4WI0A

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
168
structure length
168
Chain Sequence
MESYITMNFDKNTAEVGQIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVNEDYGPIVQGVHKISEGILNLSRSYTALDVYRASESPEETGTVAVVGFKALQKKATTVVFEHSVTMPNGIIGTTLFNWYGNRITSGYSVIQPGEINSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein
molecule keywords Cellulosomal scaffoldin adaptor protein B
total genus 38
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wi0A00
3BWZA 1ANUA 5K39A 2XDHA 3UL4A 2JH2A 4FL4C 4U3SA 2Y3NA 1QZNA 3F2LA 3KCPB 1G1KA 2VN6A 1AOHA 3GHPA 4DH2A 4IU3A 4WI0A 2BM3A 5LXVA 2ZF9A 5AOZA 4N2OA 2VN5A 4FL4B 2O4EA 5G5DA 3FNKA 2OZNA 3KCPA 1ZV9A 3L8QA 4IU2A 1TYJA 2B59A 4UMSA 2VO8A 2W1NA 2CCLA 4UYPA 4UYQA 4WKZB 1OHZA
chains in the Genus database with same CATH superfamily
5B4MC 2ATPB 4RISL 4IJ3B 2RCSL 1DL7H 4PVMA 2XG5B 1A9VA 1I9IL 4P2QD 4RWHA 3RWFB 1DDHB 1EJFA 1LDSA 3NJFA 4UM9A 1QUPA 3BW9B 1F8TL 3KE0A 4LCIH 2A38A 5I0XA 3QDJE 4HJGA 1I31A 4OZIE 3D7PA 3QUXC 4PRDB 1XIWB 4B50A 4MLSA 4WFGD 3OZLA 4ELDA 3NJMA 5IVXE 4JE4B 1VCAA 2QVTA 5SWSE 4OLEA 1FC1A 3QDGD 1S7VA 5EN3A 5SWZE 5H35A 3VVWA 1U8QB 1MW2A 2FB4L 4Y5YC 3MACH 1ZEAH 4H13C 4A6YH 1TZHA 2ZOOA 3KZ8A 1RZJH 5J6GA 1SMOA 3QZBA 5ACZB 2FAUA 2IPUG 2X12A 4DOHB 1XGTA 1BQUA 1E6OL 4FP8L 4LVNC 2O26U 1QSEA 4FNLL 2WBKA 5JHAA 5E99H 2WLZA 1ZTXE 3SOTA 5HHQA 1NOLA 4FYRA 1KCLA 3O3AB 4R97C 2ESVB 4XWGH 1HL9A 1Z5LB 5L9DH 4JM4L 5CBEB 3D5OF 2CRIA 3O6KH 2VXVH 1IKNC 2CLVA 2X4TB 3R8QA 3FQNB 1HIMH 4KAQL 1JGUH 1JGDB 3RAJH 4DCQB 1U95B 3P0YL 4KKQA 2Z4TA 4PPTA 4Y4HC 1K2DB 1D6VH 4L4TB 4XN8A 5ILTL 4BIKA 2O93L 2WBXA 3FB7A 4FG6C 3LEYH 4DGVL 1NBYB 3GT6A 2VRQA 1L3NA 3QR2A 3EH5B 2DJSA 3L7FB 3MRCB 5D5MB 3GLDA 5E8NA 4PJDE 1WF5A 4NOFA 5A16A 1DBML 2UXTA 3UBXI 2K3TA 2FJFB 4IRJB 2AVFA 4FFZA 2Y1YA 5DD6B 2F7OA 4U1SA 3EGSA 1YPZB 5LNDA 2C1PB 1KYOJ 3ETBF 3RL1B 5EO1B 4LHJB 4RISH 4DEPB 4GKLA 2M26A 4H8UA 4RMUA 1WBYB 2WKOA 2DI9A 1U4FA 3P9LA 1MJJB 4MD4A 3GKZA 3X1EA 2XYCA 4JGNA 2B1HH 3SE4A 3T0EC 1QEWA 3T3PB 3I9IA 4QOKB 4QY8A 3QWOB 2WTPA 5EU7E 4MX7B 1CYWA 4OFYA 4P2RD 4JQVC 4QHKI 5IVXF 5C0CE 2IGFH 3SKNA 4X4KA 4WUUB 1W0WB 1G7QB 5CZRA 2C3VA 4M7ZC 2FJHA 3SDXE 4HP5A 1A14H 5GRXG 4NKIH 4QIRA 2ITCA 4R7DB 2CA4A 4YEEA 4BGDA 1KIRA 2JIXD 4X9YA 1LEIB 4M5ZL 2PR9A 4AW7A 1CGSH 3S37H 3BP6B 3BESR 3G6DH 2KERA 4R7XA 1SXNA 2M8XA 2NQ3A 3RI5F 2IPKA 5AW9B 2O5XL 5CEZD 2VGLM 1UASA 2J7LA 3SGKA 1MG2C 4ZUTB 1EXUB 1LM8V 3DJRA 5CCKH 1OPOA 1YLBB 1ZXKA 2LR4A 3NCBB 3V0IA 2XBZA 4LOUC 2WUBL 2HZHA 1M2OA 4UNVA 5CCJA 2OPCA 4FNUA 4FNRA 5E2JA 3LZRA 2X7LB 5KSVA 4LLUB 3VXSA 5EOCJ 3WY1A 3JWOL 5HYJD 3BAYA 1IBGL 3WKQA 3MROA 3TO4A 1ADQL 5DVNA 3BPNB 1FI8C 4NN6B 5IIEA 5KYXB 4EN3A 2XQYK 1JPSL 3I2CL 1SRDA 1D5MA 3MV8E 4F2EA 4XNXH 1OSZB 3QT2A 2CO3A 2H1LM 5C08A 2QJDA 2Z8WC 2R29L 2GUOA 4YSEA 1X5FA 3F7PC 1AXSA 3NGBC 2G9HB 4MAZA 3EXJA 4C58B 3D85B 1GS6X 2DQFB 4N2MA 1V27A 2EP6A 2ZUQC 4M1GL 4W4OA 2CMRL 2NX5B 5EUOB 1TKWB 3EKCA 1MG3C 1MHHB 3MUZ1 4WO4D 3HC3L 4HWNA 4GAJL 4JFEE 3CLWA 1JK8B 1Q72L 1Z5LA 3HS8A 4MXWH 4P0DA 5D7LB 5EIIB 3MUY1 3ZGHA 3CN0A 1P5VB 4JZNA 2DH3A 1N3NA 2FYVA 3SBRA 4C47A 4NI3A 1AGFB 5H4YA 4E9WA 1H3PL 3LSOA 7PCYA 3RLSA 1B0RB 1I8UA 1TT6A 2OJEB 1SFHA 2BVOA 1KFGA 2DV6A 2RB8A 2NY7H 4DZ8A 4LCCA 5J11B 4IGBA 5DI8B 4L3FA 4PRHE 2FSEA 1CXKA 2QKIC 5F7EL 4C57C 4CAGA 4DHLA 4S1RH 4F1SA 1CICA 4GSDH 3ECBB 3WUWA 2FJFA 4PJFE 1HZHH 1U3HD 3ARFB 3SQBA 2BLFA 2DWSA 2ARJA 3HAEA 1ORSB 2BXYA 4Z0XA 2AJXL 3M1BB 3WOVA 5IQOA 5C0EA 3HPLA 2HT4D 4B3VA 5GGSB 1RXLA 4E36A 5KSAA 3IBEA 5AKVA 4WJ5B 4IDJL 2KPWA 3WY3A 1VDGA 4KY1L 1CT8A 5FA4B 3TN0B 5ID1A 1KN2H 1QEWB 4R5TA 3QNXB 4ALAC 4QY8B 2Y7NA 3N1GC 3T0AA 3OKDB 1WGOA 5T3XE 4OCLC 1FQ9C 1FSKB 2VDKH 5AVQB 5HHVL 2R2EA 4JEGB 4F58L 1R5WB 4HWZA 1IMHC 5AKTA 4U33A 3CWGA 4MCZA 1Y18B 3ZR6A 1E65A 4OBSA 2WVSA 4N8VA 2OULB 3T4AC 1HFUA 3O4LD 4XHQA 1MLBB 1WJ3A 3C60C 4GBXB 4DK6A 3L3GB 3WS6A 1PX8A 1JIBA 3DX6A 1RIUL 4JDZA 3K8MA 4GRWH 2H0FA 4O58H 4BFBD 4PJHE 2OQJA 5DMGD 4LLAA 1ZGLB 4H8QA 3HBQA 2YUWA 3QQ3B 3O6FA 4XVUC 1IGFL 3RPBA 1A66A 1KF9B 5DJCA 1RVFH 4QXTA 4U7KA 1NMBH 2RBLA 5DC9B 2V9QA 4NRYB 4XMPL 3W0WB 4N3UA 1VZGA 4NO5B 4CC4C 5HJGA 3ULVC 5EBLB 1SOSA 5JIIA 4K9EL 1AACA 4J3WA 5GRWA 3LB6D 3T08A 1KGYE 2EINB 3F04A 3G08B 3KYMA 3SE9H 3L3JA 1QACA 1BXXA 1E0OB 1SEBA 1WITA 4QKXB 4XXCC 1B2WH 1NWPA 4OB5L 5E94B 2TAAA 3KJ4C 4X5RA 2FYYA 3HZKA 3FUIA 5KYWA 4L5FH 4L8DA 4N28A 4AL8H 3K2MC 1D9KB 4G6KL 1C1EH 2WK2A 4RZKA 1LK3L 1QMUA 5AVVB 2PW1B 1IC5L 5D70H 3C2SA 5DCCA 3BZ4B 1JK8A 4FFWD 4M6AA 4Q14A 3ARPA 1T1ZA 3GNML 4FE9A 3MKKA 3LEXA 1KENL 3IXTA 5TDPA 4YSUA 1OHZA 1Q9LB 5E6IA 4JPVH 1XSOA 4Y4KB 1A6ZB 2AI0L 3CFCL 1O6SB 4HWBA 4BINA 1KTBA 3VDAA 1BW8A 5FHBL 3NCYS 3U7YL 3IDJA 3U2JA 3K4DA 1WH0A 4NM4L 4HALA 1OP5K 5J13B 1GTNA 5IHLB 3KDMB 4XOAA 1HEJC 4Y1SA 3B7RL 3ESOA 1UFUA 3FDWA 1I1FA 4WFEE 3NSYA 2A9ML 2FT7A 1KEGH 1XH1A 2ZOLA 5GRVK 3VFPA 3UC0H 5ICYA 2BVPB 4MMZB 3F5WA 3V5HB 1RURH 3GMLA 3E6HB 1WICA 1MELA 1QSFB 4FQ1L 4E9QA 4KDWA 4MVBD 5TE4H 1T80A 1A6PA 2HH0L 2NY2D 2D9QB 4AH2B 4BXSV 1TVHB 4I0PC 3RL2A 3SGJC 1LO2L 1NCHA 2DIBA 