4WI0A

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
168
structure length
168
Chain Sequence
b'MESYITMNFDKNTAEVGQIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVNEDYGPIVQGVHKISEGILNLSRSYTALDVYRASESPEETGTVAVVGFKALQKKATTVVFEHSVTMPNGIIGTTLFNWYGNRITSGYSVIQPGEINSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosomal scaffoldin adaptor protein B
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein
total genus 38
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wi0A00
3BWZA 1ANUA 3KCPB 5G5DA 2W1NA 2CCLA 1OHZA 4UMSA 4DH2A 4FL4B 4FL4C 2OZNA 2XDHA 4U3SA 5LXVA 4IU2A 3GHPA 2VN5A 4UYPA 5AOZA 2VN6A 5K39A 4IU3A 2BM3A 2O4EA 2VO8A 1ZV9A 1G1KA 1TYJA 3F2LA 4WI0A 3UL4A 4WKZB 4N2OA 2ZF9A 2Y3NA 3KCPA 1AOHA 3L8QA 3FNKA 1QZNA 2B59A 2JH2A 4UYQA
chains in the Genus database with same CATH superfamily
2FX9H 4GP4B 3B3IA 1RJLA 3GTTA 4O4YL 3AAZB 3QWQB 2W0LA 3JYCA 3B2PA 1DBAH 3FBQA 3QDJB 4ONFL 4QWWD 1G84A 3GTNA 2VMDA 2AJXH 1CL7H 2QADC 4R97C 3KYKH 4K5MA 5AEAA 3OHXA 2HFEB 3P9MB 4F58L 1FNLA 2CRIA 2MQ0A 2XVGA 3CK0L 4EIUA 1W16A 2CPUA 2OMBA 4NNXB 1TQBC 5J7CC 1T83A 5DSCB 4AV0A 5EBLB 3WFBH 5GXBB 1FUNA 2LW3A 4MJ4A 4PJXF 3OR6B 1BZ9A 4GRLC 1F58L 1P6FA 4M93C 3ABKB 3W9EA 4KUCD 3RWGA 4HWEH 3PIQA 4XBEH 4ZYKB 5KS9F 4GY4A 1CLZL 2NTFB 5FK9B 3VXMD 2VR3A 1P4IH 1CT8A 1ZTXE 4LOFA 4KQ3H 2CUAA 1J9SA 3WHXA 3UADA 1RZKH 1RV6X 3BQUB 3VNZA 3PQYA 3IFNH 1IM9A 4PEEA 3GB7A 1FNEB 3PWUB 1TTUA 2R1YB 5FEBA 3HS0C 4IRSB 2H41A 3MNDA 4LRIA 3DX9A 4ENEC 5IB5A 2WXOA 1XEUA 4MNHA 4PVBA 1WWCA 3FO1B 3LXBA 4TYUA 3GSWA 1N0XL 3TPUA 4UAOB 4IGBD 1FLRH 1YMMA 5GISH 1CGXA 3IFOB 4NEHB 3O4LA 3MV9A 3ETTA 3FUJA 1X7SA 1IVLA 5E4EC 1IC1A 1MAJA 5B8CA 3H42H 1ZLDA 2FO8A 4X6FB 4XMXA 5KAQF 3T0AA 4HIIA 2Z93A 4I0PD 4P2OD 4S10A 2HLAB 4D0DA 1KN4L 1MFAH 2WLYA 4FQQA 2X6UA 4IBTA 4PWIA 1Q72H 1TFHA 4BFIB 5F3BB 4XOEA 3HMXA 4PLNC 1MNNA 3AGWA 4A39A 3DI2B 1NWPA 4HEPA 4PGCB 1NBYB 3T2PA 3UG5A 4M5YL 3UYPA 2FO4A 4W9IC 5EZOH 4QTIL 5DC2A 1P6AB 3THML 2VDLB 4UOZA 5F8RC 5I0VA 2CM5A 1PFOA 4JQXA 4L1DA 3TH3T 1SOQA 4XPAL 1XF3B 5MEOA 2XLLA 4PW9A 5CEZH 1MFEL 2YR3A 1KB5H 2GC4C 2VLKB 3VM5A 2JKIS 4YFLI 5EUOE 5HJ3B 1XHHA 1MCIA 3L3OA 3NQKA 4XVTL 2YGNA 4YDJB 5KVMC 1J5OH 2NXZC 2V7NB 4RDQF 2OSWA 4KHTL 1EXUA 1COBA 2X88A 3W57A 1IL1A 2R8SH 2N3JA 4PJ5E 1HHKB 3MLWH 1JNLH 4FQ2L 4QHLA 3TV3H 4WHCA 4POYA 1RHHB 2H9GB 5JNYB 2Z31C 4U6YA 3ARFA 1YEEL 4DKDC 5I0WA 3MA7B 1RJCA 3ZT5A 3KPOA 5D7SL 5DHYA 4U1LB 2AJZB 3MRCB 2H0JA 1PDKA 1JHLH 4PJIF 4XPHH 2C5DC 2W0KA 4Q9CA 4EJ1C 3U30B 1QFHA 4R26L 1PMYA 2QLYA 3FFOA 4FI6A 1I9JH 2E5EA 1XD0A 2UY7B 3REVB 3IRZA 1A64A 3FCTB 3ARQA 1H8NA 4RZKA 4Z78A 4HUVA 1GA2A 4RWHA 2Y5EA 1TKWA 1IJNA 4OZIE 3FZUC 4RGOL 4TL4A 4MASA 4IQHA 2GTZA 4WO0A 4N25A 2J6WA 5ID0B 4Z1PA 1PKQB 4NZFA 2VDPL 1SGKA 2EEAA 3EJUA 3I2CH 2WP3O 4X9FA 3RPIA 5DHEA 4NB7A 4KX8A 2X1QA 3IMUA 2ZOTA 3VXUA 1WHOA 4GI8A 4FXGC 4LPCA 4X4KA 3LIUA 4M8UA 4F3FB 4UNUA 5DRXA 5IMOA 4FQHB 2EDJA 1UUNA 3EOAA 2EYRA 1G6RL 4GSDH 4PBXA 4LSTL 1MXGA 1RCYA 1P2CB 2MTAA 3OZ9L 3UTZA 5LQBH 3ZE2E 1JNHA 3JWOH 5I1CL 4U2ZA 1LE5B 4CUCA 3SDAC 1E0OB 1UB5A 3TT3L 1ICTA 2NUTB 2GY7B 4WAFA 1R34A 3H7BB 4N0CC 2KI6A 3DX6A 4WU7B 2BRRL 4XN8A 1OTTD 1L9SA 3C5ZD 3QJHA 1Z5HA 4MMZA 5DUML 2QVFB 3ZKMC 2BNRA 1QSFE 1WQVT 2CSPA 4ZFFA 3DSNB 4WWKC 3B9KC 2XWEA 6PAZA 2Q2EB 3WCYA 4APQC 2WM0A 1BF2A 2OCCB 1Q9OA 3E80A 2BFVH 5GJTL 1W9XA 3QBTB 3A22A 3M6DA 1IGTA 4S1QL 2HB0A 5L8LB 4N2GA 1GCYA 1NC2D 3VXTA 5AALA 4C57C 5ACZB 1YC8A 3JVGA 3L1OH 1O6TA 5L2JA 5B7FA 1KPRA 2XJLA 5CHNB 1QTYT 3IMWA 5GRJL 3SDCC 2XRAL 1A3ZA 2OMUB 3N1QC 3C6SA 4DESA 1KLUA 5C0BA 2JSFA 3OJDA 4TNEA 2VDNL 1Y18A 3ESPA 4V2CB 3F5WB 5MEND 4DP7X 3PAYA 3DC0A 4GMTL 4TUOB 4BDVB 2WXQA 4XO5A 4X7FC 4NQVA 1I82A 1WVZA 3TN0D 1M7IA 4EQ2A 3M86A 1NOLA 2XWDA 4HMEA 3JUZA 4L29A 2XXGA 3DHUA 3QT2A 4BFOA 5IW6A 4O5LH 1S7TB 4UQIM 1QO3A 4DUWA 2O5XH 3MRIB 4EKJA 1IAIM 2VQ1A 1E6OH 4LPXA 2BM3A 1OV8A 3MGTA 4JR9H 3V7AG 1VFBB 2NZ1A 4GAFB 4ZSOE 3T71A 2MQCA 1BP3B 1BYPA 4RIRB 2WNXA 3V4PH 2XKSA 1BVOA 2EIKB 4P2YA 3BAKA 4BFRA 3GF8A 3CXFA 1CTNA 4XPTH 1XZWA 5DK0B 4BZ1L 2PXYC 3VD1A 1Z66A 5KSAC 2XJKA 3FFCE 1D9KC 1M7XA 2WKLA 3HPJB 2BVPA 3KPNA 3GSNL 5T33H 4F7MB 1UD8A 2A74A 1VGEH 1T1ZA 1VADA 5DEJA 5T1LB 3GM0A 5AL0A 4EUPG 3CHOA 3FQ1A 4QR7A 4U4IA 2WTRB 4LLYA 3NIGF 5CXPA 5KYYA 2I27N 5D7LD 5KSVA 4MZ2A 2Q8AL 1J86A 4NN5C 2ZIDA 3BAEH 2R23A 3H1ZA 4LLQA 2MH4A 4UILL 3ARVA 5EIVA 5ABAA 5KG9B 4XAKD 3RTLA 2H47C 1ILUA 2X4PA 2QHRH 1J1XL 3VYPA 3OXRA 3IS0X 1DANT 3EFDL 3KG5A 1MHCA 1CFQA 3DMMA 3LZRA 5D72H 4BINA 1FDLL 2AEIT 4RMRA 3IAPA 2FRGP 3NIDF 3ZL4L 5PCYA 2ED6A 1I9RL 1BECA 5F0JB 2WTPA 5A2JH 1U8CA 2VMFA 43C9A 2W5PA 4X6CA 5JHMA 4OSUL 1MFDH 1XF4B 3DRQB 3CDZA 5EC2B 5I1DA 1S9YA 4N8CL 4FQXB 5IFHH 3QEQD 1PZDA 4X8XA 2W9EH 2EDHA 3VWKC 1J9TA 2MPAH 5HD8D 1W8EA 2IFFH 2NNAA 4U0RC 2XIBA 4LPVA 2G5BA 5C9KA 1VEMA 3O45B 4OM0H 3FFDB 4UOQA 3KPSE 5E2VH 3VRJA 3CDCA 1RU9L 3NGBC 3G6AA 2ZP0T 2OR7A 3FT3B 4XMPL 3SPVA 3QXVA 3KHOA 1D5MB 3DPBB 3KNBB 3VSVA 5DRWB 2V17L 5DT1H 4LSQH 5C8JA 4R4BB 3TA3C 3H6JA 1X5LA 2YXVA 4MCMA 5F89A 3WEXA 3PL6C 2I07A 4BCZA 4IBQA 