1KEML

Catalytic antibody 28b4 fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRFSQSIVHSNGNTYLEWYLQKSGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Catalytic antibody
molecule keywords 28B4 FAB
publication title Insights into antibody catalysis: structure of an oxygenation catalyst at 1.9-angstrom resolution.
pubmed doi rcsb
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1996-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kemL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kemL01
1T22A 5D1QD 1GAFL 2FCBA 2Q3ZA 2VUOA 2CO7B 3QDHA 4KPHH 4L4VE 4RBPK 4X6FA 2HFGH 1CTNA 1Q9OA 2AXFA 4QKXB 4YO0B 4PRAA 3CDGA 5ACZA 5FO8B 1XF4B 1R3LB 3L9RA 4PLNC 5TFSL 5D7LD 2R39A 4X5WB 3DXAE 3N50A 3AVEA 4ZPTB 5DR5H 4BSJA 1XF3A 3QIUB 4MA8L 3G6DH 3PV6A 4QXUH 2WM0A 4OLEA 1RZJH 1F8TH 4EUPG 3VW3H 3TC9A 3CLEL 4QHUB 2ZOLB 3T1FB 3DV6A 2E27L 4TNVF 4PREB 5E8EA 4K94H 4HX1A 1KF9B 2P48B 5I75C 5HDBE 4GAGL 1RZFL 2VN7A 4HGKC 3CUPA 5IVZB 3C6LA 4OQTH 5CD3A 5DVNA 3UEZA 3HAEA 4V2BA 2PO6D 3VXSD 1OF2A 3GSUA 1VA9A 3QA3A 4OZFB 5ESVB 4UT9L 4OZIF 3VXNB 1GPOL 1ADQH 25C8L 1JGVL 1KIQB 4Z77B 4GOSA 3TVMC 2CRMA 3IU4H 5E99L 4DTGL 5GS2D 1KTLA 3NH7L 2FO4A 4WTXA 2J8UA 1N3NB 4IOIB 2BJML 5H35A 3FRUB 1QLFB 2YD1A 4GMSL 3TH3T 2XWJA 2F54E 2HJFA 1PKQA 1JZ3A 2ZJSH 4OZHF 4D0DA 4JFQA 1Y6MR 3QQ3B 4NSKA 1OTUD 1M7DA 4TQEH 4NNXA 3BKYL 4KRPD 1ONQA 3DJ9A 4OCYH 2A6JB 5J13C 1RURL 4WRLA 3V6FA 3UTPE 5BS0A 5J6HB 3LOWA 5BRZD 5K9OA 4PLJC 4J3VA 5H8DA 3BP5A 3HFML 2QKIB 5I66B 3FB6B 2HTKC 3V4UH 1KNOA 3C6SA 1P1ZB 4F7EB 1HKLH 2MQ3A 5A2IH 4UT6H 2DQGH 3W5MA 1U95B 2AJVL 2Q6WA 2I26N 4ZFZA 1AFVL 2D03L 4YZFE 1HILB 4JVWA 1T2JA 5B39A 5KOVC 4GG6F 4FNLH 4PRNB 2PN5A 4UBDC 4EEEA 3Q6FA 4RMVA 4CN6A 4NYLA 3B5GA 4J7RA 1NANI 4KXZI 3L3JB 2F5AL 2BVPB 4RNRB 4XBEL 2R56H 4MAYC 3MMEA 5E8DL 4MLIA 3RWGB 4JN2B 5FGCB 5EO9B 5ITBL 1TIUA 5D7SH 1MY7A 3C5SA 3LQMA 3O3BA 1T0NA 4NKDB 1I3RA 1DVFB 1I1FA 4UNUA 3V5DB 4YXLL 1QQDA 4R8WL 4YDIL 5F6HI 2V5YA 1HHHB 5ALBH 3VDAA 1LO3H 5JUEH 4ZAKC 4ELMB 5SWQB 5D1XA 1BPVA 4P48A 3QP3A 1X5ZA 4JY6A 4JCLA 3H7LA 1KSRA 1T21B 4YDVA 3NFNB 2QBWA 3QSKB 4Q74A 3QDMD 3T0EA 4WO4A 4Q2ZA 5E5UB 1MJ7L 1I3GH 2ZSWA 1OAZL 5HYJB 2GSGA 4RA3A 3LKPA 4IMLA 1A2YA 2W07A 3GSNA 2BNRE 3V0VB 4XZUB 4OGXH 3TV3H 5M7QA 5IROC 2XN9A 4G9FA 1TENA 4X5XA 5BVPH 1KCVL 3QDGE 3VD7A 4O5LL 2NY6B 5C2BH 2WINB 1CWVA 3ESUF 5B38G 4LNRA 3T8XB 5TPWH 3RY4A 2E9JA 1C08B 4JFXB 1DJSA 2MCPL 3QUMA 4P4KB 5ILTH 3W11C 3W9DA 4MMZC 4K07A 2DBLH 4KVNL 5IF0B 3EYSH 3S35H 1MNUL 5LAXB 2IF7A 5CJQH 1T20B 1NCAH 3Q1SH 1CXEA 5KSVA 5IGXL 1UZ8A 2DWDA 2LQRA 5I1DA 2VDMH 4QRRE 3EYFB 5GRVL 3MBEB 4XP6H 1IKNC 4U1KB 3FTGA 3QIWC 5JIIA 5C0JB 4WU5A 4ODTH 4NQDD 1MSPA 3R4DA 4U6TA 4Z8FL 1A6VH 1H3GA 4X0KB 3UBXA 3HPJA 4MQTB 2B39A 2PW2B 4EN3B 4G8GA 3BYYA 5DJ8B 4GQ9H 5DJXB 3C5ZD 3BGMA 4EI6B 5KVEL 5SWSB 4QHMA 4JQVA 5BZWB 3PWUA 1RZ7L 4JM2C 4NO3A 3TBTA 2VDOH 3DTXB 5KBNC 3S9DB 2D7QA 4Z7WE 1TJIL 4QOKA 4LGRB 2XPGB 3O4OC 1T04A 1ZTXL 3BD3A 3OR6B 5FFLA 5KSAD 1IM9B 1NAML 3O4LB 1E4WL 1WISA 3KPRE 1DEEB 3PWPB 4LPWA 1JZ7A 1AJ7H 2UY6A 3OJMB 1EJOL 1NUFA 3ARFA 3IYLW 4K71C 4TYUA 3NCFB 5CEZH 4NQVA 2RCSL 5D5MB 1FO0B 4OI8A 1KEMH 1DBBL 4BSVB 4CVUA 1KB5B 4FP8H 4MXWL 5E08L 4CDGC 5JW3L 3QJFA 4TPRH 1IAMA 1Q0YH 3QXVA 3IDIA 1ZVHA 4EUPA 4NWUH 1BX2A 2DAVA 4KKBD 5L2KD 5I0ZA 3DETD 5D70L 3CVHA 5CP3A 3VWKA 1X5LA 4TSAH 1AR1D 1KYOK 3OWEA 2CKBH 2HAZA 2DRUA 2AGJH 3UYRL 4PJFE 4U6YA 3CSBA 4B7IA 4WWKD 1FL5A 1QSFE 1WQVT 4C59B 5LXGL 4G8FB 1H3XA 1TZIB 1GXEA 1CU4L 1FAIH 2HKFH 5C0RL 3SHSA 2JJTC 5I15H 3OR7A 5AZ2H 1AO7D 3CFEB 4AK1A 4LLWB 3Q5YA 1OY3B 3VJ6A 3KYAA 1XH3A 3BRFA 4POUB 3O9WB 4Y4FA 3PHQB 5JHLH 1T1WB 2AJYH 4G43A 4CDHA 5I30L 3DX6A 4ELMF 1H3PL 1NUDA 3E1F1 4ODUB 3IFLL 2CGRH 2X1WL 5K93A 1G6RL 4IMKA 4HXAH 1IKFH 5A3ID 3FO2B 1QFWH 3ULUF 4PRHB 3ARDA 5HHVH 5KN5A 1IGIH 1P4LA 3QNXA 3BXNA 3SBWC 4XNUH 3WSQH 4GUPB 1I7ZA 4CMHB 3PL6D 2GTZA 2VXTL 1F11A 4YHLH 1ZSDA 2CUMA 1KCKA 5DRNB 3V4VH 1FL3B 3N0PB 5IVXB 1H3UA 2W9DL 1X5GA 2BNUA 1LEKB 4MVBC 5GSVA 4L8BB 2ZKHL 1YMMB 5DTFA 4DVRH 4ZSOE 5EO0B 1V8HA 3TN0D 4JZNB 1QFPA 3PWVB 3PQYA 3O6LL 2NZ9D 3CFCL 4F33B 1MWAA 4FXGB 4U05A 4X7SL 4TRPL 4NZRH 4WWID 2YPVL 5DI8B 2R0LL 4U6HA 4NKIL 4FABH 2Q76B 4UOW0 3QHFL 5DURD 4HWUA 5F1OB 3ULVH 4KUCD 4IRJA 1DFBL 4LFHD 4UTAH 3LDBB 4HQQL 3KWWB 4YK4C 1OAYH 3EBAA 3MOAL 3FB7B 5DK0A 3BZ4B 1NDMB 4HJ0C 1RK1A 3FB8A 3SDXA 3KPLA 1DSFH 4WFEE 3FFDA 4WUUE 1S9WA 4G6KH 1OCWL 4OZFH 1CS6A 2DLIA 2NQCA 4R96A 4B53A 5F7EH 2R1YA 4PP1D 4KHTL 4JHWL 1CICA 4KTDL 5D5MF 1WSST 2MQ0A 3QDJA 3OJDA 4U1MB 3I9GL 3ZT6A 4PTTB 5J9PA 4L4VD 4YE4L 4F15B 2FLRT 4N8VB 1F4AA 1JGLH 4JY5H 2H2SC 5DEFB 4XP9L 3DXAD 4N9GA 5B38A 4LVHB 4HKXB 5KZCD 5C0DB 1JWUB 2VIRA 2VC2L 5JW4Q 5TQ0L 3IGAA 2HMID 3OKYA 5LGHH 3GBNH 3SGJC 5ICYB 4HUVB 2VDNH 4F2MB 4BSWA 4ZQKB 1S7RA 2GCYA 1K5NA 1T1ZA 4P49A 1V7ML 1ZHKB 2R0WH 3MBXL 1QSEB 4Z7OE 5CJ8A 1ZEAH 3KPQA 2L7JA 3FT3B 3IAPA 5A2JH 4N0FB 5C6TL 4PPTA 3FQTA 2VH5L 3JTTB 1AQDB 1SJEB 3W9EB 4H20H 4WW2C 3GBLA 3WNPA 2IBZY 2Q86A 2M2DA 4PY8J 3BESR 2IAMA 1PFCA 3MRFB 3SKNA 5F7MC 4LSQL 1KLUB 1IAOB 4PG9A 