2Z1KA 4PW3A 4Z78B 3QAQA 3GUTB 1CFNB 2CBMA 3NZSA 3EYQD 4U1HB 1AJ7L 1IAIH 2EVGA 5ITBH 4M7KH 3EDJA 1HDMA 2NY6C 3CU7A 1P6FA 3EZ8A 3NG5A 3NP3A 3NTCL 1C5CH 1OZUA 4DUVA 1QRKA 4H20H 5DJZA 3K6IA 5GS0L 5HHOD 1CQKA 3NCXA 1HINL 1ZTXH 3S5ZA 4Q6IC 4EZLA 3TXAA 4HGMA 3KEDA 2K3HA 3BIKA 5FK9A 3BZFA 4I0PA 1BBDL 2OXHB 4MCZB 1ID2A 3RE0A 1XD1A 4L1SA 1F1AA 5IB3B 1SY6L 3T3PF 1OL0A 4FNSA 1JGVH 3BVXA 1UXSA 2VMCA 2D0FA 4HIQA 1A3ZA 4QRQB 3T0WA 3VWJB 4AJWA 3OMZA 5IVXB 5FOBB 1S9YA 4ERSL 2YBGA 5I2IB 3VXMA 3ZJAA 2FNWA 2Q0ZX 4LBEA 1NMAH 3TTSA 5D7LE 3V0JA 3L5WB 3LEVL 3DX6B 1F3DH 5F7FA 3O2DA 1OHQA 2W65A 5LJYH 1XH2A 2VWEE 4OZGF 5D7KD 1BQSA 1CJYA 1KOAA 1UH4A 4B5ZA 1C8QA 3NOIA 2CK2A 1BZ7A 1QI4A 2AEQL 3FMGL 5E8DH 4MJIB 5PCYA 2VLLB 3ZKND 4ZFOL 1YG9A 2AEQH 4KMTH 4ZMPA 3ESVF 4G43A 3W0WA 2NY6B 4DGYL 4OT1H 5DXWA 5LVEA 5C0IB 3F7VB 4YPGA 4I85A 4HH9B 4PJXE 5D7IE 1JCKA 3LMJH 3AB0B 1AC6A 2VSMB 4Z7UF 2UWEF 4HJ1A 4KXBA 1PPIA 4ZFOA 5DTFB 2CAKA 3L4TA 3X1NA 2OZ4H 2PO6A 4ZMLA 5JPMB 4Z7NB 4PWHA 2ZXEB 4HUWB 4G8FA 1GYWA 2EUWA 1D9KA 3VWKB 5FW7A 3CZFB 3MMEA 3WIHH 1C16B 5F7KC 5DMIH 2FLMA 2PW1A 4ZS7L 2CZNA 5IT2H 4DOHE 4AVHA 3KD4A 5T33H 1S7TA 1X9UA 1WZLA 1C5CL 4P9HC 1AQKL 3FT4A 1YUHA 4U0RB 5IKCA 1JZDC 4HUUA 3ZMNA 1ODAA 4L1BA 4XVOA 1MDTA 2F58L 4P9MH 5D7KE 2OA9A 1A4JA 5BOJA 3O3UN 1N68A 4HIXL 3I75A 3C08L 3CZSA 3GSRA 5DO8A 4IMLA 2VQUA 5JA9A 1RZ8A 3H53A 1JXGA 1YYML 7FABL 1WISA 3V0WH 5EU6E 3PWVB 3RWHB 1YMME 1W72L 3ARVA 5KSBB 5EFIB 1I75A 3C9NB 2FBJH 1J05B 4WVRA 1N19A 3KPOA 5AYUH 1HZKA 2HTLC 4PJEE 3ATAA 4UT9L 1JZ3A 1YMHA 4M93C 3N0PB 1IGYB 4XO8A 5GSVA 3W9EB 3LPOA 5HHOE 4TVPE 3KL5A 1UZGA 2L7EA 4PI0A 3T3MF 3GNMH 5DJZB 3LNDA 4ELMA 4KDVA 3TBVA 1M56B 4G5AA 4JCMA 4HBQA 5K9QI 3BRGC 2BHUA 3D25B 2R4SL 2MNUA 1L7TH 3EJTA 2HT2D 1LK3H 4AG4H 2DMGA 2E5EA 3BIKB 4NO2B 1SYSB 3S34L 1BQHA 2HN7B 1E30A 3P0GB 4B9KC 3RWJB 4A04A 1LDPL 3QHZL 4GW5A 1XGQA 3V9CA 4IBWA 4GO6B 3GXFA 4EQ3A 4NPKA 1N9PA 3VXMB 2JK5A 4H25B 3A23A 4ORGB 1ZHBA 2ESVE 2ZWSA 1Q0YL 1QATA 1W8NA 3FFDA 3I85A 3GJFA 4HWUA 2AJSL 2RMNA 4LCCC 4WW1B 3KPMA 4AGNA 1OM9A 2IOOA 1LEGA 4KKLC 5D7IB 4Q6KA 1LEKA 2X0WA 3EO0A 4JFPB 2NSXA 2AMUA 1K8IA 2R2HA 5EBWB 1HXMB 3JTBA 1IT9L 2C9XA 3NJIA 1PDKB 3PREA 1QTYT 1UKSA 2NNCA 4IRSD 3LS4L 4A2EA 5FM5M 1R1CA 3AWGA 1AI1H 4LE8A 3PWJA 4D9RE 4OR1A 4GEJA 4HEMA 3JWDL 1U93B 3LZFH 3ZDYE 3TNNA 1H8NA 3FUFA 3H9SE 3QJFA 3T2LA 1H5BC 2A74C 4IYKA 4LDEB 1R3JB 3QDJB 1QYGH 3QWQB 4N25A 4PD4J 2MPVA 4JFDA 1HWWA 2PO6B 1JN6A 3EJPA 4M1DH 3HR6A 1XF3B 4KOCA 5IF0A 2ZP9A 1NDGB 1AQMA 1E5AA 5HI5D 4YGVA 1YEEL 4IBZA 1PBYA 3F12B 3H7BB 4Y8DC 2E7BA 4N0UB 5B1BB 4WAFA 1XVSA 3PUUA 3AQZA 2MIZA 5IROC 5M95B 1EJOL 5I5MA 4GIAA 5K93A 3HBPA 1VZHA 4PIRF 2C7FA 4MMYA 5DSCB 2WYHA 3L95A 1J5DA 4XBGB 4ACTA 1M05A 4BQ8A 3RNKA 5JOFB 2WAQA 1NZRA 2YOAA 1JDCA 4ENED 2BNUB 2PF6A 3ROLB 1PG7L 2HVJB 4CVXB 5J06A 2XIIA 4EO5A 5C0GB 5KVMC 2CO4A 1KLFB 3FBKA 1IAKB 3IU3B 4IRSC 2R4RH 1EUTA 2C4FU 5MEQA 2H32A 1AKPA 3KGUA 3EFFB 1OT2A 2QVKA 4OSUL 2WB1A 3W82A 1E40A 3DNKA 3QNFA 4I18A 2UWEB 4AC2A 2EH7L 5D7JA 1FG9C 1XSIA 4PWFA 2P5EE 4X50A 3TIEA 1UJ3B 2EZ0D 2WWMC 4YS4A 5LHDA 4R4FL 3VXUB 3ZU8A 3R4RA 4WENB 5JW5A 2OTUA 2ICES 4U0QB 2O61A 2WQRA 4K7PX 1NA8A 3GMRA 3QUYD 3ZL4L 1DJZA 1FSKC 4M03A 4X99A 3W39B 3DHUA 1NFDB 3GYRA 2WJ5A 1IZKA 2MNJB 3QUMA 5DJ6B 4JQVA 4C59B 1ES0B 2XXMB 4PJBA 1CFVL 3I9GH 1BDYA 1HOEA 1NJ9B 2DWXA 4LGRB 4Y2DC 2CKBH 3P11H 4ZFGL 4GAJH 3T71A 1C5BL 2MCAA 3P9MA 3PJLA 1FZOB 5F1KC 3HNTL 4PBWD 2OL3A 2FWSA 3U0WL 2G75A 4U1JA 1KYFA 4N0CD 1GL4B 5CJXC 3MA9H 2DMBA 3N06B 3QUZC 4HKBB 3CN3A 2JB5L 2ZUVA 2OMYA 3L4WA 3MVSA 2VUOA 2ED7A 4G8GE 4XNXL 3TFBA 2H0EA 5TFSL 3QCVH 3CDGA 2DLHA 1X5MA 2Q2EB 2HTLD 3V0GA 3FFDB 4JRXB 4HHAA 1R47A 3V6OC 3C6LD 3VGDA 2JB5H 4LSUL 2BWIA 2P45B 1DJIA 3EO0B 4MA8L 5FV1L 3OB0K 3IGLA 2J43A 1LMIA 5IM7B 4X4YB 1U8LA 4ODXA 3ILEA 3FZUC 4P2AA 1CGVA 2Q3AA 3H7LA 4IIQA 1NKRA 3T0VA 5JHMA 4AMXA 4LKCA 4MGXA 1B2YA 4M5TA 3ABMB 3FO2A 4OZIA 1U93A 3WE1A 2IPTH 1FYHB 4NXSA 5L2KD 3RWIA 5E9DB 5BV7L 3QJTB 4RIRB 3INUL 3VFGH 3P40A 3AC0A 1YCSA 2W92A 4DVBB 1X7SA 2YGNA 4F37K 4N5ED 4XX5A 1S9VA 1JRHH 1W2KT 2VYRE 1AR1D 2MKWA 1ITBB 3MRBA 1XF3A 4JDVA 3EJQA 5I26A 4GRLD 4N9GB 5ICXB 4GY4A 1J0YA 32C2A 4I4WB 3WUWG 5EPMB 5FGCE 4Z7UB 1WAAE 2EADA 3REVA 3PDOB 4XAWL 2PPFA 4JLRB 3CDFA 3GXUB 1NLDH 1YEIL 2K6YA 3DIFB 4L29A 4MMYB 3BJLA 3IMWA 4HPHA 2ZOKA 3VE0A 1SHMA 3CFJB 1QR1B 1T89C 2B1AH 1PZUB 4ELKB 2YSTA 1ZLWK 3LKQA 1NAMH 3AU0A 3P77B 3RKDD 5D4QA 3V4VL 2B1OA 1A7QL 4YHIB 1IRAY 3NAAH 1JTPA 2AEIT 5E6RB 3NACH 3QJQB 5DHVB 4L1HA 4DGUA 2FATH 4B7IA 3AUWB 2OZ4L 1QHQA 3J07A 1GOHA 1GGBH 4XMKH 3HRZA 2VR5A 2YPKA 2Y2YA 3A4EA 2O5ZL 1GA2A 4G70B 4A7VA 3SD2A 4WWKB 3WCYA 3WNMA 2D31B 4IIZA 1MCQA 3T2QA 5ILTH 4PHXA 1XF2B 1XIWC 5T3ZD 3MAWA 1F41A 5DHEA 5HI3D 3ENEA 3QUMB 1H6UA 1HIML 3GMMA 4KAQH 2FO4B 4JO3L 4PJXB 3LQZA 2VJ0A 1LWJA 2OMZB 3IJYA 2BHFA 2NW2B 1G6VK 4FKHA 5F44A 4LARL 2VM4A 3G6JA 4LCYA 2ZP8A 4J3OH 4MAYD 3MREB 4YR6A 4DKFL 1GW0A 4Q9RL 1UJTA 3SGKC 4HPYH 4UNIA 2IBBA 3GHBH 5K1NA 5EIVA 2GC4C 5CGYC 3NSXA 1CUOA 3LKOB 1OK0A 3NABL 4KHTH 4CADB 3IU4H 4OLUL 5JHDA 1INEL 