4GUCA 4P9MH 1D3CA 3UOAB 4LSPH 1AZBA 4JDEA 5E8NB 2VABB 3V8OA 3N44B 1PBYA 1VPOH 1BAFL 1AQDB 3QQ3B 3V6ZA 5A2CA 2P5EA 4AQZA 1NGPH 4Q9QH 2AKRA 5HHNA 1ZHNB 4XNYH 3UBXA 2AQRA 4NIKB 3FQTA 3KBPA 1NPUA 1SEBB 3IMTA 4R0LC 2X4RB 4JPKH 4Q89A 4OGXL 4MXQD 1UD6A 2LR4A 4MAYB 2DMHA 4MAUL 4U0QB 4NCC2 1FA4A 2BHZA 4TNFA 2IOIA 1MWOA 1NCHA 4Y4FD 4L4VA 3RVTD 4CVXA 3DIVA 1N8OE 5DFVD 5BVPH 5C07E 1KFGA 2GI7A 1CD9B 1N6VA 1O9VA 2AANA 1NCDH 5C09B 5EWIH 3QFDA 3D69B 5IJVB 3V2AR 4K07A 4NHCL 4NZTH 5DUJA 5HGAA 3D2UB 1A2YB 3OL2A 2AJUL 4DKEH 3G5ZA 5GS2H 1QTSA 2WK2A 3QUKB 1BD2B 4AXWB 3QUXD 1NLBH 4F9PA 2CAKA 4RNRA 3K72A 3AWEA 1W6LA 1G4RA 1KBGL 3NRPA 3QC5X 3JWOC 4G80B 5H94A 3K4AA 2H45A 4LCCA 5K9KB 3KGSA 4ELMA 5MEQB 2AERT 3N85H 4JKWA 1UZ8A 2XY2A 4FTVE 4LRNH 4X8CA 2MCG1 1JIBA 1L0XA 3S9DB 3CDGB 4MZIA 1A6AA 1F8TL 2IXQB 4GI6A 5IFAL 2V2TA 2Z7YA 3HC0B 3KPPB 3OKDB 4O02L 4AK1A 5D2NB 1JPTL 5GGTH 3GSRB 2Y1ZA 5DEFA 3UCRA 1A9BA 3K91A 5T8IA 1R24B 4IBYA 1JGEA 1EZSA 1HE8A 3LH8A 3R8BB 1DBKH 2BSRB 4KI5C 2OMWA 3U0WL 2MOQA 4W9JC 4X98A 1L3NA 3N91A 4G7VL 2YXFA 4YJZL 4Y2DD 4FFWD 5H2BB 4LSRH 4HEME 2HA1A 1B4JH 1T03H 1M9WA 3EAKA 1PZ2A 1R5WA 1TZGL 4K4KA 3QEHB 3NEOA 1EAOA 5JDSA 5TE7H 5TDPB 5B38G 1AZNA 3HAEB 4M5ZL 1WFUA 1KIUB 3MCLH 1YPZF 3VXPB 4CAGA 2JLLA 2XIIA 3ES6B 3PJLA 3TLRA 4KI5F 2IBGA 4XOAA 3TBTB 3UJJH 3DX2A 3OXSA 3FB5B 4P5TA 3WIIL 4I2XE 4XHJD 3PWLA 1RJZA 3U83A 2VISA 4X4YA 1Q4NX 4DUVA 2BJMH 2AQSA 5KJ4A 1ZS8A 1ZK9A 3WLWD 1NCWH 1W72L 2DBJA 2ITEA 3WKPA 4HBCL 3FOMA 5IVZB 1OD7A 2FAUA 2NSQA 3TEZA 3NAAH 7PCYA 1PCSA 3JYBA 5EIIG 3S37L 2ATKA 1PLCA 4IDJH 4KXZI 1HZKA 5EOTA 5LNGA 1ZPLA 2EABA 2VR4A 2V0AA 3T3MB 4NQEB 5HGBA 5MP6L 3O8XD 1YUKB 1DO5A 1HFUA 2K7PA 2Z92B 3QCUL 4OAWB 2JJTA 4HSAC 4OY9A 3AMLA 3MRLB 3QDHA 5E6UB 5KVEE 1IFRA 2P24B 3HZMA 3ZTJG 4JFQA 2OCFD 3WE6B 2EVGA 2IADA 35C8H 3Q5OA 4JRLA 4NZRH 4W81A 2EVFA 3OJVC 1RFDH 3FSWA 2XWJB 1UVQA 2YFOA 3LH2L 3Q6FB 2H26A 3SOBL 4YDVB 4MQSB 4MXWH 4O2FB 4XNMB 2Y3AA 3BIAX 5FCUL 2ZUUA 2VIRB 4I9WD 3KYAA 1KB3A 3N43F 3NZHH 3GPEA 5BRPA 1W8OA 1T7WA 2YLKA 4PJ8A 4WI6A 4LCWB 3L3JA 2FYVA 1S9WA 4RFEB 1G9MC 1MCWW 1H9VA 4C4UA 2I32A 1OGPA 2H32B 1ET8A 4HBQA 2EEDA 2EUVA 3ZHNA 3LKNA 2AVFA 3HR5B 3CTTA 2CGYA 3BH9A 3AXIA 4NJ9L 4FHBD 4P4RA 3PHOB 1RUAH 5DQDL 4AYDC 2DQJH 3KWVA 3ZZQA 3FT2B 3NJJA 3WUZA 3C2SA 1ZHBB 2YLHA 1V7NL 4P23C 3ABGA 3V5HB 3SDXE 4FNLH 1ZTXH 1BBDH 2ENJA 4KVCL 3BHBA 1ID5I 3BRFA 1T2QH 4Z0BL 3SE9L 3D09A 4IRSC 1FH2A 4ACPA 4IBVA 3W2DL 3L4CA 1BF5A 5FUCC 5BQDA 1FIGL 2QKSA 1EFXD 4JFZL 2QZ5A 4HIHB 3QO1B 4PUBL 3SDYL 3ULUL 3GINA 3M1CA 3Q1EA 2CO6B 1OAYL 5HI5D 2N1KA 1J8HE 2K3TA 3BUDA 1BOGB 4YSOA 2P43B 4MCZB 1ERNA 2WQXA 1LO0L 2Y0SA 3KW8A 3P4NA 5F9AC 3B8YA 1GSMA 2FHFA 4UINL 5F7YC 3E6HB 4M1GL 3BDYH 3NEEA 2APWA 3HNTL 1CFTA 1LO3L 1R3KA 5I74B 5HGHB 2YJQA 1JUFB 2J1YA 4IRZA 4X5QA 5HDOA 3BKCH 1VA9A 5IMLA 1ZDQA 2F53B 5E08L 4HIQA 2X4SA 2P4AB 3WUWA 1OK8A 3LN9A 3VFRA 3K6SB 4P4KD 5MERB 4Z18A 4BFEA 2XG4A 2WBJA 1FZJA 1GC1H 1O7DC 4N2KA 1H3PH 2VH5H 1GZPB 4LGSB 3N40F 1EDHA 3J07A 4J27A 3QFJE 4QJ4B 4QF1A 4I8DA 2WAHA 3EFOB 3MJ9H 1UUSA 2WANA 4OD2A 5IZ7A 3V4LA 4BH8A 4J6IA 4CC0A 1RD6A 3QQ9D 2DLHA 1NFDB 3LQMA 3BSZA 4H20H 1Q1JH 4E5XB 4O9HL 3QXUA 1G7IA 2CRZA 3U2JA 1TJGH 2WV3A 3QXAB 1F11A 3T4AA 4HUMB 4Z7VA 1D5BA 5SV3A 4KOCA 1MUJA 1KPVB 2I60L 1GYWA 2NYYC 2LHAA 3HLAA 4TVPH 3NN8A 3VFNB 4FQ1H 1TEYA 2W94A 2CIIB 2V8LA 1REIA 5CJOL 3CFJB 4UCFA 3MV8D 2CBQA 1A4BA 3WTVA 3DJTA 2P9RA 1U8MA 4PVNA 1RZ7H 1CLYL 2AABH 4EI6A 4HK0B 4ZAKA 2AS5M 4YEFA 2ZUYA 5I1EL 1XH3B 4NQSA 1KJ2L 2QEJA 4FNUA 5CAYB 4S0HA 3DX1A 2DQIH 2W91A 3OAUH 4NXKA 4A2HA 3QUML 1T4WA 4WGVB 3RX7A 3ZL1A 2UZYB 4WSKA 1OAUH 4NQCE 1CFVL 3IU4H 2GK0B 5LGHL 1P4UA 4TF4A 5FGCB 1DCLA 3BKML 3MBXH 3SZ6A 1AZVA 4XMKL 5KVDH 3KYMB 1PAMA 5E00A 3BZ4A 1MJUH 3GBDA 5LDSA 1FFNA 1YEKH 3ML8A 1UM6L 2OJEB 4XBGA 3BAYA 5IEKB 2X6MA 4ODSH 3BLPX 2IEPA 2ENQA 3V0VA 4M62L 2CDEA 1QTPA 5FM5O 5GJSL 1ONQA 2YEQA 4IKNA 2FUQA 4D8PB 1AS8A 1R0AL 4UOJA 1FNSH 3NCJL 3OKLA 4JY6A 4MDJA 4NQDA 4EXKA 1SM3H 5FIEA 3GDBA 4CVZA 3RDJA 2UY6B 1YYCA 4PJIE 1FYTD 3BPCB 1SUJA 4FHKA 3ARBB 3G5XA 4WV1C 1OM3H 2XV6B 5DJAB 4Y5YC 1WICA 2HLFC 3NEXA 3WTSA 1WO2A 3ME0A 3MGOA 4WUUE 3VYOA 1P69B 3V6OA 1EJ8A 1SLVA 4N2IA 4K7FA 1HHGA 4XOBA 4XMLL 5LN8A 5D1XE 4DGIH 1BEYL 1IGYB 2WWOA 4N0RA 4XVJH 2F5AH 2O6EA 4RZCA 4QHPA 4YLQT 3VH8G 1TETL 3Q01A 4LLMB 1TTFA 4OLWH 2HVKB 5IW1B 4EZKA 3L48A 2FNBA 4QRRE 2X2JA 1NC4B 1WIOA 4EQ3A 4WGWB 4MRBA 2VM9A 1N5AB 2R4RH 2DI9A 2Y7QB 3OX8B 3UAFA 3O2VH 1EJOH 2FATL 2ZJSL 3NJMA 1A1MB 1ACYH 4E41A 4QHKJ 2GC7C 3P11H 1E2ZA 1PAZA 1EZUA 4XNXL 1N0LB 12E8L 2BOCB 4Z8FH 1RK7A 1IEAB 5B39G 2BNUB 3C5JA 4KQ4H 4L1SA 4WSJA 1AZRA 2TRYA 4ZMAT 1XGRA 2MJWA 4LK4A 3ARGD 3UAJA 4QJ5B 5BOPA 5CLXA 2B5IB 5JHDD 4HF5L 2GIMA 5CIPA 3DBXA 2OTWA 1HH6B 3O3EB 4WI5A 3CN3A 2H0PA 3NH7L 2VAJA 3OLGA 2J8UA 3AABA 4WVRA 1U8OB 3G5VA 5I6PA 2ICEB 3LKSB 1NIDA 2QV4A 2WO4A 5FA4B 1YDPB 1FI8C 4RQQB 4DEWA 1HTYA 3SGEH 3IDMA 3RB7A 4YK4B 5T1KA 3PJNA 3L5XH 1YAIA 4HUXB 3VX1A 3NZUA 5CCHE 1U8QB 4N2OA 3JQOB 1AZZC 1UACH 1O0VA 4KX7A 4X4ME 1JWSB 4AG4L 1JZ3A 2ROYA 3Q2VA 2XWZA 1T0MB 