZFF 5EU3B 4LBEB 2YD5A 4U6YB 4BCYA 4BKLA 5KTEL 2VLMD 1DN0A 2XT1B 3FT3B 2Q8BH 3H9HA 3S97C 3ECBB 3ELQA 1EEYB 1QLFA 1EZVX 3CC5A 4HXBH 4TVSa 1WAAF 2IGFH 4HKJB 3UZQB 1AGFB 1HH9A 1V3KA 1E9OB 3LDBB 4LNRB 4O9HH 2PCFA 4WO4C 5CZKA 3WIHA 3EYOB 3HG5A 4A7GA 3CMGA 1I7TA 2BC4B 3OGCA 1MCOH 2QADD 2VDRH 4NWTL 2HWZH 1BLNB 1H6FA 3GHBL 1ACCA 2VXTL 3GFUA 4DNLA 3VGAB 3ULUF 5LHDA 1X7TA 2Y5TA 1T21A 3PIQA 2HVJA 3FRUA 5EU4B 4Z78A 3QK0A 4LCWE 3CH8A 4HDIA 5A40E 2VDMH 5B38A 3IJ7A 1T03L 3V4VB 3SJVE 1RL1A 3RFZA 2ZQKA 3WFEL 2YC1A 4OR1A 4U1JB 5DFWH 4KKZA 5AAPA 4JHVA 3MJWA 4TSCL 3U7YL 2IFFH 5GS2H 3E0GA 2L7EA 8FABA 2HFEA 3QPQD 4JFEE 1BREA 2BS9A 1KXVA 1MCKA 4GUOA 5EDXA 2OSYA 4JFFA 3R4DA 3QUMB 2DM2A 3ULVH 5BRZD 1OQXA 2WXQA 4O02A 1TQCB 3QPXH 1TQCC 1DBJL 1CPUA 3FFDB 4L37A 4B9JA 3N2JA 4G8GA 1TOXA 2VABA 4NQXA 5CILL 3WY3A 4XHJC 4H8QA 2BSDA 1W72L 4AGNA 4S1DC 4YDJB 3ILQD 2ZXWB 5M95B 2WK2A 3O4LD 2VDQH 4MJ6B 5ABAA 1S7UA 3QAZC 4NUQA 1PS3A 5H37G 3C75A 3DX9B 3ZHNA 2EILB 4MJJA 5DZOA 1PKOA 1SN2A 4LLYA 3W5MA 3QUXA 1X7QB 2JFCA 2IAMB 4ES9A 1ZHNB 3O2WH 1T3FB 4RLDA 5KN5A 3X17A 1E42A 2XFXB 3AS1A 4QTIH 1RJLA 3FHEA 5F88B 2XZAH 1I8KB 3J07A 3TBYB 5B22A 4OCSL 3LYRA 3WTXA 5FUCE 3MRMA 1JK9B 1EMTL 3DUHA 5FO9B 2FZ3A 5BQ7B 3GGWB 1S8DA 5J7CC 4LKXA 1KGYE 4WUUB 3SGDI 4XO3A 4LLWB 1ZDQA 2W92A 4LMQE 1KZQA 2XOTA 5HVFB 2V5YA 4JGNA 2MEJB 1H6UA 3LQAC 1ZLUK 3U4KA 3T3PF 2JQMA 2VISB 2VDPB 4UOW1 5IVOA 1FNAA 3GSVA 3HS0C 4FP8H 4RGOL 4I0PD 5E6YA 3ZRCC 3NFPB 1CD8A 2Y7QB 3F01A 1DVZA 4OBSA 4ZMYA 1I9RL 4ZJ9A 3NCYS 5HYSG 4Y2DC 4QLWA 4QMEA 5GRUL 2XBZA 3L7FA 3BXNB 1VHPA 2J1WA 2OP4L 1WLHA 2YMXH 4MNHA 1UCBH 5GGVH 2GBAA 3VDCA 4Z7UE 1SDYA 3ZTNH 4LPUA 1TQTA 4BFJA 5JW4Q 1MCLA 4MMXB 5DD6A 1G6RL 1UHVA 2J73A 2PCPB 3KPRE 3QFJE 4YNYA 1XBRA 3DXAE 4KQ3H 3HRZA 1XD1A 4MX7B 3L3JA 4LLQA 2C5DC 4DKTA 2E59A 4PLOB 3QUXC 1E4XI 1A3ZA 4MKMA 5TPWL 2TRYA 1MRDH 4G6MH 1MCBA 3Q0HA 5IMMB 1NDGB 4JFDE 4LOEA 2WXJA 1URLA 4P2RD 1E8ZA 2NY7H 3PYCA 5B1KA 2VR4A 3KAAA 4F15C 4Y16C 4HKJA 5KANG 1VCAA 2D7QA 2XFGB 4GJTB 3UTZA 1HNYA 4BDVB 3QWNA 3VRLF 2F54A 5JQHC 9PCYA 1JN6B 1ORQA 5C0AB 4CSPA 3M8OL 4HV8B 1IAMA 2G5UA 1AXTL 4GQPH 3PRZA 1QABA 1CTOA 3NEXA 4JM2F 4XPBL 3RGHA 2D3LA 2R69H 1C12A 2AJZB 1JZDC 1CXHA 5L0QC 2IH3A 1T7XA 5CLXA 4Z7OB 3JWDL 2EXYC 1IGIH 3SO5A 3WNPA 1A6ZA 3TBSB 2XHNA 4ZTEA 1E4HA 4EPSA 5EZIL 4ODXB 4PRPA 1F4YL 1XR9A 1BAFH 3HN5A 4D7BA 1MI5B 1TENA 5ISZE 1D9KD 2W0LA 4XPFL 1V55B 2RACA 4K94H 1JWSB 2GUYA 1HHJA 4G1MB 2ADGB 2HFFB 4PYGA 5EFIA 2Y1VA 3C6LA 2OX5B 3ZZQA 2V7HB 5C0IA 2ZOTA 5DUBB 3VSQA 3S6CA 3U6RA 3VFGL 4B53A 2XWDA 2XKNA 3HG1D 3SDXE 2X5PA 3CDGA 2XV0A 1BJMA 3IGLA 4K9EH 3HI6H 