4WI0A

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
168
structure length
168
Chain Sequence
MESYITMNFDKNTAEVGQIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVNEDYGPIVQGVHKISEGILNLSRSYTALDVYRASESPEETGTVAVVGFKALQKKATTVVFEHSVTMPNGIIGTTLFNWYGNRITSGYSVIQPGEINSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein
molecule keywords Cellulosomal scaffoldin adaptor protein B
total genus 38
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wi0A00
2OZNA 2B59A 4IU3A 3UL4A 1QZNA 2VO8A 2W1NA 3GHPA 5K39A 1TYJA 5LXVA 4N2OA 2BM3A 2O4EA 4FL4B 2VN6A 3BWZA 4UMSA 3KCPB 4FL4C 1AOHA 4DH2A 4UYQA 2VN5A 2Y3NA 4WI0A 4U3SA 2JH2A 2XDHA 4UYPA 2ZF9A 2CCLA 4IU2A 3KCPA 4WKZB 1ZV9A 3F2LA 3FNKA 3L8QA 1ANUA 5AOZA 5G5DA 1G1KA 1OHZA
chains in the Genus database with same CATH superfamily
4D0DA 2LLLA 4QLWA 4A04A 3DOSA 1TVBB 4AENA 4PMFA 3VGHA 4OUOA 1DL7H 3QUMH 3RKDD 2HKFH 2X6VA 1VZIA 5I66A 1KYOK 1S7SA 4C56B 1UB6B 3FOMB 3CMGA 3FO2A 2I26N 4GI8A 3EYSH 4B9CA 1N3NB 2VDKL 3X2QB 4AJYV 2F19H 3LEXA 3TCXA 2NNXA 1M2VA 4Z7VE 3CLWA 5E8OB 5ITFA 1X7QA 2FYYB 5GGQH 1NPNA 4J3BA 3SYAA 5C2UB 3S34L 5JA9A 1R75A 1K8DA 2EDBA 2ZXQA 3U2IA 2DKMA 4M61B 3GHPA 5IZ7A 1Q1PA 2XHNA 4G7YL 2XZQH 1KPRB 1FBIH 4LHUD 3EGSB 3QO0B 4LSPL 3ENEA 1INDH 1X5IA 2P28B 3FTZA 4F8NA 3PPSA 4NKMA 3PAVA 3V4UL 4I4WA 2CRMA 2JLPA 1G7QA 3OGOE 2R0KH 1NBZA 4H8WC 2DM3A 4KHTH 3KLAA 3P3SA 5EUKB 3VWJA 1MAMH 4UQDA 1JUFB 1KTDB 5F3BA 4W70A 4X5WA 4M7KL 3WAJA 2DTMH 2GY5A 3BUIA 1MUJB 5CFAA 5BRQA 5LXVA 4OKDA 4UILH 4YE4H 2FT6A 2VZTA 4WDIA 3HG4A 4GH7B 4HXAH 4N1EA 5DZOA 4PGJA 3D6GA 4HUWB 3JWNH 5DS8A 4OT1L 3CSFA 3IDUA 4KX8A 2IEPA 2J2ZB 5L2KA 1MG3C 4Y5XA 5F8QC 1S6NA 3VI3F 1TLKA 4RSYA 3HUJE 4ADIA 3KPSA 3MGTA 1RIVH 3KHOA 4XWGL 3QIWB 3GSRA 3V0EA 4ANXA 5L7XH 4K5PA 4GQZA 2PABA 2BDNL 1CXHA 4HIJB 4HIPA 4LSSL 3SQOH 1QLEB 3U4BH 2VXVH 4NPYA 4F57L 3J2PA 5I1GH 2HPTA 3IKCA 4L1LA 3EOBB 3O81A 3QFJE 3ULVF 4FFVC 4ELMF 3LIZH 1RK0B 3HOGA 4JJOA 4LL4A 4R96B 2H8PB 1PQZB 1Q0YH 4F7MA 3PDGA 1I3VA 4Y4FD 1DJXA 1LO5B 4FLRA 4JQIL 4UQ2B 4FYTA 3O2VH 5ICZB 4XBGA 2ORBL 4LCIH 1IFGA 5C3TA 1FLRL 2E76C 5MEQB 1F4XH 5L9DH 2GTWB 3BRGC 2O30A 2Q87A 1X5AA 3LH2H 2XPGB 5L0QB 4G8FB 4LHUA 1V3LA 5EIIG 5A2BA 3ESOA 1R5WA 5F7MC 2A73B 4H0HB 1AGCA 3NN8A 4PTTA 4HH8A 4LE8A 3HB3D 4JDEA 3T8VA 3H2PA 3CDZB 3EO9H 5B7MA 3AT8A 3NVQA 5KSAD 3C2AH 1Q9OA 1QLRA 1AQHA 1IGIL 4QRRE 3HMXH 3VFSA 1ADQA 4JFZL 1FGNH 5AVUB 2ADIA 4ZW3A 4QY8B 3UYRL 3VDAA 5DJXB 4PRHE 1KNOB 4F7PA 4OF3A 3MAWA 2NTFB 1GL4B 2FIKA 4IIQC 4OZGF 1PD1A 2WXRA 3ARTA 4PRDB 4EBQL 1F3JA 1JV2B 2P43B 1P53A 2H2PC 2NXZC 4WI0B 4J8QA 4FEIA 2D4DA 2OJ1A 2F53B 3RURA 2A4EA 2C1OB 2LLNA 3NSDA 4BXVA 1LVEA 3W9DB 5DEFB 4PVMA 2PNDA 4FABH 3MRIA 4E9RA 2ITDA 3OXSB 2C3HA 2R83A 2EXYC 2DYRB 4N5UA 1KLFB 2NNFA 2O5NA 4MNGB 4X0KB 4BEIA 3ZDZF 4J6IA 1F58H 1G7PA 1UOLA 3MJ7A 1KXHA 4UZSA 1JYXA 4DP7X 4R96A 1R5VB 2ZUTA 4NJAL 1O9WA 4P57A 1Q4NX 3N44F 1ZIBA 4FOMA 3KVPA 4RGOL 4MBOA 5KVDH 5EEVA 4B9KC 5I8OL 3QAZC 3ZE1E 5B1KA 3ZRCC 5C0AB 3FO1B 3IMSA 2A9MH 1KN4L 3HG1E 5EEUA 3ATBA 5AUMA 3U30C 4ZAKC 4XWGH 1B2WH 3MX0A 1J8RA 4XPGL 4KI5E 3O3AB 4W9CC 4F2EA 1NGQL 3JYBA 4OD3L 4D0BB 3US0A 4KQ3H 4ZX3A 1FH5H 5ACMA 1EEYB 4E41D 1LD9A 5IVNA 4JFDA 4JFEB 2IGFL 3AREC 3ULUE 2QKSA 3LXUX 5I0YA 3FW6A 1L3WA 4IMLA 3SY6A 1YEIL 1ZTMA 5F7EL 4AG4L 3C8KB 2WVUA 4I0PD 5KZCD 2FB4H 3P4NA 1I3RA 2IPTL 4P07A 1L6PA 2QADC 3HE6A 3PWVA 5ISZD 3SE4A 5AOLA 4D9QD 5E08H 4NJ9H 3EZJB 2XWBB 1IU1A 5DVMA 4JFDE 3RAJH 5CSGA 3TEXA 2F53A 1EXGA 3WFDL 3NPSC 4BK5A 5E23A 4F9LA 3OWRA 3ZW3A 4OGZA 3BEWB 3HRZB 4PJ5D 4KHXH 4ILDA 5ISZE 3IDXH 1CE1L 4IRJA 5MP6L 4HFUH 1JHLH 2EO7A 3CZUB 5H94B 4KTYA 3V6OC 3BH8B 3PQYA 1KCSH 2GTZA 2V5TA 1WHPA 4XNUL 5TK2A 4APQB 3AROA 1GXEA 1ZVNA 2HT4D 4G5ZL 2DYPA 1UWXK 3VM5A 2VN3A 2N3JA 2YEVB 3FO9A 3ZTNL 2KHAA 1KB5L 3D0LB 3EJJX 1REIA 2CUAA 5KS9F 2YSTA 3FC8A 1MREL 2XPGA 2FWLB 1F86A 3QAQA 1XQ4A 3OMIB 1TZ8A 3L3OC 3RUGB 4Q9QH 2SEBB 2AVFA 5CZRA 3TEWA 4FQIL 3VXOA 1YNTF 1HHKB 3QPQD 4JMXA 4PSRA 1MAKA 1JV5B 4Z76A 4XTRD 3IBEA 5J6HB 1N59B 3MRHA 3I6KA 4PB0H 3EO1A 3VJ6B 2DI7A 3DO7B 5LB1A 5KVFE 1QWHA 1FHNA 2OX5A 2WUCH 2VAJA 4B3VA 4M48L 3B2UC 2ED8A 3RVXC 2W9DL 1AZBA 4I48B 3BO8B 3TBVB 3DX6B 2D0FA 2CLVB 4TTDC 1TQSA 3SE3A 3VMOA 4OJEH 1RJZB 3RUGE 1PF3A 2WJ7A 3Q2VA 4ODSH 2Q3XA 2XN9B 5HVFB 4YDMA 1CXFA 4LGSB 3B56A 3ZKNC 4QXUL 1KJ3H 3D39A 1AO7B 1ONQA 5EU7E 3QQDA 2G2RA 1X5MA 3WUWG 2FJUB 2GT9B 3AGWA 2NW2A 3OBAA 5CEYA 4NLAA 3O0LA 2IQAB 2VLLB 2UXGA 4YBQC 5EU5A 3WXWL 1EEQA 1YA5A 3F7PC 3LQAH 2NX5D 1AHWB 1DZBA 3KAAA 2PCPA 4WFHD 4N8VB 5E1AA 3QWRD 5SV3A 2VQ4A 1E42A 4ES8A 4XP1L 3PGFL 5IESL 4G3YL 5DJZA 2P45B 1YJDC 1TTRA 4UM9D 5ANHA 3RL1B 5IW1A 3BRFA 5FHBL 4UTBA 4LVEA 4NQVB 2V5YA 2R1XB 3ARXA 5I0XA 1TEGA 1P4LB 1XSKA 2FO4A 5MI0C 3LQAC 4MYWB 1GIGH 3QIBC 4RH4A 3INUH 4X4MA 5K69A 2FEEI 3IFOA 1C5DA 4W93A 1I85C 2ZCLL 4BUQA 2EILB 3IRZA 4XCYB 4YXKH 1G6RL 1KV3A 2B16A 5DO2D 3TFKC 4I77H 1G7LA 1FG2B 3AXLB 4KROD 1RSYA 4LEXL 4H5SB 2WZPD 2VDML 1A7BA 3IGLA 5DJ0A 2NPLX 1OPGL 4L8DB 5DT1H 2K6ZA 4I1RA 2BW4A 2YBRA 1IM9A 1U8QB 5AW9B 4HIHB 1ZA6A 1J48A 4XRCA 