2OXHB 2X1XR 2YPLA 3QCTL 2DQTL 4QEGA 4ZFQA 3B2DC 3F62A 4G6KH 2ADYA 4CNIA 3FQUB 1LDPL 1EZVX 4KZCA 5JPNB 2X89A 4XXDA 3CFMA 4NLAA 1RVFL 1U6AL 2CHXA 3UTOA 1HAUA 4D3CL 3NPSC 3RTQD 3QEGH 4EKXA 4FA8A 5L8KB 2NY7L 5DHVH 1MHPL 4UIMB 4FQXC 1G6VK 3CZFA 4JKMA 1KENH 4XGZA 4FQLL 2H1LM 4ZNEE 3PWJA 5FECB 3AJ7A 5KYWB 4OVVA 1UC6A 2Y24A 3WFEL 2FHCA 4MJ2A 3KE0A 4KO6A 4PTTA 5FB8B 3FHQA 4ANVA 5IJKA 4IHBA 3WN6A 8FABA 1I9IL 1E5AA 1UZGA 4N90E 1DQLL 3MUUA 3FW6A 2SEBB 1THCA 3VD7A 1C16B 1FRGH 1I7RB 1D6VH 5LBGA 1DJWA 2XETA 5KUKA 5HYSG 3O2DH 4JRYE 1HKLL 4FQIL 4GIOA 1IEHA 3RVXC 1A6TA 5DA0B 3MKKA 1AY1L 3VXRA 3SGKA 4MDRA 1BZOA 3GSOB 3RY5A 1EIBA 1MREL 4IGBB 2ZCHH 1NMCC 3MU3A 1QACA 2HRGA 1CDCA 4PWFA 1E9OB 2XPGB 2P7TB 3NIGE 1SZNA 2H1XA 2MHAA 3G9VA 2YGQA 4GIPD 4OKVA 3JTTA 4DTGL 5HYQB 3QIWA 1NGZB 2DQHL 3JWNC 3HUJB 4YFLF 3RUGB 3SDAA 4BGDA 2XX1A 4ZS6C 4CSZA 4KJPC 4I0PB 4MAYC 4P2OB 2H2SD 4P2RA 4NNYA 1SHXA 3BPOB 4QCIB 4IOFC 5ETUB 2RR3A 3N44F 4QXTA 1N70A 2NY0D 2VR6A 4NP4L 5DVOA 5B1JC 3ZUNC 1N5YL 4WK2B 1XCXA 4YSCA 5C3LD 3NABL 5GZND 4KNTA 4XVOA 4FA7B 5I0XA 1WYJA 1QI3A 4RAVB 1NFAA 1AGBB 1NBVL 1OTSD 2ZKHL 5GGSA 3HG5A 3AG3B 4OUUA 2QDVA 4GSQA 4FRWA 2R0ZL 4ZUVB 3MJ8B 4D9QD 2BDNH 5CZVH 4QO1A 4L8DB 4PJ9D 1MCJA 1T66D 1RH8A 5B38B 3ZZSA 1CVRA 1AQKH 4NO5B 5ISZA 1H19A 2DDQL 1F6AB 4PJ6A 1AMYA 3MMEA 3Q6GL 4U3SA 3LXUX 3NCCB 1E4XL 2EYSA 2Y2TA 5CLYA 5DJXA 1CG9B 5EU4B 3NOIA 4R5XA 1MW1A 1E8WA 3WIFA 4GKZA 3WYRA 4JY5H 5CILH 4PRID 5D2NC 1Y7VA 3VYNA 1TYJA 2FWLB 1I8IB 1XZ0B 1UOKA 1Z1WA 4GMSL 1JTTA 1CURA 2H5UA 4QXWA 1HE7A 2WINB 5C0CA 5D4IA 5EIIB 4HZLA 3L9BA 3FS9A 2Q8BL 1ZJAA 3AVEA 3KL3A 3MNWA 5GS0H 1KCSL 4FYTA 2N7AA 3OKNA 1J0HA 4QI3A 3FT9A 3S96A 3TA4D 4BE6A 4OU3A 1DJGA 3ASWA 5EBWA 3D06A 3MXWH 2NX5E 3VB9A 3CLEH 3MRJB 5DMGC 4F91B 3QWRD 4GG6E 1QYGL 5FYLD 2W88A 2IAMA 4K7PY 3VFWA 1KGCD 2OR9H 2DB8A 1J5DA 3F84A 3FCSA 3FU7B 4I3RH 4DGVH 2G60H 2AEPL 4DWHA 4WJG3 5ICZA 5GGVL 1QX1A 4PMEA 5TE4H 5H4ZA 4XN4A 1QRKA 2X40A 1ZLUH 1AHMA 4NAMA 2VDKH 1Y6KR 2RTTA 4G42A 4L37A 3CHPA 5KJRH 1Z3GH 2ZCLL 5GGRY 4PTUB 5CZKA 3DHPA 3EH4B 3H2PA 2H1PH 2R0WH 3MX0B 2FEDC 2IPKB 5B22A 1PL3A 4R90L 1OAXL 4FFYL 1RK0B 2FGWL 4OJFL 1EVUA 2AK1H 2CDGA 3KPTA 2R4SH 4WW2A 3KCPA 1JZEA 1YY9C 3UACA 5E56A 5HI3C 1U8PB 1CGTA 3U6XS 3BT2L 2AQ3A 2YRPA 1I53A 1KB5A 1B6UA 2FGZA 1OLLA 3F64A 1HS6A 2X2UA 3EYVB 3M17B 4XP1H 2YQ2A 1LEGB 1UCBL 2VDOH 4K3EL 3C5ZB 3T3MF 4RBPK 1UOLA 5FM5M 4ZG1A 3NJKA 1J5HA 3GNMH 4JUTA 1DVTA 3FUMA 4N6QA 4LEXL 2XUWA 3KYNA 3LOWA 5HHQB 3Q05A 5HHXL 5IB4A 5CP7A 1OCOB 3DARA 4L05A 3BAIA 2VXTL 1JPSL 2AI0H 1NC2B 5KBLA 3ULSB 2AVGA 3IBEA 2FJGA 1DDHB 3LSOA 4UU9B 4AENA 5CR1A 1XF5A 3PL6A 3M07A 1NWOA 1LO5A 1E8XA 1S7SA 3ATFA 3QJFA 2ZKYA 1A5FL 2AK4B 5MENB 3QZBA 3H9SE 1DLFL 3ALPA 1XGUB 5T3ZD 2VN3A 2B7DT 5KYXA 1E28A 4LBEB 1KDJA 2N0KA 2PETA 4ZD3L 1RP8A 1NGXB 3IDIA 3TN0B 4D0BB 3HG1E 5F2FA 2R51A 4FQPA 3K1DA 15C8H 2JB6A 1KY7A 3BOVA 3LNIA 1KULA 4PR5A 1OO2A 4RBPH 1FFPB 5IVXE 4YXHH 4LHUD 5DMIL 3V5KB 3PCYA 2WZ6A 2WQRA 4HFUH 1I7ZB 1UA7A 2D7TH 2O1AA 2GEEA 2VGLM 1A8JH 1L9MA 2V3FA 2Q2LA 4XP4H 3COOA 5I74C 2WJ5A 3F85A 5LBVA 3VNYA 3WI9A 1ZDSA 3O9WB 4PV9A 5EU6E 2D9QB 2VR7A 4L8SB 4DN4H 3LB6C 4M7JL 3KLSA 4LSSH 1E3XA 1QNIA 5CN3A 4A55A 2KZKA 2QT6A 4KKLC 1MCOL 2IH8A 4J4PC 3QISA 3HS8A 3EIFA 3SY0B 3V5DB 3M7FB 3EW3B 1U8IB 3BGMA 5D7LB 5TFSH 3EDKA 4F7KA 1FL6B 4HPOL 2O5NA 1AYRA 2HFGL 3QDJE 4OV6F 3WXWL 1MFBL 1LGVA 4YDIH 1Q38A 2MCPL 3P77A 5FLUA 4ZS7L 2P5WA 3HFML 3CSGA 2KZ1B 2EDOA 2V2WA 1YRKA 2HMIC 4LSDA 3Q9QA 5DHDA 5JXEC 2XBZA 2XC8A 4UZSA 2YK1L 4MMYB 4CJ1A 1WTLA 2X3CA 2VLLB 2CCVA 5K9OB 4O2CB 4ZDHA 3D0VA 5C6PB 4JFUA 3QEQB 1M71A 2EDXA 3Q1SL 1Q0XH 1MVUA 1T3FB 3OKMA 2G9HA 4PJGA 1ZVNA 1SXZA 4OGYL 4G8AC 4NRXB 2GVYA 3TV8A 2VXVH 2ITDA 4MNQB 3ZKQD 1A4JA 5JIMA 1Z9MA 3RIAF 5MI0B 3BXNB 3G08A 2VDQB 2VAAB 3ILPA 5HJDA 4DO6A 1NFDF 1Q9LA 4X6DA 1DLHB 3UTSD 3QPKA 4N9OB 5E8EA 4GW4A 1QFUH 2LFGA 3GZKA 1INQA 3MV7D 5D7JD 4NUJB 4XNZB 3FT0A 5EO1B 4B5EA 1KIPA 4JFWA 1FQ9C 2G0KA 3ZTNH 1MFMA 2NY1B 4XAWH 3VXSB 1J87A 2AAVA 2AJVL 2QQKH 3DVNA 3U7YL 3ZDYE 3C60A 1FHNA 3STZA 4Y4HD 5SWQA 3V4PA 1LP9B 3KS0J 1HZLA 1NEUA 1T20B 3IKKA 5HHPB 1JP5A 3GLAA 4QHNA 5DO8A 4EDXA 3QZWG 1TZ8A 4OFPA 1P84K 4LEOA 1CK0L 1HEZA 3V0JA 5EN2B 2CHZA 1N7ML 3LKRA 1BZ7B 2CE6A 4TQEH 4UBDD 3E8VA 1U3HD 5SWZD 3ULVL 1E8ZA 3JV6B 3OZLA 1B0RB 1CI3M 4Y4FB 4R4NC 3X11B 2EIMB 1BQLH 4AGPA 4IBWA 3IXTA 1M42A 3IJSB 5EOCL 1QAWA 3BKYL 5F88B 1VAHA 4WEBL 3KJ4B 2NZ9C 1OGAA 4MJIA 3QUXB 4Y9BA 3BWUC 3FQRB 5ANMA 4OJCA 2WYIA 4V1DB 4XMZA 3BP6B 3TJEH 4BFFA 5FHAL 1A7BA 4OD1H 5KSBB 3GZQA 5I1AB 1FE8H 3BJ91 5TH2A 3ARBC 2B9AA 4X42A 3HNSL 1ZEAL 1RIVL 4DP9X 4JREB 3VAEA 2DW5A 4P23A 2W1NA 5JA9A 3T04D 4Y8DC 1WBXB 1RIUL 1F86A 3VW3L 3BWAA 5HVHB 3BWUF 3CN0A 3KWXA 4RGND 1K5NA 4D9RE 5I2IA 3LQAH 2XOTA 5JHLH 1RL1A 5CLTA 1S5IL 3DJSA 5T5NG 1SXNA 3P73A 1IBGH 2DS4A 1XGPB 4K5PA 5A3ID 2ZCKH 4POZC 3EYQC 4HV8A 3FTZA 4IBUA 2YA1A 1AO7D 4OFKA 2JMRA 1UT2A 2AF2A 4JFXA 4Y2DB 3A24A 5EOQH 2XN0A 2J25A 3LY6A 2A6KB 4HOZA 1GSKA 1I1AA 3US9A 2UVFA 1QPXA 1YUHB 4GXVL 2DEXX 1QI5A 3HJEA 3LD8C 5ELIA 1QFWH 3WXVL 3RP1A 3KMDA 