4WI0A

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
168
structure length
168
Chain Sequence
MESYITMNFDKNTAEVGQIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVNEDYGPIVQGVHKISEGILNLSRSYTALDVYRASESPEETGTVAVVGFKALQKKATTVVFEHSVTMPNGIIGTTLFNWYGNRITSGYSVIQPGEINSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Cellulosomal scaffoldin adaptor protein B
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
source organism Acetivibrio cellulolyticus
total genus 38
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wi0A00
4FL4B 2Y3NA 2JH2A 4U3SA 1G1KA 1AOHA 3BWZA 2OZNA 3F2LA 2O4EA 2W1NA 2ZF9A 5K39A 3UL4A 1QZNA 3KCPA 2BM3A 3GHPA 4DH2A 4WKZB 4WI0A 3L8QA 2VN6A 1OHZA 5LXVA 3KCPB 1ZV9A 2VO8A 4UMSA 4UYPA 4UYQA 4IU2A 4N2OA 1ANUA 2CCLA 5AOZA 4FL4C 5G5DA 2XDHA 1TYJA 2B59A 2VN5A 3FNKA 4IU3A
chains in the Genus database with same CATH superfamily
4LEOB 1XTLA 4Z7OB 1A4JA 4JPSA 3UFIA 1WFJA 2XPYA 1DBBL 2R69A 5INCA 2WXQA 1R0AH 3P40A 2HVBA 1KB5B 3CFIC 4NDMA 3NH7L 4GG6B 4WJKB 3GB7B 3LZFL 4PR5B 1NCJA 1OSPH 3H9SB 2IOMA 3QI9A 1X5HA 3QCUL 3JV0A 2ZCKL 4YAQB 3WDJA 1NMCB 1MHHA 4FQCL 2FIRT 2ZOLB 1M2VA 4FYTA 4OD1H 3UOAB 3QCVL 1T04A 3N43B 3SY0B 2XKNB 5LKNA 1YEGL 2EYSA 1DBJL 5H94B 4DK5A 4H8UA 4HUKB 3ZE2E 3IRCA 2BRRL 3TNMA 4TUJB 3S4SA 1ZVSA 4AQ1C 1RU9H 1QEWA 2YWYA 1X9UA 5DEGA 4EIZC 1S7QB 2VW7A 5A2JH 3SDXF 3RA7L 1O6VA 4G70B 1JXFA 3VMPA 4HAFA 2WZ6A 1K4DB 3I85A 3QQDA 4X4ME 1Z32X 2P8MB 4AXWA 5B4MC 1TLMA 2VM4A 2YJQA 3IDXH 5C0CE 1E9QB 4K2UL 2OSXA 2VUOA 3AS2A 1DBBH 3O45A 3TO4D 3CXHK 2NNAA 4JRXE 1OQOA 3NH7H 1UATA 4R4FL 3UG3A 3BAJA 3U9UA 3QCUH 2ZCKH 3SE4A 5L9DH 4DP1X 2OW6A 4FQCH 2P24B 4WNJA 4DEUA 4GO9A 4IBYA 2ZF9A 3CVHL 1A6UL 4HHWA 1VEMA 3P9MA 3OKOB 1YEGH 4XVJL 1DBJH 1RIVL 4WO4B 1OT1A 1UJ3C 1IAKA 2KPNA 2BRRH 2EE2A 4ELKA 1OF2A 1AR1C 3WYRA 1DSYA 3T6QC 2HG0A 4KI5C 2Y7QA 1M2OA 1IQDB 3PWLB 3OR7B 4Y2NA 4X7EC 1ZHLA 3P11L 1BYOA 3RA7H 5IWLA 4POZC 4WENB 3DROB 5IF0B 2PTTB 1H6FA 3NJXA 3IVKA 1GVIA 2XT1B 4HYTB 3VXNB 1X5YA 3WTVA 4K2UH 5HHOE 5DQ9A 1RURL 2PXYA 1VFBB 5DS8A 3GMQB 3SKMA 5DWUL 1HL8A 2DJSA 1NDGA 2FX7L 3RWGA 4DNLA 4K73A 3LV3B 1WVZA 4ZOEA 3F8UB 3GMMB 1TZGL 1T6BX 5DGQA 3OV6A 3OHMB 2FZ3B 4XPTH 3BGMB 4G1MA 3V5DB 5T5NF 3CVHH 1A6UH 4ZI8A 3PABA 2HT2D 1R34A 4XVJH 1PKQB 1RIVH 4IJTA 3FU8A 3CDGB 1XGQA 3QUZB 3ZDZB 2R29A 4RAUB 2XDHA 3ZTCC 4QGTA 5I1AA 1J88A 1ZHKA 4PLJC 1OD7A 4XO9A 3VVWA 5I6XB 2XG4B 1VRSA 3O3UN 3P11H 4XMVA 1SVCP 4RCAA 1MRCH 2A73A 5LDUA 3WMPA 3PQYA 1G7JB 2PYEA 3DGGA 4R2GC 1K8DA 4WFGE 5KYXB 3EYQD 3H9HA 3UGXA 3E6FA 4YC2B 1JG9A 1RURH 1CXHA 2C9PA 1U36A 2WQUA 5EPMB 2XX1A 2WLHA 2W0PA 5DWUH 1HHJB 4BQCA 2FX7H 2MJWA 3L08A 1UZ8A 1TZGH 5HGBA 2UVFA 1A2YB 4AVIA 2Y6SD 3S8GB 4H8QA 3SDYH 3TBWB 1RZKL 5BS0B 3Q3GA 4L4TB 3BT0A 4Y1AB 1JGEB 3VACA 1WHPA 1NCOA 1IBZA 3HW7A 1UB6B 4MS8C 5EDSA 3ROLB 3D69B 5I0XA 5CAYB 3K1DA 5ACMA 4L4VB 3VM5A 3BEWA 5D7EA 4KK8D 3C09B 3P0VL 2HKAA 3QARA 2C3VB 1KYAA 4G9FE 1P7HL 1OVZA 1XGPA 3CSYA 4IGBA 2IAND 1CPUA 3JWDL 4IRSC 2BHZA 2EADA 1ZEAL 2DYPA 2J4WL 3LS4L 1T0PB 4ANVA 1IFHL 4ZQKB 2FT8A 1U8CA 3AG4B 1MCQA 3D05A 4HIXL 2AEPH 4CNIB 2WK2A 3AMKA 4I89A 5I26A 1BX2A 3R4DA 2YSSB 3Q1SL 1RZKH 3OLDA 3MV9A 5IFJA 3D85D 1F4XL 1U8KB 3TWCL 1NAML 1SPDA 3CVHB 5AOJA 1MJ8L 4TVPE 4UMGA 3TZVD 4A6YH 3SCMB 1NGWA 2Y36L 4B53A 2FAUA 4CMMB 1ZLDA 3D52A 3VGEA 3DXAB 5G4MA 5EO0B 3IDMA 2GJ6B 3TN0C 1O9ZA 2VXSL 4HJEA 3P0VH 4CN1A 4KJWC 5C07D 3FU9A 4G9DA 3MCKA 2AEWA 5FDYA 1A5FL 3VTAA 3CJJA 1QFWM 3LAFA 5CFAA 3JWDH 4LARL 5DJ6A 4WUUB 4ZNEE 2VM9A 1ZEAH 1AQDA 2YPKA 4UAOB 2BIQA 2J4WH 2NSQA 1OQXA 3LS4H 4I0PB 4K15A 3UJTH 1IFHH 4JANA 3E38A 1W8OA 2VZSA 3FUMA 4G80B 4HIXH 2EYRA 1FG9C 1WFMA 4XOEA 5HYQB 4F2MA 3RX7A 4L8SA 4Q4IA 4GQZA 3MDJA 4PTTA 2IV8A 2BY1A 1OANA 3GBEA 2BY0A 3Q1SH 5AUMB 1PS3A 2C7UB 5F88B 3ALXA 3D09A 3TWCH 3NPSB 3X1EA 3DO7A 1NAMH 1SJVA 2G3MA 4GI9A 1OGAE 1MJ8H 3NFSL 3JQOB 2Y36H 1DANT 4HUXA 4IEFB 4Y19D 2VMCA 3ETBJ 5A2AA 5CBEB 4WV1C 1A65A 2FBJL 1NGPL 3K71A 2J5LB 1BZ7B 2VXSH 3X12A 1DE4B 1UD8A 3U1PA 4NSKA 1JPFA 1NWOA 1XAUA 1ZGLP 2HRLA 3MRMB 1JZHA 2DWTA 4LARH 2HMID 3WAKA 4Y9BA 3C60A 4RRPA 1DSFH 5E1QA 4NC1C 1TQUA 1E28B 1AZVA 4Z95L 2G75B 2IGTA 3S8FB 3QZMA 5E1GA 4OGZA 5KVGE 4LLQB 5B1CA 1NMCC 2PTVA 3DIDA 4JO1L 5BW7C 1ET5A 1Q1JL 1RHFA 1YC8A 2OW7A 2JK5A 1UT1A 4DN4L 5ISZE 1TCRA 2FJGB 2H6PA 4UNVA 3U7YL 2MNUA 5KSUA 1K5WA 5JPMB 3KYMA 4HJGA 2FQEA 4FNQA 3SDCB 2FBJH 5D7JD 1NGPH 4AH2A 3EFDL 3SB3A 2BJML 1OKEA 3BLKA 2LR4A 4P2RA 1WT5A 3BXNA 4PJ5D 4N2MA 5I1KL 2EECA 3OB0H 3N1GC 3HZKA 4BD4A 3HR6A 2ENQA 4AQEA 3HS0B 4IKIA 4TM9A 1BWMA 1K5NB 2DQEL 3KBPA 2OAAA 1CDBA 5TE6L 1O0VA 5MENA 5DJDA 4Z95H 5T3XE 4MX7B 3EFFB 1CGXA 1SF5A 3S2CA 3VO0A 3DX0A 3MBEB 1IM3B 2Z65C 4YDZA 3W37A 1RJYA 1S3RA 3PWPE 4JO1H 1Q1JH 2VMEA 3I84A 3SE3C 3WOVA 3US1A 4NKOA 4DN4H 4AENA 2VZOA 3NQKA 1XZ0B 4AK2A 4N28A 4WO4C 5CEZD 1S9XB 1MCIA 2P1YA 2PO6B 4YXLL 2BSEA 4L1BA 2KZ1B 1NAMB 1UACL 4YOKA 3F5WB 3D7PA 2QZQA 3EFDH 3ILEA 4PJDE 4X83A 2FWOB 2BJMH 2AAVA 2EIJB 3CH1A 3I6LD 2F74B 4X5WB 1O5PA 4DQOH 3SKOA 3RFZA 3DWTA 3NT0A 5I1KH 1JV2A 2UY7A 4LPTA 5AW7B 4Z1PA 3ISWA 3AACA 