1JGUH

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYLDSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Antibody Light Chain
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH01
5K9JL 4MZ3A 5CZVH 5MEND 2X4PB 4ZOEA 2FZ3B 1B4JL 3TWCL 3T77A 5SWZB 1L7IH 3QQNA 4PBVC 1WFTA 1J10A 4X80H 4MVBC 1C8PA 1F6LL 1AY1H 1KLFA 4Y19B 3D3VD 2C7UB 3UCRA 2XWBA 1Q0XH 1D5XA 3DX6A 1LD9B 5AYUH 4ODWB 5EO1B 2DRUA 5IESH 5C0AE 4MD4B 1NDMB 3WS6A 4LSSL 4DN4L 5J3HD 1U93A 1EBAA 5C0BB 3DOSA 1TQBC 4YBLB 5DJ0B 3NCFB 2QQLL 3ARPA 5E00B 2VAAB 3BPNC 3LZFL 1F13A 4A6YB 3MREA 1Z0NA 4GRLA 3O6KH 4CMHB 5MEPA 4AMKL 5I1EL 5J6GB 5E6IA 1RQ5A 4JFFB 3NABL 4QTIH 4PTTA 2WLZA 3IDMA 3DMMA 2X4NB 3OPZL 3UEZA 1EIBA 4J12A 3B5HA 4LPVA 5E6ZA 5F70A 2ZZUT 2FIKB 4L8SC 3VMOA 3VMNA 3TNMB 4EIZC 4XNQA 2AP2A 1S9WA 4LFHG 4EIGB 4PB9H 3BYYA 4DKEL 4AEHL 1UQSA 2R0LH 1DLFH 1AGEB 2P47B 4OLEA 2XQBL 4RGMB 4RMWA 5KTEL 1IGTA 4N8CL 4IHOB 5DO2D 3L9RA 4FXGB 5D1QA 4IS6A 3RQ3A 3EO0B 3M17A 12E8H 2A6DB 4ONFH 4PGEA 5EWIH 3NGBB 4R7NB 3V4UL 3UTTA 3T3PE 2AVGA 5D93B 3MNVB 3H0TA 4FG6D 2XA8L 1FL3B 1UZ6F 4PRID 3VXME 4L8CA 4O2EB 3I6KB 3S98A 2PN5A 1QBAA 3DUUB 1UM4L 4WDIA 4FXGA 1G7PA 2DIAA 3SPVA 2FO4B 4KKLC 5FF6A 5IWLA 1F4XL 5IVXE 1OPGH 4R7NA 4FQ1H 3CX2A 4F15C 5AYQA 3BSZL 3B9DA 4CDGC 4YC2B 3U0WL 1EVTC 1OAUL 2C9AA 5E5UB 4PFEA 1PLGH 5H2BB 2IGFH 3ARRA 3UTQB 3Q1SH 4GRMB 4N5UA 3RP1A 1JF5A 4PJ7B 4OSUH 4YK4B 5T1MB 4LRNL 5CIPA 3PV7A 2J12B 4RGOH 4G5ZL 2VWEE 4BSJA 1NCCH 4JDVB 1P4IL 1B90A 5GZOD 4MA8H 2WW8A 1FO0L 2DI9A 3DIFB 3D0LB 4XH2A 5C0JB 2QSTA 3H9YA 3DX7B 4L8BB 2CUIA 1DBBH 4Q9QL 2ICWI 4OZGF 5E08L 3I6LD 4N0UA 1F2QA 1DR9A 2D7PA 3VWKD 3LQAL 3RUGA 1RJZA 5I0ZA 3ARDB 2BVUA 4GAJL 4Q9RH 2YD4A 2J4WL 4WNQA 5HI3C 2X4OB 3L3DB 4EZMA 1A64A 1JRHI 1MF2H 4I2XB 3S88H 5FKPA 3OTTA 1FYTE 1I7TB 3ARFA 1F4YL 4YPGB 5GIRA 4WFHE 3TF7C 1A47A 2NY4B 2VLMD 4NZRL 4JHAL 1G0YR 5HHVH 3O4LE 3HS0A 2X09A 5HYEA 2DLHA 4G8FB 1A5FL 3FRUB 5FKAB 1IGTB 4P4KD 15C8H 2HKHH 4D9LH 1SJXA 5EUOA 1WCBB 4NRXB 3NPZB 5DS8B 1JV5A 4P2RA 1T66D 3HPJA 2AS5M 2ZUSA 2H45A 4GOSA 5D7SL 2OX5A 1UA6L 1FGNL 4YGVA 2J88L 3K7UA 4K9EL 4YDJA 2YD7A 3TZVB 4K07A 1BFSA 3OAYK 4PP2B 4B0MM 4LLUB 4KRPB 1AKJB 2Z35B 4H0GA 5EZJA 5GJSL 3G9AB 2R8SL 5DTFA 1VGEH 5SWQB 3HN3A 2X1PA 4ALAL 4NM4H 1QSED 1A9BB 1TCRB 3DSNA 4P5KA 4XHQA 2XT1B 1EHLL 1CL7L 1JYWA 1X44A 3IU3A 3B3IB 4H8WH 4MJ2A 5I8EA 1N2RA 5E6IB 1F4XH 1FVEA 5EOQH 5F7EH 3OR7B 4RFEA 3CU7A 1DBJL 5E6IC 4AG4L 3N1MC 4HUUB 5D7IE 2X7LB 5DC0A 4S1SL 3LKPA 1KB9J 3CFEA 3EW3B 4E41B 1JWSA 1IGYB 3MBXH 3O3AA 3STZB 3WJLC 1XGTB 4Z0BL 4NFCA 3D87B 4AEIL 3GDBA 2VL5B 3NZ8B 4LRNH 3KPSE 1IC5H 3O6LH 3QHZH 4GRLD 1OTSD 3TBWA 4AIOA 2D3VA 2QL1A 4U4BA 4F7MB 3FQNB 4O4YH 2AK4B 3LKSB 3QXAB 4MNQE 1NEZA 3S4SA 2JELL 3IJSB 2D7NA 1IGYA 5FA4A 2WP3O 4XVSL 3TN0D 3KR3L 2P43B 1QLEL 1S9VB 4MXWL 4NO5B 5T3XH 5HDQL 3UTPE 2GIYA 1UH3A 3QXUA 1DVFD 4XPFL 4KPHL 3B6SB 2VQ1A 1UEYA 2DM7A 1T83C 4YAQA 5T1LA 1QSVA 3TN0C 3E3QE 4F2MB 3HI1B 2VRAA 4JO4H 2DKUA 3DLQR 2WMPA 4WW2C 1OGTA 4JFDA 3FT4B 4UI2A 3VI3F 1NUNB 5I30H 5C6PB 1MFBL 2AKRA 1NH6A 2GY5A 3K8KA 5JW4N 5AEAA 3P3YA 3QDGE 4HWEL 1CT8B 4Q9BA 3EDFA 3HE6D 4ZOBA 3P0VH 3SDCB 4JFDB 4IRJB 3GUTB 5CJOH 3WNKA 1R24A 3FO2A 1CFVL 1HHIB 4ZPTA 2VXUL 5ETUA 3MCG1 3MRBA 5DHYA 3OB0K 4ZTOL 1NSNL 3PABB 1UKTA 2J88H 4K9EH 1T2QH 3DX7A 4R96A 3WIHL 4XXDA 2DQDL 3KYMA 1I1AA 1CZ8L 2CLRB 4YNYB 1PVHA 2R8SH 1H0DA 1CK0H 1B0RB 3RVTD 4QOKA 3H9HB 4YBHA 2VABA 5KN5A 2A74A 1YJDC 4ZUWA 5C09A 4R3SA 2BVQB 2DJUA 4Y0GA 2NCMA 4S1DD 4J7RA 3OKLA 1JHKL 1U8IB 4XC3L 1I1CA 2QSVA 4Y2DA 1KB5L 4H1LA 2IANE 3ZTJG 1JBJA 4KTYA 5LCVH 1WT5C 3VFVA 5HXMA 1IKFL 2BSRB 5KVMC 5B38A 2HG5A 1JUFB 4FZ8L 2CJUL 1KN2L 1YEEL 2X70B 4YHMH 1KG0A 4UIKH 3TCLA 3RZCA 1HH6B 3FB5B 1J8KA 1ZS8A 3MV8B 1A4JB 3VFRA 4O2EA 4X7TA 4U2YA 5EC1B 5GGSA 1GZPB 5GGVL 1RURL 1Q72L 2DI8A 1RULL 4NKIL 4MMZC 3KGRA 1RZKH 5HI3D 2YPLE 1OP5K 1A8JH 1J8HB 2QLVB 3G04A 1IAKB 3JXAA 1ZLWH 1U9KA 2BNUB 3RWJA 3O6FD 2APXA 4YH6A 5DMIH 1KJMB 5C08D 1MRCL 5ADOL 4G8IA 3EYVB 2WBJB 5BRZD 5JHLH 3U0PA 4AYFA 3B5GA 2J1KA 4WY7L 3WS3A 1WBZB 4U1IB 5BOZG 3QI9D 4TULH 4D3CL 3UYRL 3NFPA 4LEXH 3FB7B 4XT1C 4EDWL 5T33H 4KZEL 1JGVH 3MRFA 3CFJA 2V5TA 2AXGB 3FOMB 2YD6A 1AGCB 4I48B 3UPCA 1ZEAH 4M1GH 3S3SA 4UT9L 1MH5A 1MIMH 