2R15A 2AEQH 2BMKB 4X6EA 2X9YA 3U36B 1K3ZA 1O9ZA 4U1GB 1EZLA 4NPKA 1T22A 4F20A 2R1WB 3QNYB 1AAJA 1F3JB 1PKQE 2DLEA 4R7NB 1E27A 5EDXA 1A4KB 3ZO9A 4A7GF 1SBSL 1NL0L 1X5ZA 2A1WH 4JRFA 4MNGE 5GGRB 2ZUTA 4CADA 2WP3T 4RCAA 1NAMB 1S3RA 2B5IC 1X5IA 3GMPA 3OBAA 5D8JH 4IRZL 4HKXB 2O5YL 5C0FA 4K7PX 4XP5H 3UZQB 4HA1A 2JKSA 5EFIB 2VL5A 3T77A 3V95A 2JI3A 3TESA 2ICEC 3I02B 5E8DH 3A4FA 2Z35B 4TQIA 1IGMH 3IGLA 2I25N 3LZFL 4PBDA 1J05A 2WPGA 3GO1H 3HI1B 3VFOA 2LFEA 4OT1L 3ORJA 4AC4A 1P9MA 4MJ5A 2BLFA 3WU1A 1QSEE 4MD4A 5C0DA 5KBPA 1BFSA 2FK9A 5HXMA 1CIDA 4XC1L 1Q9WB 5EU5A 5HYSB 3WS3A 5DS8A 5DQ9B 1LE9A 4QWWC 1S6NA 3BWZA 4YHML 1YO4A 1KGYE 2CO1A 1C12A 3G3LA 3HN5A 1WRFA 5GGTA 2F1EA 2VO5A 3ZRCC 4QRAA 4ANKA 5IR1B 1F4YL 5EULV 3BSZL 3FH5A 1HWWA 1Q90A 3PWNA 5DZNA 3ETBJ 4PBVC 4AEHH 2RCSL 4F24A 1IC7L 1O6SB 2HXAA 5J13B 4MSWB 1F4HA 4N2NA 4BSJA 5DUPL 2PTTA 2KLRA 5JYMA 5DZLA 4DFHA 2XV2A 4H0IA 4NZ8A 3GMRB 1FG2B 3UMNA 2D7QA 3W39B 1EO8H 1CGSH 1KYFA 1MCPH 3FB6B 3FMGL 1DANU 2VLJB 3KGRA 3CZJA 3LKOA 4QRUA 1BXAA 3MLZH 1J0YA 1S7UA 1MKFA 3KBFA 4KUCF 4H1LH 4X7TB 1EFXB 4KVNH 2YPKB 5E24E 1HNGA 1WD9A 2CGRH 3GGWA 3TO4A 4YUEL 4ADGA 3GMMA 4NRYB 4E9YA 1DYZA 3HHRB 2HRPH 3BLBA 3GJFB 4NHUA 3V9FA 2JF1A 2PPAA 1BFOA 1NOAA 2WCPA 3D08A 4FXKB 2G5UA 4L8CB 1OTUD 3K81A 1S7WB 3I9PA 4TLKA 1KN2H 4I0PC 4P2OC 1NJ9A 3E8UH 3BPOC 4IS6B 4WDIA 2JI1A 2OW6A 3FU5A 2AXGA 1IGCH 1WDAA 3O0RH 1RZFH 2IGFL 2VN7A 3VCLA 3CH8A 4P4KB 4QRQA 4CRPA 5KBDA 3DUUB 4WV1A 5LBSL 4FG2A 3SPIA 4Y5YA 4DP8X 3HUJF 3RUGF 1UH3A 3VXNB 1UB6B 2Z4QB 4E0RA 3PQYD 2IDTA 3QIUA 1IM9D 3FB8B 2KH2B 2H7WA 3WJMA 4QTHB 3EJSA 5J6GA 2AXJA 1LEIA 5FUOH 4ZQTA 3ZQXA 2YFNA 4LHUG 5G2NA 5L0QB 5AUMA 4LIQL 4UYPA 1P5VB 2HJKA 1JDCA 3IMBA 2XZAL 1YMMD 4JFVA 1MHHA 1KELL 5AYQA 3T3PB 1K5WA 2UXVA 3P4LA 2YS4A 3O4LD 4GJTB 1R17A 3MV9D 4O58H 1ZOXA 4PRAA 4AYFA 1SJVA 1PG7L 4FQJH 3S36X 2C3HA 5CD3B 3HZ3A 2KHAA 4BSWB 1IQDB 4YPGA 3M46A 2QR0B 4WTXA 3F05A 3BH4A 4URTB 3TBVB 1L7TH 1E3ZA 3LQAC 3C5XA 5HDQL 2X38A 4Z7WB 2PUQT 3CZLA 4R96B 3ILQD 2V9RA 2RHEA 3AQZA 5CU5A 4G3YH 4E42A 2YEVB 3ZE1B 4U7KA 2XQ0A 2ADFL 3DJ9A 4TM9A 2P5PA 3A6CH 3MREB 3MV8B 1FZOB 1QSVA 4LOUD 4YLBA 3MYJA 1EXHA 5FYKD 2QTVA 3INOA 3NK4A 4WJKB 2I5YH 3SDDA 3DX8A 3MXVL 2NCEA 3HG0A 1NKRA 4LCYA 4DSYA 5AVSB 4U1IB 4YR6B 5J0BA 1M2VB 4XO3A 5F7DB 3I9GH 1A6ZA 4MJ6A 1W0YT 4IW4C 4C56A 4P2AA 1E40A 4CL7A 1TNNA 1B90A 1V27A 2VLME 4RRPG 5JO5B 5C09E 1AHWB 3ARFD 1BJ1J 2W9DL 1M56B 1M1XA 2F7RA 2V33A 3NESA 4KV5F 2DWEB 2V9QA 4OZGB 2PYEE 5M7QA 5F7UA 3RNKA 4H8PA 4M48L 2Y7MA 3IFLL 5GSVA 3U7WL 3P2DA 3LRSA 4GQQA 3MJ9A 5AAMA 4L9DA 1OTTC 3IFPA 3L7FB 5DJYA 2N59A 3WJJA 1F97A 1YEFL 3C5ZC 3TIEB 4NM8H 1G1CA 2WHVA 4AIZB 1JHKH 2B8OT 4M6OH 4CBPA 1CFSB 4JRWA 1LJMA 1Z5LB 4KRPD 4PJCA 3LV3A 1NUGA 1QG3A 2YRZA 3KXFE 5F1IB 5LCVL 4Z6AT 2ZOLB 4JO3L 1P7QA 1BQHA 2VZOA 1A1NB 5D2NE 5E6ZA 5BQ7A 4PRNB 1QP1A 1RULH 3U9UB 4MLIA 3KHQA 1FJ1A 5F93C 4OZFH 5IQMA 2JVUA 3ISYA 1QQDB 2PCPB 4F7TB 3BAXA 3BP4B 3RX8A 2FLRT 2V2XB 3K5SA 3VXUD 5E9AA 5IIEA 4WY7L 5K9JL 1CU4L 2E74C 4K7PH 1P4BH 2E46A 4TKWA 1NH6A 5IB1A 2DWSA 5CFHA 1CD1A 4HMDA 1PS3A 3K2MC 4NUGL 1H8SA 2ED9A 4JZNB 3OKYA 5C2BL 5IT2L 5I18H 3JTSB 1FIEA 4HETA 3Q8EA 5B1CA 1GGCH 5TD4A 4KH2A 2WNGA 5HY9A 4OCWH 1K3IA 2RQEA 3TN0C 1UWEL 4OZIA 3SN6N 3M1OA 5DJZA 1XGTB 5K93A 3ZOAA 3I6LE 4HU8A 5I17A 4J3XA 3VXQA 4OD3L 3RWHA 1IZKA 1KG0A 2GSGA 4F2FA 3ABZA 2PLTA 1HX0A 1XVSA 1HYSD 2GABA 3ISRA 2BNRD 2H6UA 3FPYA 3I85A 4ZW6A 1CIUA 4LOEA 3WY2A 1J7VR 5JOEA 3D39A 2UUDK 4P8QA 4DP2X 5JHDB 5J3HD 2BOBA 1NCTA 1AD0A 2XVKA 4PV8A 2GJZB 2Y07H 2ZWYA 3Q3GB 4ICWA 5DJ8A 1OPGL 3T3ME 4NQEE 3BIBX 3T09A 3HI6H 1NGYB 1QEWA 2ZQKA 5E99H 1MFCL 1PCXA 5EOCJ 5JTWA 4QHKI 3L1GA 4XP9H 4RX4A 2XN2A 3OG6B 1E5CA 3R19A 1ZTMA 1V3MA 1C08B 2WB7A 3L3IA 1CL7L 5DR5H 2CJUH 5C0BD 3KYKL 1BXXA 2OYKA 3VXOA 3CBKB 3CHSA 3FT4A 1JSYA 1K4CA 1KF9B 1F5WA 4ZT1A 2OX5B 4M8QB 1BZDA 1JMXA 5AAWC 3BP7A 3WKNA 1DEEB 4KMTH 2LLLA 4JG5A 2Y7SA 32C2B 2X2YA 3RTQB 4XO4A 4HH8A 4XBEL 4PREB 3QZWB 4IEFA 3HHSA 1P4IL 2AXFB 4JO2H 2WLIA 2AW2A 4ANWA 5HD8C 2X4NB 3IFNL 2VDPB 2UUDH 3MR9B 3ZT6A 5FWRA 5BUAA 4Q2ZB 1KV3A 3QUYA 1QZ1A 1RZ8B 3HE7A 3MRMA 4PY7B 3MOQA 5D5MB 3UJIH 1D5ZA 1MN4A 3UDWC 1ADQH 2LVEA 1FVDB 2QFPA 4F7CA 3NFNB 2ZP9A 5MI0C 4QHUA 1PYWB 2R83A 4GS7C 4NSKA 2C9AA 4ZMOA 3SE8H 4K8RD 1CMOA 4M8RA 4BH7A 1FFOB 1MLCB 4ZX4A 3JUYA 1PEWA 1JV5A 2NLJB 2YWZA 3DOHA 3N0AA 5J12B 5EEYA 1QHPA 2KS0A 1AC6A 3QQDB 4ZQKA 3MRHB 5CF3A 4F7EB 4GRWB 1LNUA 1T21A 2IH3B 3NSYA 1IJ9A 5FF6B 4A68A 4AGLA 4JHAL 1B6DA 4NUPA 2KC0A 1G9NH 4J1UB 2HKFH 3F7KA 4ZSOA 1EEYA 3DMMD 3H2QA 4JPIB 1YEGL 3EYSH 1MFAL 4LXFA 1VERA 3T4YB 1IGJA 5LXGL 1Q72L 3NSXA 1KTCA 4JLRB 4N8VG 2F19H 4MB5A 4FA6A 2HYMA 3KR3H 3FFCA 2H6PA 3EFFA 3D07A 1S7XB 5F70A 1ET5A 2DYPA 2FX7L 5EZOL 1WZKA 4MXQC 3V4VH 1MRCH 1B3IA 3GEFA 3A4DA 2F53E 5KSUA 3LN5B 1LP9F 3LPFA 3RVTC 4Y4FC 4FCHA 2PYFB 2NY0B 4FKKA 4PLKD 4XN7A 1OE2A 4DKTA 1OF2B 2AQQA 3EOYG 4Y8AA 5DD6A 3RHWF 4ZMTA 5CEZL 4R2GB 1DEDA 4NZUL 4B95C 1MAML 3KJ4C 1R3LA 1KWGA 1LD9B 1T5WB 3QUXC 2FX8H 1NDMA 5GIRA 1BVLB 4PJ9B 1DBBH 2VDNB 3G6JB 3GIVA 4KNSA 2X4OA 1ZT4B 3JVFC 