4E9RA 1MCOL 2HKFL 3HUJF 4K55A 2LR4A 1IBHA 4UT9L 3AXLA 3D9AH 1E4XH 4H8WC 3GKZA 1OKEA 4LCUB 3BKML 1TDQA 5SWZA 5C08B 1CBVL 1R47A 1X5ZA 4HFUH 5IHHA 2H0FA 1J0KA 3FTXA 1TEYA 1KTJA 4PHZA 3ETSA 3PAZA 3X3FL 2XZZA 2PXYA 2C3HA 1IEAB 3EYVB 1KG0A 2YBRA 5DJXA 1KFAL 2UVEA 3EW3B 4X6CB 2ARJQ 3RKPA 4Y2DD 1V7NH 3NVQA 3TEWA 1AQKH 4Y16B 2NY3C 4HBCL 4X5RA 1S7SB 3L3JB 2NR6D 4A7QA 5HYJD 1P2CB 3FS9A 1MCDA 3PJLA 5ALBH 1Y18A 4GAYB 4B9KC 3MXWL 3EDDA 5JHLA 1OAKL 4LCIL 5I1GL 1JGVH 1T0OA 3V0EA 2FJFB 2CIIB 5IB5B 3MGTA 5FUZH 4UINL 3U0WL 4AWJC 3D39A 3PP4H 4ZPVB 1IQWL 4P2QB 3WS3B 1D7DA 5HHXL 1D9KB 5F88A 3BFOA 3OKNB 5GHWL 1Z5YD 3IEAA 3C12A 1WZ1L 1XIWD 3DSFL 4JE0A 3GMOB 3RHWF 4DQAA 4YDZA 3MMEA 3VE0A 2LAGB 4QWWC 1B0GA 4UTBH 3IRCA 5AUMB 1N67A 4F1SA 3MCLL 4ZW6A 2VDQL 2OL3A 4QCIA 3UBGA 4ELMB 1R46A 4DUWA 1XGRB 4KZDL 1WDAA 4KQ4L 1SJXA 4TUOA 4Y4HD 3BVXA 1AZZC 4F58H 3WNOA 1B0RB 1HXMA 4ELME 2YKKA 2DD8H 3MRDB 3IN0A 5EBLA 4Q74A 1AMXA 4U3SA 4NXSA 2GTWB 3FOLB 2ZG3A 1IX2A 2DTML 5B4MD 3ZL2A 1K4CB 1HYSD 3ESNA 1ADQL 3RGVA 3BP6A 3DVFA 3CCHB 2EVGA 2OL3H 4QRRA 1A64A 1QP1A 3L4TA 1D5XA 2GHWB 3BESR 4MB5A 2XG4A 4OKVA 3TURA 1AZBA 5C6TH 5C09A 3Q05A 3IFLL 4HKBB 1TG8A 3DV6B 3CK0L 3D51A 2VXTH 3GRWA 4TNEA 3BDXA 2N7BA 4I2XA 3RZCB 3DIFA 1QNIA 5E0FA 2DLIA 3NFSH 3QG6B 3OKLB 5FYKE 3MRPB 2XTJC 4PJXB 1UD8A 4KRPC 4WTXA 3H6AA 3I6LD 4ZFOA 3SYAA 5DHVH 1CCZA 5DMIL 4F2EA 3L3GB 5DJAA 3LEXA 1WISA 1ET7A 4P07A 3WXVH 4EN3D 3WNMA 4MCZA 3CGTA 5I15H 1CFQB 3MX0B 3P2BA 3QR0A 1EVTC 1NAMB 3KDMA 3JV6B 4OZFB 5GZNC 4BYHA 5K9JL 3S88H 1MREH 4OJDH 1T0NB 1NCOA 1KTDA 4PS7A 2EUVA 5I1AA 3O4OB 3RBSA 4O51A 4IRZH 4B9CA 2TSAA 1HQ4B 3C5JB 4UM9D 4GRMA 2NNXA 3NZSA 2IV8A 3GXPA 4YDKL 2EE3A 4HCIA 1JVLA 4M4RA 5E00A 2C9XA 5IHBA 3VWKA 1RZJH 3NYKA 2NUTB 3L5WA 4Z7OF 1LMKA 2F74B 4PWFA 5T33H 3X3GH 3I6SA 3CFIC 4ZOCA 2DWDA 1R0AL 4YDNA 1VCBC 3RY4A 3MHZA 5HY9A 3MC0A 4OLXL 4ZPVA 3K2IA 4M7LH 2A9BA 3NCMA 5F7LB 3GMRA 1HIMH 5DWUL 4HIEA 2AXHA 3GZKA 3PNRB 4XBEL 5E8EB 1PAMA 1MVUB 4OM1H 1J12A 4H40A 1DLFH 3C8KB 3QHZL 3CHQA 1X4YA 2XVBA 2J6EL 2E56A 3TO4A 2PETA 3TCLB 5B8CC 5E70A 3OKMB 2HX9A 5AOZA 1AKJD 1YPZA 2NMSA 3DO7B 1SOSA 2DMBA 3CNKA 1IAOA 1CURA 2IBZX 5DUPL 1SRDA 4N0UE 1NCAL 2VDPL 4NQDE 1HC1A 1COBA 3QIBC 2DJSA 3NK3A 2NZ9D 2GBVA 3FYIB 4AJVA 3A3YB 3NIGE 4G6AD 1JGEA 4HGWB 2B59B 1G1CA 4ZUTA 2DYRB 1A9EA 1V54B 1A4KB 3ISRA 5HBBA 5DQJB 1JHKH 1XV8A 4Z7WF 2EO1A 5IJCC 3FU3A 5FFOA 4ZAKC 3LD8C 4DPRA 2MCPL 4FTVE 3VH8A 1S7VA 4N68A 3RWGB 5GRXG 3QDAA 4JFDB 1B4RA 4OIIL 5HD8C 2E7HA 5IQ9B 3VWJB 4XB3A 5DHXB 3TT3L 4M6MH 5FOBA 3D69B 4G43A 3I6GB 4GIPD 2EINB 4XO4A 4M4RB 1ML0A 2BXYA 2OMVB 2WB7A 5CZXC 