3WJLA 4K8RD 4PJCF 3TIEB 2F53A 5HHOA 5F8RC 1WWBX 3F58H 5GRJL 5DHVH 1LE9B 2FR4A 4KHXL 4X0KA 1CVRA 2JJTC 1UZ8A 5HPOA 5D1XB 5BCAA 5J6HA 3QRGL 1ZTXH 3GJEA 4V1DD 4NSKB 3CXDH 3H7BA 3MV7E 4JN1H 4KJQD 4Z7WA 1BJ1J 1D5IL 5E03A 2DTML 3SY0B 1A3RH 4DZBA 4L29A 3EO9H 5I18H 3CFBA 5I9QC 2NYYC 2AJSH 2YSSA 4F7CB 4KH2A 3SO5A 3N9GH 2JCCB 1S7WA 4OQ1A 4P4KA 1T7XA 3FOLA 3EJJX 3QULA 4PS4L 1RJLA 1G7LA 5BXFB 4JPKL 4PR5B 1O7SA 4GAYA 3DWTA 1CICC 4WRLA 3QFJD 1EZVX 2JB6A 1GAFL 4LMQI 1CN4A 3VFOA 3RDTB 4WCYH 2EYTA 3A0OA 3WCYA 3JVGC 4X8XA 1HIML 1GPOL 3BKYL 1RJLB 3OR6A 4W6XB 1LO0H 3S37X 4F33A 4JKPL 4MNGB 3I75B 3QEQD 2C5DC 4X6DF 4XCFL 3V0WH 3X3GL 5FYLE 1OAKH 4N8PA 5D96B 1ZHBB 1FZOB 4BJLA 3ZHKA 4M3JA 3WD5H 1R5IA 4JHWH 3IFOA 1YMMB 2M26A 4YPJA 5CP7B 5BVPL 5ILTH 4TNVF 4D8PB 4Q58C 2VISA 5D1ZA 5I1KH 5LBSL 3E8UL 4LCUB 2X4QA 2CGRH 4UT7L 5ICXB 3D2UD 1IJ9A 5I1JL 2B0SH 2VZUA 3CFCL 3ULUH 3LV3B 2AV7B 5EU6D 3QXDB 3BOVA 1U36A 1QFWH 3W9DB 4CADA 5BMFL 2QHLA 5L6YL 5CIPB 3CNKA 4NCC1 2ADJA 3A6OA 3NIGE 3DUSB 4F9LC 4NO2B 4PRHE 4ONGL 2A6IB 2NR6D 1PG7H 3P4MB 1YUHA 1KG0B 3RZCB 3D18A 4H25A 3O0RL 2R1WB 3ABZA 4XNZB 3NAAL 5E2WH 5B8CA 4L8BA 2IPTH 2OJZH 1ZOXA 5ESQA 4BQ8A 1FJ1A 3HR5A 5F1IB 3MNWA 5LKNA 4D9RE 3IJYB 1I1AC 3EFFB 3TBVA 1OVZA 5MENB 1YUHB 5EBWB 4N5EC 1HYSC 5DJAB 2Q8BL 2IBZY 5DI8A 3TVMD 4L8CB 4O51A 1YMHA 1DUYA 2VAJA 1DJSA 1UCBL 3T3PF 5C2BL 3STLA 3QUXC 2DYPB 5CJQL 2FO4A 5CINL 2DMKA 5L2JA 1QUNA 2AW2A 3GMQA 1A7RL 3MROB 5HHPB 2ZOLA 1UM5H 3GI9H 1JI1A 3VXUE 3BZFB 5E8PA 4JKMA 1ZLWK 5J56B 4L8DB 1T89C 1IEAB 4U1HA 5GGUA 1WIOA 2X9XA 3EAKA 5GRUH 4OCXL 3NIGF 5L2JB 4PRPB 1H3PL 3QFDB 4JZNA 5KSAC 3WNMA 4JFYA 4XPTH 4Y4HD 1LILA 5L88H 2BCKA 2IFGA 1Z5LB 2W9EL 3VW3H 3LKNB 3MCKA 3DMMB 4DAGL 4NC0B 4P5TB 2HT4C 1JE6A 5IMLA 3KPRE 4B41A 1CFNA 1MCWW 4U49A 1AQKL 4WUUA 3DXAE 3TO4D 5FM4A 4HV8B 1R5IB 43CAB 4HFUL 4ZS6C 4JN2A 5D5MA 5SWZD 5TE6H 2X10A 2EIEA 4U6VH 3AUVA 3CFBB 2EH8H 2DKMA 4FMFA 1GJIA 1OSZB 1J0HA 2C1PB 4Y16B 3RL1B 3SEPA 3CPLA 1OGAE 1T7WA 2AQ1A 2YK1H 2BVOB 1XIWC 3HE7A 4K23L 4IDJH 1XF2A 4H26A 3OXRA 4JM2D 4HPYH 3T65B 4Z95L 4FA8A 4FFVC 1RMFL 2ZCLL 1BX2B 5L6YH 1QPPA 5HD8D 3O6ML 4X9GA 3ZZ1A 2ILLA 4QGYA 1OQXA 4OGAC 1W0VA 5C07D 3KPMA 5TQ0H 1HI6B 3PHQB 2RB8A 4AM0A 4C54A 3ULUD 2ITCB 1D5BA 3PP3K 3OPZH 3QR2A 1EMTL 2RCSL 3T65A 3PWJA 1L6XA 1FFOA 1NAKH 4OLUL 4RMSA 4F37K 1DP0A 1YECH 3LKQB 2NXYD 1OPGL 3HPLA 2WUCH 2EYSB 5A40E 1JZ8A 1JGDA 4QTHA 4HEME 3HNVL 2AV1B 4UUJA 4FQPA 2C3XA 3PHQA 2A83A 4I18B 2JK5A 1JYXA 2DYPA 4ZNCD 5F7MC 3C08H 2YD3A 2IFFL 5DJCA 5T1MA 5BVJB 1FNGA 1MREH 4P4KC 2E7CA 3JV4A 1LQSR 4U6YA 1OD9A 2R23B 4KROC 1U8MB 2R1YB 1MJ7L 4XNXH 4HBCH 5C0CA 4Z7NF 4KI1A 2OQJB 3NCEB 1LEKA 1ZVSB 5EBMB 5J8OA 5I16A 1KXQE 1FHGA 2EEBA 5IK3B 1W72H 1NAML 2D0FA 1RJYA 2A77H 1DVFC 2YD5A 1MVFA 1G0XA 1CU4H 2ITDA 1QKZH 1H3PH 1R0AL 3HNTL 4ZAKB 1EDQA 3LKSA 4P46D 5BRZE 5I15H 1TENA 2YN5A 4HW6A 2ADGA 4GG6B 1T4KB 2D0HA 3D6GA 5C7XL 2VDOL 5EOCL 3VFPB 1YNLH 5IKCA 2XN9B 1KOAA 1EA9C 4N0YL 1FAIH 4CMHC 4NN6B 3ZYIA 3LEVH 1TETH 4XCNB 2P49B 5E9DA 4RFOL 5B39B 1QO3A 2YEZB 4WFFE 3QXWA 2ENSA 3QIUD 4YHLL 1C5DA 2VR5A 5IM7A 3GIVB 5ALBH 2HFGH 3REWB 3DHMA 1KJVA 2X40A 4P2YA 1IAOA 4KK9D 3BQUD 1P84J 3K2UH 5SX5K 3GHEH 5F7FA 2PETA 1N0XL 3TVMC 3TCLB 3WN5A 5C0AA 4HCRA 2EXWD 1EBPA 2J4WH 2Z93B 5DRNA 2MPAH 4WU7B 4G9FE 3ARVA 5JIHA 2YRPA 2V5RA 1CGSL 1CLYL 3OL2A 5HDOA 4JPVH 4GFTB 1T1YB 4M1CC 4NUJB 5DHVA 3X11A 4PJ8B 4BSWB 3BJLA 4NJAH 1HKFA 4M6OL 1DN0A 4OM1H 4Q97A 2FCBA 3MLVH 3O4LA 1GIGH 4YZFF 3OXSB 4WU7A 1CG9A 4G8IB 2XKNB 5C0GA 2BC4B 1Z9SA 4GG8A 5GRZA 1UYWH 4DK3A 1KEGH 4HUVA 2IFFH 1OAQL 1RU9H 2HT3D 3MV9D 2Q8AH 4LSUH 3D25B 1ZANL 5HI5D 2PYEB 4QRRE 3O9WD 1J5OH 3S5LB 2R1WA 1TITA 3HTLX 4TTDC 1MJ7H 4XNXL 4J6RL 3OXSA 3PWPD 5FO9A 2VE6B 4O4YL 2G60H 5EIIA 1T89A 1ZT4A 4OFIA 4F58H 4CKVX 4EBQL 3C5JA 4PREA 1HZHL 1NAMH 2ZSWA 4LPXA 25C8H 5KJRL 2HA1A 2X89D 3JWNC 1HE7A 3ZHDA 1M6OA 4ZSOA 3IDJB 2VNCA 1DUYB 4U1SA 2XTJE 2B1AH 2BNQD 1JRHH 4R0LA 4P5MB 2H8PB 3T1FB 1ZWIA 1ACYL 4S0SD 5ID1B 4ZO9A 1AXTH 1O7VA 5D2NB 5F9JB 1QSEA 3BD3A 4OT1L 1HHKB 4ZSOE 3MROA 5HHPA 2BVTA 4TVPD 2M2DA 2F9BT 4NQDB 1CVSC 5E8DL 1IGFH 2XQYK 4HK3J 3SGKA 2ATPB 3RWFA 2R2HB 5B38G 4P5MA 4I8DA 3SE9H 3N1QC 4PG9A 4XMLL 1MFNA 4R2GD 4HMDA 2X89A 3SDCD 3FO1B 5BVJA 