1LMKA 3MRNB 2X7LA 3Q13A 1QKZL 3VFVA 1NLDH 1ORSA 4NFDA 3VTTA 2YAHA 3MLWL 4H44C 5DHVA 2HT2D 3TV3L 2RFXB 1MWAH 3SPCA 4BD4A 1JG9A 3L1EA 2KLTA 1JRHH 4JREC 1ZT7B 1NFDE 1UM4L 3E2HB 4H8HA 1WJ3A 2APTA 1FHGA 2XKNB 4NC1C 4A7TA 2CRYA 5HVFB 4PRIB 3WLBB 5HVHC 2AQTA 2P5ED 4XCCH 5AKSA 1JHLL 5IBUG 2ZAHA 4FFZH 1BFVH 2G4GA 1UYWL 2W65A 5F3HB 1U3ZA 1AD9A 4YSSA 2VZUA 4U1SA 4U1NB 2YIHA 2ZUWA 5KSBF 3HPLB 4EBQH 1IT9L 5LGYA 3KPSA 1TUPA 3G04B 5CBEA 2Q0ZX 2AJ3A 3MHZA 2KDYA 4H2AA 2PWDA 5E2JA 4Y2DC 4FFWC 4QTFA 3O2DA 4W4OC 3FSZA 4L4VD 5IFJA 1E65A 3M8OL 3MO1A 4X0KB 4H0HB 1IEBA 2X9WA 2HVJB 2HX8A 3IRPX 1UXWA 4W6YB 2ORBH 1WD8A 2CCLA 4N20A 2HJLB 4BUQA 2OQJB 1DJXA 3BRGC 1KLFA 4CILA 1GS6X 3HKZA 4U1GC 2GT9A 5K9QG 4LL1A 5MEPA 3GXIA 3C9NB 1XH0A 4XHJC 5BXFA 4Z95L 3MLXH 2W81C 2X6BA 3WFHB 1KTRL 3O3UN 5DZVA 3WLWC 1KB9K 5LNDA 3H9YA 1MLBB 1XSOA 4U3XA 5T3XD 5CKGA 4J4PA 5FGCE 4GSDL 3EJYD 4XCYB 4GAGH 3CBJB 1DQIA 3JWOL 5BS0B 3K8LA 1BQUA 3QDAA 5C07A 2NNRA 5FA3B 2Q6WB 2NY2D 2B39A 2WKOF 3O8XC 1MCNA 3DYPA 2BWIA 1HHIB 3LN4A 2Y9RT 4ZPVB 2GY5A 1R6VA 5AZEH 1UJ3A 1SHSA 1YQVL 2UZXA 4NYLA 4WEUD 2Z1PA 5E2UL 4AUUA 2A6JA 3OWRA 1NAKH 5A43C 4MMXB 4HPYH 1D7FA 4LU5L 3HB3D 3K1KC 5BRZA 3WFCL 1VACA 1VGKA 2BFVL 3MOAH 1OHQA 4N87A 3FUNA 3GS4A 1OKEA 3SQOL 3R06B 1KZQA 2XFXA 3VRIB 3FB7A 1GY1A 5DCCA 1IGIH 3V7AE 2K9UA 1WE5A 4W6WB 4XWOD 2P8LB 1EHLH 4H5SB 3QFGA 4ZTOH 2CPCA 4P5TD 3FTYA 5LNEA 5E6IA 5KW9H 3D18B 4JW3A 5IEHB 5TQ2L 1U8KB 5J13C 3QNZA 3LZQA 3VGFA 3AXLA 4H4NA 4A6YL 4POUB 3CXDH 4L8BB 1NGQH 4L0ZA 3OB0K 1BQKA 1IUZA 2BFGA 4WNJA 3UPCA 4AIOA 1MOEA 5FGSA 5J1AB 3SQRA 2WXPA 3ULVD 2ICWA 5CGBA 2H3NA 3HMWH 5I16B 4O5LL 4FGMA 3PP4L 4PCYA 4G1MA 5HDBB 3MOBH 4QY8A 2PTVA 5BV7H 2CKNA 4NO2A 4JR9L 5EO9A 1PLGH 1AMXA 2J73A 4HUWA 4M3JA 4PG9A 3FAXA 1A7QL 3RWCA 1DVQA 3ILEA 1AP2B 3IJEB 4JY4B 4KKBD 4NOBA 4ODBD 1AGDB 1O5PA 4RFNB 4XPTL 5HI5C 2VDMH 4KU1A 3BWSA 4LHUB 4B9JA 3DJRA 3ESNA 4NZJA 4FXKC 1AE6H 3A6OA 3BE1L 4LDEB 3SGJC 4PJ8D 2BSBA 1U4EA 4DKFL 3LDBB 4F37K 2EEBA 3VO0A 2BSSA 2EE3A 5KN5A 4ABVA 4I48A 1E6JH 1KYDA 4JFOB 3BJLA 2IGTA 4ISVA 1MFNA 4C54A 3CU7A 4O02B 1QBBA 1F02I 2FDBP 3VA6A 3BAEL 3V0AC 1T1WB 3R7QA 3I50H 2E9JA 2ZOWA 4WHTA 4Y0GA 5CEXB 5KTEH 3OB0H 4P4KC 5SWSA 5FO8B 1DZBA 3AMKA 4K23H 3K71A 5D72L 1G9ML 4OZHE 4QT5B 4UQBA 5CUSH 2Y1YA 3LKQA 4N2FA 5GGQL 3NFPA 1MIML 4NKDA 1BM3H 1F00I 5DD0L 4P57B 4N0YH 4OTXH 4LKCB 3MFFA 4GSXA 1B2YA 3U25A 1MFDL 2CIKB 3U46A 2B16A 4I3GA 1RZIA 2A5UA 4TSBL 3RY6A 5IFHL 1JTPA 2A4CA 4X83A 4N1CA 2W9EL 2CO7A 4ANXA 5HHOA 5L0QC 3JXAA 1N59A 1KIQA 5AVZB 3TT1H 1ZS2A 4ZXBA 3WFDH 5IB3A 2AV7A 3QQ9C 4F57L 4QHMA 1FBIH 3EO1A 4OM0L 5FYJE 3ZL2A 3PWPE 5E2VL 4FP8L 5AOJA 4AH2A 5FDWB 1QSZA 3LEXA 4GEJA 4HJTA 4L3AA 4NXSA 1F2QA 3MJWA 3KPLA 2IPUG 5I76A 2QV2A 1JNNH 2HUHA 3FU3A 1RJYB 5IQNA 2AAAA 1NQBA 4Y88A 2Q3AA 3RL2A 3DVGA 5AYTA 1ZHLB 4A37A 4HS3B 3T3PF 4DOHB 1KOAA 4WWOA 1ACZA 4P9ML 3EG9A 3UTSB 4LSPL 3W0WD 3MV7B 2R69L 5D7JB 1VPOL 3VA2C 3WKMH 3OPZL 1P7BA 1V7MH 1OLZA 3QO0A 2WBJD 1NGPL 4Q9QL 2D3JA 1MH5B 5BO1H 1Z0NA 2J1ZA 4XNYL 1J8HA 2V6HA 4RGMB 1USZA 3SD5A 5CD5D 4Y4HB 3FYEB 4MX7B 1L0QA 4JPKL 4Z7WF 2HSIA 2FECL 4L1HA 3Q8AA 1KPUA 2P47B 4JGMA 2JJSC 2EDLA 3ZE1F 3X3FH 2VDLL 5EBMB 5K9QI 3QS3A 1YNTA 2Y06L 3GZPA 3HUJE 3RUGE 4A2FA 4Q6YA 3II1A 1JPEA 1NCDL 1P6WA 3E6FA 1I3RB 5EWIL 3QHZL 5D96B 1FPTH 3W37A 3MCKB 5IK3B 5SWZB 2FL5B 1JGIA 4FERA 1CLCA 4PH8A 4XC3L 5FKAB 2YO3A 3RVVD 4L1LA 4UZGA 1AHWC 1ZT1A 1NLBL 1P5UB 5DJDB 1OT1A 2F1BA 4HCIA 3HKFA 1FVCB 4BSVB 4DVBB 4FLSA 3OC5A 1WK0A 4I5BB 5FHBL 3O41A 4Q6IC 4KXDA 4HOMA 4S1RL 4KZDH 3S5ZA 5KZCD 4YZWA 4DPBX 3OKKA 2AEWA 2XV0A 4NCDA 3VXMA 5KYUB 1M7UA 4JO5A 4E9XA 4OZGF 4N3UA 4L48A 4ZAKD 4OCYL 4KMLB 5DVMA 2VXUH 3BZ5A 3RQ3A 1QBLH 2Y5TB 4HXAL 1NMBL 3QS2A 4LB8A 3EO0B 3QULA 2K6ZA 4R7DB 1FL5B 4RGNB 3K6NA 2ITCB 4LSRL 1JGDA 3BCDA 4AMWA 4YHNB 1B4JL 1T03L 2FJFA 5AW3B 2GITA 2ZXAA 4N85A 4YIQB 3T65B 5CLWA 4NWUH 5TE7L 3LEYH 4F2ME 4OJYA 5ES4B 2QZQA 5F97E 1AO7B 4HLJA 5F1SA 4ERSH 2ZYIA 4X9IA 3QNXB 1A7OL 4AITA 3UJJL 1QBML 4OVUA 2GUOB 2GJ6D 2H4EA 1IRAY 1OCWH 4FS0A 1T0NB 3J2PA 5ESAA 1HVXA 2BJML 3ECQA 2W38A 2X4TA 2VRKA 4KZEH 1AFVL 4M4PA 4NQDD 3SYOA 4FTDA 4FX5A 4AT6A 3NAAL 3NCBB 4HDIA 5DA4A 2MOVA 1Y1UA 4IDJL 4X5XB 1JHTA 1P1VA 4DKAA 1XGQA 1RKRA 4GAYB 1HHHA 3O6KL 1AQHA 3BP5B 5ACLA 3QARA 4HIEA 4J3WA 3ARGC 2Q3ZA 4IDLA 4NDMB 5F7HA 2J43A 4BFBD 4N2BA 1CFMA 1U33A 2G75A 4I9XA 1G7JA 1SN5A 2O26U 4Z7OB 2LLGA 35C8L 2YD0A 3EGSA 3QR2A 1RFDL 4GUPA 5TF1L 1F4WL 3QP3A 3ZKXB 5BJTA 1X7QB 5C0EA 3QWOA 3KLHD 4HAKA 4MXWL 4WFGD 4XN5A 3KDPB 2YBRA 4W9ZA 1YNKH 1ZXQA 3H3KA 3NZHL 3IMVA 4IKLA 2YA2A 3CPUA 4DUXA 4XXCA 2Q76A 2WUBH 4JO4H 3SO5A 3BUPA 2P8PA 5DZOA 1UATA 2VCOA 2PP8A 4HD5A 4E41D 5TDNB 3RTQC 2ATPA 3TYFA 5JHLA 3ZDXB 4JGNA 1RUAL 1N8ZB 2Y2WA 1KJ2B 3MRGA 1C8PA 3MRRA 5D1XA 4N0UA 3GXTA 1HJCA 3K3QA 2WCGA 3IJHA 5I0ZA 4Y16D 2MMXA 1U8HB 4Z7UA 3UAJD 2A9CA 4RSYA 1PGRB 1W0WB 1E4XI 5D9SA 5DQJB 4UT6A 4HX1A 4EVNB 2AK4E 4QRRA 5HYFA 1KXQA 3PHQA 1YMHB 4MB1A 4ZUUB 4N9GA 4J8QA 4QRPB 2DTSA 5T1KD 2NXZD 4W4NA 1GW6A 5CZXD 4JFTA 4ZTPH 4OV5A 3B3IB 5SX4I 1RJLB 5D5MF 1UGKA 3IS1X 