4V2CB 5GS1C 3OB0H 1NCCL 1HJCA 4PAZA 5I9QB 4TSAH 3V0HA 5I8CA 1LO2L 1KB5A 4QGTA 3L81A 3MJ6A 3WS6C 3VSUA 5EZJA 2QJDA 3UAJA 3PGFL 5EU5A 2JKLA 2XKSA 3H9SE 1OLZA 3VX1A 5JR1H 3F7VB 2X6CA 1AHWA 4J5VA 3LMJH 1URZA 2Z3FA 3VU1A 5DYFA 1GGTA 2NPLX 1CO1A 3C5SB 3BYYA 3N9GH 3HZKA 3LN4A 2NW2B 3QIWA 5ICUA 4P05A 2CH8A 4N8PA 3QRGL 2XN1A 5DSCB 4B7LA 5DU7A 5MENE 1L9RA 1EQWA 2ZWNA 3HS0A 2P52A 3FB7B 3B83A 4I2XB 5FYKH 2VQ1B 1XH2A 3LQZA 2V2TB 4U1KB 5HYJE 4X6CF 5T1LD 3V2AR 2NLJA 3I74A 2P8LA 5K9QG 2ENYA 4UAHA 1KJ2B 4XPHL 4YDIH 3BSZA 3UTOA 5DK0A 3BUYA 4IHOB 4QAWA 4D0BB 4AG4H 4OH2A 2ZAIA 5GPRA 5CZRA 1F3JB 2XA8L 4OU3A 1QQDB 4KFMA 2ZCKH 3N50A 3QCVH 2X05A 4IS6A 4WWKB 3N91A 1T1WB 5KVFH 3QQNA 3MLZH 1YPZF 5I17B 1HX0A 1Z66A 1TZGH 5B1JC 1UT1A 4QRSA 4NS0A 2GK0B 1N6UA 5KSAB 1EFQA 3ABMB 3BPLB 3PPSA 4NNYB 2AQ3A 2QDWA 2VLLB 1BIHA 2W9DL 3EOTH 2WZ6A 3MRRB 3NIFB 2CM6A 3IS0X 5D7EA 1P4LA 2EAEA 2OSXA 3S37L 1OARH 3RIAK 3W0WB 3UZVB 3PDOA 4DSYA 1CGXA 1XAUA 3N1MC 3RE0A 2G5BA 1TJHH 5HPMB 4FQQA 4KV5F 2O5XH 5BZWB 4DH2A 2ZYRA 4H88H 1RD6A 1MCEA 2NYYC 4LFHG 1U6AL 4CNIA 3FO0L 1K2DB 3N55A 1WIOA 2WGNB 2R23B 3ARGC 2FSEB 2OMYB 2PF6A 1JVOA 1JGIA 3GSQA 4XMLL 3TH4T 4G8GD 5I6XC 2VDOL 3EOAB 4PJGF 3P3SA 2BVEA 1GAFL 3M7FB 3PWUB 5I5IA 1U8MB 3GBMH 1R3IL 5E8OA 4BFRA 3UDWC 1CDYA 3RA7L 5D70L 2EIZA 2V4LA 4WWKD 4FQIL 1NFIA 2A77L 5IB4A 2P3YA 1JPEA 4KK6C 4LEXH 4PJ7F 3AT9A 1ZTXH 5IZ7A 2PCPA 2CGYA 1V5JA 1WZ1H 1S7RB 4H20H 3NRFA 3EKCA 4U05A 3HB3D 3W81A 4J3WA 2DBLH 3I9AA 5E9DD 5BMFH 2NNCA 2X9ZA 4DO5A 3FB7A 4K3DH 3RWDA 4TRPL 2F7OA 3W57A 4NERA 3GSNB 4V2BA 1DEEA 4WHTB 3P30L 3IU4H 5JIKA 4KTDH 4EI5B 1MW3A 5EO0A 4PV8A 4D7PA 3C60B 5E2TL 4YE4L 4FL4C 3LAFA 1FAIH 1AHWB 2B4CL 1ZGLA 2BNUB 1BFOB 32C2A 4E2OA 4BD4A 3ARBB 4LL1A 4EI5C 4H1LB 3NTCL 2XACC 1JZIA 1XWVA 2DQUH 3MLSL 4Y7MA 1O5DT 4HJGA 1BOGA 2ATKB 4ZK8A 2XUWA 3IAQA 4NSKA 1XIWC 3BD5A 4G43B 4EEEA 3OHXA 2XXMB 1T20B 1I1AB 4ODXA 1J9TA 3ARFB 3G04A 2YMOA 2ADIB 1MRFL 3TBWA 3AM8C 5DO2D 4GKSB 4TSBH 3MVSA 5D72L 2X4NB 1BGXL 1CZ8H 2XRAL 3DC0A 2VERA 3CIQA 4CC0A 5DVOA 2Q3AA 2Z6FA 2NY6C 4LARL 2CDEA 4XMUA 1DL7H 5F1IB 1YA5A 1B88A 2PNDA 1FDLL 1AI1L 1RJYA 2PYEA 1ZWIB 3W56A 3KBPA 4JR9H 4F8NA 1UUNA 2Q7YA 1G6RH 1OGAA 4N8VA 3MACH 1FZKA 3FQWA 3CU7A 3GKWH 4FXTA 4YXKH 3ZRSA 3M86A 4OLZL 1MRDL 2NY2B 4G6ML 2C9PA 4K0OA 2XWJA 4Y2LA 1AC0A 2B08A 4A68A 3O0RL 1U3HC 1C5DB 1Q0XH 3C8DA 4PW9A 3VTMA 2F53B 3BGAA 5FW6A 2GSIB 1B2WL 3ARED 3ECQA 3P0YL 3QRGH 3IMVA 3MRBA 3OMZA 2HFEB 1E5YA 3GSUB 2VW6A 3FCBA 3PDDA 1AD9B 4N2CA 1QR1A 1X5YA 2X9WA 1RPKA 4PY8J 4GW5B 1UACL 2R2BA 1WFJA 2YBGA 1NGQL 3N85L 2EYTA 4P23B 4POUB 4UAOC 1D5IL 1K5NB 2VRKA 4L37B 