4C83A 1X44A 4HX1B 4PHXA 5FXCH 2H0EA 2IPTL 1VERA 3FT2A 4Y7MA 5TE6H 2X38A 4PJCB 3HBGA 4XR8C 3R0NA 2VW6A 3BDYL 2IMMA 3SE8L 1WFNA 2X7LA 4QRTA 1I8IB 1BIIA 3QUZC 4HV8B 5DJAB 5FW8A 3K6FA 5AW1B 1QBBA 2A77L 1UM6L 4XNZB 4YXLH 5K1VA 4UQ2B 1OB1B 1S78C 1UACH 4PJBA 5L2JA 1RHHB 3G5ZA 1YUHA 3CSBA 1X9LA 4IRZA 1WC7A 3O2VL 3WIHL 3P30L 5DUML 2CO7A 2NXYB 5E8NB 4X99B 4N2BA 4CADA 1JGDB 3T8MA 5BJTB 2G3XA 2CJSA 4YC2C 3ZY7A 3KPSA 4KKAD 5FWQA 4NYLA 2IPTH 1A3RL 3MA7A 4WI0A 5DR5L 4UV7L 4N2NA 1YEKL 1WGVA 3BDYH 4IIQB 4IBUA 3SE8H 2ZF8A 3NBNA 3BW9A 1MJ7L 4H1LH 4FFZA 4JM2D 2WYZA 3MTRA 1BOGB 1QSVA 4LSUL 3RNQB 4AT6B 2H6OA 2A77H 4JDZB 1UADC 3TFKC 3ZDXB 3W1ZA 3RWFB 2J8UB 4JKNA 4ZXBA 1WAAE 3G08B 3KYOA 3O2VH 4CRPA 4JFDA 3WIHH 3C09C 4M56A 3P30H 2DMCA 4BQ6A 3UH8A 2H8PB 3DVGB 3BZFA 3QRFM 1CR9L 4PPTA 1CL7L 1C9SA 2FX9L 2GI7A 1QWHA 1GZQB 4PJHB 5I5MA 4PG2C 1HKFA 5F9WB 5F1SA 5G5DA 4WI2A 1A3RH 1XCQA 4HSAC 3SQBB 1L9RA 1FYTE 1F90L 2XQYK 3GSRB 4NQCA 1F3DJ 1MDTA 3NIFB 5DR5H 4UV7H 4W9GC 2JJTA 3VFVB 1GR7A 4OB5H 4EJ1C 3S35L 4I85A 4GFXA 2P5PA 3BKML 3LNIA 2FEDC 4MDJB 2IDTA 2H4EA 4L5FE 4OUUB 4LSUH 3QDJD 2NOYA 3GGWA 1FLRL 3SCMC 1SJHA 3HG1A 1FFPB 4HLJA 1KCVL 2R8SL 3AM8C 3C75A 4XNXL 2C9RA 2EC9T 3ZE1B 3ECVA 2EH7L 3SD5A 3NJNA 3A23A 1YYML 1M7DB 3TF7C 1Y18B 4WFFE 1CR9H 3VFPA 1CL7H 2FX9H 4YPGB 3SGDI 4UTBA 2OTWA 3T71A 3KLDA 3FT4A 4UAOC 4NBXB 1D9KD 5E8EA 1WJ3A 4I0PC 1S7TB 3EOAB 4LOFA 1F90H 2NYZA 5FOBA 3GZQA 5IOKA 1I85C 1S7WA 4ZFOA 5JZ7C 2BZ7A 4E9VA 1R5IB 4YE4L 3FZUC 4P5MB 3S35H 3IMSA 1WP6A 4MQSB 4NPJA 5KSAA 4PUBL 3BKMH 2ZIDA 3LQAL 1YN7A 4MA1B 4JY6B 3GZKA 1V3JA 3NPSC 2A9BA 3O41B 1P4LB 4H1LB 4KX8A 4AW4A 3OG4B 4OFYA 1FLRH 1VESA 3BQUB 1SJXA 5GIRA 2CHNA 2ORBH 4UQBA 4KJQD 4F7EA 4LEBA 2R8SH 4XNXH 2WJ7A 4XNMA 2J5LC 1QUNB 4HEMA 2EDRA 2EH7H 3KNBB 2X42A 1YYMH 3OKLA 4UINL 4K4KA 1J5OL 5E2TL 5E9DD 5JIDA 2AFNA 4NJ9L 3TEZA 4YHYB 4Z76A 3NJMA 2X28A 4KROD 4UM9B 4Z7VA 3WJJC 5KSBE 4MA8L 4YE4H 3UACA 3BYTA 4QTFA 3DECA 4K5OA 4XMUA 4K7PL 4GUPB 4PUBH 3DRQB 3LQAH 5DEFB 1ZT1A 3QRLA 3HE7A 3RB7A 1YQ2A 3FSZA 1Y0LB 1ZS8A 4RGMB 1RZKC 2P5EB 1MJJA 1A9EB 3HC0B 2BWIA 1CDYA 4MBOA 5JPMC 1LEGB 1XGUB 3RX8A 4E9XA 1T1WB 4MCYB 3KLHD 3SDCC 3WY2A 1VADA 4OGYL 4Z78A 4IMLB 3HC2A 3BPLB 3HTLX 3UTTE 1KJMB 5BUGA 4OZHE 1KLUB 2YZ1A 3BIKB 1NGYB 2YAQA 1KCKA 4HPOL 4NO2B 5SWZB 4MJ5B 4XZUA 3P4OB 5IESL 4UINH 1J5OH 3S8WA 4IHOA 3HS0C 1MCCA 4WHYG 4D0BB 4NJ9H 4CC4A 4NPKA 2OQJB 5AW4B 5IJCC 2ICWJ 3JWDC 1Q9KB 3MRHB 2EDOA 2QHRL 4JJ5B 5KG9B 4NWUL 3MBEC 4MA8H 3D3VA 2AEOA 2DI8A 3QXDA 4OLWL 4X4XA 2APWA 4G1EA 1QEXA 2PWGA 3BZ5A 3UMTA 4K7PH 4NFDA 4ZUUA 2XN9D 3QDMB 1JPSL 4Z5RA 4NJAL 4WEMB 3WE6B 4MSWB 3F6LA 1ND0A 3N44B 4U1JB 3MRQB 2PO6C 2WLLA 4WK0B 5D55A 4DP6X 3BUTA 3RWEA 4LKCB 2AW2A 3O4LE 3QWRD 4M8QB 1KYDA 4S0SD 1ZGLM 3QUMA 1U6AL 2HJLA 1KGJA 4PWIA 2EXYD 4JRYE 2EEBA 2MH4A 2NW3B 3TYFA 2X1OA 2DYSB 3RHWF 3FFDA 2J1WA 4P5SA 1BVOA 5FYKE 3GXDA 1U8QB 4JO2L 3B3BA 3NK4A 2ADJB 2EICA 4QRPA 3D0AA 1J87A 1J9QA 1I8UA 2QHRH 3MO1B 4NWUH 5D1QB 3K2KA 3N0AA 1NGXB 3D6GA 2DLEA 3SE9L 1T21B 5D1XE 1QUPA 1D5ZB 3GZOA 2HKHH 5K9JL 5MHSD 3TXAA 3DSNA 5I9QB 3SZKC 3WS6C 1JPSH 4CGUB 5AZ2L 4JE0A 4NJAH 4FXGA 3PHOA 1KY7A 2YMTA 3HI5L 3P4NA 3ZT6A 4WDIA 1NIEA 4XNZC 1MEXL 4Z7QB 1UCBL 1FFNB 4GBXD 5ACZA 3UG5A 5KOVC 4EMZA 4DAGL 1LQSR 5IFAL 2JCWA 1CFNA 2ADIA 1U6AH 5FKPA 3WFHB 2D31B 2NXYC 4BDVB 1JWMA 3L9YA 3BE1L 2EDMA 3AG3B 3FO2B 2DQCL 4AM0Q 1FAIH 3U30B 4B9GA 4XX5A 1CTMA 1HT6A 1LWJA 1AZCA 4IIQC 2BNQD 4N1CA 4EF3A 2MCPL 4DUXA 4QGYA 4FRWA 3DPBA 1P7BA 3SE9H 3PAUA 1EDHA 2FJFB 4KDVA 5K9JH 3NCJL 5A2FA 1N70A 1BQ5A 5AZ2H 1JPTL 4FULA 5C0NC 1EXUA 1HHGB 4NZUL 1KCRH 4FQQB 3D2TA 4XH2B 2YD0A 4R7LA 1MEXH 1INQA 2O5NA 3LZOA 1UCBH 1LE9A 1L5GA 4LCYB 4AC2A 3IGFA 4DAGH 3PAVA 5IFAH 4P4KB 4XPHL 2XBZA 2I9TB 4PFEA 4KQ4L 2QPUA 2BSTB 2VLJD 1SYVA 2X1PA 3BE1H 2DQCH 3KYNB 3OR6B 4FCHA 5F9WC 4XX1G 3GIVA 3TV3L 2EUVA 4HHAB 1AAJA 3OC8A 3I6KA 4JUSA 4I2XB 4NHUB 2NTFB 2CO1A 4X2UA 1DFXA 5AW6B 1GYAA 2IF7A 2MCPH 1VHPA 2VXUL 1E6JL 1MWAL 4XI5D 3X13B 3GYRA 3SYPA 1QZ1A 3CUPB 5TQ0L 1JPTH 4UTAL 4PJXE 1L9SA 1HK6A 4NZUH 5A40E 2OMTB 1KIPB 2F9BT 1PZ5A 5D1ZB 4HD5A 4DERA 1CICD 2GHZA 3U46B 1EHNA 4TTDC 5AB2A 4OF3A 3KHOA 2DQIL 1QABA 1N3NA 2QTEA 2ZX6A 1CYGA 4U33A 1GYUA 4KQ4H 2H5UA 2ZYSA 1IBBA 1NBYB 3FYEB 1U2CA 2OCJA 3C2SA 5FO8B 1YMMD 1JWSB 5D5ME 3KXFE 4R26L 4FTVE 4H8PA 3BHBB 3VXOA 5AG9A 1O9VA 4AGNA 1XMEB 2VXUH 3DX9A 1E6JH 1MWAH 1PZDA 4YFEA 5D2NA 5DUPL 3T65B 4K9JA 4MAYB 2I9LB 1KTRL 4MA1C 5TQ0H 2NT0A 1X3DA 1AQKL 3QE5A 2P5WA 2V3FA 4G83A 3QYMA 2JCCB 3BQUC 3MJ8B 4GIPD 4OAWA 2PABA 1FNLA 2EDXA 4KXZH 5C0JA 2ID5A 2EP6A 2NPLX 4PJ9A 4D3CL 5DJ0B 3D1MC 2O6CA 4RGNB 4ZFFA 1S7XA 4AGOA 4P2QD 1DQQB 1V7NL 1XEUA 3UTPD 2JJSA 5I30H 3FUIA 3BT2L 4PB9L 3L7FA 2F08A 4YHYC 4K3EL 1RQ5A 2PCPA 3CFBB 4LBEA 4R26H 3H9YA 1EO8H 1MZZA 5TGBB 1FVCA 3QJFB 3L54A 3RILA 2X3AA 2I85A 3KPRB 4DOHB 4AVKA 4OZFH 2VR4A 5LBSA 1P5VA 1J11A 2JH2A 2BERA 3HPLB 4N8VB 4YGAB 1IEHA 2W1NA 1AQKH 4RGMC 4FTDA 1UFGA 5JOPE 3UTSD 1MI5D 1S9KC 1FNFA 1ZLVK 1N2RA 3BPLC 3J8F7 5CJ5A 1NOFA 4D3CH 2BFGA 1BQHA 2GBUA 3L4YA 2VDPL 3MUGA 1FF5A 4FKKA 3RVTC 5HGHA 