4J4PD 3SQBA 3BWUC 3I50H 1QBAA 1F5WA 4JKKA 3DVIA 4KK9C 3R8QA 4JDTH 1YNLH 1M05A 3T77A 1PLGL 2QSQA 3G6JB 2HJLB 5F1KC 1AGEB 5E6ID 4HXBL 3KXFA 4N0UA 3OKLA 1RSFA 5CMAA 5IVXF 3U4BL 5BXFA 5JXEA 3BN3B 3GSNL 5EOTA 5F8RC 4NFCA 4K55A 1FVCB 3UTPD 4EI5C 1RUKL 2PKDA 2HVKB 3BO8B 2ZG2A 3EHBD 3LPGA 5FGBA 1NCUA 2HT3C 3RWEB 3P4OA 3RDTC 3VFOA 1KJ3H 4LKCB 1Q9LB 3LZFH 3QUML 1K2DA 4HH9B 4F9PA 3BP6A 2OI9C 2GAZB 1BQSA 1RPQA 2ATKA 1UM5H 3FOMA 3AUVA 3O41A 4GAJH 5T5FL 3HA0A 5L6YL 4PGCB 4YR6A 4DK6A 1CFTB 1S9VB 4UIMB 5L2JB 3TJEL 2QV2A 3QUZA 3OTTA 4CW1B 1W0WA 3UDWC 4PP2B 4M7LH 1F4XL 4YXKH 5DJYB 4I0PC 1FAKT 3C9NA 4F7PB 5LBSH 1FFOA 1MCOH 5T1LB 1HQ4B 4IRSC 1D5IL 2BNQE 1F2XK 1UWXK 3TCLB 4WDIB 3CJJA 3JZ7A 5KANI 1VADA 3MLRH 3ZSSA 4FXKB 3B5HA 3MV8A 3SGDH 1YYML 2YXFA 3RBGA 4PJ8C 3SE8H 3LKSB 2F9BT 4K23H 4U1JB 4KK8C 4Y19A 3ZYJA 5MEQB 1NBVL 4QRQB 2JK5A 4GBXD 3LKQA 3WFEH 2VZUA 1YN6B 3MGTA 3MA7B 4U1SB 1P4IH 5DLML 4Y16B 5C0FB 3MA9L 1EO8L 2Y07H 2DLFL 1I1AD 5SX5H 1R0AH 2CJUL 4FS0A 4C83A 5JTWA 5FA4A 1HI6B 3JWDC 4WHTA 3KGRA 4NM8L 1LD9A 4XNZB 4NHUB 2UWEA 3AMLA 4RIRA 4WY7H 3ZLQC 1ZHBB 2W60B 4X9FA 1DBAH 4XMKH 3HG1A 4PB9L 4ODHH 2YN3A 2BNRD 3WEXB 3WS3B 5ADPL 4U1HA 3LKRA 4UNVA 4ZFOB 2GK0B 3QDGD 4Y5YB 3JWDL 3FFCA 3GEWB 5DVOA 3K2UH 4H1LG 4M43L 2L0DA 4R26H 43CAB 3CVHL 5HI5C 4TUKL 4HIJA 3VFVB 4G8EA 2AEIT 3KHQA 3ROLB 2IPUK 1SYVB 1RIUH 3INUH 4LSVL 3DO7B 4PJHB 4JFFB 4MNGB 1OD7A 2WK2A 4L8CB 1LO4L 5HGBA 5D1ZA 5DVKA 1OP3H 1KN4H 2DBJA 4PJ9A 3DI2B 5I2IA 2H3NA 4QRRD 4G9DA 2BY2A 2OR9L 1UVQA 1AGBA 4NM4H 1KPUA 1QNZL 2NY3C 5EBWB 3QNZA 4IMKC 3RIAK 2XY2A 1CT8B 5DO2D 3N9GH 3FAXA 2J5LB 4YIQB 3RWFB 4MJ6B 3L6FA 3NIGE 4O00A 1JV5B 1HHGA 1A7RH 3GK8L 5ESQB 3NBNA 3G6JF 1D6VH 3KYMB 1K3ZA 3HMWL 2AV7B 4QGTA 5F7YC 3FO1B 4HUUA 5FV2A 2QEJA 4WJ5A 5I19H 3VGFA 4KKCC 5JW4N 2DQUL 1R5IA 1NSNL 3P77A 1IC5L 2YOCA 3L1OH 2QADC 3MLZL 3KPRD 4XVTH 4PRPD 3DRTB 2VXQL 1MFEH 1FZOB 4D0BB 3S4SG 4JY4A 1QP1A 4H5SA 4JKMA 2FJHB 1MHPL 1J05A 1DBKL 4CU6A 3S36X 4XCFH 2PR4L 1IAKA 4N1CA 1W72A 2IPUG 2VL4A 4KJQD 3G5XA 2D9CA 3BUYA 3QO0B 1NL0L 4K3DL 4QHNA 6CGTA 1FFQA 5C07E 4NZUH 4GKNA 1WVZA 2VZSA 4LVEA 2RJMA 1YEFL 2ICEA 1INQB 4IRJC 1UWGH 5F88A 3RZCA 2RIKA 2I25N 2XKNA 2B7DT 5JORB 2B0SL 2APFA 1CIDA 4O58H 4JDVB 5DMGD 4OCXH 4Q9QL 2SEBA 2A2QT 3AU1A 4R90H 2ADFL 2GK2A 3HS0A 4NWTL 2GSIB 4JFEB 3F7YA 4Y1AA 3K0WA 5EG6C 3VU2A 4OUUA 4HS8L 4OV5A 4MJIE 1J0YA 4PGBA 4UB0L 4Y4HA 4GRLD 5DFVC 4E0RB 2WIIA 3BPOB 1BIHA 1OLLA 2Z4QA 1LNUB 32C2A 5INCB 1VGEL 2ILLA 1A7NH 5HGAB 1KTRL 2EDKA 1TETL 1N5YL 2Z91A 3EO0A 5KTEH 5HJ3B 5EOCL 4WHYH 4WI8A 1HN1A 3HZVA 4GXVH 1IZKA 4M1GH 1CFBA 1PW3A 2P4AB 3HZMA 3GM0A 1AE6H 4LSUH 2XWTB 3U7YH 4OM1L 3PWNA 2EYRA 1PX4A 4GAYB 4K8RC 1X5KA 4X6DE 5JA9A 1DBJL 2CH8A 2VWEC 3CK0L 5K59F 2H6PA 2W91A 1OGAD 4L8SA 2W1NA 3I6KB 1HE7A 4N9OB 4HT1L 4HFUL 4PJHF 1FNGA 4WI2A 4ONHA 5DHVH 4XWOC 2CLRA 3QUKA 3WDHA 4K8RL 1U58A 3IJHA 2CDGB 3LIZL 3QCUL 4M5YH 4R3SB 3O8XC 4BA8A 1P53A 1LDPL 3WIFB 1NEZB 4Y2OA 2E3VA 2VMFA 5C09A 3RX5A 4PJDE 5EWIH 3U9PH 1XF5A 1WF5A 1Z0MA 2J4WL 3SE4A 4RFOH 3TNMA 1LO0H 4PGEB 3MLSL 1Q94A 5I1JH 3FQWA 5EB9A 2EDJA 1I7TA 4P2RE 2A0LC 4AQ1B 1RHHA 4JREB 1N8ZA 4O9HH 3V5HA 2VLKA 4NQCB 4WUUD 2FHBA 1HSAB 3QXWA 2YD9A 4L29B 2OL3A 5EORH 3DUSB 3T3PF 5KSBE 1Z6JT 2FSEA 2MCG1 5I8KL 4KMTH 3M17B 5JPNB 3O6KH 4KU1A 3V7AE 3HE6D 1CDBA 1G7QB 4S2SA 3TP4A 3H9SA 3BIKA 5HYQA 5DUPL 4MA7H 5IHUH 3CXDL 1ND0A 3STZB 1MHHB 5FHBH 2J88L 1F3JB 1QBLH 5IB3A 3BZFA 1TZGL 1EGJH 1J10A 3WIHH 3K4DA 4ODBD 3SOBH 4H1LA 4ZO8A 1W0VB 3IDJA 4APQD 1HQRA 3KPNA 3SEPA 3QUXD 3KS0J 4BELD 5E24E 1CBVH 4JJ5B 1YY8A 4J23A 3CX2A 3NA4A 5J6GA 1L7IH 3UAJC 3K8LA 1NFDE 4OLXL 4NNPL 3GSRA 4XP4L 4C56B 4JFOA 1RULL 2DI8A 3JUZA 1YJDH 1A3LH 1SVZA 4ZD3L 2P5EE 5D2LA 5C92A 3OAZH 3DVNA 3D85D 3MRIB 1XIWB 5D2NE 4L3AA 4FFZL 5HVGB 3VA6A 1G7MB 4IDJL 1ZAGA 5D8JH 2F8VA 2NMSA 2B4CC 1D5BA 15C8L 1EMTL 1BFVH 2W9LA 4JG0H 3QQ4A 1H5BA 1JZ6A 1K8DB 1OLZA 4G42B 5GGRY 3SCMC 3NFPB 2YBRA 1CFNA 3I85A 2KL6A 5CUSL 1FYTE 2B4CL 3D18A 3VFSB 3ISWA 5LQBL 5DJ0A 4HDIB 1ZT1B 3MRHA 2ARWA 1F00I 3HZYB 4YHOH 5C0AA 4JAMB 3G6AA 3H6JA 1WBZB 2AXGB 1XR9B 4ZOAA 3RVTD 1BVLA 1ZWIA 3FQNB 2P7TB 5F1SA 2ZUXA 2WANA 1ES0B 3O2VL 3ET9F 4LAJH 1T1XA 5C0IB 3HRZB 3V5KA 4QXGL 5E6YA 3O45A 4ZXBB 2LFGA 5HY9A 1YC8A 4XXDB 2W59A 2CLZB 5AYQA 4HV8B 1MCQA 3SDAA 4X7TA 4ZPVB 2FR4A 3H3KA 1J18A 2ZCKL 3ZTNH 1YEJH 4KQ3H 5CEYB 1EEUA 4P5KA 2DL2A 2QHRL 2O61A 1S7QA 2ATPA 4KUZL 5FGRA 1QA9B 2FRGP 3N1PC 4NO2B 4DJMA 5BQ7A 3HB3D 4XXCA 1MAMH 1A8JH 4W81A 1U91B 1UXWA 3DWTA 4F7MA 2IMMA 5E6ZA 1UYWL 3IDGB 1QBMH 2RAMA 4V2CB 5JOFB 2VSDA 5HHXL 4Y8DC 1JCKA 4HBCH 4EQ3A 3W39A 5F3HB 1R3IH 3TZVA 2BNQD 2ZCHL 1KTDA 4NRXA 5IJVB 3CDFA 3LH2H 1YDPB 4QTHA 4LVNC 3S36H 4NP4H 1XF2B 1X5AA 2ZUQC 4G6JH 5LKNA 4OZ4B 4ETYA 3D3VA 4JPKH 3P9LB 4NRZA 1T5XB 3GO1L 1WCBB 5DRWA 2BXZA 1XGUB 3RUGE 5IB4A 3RWJB 4U1GC 3MODH 3DGGA 1LO2H 1YEHL 3AY4C 4PV8B 2ZUUA 3L7EB 1FBIL 3WIIH 1J1PH 1BWWA 3RZCC 1NCWH 3STLA 2V2WA 4JEGB 5F7DA 4HKBB 4TVSa 4OQTA 1SY6H 4WI5A 5IW6A 1OARH 1I7RB 2X41A 4YPGA 1IJ9A 3JTSB 4H8WC 5GZOD 2W65B 2D7PA 5IEKA 3V0AC 4JRYA 4Y0GA 3RVXC 2WP3T 