2F2HA 2CNZA 5JDSA 4ODWB 4NC1E 2W38A 4IRJC 4KX7A 4NQCA 1G1OA 3CXHJ 3GBML 3SD5A 5KJ7E 4HC1A 4A7SA 4ONOA 4WF7A 2WCGA 2ZWKA 4K07A 2IAMC 3MV8B 2SODB 3O4LA 1CXIA 4HQQH 5D7SH 2YWYA 3EYFB 3HG4A 3DVGB 2F9BT 2OMWB 3LRKA 3M45A 3U9UA 3CBKB 3W38A 1RHHB 1S7UA 1EVTC 2IANA 1YNTB 1JDAA 1ZS8A 3O2VL 4RWYL 2F8VA 2Y6SC 3CK0L 1MFMA 4LPYA 2KI6A 5DJYA 1C8PA 3G5YA 5DVKA 1T5XA 5EU4A 3VI3B 3U2SB 2HH0H 4WK2B 3CSYB 4OGYH 4GRLC 1E7UA 3N85H 5D1ZB 4Z76B 4ZMTA 4DUWA 4H8VA 4N86A 1DFBH 1PFOA 1PW3A 4E41E 4OI8A 2AZUA 3S48A 4YBQD 3AAZA 4FI7A 1JG9A 4KZ0A 5BJTB 1HXYB 2WYTA 2ATPA 4JMNA 2HKAA 4XGZA 1UC6A 4QO1B 2R2BB 5LG6A 4XNMB 3QDGE 5SWZD 3UTOA 5SWSD 3TH4T 2WO2B 4P5TB 5IEKA 4QXWA 3RWFA 3FCGA 4WFGE 2Y7MA 3BQUB 2K45A 1NGWB 4B41A 4WWNA 4G9DB 4ICXA 5ISZA 3QPXH 4P23A 3DJTA 3L4VA 3FH7A 1RERA 4WHYG 3KWTA 4FADA 1JFHA 4QRAA 1YECH 3CVCA 5CMAA 5CJQL 1JDDA 2HFFB 3L3OA 3QUYA 4XPTH 1TZGH 1LK2B 1MVYA 2X9WA 3V6ZB 2YN5A 1SLUA 1FBIH 4NWUL 3UAAA 1PEZA 1C1EL 1J1XH 1S7VB 3LNHA 5H35B 4ONFH 2ISDA 1UA6L 1KULA 1U8QA 3H55A 1EDYA 1KN4H 2CJTA 1S5IL 4MA3A 4PJIA 1F02I 3BO8B 5HI4C 4TSCH 3L3IB 3CQQA 2ZUSA 4LSRH 3D4ZA 1YPZE 1MI5A 1BD2D 1GAFH 5F9AC 3SE9L 4G2AA 1TETL 1NBVL 1SDAB 1RJLB 2O72A 2E9WA 1KNOB 4HETA 3EBIA 4JB9L 4NHUA 3BWSA 1BX2A 2D31A 3GBMH 4AI7A 2WXOA 2VLMD 2FHFA 4XMPH 4P2OD 3CZKA 1RVFL 5JW3H 1PY0A 1IGFH 3Q48A 3ATBA 4G3YH 3VD9A 3ABLB 3JUYA 4GLRH 3VI4E 2XKNB 1JMXA 3QRFM 1OCCB 4HUVA 2WCSA 3LQZB 4KQ3L 2GQHA 2VUKA 3QXVA 5EUKB 3S4SA 1MAML 3OXRA 1HZLA 3L3OC 3QUYC 4HOXA 4IIQC 3X11A 3RZWA 3WTWA 3ULUD 3Q44A 4YZFE 3B2MA 2XV6B 5GSRA 3L7FA 1LP9A 2BP5M 3BPOC 3MRCA 5D5MA 1RZKL 4AQ8A 4KMTL 5JQIB 3N50A 4IBLT 2EIBA 2DDQL 3VSTA 2ZF9A 2VKWA 3ASOB 3F84A 1P53A 2XXCB 3TOPA 4CC0A 3ARUA 3PG2A 4FG6D 3ZHNA 5I1GL 4O2CB 2XZQH 4NYLB 4E0RB 4UOQA 1GMIA 4NPYA 1HSAA 2CG9X 5F97E 1EBAA 4E5XA 3O3EA 4PJFF 4UU9B 3HZMA 3QIWD 2HJLA 5I8CB 2GJZB 3P9LB 4MD4B 5AWNH 2W9EL 2BS9A 5EEZA 1U92A 3LKNA 1NKOA 3SQOH 1RZFH 4H1LH 4EXPX 5T3ZH 1YNTA 2B9AA 4NQXA 2AF2A 5LXVA 4B96A 1TQBB 1W0WA 4M61B 2C3VB 1L9QA 5I1LA 1IFHH 3IKKA 5TF1L 3RWDB 1NFAA 1Z7JA 4YC2B 5DVOA 1FJ1B 2E4FA 1PZ5B 3TJPA 1ND0A 1F3JA 4ZG1A 1WHPA 5ABAA 1UJ3C 1SBSH 1U3YA 4WHTB 4P57B 5IEHA 2XKSA 4N2FA 4MKTA 3RKDC 2G0LA 3AAZB 4D94A 2DF3A 1IAIL 5I8OL 3PAZA 1O9VA 4RCAA 5E9DE 1IBFA 3BKJH 5DFVC 1MCCA 1ZK5A 5HHME 3FU6A 4UQAA 4Z7OF 1N0XH 4PY8J 4MRBA 1QPPA 4A2HA 3TCXA 4FQ1H 3ZUNC 5LDUA 4HISA 3T0EE 4XPAH 5ISZB 4GS7C 1R24B 1EHXA 5IB4A 1G5AA 1JPTL 3EJSA 3FTVA 3MCLL 3TEWA 4YK4B 3TH2T 1X9QA 2KQMA 5FYKH 3C2AL 2EIDA 3M8OL 1NAKH 5FKPA 1F18A 4P07A 1LE9A 4NUGL 2F54B 5F3BA 5EC2B 4PWKA 4HXAH 3T4YB 1KJ2H 3A67H 1GKEA 4S1DC 3LN5B 3OMNB 5E6ZA 4IRZH 4NCDA 4DF9A 5INCA 2BH0A 5SWQA 2CUHA 3D85A 1XTLA 4AQ1B 3QQNA 1WBXA 3AG2B 4LRNL 3RIFF 1I1RA 5ADOH 3EH1A 4KWUA 1IC5H 4ONGH 3PQYD 3VD2A 3I02B 1BX2B 1ADQH 5MEOA 4AL8L 2X1XR 1GCYA 1HAWA 2PCPB 1KDIA 3D4YA 1J86A 3UGUA 5JHLA 2HA1A 3T8VA 4CJ0A 3K4AA 2YD3A 2NNAB 2XKNA 3GINA 2AGJH 3PF2A 4FEIA 3NJJA 1E27A 3ZTDC 2DYPD 2EYSA 3CVHL 5BXFB 2QELA 3HNTH 4BUHA 1IGMH 3VD0A 3GGWA 1ACYL 3GLZA 2O5XH 4UBDC 5F1IA 4EZJA 1UD6A 4TSBL 1KBKA 1INQB 2JQAA 3CVIL 4OFPA 4HAKA 4PRPB 3HN3A 5JIMA 2WHVA 1VFAA 3O0LA 3S37L 3NFNA 3UTQB 3HZYB 1CICB 2NZ9D 2WJ7A 3LXCA 4DTGH 4FA8A 2X38A 1LHZA 3VGEA 2W1NA 5CZVH 4Z7IA 5GHWH 4HJ0D 4K9EC 1LD9A 3M1BA 2CRZA 4KVCL 5C09A 3LIZH 1J7VR 1I4FB 3X3GL 3N40F 1ZVSB 3W37A 1RIUH 2ZONA 3S3SA 3O3DA 3T3MB 1TYEB 1ZT7A 2JF1A 3JV6A 3SPGA 4DZBA 3MLYH 4LL4A 1AD0A 1U41A 2X1WL 4G8GB 3L2NA 3QNXA 3BQVA 1MUJB 3SDCA 5I16B 3FQWA 3LNEA 1T7VA 2B1HL 2QTEA 4AYGA 3FCSA 2A4ZA 3ULUE 3VGFA 3S7GA 4N24A 1ZA6B 5LGHH 2YZ1A 3MLTB 4PJEB 5TK2A 3OLGA 4OJFL 1MCOH 2X09A 3B2VL 4HDIA 4NQEA 3OKLB 2GFBA 4BSVB 4YE4L 3DSFH 3MBXL 5FR3A 1CTOA 2QMJA 1HNFA 1R17A 1ZPLA 1Z1WA 2MCPL 4RMVA 4AY0A 1X6NA 4XMVA 1KN2L 2KBGA 3DX7A 3AREC 5KAQG 4FQHA 1I7TB 3SE3C 2BIMA 3WEMA 5DZNA 3PABB 4WTXA 1N64L 1JWUA 1DLHA 3NIGB 4U6XA 2H1PH 4YJZL 1CLYL 1CU4L 1AKJB 3NZHL 5E03A 2Q5BA 1F42A 1TLMA 1UB6B 5HHPB 3NFPA 5ALBH 4AIXA 4EMZA 3B7TA 4NENB 4Z5RB 1WIPA 3AG1B 4P5TC 4XCFL 5HGAB 3ZPDA 2BIIA 1U6AH 3SDXF 1LJMA 1ZE3H 4Y0GA 4U0RC 1AQDB 4PGCB 1JGIA 4YDLC 3JQOB 4NO5A 1D5ZB 1T22B 2VXVL 2VLJE 4YX2L 1B4RA 3BKYL 1OB0A 3GSQA 4M29A 1M7DB 4APQA 1GYAA 2CR0A 4HIEA 3KYMB 1PZCA 4XTRD 7CGTA 3QW9A 2J55A 3WN5B 5DJXB 3OHMB 1PZDA 2OMVA 1NCNA 1NL0H 4W9EC 1CDCA 3D48R 1IKFH 3VDBA 1JNJA 3QVAA 4XOEA 1VA9A 3O8XB 2NTFA 3UTSD 1TYRA 3QAZB 5JR1L 5MP6L 1RZIB 1NEZA 3RZCA 2VLJB 4NN7C 1CL7H 3MN8A 3I02A 1VFBA 2LABA 3D52A 1T5KA 2XPGB 5L2KA 2PCPA 1YDPB 4KH2A 1DN2A 2F53B 4IRSA 5LQBL 4PBXA 2E7MA 1QRND 1QUNA 2NNAA 3L9RA 3O45B 2Y2TA 1IAIM 3X3FL 4X5XB 1A6VL 4HKXB 1UCBL 1I9IH 3GXTA 5AVSB 3JWOC 1UKTA 2DQGL 3IDJB 1KC5H 1JPSH 3I2CH 5DJDB 5F89A 3MV11 3IGUA 4OD1L 2AAVA 5FYKU 1UD8A 1T7WA 5FM5O 3JZYA 4Y2NA 5EWIH 5FYKD 2WBJD 4K94L 4HAGA 1DSFL 1ZSDA 2UZIL 4G7QB 4TRPH 5EOTA 5KYYB 3FFCB 4PSPA 4TL4A 3V5HA 3CIQA 4QUOA 1SF3A 4WY7H 5KOVC 3SOBL 1YEDB 2J25A 1FDLL 1TVHA 2EVFA 4QXGH 3RVWD 4KRPB 5EA0L 1NBCA 1NCJA 4NKMA 5F0PB 1M2VA 3WFEL 2R23B 2BY0A 3BHBA 4WWKC 3T04D 3HLKA 5CUSH 2PKDA 2HXAA 5JO5B 4M5ZH 7FABH 4IEFA 