4YLQT 3KM1A 5IVOA 3FQYA 5G4NA 3BOVA 5CCHE 3M88A 1KT2B 4GO8A 3TEWA 5ICYA 4PB9H 4DHLA 4Q56A 4N9GA 2Z0UA 3AWGA 4K3EH 1Z3GL 3MA9L 4V1DA 5J9PA 3TEYA 4GIOA 3U79A 1ZJBA 4JM0A 1E4XI 2DWEA 3D87B 2F53E 3CC1A 5CILL 1W2KT 1U8HB 2HFFB 3MRBB 2G2NA 4J8QA 5B3NA 3OKNA 2FJHA 4ETQA 1TEFA 2LT9A 3GMRA 4DKEL 1SUJA 1MWAB 2WWMD 4PJIE 3F65A 2W60B 3TGXA 4IMKA 4DFIA 5F70A 1Z5YD 2EYTB 2MIZA 2J43A 3QQ3A 5E7FA 2ZCHL 2DJMA 4GJTB 4EZKA 5I17B 5EF1A 3C6LA 1I7TB 3RGHA 1QX1A 3KS0H 4X5RA 1TZHB 3VXPA 3IU3B 3NEOA 1E6OL 2RCSL 2VDPH 2CPCA 1KGWA 1HHHB 3BVWA 2IXQA 1GA2A 2QSTA 5JR1H 3KGRA 1OM3L 3BD5A 5HYEA 1M1SA 3WG7B 2RQ8A 3E1F1 3O6LL 3T3PE 5IR1A 1Z3GH 3MA9H 5EF2A 1SBBA 4QTHB 3VU2A 1QHPA 3W0WB 4KC3B 1E7VA 2ZUTA 5D1QC 5CILH 4QDGA 5D7LB 3ESNA 3ZHFA 4ODTL 5DJXA 2WIIA 3I9IA 1D5MB 2VZVA 5I9QC 2OX5B 5C09B 4DKEH 3MRNB 5I74B 4ANWA 4F5CA 5KWYC 4OZFB 4N25A 4MNQA 3JVGA 2G9HB 2XTJD 2EVFA 3FO1B 3LQAC 1OARL 2YEQA 4IKKA 1XF4B 5MEOB 1QLEH 3FYIB 2JIXA 2OR8A 1FL6B 2BZCA 5KN5A 4K7FB 5EO1A 3FTZA 4NT6B 2CG9X 1E6OH 3GXUB 2RCSH 4HIIA 4Z7UF 4F20A 3LZNA 5EHFA 1TCMA 2J6WA 1HAUA 2IH3A 1RP8A 2MNJB 2GBVA 4GKNA 4OFQA 1OM3H 2Y0SA 3WIIL 4NEHB 1YUKB 2IC2A 2CRIA 2ZX8A 2FEEI 2XFXB 3FB7B 3O6LH 5DVPA 5HYJA 4OD3L 3U30C 5TE4L 1IGFH 1T5XA 3CFQA 1BQKA 1MQ8A 4KMLB 4CJ1A 4GAFB 3P4MB 4FFTA 5BQ7A 5E2UL 3WN5B 3ECBA 3MRRA 1TTUA 3MOAL 2BVEA 1WBYB 1ODUA 5B39A 4GW4A 4FQPA 5C0BA 3BAYA 4L9LA 1WAPA 4PJ8B 4Q89A 1F13A 1PX8A 1V10A 2YPLB 3FSAA 2DBJA 1OARH 3QNXB 4FFYL 3O9WB 3Q8EA 3PFQA 3ENEA 3WGVB 3QT2A 4LOUC 4HOXA 2DEYX 1IM9B 4YFDB 3C6SB 3E3QE 3P73B 4P4KC 1RH8A 1KPRA 2ED8A 3FU7A 4KGJA 4PAZA 4JG9A 3ZO9A 4BZ2L 4DVRL 4F1ZA 3B2UC 4RZCB 4HFUH 1AGBB 4ZMQA 3ES6A 3WIIH 3PLYA 3ULVF 3VI3B 2VDPB 1YY9C 4OD3H 5TE4H 1NAKL 2DQFA 3GEFA 4CVUA 4A7QA 2LQRA 4E9YA 3E2HB 1H8LA 3KVPA 5E2UH 3TU6A 3VI4A 1U8NB 3WJLA 4PV1C 4DK3A 1HHIB 5EBWA 1FZKA 5C9KA 3MOAH 3PQYE 3SYQA 4U3HA 1BW8A 1FA4A 1WA2X 3KPMA 1XGRB 5F1OB 4RMQA 4KKPA 2FX8H 1OTSC 1EQWA 4OI7A 3NFPB 2WBXA 4HKBA 4YDMA 2AJXL 4HALA 1BLNA 4YHPA 5D1ZC 1TJIL 2XPGA 4MJIA 3GI8L 2N7AA 3IDIB 4OCYH 3WHXA 4XXWA 3FO9A 1QRND 2R7EB 3EZ8A 3QG7H 2C26A 2GSIA 1UD3A 5HDOA 4BZ2H 3L95A 2B08A 4DVRH 3I6LE 2GYSA 4GKOA 1YN6B 1B6UA 3L81A 2W59A 3N1MC 4X0NA 2ZXWB 2EDNA 2PF6A 4FQ2L 3TA3B 1CGTA 3V5KB 1NKRA 4Y9GA 4EBQL 2G5BB 1XBDA 2VCOA 4HK3N 5C7XH 2FO4B 4ZUTB 4XNAA 3C6EA 3T2NL 3AB0B 3TBSB 3SDAD 4HIEB 1KPVA 4NN7B 4MVBC 1KTJA 2GABA 4GOSA 4MAYC 4LLUA 1YYLL 4IU3B 2MKWA 4PRNA 3TNNB 1EJ6A 1MF2L 2PP9A 2GIXA 4W9IC 1VFAB 1JGLL 1OIOA 2AJXH 2OA9A 5HGDB 5A2IH 1K8IB 5BZDB 5LJYH 3S9DB 1AP2B 1URZA 1TJIH 4MCNA 3QUYD 3GI8H 2BCKB 4WTXA 1WQVT 3DETC 2Z35B 4R84A 1WWAX 1GOGA 1NPUA 1ORQA 3HBZA 3LN4B 4FMKA 4RGNC 1AKPA 3QA3B 3QWOA 5C0AB 3L9RB 3FFCA 3V8OA 3IDNB 1HESA 4K3GA 1KXQA 3MV7B 2CLVB 3V6BR 2K8MA 4H1LG 4FQ2H 5HVHB 3WIFB 2F5BL 1U3ZA 4F92B 3GBML 4KGLA 4EBQH 1I7UB 3X11A 4U1HA 1MG2C 1IV8A 2PPFA 2VSMB 2KH2B 4G2AA 4JY5L 4U6XB 1H15B 2HVKA 1W80A 3T2NH 4J3OH 4A7GF 2Z93A 3BO8A 2CO3A 5D4JA 5KVFH 4TUKL 2AVGA 2FCBA 1YYLH 1ZTMA 4LRIA 3VFGL 4KUCF 3VFOA 4G8IA 1UH4A 2QDWA 1JGLH 4I5BB 4NNYB 4OCSH 1OP5H 3OQ3B 4AIEA 3MRCA 4R3SB 3RWIA 25C8L 4FQLH 3H4FA 3QXAB 4BGLA 1KNOA 4ORGA 4Y5YB 1F3RB 5K59F 3LRSA 4PJEB 5FM5M 3B3IA 3BLBA 1AJ7L 5BQDA 4R96B 5HGAA 3SDXB 4APQD 5E6ID 2DLHA 3ZQ9A 3G6DL 2WMPA 5L2KD 1JPGA 4PW4A 1NLBL 2DWXA 2ICWI 3QQXA 4YDJA 3U2JA 3ARWA 4K07A 4ONGL 2F5BH 1KZYA 1VGEL 5ENWB 2K9UA 2ROYA 3BVVA 4XBMA 4ONOA 4JY5H 1GW6A 4HXBL 2FWLB 3FQNB 2DEWX 3HNSL 4PW3A 1A6AA 3T8XB 7FABH 4TUKH 3PDOB 1B0GB 4S1RH 2ISDA 1VENA 3B8SA 3VFGH 4HS8H 3EYUL 3IETB 1BVKB 3H7LA 2J56A 1VB9A 4KOCA 5LCVA 2ZPKL 4PJAB 1U3HA 2DQHL 3QDJE 3RL1A 4JCMA 4CSPA 3ASWA 2X9WA 1R4XA 5DCCA 1AJ7H 5CGMA 3T6WA 3TVMD 3DRTB 3V4UL 1H5BA 1P4BL 3NGBB 1BVLB 4OCRL 1T83A 1MCWW 3IN0A 5DT1L 2O93L 1CJYA 3A6OA 5C08B 1TO4A 3G6DH 5LG1A 4DKFL 1K6QL 1NLBH 1VGKA 4JPQA 1CDUA 2XCMC 3QIWA 2ICEA 4ONGH 4XWGL 1EAOA 2VISB 1VGEH 5DDHB 3X14A 4Y8AA 1QACA 4Y4KB 1OLZA 3OSVA 4HXBH 3HNSH 3G5YB 2N7BA 1PZUB 4GH7B 4LNRA 4P2RE 2QFRA 2HTLD 1UT2A 2GUOA 4J3TA 4G8EB 5I74C 1AMXA 3EYUH 2VDQL 3FQ2A 3NCYP 2CSPA 4KVPA 4YDNA 1G7QB 5AOIA 2L04A 3ZE2B 2JSFA 3RWHB 1ZWIB 2AZUA 3WUWB 2DICA 2ZPKH 3BEVA 5MENE 4BWUA 2DQHH 2PR9A 1QHOA 4FS0A 3ABGA 3MAWA 4A67A 1AYOA 2OMZA 3F7YA 3LKQA 2VJXA 1YVLA 2BP8A 4BFGA 3V4UH 2EEFA 5C0CB 4OCRH 2ICES 4HUNB 5T1KA 3DTXB 3QEUA 1S8DA 4DKFH 4XHQA 1L9NA 2NW2A 2YO3A 4XCCL 5BZWA 3MFFA 5B4MD 3V9FA 3ZZQA 4AGQA 4XWGH 4JRXB 4KKRA 4PGEA 3AW5A 3BZEA 1Q4NX 2I5YL 4NO3A 5SWSD 2WVVB 4RX4A 1FE8L 3KDMB 3WN5C 4AUYA 1NUNB 2HH0L 2X4NB 2JXMB 5SV4A 1UM4H 4TVPL 3JTTB 1AD9B 3CX5K 4IKNA 4J7RA 2O5ZL 2Q76B 4PJ8C 4F2FA 4NRYA 2VDQH 4D8PB 3CVDA 3U83A 2AJZA 5GZNA 4QHNB 1QI4A 1A14L 1DVQA 4M8UA 1ACXA 1HCFX 3QSKB 4KAQL 4O2CA 3UP6A 3O9WC 4ZFGH 1AR1D 1MVUB 4X9FA 1LL1A 4NO0D 3V0VA 3QQ4B 5IHBA 1QATA 2XIIA 2Y6TE 3GM8A 2BMKB 5HHOB 4POZD 1ETB1 4K94H 4XCCH 2F54A 3EJYC 1EO7A 1R5VB 2PPEA 2ZXEB 3FOMA 2Q9OA 5FW7A 2I5YH 4KRMB 1WWCA 3E2HC 1WZ1L 3DLQR 2Q2LA 3ELQA 3GPSA 4HFWA 4Y2OA 1BA9A 3X2QB 2XWJB 4QXUL 1I3UA 5EV7A 2XICA 2WLJA 1MXDA 4P23B 4XMXA 4TVPH 4WHDA 4AC4A 3IDGB 2EDDA 1MLBA 3KWVA 