5IF0A 2YPLD 4ZPTA 4WW1A 1HXYB 4PU2A 3I9AA 4OIIH 2J44A 5JQ6L 2X89D 3RGHA 4U7MA 1A0QH 1KCUL 1PEZA 2VZVA 3BKCL 1NCCL 3TH4T 3B9EA 1I1RA 3IWVA 1NPNA 2AJSL 4GRWF 5IBUB 1MFVA 2H2SC 3FC8A 3P30L 1UWFA 4LKXA 2NY0C 1BZ9B 1IO4C 2WUCH 3W9EB 1AOZA 3RWGB 1AGCA 1HN1A 3PIQB 4ZO7A 1QOKA 2B1AH 3WFZA 5GZNC 5IP4A 1GAFH 2VH5L 3ARSA 5A2IH 3BDXA 4JX0A 4PGDA 1CT8B 1OTSC 4X5LA 4XB3A 5GZOA 3WHXB 3OJMB 4NT6A 1KTBA 2ZD0A 4XAKE 3PQYB 4PJ9C 1BBJA 1IM9B 1T66C 1TMQA 4DK5A 1ZANL 2DV6A 3GB7B 2QQNL 6CGTA 1JZ6A 1WFTA 5T5NF 3L5WA 3N42B 4PP1D 1Q1JL 5ESQA 3DX9B 5IB5B 4JANA 2QQLH 4L3EA 4WNQA 5CMAA 2QVTA 3VXRD 4MNHB 1TPXB 3E2HC 4M8VA 3GSWB 2HTLD 3TPUB 2PPEA 1YMMB 1QLEH 5F71A 4H8UA 3O4LB 3PP3H 3G6JF 4IIQC 4G6AD 4TVPL 3H9HB 4O51A 4ODUA 1KYUA 2NDGA 1S8DA 2OJ1A 3QIWD 5B8CB 1E5BA 3KAAA 4MNQE 1W15A 5CGTA 3SDAD 4HIIB 2IWGA 1SJMA 2Z93B 4BJLA 4HIJA 4P2RD 4D0DB 3VD0A 1OSZA 4WI8A 1SJHA 4FQQB 1RZ7L 4YE4H 5AQ0A 5KVGL 1UD4A 5I15L 1EGJL 5DD1H 2QGEA 4H1LA 1IIKA 2HG0A 1I75A 2FO4B 3UYPB 4HJIA 1HOCA 3MCYA 4BQCA 2YGPA 3VFUA 3BEVA 2YPVH 3VXSE 2DQIL 3S3PA 3VX0A 2DQGH 2IDQA 2Y6SD 1LP9E 1JN6A 4X4ZA 3AY4A 3K6FA 2VYRE 2K6YA 1LO4H 2JIXA 4U1JA 5D7EA 3IDYB 4FKEA 4XCFL 1RMFH 5MEOB 4MA8H 5KVDL 5ISZD 2NTSP 3GHBH 4ADJA 2IC2A 4NIYE 3L3OB 1YEKL 3T2NL 2PCYA 4P3CL 1KTLA 3CVHH 5AOIA 1EXUB 1N10A 1IL1B 1J0IA 4L4TA 4UNTA 2YA0A 4QHLB 4EDWL 1JYVA 2WXNA 3FQ2A 2Z8RA 4G6FD 4U6YB 3ARFB 4LSVH 3TEXA 1SM3L 1QNZH 3KPOB 1GL4B 5DHYB 4PLJD 4BKLA 3CSYA 4HAFA 3WUWG 1V3KA 1PDKB 3QPQD 5F7EH 2WB1A 3EF4A 4PRDA 2E4FA 4V1DE 1OM3L 4KK5D 3DROA 4OLUL 4Y5VA 3X1GA 1QW9A 4XNUH 2EO7A 3V0GA 4R83A 4UNVA 5KSBE 3EOBA 2C1OA 3VG0L 4KWUA 4FC3E 3KVDD 4HZ1A 3HG2A 4D9LH 4Z78B 3DHJA 4KRPB 2IAMD 4HUVB 2LQRA 1A25A 1TKWB 1INDL 1YVLA 4PRBA 4DGIL 3T0EA 4NC1E 1N4XH 2GTZB 4AM0A 3PLYA 2AGJH 4KXZH 1FC2D 4M7LL 5D6DA 1WEJH 2DD8L 4J3OH 2EIBA 4X8JA 1E4WH 5E5MA 1GS7A 2QVMA 2YZ8A 3NACL 3RPIB 5FKPA 5I1HL 3VXUB 1SPDA 5CSBA 1A6UH 3X3GL 2FB4L 3DUSA 1UCTA 2ZZUT 5IB2A 3ASNB 1DCEA 3APDA 1HAWA 4QGTA 3ZBMA 1ACYL 5IMOB 4EUPH 3EOAB 2EYRB 3JTBA 2NX5A 4GG6A 3HZKA 3HC2A 3UTZB 1WZLA 1L5GA 3VFGL 1JNHB 5F96H 4PCTA 5CEZD 5L9DH 4KQ4L 1WITA 1UB5B 1WAEA 2G0LA 4BUHA 4DF9A 2BWQA 3U2SB 1B88A 3DX6B 1UWXH 3MNZA 3VJ6A 3QJHB 3GZOA 2WWKO 4MMZB 3V0WL 1JOIA 2BNRB 5HDBF 3NA4A 4ZFFB 2HX7A 4L23A 2A9MH 4I0KA 4XVUD 3L16A 3U0TA 3LDBC 1Q9OB 4MCNA 3QXWA 1GZHA 3QQ4B 1OL0A 3DTDA 2PWEA 4BBWA 4G83A 1IGTB 3O6LH 1SXSA 1L6XA 2XYBA 2Z8SA 3VXTB 4AVIA 3F04A 1LWJA 3DYMA 4KZ0A 5DHMC 4YNYB 3NCYP 5L2JB 3MYZA 1KPRB 4KJYB 1IBZA 1OSPH 1HI6A 3PYCA 2PPCA 3C6SB 1KLUB 2IAAC 2EE2A 5C0BB 3OJDB 4CC4C 2D9CA 1Y18B 2WZ5A 3QEGL 3CHQA 1SQ2N 4HJ1A 1M7IB 4JVWA 1D2OA 5BUGA 3ARDA 1A9EA 3BYTA 4L29B 4WLCA 5I6KA 4GP5B 5IW6B 3GRWL 3FJTA 4X7SH 3F65A 2B2XH 3FN0H 4OZFA 1QO3B 4UQ3A 2G3ZA 5IMMA 4XXWC 4ZUWA 2VQ1B 5JIDA 3MGTB 1XIWA 1BZ8A 3CZSA 1WLHA 1HHJA 2JELL 4JPVL 3UC0L 5FYJH 2ZXBA 3RG1C 3SODB 5JR1H 4BGLA 2XU9A 5L4JA 1NBZA 5DMKA 4YDNA 1D6VL 3LMJL 4IBZA 1JZGA 4Z0XA 2BVPB 3KPNB 4M9OA 5G4NA 5EA0H 5CZRA 3EHBD 2A74B 2VLJE 5I1GH 1T1ZB 1VADB 1XT5A 1SBBA 1YYML 5JW3H 3DA0A 2JTYA 4LLYB 2EIEA 1OARL 5KYYB 4K0OA 4TNVK 4I1PA 1WWAX 4LCIH 5KSVB 4RGMC 3S4SA 5AWNL 2R23B 5IVXA 4LLQB 2QJDA 1A6WL 1Q0EA 4N3TA 4Y4HC 2VC2H 2X4PB 4JQIH 2ZNWA 1MY7A 3OXRB 3O8XA 4DO4A 1IB5A 1MHCB 1CFQB 3DMMB 5C70A 1B4RA 3GC3A 2P5WD 4UANA 5KVFH 2CA3A 1UKSA 3KPMA 1KGUA 1YCSA 1WBYA 3F58H 3ZKND 1U8CB 43C9B 4X6CB 5D96C 4UBDC 4RDQG 1U3HC 1J0JA 1RUKH 3CDZB 5EU6A 5I1DB 1S9YB 1GYVA 5AD0A 4JDTH 4LSUL 1G7LA 1P5UC 1CBVH 2BDNL 5CZVL 3BKJL 1F42A 2NNAB 2OZ4L 2G5BB 1IKFH 1RZJH 2C9VA 2XQBH 4LPTA 1DVFB 2PMZA 2RD0A 1I8MA 3VRJB 1WFOA 3G6AB 4J2XA 3SPVB 3ARPA 3NFSL 4H8WH 5KUMA 4Y2LA 2FSDA 3DURB 4JKKA 4KTEH 4NBZB 1ZSHA 1A4CA 2ZYSA 4UV7H 1JPGA 2C1PA 5CILL 5C8JB 4XCNA 4M43H 1EMTL 2XZQL 4GQZA 4IMKC 3QB7C 4UB0H 3RWIA 3SKJL 4G6MH 2BP8A 5F89B 5ITFA 2PNDA 2I07B 3CMOH 3T3PE 1C8QA 3QG6A 4JHWH 3C60D 4JDEB 5BOJA 3V6ZB 1YZZA 3TIDA 1I8KA 1XTLA 2P5EB 5GS0L 2VMCA 3F7VA 4RGNC 4IK6A 2AKRB 1ADQA 1I3GH 1L9NA 3CFNA 5HHNB 4ZJ9A 3UBXB 1ZJBA 4M6NL 3FQTB 3GI8H 5F7KC 1FF5A 1UH2A 1A7RH 4A04A 3AS0A 3BQUA 3LS5H 3MXWL 3MRQA 4UUJA 5A3IC 1WT5C 2ZXWB 3CLEL 4Z7WE 1L9PA 3VI3A 2EUWA 3X12A 1AGEA 3IJ8A 2UX6A 1BWMA 3ZE1E 4WF7A 1URZA 4L4VB 1TO4A 5FYKU 4CVXB 3P2TA 5I8OH 4DGVL 1K85A 3QFDB 3ZTJH 5IUCA 1AKPA 5HGAB 1RZQA 3VTAA 3F8UB 4KMQA 3G5ZB 2Z8WC 2A99A 4OM1H 1OGAD 2QELA 4MJID 5J1SC 5AOKA 5KJRL 1Z3GL 4RNRB 3K72B 1H0DA 1RUPH 1EHAA 2J3SA 3SYPA 1OHZA 2R56H 1C1EH 4JN1L 3CDFA 5H94B 3TF4A 2H1PL 3L3GA 4LCCB 3V4VA 4ELMB 1XH1A 4XB8A 1UZ8B 3VMNA 1WCBA 1C5BL 2ZXEB 4XPFH 3QH3A 2AK1L 4A2GA 2R4SL 2V2TB 4UQDA 4PP2A 5BNXD 1JAEA 5HYEA 4AY0A 3SYQA 4M02A 4ECNA 1ODAA 2X6CA 4LFHG 1DQTA 1B4TA 5DEFB 1A9BB 4GQ9L 4JS7A 2NY2B 5G5DA 1JGEB 2J7LA 4YFEA 3HOGA 2VDOL 2OMWB 3FCBA 4CBZA 1DBJH 2ADIA 2IH9A 3FF8A 5F7FA 4X98B 1OQXA 5DK2A 4IU2A 1T7VA 1MWAA 4APXA 1IAMA 1I1AD 1E9QA 1Q8MA 2DLGA 3FSAA 1R5WB 4HWBH 4ZODA 4ADIA 4Z7OF 2NY3C 5CGMA 1KV7A 2YQBA 3BZEA 3JWDC 4FG0A 2FQGA 4PJEE 3A3YB 5C2UB 5JDSB 1XXFC 3K0WA 4KTDL 1EBPA 2NMSA 4LCVA 2OK0H 2R1XB 4FI8A 3B9VA 1PZCA 3DIFA 4G7YH 4ODHL 4X99B 