1JGUH

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYLDSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody Light Chain
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH01
4FXKB 4RWYL 1HDMB 1WK0A 1NCTA 4GKSA 3VD5A 5I1CH 1BOGB 3FT3A 3HZVA 4IDJL 5D1QA 3HZYA 5IBLC 4EXKA 3QUKA 4D9RD 4U1NB 5I74C 5HHME 3TT1L 2X7LA 4OZHE 4WEBL 5IHUH 2DLEA 4NP4L 2VISA 5FGSA 1ZK9A 4HV8A 1OCWH 2GITA 1GC1C 3D69A 4RAHA 4XAKE 1E6JL 2I60H 5HGBA 2IQAB 4TVPH 3ARTA 5JUEL 1CE6A 4IHOA 2IANA 4QRQA 1N7ML 3DECA 4XGZB 3S35L 4S11A 4G8IB 3UZEA 4Y8DC 3G6JB 2V5RA 4L1HA 2X9YA 2R0KL 1MPAL 2ZJSH 5ICZB 4UNVA 4MD0A 1MLCA 4RISL 5IP4A 2DL2A 4GKSB 4Q9QL 1D5XA 1DLFH 3FT3B 3HZVB 2NY0D 5D1QB 3ZDZE 4RBPH 1NGQL 3HZYB 3VWJC 3QUKB 2X7LB 4M6OH 2VISB 4PRIA 4QY8A 2F19L 2GITB 4MX7A 2NY2C 3D69B 4M7ZB 5FB8A 4IEFB 1B4RA 2VO5A 1EHAA 4WU7B 1VEOA 3WUWA 3MYZA 3L5IA 2R0WL 1CE6B 2AJYH 4IHOB 3GDBA 2IANB 3QHZL 4QRQB 1UB5A 3M8OL 3ZHDA 4R97C 3T2OA 5FYKU 1I1AD 4PY8I 1AY1H 3ARUA 2EDTA 2FBJH 2NXZD 5F3HA 4J3SA 4MD0B 4F3FA 1MLCB 2FECI 4NKIL 5HVWA 4D8PA 1UJ3A 1EFXA 1D5XB 3JUYA 4QRUA 4PJEA 1CLOH 4JRYE 2X1QA 3MRMA 2HLAA 4KMLB 2DJ4A 1ZLSH 3PF2A 3WFCH 4G42A 1X5LA 4PRIB 3DURA 1R3IL 2BXYA 3P40A 2Z31C 4MX7B 1HYSC 3TBYA 4LLAA 5F97E 3CVIH 4HQQL 4HWBA 5B22A 4RMTA 3A6OA 2LTQC 3BJ91 3SQBA 3WUWB 2HT3D 4P9HL 4W81A 3S34H 1TENA 1KN4L 2OBGA 2PR4H 4J4PA 5DK2A 1UB5B 4F9PC 3Q6GL 3KS0J 4G6MH 1AO7D 3O45A 4YHMH 2X05A 1LK3H 3B8YA 4XXCC 4Z7UB 1FH5L 4NC1C 5EU6E 4L5FL 4LPCA 1X4XA 4X9BA 1XGYL 2IPUK 2HT4C 4RMVA 5IFAH 3BSZL 1KCSL 4X7CC 5GRWA 2NY4B 3FO0H 4D8PB 1UJ3B 1EFXB 4QRUB 4JFED 5SX5H 3QH3A 3UZVB 4NO2A 4PJEB 3MRMB 4GBXA 4O02H 5AWNH 4CN6A 4G42B 2GJZA 2R1YA 2EDWA 4XMPH 3WHE0 3H42L 3O3AA 4YK4C 2XN9E 3ROOA 5D8JH 3MLVL 1A6UH 1SEQL 4ZFZA 4M9PA 3T2NH 3WFDL 3L5XL 3VXME 3PL6C 5DK2B 4DZBB 4L9LC 2CRYA 1V5JA 3QQNA 1ONQA 3WO4B 4YDKL 3MYJA 3O45B 3TNNA 4KRLB 3V52L 5EZIL 4X6BA 3V6FA 3PV7A 4PJBA 2C3XA 4LKCA 1H9VA 3GO1H 1UWGH 1IAII 3OZ9H 3P9LA 4PTTB 5BRZD 1SJEB 4OGAD 4GBXB 3U83A 4C57C 2GJZB 3SGDI 3O3AB 3L7FA 3KXFA 4NQED 3ZE1F 3GFUA 3MBED 1OD9A 3ROOB 1CXIA 4JFFA 4QXUH 4RMUA 4ZFZB 4KQ3H 2D31B 5HVFB 1JK8A 5H8DA 5E6IC 3EUUA 4GXVH 4L3AA 3QYCA 2B4CL 3PHQA 4N0UE 5ACZA 1ONQB 1Z9OA 5EOQH 3MYJB 3TNNB 1UEYA 1DCLA 1YNKH 4NN5B 1EO8H 5BO1H 4WW2B 3O6FA 1T03L 4X6BB 3HI6H 1WT5C 4PJBB 2VE6A 4LKCB 5F7EH 4N8VG 3QDMB 4E0RB 1A64A 3FL7A 3P9LB 1T7ZA 4N90E 4WFFE 1S5HA 3IJSA 3CX5K 5D1QC 1F4AA 3B9AA 4DKEL 1Z2KA 3L7FB 3KXFB 2BSRA 2ZKHL 3DSNA 5JDJA 1ZHBA 5AAMA 4OQTH 4NO0D 2X1OA 4PBWD 4M7ZC 1FNSH 5HHMD 3X12A 2LABA 4HD9A 3FO2B 3DX9A 4K71B 4KK9D 3HG1E 5IW3A 4OCRL 5D72H 4NT6A 4F7EA 3PHQB 5ACZB 2KDGA 2HRPL 2R0LH 3RA7H 3WS3A 4BUHA 5C3LD 3O6FB 1SY6A 4WI4A 5IB2A 2CD0A 4G9FE 4S1RH 2YPLE 3VFGH 1YJDL 2Q6WB 1S5HB 3IJSB 4UQ3A 4NZJA 1WBYA 1C16A 1NAKL 1RIUH 3SKJL 2BSRB 1ZHBB 1HKFA 3LZFL 2XZQL 1XF4A 3P3YA 2VXQH 2NMSA 4MLIA 1VFOA 2AQ1A 4Q6IA 2GFBB 3X12B 2FDBP 2X4SB 3MRDA 1F4XH 5DQ9A 3DX9B 5CCKH 5JO5A 3N50A 4NT6B 4F7EB 3FB5B 3H9SE 2AK1L 3DXAA 5EU3A 3WS3B 1HHHA 1MRFH 4U1MA 3FOMA 4A2MA 5IB2B 3IFNH 4RCAA 2NY4C 1UJ3C 5I1CL 1JMXA 1J18A 4KJWD 5JXED 1D5ZA 5C0AA 1U6AH 1S78D 3QAZB 4X4ME 1WBYB 1C16B 5IHUL 5T3ZL 4PJ8D 1OCWL 4PG2A 1JPSL 4WWKD 1J5OH 1DR9A 1XF4B 5ACLA 1HN1A 2AGJH 4G6AD 2E6QA 5EUOF 4X7EC 4JRYD 5CGMA 4TVPL 4Q6IB 4WV1B 4I18A 4YE4L 1TJGH 3M1BA 5DQ9B 4J4PC 3WNOA 1T1YA 3L5JA 5JO5B 2FATH 3WO4C 5I16B 3DXAB 5EU3B 3ZE1E 3QUYA 2FB4H 1BX2A 4U1MB 3FOMB 3RWHA 3WLBA 2O5YH 3G5ZA 5DURB 5BJTB 1DLFL 4N68A 1CDCA 5C0AB 4GG6A 1NMCB 2X4RB 4GBXC 2J7LA 2CLVA 5DVOA 4Y5XA 1W72H 5DMGC 4M6OL 3FMGH 1D5MB 1JFQH 2VDMH 1ETZA 2OR8A 3UBXA 4KUCF 5CJOL 1MCWM 1IGIH 1L7TL 3AAZA 2GJJA 1XF2B 4LFHD 4I18B 2AJYL 3CDGB 5MEQB 1T1YB 3CFCL 3MR9A 1JPTH 2XN9D 4WEUD 1PX4A 4I4WA 1AY1L 4G9DA 3QUYB 1BX2B 3RWHB 3KNBA 3WLBB 2W65A 4NN5C 2FBJL 1JVKA 4WW2C 3VXMD 3BQUA 1GC1H 3N85H 4V2CB 5LGHL 5TFSH 1I9IH 4GG6B 1CLOL 3J7HA 1YN7B 3U48A 2CLVB 4Y5XB 4N9OB 1ZLSL 3WFCL 4BA8A 4HEME 1K8DA 1ETZB 1T4KA 3HZKA 3E3QE 3UBXB 3CFDA 4YLQT 3CVIL 3AAZB 2W0KA 2B8OT 5DYOA 5EO1A 2P4AB 1X5AA 3S34L 2PR4L 4YBQC 4PTUB 3MR9B 4FN0A 3D39B 1LDSA 2EKSB 3KVQA 3GMLA 3BEWB 4I4WB 4WENB 4G9DB 1LK3L 3KNBB 4OFYA 3O6FC 5SV4A 5IFAL 5SWSA 3BQUB 4B41A 3FO0L 1QFUH 4B7LA 4FHBD 3ZTJG 4WO4A 5AWNL 4M7LT 2AXJA 5C07E 1K8DB 4KH2A 2ZG1A 2EDBA 1T4KB 3HZKB 3CFDB 3RBGA 1KJ2B 4Z6AT 4WFFD 5D8JL 2DI8A 4MNHA 5DYOB 1VFAA 3DPBA 1A6UL 4I0CC 3T2NL 1JYWA 2ZUQB 4LCUA 3V0VA 4MYWB 5C0CA 4HK3J 1XIWD 4IJ3B 3GMLB 2FZ3A 4HKZA 2Y9RT 3B9KB 4HHAA 5EUOE 5SWSB 3HG1D 3OHXB 1C1EH 4MJ6A 3VXTA 4NO5A 5C2UB 5DJ6A 2EDYA 3OZ9L 3U82B 4NOFA 1AH1A 2OJZH 2F53A 2OP4H 4WO4B 4NUGH 3QAZC 1F02I 4G9FD 2YPLD 4JM4L 1XH3A 1P7QB 3H9ZA 3GMMA 1KF9B 3KYKH 3IB4A 4Z7NF 2HP4A 1VFAB 4Q6IC 1M6OA 4KQ3L 5IQ7L 5KVGL 2E6PA 4GXVL 4LCUB 3R8QA 1S7XA 3LQMA 1EAPA 2C1OA 4XBEH 5C0CB 3W39A 5EOQL 2WIMA 2BY3A 1F4YH 5I1AA 1JWSA 3QIBD 1YNKL 5BO1L 1EO8L 1BIIA 3LB6C 3HI6L 4HHAB 3C60A 3BUTA 4MJ6B 1BD2E 3VXTB 4NO5B 5DJ6B 1K5NB 3H9SD 4X99B 3FFCA 1RZJC 5FKPB 4JB9L 2AJVH 4HWEH 1DVFD 1PDKA 2F53B 1NMCC 3UPRA 2FH6A 