2VL5B 2IANA 3V0DA 2O5ZH 1FCGA 3AJ7A 4IYKA 2BINA 3JV5A 1BIHA 4QXVA 1RK1A 1ZLSL 5GGVL 2XN9E 3G5XA 1T1YB 1ORSA 2LABA 4KAQH 3QW9A 2N59A 1JCKA 1IJNA 2VR3A 1FP5A 2J8HA 2OL3A 4UOW1 3UYOD 2AANA 4PLJD 4MWFB 4HIJA 3P3TA 5FYKU 4A68A 2YS4A 2ERJB 2CK0L 2R2BA 5D72L 4HZAA 4DZBA 4Q58C 4E42A 3FQRB 3LXCA 5I1LB 4R2GD 5DVKA 1ETZA 1K4CB 4YBLB 4Y1SA 5GRYA 3TZVA 3TA3C 4BCYA 5KVGL 3QFJE 2M83A 1K3ZA 1BAGA 1K2DB 3VNYA 4HHGA 4F7TA 5DRNB 3MLPA 1JHTA 3AB0C 5I6LA 1J0IA 1N8OE 2ZE0A 4JFDE 1Q72L 1N4XL 1T66D 4QXUH 5EFIA 4LPYA 3DX1A 3OKKB 3TYGL 3OAYK 4NN7C 5C07A 5IY5B 5KSVA 3B4NA 3OMNB 3MNZA 1UD6A 3UAJC 5HJ3A 3EO1B 3SPVB 5MHSE 4JQVA 2F7QA 4ZS6C 2OXGA 4NQCE 5DS1A 3CPLA 1JZEA 2VDQB 5E00B 4Z6AT 4Y16A 4R4ND 3IFOB 4GW5B 5DVOA 1EJ8A 3I02A 4Z7WA 4PCTA 2YD8A 3J7HA 3MRGB 4G9FB 2J44A 3ARDA 5D72H 2AV1A 4C59B 5JYMA 3WKYA 5T3XL 1XF5A 1BZEA 3P0YL 1ZMYA 4Q6IB 2IH1B 3MRDB 2WW8A 3EGDA 4PJBF 5KVGH 4N0UE 1KSRA 1F1GA 5HVHC 4OT1L 2Z9TA 3ERXA 4JNXA 4NUGL 2CO6A 1NBQA 4IRSD 1JZ7A 3DKHA 1TNNA 4QRAA 1T3FB 4PMEA 4BWTA 5CNHA 2R2EB 5IMOB 4N4YB 4OVUA 5KVDE 1Q72H 3TYGH 4DVBB 4V2CB 3DV4A 2BNQE 1ZK9A 2BRQA 2MSPA 1EFQA 3BWAA 4LVOB 5HHPB 4FLRA 3UTZB 4AEIL 2ADYA 4OCWL 3GXMA 1QI5A 3BDBA 4LQ1A 2VXQA 1NGZA 4Y5YC 3MODL 3CFMA 3SPCA 4PSPA 1KIQB 3S3PA 2A6DB 4D9QE 2X4TB 1S9VB 3B2MA 4RGOL 3MJ6A 5PAZA 2H3NA 2HFTA 5E6YA 3TN0D 3WCYA 4WGKA 5T3XH 1HSBA 2LHAA 1UM5L 4KJWD 3HOGA 3NSXA 3RI5F 4F8NA 4OT1H 2WGNB 3P02A 4PVNA 1EZVX 3QR0A 4X0KB 2JQAA 4XZ4A 2ETWA 5B3SB 4MQ7A 1OP3K 4HEME 1OGTB 3CBRA 4XPBL 4U1KB 4HPHA 4KZDL 3VQMA 4PJ5A 2MOGA 2X0WA 3QEQD 4YVUA 2EIZA 2HPTA 1GHFH 3MRPA 2KDYA 4DF9A 3MV8D 4OZIA 1KV3A 3ORJA 4AEIH 1GXEA 5HPMA 4OCWH 4JQXA 2XX0A 5D6DC 1OGAB 3O3DB 5CS7A 3PWUB 3B56A 3OLGA 4L1SA 2YN5A 1UXWB 4Z7VE 4G6FB 3SIKA 3ZGHA 3MODH 1E43A 3NEEA 3S35X 1FL3B 2HX9A 3VFMA 3F7VB 3HLAA 1AXSA 3AXLB 1IEAA 2ZTBA 3FTSA 2AABL 3BVXA 1KBGL 3QUHA 2WM0A 4RGOH 3NGBC 3TBCA 2Y69B 3BUIA 1YA5A 4LDLB 4G8AC 1F41A 1UM5H 1YJDH 2BNUB 2YAPA 4LOEA 5EZLA 1ZOXA 1IAMA 4HJJL 4PV9A 4OCNC 1DJHA 1EZSA 5AAPA 3FQ4A 1IKFL 4ZW3A 1AO7A 2VLLA 3O6KL 4Y4KC 5BCAA 4GI8A 1Y6MR 3WXWH 2GTQA 1U21A 4XPBH 3VXUB 4KZDH 1ES0B 4F27A 3WO4B 3H9SD 4E9TA 4KKNA 3NA9L 5ISZB 4J3OC 2X4QA 3IXAB 4G6ML 5EEUA 3D0VB 2JQMA 3TO2A 5ICXA 2AK4B 3CN0A 3U1SL 5IQ9B 5F1KC 3PHQB 5KS9F 5I6KA 3TFBA 3D3VE 4J8RB 4U1IA 4BH7B 4Q9CA 1DDHA 5EB9A 2M26A 4N6RA 3SOTA 1SVZA 2ICWA 2BP5M 1KBGH 3JVFC 5EIIB 3EOBA 2H3KA 2Z92A 1DCLA 5CJXA 3PDDA 1JXGA 4HJJH 1RVFH 2EEXA 1A4AA 1XQ4A 3O6KH 4XBPA 2X70B 2QTVA 1O5DT 2H41A 4Z23A 2KQNA 2VO8A 3PWPB 2EIDA 3UPCA 3FTUA 4GRLB 3VDAA 5BOZG 4L5FL 1G7IA 1ICTA 3JTSA 2QT6A 5I5IA 1Q9OB 3K74B 3NA9H 3ZUNC 4DJMA 5FUZL 5DURB 1P84K 3P9LB 2O6PA 2ZKXA 4FMVA 4G6MH 1OAZL 4JG5A 3V0EA 4C4KT 1KCUL 2EVHA 2Y7MA 3ULSA 4ONFL 4N1HB 2F0CA 3UAFA 4NKMB 1ILUA 2DS4A 3U1SH 4WO4D 3ZO0A 1MREH 4PJDB 5HVFB 5D6CB 3FAXA 4M62L 3FQUA 4W9FC 1JP5A 4UUJA 3Q5OA 4G72B 5I66A 4JM2A 5MEQB 4F80A 1NFDA 5KYYA 4G42B 1FFQA 3BIBX 4Q14A 3ILDA 1JIBA 5A16A 2IQAB 1LMIA 2BOLA 2NZ9C 1BEYL 2ADGB 4PGDA 2NY1B 4JHVA 1AFVL 5I1CL 4L5FH 2WZPD 3B9AA 4P23C 4WW2F 5AENA 4B9CA 2BS71 2X4OB 1HX0A 1A6WL 2WAHA 2F19L 1KCUH 3BUQA 5F8QC 1CDJA 1J86A 2X4SA 2FNWA 4MB4A 1BJ1J 4EUPH 4PI2A 1USZA 4L29B 4BXVA 3QUZD 1GGBH 1JI1A 3MRKB 4JY4B 4CU8A 1CD1A 1F2QA 2R23B 3FT1A 1VEPA 2HA1A 2FGWL 5KYUB 1S78D 4M62H 2ERJC 1CLOL 1RIUL 4QKTA 4PJ7A 2KKQA 2WXGA 5KYNA 1V7MH 1CFQA 1AOHA 2UVEA 4L8DB 3UBXG 2DY2A 2Q3AA 4RFEB 5E1AB 2NNFA 3V5HB 5SWQB 3LRHA 4LCIL 1JTOA 3FT3B 3O3AA 3V95A 4YBLC 4EI5A 2YA1A 2FYYA 2LLGA 2DL2A 2WY3B 5IQ7L 3MX0A 4QT5A 3HNVL 4NRXA 2X3BA 2FVNA 5D4HA 3DO4A 1BEYH 4HKXA 5GS0H 4P0DA 1AFVH 2F8IA 4QRQA 3RDTA 5I1CH 1IGTB 5LGYA 5DJ2B 1U8PA 5FYJE 4X6EB 3G9VA 1T7ZA 1A6WH 2XWTB 2F19H 1BZ9B 1SUHA 3IFNL 1T7XA 4L4TD 5HDBE 3WNJA 5BS0D 4Y1AD 2A6JA 5JLZA 4JE4B 3K6SB 2XIDA 3LYRA 2RA1A 3CZFA 5AW0B 2WYHA 5HI5C 4DP7X 3TFKD 4M4RB 3IF1A 1XCTB 2FGWH 4MRCA 4NQDA 5FW6A 1CLOH 1RIUH 2OMNA 3QUXA 4MNHA 4JR9L 5BMFL 5JPNB 2R2HB 4L4VD 2VRKA 1AACA 3C8KB 3DBXA 1UVQB 2BLFA 3GS0A 1FO0L 5I1IL 5I15L 1UD5A 3IBOA 1M9WA 3NSDA 4Q6IC 3GDCA 5LWYL 1NDMB 4YNYA 1M71A 5IQ7H 4H25B 1FYTB 1MIML 1NZRA 3IRPX 4Y8DC 2BW4A 3HNVH 4M1DH 2GBAA 1B2WL 4Y9FA 1BHGA 1OWWA 1X5KA 5CP7A 4ZX5A 3F62A 3PCYA 1JTPA 2Y1ZA 5CP3H 5E8OB 3Q05A 1DVSA 1WUNT 4NQED 1KJ2A 2GITA 1V55B 3B1UA 4HUCA 4LVOC 3UABA 3MLTB 3IFNH 2WSPA 4P46D 3UZEA 1P2CA 4DKDC 1IC4H 2FEDD 1N10A 2ZWKA 5B38A 1CFVL 2ITDA 1PFCA 3VYOA 5JW5B 4EUPB 4PH8A 5FYKL 4FQXA 5BMFH 3DXAD 2YLKA 5H37H 1NUGA 2HB0A 2IDSA 4U6VL 5PCYA 4E5XG 2GJ6D 5I1IH 3A4AA 2ZYHA 1MAKA 3PWVA 3J2PA 2P5WE 5KANG 4N0YL 4E36A 1MIMH 2ARWA 4KNTA 4F57L 4MD4B 1B2WH 2IMNA 4I0PD 5E51A 5EUOA 4HCRA 4I9WE 4FHKA 2OJEA 1LO5A 4ELDA 3U6RB 5JZ7D 3ZQWA 3O4OB 4OIIH 2E9JA 2H3XC 3FZUD 3D4CA 5AAWC 1CTOA 4N2HA 2YAHA 3T6XA 1KZQA 3WJMA 1JNJA 5DK0B 5ADPH 3B2XA 3T3MF 1S7VB 5DZVA 2JF1A 1RKRA 3H3BC 3ESPA 5CLZA 1F11A 2HG5A 5FYKH 1JHKL 3E7JA 4U6VH 4KXAA 1GTFA 4OM0L 4FJZA 4R90H 2P9RA 3B34A 4FLQA 4N0YH 1JDDA 1OD9A 1PMYA 2HFGL 3IM1A 1S46A 1AMYA 4G43B 5DU7A 4F57H 5KSBB 2LW3A 2WVUA 1MLCA 3B6SA 3D08A 4TQPA 3WO4C 3L3GA 4HBQA 3VFWB 5JHLL 3IS1X 2V2TA 