4IIQB 1PSKH 1ADQA 3WNNA 2FBOJ 5ID1B 1FLRL 1A6TB 1NGWA 4UIKL 2P8MA 4H8WL 4HCRH 3QEQA 5J89A 3VXUA 5L88H 1QEWB 3QRGH 3G5YB 1HYSD 3K81A 4HFWA 1MCKA 2F19L 3LB6D 4LBEA 4MD4A 1XEDA 4MQXD 3EO9H 4JKPL 2BSSA 1DQJA 4YHML 4LIQH 5BRZB 3WXWH 4LCYB 3MLVL 4PJEA 3A67L 1OTTC 2O5XL 4RGMC 1MI5A 2LU3A 1L0QA 3FN0L 4Z0BH 1MJUH 4X7FC 3CXHJ 4PY8I 5D7JA 1RIHH 2A6IB 2WQ8A 1LEGA 3MRKA 1ZHNB 4DQOH 5FKPA 4LLQA 3LN5B 4QHLA 3PDOA 4YFEA 1FZJA 5GHWH 4QWWD 3C09B 4Z7VB 1T66D 3QBTB 3KPPB 1OTSC 3TYGH 3UMTA 4L8SC 1BD2E 1UADC 4XPTH 4I9WE 3D48R 4IHOB 2Q8AL 3ESVF 3EJYD 2P5WE 4MX7A 4PS4H 4NKQB 3L5WA 4JRXE 4CNIA 2FB4L 4UZGA 5EU6A 1B4RA 3AREA 4DCQA 2YK1L 4YJZL 3V6ZA 5E9DE 1JHTA 2EKSA 5C07D 1OAXH 4LNVA 4NT6B 5FDWA 1FZKA 2QQKH 4P57B 8FABA 4UUJA 4HUNB 1T5WA 4GRWE 5D96C 4F80A 1NFIB 1T1YA 3HHRB 3FAWA 4HKJA 4P3CH 4YUEH 4KJPC 4MA1B 2G75B 1WEJL 3UPRB 1MRCH 3RWHA 1Y18B 4LLMA 5IB1B 5I8OL 5J1AB 3MQIA 1KCUL 3TGXA 4CJ1A 1A7QL 3F62A 2APXA 5I74C 3ARGD 5IMKB 1KPVB 4Z18A 4X7DC 4LEOA 4Z76A 2ADJB 12E8L 5FM5O 3LRGA 35C8H 3SGKC 3EJZC 5FYKH 2AJZA 2XY1A 3EFFA 1T3FB 3MX0A 3L5JA 4NQEA 4HMCA 3SDCC 3BT2H 3HI5H 3P11L 1CI5A 4LEXH 1IM3B 4FFYL 2VDQL 1CFVH 5FYLL 4EXPX 2NR6D 4F37K 4PB0L 3MXVH 3TPUA 3PP3H 3H2WA 3DNKA 3S34H 1CLOH 3ARPA 4OSUH 4OBSA 5ETUB 4RMQA 4OJFL 2V2XA 3OF6D 1T03L 3BUTA 4HJGB 4NQDB 3T0XA 3BPNB 3RPIA 4R7NA 1TPXC 3UTSA 5DGRA 2ZPKL 1X5HA 2YN5A 3C5ZB 1KJVA 1NCBH 1S7SA 2NY1D 5D1QA 3RU8L 2EYTB 3CU7A 2VQ1B 1G7IA 3CLFH 1GGBH 4K7FA 3P30L 3DROB 2C9AA 5ISZA 4F3FA 2WZPD 3JV4B 3VXMA 2CIIA 5KSAB 1XR8B 2DQEL 2P8PB 1XGYL 3BN9D 1M7IB 3HI6L 2AQ2A 3MRRB 3QQ9D 3F7VA 1K8IA 3FHAA 1H5BC 3X14B 3UYOD 2KZ1B 4LSTL 4AEEA 4XVSL 5TE6L 2J8UE 3WHE0 5DYOB 1HHKB 4U7MA 4P2OD 2X4QA 1YNTB 3T2PA 4YBHA 3WFBH 4ONGH 3CZFB 4LSSH 4S1DD 1PKQE 3BAEH 4JO4L 3ALWA 1A0QH 2FEEL 4LP5A 1IE5A 3FONA 1VDGA 4MXVF 1KLFA 1OD9A 3BPLC 4P2RD 3L3GA 1IEBB 5L2KB 1XGPA 2BK8A 3OKDB 3GSOA 3MFFA 1NGPH 5BS0E 2BOBA 2E9BA 1MJ8H 2PO6A 3VXSA 2PXYD 5I1EL 5SX5K 4N8PA 4H26B 5I76A 1I8IA 3LHPL 4H0GA 1S9XA 5AD0A 4HWBL 1IEAA 3NIDE 3VFUA 3GMRA 5TDOB 1T0MB 5CWSB 4NKMB 2D7MA 1U6AH 5CZKA 2CKBA 5F71A 4WU7A 5H94B 5SWZA 4E5XB 1AO7B 4YX2L 1LILA 3LKOA 4P4RA 3R06B 2H41A 4OCWH 1JRHI 4D8PB 3Q5TA 2A9ML 4XXCC 4XPBL 3VWJC 2HFFB 4P5MB 3FB5B 2P24A 4PJAA 3TBYA 3MLWH 2K3TA 3V6OA 4NHCL 4GG6A 3U48A 1QYGH 4OLUH 4HIEB 1EFXD 5GRJH 1OP3K 3VXOB 1AXSA 5GGTL 3TZVC 5EBGA 4Y4KB 5D72H 2P5ED 5KVDL 3BZEA 3PL6B 4CVZA 4LLVB 2HRPL 3OXSA 1WT5C 4G6FD 5L0QB 3C8HA 2GYSA 4UQ3B 4I48A 3T4AA 4OGYH 4FQXA 4KPHL 3OGOE 5E94A 2UY7A 5I73C 4GLRH 4EDWH 2HFGL 2VE6A 4OD3H 3MJ9H 5J11C 1BEYL 3MV7E 4OD1H 2YWZA 5DD1H 2F8XC 5DR5L 2C3XA 1FYTD 3G6DL 4E41B 4QXUL 2ZUVA 5I18H 4LFHG 1F8TL 2WUBH 5HVHC 3WFCL 3U46A 4OF7A 5FO8A 3CZJA 3AB0C 2JF1A 3GRWH 3QULB 5DURB 2OBGA 4HW6A 4O2CA 4YQXH 3VFMA 4HG4K 1RHFA 5HHQA 3OQ3B 2Z31A 1E4KC 3TPKA 3I2CH 4X9IA 4D9RE 2YHGA 5DRXB 1CIUA 4PLJD 3ARYA 3Q0HA 1NGQL 3N1QC 5JPMB 2HTKD 4LHUB 4BQ6A 2CLVA 2AJUL 1ADQL 1R3JB 3LS4L 1RJCA 2JELH 4X6CA 4DN3L 1WIPA 5IIEB 1B0RB 1FFPB 5TE7H 4JGMA 5IMMB 1MCIA 1B0GB 4K9EH 2GUOA 4OZFA 3PABB 4UBDD 4BKLA 4S1RH 4EIGB 1T89C 4L4VB 2YRLA 4KMLB 4PJGA 3R8BB 2PTTB 4QOKE 1N0XL 3D0VA 4MAYD 3GSXB 4ERSH 4OCYL 3DXAB 1ZXQA 4OUOA 1M6OB 2VDLH 5KZCB 1U8PA 3BQUC 4NO0D 4FQ1L 2ZNWA 4BFGA 5KSUB 3QQ3A 1KUMA 3V4UL 5CAYB 3NMEA 3U36B 1CGUA 4N0YH 3ZT7A 1KELH 2DQGL 3MV9B 4ZAKD 3EYVB 3QIBA 3ZKXC 1A9EB 2QR0B 1BP3B 3AREC 4M93C 4KROD 3DARA 4HS6A 4NNYA 4FNLL 3E2HB 3SE9H 4GKZB 2FGWH 4PJXB 1P1ZA 1J1OL 1U8KB 3NCMA 3X13B 2BVOA 4DVBB 4GW5A 2HG5A 2HYMA 3WCYA 2GHWB 4AEFA 4PD4J 4KJYA 4RSVA 1E27B 4U1LA 5HYEA 4OFIA 2R56L 2CMRL 2X4TB 5C2UB 5FHAH 4CADA 4CVWA 3BDBA 4E9LA 4I2XA 4JVPA 4QO1A 3U82B 1P84J 1OVZA 1HNGA 2ENSA 4N8CH 2F54B 4MQSB 4R0LA 5ALBL 3GKWH 4PRBB 2EDXA 2OLDA 1LO3L 5E6IB 4JN2A 4POZC 1MVUB 1YY9C 3MLTA 5DT1H 5JOPE 3KLAA 2WV3A 3CFKB 3QIWD 4TUJB 2C1PA 3D69A 2FZ3B 1I3GL 4M03A 3LN4A 1GC1C 1YPZA 3ILQD 4WHYG 5DMKA 2C3HA 5HPMA 4MB3A 1SBSH 3AFLA 3CLEH 2IH3B 4FHBD 3RL2A 4OGXL 3TV3L 3LY6A 4G80B 3VXRB 5FYKU 3VXPB 2P45B 4JM2D 4A6YL 4PV9A 1GC1L 3IFNH 5TPWL 3FT4B 1X7QA 1F6AA 3L3KA 4GAGH 1RAMA 4X80H 1PY4A 3U2SA 2EE9A 2A9NH 3V0VA 2XTJC 3BFOA 3QUYC 3LV3B 4QY8B 3D39D 3B9KD 1BD2D 2ZZUT 3G04B 3EKCA 4I9WD 1IGMH 3NTCH 5C8JB 2YUWA 5CJQL 4UT9H 4F57H 3QWOB 1GPOH 1OAUH 3VD5A 1J5OH 1NCAL 2P5WD 3PQYE 4KFZC 4U3CA 4EZMA 3VI4E 3Q1SL 4M7KH 25C8H 4JRXD 1JGVH 3TBVA 5I1HL 2VDML 4MA3A 4P4KA 4DTGH 4XP6L 2R23A 3NH7H 4OTXH 3W0WB 5HYSB 5E9DD 4G8IB 1A6VL 1AGCB 2A83B 5C86A 5JO5A 5TF1L 1CFSA 1JN6A 1AD0B 4P2QA 3O6FB 4OF3A 4GMSH 4NQSB 3GNML 3VGEA 5IMLB 3OAZK 1FE8L 1KJMA 2MQCA 2X05A 1V3LA 3SDXE 3RTQC 2OSLB 5T3ZE 2FH8A 4AENB 4M7JL 5DD6A 2NX5A 2WAHA 1UJTA 2L4OA 4UI2A 4RAVA 5DJXA 4FQIL 4XRCB 2Y5TA 1AJ7L 1X5JA 3HFMH 4LAQH 3TN0A 4PJ7A 4TVPE 4J3WA 1GZPB 3G5VB 5HHPB 8CGTA 3PHOA 3QDGB 5TQ2L 2FNBA 1SYSA 2AJVH 1UM4H 1NJ9A 2DM4A 4WV1A 3T2OA 4FP8L 5JLZA 4TPRL 5KVFH 5EC1B 3PXHA 2EDBA 5HDBF 1Q0YL 1KPRB 1MEXL 3DX7B 2XRAH 3DV4A 1HEZA 1D9KC 3B3IB 5F7KC 1A02N 4TNWF 1D5ZA 2PF6A 4M3JA 4KTEL 2AVGA 1JWSA 3MROB 2CKBL 5CJXC 2R2HB 4YEEA 2DQIL 2F5AH 3MGOA 4XBEH 4QRRB 4UU9B 