4D7PA 5TE6L 2W94A 3P77A 1AGDA 4G1EA 2F1BA 3QBTB 3RP1A 4ODUA 3H9ZA 2Y2YA 3PG2A 5KVEE 2RFXA 3V0GA 1LWRA 3IN2A 2VL5B 3K91A 3MRQB 4NBZB 1X7SA 4IOSD 4IRJB 3WJMA 4M43H 4J1UA 2VW6A 4RMVA 1TUPA 1E9QB 2DQUL 2Z34A 3GMMA 4FFZL 4LZKA 4OLXH 5GGQL 4FZEH 4LESA 3AW5A 3WIAA 3QJZA 3L3HA 4N9OB 1RUKH 3RIFK 1RKRA 1U3HA 2IG2L 5CBAB 3QCTH 3QEUA 5JR1L 1R3JA 2AK4D 3BUPA 3MBED 5BZDA 2WBJA 5HYFA 3BWAB 3IAGC 1AKPA 3WKNA 1Q1JH 5CINL 4BA8A 1DBKL 3RFZB 3BGMA 4EIZC 3DUHA 3GMLA 5CHNB 2AXFA 4P2RE 1I1AB 3D06A 4P4KC 3BHBA 1MRCH 2P44B 2WNWA 3BH9A 4RIRA 4P9HL 1ZWIB 4EVNB 1G4MA 4NC1C 1JGLL 8CGTA 4GRMB 1D7CA 3EJZD 4IW4C 5DEGA 2MCG1 3H3BC 1NFIB 3GWJA 1URIA 3HCVA 4U6VH 5D93B 3VH8A 1BZ9B 2VXUH 4TLKA 5T1KB 5AAMC 3FB8B 2GK0A 5KANG 1NL0H 4GEIA 4NUQA 2FQEA 4RDQG 1BQKA 4Q56A 3KYNB 1GGCL 4XVSH 4HEPG 4A2HA 3II1A 1I8KB 3TT3H 4JO4H 5C0NC 1NKRA 1XR9A 2IOMA 3KLQA 4ODWB 2YUWA 1H5BB 1U8PA 1OAQH 5IB2B 1WWAX 3QNXB 3Q8CA 1IEAB 1MW2A 4DN3L 4U6YB 4NPYB 4X4ME 4I0PC 4KKLC 1J1XL 4BSWB 1MVUA 2O1AA 4UINH 1JPTH 1IC5L 5GZOD 3TOPA 3V5HA 2WCSA 3QIBD 3KG5A 4YPJA 1J5OH 3WTUA 2JB5H 5F6IC 3G7TA 4ZTPH 2MMXA 4HEPA 5JHMA 2HX9A 1OD9A 2I69A 3FNKA 3PWPD 5B1JC 1CLYL 4W9JC 3TWYA 2JB6B 5CWSA 5DMKB 4MAUL 5A2KH 2UYLB 4KJQC 1P1ZA 1TJGL 5CMAA 1CFBA 2R29H 3FB5A 1AYRA 1SVCP 4PJXF 4UQ3B 1EGJA 5LJYH 2QSCH 2BOBA 2FYYA 2ICEC 4Z23A 1J0KA 1VCAA 3VSQA 3CSGA 3MRPB 3QDMB 4BFKA 3QXWA 1WITA 1OSPH 1BJ1H 2MQGA 1NC4B 4NQEE 1FO0B 1FFOA 1WO2A 4V2CB 1GY1A 4WJ5B 4W4NA 3DX9B 4XXCA 4FG6C 5LCVA 4OFIA 1HQ4A 4LDEB 5BPPA 5I18H 4ZXBB 1UKTA 1H9DA 3QJTB 4OF6A 4I4WB 2CKBA 5HHOA 2JCWA 5IM7B 4PWKA 1K2DA 2WLIA 1UM5H 2OMUA 1KCWA 5ANMA 3RILA 3W57A 4BDVA 1D9KA 1LL1A 4BQ6A 3T04D 1D5XB 2X4TB 1CK0L 3IT8D 4Y1AB 2DQGL 3TX4A 4F5CE 4PGBA 2APXA 5HHXL 1TJIL 3WUZA 3HBPA 4HPYL 2RA1A 1YLBB 1MIMH 3QXAB 1AHKA 2A3TA 2CK0H 1NC4A 2RTTA 1HHGB 4XNYH 1D5BA 1DSYA 2CXKA 2XBTA 3HNTL 5CN2A 2DQTH 2W0FA 3V0HA 5DD5L 1BVOA 1LDPH 4Y88A 4U05A 1KCVH 1CFVL 2XTJD 4FA7B 4J2QA 3ROOB 3C60A 2N0KA 4LF3A 3QNXA 2IANB 1KGJA 4XO4A 4AQZA 5DC0A 3A4FA 2X4RA 4MZ3A 2X3AA 4RFNB 1ZVYA 3T0EB 1MEXL 2VWEC 3RBSA 4DN4L 4AL8C 4JRYB 5I8OH 3Q1SH 5F7WC 5EEWA 1OAQL 2ZP0T 3O8XD 1JYNA 2X4SA 1H3VA 1TTUA 2BRRL 3AG3B 2PXYA 5DHVB 3CXDH 3UTTB 4MKMA 4WHYH 4DERA 1KJ2B 4OD3H 1FHGA 4TTGA 1J11A 4PB9L 1JK9A 2FQFA 4KMTL 2ICWJ 1PGRB 3UIZA 4JLRA 3VI4E 5B3JE 3DPBB 3ZSSA 4DKAA 3W37A 2OSLA 1S7RA 4CKVX 4D94A 3P3RA 4PGCB 4PRPE 5JIHA 2VB5A 4MHHG 1NCIA 5KJ7E 3ZHLA 4Z77B 1AJ7L 2ZKHL 3NIGE 3UTSB 4ZXBA 4IS6B 1RZJC 4H0GA 4M8QA 2VDNH 3B9EA 3PJNA 3L2LA 3ML9A 2GCYB 4MLSA 3DV6A 4XMTA 3DGGA 2V2TA 1UUNA 2XXGA 4XPAH 2CHXA 4DGUA 3DMMD 4FHBD 3JTTA 2VLKE 1B88A 5TK4A 2I07A 3QIUB 1A8ZA 2BW5A 3ARDB 2ZXBA 4URKA 4YL4A 2VZOA 4YK4B 4APQA 3O4OB 1KSRA 5CEXB 1RZ8B 4Z7UB 4CSZA 3ES6B 3UO8B 2ED7A 3EDKA 4LASL 1DFBL 4DFHA 2JMRA 2RCSL 2CJUL 3GNMH 5I5RA 2X42A 3N43F 1OHQA 4W9IC 2N7BA 4FQQB 3ARGA 1HEZB 1VEMA 1K4DB 3DRQB 4GBXB 4P2QB 4ZMVA 2SODB 3P9WB 4JY6B 3SDCA 3RNQB 1QZ1A 2PETA 4FNLL 4JRXA 3O9WA 2MWCA 4E9VA 5H8DA 4OZFB 3K4DA 3FH5A 3WMSA 4D0CB 4FQIH 2R2CA 2YD8A 4PRAA 1U30A 4EXKA 1VAHA 5I73C 2YAFA 5JW4R 4PJFE 1A5FL 5HD8D 2JK5B 1GGYA 1QFWM 4RMRA 2F7OA 3M7FB 5JPNB 3O41A 4TQ8A 3T6QC 5D2NA 2Q76B 2X70B 3OTTA 1SHXA 2AQNA 3BPCB 2ZWLT 2CALA 4AUUA 2EDDA 5MEOA 4CVZB 1HH9B 2CLZB 3QUZA 4ALAH 3NTCL 3Q5YA 1F1DA 5JPNC 1PX3A 1MFCH 1EFQA 5LO7A 3QDGE 4FQHA 5LBVA 3T8MA 4M5ZL 4BBWA 3P2BA 3RX7A 4WI5A 1BOYA 3RWCA 1U21A 5C0CD 4BK5C 3QNYA 5DC9B 3VVVA 4PREB 3GI9L 4YUEH 3VFWA 1C1EH 1OTTD 1F5WA 3ZGHA 2M8XA 2YKLL 5ESQB 3PAYA 1M05B 4A7GF 4Q9CA 1AJ7H 1I1YA 1KWKA 1JUFA 2XPYA 5GSVB 5D7LA 4Q9RL 1P6WA 3BO8A 4I85A 2WBJD 1UZ8A 3POHA 5CXPA 1XF4A 4NUJA 3TT1L 1AR1C 4K3GA 3KLKA 4D8PB 4L18A 4PJBF 2BHZA 1NCAL 5ETUB 2NUTB 4MHHI 1YJDH 3MRQA 4LLVA 5TDOA 1F00I 1IAII 1MCRA 1P5VB 2NY4B 3GMNB 3MRNA 2KS0A 3FRUA 4N8CH 4UT9L 1QO3A 4AOFA 1G6RH 4OF5A 4YDJA 3G08A 4ZW8A 3VFOB 2KKQA 1CYWA 4P2YA 5C0BE 4OUUA 3S4SB 1CIUA 1KCVL 2J57A 4I3SL 2DTML 5JPMB 1WGOA 3QA3B 2GBAA 3WFEH 1LP9B 1KXTB 3ARSA 5ICXB 4XI5C 1KCRH 1G9MC 5BNXD 3FJTA 5D2NC 2JKNA 1VGKA 2Z91B 1RULH 3EOTL 5T1MA 1HHKA 3EAKA 4M8QB 1E43A 1RFDH 2VDOL 4NPKA 3DURA 3AXHA 4Z9KB 4LNRA 3OX8A 4PW4A 1EZUA 4HG4J 2JIXA 4NP4L 5DZLA 1Q0XH 5JLZB 3PWPA 3IFOB 1TCMA 3L4VA 4IBUA 3W9EA 1WVZA 3SO3C 4OF8A 1P7HL 4M6OL 5HHNA 2LR4A 1E40A 3SE6A 4N0YL 1BQLH 1OF2B 1GJWA 4O2EB 1FIGH 1E4WH 5D7KD 3RGVB 4BFBD 3T2PA 2XVLA 4BKTC 1JNNH 3CVHL 3STZA 5I6LA 5JIKA 2HH0H 3EO0B 3BD4A 2VLME 3ILEA 3TGXA 4HFWA 3ARGC 4NEHB 4XRCB 1SY6L 2ROXA 4RMTA 2NY3D 2C34A 5DI8A 4XMPH 4WK0B 3K4ZA 4K2UL 3G5ZB 4XP4H 2ZWNA 4F3FB 1FLRH 2A6DB 3U0WH 1DBBL 1JFQH 3T3PB 2ZKHH 1OCCB 3WNKA 5AOMA 3RX9A 3L17A 2GSIA 1H8OA 3C5JA 1R19A 2BWQA 3CQFA 2EIZA 3D39B 4MXVE 2BS9A 4JFFE 4POZD 4OGQC 2R51A 5JYLA 4G7VL 4ABWA 2P8PB 3LZFH 2ZSVB 1F8TL 5JHDD 4HWZA 4LSUL 5DK2A 4ABVA 1XD0A 1OANA 2LVEA 4P5RA 1SXCA 1XGYL 5E9NA 3O45B 3OXSA 3BLBA 3HE7D 5E8NB 1ZTXE 3V8OA 3RX8A 1QO3B 2E4FA 2PTVA 3UFIA 4H2CA 3ATAA 3EO1B 3ULSA 3VJ6A 1KFGA 5IMMB 4OZIE 3NYKA 5LWYH 4NI3A 5BZZA 1FYTD 2EADA 5HVHC 5T1DL 1H8LA 4FKEA 1OWWA 3CX5K 4N2CA 1U8NB 4P57B 2E7HA 2AHIA 3QCVH 4HF5L 