1NCGA 4JDVA 1KSRA 5KW9H 3BMWA 2VIRA 5JIMA 4IIQC 1BXXA 3GS4A 4Y2OB 3ZO9A 2BNQA 2FLBT 3AITA 3MFFA 4X0KA 5HHOD 3UAJC 3CZFA 3DPBA 1BBDL 4CJ1A 3IMWA 2CALA 5D1XC 1FBIH 2ADJA 3JVGC 4MSWA 1ZLSH 3IDNB 4KO7A 2VN7A 2WZAA 3EZJB 3ECBA 1I1AD 2IG2H 4CVXA 1R75A 3PL6D 1QEWA 3BZ5A 3HZVB 1G7MB 5SV4A 2OMWA 1UGNA 4KDWA 2YAFA 1GTNA 2EEAA 4ZFFB 5DHDA 4WFFD 3I2CL 4YHLL 2PTTA 1DSYA 2DB8A 5H37A 4DVBB 3RQ3A 4HS6A 5EWIH 4XBPA 4N0RA 4UQ3A 3TA4D 4Y4HB 1NMAH 4XC3L 2VLKE 1AD0B 1WITA 4RAVA 1UT2A 1JGUH 4TKWA 1TQUA 1LO5A 3T4AA 1DFBL 1PLBA 4KKQA 4XHJD 1DUYA 1U93B 1ULVA 2OX5A 4IRSD 3QXUA 1MAMH 1WFOA 1KJ2L 1HZKA 3QISA 1CBVH 2I32A 3ZE2E 3K6SA 1I82A 2O6FA 4KNTA 1MFBH 4BZ2H 1BZOA 3RZWA 2R0LH 2VLKD 4ZYKA 3HZMA 4M5YH 4WCYH 5IVXB 1D6VL 1PD0A 1RZFL 4PV8B 2A9NH 1KNOA 3HA0A 5MHSD 5D7HA 1XGTA 3FBKA 4JM4H 3HZYA 5F1IA 5GGSA 1AIZA 1T1ZB 1FH2A 4BXVA 2QKSA 5C0BD 2C3VB 3ZHLA 1M2OA 3WTTA 3GBML 2X0VA 4HHWA 5A1AA 2O4EA 3LMJL 2HT2D 4L29B 4LVOC 4GW4B 2WINA 4MHHI 5E23A 4PM1A 5KSAC 1A7QH 3MJ9A 4PEEA 1CDUA 3F3HA 3VI3F 4IMKC 1IC1A 5JXED 1UFUA 1VGKA 3CFEB 4QRQB 4FYSA 1IO4C 5DMGD 1HHGA 2X4RB 5DMKB 2WQSA 1MQ8A 4LCWB 3FCUB 5CJ8A 1NFKA 4YGAB 3PE9A 3ZMEA 5T1DL 1CLVA 5D7SH 4WSGA 1DVXA 2UXGA 3QG7L 2EKSB 1TJIH 4KUZL 5C0GA 3GEWB 3QWOA 3TA3A 1O6VA 3U2IA 4UTBA 4JX0A 1FC2D 1NLDH 1PL3A 1FNSL 2QQKH 1SVBA 4L0PB 4HC1H 5I6OA 4U6VL 5ECGA 3UZQA 4KQ4H 4N8VG 1PDKA 1JE6A 1WG3A 2ZTBA 3BKCL 5HHVH 1PLAA 3S35L 1JD7A 3SDYH 4K3DL 1JFQL 2W65B 3ZE1B 1UKSA 3AT8A 1M7DA 3N1QC 3RPKA 2AABH 4R96A 2VM4A 4CKQA 1TZGL 3DX0A 3Q6FA 1MEXL 2LW3A 4IDLA 5CHNA 3EJTA 1IM9A 1I8IA 3HMWH 1DCEA 4OZGA 4L5FH 1OW0A 1A4JA 1PZAA 3X14A 4NGHL 3LKNA 3B2DC 1TQSA 1S3KL 1G87A 2MQ0A 4KAQL 4HK0A 3GLZA 1FYHB 4PJ5D 4N2LA 4W9ZA 3L2MA 4PG2A 3CVIL 1XMEB 3QEGL 4JB9L 4I18B 4PJEF 3X1FA 3F7VA 3C2AH 4ERSL 3R06B 2BVPB 4PTUA 3SDDC 3JWOH 5JHLH 2JKWA 5IFHL 4DFIA 2WLZA 3BQUD 4ZNEE 5I75B 5SWQB 3ZZSA 3P54A 2K6WA 5EO1A 4Z5RB 3U9PL 2FJUB 2OYMA 1NCBH 2IQAB 4K3EL 2UY6B 4W93A 4DETA 3VCLB 2J1YA 2XIIA 4HSAC 2HJKB 4JY5H 5MEQA 3ARXA 3RKDD 1F6FB 2ARWA 3OZ9L 5EHFA 1XGPB 1HWHB 2AGJH 2FBOJ 3V5KA 1E7UA 3QBTB 4G7VL 1EZUA 1ZKAA 3POHA 2N7AA 5D1XE 2FUTA 3BPNB 5D6DC 4K07A 2ARJA 2ZONA 4ETQA 1I7ZB 2X4TA 4XMXA 1X5FA 3U4EA 1B2YA 4A2DA 2VMDA 3I6KB 2HX7A 3KJ4B 4ZFZA 5DK2A 3WFHB 3QULB 5DEFB 2YSSA 3RPIB 3MBXL 4L29A 2X2UA 5C9JA 4WDIB 3D25A 3TJPA 1D2OA 1KACB 1RIVL 2BINA 2CK0H 4JN1L 3WIFA 4XVSH 1JRHH 2AITA 4ICXA 3S4SA 1C12B 2F58H 4FJZA 3FUFA 3D08A 5I8EB 3P3RA 5CUSH 1NFDE 2VISA 3DOSA 2EDMA 1I7UB 1XGQA 4HJ0D 4AYEC 4F33A 4EDWL 1E5ZA 1NLBL 3DUUA 2GQHA 2I26N 2DQGL 2ROXA 2Z1PA 1J5HA 5HYJA 1RIHH 1NGYB 1F4AA 1IU1A 3SD2A 1XF1A 