4FFZA 5D7IA 3HC3L 3D3VA 3OXSB 4P5TB 4WRLA 3PWLB 1RJZB 4P99A 2XQYK 2VISB 3QUGA 4X4YB 5IOPA 2G2NA 1PKOA 1DJHA 4OGAD 1ZS8B 3B43A 3DDFA 5D6CA 1W6WA 3CIAA 2F7OA 2FUTA 1KTDA 5E1QA 3RAJL 3FOMB 3CV5A 4ELKA 4YQXH 5DK3A 4N2DA 2ATKB 2K8MA 3MLTA 4XPBL 3HRZA 1MCKA 5EOTB 3ZDXF 1YECH 5GS2D 5HGBB 1XFPA 4Y5XA 2E9BA 5K1VA 4W9KC 1YLBB 4YXHL 5J8OA 3DV6A 3HZMB 3HCVA 4JFQB 4NJAL 3WNIA 3CQPA 1HXMA 2IADB 4HFUL 1JK9A 4CC1A 3CPLA 3OVUB 1UVQB 5JQIB 2EQDA 4X2UA 2NZIA 2FO1A 2H26B 4KUZH 3EJPA 3I75A 4MNGA 1UM5H 1F18A 5I1KH 4A2LA 1ZY9A 4PG2A 4P9HC 3P9WB 4U49A 1RUQH 5JHDE 1XGZA 3CCHA 3KDMA 3OHXC 4PJ8B 2YC1A 1OTUC 4LSSL 3L3JB 1S9WB 1I1YA 5HVWA 2ZTBA 3RLSA 2YRLA 3LKNB 2FBOJ 3WEOA 5EH1A 5DGRA 5DYOA 5B21A 3UTPE 3BH9B 3PRZA 4C83A 3E38A 1INEH 4P4RB 5CINL 1FYTA 4YDIL 2WQ8A 2WXFA 4W9CC 4W93A 2GBAA 1QSEA 4PJHB 1AR2A 4BHUI 4KQ0A 1GOFA 3BPLC 1DBMH 2O30A 5DYFA 4ZBJA 3BGFC 3RWDA 2BXYA 1A6VL 1PZUB 3DSNA 2QSQA 1NDTA 5AVQB 1NSNH 3WAKA 3IDJA 1TJMA 5TQ0H 1YN6B 4LRIC 1K2DA 4GW1A 4NO3A 4Q4EA 3Q8BA 4UTAL 1Q0XL 2FZ3A 3TO4D 1TPXC 3H7LA 1EJ6A 2WQWA 3B5TA 3ZTCC 4HULB 2HKHH 2R29H 4PJBA 1FH5L 3TU6A 1WIPA 2W60A 3P4NB 3G5WA 5B8CC 3I9IA 4C59B 2ZNXA 3N42F 3N1MC 3GKWL 4WWID 5TPWL 1QFUL 1BV8A 2F9BT 1CFTB 2IMNA 3VSUA 1L7IH 1R3KB 2ZWKA 3H8NA 1U8NA 5IHBA 3NCWA 3RGVA 4AL8H 1NBQA 1H6EA 5IMLB 3ILQC 3L13A 2X4SB 3WUWB 4PRHE 3VFRB 3VDAA 3JZYA 3R4RA 4H13C 4LOUC 1H3VA 2XG4B 2Z7UA 2HT4D 2WBJB 2XPYA 3ARGA 1FZJB 2ZX5A 5J4MA 2YD6A 3TWYA 1UD3A 3FK3A 1Y07A 4JQXC 5CR8A 1X5FA 3HI5H 2OXGA 3QIUD 1YJDH 1VFAA 1YYLH 3S5LG 1GTNA 4TQEL 5GGSY 3RJDA 1QFWM 3IDYC 1L6PA 3MLRH 4QF1B 3TJHD 4G8GE 3UG3A 5LO7A 1MCLA 3IJYA 5F6IC 3ZYJA 4OD2B 3N6YA 4N5UA 5LHDA 1SEQH 4NAQA 5HHVH 1S46A 4BH8B 5BZWA 1SOSA 1BMGA 3WSQL 1LXMA 1T80A 4HJEA 1G7IB 4LE8A 3G7TA 1JTOA 2CHDA 5H4YA 1JGVH 5KWYC 1S78D 2F5BH 3WMQA 2CLVB 1F11B 3P0YL 3T4AB 4Z7VB 4B9CA 1D5BB 2HH0H 2O61A 1MUJB 1SXBA 1Z9SA 5DLML 5J5EA 3P4MA 3N50A 1JZDC 1AYOA 4G9DA 3HLAB 1KBPA 3TO2B 3NN8B 4J12A 3G6JE 3L3HA 4K3JL 5E8PA 3UGXA 2AP2A 3M1BA 3SQBB 2GBTA 5E23A 3STBA 3IE4A 1N64H 2EDNA 5KZCB 1U8MB 4KRPC 5DWUH 4HUUA 3MLPA 3LQAL 3SDDD 5EC2A 5JHLL 1C5DA 3PWVA 1D7BA 4LGPB 2D3NA 1CL7I 2VSDA 3PUCA 4FEMA 4XCEA 4ZAKB 4NQSB 4PRIE 2IV9A 4OI9A 4BWWA 3RKDD 4DW2H 5GQBA 2BS8A 2ZCKL 2W0FA 4OH2A 4URKA 4A7QA 2SODB 1JZJA 4B50A 4P07A 4BRVA 1K72A 4PS4H 4GFTB 1H6FA 2EEXA 2YQ3A 4C56D 3PJSA 4M6ML 5HJBA 3FQNA 3WNNA 1LK3H 4WZ9A 4ZMVA 1G87A 1JXJA 2FEEL 3EH2A 1N26A 3E9TA 5CWSA 4KHXL 5E00B 3BZ4B 2CUHA 4JKLA 1FFNB 3TCLA 3WDHA 2HG5A 5DO2D 4XBGB 4UT9L 2LV4A 1SVCP 3ULAB 3HBZA 2DWXA 3VVWA 3V0VB 3VFTA 3VMOA 1ZLWK 5KTEL 2DWDA 1PW3A 4NNPH 1ONQB 1ID2A 4CW1A 5C0GA 3OKLB 4HT1H 4JY6B 4MDJB 4NQDB 4FULA 5T3XH 3W81A 4AEFA 5D8JL 1HYSC 4AQ1A 2NY5H 4MMZC 5DZJA 4JFPA 1AANA 4AKPA 3IPEA 2XN9A 4CVZB 4XZUA 4RAUA 1MCRA 5HDWA 3QUZC 1KZYA 3G5XB 5E8DL 2X05A 3ABMB 1IGML 3R8QA 5J3HC 3CFBA 1P7QD 5ILTH 3K8KA 3BFQG 5BS0E 1UQSA 2A77L 1IC4H 3GO1L 3ME0B 3MGOB 5LXVA 1XGYH 4JFYA 5L2KA 4GP8B 1SYVA 1DP0A 4JDZA 3MLYH 1HHGB 1Q9KB 4K7FB 4HKJA 1U92A 4I77H 3EYFA 3HIZA 2PYEA 2D7PA 2WN2A 3JVGC 3GT6A 5FW7A 1RZGA 1OT4A 4R7VA 4RZCB 4DCQA 1A9VA 3WAJA 2Z4TA 1L9RA 5F9WB 3AM8C 3HVNA 1GHFH 4X5WA 1NCAH 5AG8A 2ZOUA 1TEFA 3TYGH 4IIQA 3AU0A 2X1WL 4X9GA 1A3RL 2CWRA 3D1MC 1O9WA 4ZW7A 3KXFA 3HA0A 3ETBF 3A67H 5CSZA 2OYLA 1JGUH 4E41B 5GSRA 2BSTA 3O2WL 2XX0A 3IVKA 4ZW5A 1D5IL 2J88H 5F6HJ 1YEIH 3D0LB 1TZIA 3MA9H 3C5JB 4TVSa 3S8FB 4HAGA 4L0YA 3NTCH 2GHWB 1XGRB 2WY3B 3ZR5A 3WTUA 2M1KA 3D39D 2X70A 2W0PA 4H8QA 2EE9A 4D7PA 3FXIC 5CIPB 3DBXB 4RESB 2OTWB 3JV4A 3L4YA 2A2QT 4UMSA 4TSAH 4WWPA 1OP3K 1GW0A 2J8UB 1YEDA 4KVNL 4K8RC 5TDPA 2CGRL 3G5VB 3SPHA 1WWBX 2IDFA 4RX4D 5JDJA 3VXPA 4L3FA 3S98A 3MGAA 3IDMB 5A16A 2JK5A 4ZUTB 2HRPL 1DQDH 1R5VA 2MKWA 4AYID 4J8RA 3M45A 5T1KB 4CSTA 2NXZB 4I1RA 2ARWA 1KC5H 1X5YA 4WFED 3MLUL 4C4KO 2J56A 4LNRA 5IG7A 3H0TA 1KIRA 4MS8D 5FGBA 1P4LA 2C9SA 1XSJA 4JFDA 1G0DA 7CGTA 3VDCA 1KN2L 1QSFD 2YPLB 1CDHA 2MKLC 2DQDL 3DMMC 3FYIB 4CNIB 1E50A 3EBAA 3ZU8A 5AW4B 4XXDB 3NJXA 3FL7A 4NUMA 1WFNA 2L3BA 4YC2B 1RZFL 1Z32X 3UIZA 1EHXA 5C0AA 3ATEA 3NSDA 3U1SH 3CZFB 4XGZB 2DIAA 1KCKA 2ENPA 3D30A 4PLKC 3FRPA 3S5YA 4ONHA 3T8XA 4DT2A 3QUYD 3HE7D 4PTTB 4J5VA 5KOMC 1K4DA 3GXFA 2KPWA 5FUOL 1OP3H 4MBOA 3Q9PA 4KO5A 4X6CF 5AAPA 4MQ7A 3E3QC 1XQ4A 2ZUQC 5C3TA 3TURA 4HKBA 2NSXA 2NW3A 2HT2C 4O58L 1M6OA 3N9GL 1A6TB 4WI0A 3VFSB 2VDQL 3VXRB 3DO4A 3D7PA 5F7WC 4Q9RH 4K5OA 3U9WA 5JLZA 3S34H 5A1AA 3P2BA 2F54A 1A8ZA 2YMTA 2DMBA 4P59L 2ENYA 2DQMA 3P3RA 3DVFA 5GRVK 3WD5H 3WL9A 2MHAB 4OKVB 5E1GA 2WAQA 1YY9D 1ZHKA 1MRDL 3BGAA 3JTTB 3OKEA 3QIWB 3U4BL 4PWEA 5IMKA 3FFCD 1SQMA 3WN5C 2BP5M 2DYPD 3SDAB 4GSRA 1ITCA 4P2RB 4DOHE 4HLEA 1QA9A 2I85A 4N5ED 1XV8A 3UTSE 4FG6D 4QXTB 3FRUA 1JXFA 3MV7E 4TNWF 3RX5A 2A9DA 2C3XA 1HEHC 3ECBB 4A63A 2JJWA 5I30H 4ODTH 3I9GL 3D8MA 1BOGA 4OUUB 43CAA 1OE1A 4F92B 2B4CH 3POHA 4F9PC 3LIZL 3WEAA 4QO1B 1FGVH 2B1HH 3CC5A 2XRAH 3U4EA 1WAAA 4JFFE 4KKRA 2V4LA 4LCCC 5ISZB 3N1PC 2Q3XA 1TF4A 3MMEB 4U3SB 1H15A 2EYSB 3PABA 5DJXB 2A0LC 2BSDA 3EJYC 4TS6A 3F2LA 3WIFB 4GKZB 1TJIL 2OMYA 3FHAA 4JCLA 2FT8A 