3LRKA 1A64A 4NRXA 3IGKA 4LU5L 6PCYA 5I1GL 3L81A 3QORB 4U1JB 2G75B 1Z3GH 4PJ7E 2VMDA 3CC5A 5DRZB 3RTLA 1LO4H 3RWDB 4WWOA 1BFOB 1ETZB 4HXBH 5LBGA 4G6AC 5G4MA 2OZNA 2BVUA 2B59B 2IALB 4GO6B 3WFBH 5HYJE 1HCZA 3D0LA 2I27N 3MUGB 3KPTA 3PWNA 1U0QA 3OJDA 5C0JA 1ZHNA 4J3OF 3C5SB 3SKUD 2OFQA 2VLKA 4X99B 4R7LA 4GIAA 5IKCA 1XF4B 1E50A 3MCKA 3MV01 4CILA 1HJBC 4PJ9C 2F7QA 3VFUA 4WI7A 1SVBA 2ZE0A 4MNQB 3KJ4C 3QORA 4U1JA 4CNIB 3HAEB 2FL5B 3NCCB 4XH2B 2HT3C 4OJFL 4FQ2L 2J5WA 1A14H 1X6NA 1MCCA 2E9GA 2XQ0A 3VFTB 1WV7T 2WW8A 2EDLA 4GW4B 1NAML 4WUKL 2ATAA 1MI5E 1E7UA 3HNVH 1IE5A 5T1LB 5I18L 1NL0L 2F8XC 2VR3A 4RBPK 3QJUB 4IRJC 3U9WA 4P2OC 1UH3A 4ZQKA 4XODA 4N2EA 2GUOA 3P0GB 4KZEH 3U4EA 1JVKA 1NBYB 5SWQA 3QQ9C 3PQYB 4NCC2 2FD6L 3S88L 4FX5A 1JWSB 1MI5A 3BAKA 5HJGA 3RJOA 3NH7L 4PJEB 5GGVY 3AFLA 1SHMA 1WFNA 5CEYB 4F8OA 3VW3L 4ZUTA 3FB8A 5IEKA 4C56D 1Q0EA 2VO5A 1NPJA 3BW9A 1BWWA 3MLWL 4ACTA 1MUJA 2BIHA 3TYGH 5MEOB 4FA8A 2GJZB 5JW4M 2X4RB 4EKJA 4AIEA 1ZVSA 2DJ4A 3FMGL 4ZSOB 1QFWH 4H8WH 3THMH 4ZMAT 2VL4A 4WFGD 5GGSA 3WJLC 4CRPA 5EBMA 4HCRA 5E2TL 1IM3B 1FP5A 4MCNA 3ZT5A 4PRHD 1E5BA 3KWUA 3ZL1A 1X5HA 4DP8X 1OL0A 1ZT7B 1NIEA 4YIQB 4L4TE 1DJYA 4KNTA 4ZAKA 3U82B 3QWOA 3DJ9A 2OZ4H 5DJ6A 2AEQH 1CLCA 5CD5C 5DHVH 3GJEB 1EVUA 4U1KA 2BVYA 3FFDA 4PP2A 1I8UA 1AZCA 5AKRA 3GIZL 1NIBA 3BAXA 5C0ND 2VXTL 5HHMB 1QRND 4CSTA 3ARFC 5EEZA 1UWXH 3EXLA 4K5MA 2E46A 3HG0A 5GHWL 1HSBA 1XGUA 2W65B 2F8OA 1A47A 1EPFA 1DVFC 3FU6A 2JJTA 4MVBC 3I02A 2L04A 3TBYB 1JZHA 2B08A 3K6IA 4K3JL 4DPBX 5I8KH 4NRZA 4LRIA 1CPUA 3BIAX 1FL6B 4Z0XA 4XVJL 4FTVA 2Y7OA 4LBEB 3WSQH 5DA0B 2E86A 1CLVA 1OTSD 2A73A 4BQBA 4S1SH 3FCUB 4HAGA 1QTPA 3F7VA 2BOBB 2NZ9D 5FUCC 3UTTA 2C9VA 2HRPH 1OTSC 5GJSL 2V17L 4G9FB 3LB6D 1N7ML 3E9TA 4KRLB 2VXQH 3G5WA 1BXVA 4YDVB 4XNMA 3SDAD 3QZBA 1KJ3L 4GG6E 3KL5A 3DPBA 2EE6A 4JS7A 1HDMB 4FXGC 1QATA 1ZLWH 3E7JA 2YQBA 1BQRA 3HC4L 1U93A 1F3JB 1JV2A 1IFRA 2P8LB 4PJFF 3UGXA 5ENWA 1S7XB 1WZMA 4HCRH 1NCTA 4WFED 5BRZD 2ADGB 4ELMB 4OCSL 1MCBA 2IC2A 4CMHC 2VITB 2NNAB 2WYZA 1ORSA 1IFHH 4Z7WA 4KH9A 3QHTC 3KNBA 1L7IH 4XOEA 4EN3D 3CLFH 3O6KH 3IETA 4I0PA 1N0LA 4AMXA 4PG2A 1KELL 4MA8H 1RIUL 4XMXA 1UT1A 3OAUH 3C09B 3ZQWA 3TBWB 1CB4A 3JWDH 3FPYA 2VXSL 2X70A 4JG1L 4QRPE 2KLRA 2BSED 3WY4A 1I9IL 1X4ZA 1T03H 4I8DA 1A4KB 4POYA 4X83A 1BW8A 4JBSA 3WIFA 4AQEA 3WE6B 2BERA 4O2CA 5GRXG 2W9EH 4BZYA 3IU3B 4M1DH 3F7VB 2OQJB 5HPMB 2CWRA 4G59C 4N3UA 4YNYA 4EQ2A 4L2LA 3AAZB 1HEJC 2YD0A 1QW9A 1CFQA 3EJRA 4NZFA 4F15B 1GRWA 3CFDA 3BP5B 1E4HA 3U1QA 3KL0A 1D5IL 1SJXA 2X87A 3SJVB 1J05A 2DQEH 1H3WM 3Q8FA 4TM9A 3WXWH 4LPVA 2V7NB 5I1EH 4M43L 4XO9A 2EDYA 3H7BB 3NFSL 5FKAB 3FAXA 5B8CB 2H5UA 4BWUA 5CM1A 1JPEA 1RLWA 3MRMA 2ALWA 1F4AA 4ZFGL 25C8L 1A3QA 4F58L 2Y6SD 4TRPL 3V4VB 1AQKH 4EOWL 1XBRA 4IMKC 1IGTA 3QCTL 4ZAKB 5JHAA 1MDTA 5DD1H 1E9PB 2NY7L 1INEL 2RHEA 3GMQA 3QEQE 5K93A 5C0AD 1WFIA 2PWDA 4L4TA 3RIKA 3SJVA 4AZ8A 3HZVB 2QPUA 5DJAB 3BOVA 4A6YH 1Q9KA 4XOBA 4PBWD 4XOAA 3AVEA 3QG6A 4L8BB 1FV1B 1MRCL 2VZ1A 3CFMA 3QUXC 3BVTA 3VG9B 2F2HA 3RVXD 1KCUH 2JCCF 2NY2C 4ZMTA 3DSFH 2IMMA 5DT1L 4KI5F 3TNNA 3I6GB 1TTAA 1EJ6A 1Z5HA 2OMZB 3D12B 5CR8A 2J1KA 4AVIA 4I0PB 1U91B 1RUAH 1EUTA 4UWQB 2BK8A 4WO0A 1J1PL 2ATKB 2X0WA 4NKIL 3LQMA 5F1KC 5IUCA 4ZS7L 4KJWD 5ERWB 4A7VA 2ERJB 1MNNA 1BSIA 2C3VA 1CFNB 5KJ4A 1I9RL 3RRQA 4JKKA 4DTGL 5HSFA 1HOCB 5AW4B 2X4OB 1A3RH 3QDGB 3SDDB 3WYRA 3B7TA 1GC1L 4B9ZA 2X38A 4Z3FA 1N6QL 1I82A 1WFUA 3LKSB 3FU7A 4FQ1H 4NO3B 4YSOA 1TTFA 2M2DA 2PKDA 3ZN6A 2WLZA 5IP4A 2AAVA 4HWZB 4I9WD 5DK2B 4JL1A 4LXFA 1VHPA 1LO2H 2EICA 1DBJL 1KYOJ 2J8OA 4IJ3B 2QKIC 2IQ9L 1N9PA 4C4UA 3CK0L 1GGIH 1W6LA 3FSAA 2J1XA 3MJ8A 1BBJA 1YMMB 4NNXA 1ACZA 4WO4A 1QI4A 1W2KT 3MV7B 4YSPA 5GRUH 2CO1A 1KPVB 4MA3A 1TETL 1QSFB 2LU4A 3M8OL 3V4PA 3VB9A 5E9DA 3FQYA 3MGAA 3QFGA 3BFQG 3WUWA 3FB7A 1HINH 3RWHB 1DJIA 5I76B 2ZCKH 4TSAL 1CL7H 4L8BA 5BZXA 4LLMA 3DUUB 2Z92B 4XNUH 3ECUA 3QEGH 4KDVA 1U36A 5J6HA 4L4TB 4JQIA 2UWEF 2K9FB 3KPOA 3KEDA 3LNHA 4X8GA 4NZUH 4JR9L 1OGSA 4K23H 3BWAA 1SUHA 4EI5A 3IFPA 3L1GA 4LCIL 4QCIB 5EB9A 2QR0B 1XX9C 3Q13A 3WEXB 3SE4C 4YX2H 2VERA 2UXFA 2XN1A 2AANA 2VM4A 3TZVC 1OSZB 3OZ9H 3HAEH 1E4JA 4IIQB 3QYMA 2J56A 3G6JA 1WE5A 3WDHA 4YHYB 4GRWB 4XAKD 3L8QA 4OLEA 1BG9A 3W0WE 4M6MH 3D85A 4X5RA 2QT6A 1SBSH 4HS8H 2XIDA 2XVBA 2FJSA 4ZQTA 4WI3A 3BI9X 4PJEE 1ACXA 1N0XH 1AS8A 4C56A 1NLBH 1S3RA 3PQYE 5BRPA 1FVEA 3IRPX 3QUXD 4X99A 1YEIH 5F7EH 5KYYA 4MD5A 1QI5A 4G1EB 5HYSB 5E9DD 2G4EA 2E8YA 2V9TA 4ONHA 2R27A 3P4OA 1U3HD 2XG5B 5EORL 4FCAA 5F9DC 5T5NF 1NPUA 2G5BA 1JWSA 1MI5B 5HI5D 1IUZA 3AUWB 4N8UA 1CUOA 4QRPD 2O5ZL 3WEOA 4UM9B 4HOMA 1DEEB 4KC3B 5DUBA 2O61B 1A7PL 5DD0H 5IHBA 1YO4A 3W11D 4XCYA 3AACA 3L1OH 5SX4I 3CIAA 3EYVB 1TG8A 4EXPX 3VXRA 2EKSB 1BQHB 1U2HA 5JZ7C 5JHBA 3FRPG 4HFUL 4UIKH 4ES9A 2VT0A 5KN5A 5F9OL 1FFNA 1ECYA 3P40A 2FRGP 3G5XB 4JN2B 1G7PB 4TLUA 3UZQB 5D1QA 1GGBL 2ODHA 4OJYA 5L2JB 3PRZA 3Q2CA 3M1BB 1IGFH 2BIIA 1DO6A 3HE6C 4GG8B 2ZYRA 4KUZL 3DYMA 2V3FA 3FFCB 3KPLA 4G5ZH 2DBJA 5J6GB 3MRGB 4XPGH 3VFUB 3BE1H 4MJ6A 1B3JA 2OJZH 4XNYL 4JDZA 3KH4A 1QFUL 4HZ1A 