2Q86A 3EDKA 3FQWB 1DSYA 1DO6A 1YJDL 3C6LA 2DYRB 1E43A 4M02A 1G43A 3L4CA 5IBUB 1R75A 1XDTT 4IGBD 4P4KA 3DOSB 4MNQA 2ZF8A 4XO4A 1FVEB 1K4CB 2EIZB 2IDUA 2JFCA 4EI5D 4ZZKA 1WIOA 4PB9L 5E1GA 1JMZA 4PGDA 1CS6A 5E4EB 3EBHA 1PIGA 1JGEA 3MCKB 3M17B 1HVXA 4H1LA 3RGVB 3SCMD 3VWJA 5IVXA 4LSTL 5T33L 4FHJA 3KPSA 5IT2L 1L0XA 3LH2H 1AHWB 3LKPA 3B7UX 3DHMA 3MLSL 5INDB 5CEZH 2HG5B 3QISA 1X5GA 3P3UA 5TQ2L 1S7XA 3NSDA 3S3CB 4JDEA 1IBBA 1BIIB 4N1HB 4OAWA 2EH8H 2TSAA 4OV6F 1I8IA 4P9HH 4BK4A 1J8KA 2TRYA 4JDTH 4OJEH 5HGDB 1XGUB 2KKQA 3ALXA 4Q9BA 5KSUA 3ZO0A 1EHNA 1KCUL 3B83A 4XP4H 3ZY7A 5LQBH 3UTZA 4GG6E 3MODH 4WI7A 3S3DB 4CU8A 4HH9A 1LXMA 2B8OT 4APQB 3HG5A 4S2SB 1Z9PA 2IPUK 2YPLE 3OPZL 2HG0A 1S7WB 3AROA 4BH8B 5E24E 2QV4A 4QJ3B 4WFHD 4UDUA 2AK4D 5JXAL 4TL5A 2CLRA 3DX8A 3WIHA 1ERNA 3UAEA 1XR9A 5F3FA 4L3ED 4MNGE 2NR6D 4G8FB 4N0FB 4XE0A 3U79A 3O2DH 4ETYA 1QBAA 5D72H 1WFJA 4LK4A 4XWGL 5FO9A 4GINA 4GUQA 4M9PA 2B15A 3WKNA 1U3JA 4YX2H 3R7RA 3WEXB 2GYSA 1LO0H 5C09D 1LE5A 4QRSB 4Z95L 2I27N 4IRZA 2GBUA 1RZJL 3I84A 1U6AL 3PU7A 4RBPK 4XI5D 5DO2D 4O51A 2CBPA 5GZNC 5HSFA 3O45A 1SHXA 3IGKA 1F4AA 3PNWB 4PRNA 2EYTA 1OW0A 1WBZA 1XCQB 5EO1A 4NAMA 3O2WL 3EYVA 3GSVB 2YK1H 1YY9C 5H94B 3QNZB 4FFZL 3RX9A 5C6TH 2ZWNA 1LQBC 3D3VA 3HCVB 4NZDA 1A3LL 2EC9U 5ITBL 5F6IC 2C9VA 5ESVA 4G7VL 5EF0A 5GZNA 5EFIA 2ZX8A 4P48A 4LDCA 4MX7A 4P46B 2G5BB 5C08D 3QG7L 4WUUA 2OP4L 1MCOL 4JPWL 4YAQB 3BDBA 4Y4FB 4LU5H 2AQ3A 3MYJA 2Q7YB 3O6LL 4FL4B 5B3NA 2A9MH 4EPSA 2Q86B 1TR7A 1YRKA 4MQ7A 4Y5VC 3EDDA 1BECA 5DUBB 1WCBA 2Q6WA 5ICZA 2NY2C 4G6MH 4PG9B 4X8XA 4BCZA 5JTWA 1QP1A 3U7YH 1VEMA 5FA3A 3O9WA 3QJUB 5CN3A 4L9LA 4WSKA 3WN6A 4UDTA 4Y9FA 4WKXA 1AP2A 1J8HD 4PD4K 2OKMA 3RPKA 3OKEB 4JG0L 3Q05A 2VH5L 4LOEA 1NCBH 1ZDQA 2VRKA 4ZZFA 5EEYA 3GJFH 4U6VL 2W59A 3UGEA 2X4OA 4ZUWA 4YBHA 5C2UB 2NXYB 3GSNH 3VD5A 5EZOL 4H25A 5K1VA 5JIKA 2CRYA 1MEXH 3A6BH 1VZIA 2V5RA 3KPMB 3DUHA 2JB6A 3IDNA 3WTXA 4F9LC 4FXKC 3VI4B 4BA8A 4KZCA 4JFPA 3BWAA 4OJYA 4CC1A 2VISA 3ZDZE 3EBGA 1IGIL 1QLRA 3EH4B 1D5XB 3K6SA 5A7EA 4NCC2 3B8YA 2WGNB 4AMKH 1KEMH 3UTZB 2ZT9C 3F6LA 4OCSL 4BD4A 2QVMA 5I75C 1RZKC 2F5BH 3QJFB 4PIBA 5LN8A 3A21A 1CL7I 1EFXA 1OKEA 3MRGA 4JHAH 2XU9A 2HKFH 3TO2A 4JVPA 4WV1C 4GAFB 4WI0B 4UM8A 3C6LC 3LPFA 1AGFA 2KS0A 4NFCA 5TPWL 1LTXA 1AGBB 3NGBB 4O2FB 5FX3A 4DQAA 4DKTA 1N70A 4N2HA 4Y9EA 1QD0A 1VLXA 5D2LA 2A9CA 2KC0A 3C6SA 5FIEA 3KJ6H 4I5BA 1M9SA 3RVTC 2C9RA 4M7JH 1U21A 3BP5B 3LVTA 4RMSA 4MB3A 2WLMA 2H5UA 4K71B 5T1JA 1OP3H 1N4XH 4LCCB 4D0DA 1I8MA 3B9KB 3D9AH 2V5MA 3GRWA 4U6YB 4A2MA 5I0ZA 3RTQC 3KGRA 4OQTA 2WMPA 3O9WD 2MNWA 3FTZA 3AXLA 1AO7D 1UFGA 5F70A 1WA1X 2NY0D 1GC1C 3TCTA 4YHPA 3QI9B 1N7MH 3EJZC 1FAIL 4KKAD 1GVIA 1XCQA 4RAVB 5B8CA 2WIIA 1IAKA 3IU3A 3V7AE 3GXMA 3NPSB 1G6RL 3L9BA 5L4MA 2VDPB 3RDTB 1QHOA 3ZHKA 4PM1A 1RL1A 1UT1A 4PJFB 4MNQD 5C6TL 4R9HA 3QEHA 4HUKB 3TZVD 1R46A 1D5RA 1W72A 1S7RA 5C3IA 4Y1AB 4YDKH 4NSKA 3THMH 5FF6A 1N10A 3I74A 4YAQA 1REIA 2H41A 2WD0A 3HZVB 1HZHL 5K39A 2EIEA 1P9MA 4NP4L 3UTPE 4JKLA 3SQOL 5EZIL 2K0RA 3CDZB 3VX0A 3VI3F 2YO3A 3FW6A 1JZ6A 4PJBB 1FE8L 1KGJA 5B22A 4N4YB 4AGQA 3K8LA 2IH3A 4YXLL 1Z9SB 5JPNB 3V0AC 2VAJA 4RRPM 3E2HB 4L37B 5DVMA 1U3HC 5DEFA 3LQMA 1INDH 5DO2C 4WI5A 4DEPC 4F2FA 4JY6B 2XWJB 2XZAL 4KKRA 4TNWK 5KVFL 1MI5D 3BLBA 1ZGLA 2I26N 4M5YH 4NKQB 4NWTH 4AV4A 1CBVL 1ULVA 5BZDA 3GMNB 3O6FB 5D5ME 4K7PH 3BVNB 4V1DE 3FSAA 4FA6A 1ZANH 1JPGA 2Z4QA 5C07E 3WS6C 3CDGB 5DQDL 3HC3H 5GGRA 2MSPA 1NCWH 1H8LA 3LZLA 3L48A 4QHKJ 3T0ED 4JRXA 1QNZL 2J4WH 3L3HB 4HUXA 2UXFA 1EDHA 2NCMA 2PLTA 4O00A 5EU6D 3SHSA 1TOXA 2B2XH 4TVUA 1K6QL 4HF5L 3UROR 4Y4HB 4WUKH 3GD1C 2EH8L 2EICA 4H2AA 3C5ZA 1K4DA 2VERA 1RQ5A 4JFQB 5TQ2H 3UTSA 1JRHI 2V7NA 4IS6B 3KPSE 2D7TL 5I6MA 1BWWA 2NQCA 4A7TA 3ESMA 4D2NA 2CSPA 1T03H 4N0UE 1FCGA 4FXGC 1LO3H 5D1XA 1IKNA 4PB9H 1JE6A 4N5EC 4UM8B 2D0HA 2IWKA 4Z7WE 3AS3A 4D0CB 1UACH 3VGBA 4Y4KA 3MNVB 5CCKL 4OD3H 4JPKL 4FABL 3KPSD 3QZWB 5HVHC 3BUYB 4OGAC 3PUCA 1HEHC 1HHIA 1G87A 4ENEC 2YZ8A 3QRLA 8CGTA 4RAUB 4BQ9A 3SDXB 1TZGL 3RGBA 3G6DL 4D0DB 4MB5A 4JLRA 4WI2A 2ZKXA 1G0XA 4Z7QF 2D3NA 3JWNH 1PSKH 5DK3A 5J12C 4QEGA 3ZDWA 3CTTA 3P3TA 1MZZA 3VFPB 4J7RA 1CFBA 3VWJC 1FGNL 1OAXL 1X3DA 3F5WB 4J3OG 1QR1A 1OGAA 1CD1B 5AYQA 1D5BA 4WUUD 5K9JL 2NNFA 1MCEA 2QQNH 1CFTA 4DUXA 3EG9A 1NANH 1TZIB 2NUPB 3WY4A 3B43A 1NGXB 4YSCA 1T5WA 2NR6C 3S35X 3GUTA 2QHRH 4PSRA 1P5UA 4KROC 5GISH 5ALCL 3QORD 2XV2A 3OKYA 2ZPKH 2AEPH 1HH9A 3HRZB 5FYJL 4K3EL 1R5VA 4FF9A 2PW2A 4JFDE 3EO9L 4XP5L 1GPOL 3FC8A 5IJVA 2Y7QB 1S7QB 1ET7A 3QEHB 3FYIB 2E7CA 1ASPA 3MRFB 3QYMA 3MUGB 4ZYKA 3S8FB 3S96A 1J5IA 3F7YB 1E4XH 2AV1A 2NY5H 4P3DA 1TJGL 3Q2LA 4LCVA 2R59A 2E0PA 1DFXA 4I0PB 2PP7A 2IVFC 2ENPA 5KBKA 2GSMB 1SJXA 1AZCA 3IJHB 2D2CC 2CKNA 2OMZA 3PL6C 5JPNA 2PXYB 4UANA 5MP6H 2G3XA 3HUJA 4FYSA 5IHUL 4PUBH 5J13C 4OCXH 1TPXB 5TE6L 1ORQA 1BJ1J 2RALA 4JANB 4WUUE 4Q4EA 1MJUL 2YLKA 1ZWIB 1JNLH 3AUVA 3CFEB 5A2JH 4X6DA 3BUQA 4AQZA 1U8OA 1FVDB 2F15A 2NY4C 2WV3A 3G5VB 4DKFH 4E42A 4F8PA 3MV8A 4F7TA 4XCYA 1THCA 3VXRD 3TA3B 1ZIBA 3H9YA 1P4IL 4QRBA 3WY2A 2L7QA 4RVBA 3P0VH 