5F8QC 1QOKA 3CDCA 4PG2C 5EIIA 4OQTL 3O8XA 1XH3B 4P57A 3GI9H 4Y2DB 3D9AH 2XWTA 3C5JA 3SKUD 3SCMD 4P23A 2HMIC 4FXGA 1AIFA 1BFOA 4I18C 4YDIL 1S7XB 1EAPB 2C1OB 5FA4A 4ZSOE 3W39B 3ROLB 3UTQB 1QSEA 1MJJB 4U0RB 2R0LL 1YMMA 3RA7L 4UB0H 1ZXQA 3BMVA 1MCKA 1JWSB 3QUYC 5I1AB 5DVNA 4FZEL 1BIIB 5SWZE 1DEDA 1YUHB 4PBVC 4DAGH 3C60B 4S1RL 2B1AH 4BFEA 2EIBA 3I3DA 3VFGL 1G7PA 2OTWA 3UPRB 4Y5XC 2RHEA 4NOBA 1MWAB 2NY5H 1RIUL 3HR6A 5EIIB 1TCMA 3O8XB 4P57B 2DM7A 3DX6A 1MHEB 4GOSA 4P2OD 2VXQL 3LPWA 1JZ8A 2NTSP 2EE6A 2XWTB 3C5JB 5C6WH 2R8SL 1F3RB 4FXGB 3O11A 3K8KA 1AIFB 1BFOB 2CIIA 2NYYC 1F4XL 2QBWA 5GZNC 3AUVA 3LN9A 4PGCA 3Q5TA 1QSEB 3FCTB 3VE0A 3EJZD 1YMMB 1MRFL 3CNKA 4W68A 3VRIB 3FQXA 3NH7L 2Z8SA 1PJ9A 4GXUN 4QYOA 5A40E 4RMSA 3BQUC 3X11A 4EZMA 2WQ8A 3IFNL 3O4LE 2ZSWA 4NKMA 5IQ9A 1G7PB 3H9YA 3ARSA 1U6AL 2OTWB 4ZOBA 1XEDA 2AI0H 5ADOH 4WTZA 5HHXL 4UT6H 3WNPA 4P2QE 2E6JA 4KROB 4PJXA 1R6VA 1KIQB 2AXGA 3BP4A 1J5OL 2AGJL 3DX6B 2X44D 4KHTH 1R24B 3RL1A 3RP1A 4HIXH 3O3EA 3O11B 3SKNA 2BERA 1JNHA 2CIIB 4ZUSA 1TJGL 1FZOA 1U95A 2ZUQC 4PGCB 4FRWA 4N0CD 1T2QH 3TO4A 2FATL 4ZG1A 5TJWK 4IJ3C 1OPGH 3RIFK 3VE0B 1MOEA 4GSDH 4WUUE 4U1GB 4YHIA 2W9EH 2FB4L 1C7SA 3FQXB 2O5YL 1NJ9A 4YHOH 3RX8A 5D7SH 4AYFA 4HUNB 4FP8H 5AAWA 4PD4J 4F7PA 1P53A 3QPQC 4WO4C 1CTNA 1I8KA 1T5XA 5CSBA 1W72L 3LRGA 3FMGL 2PCPA 3GJFK 1JFQL 5T3XH 2P5WE 4PJXB 3MCKB 3ZKQD 1GL4B 1A21A 3RL1B 1WFUA 3PXJA 2YUXA 3KPQA 4XWGL 3O3EB 3SKNB 1JNHB 5C07D 1TITA 1FZOB 1U95B 1XGPA 3KPSA 5KOVC 4KFZC 4K2UL 3IRZA 1JPTL 1WICA 4KK8D 4LHUA 2MWCA 5J0BA 3GSXA 4M93B 2YA1A 2IGFL 4YHIB 2RR3A 4L8BA 3ZL4H 4ENED 5C92A 1NJ9B 5JW3L 1MREH 1Z3GH 4PJAE 1GC1L 3T2PA 4HWBH 4LIQE 2GY5A 3N85L 5C09B 2X1PA 5TFSL 4F7PB 5GS3A 3Q48A 4RFEB 4XCYA 3KPTA 5GS0D 1I8KB 1XF3A 4N8CH 3T0EE 4YFDB 2PXYD 2DBLH 4JPIA 3RIAF 4WFHE 4LLDA 4Y2DC 4RRPA 5FCUH 4Y5VA 3KPQB 3RX5A 4PV9A 2VSDA 3KPSB 1JTOA 3LAFA 1S9XA 3W9DA 1ULVA 4CUCA 1RD6A 4LHUB 5J6GA 5CGYD 3GSXB 4MSWA 4YHYB 4L8BB 3CU7A 3DYPA 3GJEA 3C60C 3KYMA 5FECA 2Z92A 3IDUA 3DVNA 1YNLH 3D6GA 2J4WH 4I8DA 4GW5A 5EIQA 2HLFD 4XCYB 5SV3A 1VCAA 1XF3B 4KUCD 2NY6D 4JANA 3RJQB 4JPIB 3GSWB 5AZ2H 1BD2D 3ME0A 4WHTA 3DSFH 3O8XC 4PY7A 2J1KA 4B0MM 3MBXH 1J11A 3BP7A 5E2WH 4BZ1H 4LEOA 1LO4H 4Y5VB 2V9RA 3G04A 3P2TA 4P23C 2P5EA 1V3JA 4PV9B 4H0HB 5CAYB 3U4BH 2A9MH 2EC8A 5CEZH 1I85A 1S9XB 3W9DB 2VYRE 4HPOL 1BMGA 2D9QB 4KWUA 5J6GB 4YUEH 2EEBA 4MSWB 2NW2A 4JGUA 4KKBC 1J0HA 2FO1A 3ARXA 5C7XH 3GJEB 2DQTH 3KYMB 4JN1H 5FECB 2Z92B 3DVNB 3U36A 4PS4H 2OJZL 4GW5B 5GQBA 1PBYA 3MQIA 2UY6A 2VN7A 3BH9A 4JANB 3LQZA 5SWZD 1NEUA 4LLVA 1IT9L 1CXEA 1HXMB 4KROC 4WHTB 3T0XA 1V3MA 5D2LF 1U3ZA 2EXYC 3BP7B 3KYKL 3LDBB 4HBCH 3RVXD 3ZSSA 4OCYL 4LEOB 3G04B 2P5EB 4YXHH 5FYKL 2BNQE 1BZ9A 2XZAH 4XBEL 1T7XA 1SMOA 2Y5EA 1IGTA 3GMOA 2H32B 3D0LA 2BY0A 4YZFF 3INUH 2ZUVA 2NW2B 5L88H 4U1GC 1R5WA 1F4YL 4OLZH 5C70A 2CDFA 1R5VA 3QRFM 3LCYA 1JRHH 3U36B 2OM5A 4OBRA 1MCFA 2AJVL 4HWEL 2L4OA 4OF0A 1PEWA 5K9OA 2A0LC 2X42A 3BH9B 3LQZB 1OGTA 3CPLA 2C7UB 1EEYA 4LLVB 5DEGA 3ZYZA 4MXVF 4Y4HA 3O4LD 2VITA 3S4SB 3UYPA 2XTJB 1IILE 1F4WH 3D9AL 2D9CA 1A1NA 4LQ1A 5D7IA 2V6HA 4OLVH 4P2QD 1BZ9B 2VUOA 3WKML 4IM8A 1IGTB 2QSQA 2OJEB 1PGRB 3GUTA 1ORSA 5HGAA 3T0AA 5E8EA 4M93C 4KDWA 1R5WB 4UB0L 2CDFB 1R5VB 4DAGL 1EHXA 3CH1A 2B1AL 4LSDA 4B5EA 3LQAC 1QEWA 4WUUD 4V1DE 5K9OB 4Z7QF 1G0DA 3CPLB 4IRSD 5D7JD 1EEYB 2QQNH 2NY5L 5FV1L 4R8WL 3UTSB 4Y4HB 1MCBA 1VGEH 2VITB 5E08L 4HIHB 4NRZA 3IDJA 4Q9BA 3MGAA 4IOIB 1NC2D 2ZCKL 1F4HA 1A1NB 1I7RA 2EZ0D 5CBAB 5D7IB 1T21A 5HDBF 2HAZA 2P5WD 2X4TA 1HXYA 3GUTB 2YRLA 1CXKA 5HGAB 4JFYA 3UTTE 5E8EB 1RY7B 5ENWA 1URLA 3C6LA 5LBSL 2ID5A 4K94H 3CH1B 4ZS6D 4DKFH 4U1LA 4NFCA 2X89D 1QEWB 3B5HA 2LV4A 4AJ0A 2DLIA 2AJUH 3CVHH 3GIVA 1MI5A 4X6EB 5ADOL 5GGVY 2AI0L 5GRYA 1S9WA 3IFPA 1UM5H 3PWPA 3BD4A 4NRZB 5ESQA 3IDJB 4NIKB 4AZ8A 4MQTB 2E8YA 2MKWA 2EYSA 4KHTL 3VD3A 4RGNB 2EE3A 1T21B 2BNRB 4Y5VC 3T0ED 1LK2A 4TSBH 3RWDA 1WTGT 1B6DA 2X4TB 3GIZL 1HXYB 1T2QL 4WFHD 1K2DA 1OPGL 1Z9SA 4GSDL 4JFYB 4HUXA 2EDHA 3SKMB 2CXKA 5GSVB 3K0WA 2C5DC 5ENWB 2W9EL 5D2LE 4YHOL 3C6LB 1E6OL 2MMXA 3MLZH 1DSFH 5D7SL 5BXFA 1OD7A 4UBDC 1ZEAL 4FP8L 5C0FA 3KDMA 4NCDA 5TDPB 4P5TA 2H6PA 4QRTA 5IESL 3WJLA 1S9WB 5FM8A 4UTBH 4YZFE 4P46A 1DANT 1VFBA 5T3XL 4R7NA 5ESQB 4QRRA 1FCGA 43C9B 3BHBA 5E8DL 3LDBC 2GTZA 4YPGA 1CU4H 1AR2A 1U8QA 2DN7A 4ODWA 3RWDB 3OF6A 1DQJA 4JDVA 1X5ZA 5C0DB 1I85C 3RX7A 4EI5D 1JBJA 1K2DB 4F80A 3IXAA 4HUXB 4XX1E 5EPMB 2PW1A 4BFIB 1KJVA 3L6FB 3MGTA 3ZL4L 4TTGA 5I30H 5HYQA 1MREL 3PP4H 1HI6A 1Z3GL 4BQCA 4HWBL 5C0FB 3RZCD 3KDMB 4M00A 4Y19E 2DQFB 2E9JA 4HG4K 3QEUA 1GGUA 4MAYD 4P5TB 2H6PB 3PDGA 4N8CL 4QRTB 3WE6A 3QWRD 4G80A 4P46B 1VFBB 4R7NB 2R15A 4QRRB 5IROA 1ZLVH 3BHBB 4BFBD 2XTJC 1UKTA 2GTZB 5FCUL 4YPGB 1U8QB 1OAXL 4ODWB 2E7CA 1DQJB 4JDVB 4Z7QE 5TF0A 1BHGA 4Y16B 3C8DA 3S36L 1PZ5A 5T1KA 4MJ5B 2PW1B 1U93A 5E2TH 1DBKH 1KJVB 2XG4A 2PYEE 3OKLB 3F8UB 3MGTB 3O9WA 5EZLA 3I84A 4CVUA 2BNQD 5HYQB 3BE1L 4N5EC 5EZOH 3DOSA 4H0IA 3RTQA 5E5UB 5JHDA 1YNLL 4PJIF 2J4WL 4RDQG 2OR7A 