5LGKA 4TUUA 5F1IB 2C9XA 2BSSA 1PZ2A 1TJXA 3MLYL 3STZA 3F6JA 1DYZA 4OTXL 2XI9A 1C5DA 1G6VK 5EULV 3UTTB 3HPJA 5IW6A 4OZHB 3L3HB 4UDTA 4WGWB 1ZHBA 1JHKH 3LSOB 1HWHB 4WHCA 3V52L 4JKPL 4PP2B 4H5SB 4U1NA 4X98B 2AGJL 2GTZA 3RVXC 4OM0H 2GT9A 2CA3A 2JKTM 2PUQT 5T5NG 1I53A 4X4YB 1FO0B 2HFGH 2HLEB 2Y23A 3FB8B 1HSAB 4PB0L 1CD8A 3ARBB 4GBXA 2ZP9A 4XHJC 4ZW5A 4ZPVB 3CIQA 3MNVB 3QG6B 2VYRE 4GRLC 4DP2X 4E9QA 5GZOA 3T0EA 1I7RB 1XB6A 5L4FA 2VLMD 5AW3B 4ABWA 5JHLH 4B3EA 2O1AA 3ZVVA 3D2UA 2P8PA 1YLBB 1KN2L 3MLYH 4Y2DA 4F24A 5GJTL 4OTXH 1AHKA 3MROB 1C1EL 3FHAA 3QIUB 4G8FA 2DWDB 4P5KB 2PO6D 4XO8A 3FUHA 4NIYE 1Y7VA 3BAWA 3BH8B 4MJ6A 3V52H 4JKPH 4JRYB 4H2AA 1DEEA 5CIPH 3GMPA 3MMEA 5HD8C 3FSOA 4F5CE 1A4CA 3G04A 2E9WA 4M5SA 4PB0H 4JZJB 1HHKA 3RWJB 3NTCL 5CHNB 4P9ML 1TF4A 5GS2H 3HAEA 1LILA 1I7ZA 2OI9B 3S37L 2OPCA 2NY1C 4IHBA 4AYEC 3LKNA 1P7QB 4HJSA 4R4BA 4M6NL 1OLLA 2VLJA 3AITA 3GMLB 5EOCL 4M3JA 5J0BA 1RK0B 3FQWB 2DKMA 5HYJE 5FWRA 5KVEE 1MY5A 3RL2B 1VKXB 1KN2H 4TNEA 1VFUA 3VFSA 4R0LB 5GJTH 1G1YA 5K9KB 2NTSP 1C1EH 4YDVA 5FKAA 1E4KC 1R5WA 3HG0A 4PEEA 4DO5A 3BSZA 3QJXA 5IQLA 2IAMB 4RAHA 1DUZA 4HC1L 1FNGB 5DVNA 1XEDA 2Q7YA 3CLFL 5EUKA 5C0BE 3RUGA 3ZTJG 4EDXA 3LNEA 1G6RL 5I75B 3V7AG 4S0TD 3T77A 2NXYD 4QEGA 2K1MA 1QLFA 2A6IA 1KBKA 3MU3A 1JZDC 3NTCH 1P4UA 4P9MH 3MOBH 5I0DA 1L6XA 3S37H 1I1AA 1AH1A 2YEZB 1VIWA 3MJ7B 5J13B 2C1PB 1OK8A 1S9YA 3ZZLA 4X9HA 5LAXA 4BXSV 5EOCH 2C9QA 3WHE0 4NNXA 1YMMA 5DUBA 3NESA 4Y5VB 3AT9A 3BMWA 5C0ND 4F93B 1QKZL 1EZUA 1QSEA 3VI4E 2D03L 4M4PA 3OGCB 1NC4A 3FAWA 2PYFB 2V9RA 1QMUA 3CLFH 3EBAA 5JPNC 5HHVL 5K5YA 1DUYB 2Z4QB 3Q1EA 5AW9B 3MGTB 4H26A 4UNUA 1G6RH 1IL1A 2VM3A 5DQJB 4C56D 2V7HB 5EN3A 2E86A 1L3WA 5F0LB 5FGCE 4MKTA 1NCHA 2H6UA 1A6PA 3NVQA 5CIPB 1JI2A 4MJIE 2QR0A 2XA3A 3A67L 1KDJA 4X6FB 2CCLA 4QO1B 4HIHB 4L3CB 3L6FA 1NLDL 4NQVA 1XBRA 1LP9A 3UDWC 4AKPA 3PXLA 4LPVA 3UBXI 3FRPB 3GPEA 4PJXB 5JA8B 1B3JA 1TQVA 2YSTA 2QFPA 3W9EA 3MI6A 3NZ8B 3QPQC 3W3BA 3T08A 4P4RB 1N18A 1DN0B 2JKRM 1QKZH 3WTXA 2AJUH 2NUPA 2D03H 1BQRA 1PYWB 5TDOA 2MPAL 1JD9A 4AMWA 1AGDA 3NIDF 3M1CA 5HHVH 5E03A 4TTDD 4DQAA 2YA0A 5C9JB 35C8H 5DLML 2UZPA 3GSWA 4QD2E 4RZKA 5AD0A 3QR2A 1OWRM 3EF7A 1NC2B 2RGSA 4NENA 5CN1A 1F2XK 3VQ1C 2VZ1A 5D5MB 3KXFB 4PBDA 2YGVA 1WZKA 2BS8A 2WSKA 4FTVB 4FXTA 1HILA 4JB9H 4X9IA 4W93A 3FTVA 3KPOB 4JPKL 1X7QA 2GC7C 2CMRH 2WVTA 3NCEB 5T5FA 1ZLVH 2R69H 1NLDH 4OUOA 5CJBA 1OXYA 2Y1VA 4AK1A 4QHUB 4X8CA 5H8DA 2OTPA 3O4OC 5C0FA 3FFCE 3NN8B 4GMTL 1KXQE 3FH7A 4R7DA 4X6CA 1KB3A 3N0PB 1N5AA 1PPIA 1J0YA 4N0RA 2OCFD 3O6FA 1ZLWK 4HXAL 4GLRI 5T1JA 1F0LA 3VRLF 4NCC2 2TRHA 3BQUD 3QZPA 3ZE0F 3WU1A 2YK1L 2ATKA 4O02A 5ABAA 1SXCA 5DLMH 3L3OA 2W0FB 3TL5A 3V2AR 1B4RA 1LD9A 1S6NA 3ATEA 4OV6F 4HWEL 4JRWA 3X3FL 1QBML 2P80D 3DBSA 1T2JA 1G6RB 2XKSA 4MMZA 4EKXA 1VF5C 5DSCA 4JPKH 1YNTA 4GP8B 3FU0A 2FIKA 2DZEA 1FVDA 1CFTB 4WUKH 1TG8A 1UCTA 3STLA 3CHOA 3JV4B 4HGWA 1FZJB 4GMTH 4LVEA 2YOAA 5FEBA 5KANI 2H26B 5J1TC 4JN1L 1S5HA 4XVOA 4YZWA 1XGZA 4HXAH 3L7EB 1L0PA 3IGAB 2ZX5A 2JB5L 5I0WA 3RY6C 2MNWA 1FV1B 3K5RA 5IMKA 4I18A 2GAZA 4YGVB 4UNIA 3RJOA 1VZHA 5TE7L 2RMNA 1WUZA 3X3FH 4HWEH 3ARED 3WTSA 1IIIA 1QBMH 3RVTD 4W9LC 3G6JA 3CCHA 4ZX6A 1P5UB 1F4WL 2WINA 5FA3A 3WD5L 5EU3B 3ARBC 3C9NB 4EVNA 1IFGA 2F53B 1HXMB 1U95B 4W6XB 3DYOA 3L4ZA 3MBWB 2JWYA 3KYKL 1H8NA 1ZT4A 2XKUA 1SLWA 3CXDL 4MMXA 3PS6A 4PJIB 5EIIG 5E5RB 3NRFA 5EZJB 2HWZL 4KKZA 1W16A 4ORZC 4NB7A 3ARFA 5BRZA 2M8XA 3ULUF 3TT3L 3D85B 4RMTA 1TTBA 4JN1H 4DPBX 4NDMB 2YUXA 4JM4L 4UYQA 3L4TA 1B0IA 2NQ3A 1FQ9C 4XCEA 3QIUC 5IGXH 5GSRA 5EWIL 4CC0A 3VD7A 2JB5H 2G30A 1F4YL 1PG7L 2X4UB 5AZUA 5M94B 1H3GA 4BBWA 2BP3A 1JMZA 3DOIA 5TE7H 1UA6L 4MJ2A 3ZDWA 3TIDA 1IAOB 1KGCE 3T3PB 4P48A 3TNMB 4AIXA 1ZVSB 5HYSB 1QEWB 2ZNWA 4K8RD 4JZJC 4WEBL 1F4WH 4YHMH 1JN6A 3WD5H 4KX7A 1XGTA 1EAPB 4YSPA 2OI9C 4LPXA 1RFDL 3WENA 3KYKH 3Q9PA 4FXKB 1MHCA 1UXMA 4RMSA 3CXDH 3UBGA 3K91A 4P04A 5D1QD 2HWZH 3O45B 3GFUA 3G6AB 5AYUL 3TT3H 1GH7A 2NNAB 2BH0A 4YH6A 4KXDA 4R0LC 5KBKA 4JM4H 2IQ9L 1TPXB 3GK8L 1FFOB 5C0EB 5EWIH 2IAMC 4O58L 3U0PA 1O6TA 1F4YH 2W07B 1KWGA 4IDJL 1MFAL 2APXA 3PWJB 3P9MB 4CVXB 4MYWB 1UA6H 2RR3A 5J8OA 5E6ZA 1IAKB 1HCYA 2B16A 4X5PA 1QFHA 3C5JA 1H6UA 1OF2B 2ED7A 4HS6A 1U8JA 5F7UA 4AEHH 2Y7QB 3FRUA 4HIPA 4WEBH 2F7RA 2BNRA 4AQ8C 1ZHLB 2UWEE 4UOZA 2Y22A 3Q48A 3KBFA 5EO9A 3EXJA 1RFDH 4OZGA 5CLWA 2ZZUT 1NBCA 3WMQA 2DIAA 5J13C 3IVKB 2P8LA 5E2VL 2A9MH 1QO3B 4NP4L 4GG6E 3S5LB 3PV7A 3JZ7A 1KTCA 1E3XA 3PGDB 2F54E 5DS8B 2Y5TA 5AYUH 3SKMB 4Y5VC 1FNAA 3RGVD 4AJWA 4ODXB 2IQ9H 3GK8H 5I8KH 1XIWD 3RWGB 2AKRA 2B3IA 1QW8A 4LHUB 3EYVB 4O58H 4R7NA 5D7JB 5FYLE 4IDJH 3FNKA 1SJMA 2AJVL 3OXSA 2ED9A 2X6CA 1MFAH 4GRWE 5E99H 5GS1B 3PABB 2GTWA 2NY3B 4LOUD 1BCIA 1OL0A 2JNZA 2R59A 4P4KD 5DZ9A 5DA4A 5I1AB 2OSWA 3B2UD 1ZHKB 5F7HA 5JHBA 1ED3A 2R15A 2XC8A 4JFPA 1U8MA 1OHZA 1YY9D 1BGXL 1EXHA 3PQYB 3QHTC 3GSOA 2DTML 3FB5A 3N40P 3DGGB 1N5YL 3ECQA 1IC1A 1WSST 5DHVA 5E2VH 1X5AA 3E6FB 4NP4H 1M05A 1UG9A 1FC1A 2FWSA 5FGRA 2K0RA 4JRLA 4JG0L 4AQOA 3LS5H 1OTSD 5F97E 2QL1A 3BUPA 1FPTH 1NANH 4IDLA 5HGBB 4EIBA 5D1ZD 