5CIPH 2Z31B 1WHOA 3ESNA 3QORC 1M71B 3QUZD 1DEEB 5CILH 2E7DA 1RZQA 1DUZA 3K0WA 5D55A 4E9LA 4EZKA 4FQJH 4ALAL 1FPTL 3WU1A 2YPVL 4X6CA 1K4DB 4JVWA 4ZPVB 1RIHL 5AKRA 5F6HI 4UT6H 3U6RA 5FO8A 5AVZB 3FB5A 1EA9C 4KK5D 1MQKL 5DEGA 4S0TD 3FTGB 3OKOB 4K3GA 4P49A 5I0VA 1KFAL 4BCYA 4I1RA 5JIHA 3TBTA 4TTGA 1JWMA 2NPLX 4F7CA 1PCXA 5C0AB 1DBKL 4CSPA 4XNMA 8FABA 4M00A 4S1DD 4TUKL 4OM1H 1DYZA 4I9WD 5FS5A 2HPTA 5EBMA 5I5IA 4MNGA 2E3VA 3BQUA 3OKMA 2FL5B 3TZVA 5CZKA 4YPJA 2D03H 1W9XA 2BJMH 3QNYB 2V2WB 1I1AD 4GBXC 2W60B 2UZYA 3ZVVA 1NCCL 1KXVC 1X7TA 1B6UA 3PWVA 4G7RB 4PV8B 2BHYA 3C9NA 1FVCA 4ZTPH 1SFDA 1TG8A 5H37A 3S2AA 1NUDA 2GY7B 3K1DA 4YC2C 4HBCL 3LIZL 2KZKA 3X3GH 4AT6B 5CINH 2F61A 2VDLH 1QZNA 2HYMA 5E8OA 3WNJA 1FC2D 3BO8A 2ZOWA 5KTEL 2ARWA 4KJPD 1QA9B 5F3HA 4QJ4B 1D7DA 4ZMVA 1PX3A 3OAYH 3QHFL 5C0FA 1DBJH 4B60A 2GEEA 1ZCRA 3UZQA 4AENB 3VTMA 1S7QA 4Z18A 4GBXD 1I3RA 5CNHA 2AC0A 4QTFA 1G9MH 3FU5A 4EUPA 3OAZK 4P3DB 4GAYA 4QRRE 3IFPB 2QGCA 4QHLB 4UT7H 3A0OA 2F7IA 4DAGH 1CR9L 3PDDA 2O5YL 2XLLA 5LBVA 3V0VB 4BFOA 2HRPL 2NZ1A 3FXIC 3VSVA 1SQ2N 3CHSA 4K8RL 3IJHA 4LSUH 3VNYA 4NNXB 1PAZA 3QEQA 3US1A 4ZFZA 5I8KL 2JV6A 1C12A 4QRPD 1O5PA 1I7UB 5JW4N 4TUOA 2QKIB 4W9ZA 2DM3A 4TYUA 2GSIA 3SZ6A 4XPHH 5F7UA 2ICWB 5GSRB 5I8KH 2IDSA 5AVTB 2AJYL 3B7YA 3ZIMA 1BFVH 1QVOA 1LEGB 3EUDA 3QIWC 1AS8A 4D9LH 4JM2A 3RVUC 3QQDB 1EHLH 4JANA 3WFCH 3QEQE 3QRGH 4RA3A 4RGMB 1HILB 4XB8A 4IKKA 1HXMA 3LRHA 3VFMA 2V7HB 4PGEB 1M3IA 1KXQA 5HVFB 4MA7L 5FCUH 1HHJA 3HZMB 4KKLD 5D1QB 3PWJB 3UBFA 4PRIA 1HQ4B 5B7EA 3TNNB 3TT1L 1YEFH 4YHKL 1OO2A 4PS8A 3MRDA 5I6OA 4KK9D 4PRHD 4CVZB 3WHXB 2JCCB 3WFDH 3P4OA 1DEEA 2VZVA 5FB8B 3MNZB 2B14A 4L3CB 3GBDA 1VGEH 3SE8L 3FN0H 3KPRE 2Y06H 4HBCH 4GRLA 1AGDB 4HJ0C 4YGVB 4ZTOH 5EEWA 4JO4H 5L2KE 3UH8A 4R4FH 4AM0B 4LDOB 5GGTL 1WWAX 2NY0C 4E9TA 3R1GH 4HIHB 1PY4A 3CVHB 2KDYA 3NJLA 3FO0H 1NGPH 2H26B 3SCMC 3X13B 3ME0A 4BXVA 1JJUA 2HKHL 3SO3B 2AABH 4UBDD 2DQJH 4FZEL 2C3XA 5LAXA 4JREB 4LEEA 1OF2B 1BSIA 4U2ZA 4DW2H 4GRWE 4JAMA 1HE8A 2CPUA 5DD0H 2XOTA 2Z8RA 1KIUB 4TUJB 4ZXBA 3EFFA 5AVXB 1OCWH 1KGUA 4F33A 3MBEB 2UWEA 1A6TA 1F11B 1IC4L 5D1QC 3LHPH 4PJ9A 4WGVB 1C5DA 4M6NL 3AM8A 3LRSA 3WMPA 1T4WA 4ABQA 5FKPB 3LKRA 4WNJA 4NLHA 3EGXA 2E76C 2VN3A 3AG4B 4M7LT 1HL5A 5C3TA 1MIEH 4RGMC 3NBNA 3GMRB 4PJ5E 2WLIB 2E46A 1G7PB 4N9OB 1Y07A 2V0AA 2OZ4A 1LVEA 3UIYA 3DVIA 5A3ID 1K5WA 3V8OA 4YBQC 3WXWL 3DI2B 1MVUB 2ARJQ 2VL5B 3LZFL 4M4RB 3CFKB 2E7HA 1XIWA 2X53A 3NVQA 1YN7A 1QBLL 1XGPB 3Q6FB 1FZOA 1E8WA 4Z7VB 1HEZB 3MV7E 5IP4A 3BP4B 1Z5HA 2BY1A 4GAYB 4QWWC 5JIDA 3M07A 1IT9H 1HS6A 1ZGLP 3MV9A 2B39A 2XWXA 4UUJB 3P73A 1ZXQA 2CXKA 2J1YA 1A7OL 1EEYB 1N59A 4KZDH 3KLQA 2GJRA 2O6PA 4WW2C 1NIFA 1I1AC 1UA3A 1VFAB 3UTQA 1I7ZA 1V54B 1OAKH 1MHPL 4JM2C 2D7NA 3N41F 1EZUA 1P5UC 2EYRA 3D0LA 3FH8A 1TEFA 1IILE 3CUPA 5B21A 3AW5A 2EC9T 1AXTH 3DLQR 3MLXL 2LVEA 4C83A 3GBNL 3A6OA 1K2DA 3VWKD 1J1XL 1PZSA 1X7QB 1VPOL 4P06A 3QPKA 4PMEA 5DMJB 4ZD3H 3FB7B 2X2UA 1WD9A 1HQ4A 2XN2A 4MJ6A 5IHWA 3T8XA 3HHRB 5CZXD 5LKNA 4P8QA 3GLAA 4OGQC 3TURA 1MUJA 3SDCB 4XP5H 4FFYH 3MV7D 4OJAA 2MJWA 1OQOA 2PPCA 1GY1A 3NZ8B 1Q0XL 2A1WL 3DJ9A 4HOMA 4H44C 3US0A 4KK8C 4LNRA 4X9HA 3S36H 3ZKNC 3MLTA 4PJEA 4WEMB 4BH7A 3EGSB 1DN0B 3PWLB 4GKZA 3MHZA 4P04A 1Z3GL 3T2NL 3J8F7 5GRJH 2XG5A 3Q6GH 3AQXA 2QQNL 5EEUA 5EZPA 3ARDB 3B3BA 1UH3A 4I4WA 4LVHB 3S36L 3VFWA 1CD0A 2VLRE 5IGXH 1Q0XH 2DPKA 4B0MM 2LFGA 3LIZA 2DY2A 3MX0A 5CIPA 3ARED 4OGAD 3BWZA 5FV2A 3S2CA 3PABA 1OTTC 3VE0B 4DN3H 4LLMB 4UT6A 4X0NA 5I1IL 5CHNA 2HPOA 2ZOTA 4UAOC 4XXDB 2GITB 4KH9A 3D34A 3QEUA 5H2BB 5L4FA 4M43H 3KPNA 1XF5B 4ZDHA 2HUEA 3Q8CA 4XXWA 3BH9A 4GQRA 1N12A 2BNRD 4QYOA 1O7SA 4QNPE 2PTUA 3FTWA 4S11A 2WVTA 3TZVC 2IV9A 2A6DB 1D5ZA 2N01B 2X9YA 2XY2A 3FTUA 1A6TB 1F11A 3ARGA 1T03L 1F6FB 1TTBA 3U30C 1FZMA 3LKRB 3WIHL 4Q52A 4K5NA 5C0DA 4BYHA 4TNVF 4R7NB 4ZW6A 5EZLB 3B56A 4P05A 2GK2A 1T7YA 2CGRH 4R90H 5CSGA 2F08A 4B53A 5BRZB 1G6RB 4OLZL 4HCRL 2B2XL 2Y5QA 2ZX5A 4L4TA 2NW3A 1AHMA 1IC1A 4X5WB 3VXMD 3UO1L 1U3NA 3ZDXB 3PL6B 1ESOA 3DV4B 1KELL 1TJHH 2X28A 1HQRA 1KLUB 2QR0A 4KFZC 1A6UL 3GZPA 2XPGA 3MXVL 1YEHL 1KPVB 1UXLA 1YNLH 5DHDA 5A16B 4UQ3A 2YD0A 3SYCA 3WJLC 1DQML 3RFRA 4EI5C 1W8OA 1RZGA 4P2QB 5E2TL 4ZMQA 2FT6A 2G9HA 4M5YL 1YMMD 4NWTL 1IM3A 3MFFB 1MJ8L 3VXOA 3SPJA 3U82B 5KVFH 4IKLA 5AOJA 1S9KC 2XIBA 2MOQA 2NX5A 2QZ5A 3T3PE 4KBPA 4Q9CA 4ZMZA 3I3DA 4V2CB 1T20B 3QQXA 3UTTB 1XIWD 3DVGA 4LRIC 4QOKA 1ZDSA 2VW6A 1SEQL 4FG0A 2OK0H 1QLFB 3ABGA 2YQ3A 2D7OA 5F72S 5B38G 4RFOH 3UDWC 3VACA 4TUUA 4NO3A 2DD8L 5B8CC 4XVUD 4W6YB 1ZKAA 2VXQA 2A99A 2CHWA 1A1MA 4Y5XB 4YL9A 3QC5X 4DFIA 3AY4C 3KHOA 3WKML 3WNPA 3EOAB 5IJKC 3EAKA 2B1AL 4HU2A 2ITCB 2YPLA 2L7JA 1X5JA 2AABL 4BJLA 1PMYA 3BKCL 4LQFL 4QRRD 3ZE2E 4F24A 3FO0L 4N6QA 1M1XA 1DVZA 3OC8A 1EHAA 5DDHB 3WUWB 4IOIB 4XAWH 4D0BA 4LNRB 1HSBB 2APSA 4L1LA 2ARJB 2IPKB 3RJOA 1NC4D 1BYNA 4Z0XB 4FMKA 4ZTOL 2J1ZA 5ERWB 3WNIA 4L4VB 1KIPB 2VDMB 4YBLC 4ZSOA 3FU9A 2AQRA 1WUNT 1M9WA 2VAAA 3QR0A 2E8YA 4WJ5A 3A5VA 2IF7A 3WFDL 2OCFD 3GMQA 4LLUA 3MC0A 3VXSB 1T2XA 3QJHA 3MFGB 3D18B 1P4BL 4MMXB 