3MOQA 4JQVA 1YQ2A 3UJTH 3WE6B 4BH7A 4G80B 1OP3K 4PB0L 2GKIA 3DRQA 1VACA 4Y4HC 4Z7OF 3EYUL 1T1WA 2ZNWA 3DSFL 3V79C 3X3FH 2BFVH 3MBXL 5E2WL 2MHAA 4BZ1L 1LO4L 2P7TA 1NCWL 3U0PA 1GZPA 2OZ4A 4WI9A 3WXVH 3U4BL 2A9ML 5CEZL 1YPZF 3QUXA 1PZ5B 4MCYA 4YUEL 5T1KB 5E9DA 1U93B 1PSKL 5EZLB 2H41A 3O9WB 5IJVA 4R2GD 4S1QH 5C7XL 1NFDA 2DQTL 1MJUH 3EIFA 5EO9A 3SEPA 4JN1L 3RTQB 5DEFA 1AGEA 5JHDB 1BGXH 1GGIL 2VXSH 4PS4L 4WHYH 2NZ9C 3I2CH 3IAPA 1ZHKA 2JF1A 1EV2E 4BH7B 4PJHA 4M1DH 2YEZA 1ZLWH 5I9QB 1KXTB 3DRQB 1VACB 1P7HL 3FZUC 3C5SA 1T1WB 3EO1A 5H37H 4ELMF 1T83A 4F33A 3D85A 5DD6A 4V1DD 1P4LB 2MHAB 2BDNH 4RGNC 3U0PB 3ET9F 1GZPB 4BYHA 3FB6A 3MRRB 4YXHL 2A1WH 2V9TA 2DQJH 3RVTC 1YYML 4J3UA 2XZAL 5HHQB 1HHJB 4OGZA 3RKPA 4LPUA 2YSSA 1X9QA 4MCYB 4OZFA 5EBWA 4KRNA 2A6KB 5E9DB 3NCBB 5L88L 1VA9A 4LLQA 5IJVB 1GGCL 1UZ6F 1NFDB 3C6LC 5EO9B 3VDAA 1XT5A 1JRHL 1AGEB 4ZMAT 3UTTD 3BEVA 4J2XA 1ZHKB 1J1PL 4M3KB 3TBWA 2XKNB 4LNRA 4PJHB 1Z6JT 2YEZB 2CO6B 1IRAY 4EKXA 5GRVK 3T2QA 3EO1B 2Y25A 3D85B 1F4WL 5IBUB 3FOLA 2IBBA 5IHZA 3L3KA 5GGSA 1BF2A 4OLVL 4X9HA 4XP1H 1T7WA 3WS6A 1F42A 2CSPA 2FD6L 1A4JA 1QZ1A 4NZTH 4X4XA 4OZFB 5EBWB 1P7KA 3WHXB 2BSTA 1F3JB 2J8OA 4LLQB 3F6IA 3ZKNC 3U4EB 4GRLA 4A6YB 3HUJF 4KJYA 5EN2A 1WZKA 5EIVA 3MUHL 4U05A 5GSRB 5K9QG 4QTHA 2RQ8A 3BEVB 4M61A 3L3JA 4C55A 3TBWB 4LNRB 4P5TC 1U8LA 3WJLC 2QQNL 3BW9A 3VD7A 5F93C 4P46C 1AD9A 4MXWH 1VGEL 3B83A 4ZO9A 5C0NC 1IVLA 3D18A 2VDLH 3X17A 3FOLB 3QI9A 5IHZB 3L3KB 4OCSH 4PJIE 4OGYH 1HH9A 1HSAA 3CMOH 1FIGH 4LPXA 5JOFB 3X3GH 3SE4C 1A4JB 3EZ8A 4FQCH 4Y16C 2HKFH 5BZDA 4X4XB 5DK0A 1P7KB 2CR3A 3NPZB 3CH8A 4HGMA 4KXZH 1EEZB 2EDFA 1SJXA 2ORBH 3EDFA 5C2BH 1W0WA 3KAAA 4KJYB 1JF5A 3D87B 4F58L 1FFPB 5DUMH 4QTHB 4NM8L 4D0CA 5CZVH 2AJUL 4M61B 2JK5A 3DUHA 5KW9H 1JGLH 3L3JB 1P5UA 1YPZE 1T1ZA 1U8LB 4F7CA 3BW9B 5FM4A 4UT7H 1OAQH 3DI3B 1XGRA 4J3XA 5IROC 1UC6A 3V5DA 3D18B 4Y19D 4X4ZA 2Z9TA 2HN7A 4NZDA 3QI9B 1BQHA 3FB7A 4QXTA 2X4NA 1WV7T 4O4YH 3QDJE 4TSBL 2GTWA 1FFOA 3LQAH 5FM5M 5BZDB 4WUKH 2EIEA 5DK0B 5IVXA 1ND0A 4ELKB 1WIPA 1YEEH 4CNIA 3O9WC 4ELME 1ZTXH 4KHXH 2VDPH 4M6NH 3MLZL 1DSFL 3I50H 1W0WB 4JJ5A 3RTQC 2VLKE 3MRQA 4D0CB 1UJTA 2JK5B 1SEBA 3QDGA 5B4MD 3TEUA 1T1ZB 4JQVC 4BKLA 4F7CB 4XMLH 5I9QC 4UTBL 1XGRB 2AXFB 5TPWL 3V5DB 1I1AB 1UZ6E 3PHOA 4TNVK 2R2BA 1NLDH 2HN7B 1N64H 1BQHB 1KCUH 3FB7B 4HWZA 2VLME 4QXTB 4LNVA 3QEQE 1CU4L 2X4NB 4TULH 2GTWB 1FFOB 2EDOA 2OMNA 4KKCD 3V5KA 5DI8B 5IM7A 3QUXC 1IEAB 4HJJH 2Q8BH 5IVXB 1FP5A 5DD5H 4UT9H 3VGFA 1ND0B 3OJ2C 5CLWA 2IAMA 4CNIB 5I30L 4XHJD 4FQIH 3PP4L 4JJ5B 1CS6A 4PJCA 2DMCA 5EC1A 1RFDH 4M7KH 3MRQB 5GGQH 4KKNA 5F3BA 2QHRL 1SEBB 3QDGB 3PGFH 3SY0A 1QRNE 4BKLB 2W1NA 3QIUD 1L0QA 4YH6A 4I5BA 3RRQA 4WJ5B 2HWZH 1HILA 1T83C 3PHOB 1QQDB 1DN0B 3MV8A 2VR4A 3HUJE 4H0GA 4HWZB 4IOFD 2XKSA 1BQUA 3NACH 5IM7B 3V5KB 3U0WH 1IGCL 4MJ2A 3BI9X 4JHWH 4YHNA 3MJ8A 1QSFA 2IAMB 5E2TL 1DBKL 4UIKH 5JZ7D 2ZNXA 3I85A 3B9VA 5EZOL 4EXPX 4XB7A 4PJCB 1CE1H 3VDBA 5F21B 5FGCE 1IC7H 1Y0LA 4U6HA 1G7HA 1KN2L 4IMKA 3SY0B 4FG6C 3S37X 3ZYIA 4O2EA 4LCIH 3C5ZD 4I5BB 4KI5C 2DM2A 4RNRA 3F7YA 4U6XB 5DRWA 3X3FL 2BFVL 3MJ7A 4DGIH 5K9JH 1KEMH 4MQSB 4JO4H 3MV8B 3O3BA 3RHWK 1PZUB 3WXVL 3OXSA 4H1LH 3WS6C 2APXA 5K59F 4PBXA 5DFTA 3BN3B 1U41A 1AC6A 1KCLA 4EDXA 4YHNB 3MJ8B 3ETBF 1QSFB 4TSAH 4DOHE 1FLRH 5FCSH 5IB3B 4KUZL 4NQEB 1MJUL 3PNWA 3TH4T 5GISH 1BGXL 1DDHA 5DR5H 5ECJE 1FYTA 2VXSL 3I2CL 1RZGB 4U6HB 1G7HB 1BREA 4O2FA 2AV1A 3RVVC 3MODH 4M1DL 4O2EB 2F15A 2PTTB 1NMAH 3PUCA 4N8VA 5KN5A 4RNRB 3F7YB 4NZRH 5DRWB 4LVOB 3MJ7B 1QKZH 2D3VA 2ERJB 5KTEL 3MRIA 3QI9C 2QADD 1CWVA 3IJHA 3O3BB 4RQQA 2ED9A 3P4NA 2A1WL 2H2PC 5JMRA 2DQJL 3OXSB 3BXNA 4OKVB 2ICCA 4MA3A 4EDXB 3ZYJA 2PO6A 3ARVA 4KK5D 4ETQA 4OZ4A 2AEQH 2YS4A 2AW2A 4DTGL 2O5ZH 2F8VA 3PNWB 5ALBL 4NO0B 3U46A 3TPKA 5E0QA 4KJQC 1DDHB 4FQXA 1FYTB 2R56L 5HHMB 1CD1A 4O2FB 2AV1B 5DMIL 1P1ZB 2F54E 2JKXA 4L4JA 2IMNA 1C5BH 1OGAA 1W2KT 1RULH 4N8VB 5KN5B 1K4DA 3FRUA 3QQ3A 1I9RH 5HDQH 2YN5A 1GPOH 4ZAKD 3MRIB 3V4VH 5IJKA 3IJHB 4EVNA 4RQQB 3P4NB 4OZGA 4HUUA 4XP1L 4UUJB 3OB0H 3BXNB 3LKQA 4XC1L 2YD6A 5JXEA 5KSAA 4ZYKA 5HYJE 4MA3B 2PO6B 1CICA 2BRQA 4WIQA 4JREB 4JFDE 4DVRL 3QDJD 4CVWA 1X5GA 5I19L 1LHZA 3WFZA 2IBGA 3BIKA 3U46B 3K1KC 1IGMH 2DDQH 4Z7WF 4FQXB 2ITCA 1VENA 1D9KD 3JXAA 3RUGF 3MX0A 5CKGA 1KLUB 3RQ3A 3V8OA 3Q3GA 1U8PA 1BVLA 15C8L 1OGAB 3VGAB 4ZS7H 4ZUVB 5JIIA 2Y07L 3SE8H 2VLKD 1K4DB 3FRUB 1YEDB 1D6EA 3OBAA 4NWUH 3VFNA 4KVCH 4OCSL 4EVNB 2DQCH 4OGYL 3CMOL 5HHOD 4LSRH 3O2VH 1V8HA 3LKQB 3OB8A 4JKMA 4JZOB 3X3GL 3IRPX 4XPTH 2GT9A 2HTKC 4FQCL 4ZYKB 4JFZH 2HKFL 3VXUE 2CJUH 1CICB 5EU6A 1FSKB 4YX2H 2VLMD 2IAMC 1YDPB 3QEQD 4XVUC 4CAGA 5C2BL 3BIKB 4JO2H 4U6VH 1FO0H 3U2SB 1Q72H 1A6WH 3OWEA 1YECH 1I8LA 5DUML 2ITCB 4YEEA 5ANMA 5CZVL 5KW9L 5K59E 1JGLL 1NCUA 2DWEA 3KPOA 3Q3GB 4G8GE 2VDKL 4MAUH 1BVLB 2K9UA 1OAQL 2XA8H 4UT7L 4ZDHA 2XN9A 2ZUYA 5GHWH 2GHWB 4OD2A 3VFNB 4MJ4A 3WBDA 4XNYH 3NIFE 1QRND 4PJDF 5DC9B 4QHKJ 4O4YL 4LEXH 4FFYH 1UQSA 2NXYB 3LQAL 3WIFA 3ARGD 1SHMA 4R4BA 4WUKL 5EU6B 3PGCA 2QQLL 