3G6DH 4HJGA 5TDPB 3DYPA 1MLCB 5ITFA 3CLFL 3S5LG 5CJOL 2NNAB 2R23A 3RTQC 3O8XD 1KJ3H 4XMKL 3BUYA 2HT2D 3MCKB 2CD0A 2YPKA 3H9SD 4RGND 1NSNH 3PGDA 4OCNC 4ZXBB 3L3OB 4M6NL 2VAAA 4FFYL 1RUQL 3ARBC 2PYFA 3CVHA 3DXAB 4PJ9C 3IVKA 2HWZL 4XPBL 4HMEA 4IBLT 2YS4A 4XVJL 3O3EA 3LN4B 3ARFC 4HWUA 3MPCA 4HCRL 4MQSB 3EDJA 5ACZB 4OZ4A 3X14A 3ULUE 4YEEA 2BHUA 3U46A 1GC1C 2OLDA 3FO0H 3GFUA 4Y5VC 1JZ3A 3RY5A 2CUMA 5D1XA 1CGVA 1QYGL 4OF8A 3SQOL 1K6QH 4XP5L 1U41A 3FAWA 5FGRA 1F90L 3G5VA 4ESKA 1T5WA 3MR9B 3E6HB 5B38B 4IRJC 5CBAB 4EUPH 4N1EA 1E28A 5TF0A 1S7RB 3MUY1 4HT1H 2F15A 3F12B 1H3UA 1TJHH 4XCCH 1T03H 3W11D 5E2TH 4WWKB 2ADJB 5EU4B 2YRLA 3GI8H 1OP9A 1KELL 3WNOA 4WDIB 3D3VB 4UBDD 3FAXA 4WEBL 3UZQA 3MLSH 3CFDA 3QG6B 1GOHA 2PXYA 1LO4H 2X4RB 3FJTA 3UTOA 3V6OA 3VFSB 3IAGC 4J1UB 4X6CF 2L4OA 1FO0A 2AK1L 4QHNB 4OGYL 2NXZD 1RUML 1U2HA 1A6AA 2BRQA 2Q7NA 5L7XL 1NBVL 5JLZB 5DK0B 5KANG 2GSGA 1DL7H 1YEEH 2W65B 3O8XC 4Y1AA 5LGHL 2ID5A 4LLDB 5FHAH 1YEIL 2AQ3A 1A14L 3GSXA 2NPLX 5JW4Q 2VQUA 3THML 4JO3H 3KPLA 3BZFA 3MMEB 4R2GC 5JUEH 3X3FH 5JOEA 1X5ZA 4Y4KD 3BMVA 4PLOB 4L3CB 5L2KD 3L5XH 4JQVA 5GPRA 4C58B 5JTWA 4DEPB 1J12A 2G75A 3PWLA 2ERJC 4PJIE 4W6YB 3TH2T 4LLDA 5A43C 4OZIB 2HYMA 2ATKB 1MFCL 1UB6A 1QFUL 4XPBH 4HKJA 4UV4L 3BAEL 5JW4M 1MFDH 4HX1B 3UJJL 1BP3B 5FEBA 3WFCH 4K9EC 4O5LL 4Y4HA 5I18L 3V52H 4JZOA 5F1KC 2G5RA 3I9GL 2CMRH 3GMPB 4N9GB 4U1GB 1T1ZA 1AQDA 2BY0A 4Y5XC 4TVPL 3DGGB 1HKLH 35C8L 1YPZE 5HY9A 2XFXB 1YNTA 2IWGA 4PG2A 1CTNA 3F7YA 2ZNWA 1G6RA 1DBMH 1KENH 2EYRB 2VDMH 4YE4L 5H35B 3WDHA 3CZJA 2QQKL 3L1OL 2BRRL 1JWMB 4QRUA 1RZ8B 4CN1A 2DLFH 1YYLL 3OAYH 3TPUB 1VGKA 1P7HL 1EZVY 1FFPA 1GXEA 3O6FB 4JY5L 5F6HI 3ECBA 3B9KA 3DX9A 2GUOA 3IT8D 2NY5C 3TYFB 3MODL 3IFPB 1NBYB 3K0WA 5DUPH 2HFEA 4K3HA 2VZTA 2B8OT 4EQ2A 1I8KB 1MVUB 4QHLB 1UJ3A 2Z35A 5CKGA 5D4QA 3SDXE 3D85D 2M8XA 1BBJA 4IIQC 1F4HA 4JRYE 1ZT1A 4CNIA 1CS6A 4R4ND 2HFEB 4MD5B 3WSQL 5CKAA 2NY1B 2NY6B 4FQLH 1C5BL 2X1QA 3BH8B 3QO1B 1FG2B 2C3VA 4J2XA 1JWUB 1SBBA 1PKQE 3D0LA 4XMPL 4UZGA 2EXWC 5AD0B 1MCLA 4LVEA 2EIZB 1I8MA 4PUBH 4UT7H 4YHZH 4F57H 2AJ3B 4MAYA 5GGVY 1QR1A 4FFWC 3RWGB 2A1WL 2F5BL 1UWGH 1Y0LB 4C83A 3FQXA 4NRYB 4ZNEE 3EUUA 1PSKH 3QO1A 5LGHH 5GS3A 2X4OA 1M7DB 5FUOH 4HHAB 2R9HC 3VXMB 3MGOB 2YC1B 4NQDE 4MCZA 3O6KL 3UO1L 1MJUL 3HE6B 3RVXD 4PLJC 3F12A 4Q74A 4TUJA 4XRCB 5K9JH 3CX5K 4U0QB 5D2NE 2CKBA 5DURB 4B5EA 3IDNA 1RJYB 4L5FH 1SY6H 1LMKA 3EYSL 3ARGA 5IMMA 1A7PH 3ARBA 3EKCA 1TQCC 3WHE0 5F7HA 2NY7L 3D3VA 4QO1A 1C08A 2C3GA 2QADB 1RIVH 1KNOA 2W9DL 1SEBB 3U30B 4JKWA 5E8EA 5FCUH 1CDBA 3WFCL 5GHWH 2YHGA 2EZ0D 3VDCA 3KPRD 3NIFF 3NZHL 3V6OC 1BHGA 1SBSL 2R1XB 3GMLB 4JFOB 5L0QB 1KEMH 1FZJA 2P45B 5K9OA 1HKLL 35C8H 3VFGH 3AXLB 3SE3C 4LDOB 2LTQC 5KVEH 1PEWA 2BNRB 1A7NL 4MA7H 5EU5A 5SWSE 3AY4A 3K4ZA 2PKDA 4KTDH 2CRMA 3I6LE 4HIJA 4FNLL 5C92A 3ETBF 1YYLH 1D5ZA 1ZA6A 4HJ0D 3IAQA 2X4SB 4FABL 2H3NB 4M5YH 2Y06H 4JCLA 2EEAA 2OS7A 2WWMD 1WSST 4OD2B 5C8JA 4QRPB 3LKPB 1MRDL 5EO9B 3QDJA 2BK8A 4BYHA 4WWKD 5JIPA 5JZ7C 2LE9A 3MTRA 5HGGS 1E0OB 4RIRB 3CZFB 4GRLB 1G9ML 1WBYA 1RK1A 5MEPB 3EJYC 2DMBA 1UCBH 5F9AC 2AJVL 3RDTC 4NZJA 3QUXB 3GSUB 1ZA3B 3PHSA 2XZZA 3M45A 3F6IA 3TYGH 4PLKC 1FBIH 1MI5B 3BT2L 5HSFA 2BXYA 1IT9H 4NOBA 1V7MH 2EH8L 2IADA 3WUWB 1NBZB 1FFRA 4HJJH 5D7LA 3GSNL 4KI5C 4F57L 4YHML 1CGYA 2R29L 2X70A 4JRXE 3NIDF 3ZMRA 3FQUA 4GKSB 2G2RA 3D2UB 4FFWD 4J3OC 1J0JA 2VTFA 3QIBA 1RULH 1U3HB 2VLLA 2VKXA 1W72B 4WI4A 3IXAA 3EOBA 3TZVD 2H2SD 3OKMB 5E4EB 1FL6B 1QRNA 3WLWD 3ZKMD 4EOWH 3REWA 5SX4I 1D9KC 5LXGL 5CLTA 3MXWH 3BDYH 1G7MB 4Z78B 3K2MC 4OLUH 1A22B 1J0ZA 1XH3A 4GW1B 5T1DH 1E4JA 3AVEA 3VRJA 4NCC2 2NY7H 4NZRH 2Y1VA 5J7CC 3MRJB 2XWBB 4LGPB 3S96A 3NCJH 3JSSA 1CFTB 3NPSC 4ODTH 2AI0L 4OFKA 5FAAA 3G5YB 5A16B 5EO1A 3S36L 3BI9X 5I2IB 1A1NB 1GHFL 4P59L 1R6VA 4ENED 1I4FB 1N3NA 5CLWA 3RWCA 4J3TA 1U8JB 4M62H 5EZIH 3T2PA 3L3IA 4K7FA 1CI5A 1CDHA 1EFXB 1SM3L 4BK4A 2F53E 3QJFB 4UU9A 3K80A 4MAYB 3RWFB 4CL7A 5HGAA 1CXFA 1L0QA 5J0BA 5D70H 1H8NA 2ED9A 3KPNB 1D5ZB 4GKNB 2APVA 5BV7L 2BNQB 3F5WA 1I7ZA 3D25A 1Z9LA 4YBQD 2VXTH 2FECL 2YUVA 3VD5A 5F6HJ 2IANA 1WFNA 3X13A 1U8PA 3EYQC 1LWRA 3NGBC 1JHTB 1YECL 5DQDL 5F7EL 2FGWH 4NQCA 3PGDB 3WUWG 4AG4H 4UNVA 2B4CC 2VN4A 2XPGB 4U33A 5HHVL 1VEMA 