3OKDA 3VXUD 4NDMA 2P5ED 4IRJD 4UIMB 2I60L 1UM5H 3IMUA 3QXDA 5CWSB 5EO9A 1MI5E 2A6IB 4AEEA 4OKDA 5HGDA 3K0YA 1XGUA 2EDKA 3QE5A 4Q0XL 5D2LE 5KSUB 3C75A 2P8LB 1NINA 5I18H 2YC1B 4XI5C 1E9QB 2HKFL 5BZZA 5DHVH 4PMFA 4XPHL 4UT9A 3RX8A 4PGBA 3UTPD 3L3GA 5EDSA 3PQYA 4K7PY 4PG2A 5J8OA 1FZMB 2L8AA 5A3IC 2VR8A 3BZEB 2K6WA 1R0AH 2B4CC 4YSTA 3RWGB 1AY1H 4L5FL 2OQJB 4FXGA 4D8PA 4UB0H 2J8UF 3TEXA 3F65A 1LQSR 1U8KB 4XPBL 4XC1L 3SYAA 5HYEA 7PAZA 3HNSH 1TVDA 3UABA 4GMTL 3PYCA 1JGLH 3EYOB 4FG2A 4YNYA 4JFYB 4UI2A 3MRKB 4JE0A 3NIDB 3BXNA 3WJMB 2FIKB 4OLYH 4YFLF 1DUYB 4OCNC 1C5BH 2BVOB 1JXDA 4AYDC 1FL3B 1TTRA 3PHOB 5DI8A 2R9HD 2BRRH 3G3LA 1J8HA 1OY3B 3E9TA 4NBZB 1NMBL 2EDYA 3O3BA 1DBJL 4OZHE 1PD6A 4WEEA 1RUQL 2XZCH 5JW4R 2MHAA 3QIUB 2YGOA 5E94A 4AVIA 2GB2A 5FUZL 4UQ2A 1AO7E 2FYYB 3HZKB 2DIEA 4F27A 2QGDA 2VDLL 4PJ5B 4NX0A 3IF1A 1HESA 1NAMA 2RQ8A 3SDAA 1T83A 4CL7A 3FOLB 1X5KA 2BSED 4HLEA 2BK8A 4B9PA 3RU8L 4Q9QL 2NSQA 2J1WA 1GYUA 1UEYA 4ZPTA 4CKVX 5KSAD 3IN0A 3T6ZA 1TFHA 4PJGF 5HDBE 5JHDE 4NN5C 1T0NA 1WYJA 5IOPB 5KVFE 1SY6A 4QRTA 5EO0B 4WGWB 5EBGA 3QG7H 3ABZA 1VKXA 4HKJB 1R5WA 4HWZB 5KYUA 2EE0A 4XR8C 2NX5D 2WY3B 2AXFA 4YDIL 1PD1A 4BUQA 2AXGA 1JFQL 4TOYL 4KY1H 2YGQA 4I18C 4K71C 3VYOA 3X1GA 5DHMC 5CD5D 5ICYB 2F7RA 1SXZA 3W57A 1D7CA 2E9BA 3LQAL 4GP8B 2WCPA 4O2EB 5T1LD 2UX7A 2A3TA 1YEEH 3Q3GB 3VXTB 1RULL 3IJSB 1E9PA 5BV7B 3SJVE 3KR3L 1FPTH 4KC3B 4BFIA 1JV2B 5J9PA 4WI8A 1ZPUA 2FHBA 2VAAB 3PWUA 4JFFD 4KJWD 4ZUUB 5CILL 4XO3A 3VXUE 2WXQA 1H0DB 4FFYA 4TLUA 1XR8B 4O5LL 4M1CD 3GK8H 3K74B 4XZ4A 1TQCC 2Q1EA 4F8LA 1XQ4A 4AK1A 1DJWA 15C8H 4XH2B 1WK0A 5DZVA 3UZEC 5CZXC 1JK9B 1XGYL 3G08A 1ZLUH 2R0WL 3MJ9L 1MSPA 2DM7A 3DRTA 2Z9TA 3QZMA 4BRVA 4PB0H 3BWAB 3DO4A 3ZYIA 4I3GA 3QULB 5MEPA 1L5GB 4FKKA 5DJAA 3K6SB 3SGDI 2P47B 3LN5A 2XFXB 3N5AA 1QFWM 4LLVA 5KYWB 2A77H 3ELQA 4JJOA 1HHKB 1WBXB 5L8LB 1BVLB 1SJVA 3MKGA 3FPYA 2CMRH 1T1ZB 4OZFG 3P30L 4PU2A 4NZUH 3IXTB 3REWB 3S5LB 2J57A 4WK4B 4R6UA 2XJLA 4MJIA 4YWGH 1N0LB 5EF2A 4RBPH 5I66A 3K6DA 1E42A 1BFTA 1SHWA 4FQCH 3W1ZA 3BP5A 5CEZL 2H45A 1F86A 2VXTL 4XNUH 3X14B 5JNYB 4I88A 1L9NA 4XNQA 2I9TB 5F2FA 3FONA 1I1FB 2ORBH 1VGKB 4LDLB 1CGTA 1KUMA 3EOBB 4ZFOB 4FXKA 3AXLB 3IVKB 2AQTA 1RZ7L 5HI3C 1P1VA 4HIIA 5F9OL 4JY5H 4Y16A 1EIBA 1UZ6F 1DTUA 3TM6A 1I4FA 3MDJA 1O6TA 3FL7A 4PJAF 4V1DD 3LVEA 1PQZB 5EORL 1V55B 1MFBL 4FHBD 5TGBB 1FO0H 3HG0A 5AW6B 1ZT7B 5EU6A 1BM3L 3L7EB 3P4MB 1W72H 4FJZA 5L2JA 2ZXDA 4U1MB 1IBHA 1OGAE 3RX5A 2J5WA 3UZEA 5BCAA 2FTAA 5EOCL 4KK5C 1CI5A 2E9GA 2ZWZA 5FYLL 1BA9A 1AOHA 1X44A 3K71B 1WZ1L 4WNQB 1QFWI 1U4EA 4XN7A 4OIFA 4MJJA 2EXWD 1UM6H 5DZAA 5E5UB 5EO0A 1NGZB 1V3MA 4Y9BA 3IDMB 1BXAA 1LLAA 3GSRB 3ZKXB 4A2DA 1UUNA 3PE9A 4BQCA 5AVUB 4TQEL 5FWRA 2YQBA 1DJSA 1CFQA 4Z7WA 1B3IA 1FIGL 1IARB 1OE3A 4E9RA 1N18A 4KXDA 1JD7A 3TO4D 1N6QH 4LBEB 1J05A 1LILA 4YSSA 4GH7B 4U6XB 2Y3NA 3MJ7A 2XWJA 5AZ2L 1MIMH 2CHNA 2DL9A 2Z1PA 3S9DB 1UCBH 1BBJA 1AQ8A 4QCIA 1M6OB 2BSCA 2YD4A 2DQUH 5KN5A 2VLLA 5J4MA 2IXQB 2J88L 5F7DA 1DQVA 1BD2B 5DD3L 5CFAA 5HYJE 3FT2A 1U33A 2VQ1A 3KNBB 4NZUL 4ADGA 4MS8D 2FR4B 1OW0C 2BS8A 4O4YH 4JFOA 4FFTA 2VLRD 3UZVB 4J3OD 1IQDB 5HHXH 5BVPL 1BEXA 3BD5A 1BREA 2L3BA 4HIEB 4ABVA 2N7BA 3DTDA 4HLJA 4R0LB 4DPRA 3DK0A 4K9JA 3V5DA 4PLJD 1SYSA 1HI6B 3B9DA 4JGMA 1D9KC 5IBLC 4ZMXA 2CK0H 3DOHA 1F58L 3RAJL 1DBBL 3KJ4B 3NN8A 3L3KA 2CU9A 3BPCB 3FT1A 3E3QC 2WWKO 4WK0B 4ZUSA 2E6JA 3OKKB 5DRZA 4OQ1A 3CZFA 3MMEB 3EFOB 3T8MA 1F1DA 3LEVH 2FEDD 2ATKA 2C7UB 3SGEI 2WOYA 3NSCA 4B27A 3SE3A 3ULSA 4ERSH 4YXLH 4FNLH 1MFCL 3PWPB 1HE7A 4F37F 4UM9D 4UIKL 2X4UB 4KI5E 3REWA 1R3LA 2VXSH 1GSKA 3OGOE 3H2PA 1BBDH 4I48B 4LVOB 4ZOBA 2IWGA 3L9RB 3BUYA 4N0CC 5CLWA 1A4JB 4RAUA 4GXFA 1S9WA 1HINH 1ZTXL 4MZ3A 4AGLA 1CGWA 1ZLSL 4G83A 3WTYA 3PHQA 1MRDH 2YMOA 4LCIL 3L1OH 5AEAA 3F6IA 1MCHA 3NCYP 3WGVB 4U1IA 4KX8A 4JZJA 2PABA 3DPBA 1OGAB 4P5MB 1VEOA 1WEJH 1JN6B 1WWBX 2MCPH 3VRIA 4CN6A 1QRNE 4AJYV 3DSFL 1RUML 3JWDC 1CFTB 3MBXH 3VSQA 2QT6A 3NCWA 4MJID 1JF5A 4YOKA 4FOMA 3RPIA 1P5UB 3BEVA 2F1BA 4HKZA 5KJ4A 4NHCH 5J6SA 1K5NB 1G0YR 3B2DC 1SXCA 1HH9B 2XG4B 4GIPD 3ZL1A 5GS0C 4Z8FH 2DWYA 1RFDH 4Z7AA 4S1QH 4N8PA 2R56H 4LP4A 5T1DH 4YFEA 1UUSA 1V3KA 2CR3A 4TQHA 4YXKL 4WNQA 1BFOA 4TVSa 2WLNA 1EDQA 4RX4D 1OD7A 1RSFA 3CMGA 3M1OA 3Q5TA 3R7QA 2BNUA 2WZPA 2AV1B 4W70A 4QHNB 1BQHB 5ANMA 2DB8A 5ISZD 2N3JA 4R5VA 1UQSA 3ILQD 5CP7B 1KENH 5C0BE 4ELME 5CGYD 1E3XA 1GJWA 5HDLA 2QADC 5DS8A 5DK2A 4NN7B 3UGXA 5IFHL 1SOQA 4CW1B 3VXUA 1KXTB 1ACYH 3V10A 3D2UB 2VLKD 3AY4A 3QDGA 4RMBA 4NM8L 4LLWA 1I8IB 1U8HB 4XX1E 3CFEA 4H88L 4WO0A 4XPBH 7TAAA 2YBRB 4LT7A 5C0JB 4UB0L 4PBVC 1U8OB 3F7RA 4FQLH 4K0OA 2ZYSA 3FB8A 3N9GL 5HJBA 3BAKA 3ET9F 4KJPC 3TU6A 4IKJA 4MS6A 1CD8A 1IQDA 5JOPD 4S2SA 5ADOL 2YMXH 2Y36H 4GLRI 4BEIA 3UYOD 3V5DB 3V4PB 2FECI 1HI6A 1SVCP 1R3JA 2V5YA 4DP2X 3MU3A 5I1KL 3FUHA 4JHUA 1NCDH 4AJ0A 5B39G 4FHKA 3ZO9A 1ADWA 1BG1A 4ADIA 3U6RB 1P84J 4O58L 1MXDA 3EJZD 4QNPF 2IADB 1UM5L 3OLEA 4A66A 2RIKA 2G0KA 1G9EA 4YXKH 2Z35B 1BM7A 4JFFA 4MD5B 5T1DL 1EBPA 2IBGA 1H6FA 2AK4E 4S1QL 4ODTH 3RHWK 2ZXWB 3J2PA 4EVNB 5DFVD 