4CN4A 3BO8A 1ZTXL 4KHXL 5CMAA 3MLTA 4M6NL 3I50L 4C56E 2FRGP 4KTYA 5ANMB 3WUWG 4IMKC 2DWEB 3KPOB 5A43C 4CDHA 2XWBA 4XMLL 2XWJA 1DBJL 2XN9B 3RY6C 4LVOC 4OM0L 2ERJC 1CFQB 1N64L 4EN3A 1KCUL 3VXMB 3LPFA 4OFPA 1U92A 5IB5A 3DO7A 2A74B 2WP3O 6FABL 1CFTB 1UQSB 1OTSC 3CIQA 2E9BA 3T08A 3P0VL 1JNNH 3WIFB 5C8JA 1T20A 3HC0A 1R0AH 4HJJL 4K8RH 3IS0X 2Q8BL 3PGCB 4L1DA 2V5SA 5DD5L 4UT9L 3BPOB 2W59A 3BO8B 1CLYH 4FQIL 4KK6D 4OZIF 4XNXH 3GKZA 2ILLA 3ARQA 3FT2A 3EJYD 5D2NA 1RFDL 2XYCA 5GGQL 4HWUA 4NO3A 3PGFL 3TBSA 4NQCA 1JE6A 5ACMA 4H20H 1YN6A 1MUJA 2HRLA 5LWYH 2HWZL 1J1OH 3M17A 1I3VA 2CGRH 3CSGA 1YC7A 3LEVL 4MDJA 4HDIB 3PGDA 4Z7WE 1U92B 3DO7B 3NACL 5C8JB 3U0WL 1T20B 3HC0B 5FAAA 4MWFA 4HMEA 2PO6C 4JHWL 2G75A 4DUXA 4JREC 2E7BA 4UIKL 4OCMC 4L3CA 2X6MA 5KSUA 3FT2B 4FQXC 3BESR 1IC7L 4TTDD 1OTUC 3TBSB 4NQCB 3HTLX 5DZOA 3FFDA 4M5YL 1ZA3B 3DX7A 3VGAC 1CGTA 1YN6B 4K07A 1X5FA 1XIWB 1MUJB 2V17H 5F96H 1WFOA 3BZEB 3QHFH 4OIIL 5K9JL 4DGIL 3M17B 1KEML 1WFNA 4JO4L 5IBTH 4MDJB 2DQHH 2DOCA 3MXVH 1CGVA 3PGDB 1WBXA 2F54D 4LCCA 5C6PB 3T4AB 3E2HB 4KJWC 5JXEC 5KSAC 4MWFB 1S7UB 4F7MB 1CICC 2G75B 1FSKC 4RWHA 3HZMB 4TSAL 1FLRL 5KAQG 1NSNL 1LO5A 5KSVA 4HW6A 2H3NA 3PWVA 5KSUB 5D7LE 4G6AC 5GISL 5DR5L 5HYJD 4PJDE 4OFVA 4OCNC 4PRBA 1WEJH 4XCEA 4JFDD 4PRDA 2HJLA 4GLRI 2PUQT 3CSBA 4P3WA 3B2VH 4CMMA 1NMAL 1MJ7H 5E00A 4OZFH 5C3TA 3GKWH 2EEAA 1QKZL 2R1WA 3QIBB 3A0OA 1IM9A 1JWUA 1A1OA 1G84A 3B3IA 5IK3A 1WBXB 1AE6H 3BVNA 4QF1A 3H9SB 2NXYC 5L2KA 1PG7X 1DVFB 1CD8A 1WTLA 2D0GA 3UAJC 5L8LB 1S8DA 1KV3A 5TF1L 5KSVB 2O5ZL 3I9GH 1RHHA 2H3NB 3PWVB 1U36A 1KCVH 2FGZA 1GHFH 4P2OA 3VXUD 1XZ0A 3FN0H 3RI5F 2DM4A 3SCMB 1OT2A 4PRBB 4XPAH 4PRDB 2HJLB 1TNMA 3MLXH 4CMMB 1C5BL 1EVUA 3S96A 1BZ7B 1RULL 3EOBA 5E00B 4R3SA 2WP3T 1G7QA 2OSLA 2X70A 3PWUB 1I9RL 5HDQL 4RDQF 2R1WB 1AR1C 1GPOL 4OZIE 3HNTH 1IM9B 1A1OB 2V7HA 3B3IB 5IK3B 1FLTX 4G8GD 3K3QA 7CGTA 3BVNB 2N56A 1DLHA 4QHLB 4X5LA 5EU5A 4YBHA 3HA0A 1KTLA 1NUGA 3B5GA 4JVUA 1F90H 4NQTA 5F70A 3WXWH 1INQA 4S10A 4U1IB 2MQ3A 4PJ5A 3BPOC 4Z95H 1A7OH 3DJ9A 1S8DB 1TQCB 1RHHB 3MFFB 1Z9MA 1QRKA 3TT3L 4P2OB 1A1MB 2DDQL 1XZ0B 1L9NA 4GMSH 4LARH 3SDXA 1A9EA 3WIIH 1WIUA 5C6TL 1G9EA 3MNWA 3PP3H 3S96B 4Q9CA 4ZS7L 4UV7H 1CBVH 1I8MA 4R3SB 1G7QB 2OSLB 2X70B 2VWEE 3D25A 4YHZH 4TVPE 4NWUL 4HIIA 3HS0A 2DKMA 4EN3C 2V7HB 4KVCL 4GJTB 4AIXA 2DQCL 1KEGH 5CZXC 1E0OB 1DLHB 5EU5B 4Q7DA 3ZE0F 4XPTL 1DQMH 1DTUA 5CJ5A 4JFZL 5ESVA 1INQB 1WQVT 2CJUL 2YWZA 1X5HA 4PJ5B 1FNAA 4OD1L 4PP1D 1OP5K 3F65A 3QULA 4HIEA 5EUKA 2EDRA 3KR3H 4U6VL 3MUGA 1Q72L 4PGJA 2ADFH 5HTSA 4NC0B 5GIRA 5E2JA 2ESVA 4P5MB 2IPUG 4MAUL 1QLEL 1XIWC 1I8MB 4P2CG 5GHWL 2A9NL 4HIIB 3HS0B 5DF0A 3HI1B 2LVEA 4XNYL 4UQ2A 4BSWA 4ZPTA 2BX5A 4ZUTA 4K7PY 4LEXL 4FFYL 4R26H 3FTGA 3VWKD 1J1XH 3E2HC 3TFKC 1EMTH 1HINH 2WLZA 5ESVB 4F37K 4HUVA 3TLRA 5I2IA 4WEMB 2PXYA 2I07B 4POZC 3RNQA 3JV6A 2EDDA 3LS4H 1IGJA 3QULB 4HIEB 4U49A 3RGVD 5EUKB 4MLSA 4OSUL 3LKNA 3UBXG 4ESKA 1IEHA 2OR9H 5DT1H 4LCYA 5GIRB 2ESVB 1ZE3C 5C07B 4X8JA 5J9PA 3SDYL 4LOUC 5T33H 3SKOA 1ZGLP 4XB8A 1NANH 4UQ2B 1DUYA 4ZPTB 4ZUTB 5AUMA 3HN3A 1TTGA 3FTGB 1JNNL 3EOTH 3LIZL 1JN6A 1A47A 1DVFC 5DJXA 5DMKA 4HUVB 1R0AL 4K8RL 1FNLA 5I2IB 2P45B 2PXYB 5EUOB 2P48B 3JV6B 1R3LA 4HUWA 1CLYL 1IGJB 2DRUA 2KL6A 4PGBB 1G7IA 3EYFA 4XNXL 4JY6A 3LKNB 3RU8H 5GZOD 3MC0A 3NZHL 4Z9KB 2D7PA 4UV4L 1KOAA 4LCYB 3SCMC 1AKJD 1EHLL 1DQDH 5J9PB 3G5VA 4H20L 5D7LD 1C5CH 3SJVE 4L4TE 1WZMA 5LWYL 2FR4A 1J1OL 5E1AA 1EBAA 3Q5OA 5EBGA 2CGRL 1G0YR 3GRWA 4RGMB 2NY7H 3HI5H 4MZ3A 1DUYB 1PY4A 3QZWA 5AUMB 2DWDA 4ODBD 5DMKB 4U2YA 5DJXB 4YHLL 1RZKC 1SVCP 1LILA 1NCNA 2EKJA 1RJCA 3QIWA 4L8CA 4XXDA 2EXWD 4JAMB 5EH1A 1R3LB 3LEYH 4HUWB 1TQCC 3EYFB 1QA9A 1JZ5A 4KZEH 4P2OC 3UJJH 3VGBA 4NNPH 2VDOH 3D1MC 2ARJQ 5C9JA 4FABL 2OZ4L 4OM1H 3UC0H 5CINH 3SDDA 3G5VB 1FGVH 4ZPVB 1FNEB 2V17L 5F96L 2C4FU 4K3GA 2FR4B 2Y1VA 1B0GA 1LNUA 5IBTL 2DQHL 3MXVL 1S7VA 2VN4A 3QZWB 1TVDA 1QO3A 4WW1A 2DWDB 2J8HA 4K7FA 1TXKA 3F7QA 1CL7H 3QIWB 5SWZB 5J7CC 4QRPE 3LRHA 1MCPH 3O4LA 1EUUA 4IOSD 5IIEA 2JIXD 1QA9B 3NTCH 3AC0A 2BNUA 1LP9F 1I3GH 5TDNB 2HFTA 3CXHK 1ED3A 5GS1A 4Q0XH 4P2QA 3HPJA 4MVBD 1WEJL 3B9EA 1J05A 1MCNA 3E3QC 2X9XA 3B2VL 1GGTA 3S5LB 5ESAB 1MJ7L 1PYWA 1FBIH 2CKBA 3QFJA 1B0GB 1LNUB 1OTTD 3DETD 4JZNA 3GKWL 5CUSH 1KIUA 3T77B 5T3ZD 2LU3A 5I1KH 3MRPA 4Z7VA 5CIPB 1S7VB 1AE6L 1QO3B 2JJTA 3B2UD 4WW1B 1MCJA 4GKZA 4H8WC 4LHJB 1J8HA 4K7FB 4QOKE 2NLJA 4TVPD 3RVWD 4DJMA 5B8CA 1S7QA 4PJFA 5D7JA 2CDGA 5EU4A 1FG2A 3O3UN 3O4LB 4IRJA 5IIEB 3I9GL 4Y4FA 2BNUB 1KCVL 1FAKT 1GHFL 2IG2H 4I0PA 3RIAK 1N0LA 3FN0L 1ED3B 1J7VR 1HQ4A 3P4OA 2HVJA 5GS1B 1B3JA 5K9KA 4P2QB 4XPAL 4XVSH 3HPJB 1J05B 2P5WA 4FZ8L 1AGFA 2B1HH 3MLXL 3NABH 4MCZB 2UVEA 1DN2A 1PYWB 2CKBB 2VLRE 4XPHH 5F89A 3QFJB 1EO5A 1FHGA 1P4BH 3RKDC 3MRPB 3NFSH 3HNTL 4ENEC 4Z7VB 4R4ND 3SDCA 4EIGB 3UXFA 4GKZB 2NLJB 5GS0C 3WXWL 5ISZA 1S7QB 1RVFH 4PJFB 5D7JB 2CDGB 2PXYC 4Z95L 4PJAA 5EU4B 43CAB 1FG2B 4IRJB 4S1SH 3TNMA 4Y4FB 2QR0A 4QT5A 4XI5D 1A6PA 4M3JA 2ICWJ 1CVRA 4I0PB 4XWOD 4GMSL 1HQ4B 3P4OB 