5TE4L 4DEWA 3Q8BA 5L4MA 3H6AA 2EIZB 2F0CA 2LFEA 2UUDH 3GKZA 3FRPA 3J8F7 5IF0A 3GSVA 5FO7B 4HH9A 3J7HA 1VCBC 3W2DH 1VADA 2MKWA 2OI9B 3DK0A 3CU7A 4TN9A 3ZDYB 1VGEL 2YJQA 5TFSL 5C0EB 5FM5M 3QDJB 1IAMA 1X9QA 5DJDA 1BYOA 3TEZA 4C58B 2J1ZA 4NJ9L 1UJTA 4AVKA 1FGVH 1JZEA 1MAJA 1QTSA 5IB5B 4DKFL 5ESAA 4L3FA 5F3HA 2PP9A 3RY5A 1JGUH 4QJ4B 5T3XE 3D8MA 5HGDA 1AXIB 1AGEB 5CLTA 2EVJA 2APFA 1HE7A 1JZGA 3SKJH 3ZUNC 5JQ6L 4G9FA 4I89A 4W4OA 4NWUL 5KYYB 1N70A 1KXVC 1WFJA 2VDLL 3NCBB 1N8ZA 2D2OA 2KL6A 2VXTH 3K0WA 2FWSA 3TWCH 3R7RA 2DLHA 2H3NB 4YE4L 4POZC 3FTXA 4BK8A 1AD0B 5IBUB 1J9SA 1RZ7L 5I1LA 3LCYA 1MF2H 5IFHL 5JIIA 3K6NA 1NGZB 3M6DA 1ZHNB 4NO0A 5D2LA 2G3XA 4DH2A 2XV6B 5D1QD 3QK0A 5BOZG 1FZKA 2NY3C 2NYZA 1KCKA 2BNUB 1O7VA 1F1GA 1KJMA 1L0PA 2VLKD 2IH3B 1JN6B 4OVVA 5CBEA 3STLA 5DWUL 5GJSH 3FFDB 1FC1A 2F54D 4KY2A 5GGRY 5LGYA 2E3VA 5F6HJ 4U1HB 1VEPA 5CCKL 4KKCC 1P2CA 1FVCA 2EH8H 1XGRA 1UD4A 5FECA 1BM3H 2W8CA 3HLKA 4OGAC 1QHPA 4D8PA 5F0PB 4FI7A 3FOLA 1BPLB 4QRPA 3HI5L 2J71A 2YZ8A 2Z93A 3QEGL 3TP4A 5E8DL 2EE0A 4CVXB 3VTTA 2OR8A 3O0RH 2G9HA 2DI9A 5DWPA 4LAQL 1O6SB 3UPRA 1GTFA 5BCAA 4HJ1A 4JY4A 3VYOA 3TBCA 1AI1L 2XT1B 4ZFQA 2V9QA 4Q9RH 4ZYKB 4X7FC 2GJ6E 1CFTB 3S8GB 1RAMA 4PY8J 1U9KA 2ENQA 3HC2A 4PWIA 3HC0B 4QXUH 2ZSVA 4PJCB 4W1TA 5TPWL 1NC2D 4XMUA 4PEEA 1YAZA 1YC8A 1I7ZB 2ZAHA 4XCCL 5AVTB 4I3RL 4A2LA 3LKRA 1J18A 1HAWA 1TSRA 1K8IB 1ZS2A 3DURB 1AAJA 5G5DB 3O3AA 3MUJA 2UY6B 1YY8A 3FT2A 5JOEA 3QQ4A 1Q8MA 3DIDA 3HMWH 4K7FB 4MMYB 4WV1B 4AQ1C 3SQRA 5KSAC 2X9YA 3OR7B 3VXPB 4FDWA 3ARQA 4EJ1C 5IWLA 1AE6L 3VRIB 2HJKB 3L3OA 4S1RH 4CGTA 1AD0A 2V17H 2JKXA 3QUYC 2DJSA 2CQVA 1OM9A 1VFAA 2P5ED 2X88A 2HKAA 1DJHA 3MV8A 4G2AA 5DLLA 3HFFA 3K5SA 3SE9L 4ZNEA 2I32A 5G4OA 1RERA 1CTOA 2EH7L 5I6XC 4HC1H 2NSMA 1OE3A 3BN9D 4FQCL 3Q6FA 4YZFF 1X5KA 3DHJA 4FAAB 3PHSA 1DDTA 4HCIA 4UUJA 3C5SA 1CFMA 5K9JL 5DUJA 1E6JL 1Z3RA 4J27A 5I75C 1IFHL 2ZX7A 2H6OA 3KPMB 1XR8B 1G9EA 5EOTA 4UQ3A 4QF1B 3K2MC 1S7SB 3NDYE 2DQJH 4JRYD 4AIZA 4GKZB 2WTRA 4RNRA 5F7NC 2JCCA 4DUXA 5AW7B 4K3DH 3N43B 4LEBA 1WBXA 1SJEA 1P7QD 3JV4A 5FM5O 1EDQA 1CFSB 4OSUH 5JIMA 1SXAA 1TQCB 1IGYB 5DHXB 5CIPA 2EXTA 2GITA 2VLJA 5D1XD 4DAGL 3BKJL 3EJTA 2E7LA 3VFRB 3VI3A 1KB5H 4DO6A 2WP3O 1MSPA 3TO2B 4LLUA 5HYEA 2JB5L 3QEHA 3O3BB 4RAVB 5IHZB 1INQB 2ZIDA 4BH7B 1E27A 5KTEH 3IETB 4UOJA 4K94H 3ARGD 1XF3A 3RE0A 1S7QA 2BCKB 5TPWH 2NQDA 1FWXA 1N67A 1G7QB 3BPLC 3OZKA 4AJWA 4L5FH 2YUXA 5H4ZA 1A0QL 3NIGF 4HK3J 3IJ8A 4D8OA 2FUTA 2X4TA 3DKHA 2EABA 4U1HA 3S6CA 1L0QA 5D72H 4QHPA 2Q7YB 1MWAA 1S5IL 1O9VA 4CC4A 5T5FH 4QRFA 2FEJA 2XN9A 3MLXL 4GS7C 5AL0A 2FX8L 4DVBB 4L4VE 1OARL 2B20A 4UB0L 4QOKE 4BHUI 1HXYA 3OKNB 5JUEH 5AYTA 1NOAA 2IVFC 4YSSA 1FVDA 2NY7H 2CHZA 4D7BA 4YLQT 2PMZA 2XPZA 2YSSA 2P48B 1BZEA 5C09B 4GAJH 4OJDH 5C07E 4PJAE 1M6UA 3WU1A 3W0WA 3N3EA 4JM2D 3QZWA 3B2VH 1RZGA 1GTNA 4DT2A 1AXSA 4DP2X 4TSAH 3AG4B 3CFCH 3IS0X 4PW3A 4MAYA 5EDXA 1PSKH 2PPEA 1UQSA 3C6LD 1GZQA 3DBXB 3HW7A 3MVSA 3LS4L 3OKKA 5DD5H 4MTMA 1V3MA 2KYIA 4X4YA 4ZW6A 3FQNB 3OV6A 4PJAF 3LKQA 4F33B 4HHAA 3UP6A 4R2GB 4PBDA 4NYLB 2WBJC 4G8GE 4PJEF 5C3IA 3ILQD 1JK9B 3CPLB 4OM1L 1XF2A 3C6SA 3UYOD 2EEAA 3HZMB 1PLGH 1SDYA 1FRGL 2A9DA 3VGFA 1XHHA 4ZRGA 1OZTG 4LLWB 4KTEH 5D7SH 3VB8A 4O2CB 4XHQA 1TZGH 4LQFL 5CMAB 4MA1C 4FQ1L 4CC4C 1YEDB 2J4WH 3KLLA 4XPHH 3LMJH 4JDEB 2DQMA 3OG6B 3RHWF 3IGUA 2YD3A 2WQWA 1FL5A 1PKQE 4OKVA 2E4TA 4FG2A 1U8CA 2ARJQ 3C5ZB 2PYFA 3GMPB 4JZOB 4LLYB 2D0HA 1ROWA 2YC1B 5H2BA 5DVNA 1OSYA 5TQ0H 5H37H 1A6ZA 3LN4A 3OWEA 3PWLA 4HKJB 3ROOA 4XBGB 4E41E 4PP2B 5FYJL 3MREA 1LHZA 1M05A 2Q7NA 5EC1B 1T04A 5D8JH 3HHRB 4B9PA 2X28A 4Y5XC 3T2LA 1XH3B 4GQ9H 3ELQA 4U3XA 3SDCC 1G7MA 4I2XB 1HWWA 1XIWC 1GYCA 3RAJL 5ERWA 1PW3A 3EFFA 1HCYA 4UQEA 4ZUUB 2Z6FA 1GJIA 1V55B 4DGWC 1PZBA 2VR7A 4EI5C 1HTYA 4BZ2A 3AWEA 3B8SA 1L9QA 2QHRH 4B0MB 3QR2A 3KLHD 3MLTA 1XGQA 1S9WA 4UB0H 4Y16A 1FG9C 4C57C 3DTXB 1YEEL 5IGXH 3TVMA 2EEBA 4HHAB 2C9XA 4OLUL 3WIFB 1YEJL 4AQEB 1GY2A 4X9GA 4WTZG 1ZWIA 4EVNA 3MJ8B 3P4OB 5CSZA 3ECBA 1PAZA 3N91A 2R4SL 4WU7B 1NLDH 1NCUA 4C47A 7FABL 1O0VA 3QI9A 4OCYH 1KXQA 2RGSA 3RY6C 3R1GH 2YEZB 2DBLL 3U4BL 3GMRB 4YLBA 3BUBA 1NEZG 2G3ZA 1P7BA 5HDOA 4RDQF 2AAAA 3LEVL 3ZYJA 5K1JA 5E6YA 5I1JH 1HHHA 4XOCA 3ZU8A 4WTZA 3S35L 3ZL4H 2VXQL 4YAQA 4CC0A 5C9JA 3RFZA 3MQIA 2ORBH 1E4KC 4Y4HC 2AABL 4WCYH 3RGVD 4JQIH 4WIQA 5DVLA 5K59F 1KBVA 1OAUL 4X6BB 1TVHA 1RSFA 2XVGA 1UWEH 4W6YB 2XZAH 1RFDL 3ZTJG 4NHUB 4GRWE 4U6TA 1XZ0A 2DQCH 2VR5A 4QOKD 1QUPA 2ADIB 2NY3B 4AJVA 1A7PH 4K94L 5DD0L 1AACA 4E68A 1BQSA 1JPSH 1S7VB 3G5YB 3A0OA 3ROLA 3NAAH 1WT5A 4QO1B 4XPAL 2NLJB 4ADGA 4G8GD 1N5YH 2J5LC 2JJWA 3G9AB 5D7LB 1TF4A 3RVTC 5C7XL 3CVHH 3RI5K 1E3XA 1QFOA 3U7YL 4MGXA 4JKPH 5A7EA 3TWCL 4JFZH 4PJDA 1PLCA 2DMKA 4N0CD 5C0EA 3MCYA 4NQCA 4J3OH 4Z7NF 3LVTA 5J8OA 5DYOB 1ZGLA 2YARA 1F4WL 2E6JA 3DNKA 3KVQA 3MACH 4NYLA 5EU7C 5I0WA 5EU6D 2CHDA 1IAOB 3MRFB 5JXED 2YJLA 4G80B 4LLQB 1ZOXA 3BKYL 2CBMA 5GRJH 4WK2B 1VPOL 3QIWD 3BGFB 3C5JB 4BINA 3D18B 5BV7H 3UOAB 1R9FA 1NH6A 2FLRT 4GUCA 2KPNA 1XB8A 3RZCB 4YDIL 4Y5VB 5CJBA 4L48A 5TFSH 4A2EA 