5A7EA 3B2UC 2NR6A 3GRWH 3L1FA 4ABQA 5DDHA 4QOKB 4R4BA 4TQIA 1E30A 2WQXA 3PP3K 3SYQA 3QAQA 2B4CH 5E8NB 2CLVB 4BZYA 1CTNA 1MG2C 5EOTB 3ZX1A 5F71A 1CGVA 3OKDB 3TO4C 3L5XH 1ETB1 5CLTA 3RWJB 5I1LA 4U49A 4JUSA 2EXWC 5C07B 4G9FB 4KROD 1C5BH 4MX7A 2OBGA 4EAEA 2VC2H 3KPPB 3H85A 3L48A 2XZQH 5HYSB 3UTTE 3ZYJA 1NKRA 1PG7H 3EBGA 4PJBF 1FH5H 2OQJB 3HNVH 3RIKA 2X6BA 1KV7A 4OTXL 2R0WL 4XC1L 1U95B 1MVYA 3KG5A 3V55A 2R51A 3BGFC 1HZHH 3TYGL 5FLUA 4NXKA 3IS1X 3FQTB 3FT1A 3KJ4C 1EWHA 2ZXEB 1GKEA 4Y9EA 4AJ0A 3RB5A 5D4JA 1TIUA 4OLVH 1AY1L 3NSFA 2Z7YA 3WN5B 4HAKA 3HAEH 4GFXA 4PQXA 4XWGL 1ZXQA 3ILQC 5IHZB 2JF1A 5FHAH 1A3QA 1IBYA 5TK4A 2R56L 2NX5A 4LP8A 4PGDA 4QHNB 1GZPA 1WCBB 1GA2A 5DWPA 3H2PA 3H54A 3VMNA 4H44C 2WWKT 1CWVA 2CJSA 1IGCL 3LS4L 2W81C 3WMQA 4NQEB 4LSSL 7PAZA 2WLYA 3FUEA 4JFHE 5HGHA 5DC9B 5FX3A 3WSQL 2LGNA 1G1OA 3FRPG 1MCWW 5FYJU 1S9XA 4E42A 2ERJB 3LEYL 1YEEL 4P3CL 3V5HA 3IAGC 4L2YA 1S46A 1O9ZA 4AQ8C 1AJ7H 1KGCD 1UC6A 2VDPH 3SGKA 4UNUA 3W39B 5C0BE 5ACMA 4TLUA 1AHWC 1K72A 1NIBA 1U8OA 1KXVC 3QQXA 3WUWB 2OFQA 2CG9X 1BD2D 3TPUA 4HC1A 1U58A 1G7LA 2BP5M 3BMVA 4H8UA 5F1KC 5T1MB 4POZD 5I1EH 5JZ7D 1FNEB 1BV8A 1N5AB 1OK0A 3QORD 3KLSA 4I0PC 5I1CL 4E42B 5KVGL 2CIKB 2IWEA 1G0YR 1YEGH 4OCRL 1QNZL 1JZ6A 4KRPD 1LP9B 3ELAT 1CXIA 2PPCA 5A2LH 2V5RA 4R7VA 1CQKA 3T4AC 3K4DA 4TTDD 1G9EA 1R3KB 2P24A 5B39B 1D9KC 3PS6A 1HAUA 5D6CB 5HJ3A 5F1NB 2B3RA 3ZE2B 2UX7A 1YDPA 1ZT7A 5HGDB 2YAQA 1W0WA 2YEVB 1WT5A 2FL5B 5C09B 4WEMB 3RIFK 1HEJC 5DTFA 3FTGA 5CCHE 1KCWA 2CMRH 5E03A 1FLTX 2JQAA 4HWBH 1KN4H 5CSGA 3HRZC 1DFBH 2HFGL 2N7SA 4FD0A 5IY5B 4X6FA 3FYEB 3DOSB 4JJOA 4LSVL 5FYJD 2X6MA 4XX5A 4ODVL 5AYQA 4RRPG 3ARGB 1ZA6B 5B4MC 2BX5A 4FNUA 1DZ0A 1N59A 4WNSA 43CAA 1A0QH 3DO4A 3J27A 3WKMH 4JN2A 3Q1SH 4AUJA 3DSNB 4S0SD 1A7NH 1HCYA 3GRBA 3E6HB 1KV3A 3FPYA 3T3MF 4AL8L 4NN6B 5HGBA 2ORBL 2XXGA 2YSSB 3L95B 4NNXA 2FHBA 3S48A 1KCKA 1U33A 2YA0A 1AP2A 1MAKA 1H0DA 2ZX9A 1MCCA 3ULSA 1PJWA 5E5LA 5EU3A 1YEWA 1U8OB 4KHTL 3OXSB 4PJDE 5AVTB 1JPSH 1YYMH 1AIFA 4C4BA 5JUEL 2IANB 4JRYA 1ED3A 4MA3A 4HUWB 5AW0B 1GTFA 1F3RB 2YPKA 3HJ0A 3LKSB 3VH8G 1MRCH 4HUUA 2IH8A 1BXVA 3WAJA 1GOHA 2XV2A 1X5LA 5KG9A 2Z8RA 1F02I 5K39A 3DX2A 2BNRB 2XA8H 3FB8B 3JV4B 1LDSA 1OE2A 1TJGH 2ATPB 2K1MA 3VQ1C 3MPCA 3O3BA 4GSXA 5DMYA 3UX9B 1L5GB 1YN6A 3FNKA 3CFDB 4XP9L 4Z7UA 1AQDA 2XPYA 2OAAA 1BWMA 3ZPDA 1FAIL 1F4HA 1Q9KB 1PD1A 2Y7MA 3FQ2A 1OF2A 2Z8VC 1A3RL 4ZFGL 2IQ9H 4GAJH 3WD5L 3K46A 3ARZA 5CMAA 2Q7AA 4TRPH 1WFNA 5G4NA 3HS0B 2Q8AL 4JFZL 4BE6A 5T8IA 5BW7A 1W8EA 4MFHA 2QQLH 2YS4A 4FG6C 4NZ8A 2D7PA 2ZD0A 1T1XA 4N0CD 4PJEA 1KYOK 3VQ2C 1GW0A 1AQHA 4JL2A 5FA3A 