1F56A 4F58H 3CK0H 2APSA 2KL6A 5C0CB 2BVQA 2NY2C 1JFQH 4CMMA 4G6FB 4AUJA 1MG2C 4HZLB 2ZYRA 4ELMF 4W9EC 3KPSD 1F58H 4NM8L 1JHKL 3BISA 2TAAA 3MNWB 4M6OL 3P3YA 1TJXA 1NINA 2DKUA 2C9PA 4XXWA 3S96B 4PWJA 3HB3C 2FBJH 1P0SE 3MRBA 2FQFA 4LP8A 1CJYA 1ZV9A 3MKGA 5EBWB 2AC0A 1RULL 1OAZL 1SFDA 2EDEA 5HGDA 2IAMB 3VFWB 3ULUE 3QW9A 3FCSB 2PTUA 1MVFA 5E7FA 4P5TC 5EZLB 2GSIA 2K7QA 2V3EA 5ICZB 1F1DA 1YN7A 4OLYL 2WYHA 4R5VA 4LQ1A 4K7PL 4EN3A 2P44B 3ML9A 4HU2A 1DSFH 1EEZA 1DVXA 1I8UA 4G42B 2D8KA 4L37B 1NANI 2FR4A 5EB9A 3K7UA 1BG9A 1GGCL 2Y1VA 4PWHA 5DWPA 3IU3A 1G1KA 1E2WA 5C07D 2VSCA 3ULVC 2YPVA 4QD2E 1KN4H 4M6AA 2CDGB 1PZ5A 2G5RA 4UZUA 4WW2B 2P52A 2IFGA 4HK0A 3KCPB 1M3IA 4IM8A 3IK2A 2EH7L 1ESOA 4FLHA 2MCAA 1FORL 1KB5B 3HE6A 4YXLH 5CM1A 1U3HA 3DSFL 3B7UX 5BRZD 1USQA 4KKBC 4AX3A 1JWMA 3ULVF 3V6FA 1QR1A 3BSGA 2VJ0A 3CVHA 1P7KA 4MKTA 4XPAH 3HI6L 4U0RB 4DZBA 5E99L 3UTTA 2BW5A 2DOCA 4PJ8C 2VXSH 1TYRA 5E6YA 4I3SL 3KYNB 5E6ID 4Z7OE 3NGBB 2OJEA 5IB4B 1EVTC 5CP7B 4BQBA 4KHTH 2HPOA 1IX2A 2CJUL 3STLB 1HILA 4AYBA 4B3VA 5GS0D 2J6EL 3ALXA 2ZAGA 2FJGB 4FQ2H 1NCBH 4ODWA 3LSOB 2UWEA 4AENB 4E36A 1XF5B 2ILLA 4OQ1A 2VUOA 3PL6B 5D4HA 2WTOA 1QLRA 1WHPA 3B4NA 1C7SA 1S7SB 3D4ZA 4KMTL 5D7SH 3QJFB 4B27A 3RY4A 1P84J 3WEBA 3K4ZA 1GKOA 5IV2A 1G7MA 3RB5A 5AOLA 1QRNE 5I5IA 4BXVA 5KYXB 1E28B 4QOKE 4YO0A 2JKTM 1YEJL 4JO2L 4O00A 3IDIB 3US0A 3M7OA 2EEFA 2IQ9H 4OCSH 4ORZC 4YAQA 3ZDXE 2JB6B 2FWUA 4PJHF 5IJBC 4FLRA 4KAQH 4PR5B 3D25A 2XKUA 2X12A 2YHGA 2XZZA 3UJIL 5E94A 1BQHG 2D3VA 4AMKH 1Z9OA 2IV8A 4OFQA 4EI5A 1LMIA 3SE8L 1HCFX 3DYOA 4LLMA 5F21B 1UWYA 2EKSA 2MEJB 4ZMPA 4EUPA 3GMQA 2J2ZA 2ATAA 2P26A 4K55A 4AYSA 3H55A 5BVJA 5SX5K 3J7HA 4PV9B 4X6BA 2EILB 3EHBB 1FO0H 3MBEA 4G5ZH 4PM1A 1BPVA 4GKOA 4FJ6A 1E2VA 4QRPE 5SV4A 3NJGA 3CG8A 3FHEA 4NWTL 1G6RH 2WBJC 1T1YA 4GUOA 1E4KA 2BOCA 5D1QC 5K1JA 1DQQA 3BGMB 4LSTH 4OJDH 2CR6A 3OZ9H 2XWTB 3QR1A 3JWNG 1JXGA 5CD5C 2VTFA 3TT3H 3RJQB 1ES0A 5H37G 1MRCL 4N28A 3P77B 3L9EA 2P5WB 2V2WB 3RZCA 5HHOD 5DUMH 4X9BA 3TEWA 3ESVF 4M4RA 5F1NA 2BC4A 2XZCL 4ZXBD 4UQEA 4R84A 2IANA 2IOOA 2JB5H 1OAKL 3UEZA 1MCHA 3AXHA 3NA9L 2CKBH 4QRSA 5AVUB 4ZDHB 3D0VB 5GJTH 3RVVC 3QHFH 5ACMA 1M71B 1HL4A 2FX8L 5IBLD 3S37X 1MVUB 3OKMB 4PJGB 2G9HB 4S1QH 5CJXA 1IVTA 4ZMLA 3M88A 4OZHA 1UOWA 4GW5A 1U8QA 2ITDB 3BUYA 1NLDL 1A4JB 2X3AA 2YD2A 4PJDE 1I8AA 1Z0MA 3PQYE 3G08B 3ILPB 5GRJH 3S8GB 1JRHL 1Q9LB 5AZ2H 3L45A 4X6DB 5E8EB 4GW4B 5AW2B 4HIXH 2ZKXA 1INQB 1UA6L 1MY5A 3VD2A 1QWUA 3QXDB 1Z9LA 4JUSA 3ZYOA 1KGXA 1AIFA 3TNMA 1KIPB 4XCCL 4Z7VF 3VE0A 1UGNA 5TGBA 4FFZL 3V0EA 5BMFL 5H35A 5I5MA 1J8HD 4UIMA 4ZAKC 1KJ3L 1YMME 1NUDA 4NC2B 1HZHL 3C60B 3STZB 3V4PB 5SWQB 4JB9L 3EJRA 3PWPA 3F7PC 3DUHA 1BAWA 4QHNB 5C6TL 4YHPB 4EDXB 3B34A 4G7RB 4LEOB 3CIQA 2L7UA 3NZ8A 1HEZB 4JG1L 1UZ6F 4FJZA 4M29A 1PLAA 1HSBB 3LKRB 4YSEA 2IWFA 2NW2A 4Q8BA 1AG0A 3K2UH 1A1OA 1AR1D 3HAEG 1X5AA 2DMKA 1JGLH 1QATA 1KY6A 4BZ1H 4G8FA 3FONA 3ZRFC 4PCSA 2O6DA 4F5CA 3DGCR 4GINA 3VGAB 3GSNH 2CUIA 2WXLA 3IXTB 5HGGS 2ZUSA 2VITA 1ZWIA 5C6WH 4JQIA 5L4FA 3P0GB 2HFTA 5IJDC 1NZRA 3TBWA 1OGAB 4MJIB 2DH2A 3JBG7 4HCFA 5DJ0A 1TTCA 5FOJA 2EUXA 3ZLQC 1WA1X 1FNGA 5ANMB 1BZEA 4OLZL 5GRYA 1C7TA 4AQEA 2HN7A 3GLEA 4FYSA 5DS2A 3VD4A 3IRCA 1CXIA 1L6ZA 4PD4K 1MW0A 4OR1A 1G7PA 1J1XH 1MJ7H 5TH2B 3EFDH 3MJ6A 4PY8J 1DQJA 5CCKL 1PTZA 4MVBD 5FW6A 4UM8A 4P23B 3TCTA 5EEWA 2XSKA 5AZEL 4ZMZA 4LARL 3V6OC 3C87A 2IG2L 3BWAB 3QC6X 5FLVA 4OSUH 4PN6A 1K5NB 3HBQA 2BIMA 5I2IB 1QVOA 3UZEA 4BZ2H 4N8CH 4NGHL 4HKZA 1AJ7H 2JXMA 3KLHC 3P73B 1QLFA 4OLXL 4FF9A 2FVNA 2K70A 5F9WC 4HV8B 2BVUA 1AKJA 2Q87A 3Q8FA 1CI5A 4JFXB 4RISL 2K9FB 1EHLL 4AC2A 2ZSVA 5DTFA 1I1AB 1RU9H 1M9SA 4Z5RA 4GSUA 3ESUF 4Q9BA 5KW9L 1MRFL 4LLVA 2B20A 4H8VA 4MHHG 4HPHA 2Z9TA 4JZJA 5GRWA 4X6EB 5FO9A 2V17H 4AWJC 4QJ3B 1X6LA 1J0KA 2F8VA 4XODA 5LVEA 3CXDL 2P3YA 1KWKA 3VD9A 3EJZD 1E27B 5EIIA 4J23A 1JK8A 2GCYA 3HC4H 2X9XA 4A67A 3L2NA 1KEGH 2VKXA 1Q94A 3T0XA 4KH9A 2XN1A 4Y16C 4CADB 5FR3A 3GSUA 3QDGE 3UAJC 3PV7A 3GMPB 4F2MA 1JZ7A 4HHWA 5BV7L 2EC8A 3FTSA 5L6YL 1PLGL 2VL5B 2DICA 3T77B 1KYOK 5CNHA 4NM4H 1UEYA 4BWTA 1XCTA 2CXGA 3A6BL 1S4IA 4YHYB 1J05B 2VDML 2F7PA 3DXAA 4WI7A 1U93A 4GAJL 2YRBA 3VFOB 4AM0Q 5CJQH 1GIGL 4MJ5B 5CZXC 2OS7A 3SHSA 1AE6L 4MD4B 3DPDA 4NHCH 5C0DB 5EU5B 4Q74A 4WTQA 4RVBA 3WS3B 3GUFA 5DS8B 2J8UF 1E6JL 1LE9B 2WWKT 1IARB 2A9NL 1TLKA 1C12B 3AZUA 3KEDA 3PXHA 4KC3B 1IM3A 5C0ND 1IKNA 4YC2C 4WUUD 1HCZA 1R5IA 1E42A 3C5SA 1K8IA 3BESR 5GPRA 3PWNB 3FTXA 2CK0H 4K23L 3SE6A 1F8TH 3PHAA 5D1XD 1KUMA 4LBAA 1LYQA 1BM3L 3AQYA 4G70B 3WMSA 4N0YL 1JPTH 4OTXL 2PTTB 2IH1A 4FNQA 4HWBA 5C0BE 1UHVA 2ZX7A 5IJKC 3Q5TA 1UT9A 1URIA 4QRRD 1I3VA 5HSFA 5TTRA 1WFJA 4CDHA 2R0KL 3HLKA 2IGLA 3RYMA 3K2IA 3TT1L 4G7VH 1YEHH 2G2RA 3FOLA 1FZMA 3LKOB 1FBIL 4G9FE 4E5XG 1S7UB 1AXIB 4PP1C 3TOPA 4ZOAA 2DM4A 2CNZA 2YKLL 1HIML 3QRLA 4UTCA 3SGKC 3GGWB 4YSRA 3TO4B 4M5ZH 2L4OA 4S1DD 2HTLC 3GMMB 5CCGE 3ULSA 5E1AA 1JNNL 4PGZA 5I8CA 5DEZA 4NHUB 1JE6A 3K6OA 1BFOB 1NOFA 4G6AC 3R4DA 3PUUA 4K3HA 3QIWC 2DJ4A 5J11B 4F8TA 2ESVE 5L88L 1NDGB 5PAZA 5E6RB 3WKML 1W72H 1PNCA 2AK4A