3VA2C 5KSBA 4HIEA 2BNQA 2Z8WC 3DUHA 3PWPB 4TSCH 4LLVB 3TT3H 3E1F1 1ZHNB 2P8MB 3CDCA 1IM9A 5DLMH 4IIQA 4CDHA 3IGAA 5I1AB 4TQEL 4PTUA 3DURA 4BQ9A 4MGXA 5CBEB 1K8DB 5I75B 4P4KB 5FV1L 4Y4KC 5E8EB 4YZFE 3WIFB 1D7FA 1OOAA 3CUPA 3DTXB 2OSLB 1FGNH 3SKOB 1B4RA 4PGEB 1ND0B 1S5IL 2YPLD 3C9NB 4LCWD 1HEZB 5I1LA 2DD8H 4OCSL 5CGMA 5ALBL 3KPSD 5TE4H 3BISA 5F89B 3KR3H 1Z6JT 3Q0HA 3ZKXC 2ZOKB 4DQOH 5AZEL 1KLGA 3MLXH 5HVHB 1E4XL 2X2YA 4P5TD 4ONHA 4UBDC 3G6AA 4Y5YC 1G7IB 4IOSD 1KPUB 4NQTA 1J1XH 5EIQA 1KCKA 5DZNA 1J88A 5KG9B 1I8LA 4MQ7B 1Q94A 4YHNA 1KPRA 4Z6AT 3PL6B 4UQ3A 5EZJB 1JJUA 4JFDE 4PJEB 4F37F 5IV2B 1JWUA 3BDYL 2YPKB 4U31A 3KWWB 2V2TB 5IOPB 4YQXL 1DANU 4I48A 4M1DH 1I8MB 1V3LA 2DQEL 1ZGLA 2EDNA 1AFVH 2JE8A 3HC0B 3KJ4B 4ZFZA 1GOFA 2NY6D 2NY1D 2BZDA 4NYLA 3DBXA 1MHHB 1Q9KB 3ORJA 1L0XA 3RWHA 3VXSA 1J05A 1WWWX 5FECA 1TTFA 1U8LB 4D0CA 2NY4C 2VXSH 4K94L 1RK0B 2DYPD 3STZA 3OMZA 5D2LE 2GSGB 2WLYA 2QQNH 5J1TC 2NW2B 2YUZA 3PJSB 1NFDA 4JPIB 1EGJA 3C5JB 3ARDA 3D5OF 1CXHA 3RGVC 4YHYC 1YPZB 2VDPH 3GSXB 3LDBB 2A73A 4RMQA 1P69B 1SMOA 4WTWA 3WHE1 1M6OB 4ZSOB 4FRWA 4KROB 4M61B 2B7DT 4K94C 5I73B 3BSZH 3K1DA 4HIHA 5AUMA 4HK0B 2IPUG 3VFNA 1UC6A 4MJ5A 4AEHH 3VFTA 2FHBA 2AK4E 4GMSH 5I66B 1XGYH 1GC1H 4N8CH 3CFDB 5KZCB 1FE8H 1MCHA 1MI5E 2HT2C 1XGPB 1FLTX 4CU7A 3DV6A 2W1NA 3B43A 1KB5A 4Z7VB 4B53A 1B88A 2IBZX 4OZHE 5GRVK 1KCUL 4QRPE 1AXIB 3SBWA 4PP2A 3VXOB 2J8UF 1UM4H 3QZWB 1IEBB 5JOPD 2QR0B 3REVB 3EYQD 1P6AB 1FRGH 5TGBB 4KY1L 4HSQA 2VB5A 4DQOL 4Y1AB 4FQ1L 1RZIA 4KKBC 4UB0H 3FN0L 5C6TH 5JO5A 4GMTL 4KMTL 5CIPH 4LDLB 4CU6A 3HZKA 3H6JA 5DJ0A 3O3EB 2IAMB 3FQTB 3BW9A 4JRXD 4TPRH 3H8NA 2X1XR 2ZG1A 4LCIH 2EXYC 1AE6L 3ARSA 1ORQA 3MV9B 2WSKA 4TRPL 3ALPA 3RWEA 1I9JH 3W0WA 4Z5RA 4OZGA 1WZLA 9CGTA 1BQLH 3LKRA 3BZ4A 4J8RB 4M43H 1PFCA 4PB0H 2Z8VC 4AH2B 1KIRB 4KUZH 5E5MB 1ZHLA 4AQ1B 4C56D 1I9RL 1RZFH 2ZCLH 5DRXA 4EI5D 4I4WB 1EO7A 5DMGC 1G7HA 1GH7A 2E6PA 4YXKL 1X5GA 3TVMA 2OBGA 3P77B 4U1JB 2XFXA 2CR6A 3OXRB 5J13C 4YDJB 3MV7D 5I76B 5KANI 4M6NH 4OGXH 1MY7A 5E2TL 1YMHB 2XKSA 4LVNC 4X7TB 1ZHLB 4X9HA 5D7JB 4AM0B 2VZSA 3DPBA 1XF5B 5MP6H 4CRPA 1G7HB 2HJKA 2DLIA 4WEMB 3PHOA 5F1OB 5LG1A 4QRQB 3SJVA 4PRDB 4PJ7E 3H0TB 1INDH 4J3WA 3RVTC 4MA1C 4MAUL 3GB7A 1I8LC 4MQTB 5TH2B 4KRPC 1ZEAL 4M1GL 4I18A 1JGDB 2R0KH 3SDDC 4DCQA 5FIEA 4LLMB 4M8QB 2J7LA 1JZ7A 2D7OA 3GUTA 3QCTL 4JAMA 5IVXB 3ILPA 1BD2B 3FCTA 4F80A 4OV6F 4AT6A 3BZEA 3HRZB 3T0EE 3MO1B 5ENWA 1U93B 2JELH 5HGBB 3PDDA 4HKBA 1KC5L 3LEXB 5IBTH 3QNXA 1CXKA 5H94B 4KKAD 1YN7B 4OCWH 3QRFM 2X4UB 4KRLB 2JCCE 3O8XB 4JDVA 1T7YA 3MO1A 5I1DA 3EO9L 3V8CA 5I15L 2XACC 3VH8A 1TPXB 2DL2A 3RL1A 1NDGB 4UV4H 2W0PA 1WITA 4UDTB 4P3DA 4GT7A 4IJ3C 1U91B 2KKQA 1E4WL 1FORH 2JJWA 2QBWA 4Y4HB 3V9FA 4TPRL 3E2HC 1OARH 4LCIL 2AKRB 3F62A 5D7KE 5J11C 3VFTB 4DN4H 1UGNA 5DXWA 3I9GH 4Z7WB 1GGIH 4HAGA 4LGSB 1ZT7A 3BVNA 4WI5A 4PJGF 3FHAA 3OSKA 1NGZB 4WTZA 4CJ1A 5KSVA 3MV8E 4WW2B 1DFBH 1WEJL 3B8SA 2NXYB 3FMGL 3ARUA 5ETUB 4HUKB 5F93C 4K7PL 2RGSA 3P30L 1KB5B 4HGWA 1BIIA 3SJVD 4KJPC 1HHHB 1IAOB 3V4VL 2GJ6B 4WI6A 2D7QA 3H3BC 3MYZA 2Q86B 5FYKD 2JCCF 3QG7L 4JFFD 3O2WL 5I1IH 3KYMB 4WHTA 4GSDH 2LU3A 4LLQB 4GQ9L 3WNLA 3L3GB 3LKOA 3S3JA 3SO3C 1KBGH 1SQ2N 4NNPL 1MWAL 3OKLB 4U1GC 5C0CB 1NCWL 4JM2F 4NUJA 5TPWL 1MIEL 2XRAL 3U82B 4EKXA 3VE0B 4DFIA 3MJGX 3O3UN 3O3BB 3C5ZB 1CFVH 4YDIL 3HZVB 1MH5B 4X98B 5I1HL 4BH8A 2EECA 4IMLA 2FEEI 2PTTB 1D9KD 1NCAL 3IDGA 4G6MH 4YHIA 4HLZH 3GMOB 4NQXB 3GIZL 1ZSDB 1LK2A 1N8ZA 1PSKL 4WV1C 3TP4A 3X17A 2C1OA 4P2QE 5BZWA 2IH1A 4KKCC 3BJ91 4Z7OE 3U0WH 3JUZA 5E2UH 2R2BA 1CICB 4DAGH 2A6IA 4UOW0 4QHKI 5DEFA 1KCVH 3ZL4H 3H7BB 4ZS6D 4F7MA 3NFSL 1AR2A 2K7PA 5IB2A 2YRZA 4ETYA 3GSVB 1FSKC 3CSGA 3QIBB 1QACA 1J0YA 3AMLA 3A6CL 3TO2A 2GT9B 3ARWA 4XXCC 5L8LB 4JZJA 3GSOB 3HG1E 1Y6MR 4G5ZH 2JB5L 4OJFH 4QXUL 4XMPH 3BEVA 1DQLH 3RAJL 3NIFE 4BK5A 2GSIA 4HIEB 4JGJA 2X6MA 3P4NB 2FEDD 1SYSA 3MLUL 4OCMC 3A67L 3JTTB 4HJ0C 1U8HA 1YEKH 4XBEH 1QHOA 4K23H 2ZP0T 2DIJA 7CGTA 1UWGL 2OI9C 3VFGL 2CUHA 4GXUM 3FT4A 3KYNB 4QY8A 1BQHB 1HXMB 2J8UA 1PY4A 1IGML 3CC5B 4N5ED 1HYSD 5DS8A 5HHOB 5FO7A 3MV7B 1UCTA 2MTPA 1ND0A 1MF2L 1OB1A 2X1WL 5GS0L 5JW5B 2GJ6A 3IU4L 1BEYL 4JANA 5DMIL 5IMKA 2CQVA 5ADOH 2NTFB 4K2UH 1N5AA 5DDHB 3KPSA 1BZQK 