2HVJB 3WIIL 3ZKXB 5HYEA 5K9KB 3PDDA 5EFIA 2P5WB 1ZT1B 4NN7B 3AU1A 2EC9T 3HRZA 4UV7L 1CBVL 4L8DA 3OSKA 3U7YL 3NN8A 4YHZL 4RGMC 1YNTA 3QEHA 4C54A 3SDCB 1QLFA 4L29A 4PJ7F 1MVUA 1O7VA 2WUBL 1QSZA 3VFVA 4KQ4H 2HLFC 1UB6B 1RZ7H 4XVTL 4EI6A 5K33A 2V5MA 1PY9A 4ZODA 3TA3D 5BQ7B 4JKPL 4PJAB 3TNMB 5CEXB 1KNOA 3O6LH 4QT5B 4TNWK 3KR3L 3BP6A 3SDAA 4YDLB 5MP6H 2IMMA 4NQSA 1T6VN 1W0VA 2ADFL 2HKHH 5CP3A 2VZUA 2JB6A 3IDYB 3IYLW 2ATPA 4HJ0D 3AU1B 1WWAX 1IM3A 3HRZB 3BKJH 4K7PX 1FL3A 3NN8B 5CD3A 5I17A 1S9VB 2BVYA 5D1ZA 1YNTB 3QEHB 4X9IA 3G08A 2QHLA 1QLFB 3KHOA 5JW5A 5AZEH 3LSOB 1QFHA 3SJVD 4KKLD 3TBTA 4L4TD 3VFVB 1J1XL 5B3JE 1GIGH 1EMTL 1UEMA 2UWEF 1HINL 4I3GA 1EVTC 4MAYA 1PLGH 4EI6B 1A4KB 2IQ9H 3QIWC 1RJYB 1MCOL 2IH1B 3K81A 3LS4L 3VW3H 2VDRH 4NRYA 2W38A 3VFOA 4FFVD 3MV7A 1WISA 3LHPH 3BP6B 3G6DL 3SDAB 3RVXC 4NQSB 2H45A 1W0VB 2OR9L 3C9NA 4YAQB 5DT1L 4CBPA 1F11A 2JB6B 4NBXB 3TZVA 1T3FB 5DFWH 1AJ7L 3SDDC 1JPGA 2ATPB 4EI5B 1IM3B 5T33L 1TZGH 1QFWM 2Z91A 2DTSA 4LHUG 3VJ6B 1KGCE 2IPTH 5GRJH 5I17B 4CVXA 3G08B 4KMTH 2GW5A 4KDVA 3MLSH 5JW5B 4NUJA 4MS8D 2BCKA 3RZCB 2FEEL 2GCYA 3EOTL 3V0WL 1DE4B 3BMWA 5EBMA 5F7KC 4MAYB 1HK6A 4K3EH 1AP2A 3T3ME 3OPZH 4MJIA 1CZ8H 3VFOB 3ZTJH 2F5BH 4POUB 4Q74A 5IMLA 3C9NB 1IC4H 1F11B 2RJMA 3TZVB 4QRPD 5I66A 5BW7A 5GS1C 1E4XL 2CKNA 1DQDL 1EJOH 1KJ3L 3UJIH 4M43H 1C5CL 1RSFA 3GB7A 1U0QA 4LPTA 2V2XA 3BGFB 4JCMA 4CVXB 3DYOA 2NY7L 1I7TA 4W4NA 2JJTC 4OTXH 5AG8A 2B7DT 1I8IA 3L3HA 4WNQA 3QDAA 4XNUH 3VFTA 5EBMB 1KC5H 4HSQA 1BFSA 1KBGH 1ZT4B 5D7JC 2W0LA 5IG7B 2ZUTA 3LEYL 1B88A 4IRJC 1FORH 3MV11 4Y4FC 3T04D 4OF5A 4KZEL 4N1EA 1HNGA 4UAOB 4IMLA 3UJJL 1OLZA 4I0PC 2VDOL 4NNPL 1FL5A 3HE7A 3VG0H 3V9FA 4APQD 5IMLB 4P9MH 1IJ9A 4PB9H 3ZKXC 4OM1L 5CSZA 3UC0L 2IALB 2RGSA 1J88A 2WMPA 4NN7C 2XV6B 3MMEA 1NGYA 3GB7B 4CL7A 2HFGL 2V2XB 3QSKB 4R2GB 4J8RA 3VRLF 4D3CL 4WU5B 3UPAA 3SDCC 1I7TB 1I8IB 4LK4A 3L3HB 5MENE 5FHAH 4WNQB 2VLRD 3VFTB 5EORH 5A16A 8FABB 3QG6B 1PD6A 4ZFOA 2DLHA 5HYIA 2HG5A 3PJSA 5BV7C 1MCPL 3C8HA 2BK8A 2FSEA 3K8LA 3NTCL 1FAIH 1BWMA 2VZ1A 3IKCA 3S4SG 4NGHH 1UWEL 4IMLB 4YDLC 3IF1A 1FL5B 2Z4QA 4PJEF 5DK3A 1S5IH 4L4VE 4LQFH 4Q0XL 5CSZB 2UWEE 3RWJA 1QACA 2A83B 2WQRA 5EOCH 5JQHC 3BYYA 5I1DB 5HD8C 3MMEB 1BLNA 1N6QH 1RZKH 1FBIL 3ARDD 1Y6NR 1C8PA 3DMMA 5CUSL 1IQDA 5I1KL 3F6LA 4J8RB 4BSJA 1A7NH 4EUPA 2QSCH 2RFXA 4URTB 1TJIL 3G5XA 1OQXA 3UTTB 2A38A 5D5MA 4AMKH 4P2RD 3U7WH 2XQBH 3RDTA 3QUMA 3PJSB 2J8UA 3WUZA 3IKCB 5J57B 1AFVH 3SDAC 1O0VA 2ICWA 3IF1B 2IG2L 2Z4QB 4NNXA 5CZKA 4DCQA 3L7EA 1BQSA 5TE7H 1KELH 1CL7I 3ZO0A 4O5LH 1CI5A 1TETH 4XVSL 3FB8A 5FO9A 3NCYS 4EI5C 1BLNB 1ZT7B 3DV4A 2R4SH 3NABL 1MRCH 3VH8B 3KPLB 4XPHL 5J06A 3PDOB 1P4BL 2NX5A 4HMCA 5T1MA 3RWFA 1IQDB 5HI3D 3LS5H 2RBLA 1U8HA 4EUPB 1ZGLM 3D2UD 3DVFA 1IKFH 1I3RA 1WLHA 2D4DA 4GG8A 5D5MB 4M48L 2BMKA 4MAYC 3RDTB 5JIHA 5FOBB 1JNLH 3QUMB 1UWXK 1W8OA 5EC2A 2J8UB 2PETA 3BPLB 4S1SL 4RWYH 4PJBF 5IBLD 4J6RH 3DHJA 3IFLH 4ZNCD 1UVQA 3FO1A 4OLUH 2X9WA 5E8OA 4NNXB 6CGTA 3MRFA 4DCQB 3L7EB 3TZVC 4LU5L 4L3EA 4AK1A 1EA9C 3TT1H 4WEBH 3FB8B 2BHYA 2ZCHL 5DJYA 4NP4H 3DV4B 3H9HB 1XGTA 4KY1H 2Q86A 2NX5B 2WK2A 3BGFC 4KVNH 5T1MB 3RWFB 3H3BC 2OYPA 1I3RB 1WZ1H 3ESVF 4OV6F 4KQ4L 5DS8B 3S35H 4GG8B 1KGCD 2BMKB 4JEGB 1RZ7L 4PRIE 2PYEA 1MIEH 2R0KH 5DRNA 5EC2B 1UH4A 4TUOB 4CVZA 3O6LL 4KRMB 3VA6A 3EO9L 4Y19B 3VRLE 3FO1B 3MRCA 5MP6L 4UAOC 5E8OB 2HKHL 3MRFB 2BOCA 1A7BA 3GSQA 4UU9A 4CADA 3BD5A 5BW7C 4L3EB 5T3XE 2XQYK 3VFMA 3I6GA 5BCAA 5DJYB 1KB9K 1D3CA 2F19H 3BKJL 1XGTB 2YN3A 3EDKA 3IDNA 5B39A 4ZO7A 4R2GC 3QPXH 3ZT6A 5C1MB 5AZEL 2DLGA 4HGKC 4FTVA 4P4KA 3M8OH 1GIGL 2C4XA 2Z0BA 3I02A 3CK0H 1PLGL 2PYEB 1HEZA 4NNYA 2IQ9L 4N1HB 3NA4A 4CVZB 4GUPA 3ORJA 3ZZ1A 3B8SA 4NQXA 4HBQA 3VW3L 2VDRL 4HGWA 2Q7NA 4YO0A 5DZNA 3WSQH 3LHPL 4PLJC 4YFEA 4R90H 5TE4H 3O81A 3HE7C 2DICA 4N8PA 2BOCB 3GSQB 3OG4B 2Z31D 4UU9B 4CADB 1NKRA 3VFMB 3I6GB 5FA3A 3GHBH 1TZGL 5HVHB 1MFAL 1FIEA 2BSED 2RCSH 3NMEA 3IDNB 5B39B 1NUFA 2IPTL 5GRJL 1SJVA 3WD5L 1P6FA 2GJ6A 4KMTL 3RWCA 2DJUA 3MLSL 5E7FA 1KN4H 1J10A 4P4KB 3RAJL 3I02B 3Q6GH 5I1GH 2HT4D 3CXDH 4P5KB 5E8PA 4K3EL 1HEZB 4NNYB 4DKDC 5SWQA 1FH5H 3HNSH 3OAUH 3VFSA 2OL3A 4LLUA 3OPZL 4GUPB 1WC7A 2VQ1A 3GSNH 4NQXB 2FX9H 4HGWB 5MEND 2N7AA 1CZ8L 1T66C 2YKLH 2O61A 4XBPA 3GRWH 1NC4D 3R0MA 4KMQA 4CW1B 2UUDK 3D3VA 3VWJA 5F7YC 1LO2L 3S97C 4GW1A 4MA1B 3WDIA 1EJOL 5FA3B 4ISVA 3HFMH 4G7YH 4M43L 3OAYH 4MGXA 3UJIL 4U6YB 5DJAA 4CRPA 2BVPA 2VAJA 3PL6D 1GJIA 3DMMC 4PJBE 4L4VD 2EYRB 3WFDH 1SEQH 3VG9B 5CEZE 3CCHB 3P9MA 3RWCB 4YGVA 4OTXL 2YHGA 5C0JB 1JHLH 4XNUL 5E8PB 1KC5L 4S2SA 1YEFL 3QJHA 3RDTC 5SWQB 2W9DH 3VFSB 5C0RH 4LLUB 3BPLC 4X6DA 1WC7B 2VQ1B 4JFFE 2C26A 2BRRL 4J3WA 2O61B 4GG6F 3VG0L 3BDXA 1WF5A 2GSIA 3D3VB 4TQEH 1A0QL 4PB9L 1AXSA 5DLML 3N06B 1DBBH 5A2LH 5MEPA 4BUGA 1IQWL 3CAFA 4MQXC 1CYGA 2BVPB 3MCLH 4OCWH 4OFDA 5E6ID 5F1KC 1AO7E 3ARBA 3LKOA 4CDGC 3IKKA 3C09C 3P9MB 4JFPA 3MZTA 4YGVB 1X4YA 5L7XH 1XR9A 2ICEA 3ULVC 2B4CH 5FHAL 5GJSH 3DHMA 3HCVA 2GK0A 4WGVB 4OIAA 5EORL 1NBYA 3AMLA 3ZSTA 5GRUL 