2OMBA 3OR6B 2R27A 1R24A 4ENEC 1PZDA 3C87A 1E4JA 2CJ3A 4J6RL 2BFGA 4Y4KC 2YPLD 3DKHA 4HS3B 4JDTH 4R4ND 5I1IL 2AZAA 2VMEA 3EJZD 3HFML 4QXGL 2FWOA 1ZHKB 3F6IA 1FH5L 4NKIH 3CLEL 1FORL 3OXRA 4EN2A 5H2BA 2ERJC 3GM0A 3MA9L 2R0ZL 2VR6A 4PUBH 5GRUH 1X5HA 5CBEA 4PJEB 1BXAA 4NEHB 4XGZB 5I17A 4NKOB 4OFVA 3ARFD 2XETA 3D69A 4NQDB 5BRPA 3TBBA 1SM3H 4JG1L 5D2NC 3SBWC 1Q9OA 4PVLA 1JV2A 1U8CA 3SDAD 1SF3A 2HVKB 2IPUG 2XYCA 1U8IB 2WQUA 4KU1A 4XTRC 4HJIA 2CKBA 1IBBA 4HZAA 3SPCA 5T3ZE 3CXHK 1YJDL 2P46B 3F83A 4CDHA 5LDUA 4RZKA 3GSRA 1NWPA 1IKNC 3WELA 4QTHB 3R19A 1KCSL 4JM2C 2H0PA 3VFOB 4PRPB 1U8NA 2GEQA 2FYYA 2QT6A 5JIQA 3B2XA 5GZNA 4JN2B 4B96A 2ZKHL 5CGYD 1X9LA 1XB6A 4MJ2A 4GEJA 4C57C 5ELIA 1KCVL 5EU6A 5IEHB 3O45A 5IEKA 1A7OL 1OGAE 5KSBF 5JOPD 1RZJC 3QI9C 5LNDA 5C0IB 3HZMB 1OANA 3LIZA 1MLCA 2DL2A 4Q56A 3OQRA 1B0IA 1KNOB 2DTSA 3B4NA 1INDL 3BYTA 3TS8A 1C5CL 2K0RA 5KAQF 3IDXL 5AKRA 2WTRA 3SCMB 4PRHE 2A9CA 2H0EA 4AY0A 2WWMC 5F1NA 1OAXL 2YAHA 3QS3A 4L8CB 4OAWA 4X9GA 1BMGA 3KBEA 1Y6NR 3QEQD 1IZJA 4KKNA 1WD9A 1I9JL 2K6YA 3ZDYE 2ZP9A 3H55A 2DBJA 2WO2B 4PTTA 3W5NA 3VGFA 2IGFL 5DHYB 1EDQA 5LGHL 2I85A 2F8OA 2JCCA 4LQ1A 4DUXA 1UTDA 4NQUA 3WTVA 1RJCA 3GXDA 4GRWB 3LKPA 2DD8L 2A99A 3NIFF 3IJEA 2CZNA 4KKBD 2ZOUA 3B1TA 3E9UA 4M61A 2OLDA 3MUUA 3D85B 5I1HL 5DJZA 4PY8I 1KPRB 3BO8A 2EDDA 3I84A 5CCGE 2YIHA 3FTYA 4DN3H 4XOCA 3MTRA 3NSCA 5KZCD 4FERA 4OI8A 3FF8A 4EQ3A 3IGAB 3O9WC 4KKAD 1PFCA 2BWDA 4IKNA 5D7IF 2A73B 5EU6D 4JHUA 2WUCL 3QDJE 3IDGA 1A4AA 5I0XA 3QH3B 1E5BA 2YUXA 2GKIA 1HFUA 1DYZA 2J7LA 4LO9A 4POYA 3SJVA 1BLIA 3HE6B 3VYNA 2GABA 4DO6A 1BECA 5GZND 5D7JD 3QWRD 3Q44A 2WBJB 3OBAA 4CBPA 5KSBB 1KYUA 1YMMD 1CT8A 4WW1A 3C9NA 4J39A 2VC2B 1MIEL 2XWCA 2O61A 2EIKB 4Y5YB 4JO4H 5IVZA 3ARFC 4HKZA 1TMQA 4MDJB 4QT5B 1A0QL 3LCYA 4ZMTA 5C0BB 1TPXC 3CFTA 3MR9A 4G11A 3RL1A 3DYPA 2X41A 1S7WB 3EBAA 3MLVH 4XVUC 2E7BA 1IC0A 1ND0A 3NGBB 2CXKA 2YXMA 4IW4C 4OT1L 1WAAA 3OAZH 5DZLA 5DRNB 4DW2H 3V6ZA 5IKCA 1P7HL 1IAIM 2NXYC 4GMSH 5HI4D 1NWOA 5F7HA 1D5MA 2CHZA 3K71B 2PCXA 4X9BA 1ZLSL 1F42A 1WUNT 4M9OA 4PBVC 2OA9A 5I5JA 1VAHA 4MCNA 1QUNB 4WHCA 4OCYH 5DEJA 4Q2ZA 5HDWA 4FQ2H 1UB5B 3ZN6A 4PR5B 5IOPA 5C3TA 4JPKH 4Q4IA 3H0TA 4DESA 4BRJA 3QDJA 1DLFL 4NQXB 3WIHH 1ND0B 1OP5K 1RK1A 4QRTB 4U0RC 2WUBL 4GRLA 3HI5H 4IGBB 4OM0H 3RTQA 1E6OH 3IM1A 2ZWLT 1P9MA 3ZE0B 3WEOA 4ZW5A 5BUPA 2IADB 2PO6C 2EZ0D 4AKQA 1SEBB 5DRZA 4YLCA 5JHDD 4O00A 3P1VA 3L9RA 3U4EB 4LLYB 3CMOL 4P2QA 1L7IL 2PPDA 3A23A 5TE6H 1A3RH 4OKDA 1RUML 1YSOA 4JKKA 3UP1A 5KYXA 1FYTE 5ICYA 3WY1A 2UZPA 1EJOL 4HISA 1QHPA 3HC4H 1MEXH 4XO9A 1ZLWH 4WW2C 1BJ8A 4G8GB 2FE0A 4KVCH 