2SODB 2DMBA 2AJVH 2MOVA 3Q3GB 5CFHA 4LQFL 2VQ1A 2PTUA 4Q2ZA 4QHPA 1ET8A 3S98A 1KC5H 4FNRA 3BP7A 3GSXB 3U9PL 2K4WA 4XXCA 3UCQA 2AJ3A 1U93A 1MCLA 1TETL 1A9BA 9CGTA 2XY2A 5DJZB 1CIDA 4XP9L 4BRJA 1LO2H 3CTTA 1U3NA 1BGXH 1E9OB 4Y5XA 2DTMH 4Z7WE 5IB5B 3UAAA 1N5YH 1EHLL 4B50A 7CGTA 3EYFA 2Y7SA 3LHPL 4KVCL 3PJSB 3SBRA 2VDNL 1LXMA 1XGPB 3KHQA 4IGBB 2DI9A 5HSFA 1RUML 2AQ3A 2ZUQB 4U1LA 2NX5D 3P77A 4MVBD 2YXMA 3ELAT 3I74A 4N2IA 4RIRA 4JG0H 3LD8B 5ITFA 2W0LA 1PZAA 1U8CB 3HEIB 5IUSA 2WXOA 1UT9A 2Y7NA 4GRWF 5IZ7A 4L0ZA 3T09A 4RMWA 3OJDA 1BX2B 2JLPA 5FECB 3CV5A 3OX8A 4UQIM 4PD4J 4YEFA 1AHWB 1TYJA 1FH5L 4Y4FA 1YEJH 3VD0A 5IFJB 3DETD 5E95B 4UWQB 2MCAA 4RGND 3U9PH 1TTRA 5ESAB 1NGWB 2E7LC 2A9DA 3CX2A 4FF9A 1OHQA 2FTAA 3IDMB 2AJYH 3UBXA 4J39A 5ETUA 2FT6A 1T20B 2E4TA 3K5SA 1EHLH 1GMEA 1WYJA 5IB2B 2ZOKA 2LVEA 3LHPH 4KVCH 3U4EA 5CGTA 4G9DB 3MCKB 2VDNH 3I9AA 2HN7B 4H44C 1JGIA 2R0KL 3NUKA 1RUMH 5DJ6B 5JYLA 3KPRD 1MNNA 1AQDB 1SLUA 1T5WA 4MD5A 4JANB 2XQ0A 5AG8A 1N0LA 5FGBC 5I8CB 4WK4B 4IBQA 1UKSA 4IRJA 4RFOL 4PTTB 1I1RA 4XX1E 1AANA 3MYJA 2OBGA 1FH5H 1AGCA 2IPUG 5EU4B 2Q6WA 1EUTA 5CXPA 4OZIE 1EVTC 1X6LA 2AK1L 2NY7L 3U0TA 4KHXL 4ELMA 1PCXA 5C8JA 5I1EL 4HUXB 1OT4A 2X1WL 4IRZL 3T2LA 3GSNA 4Y89A 5B3JE 3QS3A 1P5UC 3QDGD 4UU9B 1PSKL 3MLUH 1P7KB 3WDIA 5IB4B 1FVEA 4AQ1A 2V4LA 2VLRA 2BHUA 3X12B 3U36B 5K9QG 4JG1H 3DI3B 2MHAB 1JPFB 5DRXA 1R3HA 3OXRA 2R0KH 3TBBA 2W9DH 4NQEE 2MTPA 3C60B 4IIZA 5H37G 3HMXA 5DO8A 4LP8A 1LEKA 2D7MA 5I8EA 1WBZA 3NCBB 3QDJB 4BJLA 4FFZL 4D9RE 4YN3A 3VFNA 2W80C 4RFOH 5IJVA 3OAZK 1KENL 1ANUA 1Z9PA 2G5RA 3PXHA 3T0WA 2V6HA 1HCVA 1FYHB 4OLVL 5EC1A 2AK1H 2NY7H 3RIKA 3V6ZB 1TCRB 1Z5LA 4KHXH 3DDGA 4WEUD 1SMOA 2G5UA 5KSUB 1AGEA 1A1NA 1IGML 1S3KL 3KYMB 4IRZH 4HJGB 5DF0A 4X7DC 1UJ3A 3FF8A 1D9KB 1BWWA 4DUVA 5JQ6L 2WKOF 1PSKH 2ESVA 3B8YA 4H7VA 2L7EA 1XV8A 1RMFL 3IE9A 4P2RB 2X88A 4FXKC 3W0WD 4XTRC 3HZKB 2KS0A 3GDBA 3NRPA 5D7LD 1PLGL 5J6GA 4GEIA 4CSTA 1A21A 3F7LA 2VDNB 4NGHH 5AVSB 3HZVA 4HJUA 5MENB 3G3LA 1TPXC 5C09D 4JN2B 1REIA 3PDGA 1M3JA 4FFZH 4ZJ9A 3ABKB 3SE4C 2H45A 1CF8L 1ZT7B 4KQ0A 4G82A 1EA9C 2E0PA 3NZHL 4KQ3H 2XHNA 1KENH 2V5TA 1MFDL 4NKOB 4ERSL 4AENB 1H0DA 4B7LA 4NUQA 3FCTA 1CQYA 1A1OA 2D7TH 4OLVH 2YC1A 3EBHA 3OKMA 4JO3L 2X2IA 5L88L 7PAZA 4QOKA 1IGMH 1S3KH 5KVDL 2L7QA 3GXNA 5JQ6H 2EIBA 2XVBA 1FCCA 3JV6B 2CGZA 3CH1B 3P2DA 5IWLC 1OOAA 4KROB 4JCLA 4JPVH 1RJZA 4UTBL 3I6GA 1RMFH 5KUMA 3RNKA 4RAVA 3SKOB 3RFZB 2RTTA 1JHLL 3BIAX 1PX4A 3RPIB 4ZFOL 1PLGH 4P5RA 2EDJA 3REWB 3KPNA 1CLZL 1RZ7L 1TITA 4GQRA 4ODWA 1D5IL 1T0NB 2LTQB 4PJ8D 3SDDA 4L3FA 2ADFL 1CUOA 2ZUUA 3H0TB 2YPLD 5FDWA 5D7IA 3NCWA 5D7JC 3NZHH 1W15A 3E3QC 2LV4A 3SBWA 4QRTB 3O9WD 5GS1C 4ERSH 3VH8B 4DGIL 1BIIB 4FDWA 3ZYZA 2NY3C 1THCA 1IM9D 4G7SB 5EBLA 3QO1A 4GUOA 3OAYH 4R8WL 3FKUS 3SYOA 4HOZA 1G9NH 3UADA 3L16A 4FNLL 5KVDH 2QPDB 2EO9A 5L2JB 1IZJA 3G5ZB 3EJYD 3V4PL 1QTYT 12E8L 1YUHB 4UTBH 4WI6A 4CVZB 4DH2A 2UXGA 4AE1A 1ASQA 3RWCA 1JHLH 4PJ7E 2CO7B 4WFHD 4CADB 3ZL1A 2WJ5A 4K23L 4ZYKB 3EJTA 3KPSB 3SPIA 1HXYB 2HKFL 4NYLB 3L3IA 1CLZH 1RZ7H 2XN9B 3P3YA 1D5IH 2BZDA 2BVUA 2FQFA 4WI0B 2X1XR 2ADFH 2ENSA 4U1GB 5IOPA 1BBDH 1JF1A 1XGYL 1FFTB 1U33A 3ARSA 3O6ML 4RDBA 3BW9B 5F3FA 5AW2B 4OQTL 1QR1A 1X7TA 4X6DE 4DGIH 2XWDA 3FRPG 4R8WH 1R3JB 3QZLA 6CGTA 2ZXCA 1TVHB 4FNLH 3ISRA 3QFJB 4NFCA 1Z2KA 5CMAA 2W88A 4EN3A 1R3KB 1E4HA 1TQBB 4PIBA 4ADIA 3CWGA 4ZXBB 12E8H 3K4DA 2DIJA 3KYOB 4LU5L 5AAMA 1BBJA 3TA3D 3A6BL 1X5JA 4JFDB 3GQFA 1NFDF 4JM2F 2CR6A 2UY6A 4NQDE 4UV4L 3RWDA 3BUYB 1KJVA 2G60L 1QHQA 4A38A 3BZFB 5IVXA 4IGBC 4K23H 1S7SA 4M43L 2HKFH 2WCPA 3DV6A 4WTZA 5G5DB 5EOTA 3TIEA 3LD8C 4HH9A 2ODIA 4NQCB 1UKTA 3IXTA 4PRIA 3UAJD 3L3KA 3K2IA 4N22A 5E6RB 2A83A 1I1YB 4DP8X 1XGYH 4ZNCD 4ZS6D 3O6MH 2ZKYA 3DURA 1G9ML 1IZKA 4QXTB 1AHWC 2D9QB 4OQTH 5IJBC 4HSQA 4NZTL 4AZ8A 3UTQB 2ZCLL 1XD1A 1EFXB 1QD0A 1CVRA 4NZJA 3VTMA 3O11B 1Z3RA 1PL3A 1ZA6B 2A9AA 2WAQA 3GGWB 1TOXA 4YHNA 5C0AD 2X9XA 3K0WA 3EYSL 3GBLA 4EO5A 1VACB 4KKAC 3QUML 3VWKA 3KL5A 1OGSA 2AEIT 3P54A 4UZGA 2IPKB 3FTXA 5DYOA 1JYXA 2PW2B 4LU5H 1DLHA 3A6BH 1ACCA 1DVTA 4TN9A 2BNQB 2YARA 4Q74A 3T4YA 2G60H 2BVOB 4U1MA 3M7OA 3B9EA 3VFPB 5CJQH 1JOIA 4M43H 3FT4B 5B22A 5E8EB 5ITBL 2V37A 3SGJA 1JPEA 2FNBA 1KF9B 3SD2A 5FOBB 4ZFOB 1MWOA 5FC9A 4JLRB 1JZFA 4YSEA 1AZUA 3VYPA 3GHBL 1G9MH 2EKSA 1LLAA 4PR5A 2A7BA 3KG5A 2ZCLH 4NKIH 4LOVA 3WNLA 5KOMC 5BW7A 3ZDXE 3NOIA 5A2BA 2XKNA 5JW4R 3QO0B 3EYSH 5GIRB 3Q43A 4C56E 2WZ0A 3QUMH 1BFTA 5D7KD 5BVPL 2YGNA 1OM9A 2A4CA 3MR9B 2OZ4L 1S7QA 5A6MA 2X9YA 4JJHA 4ABVA 1K4DA 3P69A 2P8MA 3C60C 4APXA 5ITBH 2E4FA 4RWYL 4MZRA 4E0RA 1E9QA 4Z76B 4P2YA 4KJPC 3WL9A 4Z7VB 3Q2WA 1KFGA 3GHBH 4Z77A 2K78A 3FN0L 4G5ZH 4PRAA 5T1LA 2EUXA 5DMJB 4RBPK 4Q9RL 1ZT1B 3HC4L 3UCRA 1RIHH 1ZS8B 1XZWA 1MFCL 3SE3A 1MJJB 2AQRA 3JSSA 5LHDA 1XSIA 4HWUA 3VGAB 1FG2A 3OKOA 4S1QL 3ZE1E 4LFHG 4WO4A 5C08D 1ZLUK 2JKLA 3U7WH 1D9KC 1VADB 1TSRA 5FYJL 1E42A 2XWRA 4HAKA 5BVPH 3K46A 2N3JA 1WT5C 4AQZA 3OR7A 5FK9A 4XMLL 4Y4KD 2Q8AL 6PAZA 3WKQA 1JTTA 1ERNA 2YBRB 4PGCB 3DROA 2PTTA 4F7MB 3FUFA 4X5QA 3DVNA 4RWYH 3S4SG 3VXNA 5EUOF 