2YPLB 3SGJA 3KJ6H 5BQ7B 3OX8B 5TE6L 4I1NB 4PLNC 3V4PL 1CF8H 5D8JL 3LN4A 3T04D 1IAMA 3GJFB 4HFWB 1JPFB 4UT6L 1I7ZB 4LCYA 1Z2KA 5FB8B 2D9CA 3P0YH 1EO8H 1V3JA 2O5YL 3GSUA 3QUMH 5DEGA 3RWIB 3WHXB 5LWYL 4MQ7A 15C8L 1MREL 4TUKL 4HBQA 2BSTB 1CFSB 5L0QC 1CD1B 1KEML 3LN5B 4Q6IA 4APQD 2CLRA 3FRPA 5FM5M 3RVWC 3GRWH 3UC0H 3UBXI 3O3AB 3MRPA 3EO1B 5D1QB 1NJ9B 1CFQA 3LH2H 3NA4A 2ESVA 4XB7A 5HYFA 4X4YB 2YOCA 3NTCL 2GK2A 2L0DA 1RSFA 4YJZL 4HH9B 3PIQA 1DBKL 2GTWB 3U4EA 1BLNA 4M4PA 2W38A 4A2LA 3EDDA 5IVZA 5C09D 1BQHG 5C0BE 4HT1L 1GSMA 4G6ML 1MCSA 3MRQA 3PDGA 3BRGC 3U6RA 1WZ1H 2FEEL 5FA4B 1BECA 3QUMB 4ZNEA 4DTGL 5EFIA 2FGZA 3HNTH 2VITA 2X44D 1HHKA 4KDTA 1R3JA 2P4AB 1HH6A 3FB5A 4YXHL 5FO8B 3P73B 2YA2A 1XIWD 3NFSH 2NY0D 2VLKD 4NDMA 3STLB 4JHWL 2Z31C 4M7KL 2HN7A 3X12B 1I3RA 4G9DB 4X9FA 4AK1A 3ARXA 4R26L 2VITB 1J8HD 2EKSB 3O6LL 1N7MH 6FABH 1RUMH 1PKOA 1P1ZA 4XP6H 4KZDL 4IRZH 4MJ4A 1MNUL 3B2UC 4EN3B 3IB4A 3WUZA 3I6KA 1GHFH 3CFEB 2VDLL 4OB5H 3OBAA 5JDSA 1KJ2H 4G6KH 4M7LL 5FV2A 1XR8B 3LZFH 1CICD 4YO0A 2H32H 5D6DC 5HGAB 1HXYB 3U2SB 1F4WL 1JPSL 1FL5A 1IGMH 1NDMA 3MMEA 4LBEA 5CMAA 4LF3A 3HZMB 1RZKC 1I1YB 2F8OA 2IPTL 1AP2A 3AFLA 4I2XA 1S9YA 5DQ9B 4QLRA 1NCUA 1QFWI 4JPVL 2J8OA 4RWYH 1BEYH 5C0FA 3TT1H 3C5SB 4MJIA 4OUUB 2A0LD 3R4DA 5JHDA 2OR9H 3MLPA 4FP8L 4QWWD 5IB3A 3QCUL 1G6RL 1EAJA 5IJKA 2XWJB 4X5XB 3GM8A 1UB6B 4LCYB 3QSKB 5AWNH 3VU2A 2W07A 2D31B 3IFLH 2E6JA 4MD0A 1L9MA 1OW0A 1CFSA 1WIPA 1MCIA 2Q8AL 1VERA 3INUH 3MRNB 4NJ9H 1EXUB 1LO5B 4N9GA 3VFVB 4CAGA 2CLVA 3EJZD 4Y16D 4U1NA 1OD7A 2WBJD 5BRZB 4O58H 4N8VA 2LABA 3TJEH 4HS3B 4LQFL 3FONA 4XPGH 4PGCB 4WHYH 4WI7A 1LP9E 3HLAA 2VLKA 2DJSA 2W0KA 4AEEA 3WFDL 4CBPA 25C8L 5IIEB 1P4BH 1OY3B 3QUMA 4LLQA 3RUGF 5HHMB 1LD9A 1JCKA 1U8NA 5I19L 4JG0H 3HI6L 4Q0XH 3UJTL 1FO0B 1T22B 4KK5D 3QXVA 1KN4H 3MNVA 3MJ8A 2EC9U 5KG9A 1YEGH 4R96B 2X5PA 1K4DA 4PGDA 3OKYA 4LDEB 3RIFK 1NMCC 4DN3H 4YXHH 5CJQH 1OF2A 4IEFB 1WZMA 2A83B 3MRGA 5DJ2A 3SGJC 4DVRH 1OQOA 2Z91B 4JFFE 5SX5H 2BSSA 2EDKA 3MRIA 2VH5L 5KS9F 4ELKB 5EU7C 2DQEH 4ZFZB 1YJDL 1JNLH 1MNUH 1YEFL 4I0PA 1DBBL 4JKKA 2IPKA 4PRHB 4Q6IB 2AJ3A 4WENB 1IRAY 2LU7A 2ZUTA 1S9WB 1DQJB 4F7TA 1DVFA 3IU3B 2D9QB 5DJXA 3AREA 2YD1A 1GRWA 3NCYS 3W2DH 1R5WB 3B6SA 4QOKD 3KPTA 5IR1A 5EBWA 4MMXC 1MLBB 3MFFA 1XR9A 2IPKB 3BD5A 3WMSA 2PR4L 3HHRB 3MCLH 1ORSA 1D9KA 5DD1L 5MHSD 3VXUB 4Y8AA 2PW2A 3MXVL 1U42A 1XIWB 4U1LB 3QDMB 5J1SC 3T4YA 2ZSWB 4QXGH 5C0RH 2RHEA 3CVHL 4OFDA 4U1SB 4DZBB 2AV1A 3CD4A 4UUJB 5I1GH 5IQ9B 4RGMC 3R8BB 2FO1A 4ZFGL 2MQ0A 3QQ9D 1L9NA 3QDMA 5L2KB 4ZFFB 5DMKB 3D39D 5D2LB 3IFPA 1I7UB 1QG3A 4NJ9L 3HS0B 5D93C 4AL8H 3GMRA 1F5WA 1B0GB 5FOBA 5F7NC 2DQCL 3IKKA 2WBWB 4ALAH 2AJXL 4H88L 2QSCL 4ZFFA 4WW2A 1KELH 4HIJB 1IAIL 1NAKL 4OCYL 4ZD3L 3RTQD 4NO0D 2ITDB 3PGFL 1NUDA 5IROA 1LE9A 3BZDA 5IFHL 4L9LA 2CDGB 1URLA 4KC3B 3PNWB 4NIKB 1P4LA 4BELD 2X05A 1V7NH 1H3VA 2HVKB 2BERA 3TNMA 3U36B 5J9PA 3MRGB 4LSRH 1HHIA 5KS9A 2EC9T 4Y5YB 3GHBH 3DSFH 4HEPG 5EN2A 5FA3A 2FLRT 1JZ6A 1JGLH 1OTTD 4P2OC 1I9JL 3BGFB 3MBED 1VESA 3PNWA 5IW1A 4OCLC 5FKPB 3QAZC 4UDTA 4S0TD 3WUWA 2D0GA 5E8OB 3T8XA 1GPOH 3BKYH 4POUB 5JPNB 2R29H 1KJVB 4NBXB 4Y1AD 4RZCA 1VACA 2HT3C 5E99L 1HCVA 3WNNA 5DVKA 4YXKH 1R0AH 2R0WL 5KSUB 1C12A 3ULUC 5SV3A 2XKUA 5E56A 5HHNA 1T5XA 3PDOA 2E9WA 5F88A 4QTIL 2FWOA 1M7XA 2PW2B 4DGVH 4FQIH 5HYSG 4UOW1 1QEWA 3QUKB 3P11H 3RY6A 4OFVA 3EBAA 4YDVB 5E8NB 4JFHE 3VXTB 3HZYA 2NW3A 1A7QL 4AIZA 1WFUA 2FX9L 1YMME 5T5FH 2XNAB 3FFCD 3N85L 3P9MA 2VXUH 5INCA 1BJMA 4ONGH 2YWYA 4DGIH 2WANA 4JO3L 4ZUUA 5GS2D 2F53B 5D1ZD 2Y7QA 1EV2E 5EA0L 1RZFL 5K9KA 2ZG2A 1NUFA 3QQ3A 2LV4A 4M02A 3NAAH 3QPQD 5EWIL 2BFVL 3LV3A 1WICA 2DQUH 1EFXA 1JK8A 1MFCH 4HZLB 5CHNA 2R0ZL 2ESVD 1CGSH 1CLYH 3V0VB 4P0DA 5HDLA 3VI4F 3DJ9A 1DQDH 5DHYB 2H6PA 1R3HA 3ZTNH 1FNHA 2F5AH 3HB3D 1Z5LA 4JQIH 3VWJD 5LVEA 1X4ZA 4R8WL 5BS0A 1GIGL 4I13B 4ISVB 1LP9B 1OAUH 4WWKC 1FV1A 5JZ7D 2ICEA 4RNRA 1H15A 1OAYH 2ZKHH 3GIVA 4XI5D 3WV0A 3GO1L 4JO1L 3OB8A 4L8SA 5GS1A 4X4XB 2FATL 2Z8RA 1OTTC 4P2OD 1MCPH 1FIGH 5E7BA 4DFHA 4YHZL 3WXWH 5BRZA 3GSWA 2EICA 4OTXL 4E0RA 3LIZL 1WTLA 5FYKU 3ULUF 4PG9B 1OGTB 2B5IB 3SCMD 4Y2DB 1P7QD 4MX7B 4JFPA 4PRNB 4H26B 3SBWC 5I8CB 2E9JA 3FMGH 2BSRA 3MLTA 1I3GL 1F11A 2CRYA 3AREC 3L7EB 