3SE8L 4YHIA 3BIBX 4I5BB 4TMPA 2J57A 4RMRA 5I8OH 1N0XH 5E8PA 4TV3A 2AXGA 3CDZA 4R84A 5F6IC 1NUNB 2W38A 2XLLA 3O6MH 3SCMA 4XMZA 4AIEA 4FFWD 4TM9A 2FWUA 5LDSA 1IFHH 2VUYA 2CO2A 2MMXA 4LSVH 1M7IA 3BKJL 3ZDZF 1FE8H 5HDBB 1QFHA 5FYKU 5HGAB 4PUBL 3DROA 3QJRB 1GSKA 5I19L 1CXFA 3HE7A 3M07A 5K59F 4ZFOB 2FWSA 4JG1H 4N20A 3NSDA 5EZOH 3MMEB 3C5ZB 5E8PB 1KJVA 2P5WB 3N41B 2Y07L 5F8RC 1ZGLM 3EH5B 4L1HA 3PFUA 2RJMA 1SJEB 3UPRB 3KGTA 3PWNA 5IT2H 2LV4A 4TLTA 2CLVA 4HUKB 3KWTA 4K5NA 1UWXK 5J6SA 3ULUH 2O61B 3EFDL 4BM7A 2V37A 1F1AA 3N41F 1KXHA 1VACB 4NUJB 3UERA 4NJAL 1Z3RA 3EH4B 1J87A 1JK8A 1PZ3A 2R59A 2FLRT 3PWPD 2XZCL 2VLJE 3R8QA 1EHLH 2CHXA 2XJKA 4W4OA 3TO2B 1D5XB 3VWJC 2X2YA 3IKCA 2ZUUA 5ID1B 2ED6A 1RUQL 1X5GA 1ZLEA 3LPFA 1NC2D 4JMXA 2VH5H 4KKLD 5DJDB 4L5FE 4D9LH 1ZT7B 1AR1D 5FB8B 3EGSB 4RWHA 3G08B 2PWFA 2EDFA 3LRMA 1BX2A 1GGIL 4M1DL 3L4UA 1T0MB 4WFHD 2LOEA 1U2CA 3CFJB 4Q7DA 4M6AA 2GBUA 2ZXDA 2AJUH 2BP8A 2XWEA 4JKWA 2X1OA 1E8WA 1EO7A 2G75B 5T3ZL 2BVUA 5I6LA 5ETUA 4NQSB 5DEFA 3RPIA 5ES4B 3CFEA 4DUVA 3EAKA 2B8OT 3V0WL 2JB5L 3GUTB 1BOYA 1S9KC 1MCJA 5IQNA 3PJSB 2LE9A 4ONFH 3KPRB 5I8KL 4DP9X 2FJHA 3D1MC 4IBQA 5CGMA 2GCYB 4H25A 4R5XA 1XCQA 5IROD 4URTB 4UQAA 1I9IH 3H7LA 2UUDH 5DRNA 5E4EB 4PJCA 1MCRA 2W94A 3FUJA 4WKZA 4LCYA 1U42A 4EQ2A 4ZD3H 3V0VA 5C7XH 2DKSA 4P23C 3VXOA 4FQXC 3VD5A 1J1OH 2X4QB 2IGTA 2OTUA 2EH7L 1KCRL 3HI6L 5EU5B 4E41B 4KJPC 4R4BB 2DJMA 4AZUA 2FJSA 2VXSH 3GNMH 4PYHA 3BCFA 1KXTA 2NY0D 4H0GA 3EF4A 1MPAL 3E7JA 2P45B 3KWXA 1GZQB 4N9GB 1DUYB 1Q9WB 3B8YA 3MGAA 4H0LC 4DN4H 2RALA 1A7RH 3MJ7A 4G6JH 4X7CC 3V4PH 1QKZL 2ZOLB 2X4QA 3BN3B 4PREA 1N5YL 3IDJA 5C0DB 3RAJH 1H3UA 4ZXBC 4HQQL 1RMFH 2VLME 1IT9H 3CFBA 5CP3A 4LLAA 3WI9A 1F6AA 4C56A 1U8LB 5JHDB 3MLVL 1LO3L 3HE7B 2JKSA 4RX4A 5GISL 5FUCC 4W9JC 3HR6A 3L3IB 2C26A 4H0IA 3TBTA 2OJZL 3U4BL 3D0AA 3D30A 1BVLA 1RK0A 2PP8A 3I75A 2A6DA 2UUDK 4HSCX 5F7EL 1RIHL 1LNUB 4PRHB 4KXDA 4PP2A 2RQ8A 3V4PA 5CAYB 2ITCA 1XGPA 4JO3H 1U3HD 4M7KH 3MBEC 3HHSB 4JY6B 3QO1A 1F6AB 3TA3B 3WKPA 3JYCA 1UGKA 1FVDA 4IRJC 4H13C 3SYOA 2O26U 5TGBA 3WIHL 1IAKB 4MBOA 2FQEA 1TJMA 3FF7A 3AS3A 4X6FB 1A6WL 4FQCH 4XNMA 4Y9BA 4YSDA 4LCWA 5DUJA 2EIEA 4G82A 4P5KA 4LASH 1BVKA 2E75C 5AL8A 5ACLA 3K7UA 4P06A 2UZIL 3BIKA 1GJIA 4JO2H 3Q5OA 1VFUA 3WL9A 4GAAA 1U8QA 3B7RL 4HEME 3QRLA 4WZ9A 3TBCA 1VIWA 2Q0ZX 5J12B 1UFGA 4X9HA 5GRYA 2AK1L 3C08H 5CGYC 2DM7A 5JQ6L 1BPLB 1T1YB 4MNHB 5FYLL 3O6FA 4B3EA 2BNRA 1VZGA 2JXMA 4PGBA 5D1ZB 6PAZA 4RGMB 5E2TH 5E1GA 5INDA 4HUWA 1LQBC 1UB6A 4ZPTA 4EZLA 1R4XA 4FI7A 2J8OA 2VLLA 2W9DH 3QYCA 4G3YH 4ZXBB 3ZKND 2ZX8A 3H2QA 3HVNA 1J8RA 1G6RB 3R1GH 