5MENB 1IGJB 5E8DH 4KTYA 1Q0XL 1K85A 3ZZ1A 2HKFL 5BO1H 4U6XA 5ITBH 2VWEE 4HUXA 2B5IC 5E8OA 5I15L 3KR3L 4HULB 3BP7A 5AZ2L 4MVBD 1EZVX 4R4NC 4R8WH 1OOAA 5JZ7C 4S1QL 3GIVB 3C8KA 4NBYB 3P2TA 4YBLC 5KS9A 1JPGA 2HKHH 2PYEB 3QO1A 4Z7WB 5JHLL 2DQCH 4LCCB 1IGCH 2R1XA 3MJ7A 4HZLA 5DQ9A 3GMLB 1KXVC 1OAZH 1S5IL 3HN3A 3LRSB 4YH6A 5J56B 3T0DA 4HXAL 4EVNA 1IKFL 1QLRA 1QRKA 4HSQA 5F89B 1Q38A 3PHQA 1UB5B 3ZKNC 1EEYB 1BWMA 1KCVH 4I3RH 4ODUA 4HJ0D 4LDEB 3MC0A 4O5LH 3BEVA 4YHLL 4HS3B 1N6VA 4JDZA 4YZFF 1FVEA 3KXFE 4N0UE 2A73B 2GEEA 5IBLD 2C7UB 3S8WA 2ZG1A 3RNKB 4K3EL 5BS0D 1A4KB 5EZLB 4D0CA 4OFYA 1JGDA 4PJFB 4GJTB 3ZO0A 1NBQA 2Y6SC 3IDMA 2UYLA 3K8MA 4K3HA 3VRIA 1BQUA 1EXUB 1QSFB 2VXVL 3DURB 1BBJB 3ULVC 3ULSA 3MJ8A 3F7PC 2ZUSA 1HH9A 1PDKA 4NZRL 1NUGA 1L9MA 4S0SD 2X4SA 1NDGA 2FJGB 3WUWB 3GMOB 5GZNC 1A7BA 3ULVL 1HK6A 3X12B 4UTAL 5TGBB 1T4KB 1W8OA 2P1YA 1RZ7H 1I1RA 4MD5A 3RY6A 1G7PA 1LVEA 2XZZA 3P0GB 4XP5H 1IFHL 1VFBA 1XT5A 1HHIA 1GVIA 2E8ZA 1ZTXH 4GW4B 1R3HB 4ESKA 2NY2B 5IJKA 4XNQA 1BZ7B 1UQSA 1E4WH 2DQDH 5TH2B 5GQBA 5JHDA 2X4RA 2V9RA 3TH4T 3PJSA 2FECL 4BUHA 3MV8E 4DZ8B 1UT9A 1DBBH 3G08B 1JGEA 4ODXB 2G9HB 1RIVH 4Y19E 3VE0A 4MXWH 5E08H 4UT7L 1NMBH 3ARBB 3HUJB 1TJHL 4HK0B 1S7XB 5EU4B 2ORBL 3GDBA 5D1XD 3DBXA 3LQAC 1RK0A 3NCYS 3V8OA 3BH9B 2VDKH 4JY5L 4LOUC 5D70H 1K3IA 3MV7D 1LE9B 3CFBA 4ZSOB 3QHTC 2UWEE 3ALPA 3EDKA 3WLBB 3UYRH 2DLHA 4KK9D 2PCPA 2IALA 3LQAL 3A6CL 3GBNL 4JLRB 5LGHL 1BREA 1LGVA 2BY3A 3H9HB 4PRDB 2ZG3A 5EIQA 4X4XA 4Q9RH 3FFCE 5DHVA 4KQ4H 4P46B 3OXRB 4P3DA 3QFDA 2R0WL 1GOHA 5FECB 1RZ8B 3FJTA 1ZEAL 5FUCE 5I9QB 5E5RB 3H9ZA 4EI5D 3L3OA 3T3ME 4D9RD 1U3JA 4HGMA 3IFPB 3ILPB 1JYWA 1I1YA 5HGGS 1MCNA 4GBXA 4HUWB 4ISVB 1H3PH 4Z7WF 4AG4L 1UXSB 2C4FT 1I1AA 1QSEA 3U30B 1PZUB 3MRBA 2JIXD 4GRMB 2M8XA 1DVFC 1Q9KB 3BD5A 4N0FA 4HGWA 1AGFB 4NPYB 5IM7A 3I50L 1SJEA 4U1IB 3TNNB 1MIEL 3LQZB 3HE6B 2BNRA 3O3AA 4YHIB 4Y5VA 2VXTH 2VLRA 2FYYA 3E6HA 4JDTL 1YNLL 5IQ9A 3N1FC 4UOW1 1EHXA 1OP5H 1GIGH 1U8HA 1CL7I 3W2DL 3RA7H 3F8UB 2W9DH 3A6BH 4U1NA 1KJ2B 4YDJA 4IRSD 4W4OA 4P0DA 1V5JA 3ULUC 1WZ1L 3QR2A 4M9OA 2J8OA 3FQUB 3QUXB 5FA3A 3AXLA 2NW3A 5F7NC 4JKWA 3S7GA 3ARFD 4PJFF 3GI9L 3IDYB 1KG0A 2IADB 3O6LH 1EGJA 3CFCH 3NPSC 1GGTA 4PJ8D 4FQQA 5DJZA 5GRZA 3U9UB 1AGEA 3WIHA 3VRJA 5DA0B 1MQKH 4X7SH 4KK8D 3NAAH 4RFEA 4TRPH 3ULUL 5H2BB 3LZFL 1SEBA 3PP3K 4P4KC 1GYAA 3QHFH 3KVQA 4MXQD 1ERNA 1TNMA 1GGYA 4AQOA 5IWLC 2X9YA 2WIMA 3QH3B 2YC1B 3MOAH 2MPAL 4NJ9L 3TIDB 1I9EA 2V5SA 4HH9A 5IK3B 4YNYB 1AKJA 3MBEC 5JW5A 2HFEB 4YXKL 4XB7A 1OCWH 5LBSL 3IU3A 5LG1A 1AI1H 1C5BL 4NOBA 1JTOA 5ICZA 3KPRA 4PRPA 4Y2DB 4EN3C 1U8MA 1FG9C 3H3BC 5HI5D 3O2DL 4KHTH 5L2JA 2BOCA 4Y1AE 4JHWH 2NZIA 5MI0B 2JB5H 2A74A 4PRID 1ZLSH 1I7UB 1N2RA 4PP2A 4KTDH 4HAFA 5JDSB 3SE8L 3P4MB 4LP4A 5EN2A 3CSGA 4LPYA 1AXIB 3HUJF 3VFTA 1X44A 2YRZA 4YE4H 3TCLA 1P4IL 1DANT 3DHMA 4Z7NF 2Y07L 5JOPD 4JHBA 4OM0L 3WNLA 1A1OA 1FGVL 1UJ3B 1WLHA 4FXKA 4XP9H 1R0AL 3TO4A 5EBLB 3UJTH 2NY3D 4GH7B 4PIRF 5EFIB 5AUMA 3OJ2C 1A47A 2IGFH 2FO1A 2VC2H 2GW5A 2H26A 2E9WA 3ARDD 1IC4H 4QCIA 4XMKL 4U1SA 1YN6A 4ZS6C 4Y16A 1KENH 1OPGH 1MJJA 1CE1L 3F58H 5ICXB 1CGXA 1LK2B 3K2UL 4XCYB 3QJHB 3KDMA 5CFHA 5D93B 4LLAA 3P9WB 1FO0L 4KKCD 5E56A 4NHUA 2X7LA 3OKOA 1KB5L 2QADD 2W60A 5EOQL 2R2CA 1CD8A 1D6EA 3WE6B 5H37H 2VH5H 3INUL 1VFAB 3QWQB 3KJ4B 2WBKA 4MDIA 3T0VA 5CP7A 3P4LA 4QRSB 3PQYD 2EDRA 2XWBA 4M62H 4LSQH 4WEMB 2VB5A 1NGYB 4YAQA 5FB8A 1S7TA 1SYVA 2AXJA 4NM4L 1LMKA 4XP1H 3DRQB 4MJ5B 4XBGA 5C09E 4JFFA 4MNHB 3N9GL 2OR8A 5IB5B 4IRJD 1RZKC 3O9WC 1F3RB 1PLGH 1ZT7B 3KPOA 3MCG1 3ZE1F 2FX8L 1D6VL 1FV1B 4HXBH 5EBWA 2NXZD 1CT8A 2N7AA 2VERN 2VLKE 1S5HA 5T3ZD 1RZKL 5L8KB 1OGAA 5GGSY 2X09A 4YIQA 1WWWX 5TDNB 3KNBA 1RUKH 3N1MC 1ZVSB 2VITA 4XVTL 2EDEA 4CMHC 4YBQC 3K74B 4JPVL 2P49B 2WBWB 2RB8A 1UKTA 2UUDH 4XCFL 5KG9A 3SGEI 3H9SE 5FYLE 5DFVD 3QXDA 3VXTB 4F8QA 1G84A 4OF5A 2Q8BL 1DUZB 3WN5A 2WUCH 4WENB 4X83A 5B3JF 1KEGL 3ZDZE 1CXKA 3MR9A 4NZUL 3ZKQD 1C16A 1SY6A 1O7SA 5T5FH 4LASL 2ARJQ 2FJHA 3WL9A 3GMQA 5L6YH 5CKGA 2D9QB 3HI1B 4X98B 2DQHL 5DDHB 5MP6H 3TJEH 1OP9A 3MUGB 4XNMA 2WWKT 5DSCA 4OKVA 2VXSH 4O58L 5E2TL 2X42A 4MD0B 5T1MB 3E0GA 3H9YA 3ORJA 4HCRA 1BGXH 4WUUA 3WNKA 3JV0A 3OKMA 4RWYH 3UTTE 5IJKC 1INQA 4PJ5D 3ARRA 1F45A 4K8RD 1DCLA 4F9LC 3LDBC 4HWNA 4L9DA 5MEOA 4PJIB 1YYMH 2X4PB 1ETZA 4UDTB 5F44A 5CGYC 4XWOD 2GSIA 4JFEA 2IQ9L 5DLMH 3TA3A 1IQDA 2RFXB 4P3WA 2DLFH 4AH2B 1FNHA 4Z7QE 4NN5B 5C0NC 3H7BA 2OP4L 3C2SA 1KB9J 4GG8B 4HHAA 4ELKA 1OAQH 4NM8H 4APQA 1HXMB 3QEUA 3KYNB 2MWCA 4XGZA 3WJLC 4PB9H 4Y89A 4JZJB 5ADPH 1ZGLM 5E5MA 4PGJA 3CDYA 3JWDH 4M1GL 4F15C 1AE6L 4M43H 4XBPA 4MNQA 5F1NB 1G7HA 2A0LD 4TUKH 3U6RB 4YHPB 3KXFD 3UYPA 4NN7B 2RQ8A 1HH6A 4M1DL 1PVHA 4X6BA 1LO4H 2XNAA 3ZL4H 2IFFL 1UFUA 1OB1A 1UACL 3R0MA 4M5YL 3PGCA 1SJHA 1N26A 4KDWA 4BH8A 1I8KA 3GMNA 4FFVC 1C7SA 2QQLH 4HIHB 5GIRB 1MCCA 4EDXB 1R5WB 1QNZH 1HSBA 5ERWA 4BQBA 3H3PL 4NJAH 4RQQB 2YD4A 3GMPA 4ZDHB 4KKLC 4MJIB 5EWIL 3C60A 2V5RA 1X5YA 1LO0L 4Y5VC 2R8SH 3QUZD 2BERA 5C6PB 1TVHB 2AI0H 1HYRC 2FBJL 3UAJD 3WUZA 1A4JA 1ZGLB 3C5JA 3MLZH 2VXQH 