4S2SB 3GSVA 3QJHB 1XCQA 1TQBB 3RL2A 4XBGA 4M6ML 4X6DB 2WBWB 2MSPA 3VDCA 5T5FH 5IVOA 4NGHL 1G9NC 4ZAKA 5JIPA 1GVIA 2GSIB 4BK5A 3S88L 3H8NA 5IBUG 3U0TA 1S5IL 4LQFL 1AXSB 1P84J 4PY8J 3KJ4C 5T5NF 3N1QC 1N6QL 1RZKL 3JWDC 3MA7A 1JI1A 4HCRA 3E0GA 3ARBB 3LKOB 4XC3H 3F12A 5EOTA 1EAJA 2QSCL 4JFPB 4OCRH 2ICEB 2DF3A 1G7JA 3F58L 4Q58C 3HCVB 2GK0B 1NBYB 4YC2B 3DV6A 3P73B 4AMKL 3U7WL 1TDQA 2XQBL 5ALCL 5E2VH 4YFLF 3RL2B 4XBGB 3V7AG 3BX7C 3GBLA 3OR7A 5JW4M 3SPVA 3KWWB 1AFVL 2EH7H 3BDYH 4ZAKB 1RIVL 4J3VA 4PRID 1QD0A 3UDWA 3U0TB 1KELL 2JE8A 4O5LL 5EU7C 1MEXH 2VJXA 5CEYB 5FM5O 3ZHKA 5EZJA 3LZFH 1MRCL 5HVHC 5IR1B 1KPRB 4LP4A 3KPPA 4JRXE 5BV7H 1F3DJ 3LS5L 5EOTB 5T3XD 3OAZH 4X7SH 4GQPH 5C0AE 3T8XA 1N26A 2M2DA 2VSCA 1G7JB 4NBZB 4P4KC 1X5XA 4XGZA 2XXCB 3K2UL 1HIMH 2AK1H 5DZLA 3G6JA 1M7DB 3DV6B 3NCYP 4MMXC 4XNMA 3VXQB 1EFXD 2LFGA 5ICZA 3SPVB 4J6RL 4QLRA 3IFLL 3QXVA 3IU3B 4OLUL 2Y4SA 3IXTA 1UCBH 1UM6H 4H25A 2Y7QA 3B5TA 4WI2A 2WANA 3L3OA 2OI9B 4MA1C 1LEIA 5T3ZH 5EZJB 1JPSH 1M05B 3AB0B 4MD5A 4Y4KA 4KY1L 3T65B 2YUVA 2X4QB 4J4PD 4WU7A 1U2CA 3KPPB 4KVNL 2VQTA 1Q8MA 1A8JH 1YEHH 3VG9C 4YE4H 1X6LA 4GG6E 3T8XB 3MNVB 1WZ1L 1HWHB 5CP3H 1QBAA 3TN0A 3HAEB 4XNMB 4QXGL 1MIEL 5CJQH 5HGDA 5JTWA 4GBXD 2JCCA 1TNNA 4RGOH 3UX9B 5DMGD 4OI9A 1F5WA 3IXTB 3L9RA 1WCBA 4H25B 2Y7QB 1ZVHA 5GGVH 1BQHG 3L3OB 2C3HA 2A77H 1LEIB 4AG4H 5IMKA 3ARGB 4I13B 5E4IA 2V7NA 4MD5B 5CJOH 1GH7A 4Y4KB 1L7TH 3HUJB 1FZJB 2QQKH 2FJHA 5LCVH 5KSBA 3QPXL 2ZSVA 5C08A 5DHVA 3CFCH 4I1NB 2GYSA 1MRDH 2FX7H 3L95B 3TN0B 3CK0L 2COQA 1CDHA 4C58B 5IFHH 3FQRA 1TQBC 3IDGA 2YD4A 4Z7UA 5CEZD 5HGDB 3OJMB 2JCCB 1L0XA 4XCNA 5FGCB 1IBGH 3A6BH 3WSQL 2IF7A 1TZIA 1CIUA 4R90L 5LGHH 5TE4L 1XGUA 1LE5B 1F8TH 3KXFD 3L9RB 1WCBB 3S9DB 1H3XA 1KYOJ 4PJ9A 3PWLA 1A3RH 3TIDA 5IMKB 2J2ZA 5D6CA 4JFFD 4TSCH 5IVZA 4YIQB 3VGHA 3GHBL 3ISWA 2V7NB 1FCCA 4F2MB 2PF6A 4FQ1H 1GGYA 3ILPA 3PXHA 4KK5C 4YBQD 2RCSL 4L8SB 4FQ2H 4X6CA 5JPNA 2FJHB 3ARBC 4OV5A 5KSBB 2ZSVB 3AS3A 1TTFA 2P47B 5F1NA 5C08B 5DHVB 4DZBA 3EZJB 1JPFA 12E8L 3K46A 2ADJA 5I1GL 3CXDL 4DOHB 1U3HA 1LEGB 3O6KL 4YC2C 8CGTA 3FQRB 5E56A 3IDGB 3HNSL 1QFWH 3OAUL 2Z8VC 4LSQL 3GSNL 3BRGC 2FX9L 1TVHA 4XCNB 2YKLL 4V2BA 2XXMB 3W11C 4ACPA 1TZIB 1XGUB 4ZAKC 2DB8A 3GRWL 4PTTA 1SJEA 1QHPA 1DQQA 4YXLH 4G8EA 3FQNA 3MUJA 4PJ9B 2FHFA 5C0CE 3PWLB 2X4UA 3TIDB 3CDYA 1QLRB 5D6CB 3QUZD 4PJXF 5IVZB 3HFML 4G7YL 1BJ8A 2IWGA 1JGVH 3ILPB 3E6FA 4X6CB 5JPNB 5T1DH 4OV5B 4LVNB 2AV7A 1KYOK 1WJ3A 5F1NB 2D31A 4GW4B 3W81A 2F53E 3HMWL 5HYJA 5KVMC 1JPFB 1JHLL 5EO0B 2ADJB 3NIGF 1U3HB 1FNGA 4RA0C 4RMWA 3CX5J 4N0YH 1LMKA 2W9DL 3QT2A 1T5WB 4JO3H 1NL0L 4WW2A 4XNZB 5C0RL 1N5AA 5JDSA 1IE5A 2KQNA 1T2JA 1TVHB 2WINB 3QDMA 4E0RA 5IVNA 4OF3A 5E99H 1DQQB 5EB9A 4G8EB 4TQEL 4Z77A 3UDWC 3ULUH 2XY2A 3FQNB 1J9CT 2X4UB 2OI9C 1DBBL 4NPYA 3X14A 3PWJA 4JM4H 5EWIH 3AB0C 3MCLL 2QSVA 5D70H 4OCWL 1UADC 3E6FB 3MACH 4ONOA 3BPCA 2DQDH 2AV7B 5IQ7H 5KVGH 3FFCE 5CLTA 4D2NA 4N9GB 3FO2A 4JJHA 5L7XL 5HYJB 1ZV5A 5GJSL 2DBJA 2R29H 3LB6D 1NKOA 5ERWB 1FNGB 4JRXD 2G5BA 2OLDA 4N5UA 1N5AB 5JDSB 5C0AD 3SHSA 1JHKL 2R1XA 5T5FL 4AQOA 3V95A 3WNNA 4I3RL 4YR6A 4JB9H 4K55A 2WWKO 2Q6WA 4Z77B 1V7NH 3GHEL 2C9AA 2SEBA 5AYQA 1QSEE 5FYJH 4NPYB 3X14B 1YMME 3PWJB 1EH9A 2HMID 4Y4KC 3OTTA 2VDQH 4U0QB 2AJXH 3BPCB 4XC3L 5J12B 3QNXA 2GFBA 2X4SA 4YDIH 1NCBH 5IKCA 2FLBT 3QUYD 4JPKL 4NKQB 3FB5A 3MJ9A 3TN0C 3MV9A 2G5BB 1ES0A 4XNQB 5E2VL 4JHZA 4FZEH 1EO7A 5BS0A 1QFOA 4C56A 4KKAC 2R1XB 1EIBA 2EH7L 3BDYL 4RX4A 4YR6B 3JBG7 4QGYA 3MPCA 1DEEA 2SEBB 1MEXL 3ULVH 2APBA 3MCG1 2B39A 1HHGB 1MFNA 5CILL 3UMTA 2NYYD 5GZND 2APVA 5DQDH 4L8SC 4NM4L 3KPRA 5BV7L 2R8SH 3QNXB 4UINH 4KK6C 4X7SL 3AMKA 4WV1A 3V2AR 3EJYC 5IKCB 1G9NH 1JV5A 2FX8L 3FQUA 1G6RA 2BJMH 3MV9B 1HIML 5I16A 3BQUD 2FHCA 3HRPA 1ES0B 3NH7H 1BFTA 4U7KA 1F00I 5BS0B 1MJ8H 2Y36L 5BJTA 4C56B 4PFEA 2DIAA 3O2DA 3F5WA 1UCBL 1UM6L 2X4RA 1DEEB 3JSSA 3CX2A 4PJ9C 5HHXH 1T80A 2AEPH 1S7RB 2CPCA 4HX1A 4RBPK 1D5MA 1GGBL 1OWWA 1D7FA 4JDTH 5CSGA 2D2OA 3KPRB 1XF2A 4LVNC 3ZKMD 2C3GA 1YEHL 2XOTA 2HT2C 2P42B 3CDGA 1ACZA 5MEQA 1JV5B 1MY7A 4C4KO 3FQUB 4OFYD 1G6RB 5DWUH 1U3HC 5SWSD 4LFHG 3I75A 1LO0H 1E4WH 2V5TA 3MRNB 5CJQL 4XNZC 3K1DA 2FJGB 4CU8A 3T0DA 3QPQD 4WO4D 5IMOA 4RGOL 1H8NA 4G6FD 3F5WB 5TGBB 4U7SA 4WFGE 3KPSE 1YN7A 1KACB 1Y6MR 2AKRA 2WUCH 4LLWA 4NQVA 5GGVL 2A77L 3N1FC 4X9GA 3KGRA 4CJ0A 4AG4L 4HX1B 1MHPH 1UT9A 3T09A 5I75B 2I9TB 4WI5A 3O3DA 5I1JL 1ADQA 1K3IA 2G60H 5D7IF 2QQKL 4XWGH 5C0CD 5LCVL 4PTUA 5JPMB 4K2UH 1H3UA 3D39A 1MRDL 2FX7L 2EKSA 2FJFB 2YD9A 3BEWA 1ZLUH 3I75B 5IFHL 2IGFH 3RY4A 3SO5A 5E03A 5DJ8A 5JW3H 2WWKT 5T1LA 2PTUA 5D7LA 3S8WA 2F53D 3IDXH 5IMOB 1IBGL 3A6BL 3LOWA 1KIRA 2VLJE 1PVHA 2CLRA 1F8TL 5F8RC 3TVMA 4ODSH 1RUAH 2AKRB 4LLWB 4NQVB 1WGOA 5SX5K 1A3RL 1RI8A 4I2XE 4TSCL 3RY5A 5L9DL 4Y2OA 5CD5D 2UZYB 3O3DB 4ZD3H 4FQ1L 1LWRA 1KJ2A 3BKMH 1DJSA 4FQ2L 2OL3H 3VGDA 5J12C 4TUKH 4IBLT 5F9WB 4K71C 3TCLA 4ZOCA 1OF2A 3C60D 4M6AA 3TYGH 1AKJB 1OSZA 1J0YA 5DJ8B 3FFCD 1QFWL 5T1LB 5D7LB 2AJZA 3B9KA 4FQQA 5F7FA 2WLYA 4PJDB 4BK4A 