4YSQA 1U21A 3SPVA 2CO4A 3SO3B 4P46D 3SY0B 3LPWA 5GJTL 4JR9L 2NY5H 4NQSA 1HHHA 3LZQA 4NYLB 1G4RA 1HDMA 2SODB 4D0DA 1U3HB 5DHMC 5IQMA 2J8UB 2ICWJ 4UCFA 3NCJL 2FQGA 3DVGA 2NNFA 4IBSA 4N0UB 3NCXA 4WNJA 2VZSA 5DVNA 1RZJL 1XDTT 1TF4A 2CRYA 3B43A 4YDVA 5I19H 1IQDB 4RDBA 3EDEA 5J3HC 4E9XA 4UT9A 1MQKL 1DVFA 2DQFA 4N8CL 1DE4B 2IDCA 1MFAL 3VWJD 3VXQB 4U0QB 5IOKA 1DJXA 1FHGA 3ISWA 3RGVB 1F3DJ 1GYCA 5EULV 3WTYA 2VZ1A 1RV6X 2BXZA 3BC9A 2DJUA 3UG4A 1PY9A 3NQKA 5FDYA 3K8LA 5EIVA 3UACA 2HT2C 1MJ7H 3KLHC 1YMME 2P8PB 4X2UA 1TO5A 5CIPA 3T1WA 5JHDE 4LESA 1NCDL 2AJVL 3G5VB 3P69A 1PZ5A 4FXGB 3TF4A 1BOGB 3MCYA 3ALWA 5DJZB 3QIUB 4G7YL 1MHPL 3IDIA 1NKGA 3ARDB 3MV11 3M1OA 3GPEA 4P59H 5AOKA 5DFVC 3D48R 3T77A 2GW5A 3TFBA 4EOWH 3WHE1 1BM3L 3KPTA 3CVHB 3S3CB 2CKBB 3U7AA 1RZGB 4GKOA 2A83A 3A4DA 1UQSB 1IUZA 3TJEH 1TFPA 4KJWC 3CMOH 3TPKA 3RWJA 1FVEA 1O7DE 1EAPB 1E3ZA 2W60A 1RZ8B 1WBZA 4K7FB 4UF7C 3RDTA 3G9AB 4TL4A 3FQUB 4N2EA 1MLBA 3BWAB 4PJBB 3W1ZA 4AVKA 1DR9A 1HHHB 4XNDA 2H3KA 2ITDA 2LU3A 2WCSA 4PCKA 5E1HB 5AVQB 1OM3H 1WK0A 5JXAL 1J05B 1M2VB 4HJJL 3CVCA 5BJTA 1AO7A 4HCRA 2EJ1A 2GITB 5BQDA 2D0FA 1DANU 1YN7A 1H8LA 4OIBA 5FA3B 2CO7A 2SEBA 3MLTB 4YGVA 3GMQA 2VO8A 3RX8A 4CC4C 1U8LA 5JHDA 2WCPA 5EU7C 5IHUL 1FAKT 4AZ8A 4BHUI 4HXAL 5JPMA 1N5YH 4Q9RH 5EA0L 4OQTL 2N0MA 4I9XA 3NFNB 3SDXF 4PP1D 5D7KE 3OJVC 1JDCA 3QDJD 4XMTA 1Y07A 2CKBH 4HHGA 1T03H 3HG1B 4U6HA 4R5VA 2Y7LA 4FI6A 4M93B 4TUKH 5LGJA 1E2ZA 1B90A 4XB8A 4NT6A 4YUEL 4Z7AA 4A7SA 4XT1C 4YFDB 3V0DA 2CAKA 3VD7A 4CSTA 5KVMC 2JI1A 4MXWH 3BUPA 5F7FA 1JRHI 3S4SB 4TOYH 2DWDB 2W8CA 1SEBA 1LJMA 2DQTL 3NJMA 4HZ1A 3N40P 4UYPA 3EG9B 3WEXB 2OZ4L 4PGZA 4BSVA 1ZS8A 1XO8A 5FCUL 1NAKH 4FQHB 1A14H 4KMQA 4U3SB 4OJYA 25C8L 4ZNEA 1WO2A 3BLPX 3VJ6B 2H2PC 1FCCA 4G42A 3C9NB 4XR8C 2V9UA 1D5IH 4P4RA 1IEHA 4QO1A 3BPLC 1TSRA 4Y2DB 5ADOH 2BMKB 1DO6A 3QIBB 3WU1A 3DJSA 5D7LB 4UB0L 4HGKC 1Z5HA 3AG2B 1HKLH 4BHUA 2AZUA 3HE6A 3OL2A 4RDQG 4U1HA 1NIEA 3VGHA 3O8XB 2WZPA 2UZYB 2O5NA 1FBIL 1GHFH 3O6KL 5D5MF 2H3NB 4R83A 1I8MA 1DSFH 1MCPL 3HUJA 4B9GA 4MB3A 4EI6A 4JPIB 5I0ZA 2DWEB 3EOTL 1BEYL 4MDJA 4ZUWB 5CEZH 5HYQA 1XCWA 5L2KB 1X6LA 4F8LA 3MRIB 4OD3L 2HFFA 4RWYH 2AQSA 4I89A 4L1DA 3TYFA 2O5ZH 2X4SB 4W1TA 4DTGH 4JMNA 4F8OA 1AGDA 3BH4A 4Y5YC 3R0MA 4OIFA 4GINA 1WFUA 2DQIL 4EVNA 2EVIA 3IXAA 2N01B 5C6PB 2I24N 3DO3A 5LBSH 1WIUA 1U4FA 1QVOA 1IKOP 3FT2B 5CINH 1MHHA 1X9QA 2F8XC 1YCSA 1YNLL 1MNUL 5K93A 1NCBL 3Q2LA 3P4NA 4PY7B 2G9KA 2VDOH 4IRSB 1INEH 4WV1C 3NCYP 3V4PL 4U4BA 3VXSD 3CX5J 5HP5A 4M02A 3NACH 35C8L 3QQ3B 4APQA 3T0BA 1DQVA 3IDNA 4GRLD 4QHMA 1MIEH 1RPUA 3FTSA 2K78A 2CDEB 1KB5L 4L4VE