3BYTA 1HHJA 5EORL 3TO2B 1MHPH 3TFKC 2EIZB 1P69B 4KMTL 4N1EA 2BC4B 3MV8D 3MRDB 4DKFH 3O6KL 2NTFA 2ADGB 4JZOB 4MCYB 1G7LB 1WAAE 3D3VE 1CDJA 3I3DA 4K3DH 4MA7L 4NQCA 4Y19D 5IHUL 1FNLA 4N0CD 4P99A 5EPMB 1GJIA 5FHBL 1B6UA 3SKOB 1YEFH 4HC1L 3SCMD 2WBJB 2EO9A 1QBLL 1S8DA 3M17A 3CFDA 4WUKH 4OCRL 3BEWA 3SE3C 1KJ2H 3SOBL 2B0SH 4G7YH 1U41A 1YJDC 1OWWA 1CBVL 3F6IA 1DN2A 1K4DB 3VFNB 5DUBB 2ADFH 1L7IL 1WCQA 2YPKA 4YHYB 3JBG7 2BNQA 1RV6X 4JRYE 1YJDL 4JGUA 4LLDA 3GSVB 1A3LL 4C57C 4KDTC 4Q6IA 4ZUTB 4HS8H 3HKFA 3QEQE 5IFHL 3VXUE 4Z7UB 4P2RB 4I5BA 2IAND 1BFSA 3GBMH 4KHXH 1BFVL 4PJ9D 4JG0L 5EBMA 1H15B 1M71B 1TETH 1N5YH 2VR4A 4P9HH 5EOCH 3EDEA 5KSBB 1G7MA 4PJEE 1FH5L 4JQIH 4OCSH 1EV2E 4DKDC 1TQCB 1MI5E 4LCUA 3D25B 4YHOL 4Y16C 1B9ZA 4E42B 4G42A 2JCCA 2VRAA 4KC3B 4WGWB 3MO1A 1S78C 1DBJH 4MCZA 2AEWA 5J8OA 1Z3GH 4XNZC 3CAFA 4JO2H 2Z35B 2R0ZH 1RY7B 4HFUH 3IETA 1WC7B 2GJZB 4JVUA 1V05A 1KACB 2FLBT 4CAGA 3QCUH 3LIZH 4Y5YC 2JJSC 4ORGB 1NFDB 1JK8A 2R4RL 1VEMA 2P7TA 3DOSA 5F96H 2GJ6B 2VR5A 1YEJL 1ES0A 5C0IA 4ZTOH 1VKXB 2P5EB 1LDPH 3QEGH 2A6DB 4ZFOL 2DQFB 5BVJB 1RQ5A 5D2NB 1JMXA 2Y7QB 3L5HA 4G6FB 4HV8A 4FQJL 2XV6B 2J4WH 2BVYA 4O4YL 1NC2B 1CGSH 2OX5A 3REVB 5EOCJ 1MAML 5CSBA 3RZCD 1CGTA 1E4JA 3X17A 1ZHLB 5E2JA 5CHNB 3UO1L 2COQA 4Z78A 4NO2A 2F53B 3BH8B 2Z92A 3RVXD 3BPCB 1R3IL 2OS7A 1BLNB 3RGVB 5DEGB 1E4XI 1FYTB 2VDPH 4K3GA 2NW2B 5GGRB 4Y1AD 4A2LA 1JWMB 3I75B 3MJ9A 5EO1A 5FF6B 3S36L 4NP4L 2Q7YA 5A16A 4FTVA 3NN8B 4HLZH 5J3HC 3BP4A 4L9LA 3CXDH 4WFFE 2IPKA 4JPKL 2AEQH 1U8LA 4J1UA 4C54A 1QRNB 1TCRB 3OJVC 1XCTB 4NQEE 1EIBA 1TZGH 5C08B 4JHAH 3HE7B 3MODL 5IJVA 4JO1L 3GRWA 3KPSA 5GS0D 4JRWA 2RR3A 1OTTD 4X8JB 1J1PL 2EO1A 4OZ4A 3GSWA 4W70A 1BJ8A 3BJ91 3RWIB 2HT2D 2NY0B 4NO5B 1BFTA 2NYYC 1FN4A 4OLXH 1SY6L 3IJYB 4NNPH 1FIGH 3EOAB 3EDDA 1A7OL 3KYOA 5DZLA 5GGUA 4BK4A 3BW9B 5DVMA 1PG7L 1MHEB 1FDLH 3L7EA 3ARGA 3MNVB 4YGVA 2Y36H 3UTSE 1W2KT 5GRVK 1DN0B 3BKML 3B2UC 5D6CA 1PSKL 2DIBA 2XTJE 1MH5A 4XH2B 1MFAH 1DL7L 4X9BA 1I7RA 4IDJH 4XI5C 4MAUH 2W65A 5ISZE 3QRGL 1TVDA 2NNAB 5GGVL 4Z7UF 1NLBH 3BWAA 3VXME 3C08L 3TA3C 1V3KA 1YEGL 1T2QL 3BI9X 2J6EH 3EO9L 2XACC 4ALAL 1JGUL 2GT9B 3K1DA 4AZ8A 4EKXA 4LIQL 2MKLC 4AIXA 1A9BB 1H0DB 1N5AB 2HJKB 5HHMB 2QJDA 2K7QA 5KSBF 1QO3B 5C09D 2RBLA 1UKQA 2D31A 3NZ8B 4F7TB 3BPOC 2EDOA 1A14L 4GFTB 5GRYA 1RIHL 3L3IB 2YPLD 4KJPD 4KGJA 4KROB 3O3DA 5IBUG 3M1BA 4HUMB 5CEZE 3RUGB 4CVXA 3L5IA 2VKWA 2BCKA 5IB2B 1UENA 3BIBX 1DR9A 3B8SA 2VLKD 2GFBA 3O2VH 5GHWL 1CG9A 4HH8A 3VXSE 5EU7C 1UEMA 1BAFH 4OV6F 1QVOA 2V7HB 4XPTL 5JNYB 5E8PA 2EXYC 1QR1A 3CCHA 2BY0A 4AIZA 4Z95H 3FKUS 4RISL 4PS4L 1FNEB 1XCQA 1NFDF 3U4EA 5FCUL 2I9TA 1T0PB 1JPTH 3H9SD 5FYLD 3IKCB 3EJZD 2DQTL 5E1AB 4Z7VA 5DEZA 2IEPA 2XIDA 2OTPA 3L5XL 4AM0B 5SWZE 4KUZH 1AP2A 2MHAA 3QI9A 4P2OA 1OAXL 3SDCD 3FO0H 3PIQA 5I8EB 5CJ5A 1CD1A 4PJDA 4Z0XA 5ITFB 1GGIH 2QQKL 1ODAA 2X4OA 1D5XA 1Q9WA 1MCFA 3REWB 1XAUA 1XZ0A 4P3CL 3KLDA 4KZDH 2CKNA 1SBBA 4HMDA 3QIWB 1MRCL 5HHXH 5E2UH 4GG6E 3VFPA 1HOCB 1ZA6B 3UTTD 5GRXG 1Y0LA 3MLXH 3OMZA 1OM3L 2K9UA 4TNWK 2ZCHH 2PXYA 5EA0L 2AV1B 2EYSA 3DVGB 2E7LC 2HA1A 1KYOJ 2OTUA 5DJ6A 1TVBB 4FMKA 5ELIA 2W38A 4IS6A 5IB1A 3DPBA 35C8L 3M07A 1CK0H 1OGTB 1S9YA 2OTWB 5ALCH 1JJUA 5K9JH 2C1OB 3HI5L 1I9RL 1YEHH 1OP5K 3B9KB 3MXWH 3FCTA 5J12B 5GSRA 2P5WB 3LEVH 4JRXB 5FOBA 2G2RB 5LWYL 4JFYA 4R2GD 4OSUL 2CR3A 4P5TB 3ROOA 1DQQB 3AS3A 2DJ4A 1EFXA 5J4MA 1BJMA 2JLLA 2DWEA 4PJBB 2MJWA 3OKNB 3MRMA 5INDB 4NDMB 2J2ZA 4GKSB 1IAII 1SEQH 1WIOA 4BJLA 3W82A 1FLRH 1U8QB 4GRWB 4UIKH 1NCBL 5EUKA 1Z9LA 1CLZL 2R2EB 5FM4A 4BH7B 1KT2A 4HPYL 3ULVE 3GM8A 3GJFA 2F19H 4M9PA 1DUYB 4YHNB 4KAQL 3RNQA 5JA8B 2XI9A 1KC5H 4JKPH 3HLAB 4YHMH 3TVMA 1IAIM 4ZNEA 5SX4H 1J7VR 4N0RA 2Q87A 3MLVH 1XIWC 3A67H 2I5YH 4LCWB 2VQ1A 1QKZH 1R5VB 2O5XH 3D2UD 5HGDA 1G6RB 3FN0H 4QXTA 2V17L 5FO9A 3MLUL 3WFBL 1Z2KA 3VWJD 2EEBA 4DEPB 4TN9A 3IKKA 3MRRA 4X6FB 1U2HA 1Q9OB 4PJGE 1A0QL 2AXFB 3HCVA 4LCIL 3RUGF 2V6HA 4PRAB 5ACZB 3OAYH 1CDHA 3L9RB 5C0BA 3VGAB 4JPWH 4P59H 1U2CA 2KDGA 5C0GA 3TZVD 1XF3B 3PV6B 4R9HA 4EOWL 1L9NA 1PJ9A 3PNWA 4RA0C 4KDVA 1NC4D 3WHXA 3DV6B 4DUWA 2FEDC 1EO5A 5DRZA 5E8EB 3QT2A 5DMJB 4HX1B 2ICWA 2YK1H 1JFQH 3KJ6H 5IW1A 2OK0H 3CUPB 2Y4SA 3C6LB 5CD3B 1B6DA 4XHQA 4ZXBC 4NZDA 5F9WB 1NMAL 3HAEB 4OCWL 4OCLC 3BKCL 1FFNA 3MRJB 5TDOA 4DZBA 1OF2B 3GSUB 2JB6A 4J3TA 3QZWG 3QA3B 1ZT4A 4MAYA 1P7QA 2AJ3A 2YD3A 5I8OH 1KCUH 1QYGL 2FO4B 4OLUL 4HPOH 4N5EC 4I2XE 4NO0A 4X4YA 4JRYD 2J8UB 3IXAA 5H35B 4QF1A 2UVEA 2XWJB 2HJFB 1N6UA 4D0DB 3QEQD 4JFQB 4ZAKA 4NSKB 2N56A 1M7DB 3EYOB 4NNXB 5CS7A 1ONQB 5IG7A 5FGSA 5T5NG 2DKUA 4OFKA 4WI6A 3P11H 4LF3A 4XT1C 3V6FB 5BS0B 2VDQH 1H8SA 2X70A 4Y5XA 4OKDA 5K9OB 4OD1L 3BP5B 2EE6A 1NQBA 4PB0H 1YPZE 2OXGA 1KNOB 1NLDH 3C6SB 5IROA 2VYRE 5B39G 4ELME 1BZ9A 1MI5D 4XCEA 5I18L 2WUBL 4OJFH 2Q6WB 1LEIA 4JHZA 4PUBL 5D7JD 5IESL 4ZFZB 2AS5M 3GRWL 3WHE1 2VN4A 2UUDK 5B21A 4PJBF 4IOSD 3MLPA 4RGOH 1RJYB 2Z8VC 1VACA 1WZMA 3RU8H 3MNZA 4GRWF 1I3UA 5H37G 4QEGA 3I2CL 3Q6FB 4AEIL 1N64L 1FG2A 2DLGA 3BQUD 3P30H 4NYLB 3FQXA 5E03A 5HHOA 2XICA 5FAAA 4OZIB 5CILH 2DQEH 1XGYH 