1VFMA 2ZKHL 3LRGA 2YPLD 5BNXD 4I48A 4IMKC 1PZAA 4UV4H 1FA4A 2R15A 5HI4D 3Q1SH 2P44B 1TU2A 2EYTB 2WNWA 1IAII 2ZCLH 3L2MA 1B0GB 3SDAC 4N8UA 4OI9A 4M1CC 2F18A 3QNYA 5DLML 1XF4A 4F2MB 1I85C 2OMTB 4G8GD 4G9FA 4P3CH 5I74C 1F45A 5ID0B 3V8CA 3L3DB 2Z7UA 3FO1B 4OGXL 4X4ME 3PV6A 1SBSL 4PV8A 2O6FA 5E23A 5MI0C 1NIDA 4O9HH 4P5MA 3VRIB 1MW1A 1P1ZA 2G5BA 4WI4A 3MGOB 4JG1L 3MPCA 4U3SB 4I8DA 2YMTA 5LBSA 3VH8A 4LOUD 2ZKWA 3OJVC 1MF2L 3RRQA 3E9UA 3FZUD 1KV3A 4Y4FA 4GQ9H 3RVXD 4CN4A 4PWJA 3PQYE 4IQHA 3CX5J 2XQYG 5HGHA 1N5YH 3MNWB 1ES0A 2ICEB 4W68A 3G6JF 3H9HB 3DMMB 1A4CA 2C9AA 4BFKA 4YSOA 4PWGA 2APWA 4PJAA 4X0KA 4PG9A 3TGXA 3WXVL 4XZUA 5ECGA 3TNMB 5IMKB 1JNNL 2ZKYA 3GB7A 4XMXA 2J8UE 2B20A 2BP3A 2HJFB 5KSAC 3B1UA 3IFPA 4QHLA 1H3PH 4QGTA 1AP2B 2F1EA 1TZHB 5HGBA 3AWFA 1QFOA 1R4XA 4OZFB 5IMOB 3EF4A 4NQDE 4EQ2A 1Q4NX 2IG2H 2J72A 3GMOB 4ODTL 4U1GB 5GRZA 4PJDF 2X70A 2H0JA 1PX4A 2X4OB 4ZUWB 1E5BA 4G1MB 2C5DC 4KKAC 5BVPH 3OF6D 2V3EA 3P02A 2ZSWA 1OAUL 5BZXA 4XNYL 3WFZA 3MODL 3IDNB 2OFQA 3QQDA 2VISB 1JGDA 3RTQD 5I1KH 1GOFA 3VG9C 4U7MA 3UMTA 4Q58C 1MCWW 4KX9A 1DQLL 3KYKL 1IBYA 3U1PA 5ABDE 3CJJA 1J5OL 4X7SL 4PP2B 1QRNA 3IJYB 4F7EB 1YO4A 1OGSA 5JMOC 2H3NB 4HX1B 4XO9A 3II1A 4R2GB 4ZX4A 1AS6A 3HG1B 2YAQA 1R33A 3MRDB 4LSTH 3TIDB 3MRGB 4DVBA 3S35H 3JTTB 2WSKA 4XN5A 2Y3AA 3ARBD 1P7QB 3JV4A 3WIFA 3CD4A 1B6DA 2BSEA 4JO2L 5FB8A 2IWEA 2G2PA 1OTTD 2OX5B 4F57H 2A9DA 3FT9A 4I0CC 4L4VE 1U8JA 4OCMC 4PGZA 5I71B 3U4AA 4F8NA 2WBJB 1ETA1 4MD5A 2LLLA 2ZD0A 3QUXB 1G4MA 1GGCH 3FSOA 3SKOA 4Y8AA 3I6KA 5IGXL 5IJDC 3O4OB 1BM3H 5JMRA 5JHBA 5TH2A 2G2RB 2YUVA 1FO0L 3LKQB 3BSZA 4GOSA 1TQBC 2FWOB 4NB7A 1NC2D 5GRJL 4HJTA 4R3SB 5B8CB 3G5YB 2IGFL 2WIIB 4IJ3C 1FNEA 4OUUA 2QADD 4R7DA 5L0QB 1C7TA 2BSSA 4CNIA 1BVKA 3CSYA 1FLTX 3H54A 4HCRA 3HMXA 2EECA 2BIQA 2Y6SD 4ZAKA 3VQMA 2KDGA 3WAKA 1KLGB 3N42B 2UZIH 3GEFA 3L3DA 4FTVA 4L4JA 4JG5A 2EIMB 1EANA 5KBDA 4PJ9B 4WO4C 2OXGB 4JFXA 2P80D 5DRWA 5SX5H 4ORZC 2DQGH 3EJCA 3LZOA 4O02B 5FW6A 2N56A 3CH8A 5D2NE 3RY5A 4Z6AT 4L18A 2W0PA 3AQDA 4HEPA 4PJCE 5DJ8B 1CVRA 2DI7A 1FNAA 3QR1A 5K39B 1TPXC 1AR1C 2IDQA 4KKNA 2VERN 3L1OL 2HFTA 4RRPG 5HTSA 3P30H 3RUGF 4DK3A 4RFEA 4CJ1A 1H6TA 3MNMA 4PJAB 3VA2C 1XGPA 3MREA 5EC1A 5DWPA 1FORL 4N6RA 3LV3B 3BP4A 4CMHB 1AR1B 1TO5A 4XT1C 1E90A 1NL0L 1JGUL 3CXDL 4UUJA 5IG7A 5C0CB 3ZTJG 1ICTA 1UWFA 1YY9D 3GWJA 3O6KL 4JHBA 4AV0A 2NY3B 4JRWA 4DWHA 2J21A 1QQDB 2E7LA 2WNKA 4L5FE 1QBLH 2GAZB 1KNOA 2IMNA 1GSMA 2FD6H 3HRZC 2ZCKL 3ML9A 4JZNB 1YNTF 3QG6B 2XX1A 2L04A 1F58H 1GIGH 4QRRA 1AG0A 5KVEL 1S7UB 2BP0B 4C83B 4K23L 3IXAB 1X7QA 2JKLA 3DPDA 2BNQD 4JKPH 3FK3A 4KK8D 4QRFA 5HXMA 2X88A 1GC1L 4ATTA 1RKRA 1T5XB 3FRPB 2V6HA 3KVDD 5CJOL 8PAZA 4HX1A 4MB4A 5AL0A 3DUSB 4R4BB 5J12B 1Z2KA 2FSEB 1NSNL 4PJ7F 3HAEH 3O41A 1PLGL 3S3JA 5GGQL 3NJKA 3VFRB 3EFDH 4IU2A 2G4GA 5IREA 2VABB 1P7QA 4Y2LA 4G1EA 2Q87A 3WIFB 1GJIA 5BJTA 1ORSA 4K5OA 4XN4A 4HUMB 1T21B 2BXZA 2V3DA 1A7QH 1HSAB 3LKSB 3L4YA 4BKLA 5HHNA 1DR9A 4UU9A 3WI9A 3R0MA 2CJ3A 3KBHE 4WNSA 4FZEH 4MDRA 2D0GA 4JN1L 2DZEA 2JLLA 1IAOB 2PR4L 3QZPA 3SBQA 2BVQA 1BJMA 1COBA 4LAQH 4FD0A 3FPXA 3O11A 1AZVA 1OAZH 5HY9B 2K9UA 2ZAHA 1IM9A 1BEYL 2QKSA 1SZNA 1CD1A 5AOKA 1ILSA 35C8L 2Y9RT 1UYWL 3IT8D 3ULVL 3S36X 1NGXA 3LYRA 3A22A 4LSVH 3ULVF 1G9MC 5D7LD 2DWEB 3BH9B 1USQA 3QCUL 1TDQA 3L3IA 5BRQA 3JBG7 1XSJA 2A6DA 3V6OA 3ZGIA 4N26A 4P57A 4DP7X 2Q9OA 4BA0A 1RU9H 2Q76A 5BV7H 3BUDA 1MLBA 5BS0A 1CIDA 1QNIA 3DJZA 4YLCA 3EADA 2X4NB 2C9UA 3VMNA 4ESKA 2OAAA 4BSJA 4PJGB 3HTLX 2NXZC 5FCUL 5E2VL 1XMWA 2BCKB 5AW3B 1NGYB 4QGYA 1N6VA 3KEHA 1B0WA 2CCVA 4MZIA 1F5WA 1R24A 4XTRC 5GIRB 3WFCL 5M7QA 3ZQWA 1AY1L 1CXLA 1U3HB 1WA2X 3BN3B 2YAOA 5D1QE 2AJYH 3OXRB 3X2QB 4Z7VE 5T3XD 3MO1B 2XQ0A 1HQRB 5C7ZA 5E4OA 4BE6A 4KRNA 4OIIL 1EEQA 3LV3A 4EKJA 1NCOA 1KPVA 4X7EC 1H3UA 3D6GA 4LHUG 4R8WH 3V0FA 2F54A 1FFOB 1ORQB 2VDNB 4K8RH 2X6MA 2GTWA 5LBGA 4P5TD 1MCJA 5INCB 5SWQB 3BQUD 4L8DB 4AXWB 3VXOB 4WFED 5EF3A 3BCDA 1MZYA 1EFQA 5HPMA 5FO7A 3FKUS 3G5VA 2C1OB 1G9ML 1MCWM 1J0HA 4E42B 1E2WA 3TH3T 2G2NA 2GJZA 5C92A 4MYPA 5MEOB 1F97A 3CC5B 1CFVH 3I9GL 3TA3A 5K59E 2IG2L 3TPKA 3HHSB 2KMWA 4ZX6A 4A7UA 2X3AA 2DQMA 4NZ8A 4KPHL 1Z66A 1W8EA 4M61A 4OTXH 1DZBA 1OP9A 2IFFH 4OZHA 3TJEH 3L1FA 1Q1JL 5I8EA 3CSBA 3TJHD 2VDKB 3VD3A 3FRPA 1YA5A 2ZWYA 2JVUA 3DUSA 3SBWC 3WJJC 2IGTA 2AFNA 3MRMB 3VG9B 3FTGA 3OKOA 1OLLA 3PPEA 4YDVA 5HD8C 1A1OA 1ZHKB 1Q90A 2ZOLB 4LIQE 1X4XA 5CSZA 4IU2B 2LW3A 1MCLA 4MHHG 4ZMAT 1JYVA 5DHXB 4HT1H 2FUTA 3PJNA 4P2OB 3B7SA 4CBZA 3L1GA 1AZBA 5FXCH 4U7SA 3M6DA 3BKML 2P5WE 1DQQA 1PIFA 4U1HA 3CFTA 1FUNA 5MERB 4DP6X 4ZNEE 4KK6C 3QCTL 1PNDA 3GMQB 4RFOL 1H5BA 2A74A 3RBGA 2YQ2A 5HI5C 1JUFA 2Z34A 4GQPH 2X6CA 3L4UA 2WVVA 2WZ0A 2XWDA 3OXSA 5DUML 4F92B 4FCHA 4I77H 3NCCB 4A68A 1P2CB 3NSFA 2P46B 2WBWB 2RQEA 5F0JB 4PW9A 3QXDB 5CWSA 5DZJA 3PHAA 3WEAA 2NY5C 4KV5E 4LLQA 1EJ8A 2EDHA 4FERA 4G6JL 5EC2A 3RVWC 3TT3L 2X1QA 3PFUA 3G7TA 4TQIA 3V52L 2BOLA 1I1YB 1ZOXA 1HJBC 3IDYB 5IB3A 4LSQH 5K9KB 3OGCA 1XCXA 4HIJB 4KRLB 3QIWB 3T1FA 1VADA 1RI8A 2HMID 3RU8H 2WWOA 4Q9QH 3IN2A 5CEZE 5A6LA 5E5MB 