1Z6JT 1OCRB 5DEZA 4EOWL 1VFBA 3GC3A 1T0OA 3D3VB 4EI0A 5K9QI 1M53A 1MCWM 1DVZA 4G1EB 4QYOA 1GIGL 2R1XA 5KJ4A 3LV3A 3T0EE 4ZUUB 3N85L 4Q9RH 4Z5RB 5E2WL 2FZ3A 3BGMA 1MFCH 3JWOL 4GKLA 2J7LA 5C0CD 1ND0B 3DJRA 4IS6B 3M1OA 4F37K 5AB1A 2OJZL 3RWEB 1A8ZA 4FQ1H 5FYJH 4RAUA 5AL8A 2X0VA 4JRXD 1IKNC 1G1OA 4KROC 2WQWA 3FPXA 4PM1A 3RFZC 4DP0X 3QUMB 4XMLH 4JZOA 4ANUA 2HJLB 1J18A 2Q8AH 4L1TA 3LKSA 1A47A 3ESVF 5I16A 3TYFB 1G7JA 3TESA 3V0GA 5FFGA 2KLRA 3BJLA 2G2PA 4P3WA 1WRFA 4JDEB 4GPVA 2LTQC 3C87A 2DLTA 3ISYA 1DDTA 4EOWH 5DZPA 1IC5L 5EPMA 4PIRF 5DYFA 3S34L 3KLHC 1OTUC 4FFWC 3VXME 1TEYA 4NQSA 1WS7A 4BZ1A 3DTDA 2I24N 1CWVA 4UQAA 5EZPA 5CEYB 3DSNB 4XE0A 5E2WH 1A2YA 3V0AC 4FXGB 3PHOB 3JWOH 3VXSA 4LF3A 3P4NB 4M6OL 5EORL 1JGEA 5HHOD 2OJZH 2NLJA 3V6OE 4R97B 3TBVB 3D69A 1FGNL 1B9KA 4TSBL 2XU9A 3KLKA 4ATTA 4DW2L 5J57B 5D7HA 2NZ9D 1W9XA 2VE6A 2BIPA 4FMFA 4BHUA 2HLAA 3DUHA 4ESKA 4P23D 1JNLL 3GBNH 4JFQA 4OCMC 4JHWL 4L0YA 3LRKA 2WANA 1IC5H 3H2PA 1KY6A 2C7FA 5LBSL 4U1GC 3S34H 4LHUG 5IW1B 4ZQKA 2EC8A 3DPBB 3ROOB 3NSFA 2Y4SA 3AWFA 3T2QA 1EEUA 1H8SA 3FBQA 3SBQA 1T80A 1EXUB 2YSSA 2P26A 3OJMB 5LNDA 4M6OH 5DEJA 5EORH 1U8KA 1AE6H 1CC3A 1L5GB 2J12B 1TQBC 2FSDA 1QSEE 3CVHA 4ZXBC 4DGWC 1S5IL 4YDKL 2DW5A 5DFWH 3SCMA 4CMMA 4TSBH 3A21A 2QELA 3DXAA 2MPVA 4DW2H 3W56A 4TNVK 3AM8A 5EO0A 3NG5A 1ACYL 1SYVB 2IBZY 4M7LT 5TD4A 3SJVA 3VD3A 1MCPL 2L4OA 3ZZSA 3FBKA 5EU6A 3GIVB 3L3JB 1JNLH 2IIJA 4J6RL 4K7PY 5HDBB 1E2VA 3DMMA 5MI0B 3DIVA 4JHWH 1D5XB 5E1IA 3I6KB 4WUUA 4LLVA 5LBSH 2H0FA 2XWZA 3ZYIA 2C34A 1WFTA 1XCWA 4G80A 2BVPA 5B1BB 1W0YT 4I1RA 5HYQA 5HI5D 4RMRA 5AUMA 4ZK8A 5KEZA 5DFTA 3BWSA 2C7UA 3SGDH 4PLKD 4WWKD 4E9WA 1Z7JA 3MLWL 4PRHD 3ARQA 1G9NC 4KDTA 3RUGF 3ZKXB 4LIQE 5DK2A 5CBEA 4UQEA 1M7IB 1N3NB 1WD9A 2APTA 3I3DA 1I8LA 2E6JA 1XR8A 2QGDA 4JFHD 1QWUA 1ACYH 1DE4A 1MCPH 4K3JL 5FR3A 3KM2A 4TL5A 4IOIA 1B6DA 4PV8B 4KKLD 5AVYB 2UZYA 5D2LE 3MRMA 4KY1L 4DEPB 5IQNA 3VXOB 3CBKB 4X8XA 2HTKC 3IBEA 4TVPD 1WISA 1A4BA 2E46A 2VUKA 3DX9B 3GZPA 3WJJA 2G75A 2C3GA 4LSVL 1B90A 2B59A 4LLQA 1LE5B 3MOQA 2DTSA 1MFBH 4RMBA 2YQBA 2RFXB 1WITA 4X6CE 5BRPA 2P5WB 2OYMA 3QHZL 1AYRA 1J0ZA 3IGUA 1ZIAA 1QLRB 4ZSOA 5JORB 3CLWA 3US9A 3MLWH 3WIAA 2FJGA 3MJ9L 3RFRA 2K70A 2V2XB 2HRHA 4WVRA 4JO5A 4PJ9B 3UYRL 2Q7AA 2YRBA 3SDCA 2V5MA 1S7XB 3QFDA 4E41D 5KVEL 2YFOA 2B8OT 3KYAA 4UYPA 4I3RL 4XI5C 4DO6A 4K3JH 3RPBA 3KPQB 5IBUB 3FUEA 2EVIA 3L7FB 4KY1H 5E94A 3HS0A 3UEQA 4NBZB 1K5NA 4TQIA 4YSDA 4LLWA 1OGAD 3R7RA 1AQ8A 4FJYA 1TYEB 2EDHA 3L5WB 1LP9F 5K39A 4D9LL 1AIFA 3FB6B 3D50A 4ISVB 5HVGB 2QLVB 1PIGA 2HAZA 5L4MA 3EFFA 4G6FD 4X4KA 3MBEA 4JX0A 1IM3A 1KDIA 5BRQA 3QHZH 3EJZC 3VGAC 3H9ZA 4RRPG 3FSVA 4AJVA 2E5EA 1N2RB 3DJSA 1ASPA 3UYRH 5C3TA 2OFQA 2WTPA 1DP0A 1NAMA 3F5WA 1QG3A 3MUGB 5KVEH 3SKNA 5HGHB 1FSKB 1G1KA 5TJWK 3SDAB 3BRFA 4I3RH 4KBPA 4X5WA 2IAAC 5ICYB 4JVUA 3VXUD 4CC4C 4QNPE 5FUOL 1P1VA 5IHZA 4N9GB 1J1XL 4GNKB 2AQPA 3EDFA 3D39A 5J9PB 5ISZD 2NX5E 2DWEB 3V0JA 4D9LH 5DI8B 2AK4D 3QUYB 4PJCA 1ZJAA 3DHPA 3N91A 5B1KA 4UNTA 2FJHB 1G9MC 1HH6B 4LAQH 1LYQA 4XBGA 1I8IA 1NOAA 1HXKA 2F58L 3EDEA 1QSFA 3GIZH 3MNWB 5D8JL 3BMVA 2A74A 5AW8B 5BZXA 1FZOA 2GG1A 2RB8A 1TO5A 3I75B 3QQ3B 2CGRL 3RVXD 2E7HA 3WS3B 3ARVA 5FF6B 4LSPL 3C6LB 4CAGA 1U9KA 3VXPB 4GP5B 1A02N 4UQ2A 1OB1A 2P3YA 5B21A 5T3XD 1I8MB 3VUAA 3W5MA 4X5XB 5GGRA 1RHHA 3JXAA 5C97A 1XWVA 4WHTB 3PF2A 4GRLD 1OTTC 4GFTB 3ZU8A 4I0KA 1J1XH 3HC3L 4X99A 1URIA 1ZVYA 2VWEE 1HE7A 3VXRA 2VRAA 4OV5A 1OALA 3PXJA 5C0DB 5DJXB 4MA7L 2ZT9C 1MW1A 1GTNA 3JBG7 4FXGC 2YRZA 5IT2L 2CXKA 4KJYA 5I1GL 5D8JH 3IJ9A 4FI7A 4ZOAA 1AXIB 4JFXB 4UMSA 2F1AA 4G8GE 2CGRH 4R97C 5HD8D 4YQXL 2EDWA 4CW1A 4K5NA 5IG7B 4AT6A 4LSPH 5CR8A 5EO1B 5I28A 5HDWA 5KN5B 2ZICA 3QDGE 4HIIB 1H3WM 3GWJA 3PP3K 1RV6X 2OLDA 3RWFA 1CI3M 1SOKA 2J8UA 2IH3B 2E3VA 2EKJA 3G6JF 3IMVA 4DSYA 1VA9A 1X5LA 4U3SA 2YIHA 1II4E 1QR4A 2IGFL 1Q9WA 5HYJB 4NO5B 3HC3H 2H8PA 2J2ZB 3DVGA 2WWMC 4BH8A 1GZQA 2NXZB 2Y5QA 2Y07L 1C5CL 1JYWA 3EDDA 3FQTB 2BNRE 3CZUB 1UZ6F 4ZAKA 2WVSA 2WXPA 1SLVA 3ECBB 3MRRB 3TH3T 5B39B 8PAZA 5C0BB 4NUJB 4MA7H 3S0PA 3VFVA 4AW7A 4L9LB 4OF8A 4UT6L 3APCA 2LGNA 4P2OD 4F9LA 3DJZA 2EDBA 5IT2H 5I1GH 5AALA 2H1PH 4YIQA 1JYVA 4MDJA 2HCZX 4YQXH 3VGBA 2VQ4A 2QVIA 2E9IA 4XCFL 1JGVL 4AJYV 3OLIA 1RZQA 3E8VA 3LH8A 3FU7B 3FQ1A 4DTGL 2WZ5A 4MB3A 1SHMA 1KLFB 2WQAA 2IGFH 3W0WE 4ZZFA 1H9DA 3ULUH 2IWEA 2FH8A 1M7DA 1Y18A 2DQFB 4TLSA 5MI0C 3PJLA 1F18A 2Y07H 1C5CH 3VI4B 4UIKL 2CWRA 1FZKB 1FIEA 1GKOA 4YL9A 3GRGA 1HJBC 5I1JL 1NUFA 5LCVL 2VRQA 4Z0XB 4RDQF 4UT6H 4P5MA 2CKBL 3FSWA 1M6UA 3DK0A 4PBXA 5FGCB 3GLEA 3C8DA 1YPZE 4JY6A 2CJTA 2XJLA 3AGVA 4MJIB 4PJFF 3JWOC 1P4LA 3O41A 3WHXB 5C7XL 5I76B 3KEHA 1L7IL 2WYTA 2XRAL 3NSJA 3ZKXC 2J55A 4XCFH 2DQTL 1FAKT 1FYTD 2GSIB 4BFJA 2EVJA 4HQQL 5CO1A 3QULB 4WTQA 2NCEA 1ZLWH 4RH4A 1PD6A 3VXTB 4DTGH 1HQRA 3BVNB 1QUNA 4YBHA 2X6BA 1ETJA 3T4AB 5K1NA 1KTDB 4QF1A 4M61B 5ES4B 1U2HA 5ALCL 2DEXX 2P80A 4L8CB 3V10A 2V7NA 4KDWA 4OZGF 4DEPC 2AQNA 4PWKA 2AQTA 1FI8C 5JIIA 2IALA 1T4KB 2YLHA 4UIKH 4EI6B 3QPQD 1YCSA 4PGBB 2D4DA 2DB8A 1E2ZA 1LK2B 2BWDA 1CE1L 3GD1C 