1F58H 3A6OA 3MMEB 4TSCH 2X9XA 5CBEB 5AG9A 1WITA 4PG2C 2XG4A 4S1SH 4IIQC 3UBXI 2JELL 4CN4A 3PGDA 3ARED 1MCSA 3C5SB 3O3BB 1T0NB 1I3RB 1NAMA 1I1FB 2XZQL 2W0FB 1OTUC 4O51B 1QQDB 4PR5A 3AMKA 4P2QE 1TZHB 1Z9SA 3VG9B 3QCVL 4JM2A 2YEZA 4JO4H 1Y6NR 3RVVC 3ZE0E 5D1XB 4JY6B 3S96A 3JWNC 4YDVB 2DIJA 1B0RA 3T0EB 4WO4B 1XF1A 5F6IB 5HGHB 1EH9A 4Q2ZB 5IMMA 2NX5E 2OQJA 2ZSWB 3RQ3A 4OIAA 2GSGB 2DB8A 3D39A 2VDLL 1QBBA 3LKPB 4IMLB 1A2YB 3BHBA 4PJ7E 4LPUA 4J2XA 4HWBH 2XN9B 4FQLL 3O81A 4G9FB 4R7DA 1C8PA 1KELL 4LNRB 3Q3GA 4TOYL 3VRLF 4WFFD 3E3QC 1YY9D 5E9DA 3C09C 4KK6C 4YX2H 1MIMH 4MZ2A 3QUMB 1JHKL 3W9DB 4U33A 4NQED 3QI9C 3U0WH 1ZA3A 2CK2A 3BVNA 3SE9L 2FGWL 5D5ME 3MJGX 5D7KE 3QPQC 2DQJL 3MV9A 5HD8C 1TNNA 2Y9RT 3TT3L 4DOHE 5KSVB 4DUXA 3MACL 2QR0A 1UZ8B 2DWDB 5I1DB 1YNKL 4WNQA 4W4NA 2Y06L 3FTGB 4WU5B 5FHAL 2JJTA 4I13B 4XPFL 4PJXA 3IVKA 2F15A 3DVFA 4M00A 3UBXB 3HPJB 3ZE2E 2J8UF 5KVDH 5KW9H 1U8KA 4G8GB 3UTSD 2PNDA 4DVBA 3S37H 3V9FA 2V7NA 4J3SA 3BGMB 4N8CL 2XTJD 3QUYD 4QHMB 3PWLA 5KAQF 1E27A 5DQDL 4MA1C 3PWUB 4RDQF 4NO3B 3TBTB 1F02I 5KS9E 3GKWL 2ARJA 5ISZD 1S3KH 4MJ4A 4QOKB 1T04B 3V2AR 3VXMD 2X44D 5DT1L 1QPPA 1BEYH 3T09A 1WBXB 2FWOB 1FNFA 1PYWA 3ARFB 3SBWA 4PRBA 4NQVB 4LPCA 3MRNA 1SBSL 4Q0XL 1MVUA 3WFCH 2XXCB 3BIAX 3HNSH 1TQBB 3MRPB 2D7TL 4WFGD 4JN1H 5AAWA 1MLCA 3IDIB 4U0RB 4EUPB 5CEZD 1CZ8L 3IFNL 1FRGH 5KVGH 4X80L 3CVHB 3LD8B 2IH3A 2A9NL 1J9CT 3VWKB 1NGQH 3O11A 3VXRA 3BE1L 5E7BA 3RJQB 4NN6B 3N06B 1IGML 3NTCL 1FL5B 1IMHC 4F57L 5IKCA 2VAAA 1OAUL 1J5OL 4JFDB 2AJUH 3BPNC 2A1WL 3LS4H 5E00A 5GJSH 4M7KL 1UGNA 3C8DA 4DN3H 3P0VH 1CLCA 3QZWA 3C5ZC 4OTXL 1KIRA 4L3ED 3OR7B 4QY8A 5SWZD 2AABL 5LVEA 2Z8WC 1YMME 2D3VA 5C9JB 2V5MA 4QRPB 3HR5A 1D9KD 5EU5A 1MHCA 3VJ6B 1XH3B 1WZKA 4JFZL 4Y4FB 3RHWF 5KSAC 4LLUA 1JE6A 4G43B 2DICA 5I1IL 3DX6B 4XTRC 1N0XH 2P8LB 2CPCA 1JF1A 1HCVA 4FA8A 4M8VA 5JHDE 2EIBA 1G1YA 2BSED 3UTQA 2MSPA 3ARDB 4FQ1H 5KN5B 4LAQL 1P4LB 3UZQA 3QNXB 3BXNB 4R4ND 1GL4B 1I7ZB 5JZ7D 2GTZB 1F11B 2OSLA 1ZSDB 3X11B 3OAUH 4HWEL 1YC7A 4K2UH 1UM4L 4H88H 4BFIA 4FQXD 4XB8A 1M7XA 3KYKL 2YD6A 2BNUB 3MYJA 1NH6A 5KVFL 1G0XA 5GSVB 4DWHA 2XRAL 3RAJH 4O2FB 4ZO6A 1GOFA 5D71L 1J1OH 3F7RA 5DTFB 2X40A 1AC6A 1CE6A 3SGJA 3ZKND 3PQYB 4KK5C 1MWAB 3TIEB 2CMRH 4TTDC 4GXUM 4U6HB 4C58B 5J0BA 3RPKA 1DQLH 3PG2A 5BO1L 5C9KA 3JUYA 2PTVA 1JVKA 5ESAA 1BBDH 2R1WA 5E7FA 2Z31D 3OKKA 4ZO7A 2EC8A 5C3LD 5DK0B 5I71B 2MNUA 4WW2A 5IFJA 1RK1B 2QLVB 2Y6SD 3FB8B 1PGRB 3UXFA 3KPLB 3ULVD 2HKHL 2NXZB 3DLQR 2CIKA 2VNCA 4UAOB 5A3IC 2VISB 3FFDB 2DQCL 1QSEE 4U3XA 5FIEA 1IGCL 3P9MA 1FJ1B 4Y4KC 4HEME 4R96B 3MV7A 3PL6C 5GZND 5HHNA 5MEPA 5D7IA 4Y5XC 2ERJB 5L0QC 1CICB 4LPVA 1J86A 3ZDXE 3PE9A 2DL9A 3QDJB 2FDBP 2VLRE 1C5DA 2YSSA 3BJLA 3OJDB 4I3RL 4A6YH 2AXHA 3OV6A 4V1DA 1GC1H 1RZGA 4UILH 4XAWH 1OSPL 4ZUVA 2DJUA 5CSZA 4EI5A 1J8HB 3VGBA 4N9GB 5B38B 3UTZA 4X5LA 2VIRB 5I1AB 3IGAB 3RDTA 3MCKA 2K7PA 4RAHA 1PKOA 2YUZA 1F2QA 3OHXA 3TWCL 5I1HH 1ITBB 4BSWB 3VFRA 1S7RB 2GCYB 1CLYL 1T1ZB 2JIXA 4NUGH 1I1CA 3QIBD 1EEZB 4FMFA 3GHBH 3I6GA 4P9ML 3KPQB 5TF1H 2C5DC 4LOUD 2Y25A 5IHLB 1A7PL 3MLYL 3GNMH 1JUFA 1FE8H 5BZDA 3UDWA 4QLRA 3WBDA 5J06A 4I0PA 2Q86B 1U93A 4XP5L 3MRQB 2IAMB 3RKDD 2RGSA 3SKNB 4M7JH 1BVKA 1WTLA 4YLQT 4PP1C 4IRSA 3I02A 2EZ0C 4QHKJ 4PG9B 3CMGA 2DQDL 4PRPE 4FQIH 5DA4A 4XX1G 3F12B 4KKNA 2OZ4H 5C0CA 4PJ8A 4M4PA 1M05B 3BOVA 4HLZG 5TQ2H 3T77B 2Z93A 3ME0A 1RIVL 1NMBL 3QWRD 3KXFB 43C9A 3OKLB 5CMAB 5CLWA 5BXFB 4PTUB 4GW1A 5MERA 1MEXH 5EOTB 1IC7L 3OG4B 2HMIC 3QFJA 1DZBA 3QHZL 4ZUWA 1DVFD 2VDKL 5D6DA 2OCFD 2E7MA 4KTEH 3P4OB 5I1CH 2DQIH 1KGCD 3S3JA 3VFOB 4XC3H 3VI4F 4PYGA 1BMGA 5ID0A 1QSVA 1K2DB 1Q0XH 4NQXA 3BP6B 3LKNA 5BW7A 4Q9RL 3ARVA 1RUAH 4KQ4L 2H9GA 3MZTA 4YWGL 3E2HC 3FOMB 4M61A 3KR3H 4PRIA 4YR6B 5JQHC 2NLJA 4S1QH 2N7BA 4ODVH 1JTTA 3ZYIA 3QUZB 4ZO9A 1Q1JH 3H9HA 2DN7A 2VLJB 4HK3N 5FXCH 4AT6B 2LABA 4J4PC 3C9NB 2ZSVA 3OBAA 4UINH 5HTSA 5IVNA 2H32H 1S5IH 4P4KD 4WCYH 1Y6KR 3AS2A 4WFHE 1VADB 2EDQA 4PJHE 1J11A 4JFFE 3MGAA 3TJHD 2EH8H 3O6MH 1U3HA 4P2QD 4JFPA 4Y19B 1X9QA 3T04D 2JK5B 3LKQB 3MGTB 1BIIA 4NC2B 1JPFA 4OF0A 3WS6C 3H42L 1GIGL 3HPLA 1EHLL 3RA7L 3EHBC 4I0KA 3A6BL 4HUKB 1OGAE 4C83B 1HXYA 3LQZA 5FA4B 2EKJA 4WHTB 2NX5D 3SDDA 4K3EH 4EN3D 1LD9B 3W81A 3ALXA 2DKMA 4X8XA 4RIRB 5CIPA 1S7WA 5CZVH 3HG1B 1I3VA 4LPXA 2VXVH 3GSQA 1LP9A 4U1HB 3LKRB 1ZLVH 2L7UA 1MQKL 1F3DH 1KJ2A 3FFCB 3NAAL 1VGKA 5IOPA 1YEIH 3PWPD 3PWJB 4XPHH 1HWGB 4HIJB 3D1MC 1ORQA 4UV7L 3H8NA 3ES6A 3EO1A 3DMMA 4EUPH 4QNPE 3DUUA 2DMKA 1WFOA 5FK9A 5D7KD 1MLBA 1JNLH 3EZJB 5HGBB 5D1ZB 3EGSA 5GGVY 1IFHH 4ZS6D 1XGQA 2YD8A 3NA9L 2XA8L 3RWCA 4PJ9B 4F58H 3OSKA 3CH1A 3IAQA 2H3NB 2YR3A 4G9DB 2I07A 3FN9A 1UVQB 3DIFA 1AGBB 1AI1L 4Z6AT 3EOBA 4ZTPH 3QNZB 1A6ZA 3MNWA 3JV6A 3O6FC 2ZP0T 4J12A 3TIDA 1TDQA 3IJSA 3OPZL 2JB5L 4LIQE 1ZLSL 3L6FB 3HTLX 4GAFB 1HHGB 2F58L 5E70A 4UT7H 5IQ7L 3VDBA 1TJHH 2X89D 4JFEE 2VZ1A 2ORBH 3BX7C 4HUUB 3VXQA 1A1NA 4WJ5B 5CCKL 1R5IB 2IH1B 3GB7A 3P77B 3ZYZA 1BOGB 1I7UA 3UJTL 5E2VH 3NVQA 4JY4B 4H5SB 3OAYK 3K46A 4XPGH 4ZOBA 2IGFL 5IR1A 3BZDA 3L7FA 5F3BA 1IC4L 3LQAH 3A6CH 