2IV8A 2NXYC 4QRQB 4RGNE 4G8AC 4Y4FB 4LSRL 3US9A 4IMLB 3QORD 2XJLA 4RGOH 4GAYB 4BH8B 1ET7A 1FNGA 3KHQA 5DJZB 5BZDB 2UY7B 3QI9D 2AJVL 4FEMA 4AVHA 5HGBB 3SGKC 3LHPH 2XTSA 1KN2H 3ECVA 3GTTA 2BHFA 3HB3B 5KG9B 3IKKA 3MCKB 3GB7A 1BAGA 1QRNE 2VZSA 5A2LH 1ZLWK 3UL4A 3VD5A 3NTCH 2BNUA 4LVHB 1HAUA 1DLHB 1NGQH 2BP8A 2XG5A 2YWZA 1KC5H 3BW9B 3D0VB 5J57B 3HS0B 4LDLB 4APXB 1UADC 1W8OA 3ZL4L 1TZGL 4LQFH 5C07D 2H1XA 5GS2H 2IALA 2LV4A 3OKEA 3I6KB 4LOEA 2RR3A 4RBPH 1I7TA 5FYJU 1YEGL 3EBAA 5L0QC 5INCB 4DNLA 3X1GA 2FHBA 4JL2A 1UWEL 4I48A 3MRDB 3TBVA 3B9KD 2Q5BA 3JVGC 2YHGA 1OK8A 2DQFB 1A1NA 3QS2A 3RWFA 2DQDH 1JMZA 2CGRH 4FQXC 4GI9A 1GW0A 4GSUA 3CSPA 5CZXD 1YN6A 4Z7VB 4K8RH 3B3IB 2EVIA 2GAZB 3U1PA 2XKNA 1CDGA 1RZFH 1UT2A 4HOZA 3H3PH 3K0YA 1NAMH 1I9RH 4DTGH 3WHXB 4ZPVA 5B38A 2EH7H 5KSVB 5A16A 3N06B 4R9HA 2QFRA 1I7RA 5I17A 5EO0A 2R1XA 2B1HL 3ZQ9A 3QYNA 4XNZB 1M1XB 4CMMA 2H1PH 4N1CA 3LV3B 4L1DA 3RVWC 1CGYA 3V0VB 3ESNA 5IW1B 5I0ZA 4KK5D 2QVIA 5DXWA 2GIXA 3RDJA 4JANB 3IYLW 2H7WA 1RUPH 4U6XB 3O8XA 4QTHB 5DJDB 4PJEA 4CU7A 4XBEL 3MO1B 1G6RB 1WAEA 2RBLA 2C1PA 3KYKH 1JJUA 2LFGA 4JFED 4ANVA 4F37K 5CBEB 2AP2A 4TSCL 4IRSA 3AREA 5KS9B 3U48A 1FG2A 3AXLA 1R3HA 3ZHKA 2VM9A 1MFNA 1AD9A 3SOTA 3HG5A 1U8LA 4Y9EA 4HJJH 5EMYA 4FADA 1ITBB 2HKHL 4GSDH 4TYUA 3HNSL 2F74B 4NQUA 1ZS8B 1KB5A 5T1LA 2TSBA 4G8EB 4ODVL 4N2OA 5DZNA 4DK5A 3O3DA 4WKXA 3ZLQC 3GHEL 3EUUA 1VERA 4TNWK 2A38A 4BZ2H 3JWNC 3ZOAA 4EN3A 4M48H 3RPKA 1IAIM 1HHJB 1F56A 3B3BA 1C08B 2WZAA 3RTQB 1SYVA 1WFMA 2NR6D 2ED6A 4K2UH 5ESVA 3EGXB 2HKFL 2BS71 4FZ8L 4WW1B 2NY6B 3LXAA 3VWKD 1Z9NA 3WLWD 1GKEA 4F7CB 2A6IA 5M7QA 4BUHA 4HPOL 5J1SC 4P8QA 5J11B 2BZCA 1SJEB 2Z35A 1A1NB 3RWFB 4HWEH 5IEKB 3U9UA 3MLVH 4KZDL 2OULB 2I9LA 3PV6B 2CUIA 4NSKB 3T2NH 3TNNB 4PUBL 1MOEA 5F96L 1FC2D 3LS5H 3WD5L 3N1FC 4FN0A 2LT9A 1P7QA 1TCRB 1HWHB 1ACYH 4LLDB 3L3GA 2A6KB 1KYFA 4PJIE 4GRLB 3CSBA 1QFPA 1UFUA 1JHKL 3D2UB 1BFVL 3GRWL 2YD4A 3SDXB 4Z7OB 5J5EA 2OMVB 1MCPH 1Z5LB 2R4RL 4U1SA 4G8FA 1MW0A 3OMZA 4FHJA 3CMOH 4KHTL 2BX5A 1I53A 4FYQA 3ARYA 1UQSB 1ZJBA 4WRLA 5AB1A 4GLRI 1PFOA 5ADOH 4O02A 2I7OA 2Q3ZA 2OPCA 4TUKH 5EPMB 2Z4QB 4HWUA 1BAFL 3CDCA 2QV4A 5DJ6B 4G11A 3WY2A 3O3DB 1ZSDA 3WNLA 3BVNA 1XT5A 4AEFA 1WDAA 1OCRB 4OVUA 2ZUWA 4K7FA 3F3HA 2NQ3A 2X1QA 3FCGA 3EJYD 4WV1A 4YDLB 5D6CA 4OT1H 3ABKB 3MOAL 2OQJA 4KUZH 5HPMA 5FGBA 4L8SC 4X2UA 3IMWA 3GO1H 1R3LA 4R8WH 4RMWA 4KO6A 2BCMA 4GKSB 3IJHA 1LO3L 1PBYA 4HS6B 3BZ4B 5GXBB 1WCBA 1L9PA 1MLBA 1I1AC 5EZJB 3X11B 4M5YH 3SPHA 1N0XL 5AENA 4U2YA 3QT2A 3U0PB 4PGEB 3Q44A 2D3LA 1IAIH 3K74B 4WI4A 5D70H 5D7IF 4X4KA 3SJVD 4WSGA 2VDQH 3UPRB 1N5AB 3L3JB 4MDIA 1UA7A 1RUKL 1WWBX 4N6RA 4ZK8A 4KITB 1S7WB 1CI3M 4FZ8H 3SKMB 2C4XA 3T4AC 2O6DA 4KFZC 3PDOB 4Y5XB 3RYMA 4O00A 3U7WH 5IT2H 3UJJH 1R6VA 2VKWA 5DQJB 1LE9B 3B2VL 5IVZB 2WP3T 3C60C 3L9EA 3MJ9A 2ZAGA 1B0RA 1J0JA 1WCBB 4P2RA 4KROB 1BYPA 3B7UX 3NZUA 3JXAA 2ZXDA 2ZXGA 4U2ZA 3IVKA 1XO8A 3B9KC 3SGDH 4E36A 4S1QL 2L7QA 1W6WA 2DF3A 5E6RB 1CLOL 2ENSA 4Q9BA 3ZZ1A 2XN2A 4U6HA 2BSRA 2BVEA 4Z3IA 3IDJA 1ZLSH 2ZUUA 4DEPB 2WWKO 4XBPA 2CJSA 1QSED 3FSZA 5GRVK 1T89A 2FH6A 1NBZB 4NP9A 2YAMA 2YEZA 3GNML 4WEEA 3U2SB 3S98A 3GS0A 5SX5H 5DR5H 3PL6C 5I71C 1AR1B 4YDZA 2PPFA 1UVQB 3CCHB 5ADOL 2V2XB 4I13B 4JAMB 1IMHC 1Q9OB 4XXCC 2RMNA 2QTVA 4F8PA 2Z7YA 1DQJB 3RX5A 4MMZA 3VXUD 5IVOA 3UAAA 1JNNL 1USQA 4OZIA 1J88A 1WH0A 2D0GA 3QQ3B 1ILSA 1M4KA 3QDGD 2ZOWA 3SDDD 3P30H 1BQUA 2BP0A 2YAOA 3O6KL 1Q9WA 4IBLT 4OGXL 1HSBB 1XGUB 3MBEB 2VJ8A 3A6BL 2Y1ZA 1CTNA 1DBAH 4W4OC 3CVCA 5LBSL 2AI0H 4S1SL 2L3BA 2YRZA 4P5TC 2MQCA 4UOQA 4BFJA 4HIQA 2VDLB 4PI2A 5SWZB 4OZGA 3MPCA 2B3IA 1HVXA 1U3ZA 1U8PB 1EMTL 2J1WA 3IDIA 3P0VH 5FO7A 1DN0B 3K1DA 2MCMA 4PG2C 5DUML 1S9XA 1G0XA 1DDHA 3FFOA 2UX7A 4FKKA 2LAGB 4X6CB 3DUUA 2Y5QA 4PLNC 4AKOA 5IR1A 1RJYB 1BQ5A 3U7YH 5DYOA 1FLTX 3UJIL 5ITBL 5HY9B 3WIIL 2R2EB 1MFDL 3NIDE 5AUMB 4NB7A 2ZX8A 4LHUG 2G60L 1FV1A 2ZG2A 4QYOB 5I26A 2OMTB 5IIEA 4UM9A 4PJFA 3BAEL 3KLAB 3NCYP 1WZKA 4PH8A 1S9XB 4FULA 4JY6A 5FYLD 1S7VA 2B1OA 2D7MA 3G5YA 1OP5H 4RGNC 1NCHA 2F15A 3MLYL 2VITA 3WEAA 4HGKC 5E5RB 5BO1H 4JFHD 3IDXL 3N0PB 3ABMB 4O2EA 4AMKH 3CZNA 1NCDL 4ADJA 3DPDA 2B7DT 4JZJC 2WCPA 4PGZA 1A9VA 1FZOB 4R0LB 1JK8B 3X13B 2R9HC 2G0LA 3LXCA 3D25B 2X6UA 2J2ZA 2E7MA 3VYNA 4GW5B 5DK0A 1JGDB 4F15C 4OLVL 3H7BA 4MJIE 2EYRA 3N6YA 1WZLA 1QFHA 1QAWA 3NPZB 4XVUD 5FYJD 1YECH 4L8CA 5K9KB 2CRZA 4HHWA 4JFYB 4AGLA 4QIRA 4MJ2A 3CJJA 4M1DL 5C08B 3MBXL 3L4XA 5FF6B 4HU8A 4Q14A 3F7QA 1CLZL 2HRLA 2HSIA 4M6ML 4Z7WE 3QZOA 3G08B 4DFIA 2FEEL 4FLQA 1SDDB 1THCA 3PJLA 2VYRE 2WB7A 3HNVL 4Z7IA 1AQDB 3DETD 1GC1H 1N6QH 3C12A 4TL5A 1I8IA 1NCCL 4TPRL 3LNEA 3SZ6A 1YEHH 3A23A 3MA9L 1SN0A 4HWNA 4U49A 2BSRB 2JKLA 2WLYA 4WWNA 3GJFA 2NNRA 1F4XL 2GTWA 4BFGA 2WXIA 4DP0X 1ID2A 4M1CD 1TVHB 4UM8B 2QADB 1FNHA 2ESVA 1L5GA 3ZKQD 5E99H 4FQJL 1MFUA 4J3OD 4ECNA 4M1CC 3JYCA 4ERSL 1INDL 4PREA 5I8CB 2CCLA 5K9QG 3CFBA 1G6VK 3PWUA 2J6EA 3FFCD 2NXZD 4APXA 2TRHA 3FRPB 5IF0B 4JHVA 2KI6A 1T2QH 2AKRB 3QW9A 4MDRA 1UACL 2VIRA 3MREB 5EC1A 2D9QB 4GNKB 2MRYA 2XWJB 3F7YA 4MASA 5GS2D 1OP9A 