1TZIB 3U7AA 2BOBB 1VGKB 2WINA 5JXEA 4N68A 5HI4D 2QEJA 1P9MA 2YN3A 4ONHB 3QULB 4Z7UB 3MV7A 4KXZI 2NXYC 1RIVL 3L3GA 1YQVH 3MRIB 3QO0A 3JV5A 3QUKA 2AJZB 3QEQA 1XGRB 4X8JA 2ZCKH 3I2CL 5MERB 2BP3A 5HHQA 4MWFA 3EIFA 2R69H 2IAMD 2Q20A 3BIBX 5BQ7A 4PPTA 4Z95H 2N1KA 3P9WB 5DJCB 2COQA 3WYRA 1A7NH 4UTBL 5EPMB 1CLCA 1JPFA 4HFWA 4MNHB 1LEIA 2UZIH 1MCEA 1DFBL 1WEJH 1YDPA 1ACZA 3TESA 1ZHBA 1VPOL 4MJ6A 5GSRB 3FQWB 3FO9B 1BAFL 4TNWF 1CG9B 1FYTD 5E8OA 3T8XB 1FNAA 4IDLA 3WXVL 2ICES 5ISZD 4Y5XB 1Y0LA 2HWZH 2IH1B 1ZTXL 5GJSH 2K9UA 4F8QA 2R0ZH 1ZKAA 4P46B 1J8HE 3OAUL 1YDPB 2CDEB 4S11A 3S35X 5E4IA 1K8DA 4V1DA 1ZLSH 4QHMB 4PJXA 4JG1H 4KQ3L 3SO3B 1ES0B 1G6VK 3BH9B 3W9DA 1RZ7L 2CK2A 1KIUA 1HILA 4LAQL 1KFAH 4S1SH 3GJFH 2A6DA 5F7DB 4F9PA 1H5BB 4NO2A 3I50H 2BNUA 1GC1L 4LHUG 3RWJB 4OLVL 3AM8A 2PYEE 4QRRB 5GGTL 1WV7T 1KYOJ 2FZ3A 4AEIH 3TO4A 5I1HH 1OT1A 4J3UA 2H8PA 3T1FA 4WCYL 1N64H 3KS0H 4M93B 2WUBL 3IKCB 4QGTA 2DDQL 3W9EB 2Q1EA 4RFNB 4U6TA 3IVKB 4BSVA 3DO7A 4QYOB 5D2LF 3F7QA 5E9DD 4TNVK 1NMBH 3WJJC 4JKPH 3QDGA 5FCSH 4P9HH 3L5XL 1MUJB 4UMGA 1P84K 3C6LC 4HS3A 1KCLA 1Q8MA 4XPFH 1BJ1H 3QZWA 5B3JE 4MNQB 3FN0H 2WAHA 1GYAA 1T20A 4KMTH 3MUHL 4HJGB 3TIEA 4LARL 4P2QB 4XP9H 2UWEF 4FQ2H 3LEVL 3S3PA 1A3LH 4JFED 4C4KO 1HWHB 4KRPD 3ULVC 3G08B 4GAGH 4X7SH 4L8DA 4ODUB 5DD6B 4PJ5A 4WW2F 4HIIB 3H42H 4LHUA 4FFZH 3ZE1E 5ELIA 3FZUC 2L7JA 1K5NB 2XN9E 2RFXB 1QPXA 5LAXA 4MCYB 4KQ4L 5EH1A 4X9BA 1YEIH 1QR4A 1FZKA 3U83A 1A02N 4RDQG 1BFVL 2M1KA 2BCKB 2G5BA 3LVEA 5F3BA 3TM6A 1LE5A 1BZ9B 3KPRA 2UZIL 2HFFA 1C16A 5KOMC 1ZLVH 2MPAL 2JCCA 3U30C 3FQWA 4EI5B 3RX7A 5GS0H 2AV7A 1LHZA 4PP1C 1TZGL 2H2PC 3MXWL 2H26A 3EO0A 5DT1L 5A2IH 3BQUA 1VDGA 3E6FA 5HTSA 5DD3L 2EDOA 2Y25A 2LTQB 3OJ2C 5KVGL 5C0ND 4XWGL 3SKNB 4QNPE 3EZJB 3WN5B 2KBGA 2UVEA 5GISH 3WIHA 5I9QB 4E42A 5M95B 4O2CB 5IHUH 5LWYH 3K4DA 4ODSL 1INDL 2Q7YB 4JRXB 1QLRA 5MEQA 4AENB 3EYUH 4WWKA 3E6FB 1DBML 1H5BA 4MNGA 1T22A 1T21A 4QRRA 4YHOH 4R6UA 1I7RB 3N1FC 3QUZD 4M7ZC 1PX4A 5I17A 1AH1A 2QR0A 3REVA 3V0AC 4GRWH 1Q1JL 4BZ2L 5C0GB 1J86A 2F54D 1UWEL 4JHZA 1JK8B 1T1WB 3UBXA 4LLWA 1I8IB 3TC9A 3KPPB 3SKMB 4OCRL 5FGBC 4BSVB 3DO7B 4KMQA 1U92A 2YPVH 1XEDA 3HZKB 4DTGH 1A4KB 3BP6A 5EC2B 3U1SL 3TJHC 1J18A 5JQ6L 2B1AL 1WFOA 3DXAD 1B0GA 5FOBB 1ZHKA 2EC8A 4P23A 4NKOA 4CN6A 5CEZL 4M9OA 1T83A 2ICEB 2CK0H 1VFAB 5FUCC 2XY2A 4F8TA 1JYVA 1FNFA 5JOFA 4OLWH 3PQYB 3DUSA 4P2QA 1E27A 4J3XA 2UUDH 3M1BA 5GZNC 4KVNH 4XP9L 4Z7UE 3FB6A 1ZMYA 1D3CA 1W0YT 5DVLA 1KNOB 4KXZH 5IB1B 1U8KA 4PJXF 5EUKB 5HYSA 5KAQG 3MC0A 4LEXL 4NQSB 1J1PL 1MRFH 5F3HB 4Z76A 4APQC 5C0CD 4X6CE 3ZKQD 4RBPK 5ANMB 1A6UL 4HUWA 4U3HA 1SJVA 4U1MB 3FOLB 5HYJB 3VJ6B 2CDFB 1TQCB 3RKDC 3QHTC 2XWTA 3QXTA 3V5KA 2JLLA 4GBXA 1VENA 2ATPA 1F6AB 3U7YL 5C0AB 1J11A 1S7RA 1S78C 3RZCC 2NY3D 1AGBB 3MLWH 4YDLC 1RI8A 1E6JL 1EMTH 2RCSH 2VC2H 3MLRH 1ZGLM 1SY6L 3SJVB 1JV5B 3BQUB 2AABL 1BX2A 2HRPH 3KXFE 2KPNA 3QB7C 1N59B 2DIBA 3VXQA 4XPHH 1FZMA 1K6QL 1E6OH 4PRPE 4PJFF 1NGYB 2P8LA 4GMSL 2FWOB 3C08L 1A3RL 4L4VD 1INEH 3DVGB 3T0EB 3QHFL 5LQBH 3HB3C 3VWJC 1FBIL 4PJ5E 3LKNA 1U95B 5GRXG 4QHLA 5AYUL 5E9DE 1JWSB 2EDYA 3KDMB 4POZD 1X5KA 3ARDD 5IMOA 5JXAH 4L4TD 4JPKH 4A6YL 3BO8A 4K3EL 2VDPL 4LQFH 2OXHA 2EDRA 3QA3B 3T0ED 1FCCA 4XP1H 1UWEH 4B50A 1VEOA 1DBAL 1FPTL 1KTDB 4EUPA 3ARGB 4Q9CA 4JCMA 5IMMB 3SDAD 3MZTA 4FS0A 4WEBH 4Y4KB 4L3EA 3W2DL 2NY5L 3LQZA 4BA8A 3VXSD 5IR1B 2KQMA 5KSAB 3SDXB 3BEWB 1VADA 5J06A 4PGJA 5IVOA 4S1DC 5AAWA 2RR3A 5JORB 4JPIA 4Y4FB 4YAQB 3MNWB 3VGGA 2I25N 4UAOB 4BZ1L 1IGIH 2R2BB 5A2KH 1NC4A 3WFEH 4X80L 4KI5F 5IJVA 2A6JB 1SJHB 4S2SA 5I8KH 2ADIB 3AGVA 4Z18A 2V2XB 4O2CA 5CEXB 2J6EH 4KTEL 5C0DA 1BQLL 5IESL 5F3HA 1PY9A 5ERWB 1A6VH 2CGRL 2FHCA 3GSNH 3BGMB 1NGXB 3GMQB 3L5WB 1KCUH 2GSIB 1I4FA 3ULSA 1TLKA 5D5MF 2Q76B 5D6DA 4ORGA 5T5NG 4C4KT 1KJ2B 5DFTA 4Z7QE 3WE6B 3ARDC 4WW1B 3CH8A 1LNUB 5IM7B 1WWCA 4ZUUB 3LKOB 5FK9B 2E7LA 1IC7H 2EE6A 1HSBA 4KJPD 2CPCA 5F7LB 3TPKA 4DUWA 3CDYA 4AZ8A 5FUZL 4P99A 1N6VA 3G6JE 3PABA 3CH1A 1AIFB 5J1AA 2BOBA 1ZHKB 2OR7A 2FJHB 2PTUA 1Q9WB 4PBWD 1S7UA 4U6XA 4KUCD 1LNUA 4I2XE 2R0LL 1ZHNA 2P8MA 3S36H 4BH8B 4GAFB 4YHYB 4RMUA 1R3LB 4P59H 3T0BA 3T0EA 2YUWA 3ARQA 4LSRL 4URTB 2QQKH 3FB6B 2APWA 3DURB 3QDJE 1N8ZB 2AXFB 3QCTH 4F15B 2MNUA 