1MREL 1RJLA 2LU7A 1IAKB 3VI3E 2FIKA 4P2YA 2VLME 1W72B 3G5XB 1KENL 1OPGL 4QHNB 1A6AA 3WD5L 3F58L 4MNQE 4PJ5A 4ZYKB 3ARUA 5I8CA 5AAMA 4GKNB 4OT1L 1NUNB 2ICEB 1H9VA 4PRHD 1H3WM 5F88B 4OLYL 2XKNB 1XGRA 1JTPA 2EEAA 4YBQD 2Y1VA 3NZHL 2CQVA 1IL1A 5DQJA 5FO7B 1F6FB 4OFYD 4AG4H 2SEBB 3AU1B 3O8XA 4WVRA 5DO2C 1ZS8A 4LQFL 4M62L 3F7YB 3QNYA 1L6ZA 1OAKL 1CGWA 2V9TA 4ZUSA 4Y1AB 4XP1L 1MIEH 2C4FU 1P2CA 1YMMD 4OUUB 4OV5B 4MQ7A 5LCVL 4PGBB 5DJ2A 2ZUWA 2PW1A 3OX8A 4Y4HB 4ACPA 2WIIB 4LCCC 1UB6A 4M7LT 5F97E 2Z4QB 1MFDL 3W2DH 32C2B 4CJ0A 4XMPL 4YC2B 1WZ1H 5TDPA 4XMLH 2Z91B 3LEXA 3EO0B 4BYHA 5DFWH 5JHDD 4FZEL 5FYKE 1UCTA 4OB5H 4Q9CA 2UWEF 5DWUL 1J1XL 3GI9H 2EECA 1UZ6E 4NRYA 4LQ1A 1FC1A 4U6VL 1CFQA 3HZMB 3ULUH 2XKSA 5CGYD 5DMIL 1WICA 4D9LH 4NQCE 4DUVA 5CEXA 3PWNB 2G5BA 2EYRB 3FT2A 2WUCL 3UJIH 1FIEA 2X4NB 2E7HA 5C0ND 3CPLA 4L8SB 1GHFL 3T3MF 1E6OH 4NUJA 3HZKB 1GGUA 1FNGB 2ESVA 4ONHB 2MPAH 4NJ9H 5MP6L 1R3KA 5FCSH 2CLRB 2VOTA 1C5CL 1U58B 2GTWB 3IJHB 2IQAA 4RGNB 1H3TA 2XKUA 4RMUA 2VXSL 4EBQH 1KIPA 1C5BH 1BGXL 3RFZC 1FGNL 4RRPA 4RWYL 3HI1A 1YN7A 4X98A 3VH8G 3O2DH 5KJRH 5C09B 4MHHI 1NANH 1K4CB 2EH7H 4K7PX 4KXZH 1XF5B 4Y88A 3TNMB 4EXKA 2VLLA 4YDKH 1Q94B 4MD0A 3UJJH 3FQWB 4KI5F 1N59B 2GY5A 2DTSA 5K9QG 2NY2C 1S7VA 1I7TB 5F9OL 2X4UA 4PJCA 3NCBB 1RHHB 1BJ1H 5FUZH 1AGDA 1N8ZB 3V5HB 2VLKB 4IRZH 7CGTA 3SCMA 1HIML 4OM0H 1FGVH 1QSED 3PP4L 1G7JA 4PJIA 2OL3B 2BXYA 1OAQL 4CUCA 2FSEB 3QXAB 3EAKA 4RMWA 2AKRB 3PDDA 5D6DC 4DN4H 4KKLD 1QSZA 1EHAA 3BRGC 1CF8L 3ARBC 4S2SB 3OGCA 3H9SB 3DO3A 5BJTA 1HWHB 3BIKB 1J88A 4FQHA 5HYQB 2VLRD 1CE1H 2JCCE 5GGQL 4X99A 4RX4A 5BW7C 1U92A 1FO0H 3P73A 5IB3B 3KYNA 1TMCB 5JMRA 1KB5H 5EOQH 1AR2A 4H1LB 2VDRH 4I4WA 3IDJB 1HQRB 1LO5A 3KPNB 2HN7A 3TFKD 1YY8B 2IANA 3ZL4L 5J6GB 3TLRA 4P46C 2HH0L 3GSRB 4YHPA 4JFOB 3ZDYF 1TPXB 2JJWA 4MHHG 1CDUA 3EFDL 2QQLL 5I9QC 5D2LB 3RWDB 3DVNB 4NJAL 4UTBH 4W68A 4WW1A 5F6HJ 1MCDA 3MRGA 4I18B 2PYFA 1U3HC 2FX8H 4L5FH 3U30C 1D5BB 3BISA 5GIRA 3L95A 2R8SL 4EDXA 1R5WA 1AKJD 1WZLA 3IF1A 2AI0L 1CXLA 3QQ4B 1RZKH 3N85H 2YBRB 5DJCA 1CFNB 3HE6C 1I75A 3S97C 3SDDC 2FL5A 3KLHC 3D0LA 3D18B 4JPVH 2R2BA 1JPSL 5DJ0B 5AEAA 1A1MA 4LKXA 3MRHB 4R2GB 5IFAL 1IGYB 1CCZA 5C0AB 4CRPA 4DKFL 4FTVE 3G6AB 4XCNB 1C12B 2Q8BH 3S4SB 2BMKA 1KEGH 3CGTA 1BVLB 1ZWIB 3MPCA 2WQRA 4OZGA 4LASH 2I24N 3AY4A 2C3VA 1T1XB 2AK4A 5K9KA 5JDJA 2O5YL 3V5KB 4WUKL 2DQHH 3KPSE 3TO4D 1T6VN 3IDYC 3DMMC 3O45B 4MCYA 1I4FA 5HY9B 1KJ2L 3JWOH 4G7YL 3SDAB 4BQCA 2H2PC 2FR4B 4ONOA 5E2TH 4Y16D 1PG7X 2FX9L 1UG9A 4P5KB 3L3DA 2O61B 4J6RH 1S7QB 1AQKH 3MTRA 1F6LL 2ATPB 5BQ7B 4DGIH 1Z9MA 3MZGB 4L3CA 2ID5A 1UXWB 2Q1EA 3Q6GH 4P9HC 2IQ9H 4F7MB 1SM3H 1Z9OA 4D94A 4Y2DC 3GBML 4KHXL 2OP4H 3O3UN 4HG4J 3OKEA 4X4MA 3W39B 1EA9C 3TZVB 4MB4A 5MI0C 4YXHL 1KTDB 4ODSL 4IM8A 4NRXB 4P9HL 3BSZH 4WFHD 3ZTJH 4JQIL 3ETBF 1YUHA 4OCSL 4JFFD 2NCMA 5C0EA 3D3VB 2NY5H 1PZ5A 4NRZB 3LN9A 4MWFB 1X4ZA 1ZGLP 2XQYK 4XPAL 5DRWB 4QYOA 1UJ3C 5IB4B 4CU8A 1VB9A 2HRLA 1Z3GL 5I1KL 3R1GL 1T7VA 4M1DH 4JO2L 2R0ZL 1TFHA 1JZ5A 1CL7L 4J8RB 3STLB 2V2WB 2IFFH 4LGPB 1JI2A 1XMWA 2BVQA 4GMTL 4NZJA 5F7DB 5IW6B 1UACH 2XZAH 5L7XL 2R29H 3AB0B 4YPGB 5J3HD 5D93C 5F96L 4BK5A 3E3QE 5IEKB 4Z7VE 4JRYB 3UC0L 3BRDA 2Z35A 4IJ3B 3HB3C 3H3PH 4ZTOL 2ITCA 5D2LF 1W72H 2HLAA 3QEGL 4G6MH 5HI3C 2GJZA 4OGZA 1NGWB 2P8MB 1FFRA 4IOFC 3KJ4C 1JIBA 3QEQB 3WFHA 3MV11 3SKMB 3VH8A 3VXUB 3KPMA 1CGSL 1F42A 2QSVA 2YPLA 2H8PB 1ED3B 1WBYA 2NYYD 4MD4B 2FBJH 6FABL 1NCCL 4Z7QF 2BSSB 2A6DA 2I60L 1DQJB 2ZOKA 4HMEA 5BVJA 3GMMA 4CBPA 1WGOA 2XZCH 3EOTL 4PJEB 3U0PA 5IMOA 1BF8A 3CSYA 4JR9L 2VDPL 1MI5B 3PGFH 3SQOH 5GGSA 2YXMA 1RMFL 5D7JB 4XI5D 3U79A 3SGKA 1LEGB 2K1MA 1YEDA 2F53A 3MRKB 1YECH 1OW0C 4QHKI 2AEQL 1XFPA 4LLQB 5FKPB 3KAAA 4CKVX 4QHLB 4JFED 3PDOB 3MRCA 3TA3D 3SDCA 4KVCH 5DEGA 1U8OA 3ECBA 1IGTA 4HC1H 1FZJB 5CBAB 1ITCA 1MUJA 3FO9A 4JHAL 5IW3A 3RL1A 3JSSA 4OCRH 3AROA 4XWGH 5IV2A 5EZJA 5GZOC 4MX7B 3L5WB 2V5TA 5DUMH 4CNIB 4ODWA 4DKEL 4LPTA 3O3EA 5EU6B 2H1PL 3AREB 2VLMD 3LPFA 1FIGL 2NY7L 5C08A 4L8DA 3UTTA 3VCLA 3V6ZB 1JHTB 1U8JA 2EKSB 4MNQD 3UROR 1FDLL 1SVCP 5GRUH 5FDWB 3RIAF 2Y36L 2CUIA 2JJUA 1FZKB 4K7PH 3BDYL 8FABB 4UUJB 5I6XB 1YEKL 1VENA 1T5WB 3PUCA 2BSTA 5IFHH 1MFAL 5IEHA 4TULH 1OT1A 4HKJB 4TNVK 4MAUL 2GY7B 4IBLT 5FKAA 2B1HH 3J8F7 3X3FL 1MHEA 1NLBL 3RWHB 3MRLA 5IHZA 4LLMB 4RFNB 1MRDH 2J6EL 1IQWL 4WI4A 4ZNEE 1G0DA 4OFDA 4RAUA 4JG1L 5T3XH 1FH5H 3QRFM 1FVDA 4ETQA 4QT5A 1R6VA 3HNTH 2G5RA 4LEOB 3T08A 1J0IA 4C4KO 4Z76B 3C60D 3QEHA 1VFMA 2WSKA 1CR9H 4NN5C 3LRHA 4WTZG 3EFFB 4HWBA 2HJKA 1WTGT 1BVZA 1V3MA 5C0BE 4OIIH 4LGSB 4EIZC 2CUHA 1NBYA 4JZJC 5FYKD 1KLGA 3FOLA 3TPUB 1BAFL 5FOJA 2P46B 1K6QH 1OT2A 5GXBB 1HINL 4Z95L 2R4RH 2V2TA 2V2XB 4UDUA 5IB2A 1JPTL 1TJGH 1RJZA 2EICA 3RPIB 3S5LG 1I9IL 4R7NB 3NIFE 4NQCD 1DDHA 4JO3H 4MSWA 4LSDA 3D2UA 1N0LA 4JM4L 1A64A 4TSBL 5HVFB 1KJVB 5CLTA 5ANMA 1S7SB 2XTJB 3K4AA 1FSKB 3FO0L 4FQJH 5D1QB 1B3JA 3QQNA 2VABA 2UZIL 4O4YH 1GGIL 1N4XH 3VG0H 4K7FB 5GGTA 3VWJA 4MJ2A 4F3FB 4O2EA 3VXMB 2CIIB 4H1LH 4PY7B 4LRNH 1LE5A 1MCLA 5DHYB 3UO1H 4KZDL 1KFAL 1A6PA 2HVJA 5D7LB 