3QISA 4HUUB 4UM9A 1KPVB 1A3LL 3N9GL 5I1JH 2V2WB 4BSVB 1ULVA 3I50L 3Q2NA 5LCVH 1T1ZB 2GSGA 2KLSA 4POUB 4AOFA 1E90A 2BSRA 2Q3ZA 3DOSB 1VFOA 2KZKA 1EANA 1Y0LA 2AS5M 2JTYA 2P5EA 1A9EA 1PDKA 2XRAH 3HC0A 3NDYE 4PJ9C 1XGUA 4U49A 1T1WA 3KAAA 4HQQH 1E4XL 4A7UA 3VI3E 4EDWL 2GEQA 3N41F 2WBWB 3HZMB 4JDVA 2CRYA 1KJMA 2XV2A 3KBEA 2G3NA 1H19A 3FFCB 3IDJB 2KERA 2V3DA 1L6ZA 1NGYA 3BIKA 4R5VA 4IOSA 4NO2A 3Q9QA 5ALCH 2HT3C 3DVIA 5SWZA 3L5HA 4PHZA 4WI7A 3RIAF 4AJ0A 3P4OA 1JDAA 5GS0D 3X11B 4U1HB 1SMAA 2Z6FA 4D0BA 1GCFA 5FHAL 3B7YA 1KIUB 2Z93B 4TL4A 5KG9A 1CE1H 1U8IB 4ZTOH 1A3LH 3N9GH 4NERA 4MCMA 1NCGA 3I50H 3VFOB 5IFHL 3BWUF 4ZTPL 1FWXA 3ZDYE 1HYSC 2AXFB 2C4FU 2FBOJ 2ZNXA 3N06B 3OJVC 3MRCB 3ZBMA 3RWIB 5IHLB 3TURA 3QDMA 5I5RA 2OCCB 1X5GA 4AEEA 5F2FA 4JKKA 3UX9B 5KBNC 3LRSB 5L7XL 3CFKA 5GGUB 3B3IB 3MRQA 2X4RB 2X89D 1HEZA 1MQKL 2QPFA 1INDL 1GKEA 4LKCA 5KJ7E 2QMJA 1FSKC 1LTXA 1U4FA 1Z5HA 2ED6A 2WMPB 4KHTL 1JPGB 4ELME 5DMKB 3TONA 1GOFA 5TDNA 5FYLL 5JHDA 3OKEA 5DJYB 5FHAH 1L7TH 1U8QA 2VLRE 3QUYC 1A6AB 4MTMA 4TUOA 4XC1L 5B1AB 4BKSC 3MO1A 4Z3FA 5MP6L 3UTTD 4U0RB 5IFHH 1JVLA 4ZTPH 2UX7A 4CN6A 3NJJA 5C6PB 1T21A 3L48A 1D5ZA 4RQQA 3E6HB 5EU5A 2FEEL 1U3HB 4J4PA 4PREA 1WZLA 3RL1B 5L7XH 5DD5L 5CBAA 2FJUB 3C6LC 5T3ZE 3RX5A 2FE0A 1I3GH 1MQKH 3MYZA 3OKDB 1A6ZA 1INDH 1FFNA 5KJRL 2A9NL 2P42B 4HUWB 1D6VH 1SNRA 1CU4H 5BNXD 3M8OL 4KHTH 1VGKB 1NICA 3C2AH 1JFQL 2ICEB 3FQXB 3AMLA 3POCA 4HDIA 4WHYH 5FYLH 3NP3A 5DQDL 4GRWH 1GPOL 1PEWA 2ESVE 5ISZA 4P5TA 5C2UB 4XWOD 5KBDA 4XC1H 4F3FA 5MP6H 3EJCA 3QIUD 5DHXB 1E30A 2GUOB 3PV6A 1U42A 2AHIA 2B39A 1TXKA 2VR5A 2FJFA 1OCCB 1WGOA 4NQUA 5CM1A 4JRYD 3D8MA 1TU2A 2O6DA 3QXTA 1RXLA 3SDXE 1HHGA 5DD5H 5FA4B 4LHQB 4C58B 2JELL 4XH2A 2OMZB 3NP4A 1R0AL 3VRJB 2A4ZA 4LCYA 4ELMF 4LB8A 5D7KE 5TK4A 2A9NH 2PWHA 3TJEL 5KJRH 5GXBB 3QEUB 1JCVA 1OSPL 3M8OH 5AVZB 2NW2B 5BZWB 1P7QD 1JFQH 4QOKE 1NPJA 2BSTA 1TJHL 2WQSA 1W0WB 4OD1L 4PGEB 5DQDH 4KTGA 2NXZC 1LDPL 4AYFB 1GPOH 3HFML 3SE6A 2JKNA 2ARJA 5GISL 4Z7UA 4HHAA 3QNFA 2ZSWB 4BCXA 2WLNA 4NHUA 4AIZA 1AKJB 4L9LC 4TNFA 1NCAH 2IAMD 2B15A 2VXQL 3IAPA 5C2BL 1ZY9A 5I1DB 4NRYB 4OCLC 3FW6A 1KIRA 4S11A 3BP4B 1OPGL 2OMUA 1RZJL 4FCAA 1JZGA 1KXTA 5CJOL 4P3CL 3WO3B 2EO7A 1F3DH 4A2FA 1IAIL 2UWEB 4GUQA 5AVRB 2JELH 5AL0A 5C08E 3LKPA 3K6NA 2DF3A 4HAGA 3V0VB 4ZQTA 3NA4A 1HS6A 2C9AA 3TJEH 4MNGA 4KVNL 1M9SA 1YDPB 2AQQA 1GAFL 3QGVA 5E0FA 3ALPA 2HTLC 2F54B 3SKUD 3Q6FA 5L9DL 3NJLA 3TCLA 3UIZA 1TJHH 3QP3A 4KI5F 4OCXL 3DGCR 3MFGB 1LDPH 2VXTL 5FO8A 3HFMH 3KDPB 3QEHA 3QRBA 1JWSA 3LXAA 3UJJL 1CDCA 3WJLC 3FMGH 5GISH 4HFWB 4Y2OB 4W4OC 5KVFE 4UT9A 4GRWB 5FB8A 5F21B 2VXQH 2WWKT 5C2BH 3BH9B 1CFMA 4EAEA 1KCSH 4HJ0C 2CBOA 3IDYB 3G5XB 1X5XA 2X87A 1X4YA 1OPGH 2AV7A 2JB6A 4MAYA 1RZJH 1BG1A 5ELIA 1TMQA 5CJOH 1ZSDA 4P3CH 1H3TA 1IAIH 1QASA 4XXWC 3ZK0A 3TJHC 4NPYA 3IPEA 3ASOB 2P52A 2R2BB 4O2FA 5DGRA 4DZBB 4U7MA 4KVNH 1QPKA 4E42B 3T4AC 1GAFH 4M7LH 1EJOL 2VITA 3BUDA 3EHBB 3NCCB 1ETZB 3PJNA 5GS2D 3THML 1DQQA 4XO3A 1TFHA 1CDGA 1WK0A 3F12A 4OCXH 4XPTL 2VXTH 4KUZH 4BM7A 2ZAGA 3RURA 3UJJH 4KO9A 1F45A 5EBGA 2YUVA 4XNUL 3TH2T 4U6YA 4KFZC 4TYUA 5TGBA 4AZUA 5DFVC 5KSVB 4JGUA 3CZNA 4FLOA 3QJFA 1UASA 3MNZB 4FYRA 3F05A 3KPRA 4ZO7A 4S1DC 3IMRA 1JVKA 7TAAA 1MRCL 3CC5A 3E9UA 5D7IF 5IIEB 4TQHA 3CPLB 3HPLA 4N8VA 1A3ZA 1NC2D 1G7PA 1DQKA 4IOFC 1NBZB 3HUJF 4Y16B 3ZW3A 4AYGA 3HIZA 1L9MA 3KXFD 2KL6A 2R27A 2Y24A 3MLZL 4Z7WB 4FTVD 5IP4A 5I6OA 1CZ8L 1RK7A 1MPAL 2F7OA 3ARDB 1VDGA 2XFGB 1NCNA 3HA0A 5JIPA 3C5ZA 1B4TA 1EJOH 4NKQB 4WY7L 3THMH 4N85A 3WLBB 3TPUB 3UJIH 1BM7A 2CO6B 1KT2A 3SDYL 3D18A 3ULUC 2YQ2A 2BOCB 1FRGL 3U82B 3VFTA 1F97A 4KTEH 4XNUH 5GGTA 2EH8L 2WXRA 3CZKA 3PL6A 3V7AE 1E4WH 1T89A 1AG6A 3DV4B 3PHSA 4H88L 1E8XA 3L13A 4LRIC 4LMQI 2HRGA 3VSQA 3BWAB 3PP4L 1U8HA 5IBUG 3MRBA 2YAOA 1HL5A 3MGOB 3T0BA 4BCZA 4WF7A 1MWAA 3RIFF 1NGZB 4GW1B 3TTSA 2W60A 1R24B 4A7GA 1JERA 3MLZH 4U31A 1CZ8H 4MZ2A 3WNNA 1MPAH 4UTAA 4GRMA 2DM2A 3H6AA 4XVTH 2H3NB 1I7TA 1T66C 3OAZH 1TZHA 1HSBB 1TVBB 2AEPL 4G6JL 3VU1A 4WY7H 2XWBA 4ACTA 1BFVL 1HHHA 4M8VA 2VKWA 4R83A 4L2YA 3ATAA 5C0IA 4N20A 2VR9A 5F7BA 3EG9B 1THAA 3N42F 3ZT7A 3KPLB 1Q8MA 1XF2A 3T04D 1FRGH 4MQ7B 5JOPD 5IVXF 2EH8H 3BX7C 2IDFA 3QJTB 3PUUA 1BQHG 4QTHA 2FYVA 3TPKA 4R4NC 5ANMA 3QJUB 2G4GA 4H88H 3MRPB 4A6YL 4G71B 5HHNA 4U0RC 2FUQA 3RX9A 1PLCA 5JW4M 4OZIB 2YD4A 3PP4H 5HPMB 5D7LA 3OF6A 3OL2A 3GNML 1D5MA 4JZNA 2OX5A 1R1CA 3MRNA 1B0RA 1U3HC 3H4HA 4TVUA 4JAMA 4OZFA 4PG9A 5G2NA 1J8HD 3VFMB 2P28B 3FO1A 1Z0NA 4HVBA 3AROA 5F8RC 2WO3B 2WNXA 4PRHE 3ATFA 1IEAB 3SYCA 1E8YA 4QRUA 1FL6A 1Z66A 3UJTL 2F53D 1U8OA 1T83C 4K7FA 4JO8A 5HDRA 4WLCA 4G6JH 4HS3B 3RBSA 4NT6A 32C2B 4NQEB 5EZLB 2CR3A 4JFHE 3ZZ1A 5I8OL 1BFVH 1E50A 2CCWA 2ICEC 4BELD 5F1NA 4ZMTA 1PKOA 1HZLA 3QRGL 2OR9H 1AO7B 3FB7A 5GGVY 4P46B 3KWXA 2BW5A 3QIBA 2M2DA 4LFHD 3LMJH 3QZWG 1OK0A 3P4MA 1HI6B 3QI9D 3LZRA 2WLMA 4W9KC 1DVYA 4AMXA 2D3JA 2X4QB 4Z7OF 3BAEL 1WBYA 2GUYA 4J12A 3TO2B 3ARGB 4HG4J 2WP3T 2HFEB 2X0UA 1GGYA 3K6OA 4BIKA 3GNMH 5A3ID 4PJ8A 2EIEA 4JFOA 3JWNE 1MCNA 4L8BB 2J1KA 2HJFA 4N2LA 3ULVD 2ICWB 1DSFL 3N43F