3OHXA 1VB9A 5I8EB 1KIRB 1SBBA 5IB4B 3NCJH 2CLRB 1FRGL 3TVMB 1OARH 1R5IA 4YXLL 1K6QH 3O8XD 5KOMC 4OAWA 4QWWD 1T0MB 1BOYA 2FNBA 2OTUA 3P4LA 3MOAH 1N59A 4P23D 5I18H 1P7QA 1JGVL 4Q97A 5T1DL 2IFFH 2XRAH 2ZG3A 2YZ1A 1QSED 1YMMD 4KKBD 4DK6A 1NPUA 3C2AL 3AROA 5KZCD 3CUPB 3TCLB 4F57L 3MLYL 1B6UA 4DN4L 4HPOH 1OF2B 3NAAH 4JVWA 4U3CA 1CGYA 1FVDA 5DJDA 1OSZB 4N0YL 4JO3L 2AJZB 4FQQB 2K7PA 1K5NA 4X99A 1EJ6A 5FKPA 1R5IB 4KROD 5E99L 5LVEA 4PRHA 3ULUL 5FO8A 4OAWB 3OL2A 2BSSA 5C0BA 1QFWI 1HOCA 2MFNA 1IT9H 2OTUB 4P9HC 1N59B 1C5DA 3ARYA 5EWIL 4OZIB 4Y2DA 1Q94A 5D70L 3S37L 4ZFOL 4C4KT 2KH2B 3MACL 3MSPA 4OCYH 4FQHB 2DQDL 3I6LE 5FYKH 4WV1C 2VDNH 2E9WA 4M02A 3VFUA 3TH3T 4XMKH 2R29L 2A6DA 3ROLA 3UTQA 1MJJA 3W2DH 1FVDB 1RZ8A 4WI7A 5DJDB 1B0RB 4S0TD 1N0XH 1I9JL 1YEJL 1YUHA 2A0LD 3OV6A 2EE9A 2G2RA 5D7IE 2CUHA 3WHE1 5JW4R 3DUSA 1MHHB 1V7NL 4PRHB 3VD9A 4NJAL 3SE3A 1CXLA 5FO8B 5C0IA 5C0BB 2BSSB 1BEYH 5FYJL 3SGEH 1MWAA 1HOCB 4S1DC 1K9TA 2NY3D 5I75C 1C5DB 4JQXA 1CF8H 1Q94B 4GRWB 2XZZA 1L7IL 1MHEA 2VDQL 3RWEB 5FF6A 3QUML 2RAMA 2AJXL 3TO4D 2YD5A 1NCBL 3AXLA 3VFUB 2BY2A 5KG9A 3WKMH 2A6DB 4R4FH 3FCTA 1RZ8B 1PG7H 3VRIA 3MRGA 4OT1L 1RUQL 3ZMRA 2VKWA 2G2RB 3G9AB 4RGNE 4R9HA 4DFIA 3U30B 2Q3ZA 2P8MA 2CMRL 3DUSB 2DM3A 5C0IB 3ULVL 4R8WH 1EEUA 4U2ZA 2DD8H 4ODVH 1KIQA 5E08H 2ZCKH 3FKUS 3TA3A 5KS9A 5DQDL 5FF6B 4WFGD 1R24A 1D5BB 3KPSD 1XFPA 1X5KA 2JTDA 4UINL 4LHUD 3IETA 4HS3A 5F9WC 5B3NA 3AXLB 2HJKA 5GZOC 5KG9B 1G9NL 4WI3A 4ZUWA 1MI5E 4C83A 1GXEA 2BJML 4NQDA 3MLPA 3PWPE 3GGWA 3MRGB 1OLLA 2N7BA 1NFDF 2F58L 1MJ8L 5LBSH 2ICWI 2CO7B 2JB5H 2P8MB 1V3KA 3TVMC 1YEKH 5CGTA 3OKYA 2XIDA 2AEPL 3MV01 1F2XK 2YRPA 2AS5M 3MCKA 5H94A 4JDTL 4J3TA 1X5YA 2VLJD 2AJSH 3TA3B 5KS9B 4G8FA 4J7RA 1HHIA 1EERB 3IETB 4HS3B 1WBZB 2HJKB 2DJSA 3GIZH 4ZUWB 1U8JB 4C83B 4UDTB 4NQDB 2FIKA 5DWUL 4U1SA 4XAWH 4NHCH 1RPQA 3H7BA 3GGWB 1LO0L 1WSST 4QRRE 4ODHL 1E4WL 4PYHA 1NGPH 1E6OH 3B9KC 1LD9A 3HE6D 3R0NA 1ZEAH 4Z7NE 4HPYL 3KYNA 4NFDA 5C09A 4DW2H 4HFWA 1GZQA 3BP5A 1DANU 3X13A 4RFEA 3WLWC 4ALAH 2WUCL 4LRNL 5DHVH 2MNUA 2VAAA 5IESH 3SJVB 1MHPL 2YRZA 5H94B 3UYOD 5F7WC 3BZ4A 5E8DH 4G8FB 1P69B 3EYOA 2G60L 2ZUSA 1NEZB 5DO2C 5GS2H 2YPVH 1OAUH 3WMSA 1HHIB 3BISA 4I3SH 1J86A 5E6ZA 4TN9A 3N9GL 4FFWC 3I6KA 5J4MA 2ZUXA 4U4BA 4XTRC 1VPOH 5KVFH 2JJUA 2FIKB 4U1SB 1JZ2A 3THMH 1FPTH 3H7BB 3O0RH 1KG0A 4ZNEE 1LD9B 3IDXL 4XPBH 3TC9A 3KYNB 4F8TA 4HFWB 3AGVA 1GZQB 5FUCE 3BP5B 3X13B 4Z18A 4ODSL 1RUAL 4Q6YA 1EK3A 4NFBA 3WIHA 1HHKA 2VAAB 1ZANL 3B2UC 3HB3C 3B43A 2MKLC 3GSWA 3MTRA 2WZPD 1OAZH 3OGCB 1KXQE 3BZ4B 4ZD3L 4U7MA 3BKML 3EYOB 5A2JH 2OL3L 3T3PF 5JHDE 4TUKL 1OAXH 3TJEH 4QOKA 3I6KB 5FK9A 4APQA 1YZZA 4TUJA 3GMQB 4N5ED 3S36H 4QRPB 4FQLH 4U0RC 3TYGL 1KG0B 3BZDA 3KYAA 3VD4A 3I6LD 4M1GL 3BE1H 2NR6D 5LGKA 5IF0A 5BVPH 3MLRL 1RAMA 2Y72A 5EA0H 2DTML 2P8LB 3NCJL 3U30C 1OARL 4Y4HD 1K6QL 4R4NC 1PQZB 1HHKB 3SE3C 1ACYL 3QZWG 4K3JH 4PB0H 2ZCLH 5E9DE 1HXMA 3EYUH 3MOAL 4JQXC 5I18L 1UM4L 1NFDE 5CJXA 3ES6A 1FQ9C 4XCFH 1MQ8A 1NCWH 2IFFL 2XRAL 3L3GA 4QOKB 1AGBB 5FK9B 3EO0A 4LCWA 3J8F7 4APQB 4LVEA 2H32A 4TUJB 5C0GA 5A2KH 1HCVA 3NAAL 5IVXF 3EHBC 1H5BA 2EO9A 1SBSL 4KJPD 4TPRL 3TBVA 1KTKE 1PSKH 2NZ9D 4MXQC 2A6IA 4Q9RH 5IF0B 3IAQA 1D6VH 3S5LG 3QA3A 1GGIH 4XPFL 1IC5H 1YY9D 3FZUD 2JLLA 4J1UA 1BJ1J 5FXCH 1EHNA 2C7UA 4RGND 3S4SA 3CC5A 3P0GB 3MLUH 3Q2CA 3RVTD 3TA3C 5L8JB 3ES6B 2NZIA 3L3GB 2VKXA 1F58H 4FQPA 4YHPB 4PJGA 4HZLA 2VDNL 1YYMH 1SJHA 3EO0B 4LCWB 3QQ9D 5E2UH 4XMKL 4ZFFA 2OJEA 5C0GB 1KB5A 4U1HA 3C6LD 4KTEH 3W2DL 3NGBB 1H5BB 1FGNH 1K85A 3TBVB 3IT8D 1N0XL 4HJ0C 3JV0A 4PRPA 1GGCH 5LAXA 5J3HD 3DUUA 2A6IB 2W0FA 3MRHA 1H3WM 4ZTOH 4PJCF 1MI5D 3IDMB 3QA3B 4E42A 4DVBA 1F3DH 3B4NA 3PWPD 3BN9C 2O26U 4J1UB 1KFAH 1J1PH 1L0YA 1BEYL 5CJBA 3EYQD 5A3IC 3KYOA 3UTSA 3MJ9H 3VXPA 4KI1A 4AT6A 3CC5B 4HIHA 1CF8L 2MCPL 4IOIA 4UNTA 5DD1H 4XP4L 5FGRA 1CLZH 5CBAA 3K74B 1SY6H 4O51A 4FS0A 1GYAA 4PJGB 4HZLB 1RK0A 1SJHB 3EJJX 2Q8AL 2FD6H 1VKXA 1LE9A 3ZKND 4ZFFB 5FUZH 1KUMA 1KB5B 4HKBA 4MNQA 4TYUA 4U1HB 1N3NB 1OWRM 4R4FL 4B7IA 2C3VA 4HLZG 4OLWH 4YXKL 4FQJH 4GFTB 1YMHB 1PG7L 4PRPB 1WAAA 5LAXB 5IHBA 3DUUB 2PW2B 1K3ZA 5F9OH 1I75A 2W0FB 3MRHB 1MFDH 4XP6H 3GJFA 1CTOA 5I8CA 3EKCA 4E42B 2MQ0A 4DVBB 1IAIH 4P46D 3PQYA 5GGUA 2YD8A 4QRRD 3D2UB 4X6EA 4JGMA 3OKDB 3Q1SL 4MS8C 4C59B 5JW4N 4LMQI 3KYOB 1G6RH 4NJ9H 2BC4A 3VXPB 4AT6B 2DD8L 4ODVL 4PLKD 3RPIB 3BRFA 1QBBA 3OF6D 4ETYA 5D4QA 2LVCA 1I7ZA 1HWGB 4O51B 2BNRA 2VLLA 2VL5A 4BQBA 2VXVL 3ZDXF 4PLNC 5IW6A 1NCCL 1RK0B 4JKKA 5D1XA 2I27N 3SGEI 2WBJA 1RZJH 4XVJL 3O2DH 1VKXB 1LE9B 1PKQE 2DS4A 4HKBB 4MNQB 5IMMA 2C3VB 1SYSA 3SKMA 4YDJB 3S98A 1PKOA 5GSVA 4YHYC 4JG1H 2J6EA 3TJHC 1DBMH 4FFZH 4UNUA 1U8OA 3GJFB 4K8RD 5I8CB 4F58H 2R9HC 4M7JL 1I1CA 2JB5L 1JWMA 1ODAA 3PQYB 4NM8H 5GGUB 5TDPA 1YEKL 4WTXA 5DUBB 1FFQA 3E6HA 1WZLA 2BC4B 5DHYA 2LAGB 3VU2A 43C9A 2AJSL 3GMRA 3H2WA 4PR5A 1I7ZB 2PTVA 2VLLB 2VL5B 2GEEA 5IW6B 5T1KD 5D1XB 5C0DA 2JJVA 2WBJB 3QDGE 3RBSA 3W5MA 3O9WD 4APQC 5IMMB 4XAWL 1SYSB 2H9GA 1OM3H 4NHCL 1HNFA 5EPMA 4HG4J 