3BT0A 1JNHA 3M7FB 3P2DA 5AB1A 5F0LB 3U46A 3H6AA 4Y19A 5K1JA 4DP1X 1KELH 2WXGA 2VN6A 2X4NA 4L8BB 4ZW8A 4PJ6A 2KH2B 5I1DB 4PI2A 2EO1A 2EEDA 1NCDL 4LEOB 3V55A 4XO5A 2BOBB 3L4XA 4HCRH 5C7XL 2J6EA 1Z5YD 3U4BL 4XNZB 4XBPA 1UT9A 1T0MB 5I23A 3DHJA 4LIQH 3HA0A 2NZIA 4NPJA 3MRKA 3WJMA 4N1EA 3SYPA 4HWEL 2B59A 3TWCH 3F7VA 1A6AB 3FSZA 2NY2B 4YPGB 3U1QA 3NIFE 4L8SC 1FL3A 4L0ZA 4TUOB 1CK0H 5FHAL 2GSIB 3NCMA 3H4HA 4Q2ZB 4YHLL 2JJUA 3BUTA 4HA1A 1IGTB 4JY4A 1QVOB 1YQVH 1BPVA 1ZLEA 5J5EA 5KSBF 4JFHE 2MHAB 3HNSL 4Y4FC 4HUWA 4KKBD 2VZOA 2FVNA 3D0VB 3O8XA 2W95A 5F96L 5JUEH 2NY5L 2EDJA 2NTFB 3ZDXF 4GEIA 2Z65C 2DQTL 5LAPA 3VNZA 1RZIA 3AS1A 4GRMA 3FU0A 1NBYA 3FU7B 3CC5A 4MSWB 1YDPA 1OP5H 1FYTD 3EO9H 3QFGA 2WLHA 2VDPH 2LOEA 5E8NB 4X6CE 3DXAE 3QPXL 4M62H 1XSKA 5DMYA 5F9WC 3R0NA 5ALCH 1EAJA 3EJUA 4PRID 1SGKA 5KVGH 1E4XI 1H3WM 3VFOA 4Y2DA 4EOWL 4IMKA 4JHWH 3OLIA 3DJSA 4Y16D 5C0AE 1HWGB 1YAZA 2A1WH 3H3BC 4KI5D 1MJJA 4FLQA 4PYHA 4UOZA 5IVNA 1FH5H 2WLJA 2PCFA 3HS0B 3CBRA 5BZWA 3QQ4B 4NHCL 4AM0Q 2CDFA 3AS0A 4NQSB 3Q3GA 3M46A 4Z5RA 3C08H 3VYPA 1JV2A 2X4PB 2PO6C 1F56A 2PWDA 3HUJF 4IBYA 5E7BA 1NPNA 5CU9A 5GSVB 2AITA 3W9EA 4AVKA 3L6FB 4HPOH 2LHAA 1UT2A 1AQKH 4ZXBB 3IKCB 3AQYA 1F1GA 2QDWA 2OMXB 1BMWA 2WVVB 2ED6A 4IU3B 1CICD 1BPLB 2XVGA 2N1KA 4AGPA 4KQ4L 4PJ8D 1JZ5A 2AJZA 5E1HB 3UJJL 1ONQB 4XVTL 1INEH 2GJ6B 3KBPA 2OW7A 2F8IA 4OVUA 2OMVB 3UMNA 5IQ7L 4UTAH 1G7PA 3BE1L 4NBYB 4UIKH 1G7LB 3PP3H 5GJTL 3T1FB 1IC7L 4P2QE 2WLLB 4UV7H 5K5YA 5KSVB 5AAMC 3GHBL 5F7BA 1JTOA 4NO0D 5E5MA 2PXYC 3RZCB 4XCNA 1ZHBB 3CFNA 1KJMA 1SM3L 4HCGA 5IIEB 4P99A 5JIQA 2JXMA 2NY1D 3EJJX 4PV9B 4OT1L 2CE6A 2IQAA 3WXWH 4YHNA 2F53A 2FQGA 2VLRA 2XDHA 2CKBB 3AXHA 1UWXH 4K7PL 2Y0SA 2Y6TE 5I0YA 1G9HA 3MV9B 1KY7A 1XBRA 4KGLA 4PCSA 1CBVH 4HKXA 1R34A 3KW8A 4K5PA 3V6BR 2YD6A 3ARBA 1T2QL 3LCYA 2N59A 1EEYA 1QSFE 1SMDA 5DQ9B 1G84A 4J6RH 3ULUH 3L81A 3TA3D 2BOCA 5D7LA 1VGKA 3EOBA 2NUTB 3KL3A 4HFUL 3BRDA 1AKJD 4OCYL 1ITCA 2DQUL 3DGGA 2EYRB 2LV4A 1XR9B 1GYVA 3D0LB 4KROB 4M93B 4G7YH 3TCLB 1F4XL 4KRPC 4RQQA 4ES8A 4LLYA 3F12A 5ESQA 4RETB 5D71L 2E9IA 4N0UA 5I1EL 1X4YA 3LB6C 1YHPA 3ZHLA 2F68X 1JZFA 2XWBA 2Z92A 3Q8AA 2F6AA 3WNKA 1OARH 5AB0A 3NTCH 3BC9A 4W81A 5JA8B 3NZ8A 2IAMD 2PTTB 3R1GL 2FRGP 3ROOA 1G6RH 3SQBB 5GGTH 1EGJH 1PY9A 4JFVA 1YEGL 4KFMA 1AANA 2Y06L 2OTWB 3QH3A 2JCWA 3BUIA 4G5ZH 2YQGA 3HPLB 4I1PA 2XIDA 2BC4A 1MQ8A 2EDDA 3QNZA 5E5RB 4J4PA 3RVTD 3C5ZC 1EAQA 3M17A 3A4FA 3HNVL 3K2IA 4JS7A 3W2DL 5HP5A 1LO5B 1FO0A 5E6SB 1AVAA 1MFBH 1PU0A 1MFDH 2PPEA 5D2NB 5CHNB 2D3JA 3STLB 2F1AA 4OAWB 1ZLUK 4NQQA 3AZUA 4AITA 3FF8A 1RZ7H 5F7DB 3O0RL 1T0OA 5TPWH 3DX1A 1NICA 3QDJD 4FFYL 4JM2F 4MA8H 1I53A 1M7UA 1XB3A 2ORBL 2VQ1B 1HC1A 4FQQB 1WUZA 4N8VB 2IMMA 4NZFA 4MAYC 4BK8A 1KGCD 1VF5C 3VA6A 1EZSA 1EO8H 2AAAA 1A02N 4P5KB 5KUKA 2PYFA 5D70L 4FTDA 4CC4A 3Q2CA 5JHLL 1W0VB 2I5YL 4JDZB 2AHIA 4OZGB 2HT4C 3GBNH 5AW2B 3JWNG 1F4YL 2YD8A 4U6HA 1RUPL 2CLRB 4R7NA 2FZ3B 2CGYA 3RTLA 1ONQA 2FH6A 3WNNA 1OE1A 3R06B 1CR9H 4OZGE 4DAGL 5BV7C 1FFRA 1OAKL 4JN2A 2ZICA 3GRGA 3K2UL 1WS7A 1DVYA 3MCYA 3HB3C 3WKYA 1BLNA 3CG8A 3IDIA 2EXTA 4QRPB 1WLHA 1RK7A 4TTDC 3Q2NA 4QTIH 3TYFA 3W9DA 1IGJA 5D93C 1CYXA 5A6IA 2A6JB 3W56A 2IQ9L 4HWEH 3GI9H 2JB6B 3KPRA 3OHXA 3IJEA 5EIQA 4KNQA 5T1MB 3FCBA 4X4YA 5B1CA 5T1KB 5IM7A 5EU7C 3RWCA 4YHML 1CO1A 1ZV9A 3VW3L 1N5AA 1IM3B 5BW7A 3ORJA 3K46A 4JQXC 5JHDD 4ZTPL 4WWOA 3T6QC 2IGLA 3RWIB 1OPGL 1RIVH 4WTZG 1Q94A 4JJ5B 4KGJA 2J6EH 5HDQH 4Q4IA 2JKXA 1AGEA 3VGAC 3DGGB 2HVBA 4C56A 1MIEL 1YC7A 3VG0L 4JDVB 4N9GA 1A5FH 1IFGA 1X5ZA 3A4AA 3IDXL 1XTMA 1NEUA 2GTZA 3D12B 3MYJB 4Z7UA 5EPMA 1JHTA 5IV2A 3T09A 3IJ8A 3VMPA 1E8ZA 4G80B 4QMEA 4GMSL 3B9KC 1OLZA 2APVA 3RB7A 1EJOH 3QCTH 3VTTA 2CHZA 3KYNB 3PXJA 5JZ7D 1UTDA 1BFOB 2CLZA 3IDXH 2XWRA 4FCAA 1R3HB 1IUZA 2XHNA 1IFRA 5FGCB 5LN4A 2IOMA 4GPVA 2CDGA 1DQJA 3LH9A 4QR7A 3RDTA 2WIMA 3LN4A 1NGPL 3MBED 1CPUA 4QF1B 4YGAB 3OB8A 3FQRA 3ZHDA 3TC9A 2DM4A 2HVKA 2W0LA 4KNUA 3D18A 2ZG3A 5I75B 1S7RB 3H9SA 3ZYJA 1VSCA 4JO4L 4P2OC 3VX1A 4XP1H 4NSKB 1Q1JH 3LS4H 4OUOA 3GZQA 5FF6B 3ZN6A 1XXDC 3VW3H 4LLWB 4URKA 5I24A 3IGFA 5E9DD 3O2DL 3WTTA 2FSDA 5BOPA 3OR7B 3CN2A 5IK3A 1KB5H 3GMMB 4M8UA 2ADFH 4ANWA 3ZBMA 3O4LE 2GABA 4U2YA 2C4FT 2EE9A 3GI9L 2W0FB 5B38A 4NKOA 5I2IA 2HJKB 2CO2A 4UZUA 2B3RA 4NQCE 4KTDL 4HSAC 4I3RH 1UATA 3ASNB 3UDWA 4OZGA 2GVYA 4GS7B 5I9QB 4N22A 2LTQB 2BFGA 1QZ1A 4WCYH 2FZ3A 1PKQE 1SYVA 5TE7H 3W11D 4WU7A 6PCYA 5FYLD 4YZFF 3MYZA 4A2FA 3VH8G 4JFYA 5I1AB 2WWMD 2OSXA 3MLSH 4V11A 5L4IA 2Z35A 2V37A 1I9JH 4GG6B 1YSOA 4N5UA 4Y5VB 1KTJA 2CUIA 2UY6B 3KPRB 4FL4C 3V4VB 3K8KA 3ZQXA 2WMPB 4K3EH 4TNFA 3ULAB 4UTAA 3O0RH 1YY8A 2PMZA 2WUBH 5IMLA 5KYNA 2EE2A 4MDIB 1W16A 2QFPA 2WUCH 4Y5XC 3NCJL 4NNPL 4NRXA 1ROCA 2RACA 1MFDL 1B0GA 1NIBA 3IF1B 1MAJA 2GBAA 2LU7A 3U2SA 4WWKD 2NXYD 3JZ7A 4KITB 5CGTA 5GRUH 4ABUA 2DTSA 3U36A 5CBAA 2OBGA 4EBQL 1NGQL 3FRUB 3WDJA 5D1XB 3PV6B 5LXGH 2R83A 3N1QC 1UENA 4LB8A 5E00A 6CGTA 1SLVA 4HUUB 4JM2D 3VH8B 1A14L 3D50A 4HIXH 4X6DE 2EAEA 4C4BA 4MAYB 5DZPA 2BW5A 1UXWA 3FFOA 1BQLH 4FLSA 1GS7A 1UACL 5B4MD 1NCCH