2R7EA 4QTIH 4S1QH 3S8FB 3HS0C 1FH2A 4V1DE 1YZZA 2YD2A 3H0TA 4M29A 3EJYC 4OB5H 5IEHA 1P4UA 1UD8A 2WLJA 4UQCA 5D71H 3UTTD 4HCFA 4R7DB 1NAMB 1NWPA 4HXAL 5FDYA 3EOBA 5HVWA 4XE5B 4PJ8A 1KYUA 4NKQB 1BZ8A 4U1MB 4OZGB 3HEIB 3MX0B 1ANUA 3KPNA 4OIIH 2J8HA 4FFTA 1S9WB 1RJZA 3LH9A 5AOJA 3P9LB 1QYGH 3QC5X 3ZYZA 2E9IA 3QHFL 1ZEAH 4P2CG 2Q0ZX 3JWNE 5LGKA 1Z3GL 2EC8A 4NDMA 4Y5YC 3NJKA 4E5XA 2O6PA 3FUHA 4WHDA 5HDBE 2MQ0A 3D50A 2AEIT 1RK1A 2HMID 1H9VA 3KJ6H 4OCLC 3PAZA 2Y06L 4MS8D 2D73A 2OMXA 4JDTL 2VWEE 3FQUA 1MCWW 4HGWB 1TQBC 2V6HA 2VQUA 4YHNB 3DVIA 3S3SA 3BZEB 2JCCB 3V6FA 3ARBA 3MOBL 3PWLB 4GINA 3WENA 3LXBA 3ARDD 1MAML 1TKWA 3CNKA 1MHEB 5E8OA 1KELH 4MA8L 3T6XA 2HLEB 5I2IB 2PPDA 1AMYA 1DQML 3KWVA 1OWRM 4NHCL 2XRAL 4YPGA 5T5FL 1Q72L 1UXSB 2WXQA 3I75B 5B7FA 4MCYB 4OUUB 4XPTL 4GW5A 4KWUA 4IDJH 5D1ZD 3EGSA 5DF0A 4NNYB 2NCEA 1SOQA 1WS8A 1T21B 1FGNL 4FXTA 1N8OE 2E75C 2NR6C 3HZKA 4KGJA 4P2QD 3BP5A 5E99L 4FFYH 4CC1A 5KSBE 2X2JA 4E42B 5GS0L 1QX1A 4MQSB 1GW6A 3VFMB 4M02A 2WUBL 4AW7A 1IT9L 3TFBA 5HGDB 4J3SA 4XCNB 1RIHH 1LILA 1AY1H 2Z31B 3ILDA 3L3DB 1RIVL 3I9IA 4P9HH 3VD2A 1KFAH 2FX7H 1R0AL 1PSKL 2AQ2A 3S2CA 4XVTL 3HS0A 4NN6B 1BIIB 3VTAA 2Z93B 4DPRA 4FI6A 3O45A 1NAKL 5FUCE 3TTSA 2HX7A 4NXKA 5G5DA 3E3QE 3L7FA 5IQ9A 4XO3A 5IQ7H 3FFCE 4CW1B 4BZ1H 3OLDA 4FNUA 2Q2LA 4JFEA 3CFJB 4LL9A 3FUKA 3LIZA 5JW5B 3RVWD 4LFHG 3OR6B 3UMNA 4X80H 3BSHA 1XIWA 2PWEA 5G55A 3V52H 4B9FA 5FYKH 4O51B 3LIUA 5F88B 1MRFH 3TFKD 1B2WL 5IUSA 4KX7A 1DYZA 4HJUA 2NY5C 2WLMA 3T0EE 3Q2LA 2VDOB 2DQEL 1DVFB 4IGBD 5I1EL 5IKCB 5HP5A 1U8IB 4FLHA 5MERB 4PW9A 4WWKC 3HG1D 3BP7A 5CN1A 2QMKA 3MCLH 4PHXA 4Z78B 3BN9C 4LGRB 2YQ2A 4AG4H 3V5DA 5EO0B 4JN1H 3VFPB 3SD2A 4QKXB 4JHWL 4JKNA 2XZCL 3EG9A 4MJID 1ND0B 1R3KA 2R29L 3MRJB 4KO7A 1BZ9A 1T22A 4PJCF 4ZMWA 2FJGB 4NQEA 4A6YB 2B0SH 2YOCA 2ICWA 4Z3EA 1SHSA 5FR3A 3ELAT 5EU6A 3F2LA 4JQVA 1ED3A 3PUCA 2IF7A 2G2RB 5FFOA 1HSAB 4P5TA 3PP4H 5FFLA 2N01B 2IWFA 2DYPB 3UPAA 3BIKB 1FNSL 2G2NA 3W9EB 4NO2B 3K71A 4NERA 5FOBB 2EDFA 2ARJB 5BS0D 4KNSA 3NZ8B 5KSBB 4M8RA 1MWOA 3NFPB 1X5JA 3PDDA 5AVRB 1E4XI 2A74B 1HQRA 1SY6A 3TNMB 3WS6A 1T3FB 4UTBL 1BM3L 2CMRH 1QUNA 3GMOB 2JTDA 2V37A 3MRCB 5EOTB 3GKWL 5D1XB 5AW8B 5TD4A 1WUNT 1I7ZA 2AJUH 2R4SH 5FC9A 1FQ9C 4B41A 3KXFD 3LRMA 1ORQA 3GO1L 5D7IB 5GGRB 1MWAH 3BLPX 4U1SB 4YHIA 4UIMB 3NPSB 1BLNA 4PU2A 4GLRH 4WI8A 5B4MD 2R56H 2GABA 1OT2A 4YXKL 1ZIAA 2HCZX 3SKOB 3RGHA 3I9GH 5LQBH 3IFPB 5FKPB 4W81A 2P9RA 5AAWA 2JJSC 3ATEA 1WCQA 1A7QL 3VTMA 4Y2DA 4NQSA 1TZHB 4O9HL 1Q94A 4YGVA 5F7YC 3EHBD 2A2QT 3QUYB 1HNGA 6TAAA 1C12B 5DD3L 3KYAA 4MFHA 4L1BA 1GGIL 2ZOKB 2DKSA 1AGDB 1AS7A 2ZNWA 3K4AA 3OKNA 2EEFA 2GYSA 1IE4A 2BO0A 2AJSH 1F13A 3D7PA 3ULSB 3ASWA 1CG9A 3V9FA 4BWTA 4ZI8A 2WBKA 3D5OF 2ZWKA 2VSCA 4MDJB 3U0PA 5C0BA 3UZVA 5AVWB 5EBGA 4Z7OE 1NBVH 4IJ3C 1RL1A 3GHBL 2CNYA 1HWGB 3NSFA 4H88H 1GYWA 4NRXB 1KBWA 1OTUD 2OYLA 2FBRA 1GSMA 3K80A 2X5PA 4XMKH 3FB6B 1FCGA 2Z65C 3AY4C 1CN4A 3B2XA 4DGYH 1SOXA 3UCRA 4UDTB 4YFLF 3O9WC 4KKPA 3F12B 5KYWB 2QQNL 2W81C 2R0ZH 1PZAA 3HC3L 3IE4A 4M6NH 1UZGA 3LQZB 1GGTA 2CA3A 3C6LB 5JIPA 1LEGB 4FMVA 5EPMA 5GGUA 4ZODA 2G9KA 1G9NC 5J12B 5JOPE 2FECL 1S7XA 2VDMB 4TNGA 4YH6A 5ALBH 5AOIA 2ENPA 4UT7L 1CFNA 1AFVL 4WW2F 4CVXA 2K70A 3S5YA 5GGRA 3CZFA 4QXWA 2C9QA 2JQAA 2K6WA 2CR0A 3IJSA 2ZOUA 2O72A 1OGAB 4XP5L 4B96A 5IB4A 3FXIC 4JFXB 4TLSA 1P5UB 4P3CH 3TURA 1QLFB 1OD7A 4DO4A 3HG1A 3L3GB 1CYXA 3WTYA 2B5IC 3H9SD 1UVQA 4IOSA 3EW3B 3TV3H 5DUPH 3ZXAC 1ZANH 2XTJE 1OVZA 3HPJA 5IHUL 3COOA 4Q7DA 3BDYL 3P11H 4WWID 5B1BB 2HFTA 3DGGB 4QRSB 2ICWB 4L29A 2J4WL 4G6FD 4XX5A 4PLJD 2CDGB 5DHYA 1D6EA 4UINL 1BD2B 3RKPA 1DBMH 5KVMC 2XU9A 5IW6B 5L2KE 3APDA 5AW5B 3ESUF 5GGVL 5JORB 2ZXWB 4JCWA 1AXSB 5DMKA 5T1LD 3DI2B 4L37B 5LXGL 3FRUB 4P2OD 4XNAA 1TYJA 1JZFA 3P4NB 1F45A 1E0OB 2YSSB 3ZZSA 3LQZA 2AXGA 1ZDSA 1NFKA 5F1IA 5D8JL 2ZSWB 2FT8A 3FUJA 3UBXG 5ILTL 2EXWC 3W0WD 3QULB 3V0DA 1JGUL 3ZE0E 1A8JH 4F8TA 6FABL 3QARA 1HL4A 2QSCL 1VRSA 1SBBA 1XDTT 3KPPA 3IF1B 2YD7A 3LEYL 3PHAA 4IBSA 5B3SB 1H6EA 4K8RL 4Z6AT 2W60A 4JFUA 5FX3A 1JTOA 1TO4A 2ISDA 4AQ1B 4OF7A 3VU2A 1VA9A 5G2NA 4OD1H 2COQA 4P2QA 4MWFB 3GXMA 1X7TA 3U6XS 4X4ZA 4YK4C 3T2OA 3RA7L 5JW3L 4KK6C 3QIUC 4OZIF 3RY6A 4JHUA 4MA7L 4QUOA 3VMNA 1HZKA 1TFPA 5ACLA 4QTIL 3L1EA 4HX1B 3BVVA 5HYJA 3LS4H 4KTDL 2E27L 5F93C 4DKFH 2I5YL 3GMPA 1OCZB 2WYHA 1YNKL 4LLYA 4X6CE 4GB9A 3CN1A 5FYKE 2XA8L 1DQDH 2NT0A 5K39A 3K72A 3HNTH 3TPUA 2OK0L 1AIZA 3C60B 3HBQA 1QRNB 4LF3B 4ONOA 5FHAL 3TVMC 3CFBB 2AQSA 4L5FL 1RHHB 3I6LD 4JRXE 3U4KA 2VDLH 4ZMNA 3FT4A 3EYUH 2X2YA 5SWZE 4MZRA 5KSVA 4GG6B 3ASNB 4HUVB 1UXWA 3FK3A 1DQQB 1A21A 5CKAA 2DL2A 3PAUA 3OC5A 1VFOA 1XVSA 4FFWD 3ZTDC 3DHUA 1DUYB 1UZ6F 1JPTL 4M8VA 2Y72A 5DHYB 1T4KB 1SMDA 4AGPA 1M6OA 4KKQA 2FGWL 3QXTA 2IPUG 1A7RL 3VRLE 5F9WB 3GK8L 1HEZA 2HTLD 3EDDA 4RX4A 5HGAB 2QGDA 3BH4A 3FO9B 3QFJD 3WFDH 2H1LM 2KUTA 2P46B 3MNWB 1KNOA 2CO3A 4F7PB 2EIBA 2X05A 3UTSA 1C16A 3FN9A 3FONB 5HHOB 1E9PA 3GMQB 2NZIA 4NIYE 2DLIA 5EZPA 2FX9L 4RMQA 5F1SA 3ZL2A 4HKZB 2X41A 3HN3A 5HHME 1Z9SA 3MUZ1 4BZ1A 2OSLB 1ZMYA 1FIGL 3I50L 