4GXUN 3F7VB 5E2UL 1K8IB 4PJEF 3MLXL 2ZUTA 2X4QB 3TBSA 1U8NB 1QFWI 1WT5A 1NC4A 1JPST 1G9MH 3GHEH 2Z8RA 1WAAA 3FONB 4C56D 1PEWA 3L3GB 3SJVA 1CK0L 2NR6C 2UZXB 5SV4A 5ALCL 5ADOH 4TTGA 3GSOB 3MFFB 4JO1H 3G5ZB 2E6QA 5K9JL 1QFWM 1XIWD 2F74B 2PO6B 2BZDA 3MXWL 3VXSB 5JIKA 5I76B 1I8IB 2P47B 3RZWA 1YMHA 1TTFA 5DJDA 3RGHA 5AD0B 1S9XB 4F7CA 1IEAB 2ITDA 3LEVL 3VFUB 3GMRB 1ZLUH 4XAKD 1J0HA 3LSOB 1A7OH 1F4HA 1MF2H 2I9LA 2F8OA 2UV3A 4WU7B 1PG7H 1FP5A 2WBJC 4I77H 2NXYD 3U7WH 1ZLVK 1NGXA 5A2FA 3LKOB 1P7KA 4P4RB 3BKMH 5I17A 1E4KA 1VPOH 1S7UA 1SEQL 3WLWD 5F7LB 4E41E 1BQHG 2KQNA 2G2RA 1DL7H 3BN9C 5JOEA 5I0DA 5HHOE 3B6SA 5GGVH 5GISL 4KRPB 4KZEH 4X9GA 1EPFA 4FG6C 4PJAB 4YHYC 3C08H 5INDA 1YEGH 1T2QH 4TUOA 1KC5L 4NKOA 4HWZB 2FEDD 5IVOA 4ALAH 1JGUH 1VFUA 2B5IB 1IGFH 3BMWA 1AXSB 5LGJA 1DQTA 5I16A 4OF6A 2QHLA 2I5YL 3BZEB 4JANB 1QKZL 1Z5LA 3EIFA 4ZXBD 3OXSB 3V4PH 4CMMA 1OL0A 1T89A 1E28A 4I48B 3T4AB 5DJAB 4FQCL 1KCSL 3S88H 2PTUA 1A14H 4FRWA 1OSZA 1P4BL 4FQXB 2E8YA 3STBA 1DLHA 2FJFA 5I1GH 1Z0NA 4LVOB 2YA2A 2VE6B 3DX9B 1VSCA 1FORL 4JPWL 4P59L 3BQUA 1TQCC 2EDTA 3D39E 4N5ED 3SDYL 2XFXA 1EUUA 3X3GL 3NABL 4L4TA 4OLZH 3IXTA 4RISH 5FCUH 3B4NA 3U46B 5EUOA 4X9HA 4MDJA 4FTVD 5HDLA 2DQTH 3DYOA 3AAZA 4RZCA 4O2CB 4ZG1A 3L5XH 1HDMA 1RZIA 3VFMB 1T83C 2IWGA 4I3SH 1D5MA 1JFQL 5HHQB 2OMBA 2Z31B 3KJ6L 5D9SB 2OK0L 2NY4C 3CMOH 3KPSD 2BSRA 1PQZB 4ZFFA 1T6WA 4HLJA 2B1AH 1JNHA 1RUQH 3MV9E 2CLVB 5F7HA 3QDMB 2ADIA 1H3VA 4X6CB 2AJSL 4XHJC 1KCRH 4OZFG 1VERA 2QQNL 1OM3H 4X6EA 5D2NC 4ZFGL 1U36A 4PJXE 5EA0H 4HPOL 3MRJA 5EIIA 1MFNA 3IDNA 2GUOB 4BKLB 4DKAA 4P23A 4I1NB 4WGVB 3U0TA 3VFWA 1JHLL 4R4BA 5DC4B 3DX8A 4PJGB 1QZ1A 5DS8A 1JNNH 3D0VB 1TCMA 4A2MA 3RGVC 1I9RH 5M94B 4A6YA 5FYJH 4YEFA 1U8PB 4WTZA 3N1GC 1J12A 1A6UL 1NLDL 5LWYH 3EYOA 3QG6A 1MOEA 2CK0L 3RVVD 3QIBB 3HE7C 4HS6B 4NNYB 5EU3A 4WI3A 2DYPA 4QRTA 4RGOL 1MCWM 3QUYA 5B8CB 1CLZH 1REIA 1SQ2N 3S5LA 2LTQB 2NY0C 4LRIC 2DD8L 2BVOB 4GW5B 2HG5B 4B7LA 3VXRE 4HPYH 5AYUH 2LU4A 1BFOA 3TEUA 1AIFA 4KAQH 4KJYB 3T65A 4PJAF 5CILL 4U1LB 4Z5RA 5IBTL 4DGVL 1F58L 4LU5L 4TSCL 3CC5A 4KKAC 1RJYA 4CADB 4S1SL 2MKWA 4CU7A 4KK6D 4I2XB 2AQ1A 4WEBH 4EJ1C 2BDNH 4GSDL 4S11A 3QI9D 1I8LC 2V17H 3CDCA 4OZIA 3MLUH 4GQPH 4AEHL 4R0LB 1NCTA 3QPQD 3SGDI 5CBEA 3SPVA 3CFJA 5HD8D 2OZ4A 4QRUB 4LCIH 3RTQA 5KVMC 3MLTB 3W0WE 2J3SA 2YUVA 2CDFB 3KLAB 4CL7A 4R4FL 4PGDA 2C1PB 3CVIL 3D69B 2W0FA 4O51A 3LEYH 1TZHA 3LN4B 2YA1A 1YPZB 3GGWA 3Q2CA 5DMKB 5HPMB 4OZHA 4EOWH 1FZMA 2D2OA 4UV4H 4WWKB 2OJEA 3RL2B 1I85A 4M8QB 4JPIA 4KROC 3L3HA 5ENWA 4GT7A 5HGHA 4PV9B 1KCLA 1E4XL 5EC2A 4L3EA 2FIRT 2O93L 2BHUA 1X7QB 1F6AB 3L3KB 1MIML 5I1LB 3LPWA 3IFOA 1L0YA 1D9KA 2R4SH 3U2SB 3VMPA 1QFUL 2CDEA 1V7NH 1NMAH 3WJJC 3SO3B 3U0WL 3BKCH 1EZVY 3NPSB 3ULVF 4AY0A 5CJXA 2YD2A 1RU9L 1TXKA 3TBVB 1BQHA 1I8MA 2X1PA 4G7VL 4HKZA 4MA3B 4Q58C 4X6CF 2R23B 1KOAA 3GIZL 2XA3A 5F9JA 1U8IA 2LAGB 5JO5B 3ZT5A 1CFSB 5KW9L 1JN6B 2JJVA 3S37L 4P2QB 1MFCH 2YKLH 2H32A 1KJMB 4FQ2H 5MENE 1QACA 3H0TA 5CD5C 4PJGF 4OAWA 4PYHA 4OF8A 4DGYL 1S3KL 4NZTL 5DD6B 3HC4L 2NX5B 4LLYA 3ILQC 5T1KA 3TVMD 3TYFA 4RAVB 3HMXL 2Y5TB 3LCYA 1FL6A 4UQ2A 5HI4C 3TN0B 4PJ7B 5D7IE 3WO4B 1ACYL 1MVFA 3M8OL 1INDL 2PYEE 1NKOA 3PHOB 3BGFB 1SYSB 2X1OA 5CJBA 1NJ9B 4YO0A 4JQXC 3HNSL 4PUBH 4WV1B 5IESH 1XF4A 1R3LA 5L8JB 4V1DE 3QG7L 3HNVL 4XTRD 4JN1L 4X5WA 5JLZB 1WBXA 2FWOA 4ZPTA 3B9KC 2ZNXA 3DV4B 1HEZB 3QIUA 2AK1H 5J12C 1FRGL 5C0BD 5KVGL 4AEIH 2N4IA 1N64H 1ACZA 4KWUA 4QHUA 1D5ZB 2ZOLA 3MRPA 1B4JH 3A0OA 3T1FA 1JWSB 1RD6A 4P5TC 4DOHB 4PREA 3MGOB 5FUOH 4U2YA 2OMNA 5JMOC 5GJSL 5IVZA 3P0VL 4U6XB 4HUXB 3JVGC 5E4EC 2APVA 5E8OB 5JIPA 5GS2H 3BP7B 3JXAA 2XZQH 5ESVA 3VXNA 3C8KB 4JFDA 3QCVH 2GJJA 5AG8A 5KS9B 2D0FA 1JPGB 3QO1B 1KIQA 1RFDH 4Z77A 4KK5D 2R1XB 1CYGA 1P9MA 3MJ7B 1P7QD 4TTDD 4HZLB 5DQ9B 5C9JA 1QPXA 4RCAA 4QRPA 1JYXA 1INEL 1N3NA 4M48H 4IOIA 4EVNB 1QLRB 3FRUA 1QLFA 1YPZF 3CU1A 2IFGA 4F37F 1G9NH 5C0CE 4FQLH 2EC9T 4KJWC 4DEPC 2P8LA 3BEVB 1CDYA 4XVJL 2EXWC 4TOYH 3OAUL 2A6JA 4JDZB 4HIXL 4K2UL 1FVEB 4H88L 3OZ9L 2C26A 3LMJH 3VGAC 5J6HA 1JHKH 2X10A 3RKPA 2DKSA 2QKIA 5I66A 4H0IA 2A6KB 4Y4KD 3RIFF 3FB6A 3QFJE 1GH7A 3RAJL 1LQSR 2BFVH 4F7EA 4D0CB 2DQJH 3X11A 1JGDB 4G6AC 1U95A 3B5TA 1R24B 2G60H 2UYLB 3IDMB 3TT3H 3VRIB 3HUJE 3MACH 5J7CC 3ULSB 1YNKH 3MJ8B 4D9QE 4Z7NE 1HILA 1HH9B 2Y06H 2IBGA 2X4SB 1NDGB 4PRNA 4XPFH 4O2FA 5DD0H 3C6LC 1DQLL 5F9WC 2XG5A 1AHWB 4PRIE 3W11D 2EDHA 1BBDL 3V52L 3FMGH 4E41D 3L3JA 5DQDH 4P23C 3TIEA 2BVPA 4RNRA 3ZE0F 4MD5B 1G7PB 1DP0A 3RWGA 5HHOD 1VFBB 1U3ZA 3QWRA 1E6JL 1HHIB 1IAIL 4D3CH 5F21B 4XNQB 5EO9A 1UQSB 5BV7B 3FL7A 4LDOB 5JHDB 4NKDA 4WHDA 2X4RB 3SKJH 1DVFA 3V5DA 4HBQA 3ZTJG 1IBGL 4PJ7F 1HHHA 3LAFA 3PJSB 3WV0A 4HIIB 1LHZA 3WXVH 4Q0XH 5SWQA 4ELMA 4LHUD 1JGEB 3ZKMC 2VISA 1I9JL 3VE0B 1T21A 2YA0A 2D7TH 5IBLC 3NFNA 4KRNA 2OXHA 5L9DH 2HLFC 1FJ1A 2R9HC 3DBXB 1CZ8H 5HYJA 4KUCF 4N90E 1RK0B 4UILL 1V3JA 2CR6A 2EZ0D 4XAWL 5FYJU 2J12B 4DW2L 4NC1C 1WFNA 4WI9A 4XZUA 3CFBB 3P4NB 3K4ZA 5DZOA 4N8VG 4BZ2L 3BE1H 3CIQA 3ZE1E 1GZQB 1FNSL 3U1SL 2WINA 2PCPB 1DQML 1NMCB 2IALB 1LP9E 1FC2D 1IVLA