3CXHK 2FD6L 2PW1B 2Q6WB 5FECB 4X6CA 1A7RH 4YC2C 4JY5H 3HMXL 4KKNA 1RVFL 3FQRB 1ZVYA 4RMTA 4B7LA 2MQCA 2AEIT 1A6TB 2BVOA 2DLTA 2V2WA 1KC5H 1P7KA 4I0PC 5DVOA 4L3AA 1TVBB 4YX2H 3K3QA 4P23D 1LK3H 3HKFA 4RMRA 5F89A 5GGRB 4EDXA 3LD8C 4PJFA 5EC1A 1C12B 4P2OB 4X6CB 4LK4A 2FECI 1ZS8B 1RIUL 1F97A 4C59B 1DDHB 3ECBB 3HFML 5F6IC 3CFKB 2UY7A 1P7KB 3TYFA 4JO2H 2AK4D 3S88L 5A16A 3IF1B 4H0IA 4PREB 1IL1B 4PJ5D 2IGFL 1V7NL 2BY3A 4Y4FC 2BMKA 4PJEA 5IV2A 5H37H 4YK4C 4PJGE 1C5CH 3BP5B 1KJMA 1F02I 3BWAB 4NN5C 2FDBP 4NNYB 2DM2A 1FNEB 4BQCA 2OTUA 1BVKA 3D1MC 2JK5B 1ED3A 3PWPE 3PHOB 4HQQL 2BDNL 4YWGH 3RNKB 1CBVL 2IAMC 3RKPA 3W82A 5HD8C 4G7VH 4HPOH 4LCCB 1G7MA 4OF3A 4H20H 1NCDL 3GB7B 5IBTL 4Z7VE 4D0DB 1XGRA 2WWMC 3S37H 1P2CB 1MJUH 4N0UE 2NTFA 5E08H 4PJ7A 4O02H 3QUYC 1F4WH 1JHTA 1GGUA 2XTJB 1HXYA 3U2SA 1EJ6A 4MA3A 4N8VG 3IS0X 4YO0B 5IFAH 4WW1A 1XCTA 5L9DL 2DQUL 3OF6D 3BPCB 1JZ5A 1FN4B 4X6DE 5HBBA 5B8CC 3DIFA 4XVUD 1CGTA 3RWCB 4ZMAT 3IDMB 5I1AA 2I26N 4OZFB 2D7TL 2FBJH 1AGDB 3SE4C 3T2OA 1EEYA 4PJAB 3QJFA 5IVNA 3T0DA 4I3RH 4K3JH 4TSBH 2AEPL 4FZEH 4NQSA 4PJ8C 5ID0B 4Y5XA 1FLRH 1SY6A 5C0FB 4LSQH 1JPTH 3N50A 1T80A 5J3HC 2DQGL 4LSTH 3SCMC 5BV7C 2NY2D 1IC4H 1IQWH 3QUXA 4DGYH 1ZLVK 1FE8L 2DQIL 4GXUN 3BKMH 4L29B 1MI5A 5IGXL 4PGZA 1KLUB 4X6BB 4TVSa 4RMVA 2FD6H 3QWOA 3DX6B 4CVUA 1CDJA 1IAII 3QP3A 3O4OB 3JV6A 4DOHB 1NAMB 1MELA 2MFNA 3HC3L 4PLJD 3V7AE 5DUBA 2LVEA 4KHTH 1HHJA 4LLAA 3NH7H 4ZFOA 1L0YA 1RZGB 3O3DA 3PGCB 3ZE0F 1JF1B 1C7TA 3DV4B 4E9LA 1CCZA 4NZUH 1EAPA 1MCNA 4DW2L 2EDJA 1QBML 4A6YA 3KHQA 5IROC 5TF1L 2QHRL 4KUCF 5EOQL 2HJKB 3EFDL 3NACH 1MPAH 3C9NA 4U0RC 2XXMB 2DWDA 1ZLUH 3TYGL 5D71L 3S36X 1B4JH 4Y88A 2FX7L 1LO3L 4F33B 5C9JB 4OM0H 5BJTA 1F58L 1CXEA 1EAPB 2VDRH 3V6ZA 1K4DB 5DQJA 1JI2A 1FIGL 1WBYB 2Z91A 4ZS7H 4FQHA 3NFNB 1JHLH 3RNKA 2KZ1B 3CLEH 4M43L 4NC2B 4LSSH 1ZA3A 4AENA 2Z4QB 5BO1H 4UILH 5KVDH 5JUEL 2XZCH 3X14B 4OLYH 3X3FL 1I7RA 4KKLD 1MAJA 5J11B 1JZ4A 2NQCA 4WHCA 4F3FA 2QQQA 3KYAA 1I3GH 4IS6B 5DRXB 3VFUA 4ZXBC 1UJTA 1U58A 3QIUA 5J12C 1SJEB 4EN3D 4UIMB 5FYLL 4WJ5A 2FJFA 4YLQT 1WBXA 3D18B 2G5BB 1MOEA 1ZSDA 4NQVA 3QH3B 2DLGA 5T1DL 4O2FB 1IVLA 4W4NA 3VXSB 2PO6B 1A6WL 3SKJL 4Z0XA 1AR1D 2FJGB 4MD0B 3LHPH 5D8JH 4O5LH 2JB5H 2Z31D 4OGZA 4CVZA 4JPWH 3SDYL 1V3KA 2AI0H 3UDWA 3L5IA 1P5VA 3RY6C 3BKCL 1XIWA 2ZCKL 3FQXB 2RBLA 1JPST 1BM3L 1YPZA 1Z9MA 1JPTL 2E3VA 3WO4C 2MJWA 2YUXA 3TBVB 4M62L 3SCMB 5BV7B 3ZDZE 2IH3A 1WCQA 4F7EA 3AY4C 5AG9A 1UVQA 2FX8L 1WWAX 3S96B 4YEFA 3IS1X 1FGVL 5KVFH 1J5OL 3UTSB 4PJDF 4WV1A 5JO5B 3NCYP 5C0NC 1BAFH 2ZUQB 3GBNL 3BX7C 1BFOA 4FXKB 4JM4L 1RFDL 1RZKL 5C3LD 1LP9F 2BNRD 1HZHH 2BVPA 3DVFA 4ZXBD 3FO2B 1P5UA 2X4UA 4RIRA 3UBXB 3MRBB 2JJUA 3VFMA 5I8EB 3BRFA 1R3IH 4QXTB 1I9IH 3GGWA 4R4FH 1QVOB 3MUGA 4OLXL 3BIKB 4CW1A 3O41B 4FQCL 1EEYB 4PJAA 5ALCH 1UT9A 3IXTB 4MXQC 5SWSB 3ESVF 1F58H 1I3UA 2VOTA 2IADB 2P8LB 5C07E 5EDXA 4EI6A 2P5EE 3QNZB 4NQDD 3GJFA 4WI3A 2EH7L 2XIDA 3Q5YA 1U6AH 1KIPB 2F74A 2WBJC 3IGAB 5DJZB 1PKQB 4YDKH 3D39A 4M93C 4HX1A 4FTVA 3UX9B 2WWKO 1MHHA 1NGZA 4R2GB 5EO9A 2FIKA 1CLZH 4LASL 2BVYA 3VDBA 5T3ZE 2ADGB 5IEKB 1DANT 2EIBA 3IXAB 3VXUA 5IEHA 1NMBL 2N56A 3QIWD 3JV6B 4K71B 4WUKL 4TUOA 4R4BB 1T0MB 1GZQB 3SGDH 1KIPA 3QG7H 1D6EA 3AAZA 4OIBA 3CIQA 3HI1A 2UVFA 5CILH 1XCQB 3UROR 4MDJA 3FT3B 2ARJB 4IHOA 2UZXB 1S7XA 3CDFA 3ILQC 1CIDA 4H5SB 4NFBA 5TDOB 3G5XB 1DQQA 3RPKA 1J0KA 3WL9A 4EI5C 1D5BB 3IFLL 4EDWH 4KDVA 4PRIE 1EUTA 1Q94B 4YHNB 4UDUB 5DZOA 2ICWB 4F9PC 5CJXC 3SCMA 2VXSL 1A5FH 4K94H 5LGKA 3WO4B 3QUYA 1MAKA 4UT9H 3VXQB 4TTGA 1JNNH 3ELAT 3QISA 2XY1A 4X6EA 5EO0B 3OAZH 3QFJB 1KTLB 1A7OH 4JY6B 3L3JB 3SE8L 2Z4QA 1VCAA 5DJYA 3U48A 4GW5A 5IVXF 1FN4A 3A6BH 4Z78A 5DURD 1Y18A 1BFOB 1PZ5A 3VG0L 1S7QA 5C0IA 3SE4A 2W91A 4KK5C 3QQ3B 1AJ7L 3MOAH 4OIIH 3S35H 1I1AB 2KH2B 4ERSL 1U91A 1HINH 4OUOA 3V6FB 2X9YA 1SJEA 1YC8A 3MREB 4C83B 1WC7A 3GSQA 1OHQA 2P46B 2A74B 1J0IA 4HWZA 5AWNL 5JA8B 3QYCA 4R0LC 5AZ2L 4I0KA 4ODSH 1NCWH 2VDQH 2W59A 5DC9B 4OJFL 2HLAA 1DSFL 4DZ8A 5BVPH 1AIFA 3INUL 3JWOC 1U8KB 3M8OL 4GH7B 5EUKA 4WI2A 5IBUB 5HYSB 3V6FA 1G7QB 3UPRB 4YHKL 4X4ME 3IJHB 5IB3B 1RK1B 3A67H 5D96C 1QSEE 1YEKL 4XBEL 5I1DB 3E3QC 3DVIA 4OTXH 4X5XA 1U8HB 4JFZH 4MQXC 1QFWL 5H35A 4E0RB 2CDFA 2K7QA 3RGHA 3W39B 