3MKGA 3CHSA 2OYPA 1I9JH 3BUYA 5ID0B 1LO3H 1YEKH 3MLSH 4BH8A 2GCYA 2F8IA 1WP6A 5BRZB 3ESPA 1C5CH 3GTNA 3D25A 1LO0H 3WIHL 2Y5TB 3WL9B 5F1NA 2VM3A 2ZXEB 4TQEL 2QR0A 3WNMA 3S96B 4NQED 5D7KE 2A9NH 4LIQE 5EO1A 5EU3B 5KOMC 2WXKA 2N56A 5KJRH 4KV5E 1INEH 3QRGL 1IQWL 3IAPA 4DETA 2WXHA 3SPCA 3T65B 4OQTL 3UJTH 3T0EA 3ABLB 2VLRA 1Y07A 3CFDB 2CDEA 4I7ZC 3OPZL 1MCIA 1ZT1B 2BFVL 4HEMA 1CICC 2XOTA 4XVTH 5IY5B 2Y4SA 1U92A 1GOGA 1M53A 4Z3HA 1H15A 2R2EA 2V4LA 4B5EA 2JK5A 4ELKA 4PJBA 4AT6A 5KW9H 4MMXA 4FF9A 1NSNH 3A67H 5J9PA 4G8IB 3ZRSA 2UXVA 5D2NB 3EYOA 1EJ8A 1E28B 1JSYA 2W9LA 5C0BD 3HKFA 3U30B 1IB5A 1ACCA 1U8MB 3N1GC 5KVGE 4NDMB 1SVZA 3NQKA 3QCVL 4WFHE 2ESVB 3H3KA 1FVEB 1A3LH 3L7EB 4WI9A 2JJTC 4WW2B 2PYEA 2MPAH 3EKCA 3I6SA 2J72A 2CLRA 1G9NH 4LVOC 5IMKB 1EFXD 3FQXA 4KAQL 3VNYA 1PY9A 3AQYA 4NOFA 2AQ3A 5AKTA 3UX9B 3OKDB 3RUGF 1ML0A 3NJFA 5FDWA 1RH8A 4IYKA 2J7LA 2NSXA 2EVGA 4X6EB 4S2SA 1V54B 5A2AA 1F11B 4G9DA 4XN9A 1A9BA 1H5BC 2IPTH 3W81A 1D5ZA 1U91A 1PG7L 2CIIB 1QLEL 3P0YH 7FABH 3CFNA 1A6UH 3FO2B 3BESR 4NX0A 2QDVA 5E5LA 3NSXA 4HZAA 3QWOB 4MCYA 4OFPA 2VR6A 2OJEB 4QY8A 3RWGB 3TM6A 4F2MB 2QQQA 1V5JA 3QPXL 2FX7L 4QXTB 2NNCA 5FOJA 1SEQL 2ARJA 3OGCB 4KHXL 3SPVA 3DX9A 4YO0A 5PAZA 3SDXE 3RWJB 4BCZA 1EHAA 4JQXA 4LOFA 5EN3A 1MCQA 2AJXH 4GAFB 4Y4HA 3R0NA 1JDDA 2DLGA 2ZAIA 1G0DA 3N42B 2D9CA 1DLHA 2BP8B 5GS1A 2FO8A 5JW3H 4K23L 1UZ8B 3HI5H 1IRAY 3V9CA 4K7PY 4YQXL 2VDRL 3QAZB 4L0PB 2DB8A 3MV7A 3S5ZA 1D5MA 1YY9D 3M7OA 2OR9L 5JMOC 1CGTA 2X1PA 2L7JA 3RVUD 5IJDC 4I18B 2CM6A 3JWOL 3ARUA 3VXUE 4GOSA 2YFOA 1CGSH 1BFSA 2DQIL 4QYAA 3PHOA 2MPVA 1DP0A 1N2RA 3GZQA 5FF6A 1OARH 3V0FA 4ZMLA 4FP8L 4I3RH 4PJ9A 1EX0A 3L7EA 4F1SA 5E5MB 3D3VA 4JRYA 4PV8A 3U79A 1F4WH 1CL7I 3MACL 1IGCH 2IOIA 4IBYA 3B7YA 4NCDA 3KPSD 5IFAL 3M1BA 3MXWL 4OKVB 4JQXC 3EUDA 5GQBA 2J88L 3IU4L 4JO3H 1Q1JL 2CXGA 4GXFA 1CFTA 4UDUB 3MRBB 4R3SA 4RNRB 5CINH 4P04A 1IIIA 3TF4A 1WAPA 2AXHA 4GKSA 4ESKA 4D9QE 1TYRA 2E47A 1SZNA 4HT1H 4B53A 3MRLA 1KJ2L 4OZ4B 1JN6A 3O4OC 3BPOC 1MFAL 1X3DA 4PJIF 4EEEA 3VGAB 1NM4A 1FDLH 2VRKA 2LGNA 2R2HB 4OR1A 4BM7A 3EO0A 1MELA 1K2DB 2WLIB 4JPQA 4AZUA 3GXIA 4N2NA 3DO7A 2NY0D 4HJIA 4OCWH 3X1EA 1NDGA 4U1LA 3JV5A 2P5EA 1BGXH 2EVFA 2D3JA 3MBWB 2L0DA 3MR9B 2Z31C 4LCUB 3UADA 3N85H 3ZK0A 4LASH 1ASOA 1FNEB 1WICA 2BXYA 2DWEA 3E2HB 4MQTB 4OCNC 1R46A 3TT3L 5HYSA 2W88A 3OKMB 3PXHA 4BFEA 4IHOA 5IOKA 3RWEA 4TSBH 4DGVH 3AXIA 3AT9A 1OB0A 3OG4B 1UM6H 4N2IA 2WY3B 4HDIB 2A9NL 2X4QB 1JVOA 3DYPA 3VFTA 3L3KA 1ZT7A 1KXTA 2C9UA 5CILH 3RG1C 2PYEE 5L4JA 5D1XA 4L37A 3LOWA 4HISA 2IXQB 4MSWA 3VSUA 5IB3B 1BF8A 4IU2B 3DO4A 2NY1B 1BXAA 1MJUH 2EYTB 4Q74A 2P24A 1K8IA 2GJJA 4Y16C 3B4NA 2Q9OA 3CXHK 1JRHH 1U3HB 4GAAA 2DIBA 4AGQA 4TUJA 2B9BA 1TYEB 1YN7A 3MRMB 2CO7A 1ZE3H 3S48A 4GXUM 3C08H 1I75A 2K9UA 2R0WL 3GFUA 3F83A 4OQ1A 3OVUB 2DM4A 1LE9A 2FQDA 3V7MA 4CDHA 4UT6H 2EXSA 3IJSB 4LP4A 1T22B 4W9DC 1MFCL 1R24B 3HAEG 1GZQB 3DBXA 3I84A 3N0AA 3NCMA 3KLHC 4M5YL 9CGTA 5DI8B 2ZX5A 3E6HB 4KRNA 3RDTA 3NOIA 4JO2L 3U0TB 2YMXH 2XLLA 3SYPA 3FT2B 5D72L 1HCFX 1RMFH 3VXMB 1XH1A 3F85A 5CUSH 4E41A 3SKNA 4V1DA 4C4KO 2K4WA 4LCWA 2XACC 3CPUA 4OI8A 1K9TA 2OR7A 2VW4A 5IVXB 1TJIH 2YPLE 3FB6A 2HT3D 4IU3B 1VIWA 5F88A 1M9SA 4AYMC 3IDIB 4NQDA 5BOPA 4XH2A 4L8SB 5DMJB 1QPXA 4OZGE 1QSEB 3CBJB 1E3FA 5CD3A 1LDPL 3QRLA 1F6LL 1SYSB 3ESVF 3MODH 2YC1A 2AEOA 3MRFA 5SWSE 3D30A 2V3EA 1T1ZA 5EZJA 5D2LE 32C2B 5CP7A 4V1DB 5AAWC 3X11A 1JZDC 3PCYA 2F5AH 4LOUC 3EDJA 1E2WA 1EO8L 3NA4A 4ZYKA 1PJWA 4GMSH 5C6TL 3T0AA 1BCIA 3ORJA 1J9QA 2BZ7A 4OB5L 4UTAL 3AS2A 1IKNC 4QYOA 4WHTA 2OYKA 2A9CA 3O6MH 3QJRB 5JIQA 1CD8A 4MMZC 4NN5B 43C9B 1EHNA 4B6ZA 4TRPH 1OQOA 5TGBB 4OLYL 3RNQA 5F7BA 2AW2A 4P5TB 3QZLA 4AE1A 2OMVA 5C92A 3MRHB 4YHPA 1AKJB 4YDVA 3CXFA 2EDTA 3CZEA 1U3HC 2ADJA 3OAZH 4ZX4A 3VGDA 4J6RH 2PR9A 4MRBA 1KPRA 1DDHB 1RQ5A 4BRVA 4KZDH 1NFAA 1M7IA 4OGAD 1CR9L 1G1CA 2E59A 3N40F 2Z64C 2X44D 2XWRA 4GIPD 3CFKA 2APVA 2JQMA 1LLAA 1PLBA 1E5ZA 5D96B 4M5TA 1XAUA 1P6FA 3CLEH 1MVYA 4PRBB 3V4VA 3EJQA 4JFYA 4WHCA 5LBSH 3EADA 1OP3K 5FW8A 5FEBA 5T5NG 2ZQKA 3LDBB 5FKAA 2QL1A 4XP4L 4I1PA 3F6LA 3SEPA 2BSCA 1QBML 2DAVA 1AQ8A 4UUJB 1L7TL 3UMTA 4BQ8A 1GZPA 2FBOJ 1M7IB 4JKLA 2ITCA 4PCKA 3V52L 5F2FA 4HUVA 2H32H 1KJ2H 4ZNEE 1SOSA 3EG9B 1F0LA 2BMKB 1FSKC 5D9SA 1TQVA 5I1IH 1XF5B 15C8L 4JFXA 4MB4A 1DLFH 3UAJC 1IILE 4GSXA 4O02H 4EAEA 4X6FA 1UM5L 2DEWX 4PSPA 3SKMA 3EYOB 4PCYA 3VRIA 2PPCA 3RVUC 4MDJA 4ZPTB 1X5GA 1WAAE 5FUZL 1ZD6A 1YEFH 2APTA 1P7KA 2X4PB 5DZVA 2G5BB 1QEXA 3QUZB 2CIKB 3VI3B 4TSBL 4DGVL 4LP8A 4Q0XH 1KTKE 2OL3B 2H4EA 3NJLA 4M5SA 3O4LA 2IAAC 4X6CA 3MJGX 3WHE0 2MNUA 5BVJA 5L8LB 5F6HI 1DCEA 1WAAF 4NRYB 3IGFA 3MFFB 3EXJA 1ZGLB 2M1KA 4RWYH 5FCSH 4E41B 4HOXA 3ALXA 1LYQA 5CIPH 2OMWA 6PAZA 5DO2C 2BJMH 2CGRL 5L2JA 4RQQB 5FS5A 1LWHA 3ATDA 1N5AA 3L3JA 4NQDD 1CZ8L 3FHEA 1VENA 12E8H 1ZS8A 3OJMB 1X4YA 3S3JA 2XA3A 2EDHA 4AIOA 1WA0X 5DRWB 2ZOKA 3V7AG 2R0KL 1EEYA 1KY7A 2YPLD 4Z77A 5IJKA 1BFOA 3SBRA 4MMZB 4MNGA 5DVKA 2AJYH 1OTTC 2JE8A 3H2WA 5AYQA 1NCNA 1XGPA 2YRBA 3D69A 3GIZH 2HP4A 1ZV2A 2AV7A 3TH3T 1NCOA 3QS3A 3FONA 