5JHDD 1RUKH 3L6FA 4BFIA 2DLTA 2AK4A 2WAHA 4LSTH 1NGPL 3T4YA 3D48R 2CXGA 2WSKA 1U8OB 1VSCA 4OB5H 5E94A 1MCCA 1OW0A 3TIEA 1ADQH 4DW2L 1JWMB 2DQFA 4BZYA 2D7TL 1JPST 4ALAL 3E6HB 1X7QB 4MHHI 1ORQB 3KS0H 5DHYB 2DQGH 5TPWH 3GMRB 4PR5B 5CJXC 3QUXD 5IW1A 2YPVL 1OAUL 3GSRA 4OZGF 4I3SL 5ICYB 5E9DD 5EG6C 3SE4A 2EO1A 5I71B 4E9LA 2FEDC 1VPOL 5KVFL 4Y16A 1G7LA 2H9GB 3I3EA 3NGBC 2JJSA 1H5BC 4MJ5A 1FPTL 3S3SA 3O0RL 4MXVE 3THML 1NMBH 3QP3A 2AK4B 3OKLA 35C8L 4JY5H 3T4YB 1JTPA 3RFZC 5E94B 3TIEB 4XPBL 3LH2H 1KJ2H 1QBLH 4X4YA 5LQBH 2QHRH 2BXZA 3WL9A 2H2SC 3CJJA 4PGDA 1QSFE 2IEPA 1OAZL 1WCQA 1NFIA 5HI4C 3CZJA 3JVGC 3CDFA 5IW1B 3SO3B 3T0VA 3GSRB 4G6KH 2ZOKB 4MB4A 3TJEL 2V5YA 1XF5A 1ZVSA 1IGCH 1G7LB 1T7VA 5FEBA 4FQLL 4GT7A 4LASH 1IGFH 4JM2F 4FG6D 3PL6B 5BVPL 3BD3A 5EA0L 3FONA 4L4VB 4X4YB 5HDBE 3ZDXE 2UWEB 1KN2H 4YNYA 3OKMA 3V4UH 3WL9B 5TE6L 4K3JL 4PGDB 1I7UA 1IKNA 2ZCLL 1U8NA 5BMFL 5M94B 3LY6A 1EBPA 1NFIB 3BAEH 3F7RA 4DUWA 3VXNA 1P4LA 1RQ5A 5HYSB 4XCFL 1UXWA 3ZT7A 2X10A 4W6XB 1V05A 1FYTE 3GI8L 3MRRA 1XF5B 3CLEH 1ZVSB 4Z8FH 5HHQA 1HHJA 2YA0A 4GRLD 1EGJA 2DYPA 4OFKA 2A6KA 7FABH 4KUZH 1V7MH 4X80H 1RIHL 3HKFA 2YPKB 4Q9RL 2VH5H 4GRWH 5E6IB 2FECL 1D6VL 3G6AA 2B5IB 3RVVD 3FONB 1LGVA 3IJYA 5D96B 3ZHLA 1YEGH 1IC5L 2MJWA 4PRAB 3AREA 2Z8RA 1TVBA 4YNYB 3OKMB 5F6HI 3IVKA 2XKNA 3QWOA 3RHWF 1I7UB 3QI9D 1U8NB 1FC2D 2H2PD 4ODXA 3MLUL 1A7PH 1F6LL 1J87A 1E4KC 5KTEH 3VXNB 1UXWB 1F58L 4OUOA 5TQ0L 1CVSC 4LAQH 5D1XC 2WBJC 5E2UL 2ZUWA 3QFDA 5L6YL 1KTDA 5KANG 4HV8B 3ALPA 4KTEL 3V8CA 1OGAE 2DYPB 1FGNL 1MCIA 1T1XA 3WHXA 1F3JA 4KJQD 1MWAH 3BKYL 5HGBB 4DTGH 1FZKA 4PG9A 3U4EA 1QHOA 4U3XA 4A6YA 5ALBH 4WTWA 4ZTOL 3G6AB 1A3LL 3VH8G 4AEEA 4OZGE 4ERSH 3IJYB 1A02N 2R56H 5GSRA 4H5SA 3AREB 1QPPA 1KFAL 1TVBB 1MAKA 5DMIH 3IVKB 4EUPG 3QWOB 2AJ3A 3BIAX 3MJ9L 3GMPA 4X98A 4ODXB 1BWWA 5DD1L 5KVDH 3JWNC 4R0LA 1CLZL 4K3DH 2A2QT 1H3GA 1SY6L 4HXBH 4M1CD 5JOFA 4XC1H 1B4JH 5I71C 4QY8B 3QFDB 1KTDB 5FUZL 5DVLA 3U7AA 4OLWL 5FB8B 3NCCB 1T1XB 4FQJL 1AQKH 4DVRH 1FZKB 4PG9B 2EIZA 1EEZA 5I19H 5F9OL 1MFDL 4XP6L 3QDGD 1OW0C 1FE8H 2UY7A 4MB3A 1FFPA 1IAIL 1OHQA 4H5SB 3UYRL 2H26A 2L7UA 4K3HA 2NW3A 1PG7W 2ED7A 15C8H 2AJ3B 1G6RL 2Y07H 1MAJA 4NJ9L 5F3HB 1GRWA 3GMPB 4X98B 1JRHI 4F3FB 4XX1G 3KHQA 1Q9OA 4R0LB 5HBBA 2HTKD 4ODTH 1JYNA 3SO3C 2D7QA 5F88A 1MFBH 2HLAB 2BOBA 5ANME 3UO1L 2IAMD 4XVUD 1RZJL 3NFNA 3O2DL 3KLHC 3DURB 1KIPA 2XNAA 3QQ4A 4N0RA 2I26N 4M03A 1C7TA 1Q38A 2ZPKH 3TBYB 3AM8A 2JJSC 4ELKA 1A6VH 4Z7OE 2XFXA 3UTPE 4JG1L 5D9SA 2EIZB 1DBML 4MNGE 3H3KA 1U8KA 4FFZL 1CGXA 2GI7A 1N6VA 4ZQKA 2AEIT 2H26B 2YXFA 2NW3B 2CK2A 2XKUA 2VDKH 5IHLB 3CFEA 1IC1A 3MV8D 5E5MA 2AXFA 4HXAH 4NDMA 1I1AA 1ZHLA 1Q9OB 2D4FA 3BKCH 3QH3B 4NO2B 5HHPA 5F88B 3IU4H 2BOBB 1QSFD 3F7PC 2R1YB 4RSVA 1CDGA 5FHBH 3ZTNH 3BOVA 3NFNB 5DI8A 1KIPB 2NY0B 2OMBA 2XNAB 3QQ4B 3C08H 1IEAA 1OM3L 5JA9A 2QQLH 2XFXB 1RUKL 5D9SB 1MF2L 3EBAA 4LSTL 3EFDL 4X5WA 1U8KB 1DP0A 3G5YA 4OB5L 4LDOB 1ADQL 3N1MC 2B5IC 4QXWA 1RJLA 4LAJH 5D96C 2NY5C 4ZQKB 5B39G 4K9EC 2X40A 3V6OE 5HHOE 3CFEB 1DBJH 1IKNC 2FHBA 5E5MB 2DQGL 1AO7A 3V6FB 1IAMA 4NDMB 4WJ5A 1L6XA 1ZHLB 3NA9H 3OG6B 1OTSD 1QQDA 1S7WA 4OM0H 5IWLA 1DN0A 1ZLVK 2NXZB 4Z78A 5HHPB 5D2NE 4K7PL 1NBVH 1N6UA 2P1YA 6FABH 3P0VH 4JFEA 2NNAA 4X7DC 2WV3A 2W60A 4NQCE 3WIHH 5DSCA 1UKSA 4JFXA 1U58A 1ERNA 1NMBL 4QKXB 1FYTD 4JFFB 3QUZA 4XZUA 3UROR 4O9HH 4JY5L 2AQ3A 4I9WE 4X5WB 3G5YB 3LMJL 1JK8B 2F74A 4Y89A 3LH2L 1KJ2L 1RJLB 1QBLL 5FKAA 3SDXF 4XAKD 3AREC 5LQBL 4O00A 5E24E 5SX4H 3D5OF 4LPYA 4MD4A 1VADA 3UBXI 1AO7B 3DVIA 4TOYH 2VE6B 3QCTH 4U6XA 4ODUA 3QXUA 1S7WB 3LEVH 4Z78B 4G6KL 4QTIL 4UZGA 3TM6A 2PO6D 5IEKA 4Y1AE 3QR2A 4JFEB 5BRZA 2NNAB 2W60B 1QG3A 5DSCB 4JFXB 1U58B 4U31A 5IB3A 4FQXD 4XZUB 3QUZB 4NQEA 3MBEA 4LASL 1IGFL 1OTUD 2F74B 1TJHH 1II4E 1B2WH 1RURL 5FKAB 1OGAD 4P3CH 1RZGA 4I48A 5E5RB 3H3PL 3V4UL 4QO1A 4MD4B 1VADB 4M5YH 4EDWH 2H32H 2PTTA 4JGJA 5CJ8A 3MROA 3VXRE 3BAEL 4JRXA 1ZLWK 3RY6A 4ODUB 4ONGH 4OIIH 1KENH 3HMXA 4LSVH 4Q2ZA 4R0LC 1S9YA 5KSAD 4UQ3B 5A2FA 1CICD 5IEKB 5DC4B 3CLEL 4OKVA 4Z8FL 5BRZB 5D71H 3VXSE 3H6JA 1IZKA 4YFLI 4MDIA 2I60L 4LGSB 7FABL 1NSNH 1V7ML 1IAOA 4X80L 1A6TA 3MBEB 1I1RA 2VH5L 4NO0A 3CVHA 3MRDB 5I8OH 1YEGL 4P49A 4I48B 1PEZA 1OAKH 4OZHA 4AL8H 5L2KE 1L4IA 1HHHB 1P1ZA 2M26A 2CIKA 1DFBH 1GAFH 2ZJSL 1KB5H 2R2HA 5DVKA 3MROB 3TO2A 1YYLH 3K8MA 4JRXB 3T1FA 1A7PL 2NXYD 4Q2ZB 1S9YB 1D5ZB 3HNVH 3UAJD 5EU6D 4LAQL 3S7GA 2VZTA 4UUJA 3L1OH 4OI7A 2DKUA 3VMOA 2NY0C 1WFTA 4OQ1A 1WITA 2X41A 3AM8C 1UA6H 4JM2D 4MDIB 1MWAL 1U3YA 5TF1H 1BIHA 2I25N 1IAOB 1A6TB 3CVHB 3M1BB 4GMTH 3FHAA 4ERSL 4R6UA 1J0ZA 2NY1D 4OZHB 1C08A 3P4MA 3UTPD 1KLUA 1HSBA 2J5LB 1AR1D 5DFVD 5BOPA 2CIKB 3G5ZB 2R2HB 4ZUVA 4PJ5E 5E4EB 3TO2B 1YEDA 3RVUD 2FH8A 1I1AC 3T1FB 2AAVA 3DLQR 5KVDL 5FYLH 4K3DL 2NXZC 1TPXB 3GJFH 4HXBL 2XQYG 3SDXE 1N2RA 4JZOA 1B4JL 2HH0H 1FDLH 2WIIA 4XCCH 2VZ3A 4W6WB 1YDPA 1AQKL 2ARJA 4PJ8A 4ZUUA 4WWKA 1WVZA 3TT3H 3U2SA 2W9LA 1FE8L 2RIKA 4JRYA 3IGAA 3C2SA 2HT3C 1JZ3A 4BQ8A 4G6ML 5ETUA 1C08B 5C6TH 3P4MB 1HSBB 4M62H