4EUPH 1TJHH 3P3UA 5DFVC 3UYPB 3FT1A 3ARDA 5JUEL 3HZYA 4GEJA 2XZCH 3QJHA 43C9A 1BZDA 4KK5C 1OOAA 1TVDA 4V33A 2HLFD 1KTCA 1P7QB 3GXNA 5J0BA 2V2WA 5JNYA 4G6JH 2BINA 3QPXH 4YSUA 2AGJH 4XMZA 2IO5A 1I7TB 2MH4A 4WTWA 2F68X 2HPOA 2EDNA 3T8XA 3HNSH 3TA3C 4AUYA 2ITFA 3ECBB 3KYOB 3TYGL 4EN3C 3MODL 1GYVA 4X6CF 1IGJB 1H19A 1BP3B 5EBWB 2AVGA 2G0KA 3O41B 3UBXI 3L16A 4YHMH 5IOPB 3RIAK 4NZDA 1ZLDA 2VXUL 3I6LE 5ELIA 3GRWH 3GXFA 2OMXB 3GSUB 4H26B 3RZWA 1BVKB 3QJSB 3V4PL 1YUHB 4PJ7A 1N4XH 5CP3A 3TJHC 2ILLA 1KGYE 2KZWA 1LO5A 1YPZB 3GZOA 4R90L 2UX6A 5E2UH 3K6SA 3NGBC 3L5IA 5L4IA 1MZZA 5AWNH 3FO0L 4MRCA 4RZCA 3VFGH 4LLMB 1I8LA 1Z32X 3CVIL 2Z3FA 1EQWA 4IOIA 4KKCD 4PRPD 5IBUG 4GQQA 5DS1A 3V0VA 5C70A 1FL3B 4UV4L 5JO5A 2A0LC 2D7TL 2PXYB 5DHVA 1QWUA 4NNYA 3VYPA 5HGBA 1K6QL 3FFCA 5KVDL 4Z5RA 1NCCH 5GS3A 2Q86B 4N5EC 1KBGH 2YRLA 4WI2A 3RQ3A 2BHUA 5C09D 2OW6A 3DO3A 1KPUB 4X9FA 4JM2B 3VRJA 2X2UA 2DQDL 3LPWA 1T0NA 2ED9A 5E56A 3CXHJ 4R5TA 3IXTA 1KGXA 4G72B 3S96A 4NWTH 4D9RD 4E9QA 4NWUH 4R2GC 1LQBC 4OZFH 4NHCH 2VUYA 1OM3H 2CPCA 5IB3A 1PS3A 4HKXB 4BD4A 3LZRA 4EZLA 4R2GD 4JG9A 3K6OA 3MNZB 4JPVL 4LARL 2MTPA 4FKHA 4HETA 4KK9D 4PG9B 3M1OA 2OMNA 5JOFB 4HQQL 2CCVA 2Y9RT 1F18A 4KBPA 3EBGA 3GTVA 5FLUA 5D2NE 5LWYL 4X7EC 1IV8A 4QAMB 3RWJA 2H47C 5CU5A 4H8PA 5B1CA 4JY5H 1QFWI 1NCBH 1JGVH 1MIML 2XVKA 1CLZH 3JZ7A 1IBDA 4RRPM 1U8MA 3O8XC 4YZFE 4ZO6A 3KPSE 4ZD3H 3ULUL 5BUPA 3RWCB 4FERA 4PJIB 1AC0A 1UENA 4Q0XL 1SLWA 4YHML 5C0FA 4L3ED 4L8DA 4NN6C 3VH8G 3CDYA 1W80A 1JPGA 1WD8A 2NY4C 3EH2A 3WTXA 4MS8C 3GI8L 1DVFD 1B90A 4Z0BH 2VC2B 3BSZL 1DFXA 3ZMNA 2VRQA 1DQQA 3KR3L 4R7NA 4H1LG 2QQLH 3VI4F 2BRRH 1JG9A 3T6VA 3TTYA 1N19A 1X5ZA 1B0WA 5B4MC 2BP5M 1XH2A 4NQVA 1TT6A 2FIRT 3BP4B 4YVUA 1M1SA 3D33A 2LABA 1U8OB 1HJCA 1W0YT 1BDYA 2J73A 2DI8A 1DVFA 2GJ6B 2P8PA 3DX1A 1LE5B 2DH3A 2Q86A 4JGNA 4Z1PA 4ETYA 4G43B 3OAWA 4TQHA 2QGCA 3FSVA 3FUIA 1UYWH 3WGVB 1OE1A 3R4DA 1SJVA 5LGHL 1HH9A 5KAQG 4H1LA 4ODXB 5ANME 5C0GB 3VFRA 1CD1B 2WINA 5BS0B 1XGRB 4K8RD 5FECB 3ARBD 1JDCA 1TXKA 3MV9B 4N0RA 2IH1B 3II3A 4GRLC 3VXSA 4FFYA 3CK0H 2F58L 4ATTA 1CS6A 3EYQD 4DCQB 2EJ1A 4RESB 2BVOB 4LSVL 1B9ZA 4DP9X 3KXFB 5DJCA 3VD7A 1SJHB 4Y0GA 3HFML 3HMXL 1AY1L 3MFGB 1KIPA 5G4NA 3H2QA 4XP6L 3QRBA 1TMQA 2F7PA 1MY5A 3RDTD 1K8DB 4EZMA 3QG7L 5HJ3B 1F11A 2BXZA 2XI9A 3PIQB 3V4VH 2Y5EA 1YDPA 3G6JB 5K9JH 2J5LB 2IH9A 2X4QA 4EBQH 3QIBB 4J3TA 3GINA 4P2RD 4YHOL 4F37F 4XO5A 2KDGA 3PU7A 1JI2A 1ECZA 1JGVL 1FZOA 1MFBH 4R0LA 1AG6A 2Z4TA 4Y8AA 3SSGA 4XNDA 2KERA 3QR1A 3DVFA 3IPBA 3X3GL 4K5OA 1ZTXL 4MXWH 4ZXBC 1AGEA 2C4FU 4WFFE 5DDHA 4ZS6D 4PV9A 2I07B 3QIUA 2BVQB 3DV4B 3HI1B 1BOGB 1ZRUA 4A68A 2YIHA 4Y4HB 3QZMA 3L3KB 3B9KA 3HLAB 1CE6A 4AKPA 3ZE2E 2VMEA 5HYQA 1H3PL 2HJFB 5SX5K 3KCPB 3EH1A 5EU6B 1A9EA 2VGLM 5BW7C 3CAFA 3HBZA 1YCSA 2Y2WA 3TIDB 4AENB 3EJZC 4PQXA 4HBCH 5DJYA 3EFOB 4B9GA 1TQTA 3AUVA 5A1AA 3VD0A 4JG0L 4WUUB 3S36H 4TNVF 3FT4B 1Z7JA 2HRPL 3IJYB 4R97B 3CZFB 3RZCD 1R3IL 3WCYA 3FCBA 2LOEA 4P99A 4UMGA 3NZHL 3FQ2A 1T1WB 3C6LC 2IBGA 1J86A 3CN4A 4JKPL 1ZHBB 4JGMA 4MQXD 1BHGA 4EE2A 1OGAD 4M7KH 1YEHL 4UNUA 2ZD0A 1BD2E 3FBKA 4BFIA 4FXLA 5I24A 1OM3L 1PZDA 3AJ7A 4DQAA 1KB5B 1SUJA 1CE1H 2GKIA 2J6EH 2LTQB 1MF2L 4X6FB 3GJFK 1FNAA 3OL2A 5GZOA 5HDRA 2Z9TA 2OXHA 3QXUA 4EI0A 2CU9A 4Z18A 5C0IA 1RUQL 8PAZA 2MOQA 2VC2H 2XTJB 5HHVH 4DUVA 1AD9B 1S7QB 5LNGA 4O02B 1A4KA 4P4RB 4Y9GA 1QQDA 3PFUA 4F27A 4ZUSA 5CJOH 1KULA 2JSFA 4P23B 1U3YA 3QEHB 1A6TA 4AXWA 4PRNA 1A4JB 5K9QI 3EIFA 1GS7A 3QEQA 1MNUL 2GK2A 4FG4A 4ZOAA 3NDZE 3HI6L 5HHPB 1MHPH 3TYFA 5HYJD 1DQLH 1RJYA 2YD5A 1NFDE 3A3YB 5FCUL 3WKQA 2C4FT 5T1JA 1OCWH 4WJG3 5I8EA 3DWTA 5EUKA 5A40E 3QCUL 3DIFA 2AEPL 4XPFL 2AV7B 3C5XA 1J8KA 1OAYL 3U4AA 4GRWF 4M93C 3FMGH 1EH9A 4PV9B 3DMMA 5D71L 5AOZA 1CYGA 5FYJE 5ICYA 3U4EB 3AQXA 2W65A 2Y6SC 4TL4A 1D6VH 3GSXA 1D9KB 5EO1B 4Z7QB 1Q0YL 3B2PA 2X2HA 2B4CC 2SEBA 1T7VA 5F72S 1RY7B 3W0WB 5CJQL 2FH8A 4EUPG 1UKQA 3P4MA 4ZOEA 1OP4A 4HK3N 4GG6A 1NGYB 3VXTA 4N8PA 1JV5A 1AKJA 1G9MH 5EEYA 5C0JB 3IGAB 3GXUB 4WEBL 3M45A 1CGSL 2F5BH 4GUPA 4N0YH 1YY8B 2YXMA 3QZWG 4LRIC 4MZIA 3ULVD 1LK2A 2C3XA 5F9OH 4AITA 5LDUA 4G8EA 2CMRL 2O6CA 5C86A 1CLYH 5EU4B 2QQNH 2BY2A 3HC3H 4KUCD 4IBTA 4GIOA 3BEVB 1P5UA 5JQIB 2R2HA 2KZKA 3O2WL 2CKBL 4FNTA 3WG7B 4YHZH 4ODSL 1NEPA 3LH8A 5IVZA 1R5WB 3U83A 2G60H 4MXVF 5E6IC 2WKGA 2AZAA 3UERA 2GK0B 4PYHA 5IESH 3F65A 4B7IA 2XXFA 4J3OC 4U6HB 1UD6A 2BY3A 4C55A 3F64A 3H54A 4GQPH 5I28A 3NRPA 3RA7H 1SN2A 3C60D 5BO1L 1CGXA 4RWYL 1V7ML 2H2SC 4BSJA 1YMME 3EH4B 4U1NA 4AUJA 4ZZFA 5L4FA 5B22A 1XGYH 2H6UA 1MJ8H 1S3KH 2QQKL 4JPKH 3KVDD 3L5WA 4QWWD 3T3MF 4PVLA 5L2KD 1Q94B 2X6AA 3UH8A 5F8RC 4PJ7B 4YQXH 3VWKB 3BVXA 5H35A 3CVHB 4PJXB 3TCLA 1IX2A 5E6IB 4M62H 1P6AB 1YYCA 1HT6A 5K5YA 3TS8A 1SF5A 5T1DH 1CF1A 1RI8A 2WWMC 3ZR6A 1KFAL 2IOOA 1SMOA 3U46A 2B2XH 2XWCA 4PVNA 1AR2A 1CFSA 1R34A 1MW1A 1JYWA 3W56A 3FHAA 4FLOA 5D5MB 1KUMA 2CBTA 3F04A 1T5KA 4KOBA 3MTRA 3TH2T 3P73B 4M5ZH 4OBSA 1EZSA 5FYLH 2NUPB 3C5ZC 4X7TB 3SDYL 2WD0A 2ZXAA 2EDKA 2XZQL 4ZTEA 1PZCA 4IK6A 2EE3A 5CEXA 2Y5TA 3Q5TA 1OOWA 1RZJL 2RD0A 4U0QB