5FHAL 1JFQL 2UUDK 1T5XB 1IGJB 2OZ4A 4X6DA 1IQDA 3WFHB 4EUPG 4WU5A 1HIMH 4QT5A 5HGHA 2IQAB 3WJJA 3CK0L 4K3DL 5E9DB 4Q0XL 2UWEB 3OHXA 2FBOJ 4APQB 5CZVL 4MD4A 2GUOB 3G04B 1KCVL 4U1NB 4GUPB 1CDCA 2GK0B 3AB0B 3GKWL 4OFYD 1KSRA 4PJIB 2BNRA 1N5AB 5KSVB 3HNSL 4OV5A 1ZXQA 5I71C 4LIQH 2OSLA 1YYML 1N5YH 3FO1A 3CFKA 2EKSA 5TDPA 5I1KL 2N7BA 2NY4D 3AC0A 4M7JL 4ZODA 1MRFL 4XCYB 3BH8A 4M48L 3CFCH 3LB6C 3ULUL 4K8RH 2B39A 2AJZA 5TH2A 2BSTA 4XI5C 2H9GB 4LOUC 4XNQB 2XKNA 5D9SA 2DLEA 2P8PA 3D0VA 2BRRH 3OKOA 5T3ZH 3ZTJH 2A9NH 1RUKH 1XGQB 2ZJSH 4EXKA 4LCCA 5DJZA 5E0QA 1QNZL 5TQ2L 4PRPD 2A73B 2XI9A 3U46B 5IEKA 3SDXA 3PGFH 4NKMA 3KJ6L 5F97E 4F7PA 4MJIB 2P5WE 4JZJB 4MNGE 5IHBA 1MCRA 3CVHH 3RUGB 1MCCA 4QHUB 5E1AA 3QNYA 1FNSH 5M7QA 5DLML 1SYSB 3P0YL 3VI4E 4RX4A 1UXSA 5I66A 3ARTA 1INEL 4NHUA 2XQBH 1RZ7H 2MKLC 5ADPL 1K8IA 1QSFE 3K8MA 4Q6YA 3FKUS 3GRWL 1DQQB 2Y4SA 3TA3B 1K4CA 3CSPA 3S34H 4OZIE 2C4XA 3V7AG 3H9SE 1X5YA 3PJSA 1P4IH 3RJQB 1RIHH 1CE6A 1NMCB 1QHPA 2YK1L 4JM2B 4OB5L 3RNQB 3RVVD 3T3MF 1JYNA 1X5HA 4G6KL 4M7LH 3PWVA 4A6YH 2Q76A 4G3YL 4D0BA 1Q0YL 2F53D 4GRWF 5DC4B 5AZEH 4PRHD 3KPSB 4Z77B 5IIEA 2PXYB 2IQAA 4G6JL 3R06A 4Q9RL 2R2EB 3VG9B 2VLRA 2H3NA 3OR6B 3MX0A 5LJYH 3I84A 4FOMA 3BMWA 5I74C 3LEXA 4ZFOB 4YBQC 2A6KA 5E95B 5D7IB 4NN7C 3Q1SL 5DD0L 1BVZA 1YN7A 1DEDA 4QOKE 1D5XB 4J3SA 4LSPL 4NWUH 3GHBL 1FH5L 1G7JA 1WLHA 3O8XA 4V1DE 3RBGA 1UWXK 2EDBA 3U9PL 3VXPA 1RY7B 4Y1AE 1MHCB 1BWWA 1FVDA 4YGAB 1KJ2L 4FTVE 4HD9A 2VYRE 3IDIB 2FYYB 3EYOB 5KS9B 5D9SB 4WVRA 4GRWE 4FQHB 3GMNB 5C0EA 3FT2A 3QQ4B 2E8YA 3TVMB 3MOBL 1F2XK 4NPYB 1Z0MA 3W39A 1SVCP 3GZKA 1XCQA 4QEGA 3UBXG 2LQRA 4XTRC 5EU7E 5E94A 2VLKB 4RWYL 2WP3T 1F4YH 2NY3C 1SYVB 3SPVB 1EVUA 1HILB 5IB5A 4EI5A 2F5AL 1FL6A 5F7WC 4R8WH 3TZVC 1BIIB 1MWAH 1QSFA 1BLNB 4BH7A 3G5ZA 3QPXH 3RJDA 3KAAA 1HQRB 3ARGC 2AGJL 5T5FL 1AY1L 2XA3A 4OV5B 1LEGA 1A0QH 4XGZB 1QLRB 3HRPA 3U79A 1J8HA 5KW9H 1XF3B 3OG6B 2DWDB 3HPLB 1BFTA 4JRXA 3MUJA 4NQUA 1KIQA 1OGAD 5DVMA 4O58L 5I6XB 3RL2B 4QTHB 5C08A 4G7VL 4HPOL 2DN7A 3C8KA 1T6VN 1W72L 1YEDA 3V5HA 1FRGL 3TV3L 5HVHC 1P4BL 2A9MH 3WIIH 1CL7H 2OCFD 3ZL4L 4M4RA 4YFEA 3JWDL 3ROLB 4RAHA 1KN4L 5L9DH 1XR9B 3TNNA 2PR4H 3MCLL 4OBSA 3TCXA 5FDWA 4G9FB 1R5VB 1NEZB 3OQ3B 1NBQA 5AD0A 4DN3L 3WKML 4X5WA 3SDAB 1TQBB 1G9NL 2HLAB 4M8QA 4KVCL 3V7MA 3SDDA 1TTGA 3GO1H 1S9VA 1XT5A 4JO1H 2ATKA 2DBLH 4XHJD 3U36A 3RWGA 4Z0BH 4BFBD 5JOFB 1GGTA 2JJVA 3UTZB 2XTJC 3EFFA 4I3RL 4K3JL 4AT6B 1FZKB 4R90H 5D5MB 4NWUL 1IC5L 4LLVA 3KJ4C 1HQ4B 4OIAA 1MAML 1VKXA 1DLFL 1YEHL 5FB8A 3ILQD 3T4AA 1ZT7B 1R5VA 3EZ8A 2BDNH 1QFOA 1F3RB 1IQWL 1J7VR 2X4NA 4PTUB 1NPUA 4OI8A 3HE7C 1KEGL 3ROOB 5LGJA 4H20L 5CD5C 2EZ0C 3JZ7A 4L8SB 1A9EB 2V5MA 4G42A 4M6ML 1S5HA 4V2CB 4AL8L 2WIMA 3O9WA 4LNRA 1DN2A 3MA9L 3PIQB 3PP3H 4OGXL 5IBLD 3QDJD 2ED8A 5KSUA 2I60H 1PKQA 4F58L 3ZYZA 2NR6C 1BBDL 1AKJA 2IJ0C 5F88B 1HHGA 3MXVH 2FH6A 2J8UB 3DX9B 5MP6L 1JPGB 1UEMA 1A9BA 4P5KB 1FFPB 1YC7A 4JFYB 3QT2A 5F9DC 1FFOB 2DJ4A 1NEZG 2GJ6E 5IFHH 1WTGT 3O4OC 3H7LA 5DQDH 3KPQB 43C9A 3RZWA 1MPAL 3MRRB 4YIQB 5IHLB 3AAZB 5ACMA 1AXTL 2OYPA 3IRZA 1EFQA 3KWWA 1NGYA 2V2TA 3HZYB 2ZCHH 3RDTA 5A1AA 1LEGB 2ESVE 3OAZK 4OLZL 4Z7UA 1ZLUK 4D9QD 1OAQH 2O5XL 2PNDA 2X4SA 5I0DA 3F65A 4NUGL 12E8L 1KN2H 1WQVT 3QEQB 4ZTOH 4BFIA 1LGVA 2RAMA 4EJ1C 3S6CA 1EHNA 3WO3B 4P9ML 4KK6C 5JNYB 4XBGB 3WXVH 3GRWA 4LGRB 4JDTL 3WDIA 1U8LA 1AO7A 1MJJB 1PZUB 1U8OB 4P9HL 3MLZH 3QQ4A 2NY5H 3OAUH 5CGYC 4KV5F 4P4RB 4Y19E 4QRSA 3MRHA 2I07B 4LEOB 4JFHD 1MEXL 3BE1H 2ZPKL 1TPXC 5CMAB 2VIRA 5SWZE 4XX1E 3QUZC 3UMTA 5C0JA 1KCRH 4LAQH 2GAZA 2B5IC 1KYOK 1ZT4B 2ITCA 4HG4K 2GJ6D 5IG7A 1XF4A 1OP5H 2KQNA 5HI5C 2IG2L 3VA6A 5DJDA 4WNQB 2X4PA 1C08B 5ICZA 4X7FC 3HUJF 4PJ9B 4UIKL 4PRBA 4PY7A 5IF0A 3V79C 1OGAB 4OKDA 5TDOA 1OAZH 3R1GH 3ARBD 2LAAA 2DM3A 5GRJH 2WQ8A 5HDBF 5FM5O 4BZYA 1KIQB 3V4VH 1KPVA 4JY4A 5I8OL 1Q9LA 2ZSVB 4NP4L 1FZJB 2BFVH 5K9OB 4ORZC 3C5ZD 1NFDE 2AXGA 2Q3ZA 3FOMA 5FYLH 5JDSB 2EDLA 1P9MC 4NM4L 5ABDE 1EHLH 5KVGH 2YXMA 2CIKA 4FQIL 1VHPA 4IMKC 1ZA6B 3IRPX 4TULL 1ADQL 4K3GA 1T1YA 2IALA 3P4OB 3UYRH 4Y5YA 5FUZH 1YZZA 4U6HA 5ENWB 1M71B 3FO0L 4Y5VB 3CCHB 4MA1B 2YD2A 4HZAA 1RZJH 2R56L 4OLXH 5DGQA 5H94A 3T08A 4RAVA 3MBXL 1TJIL 1F90H 3ARZA 4YHOL 1BFVH 3EO1A 2OR8A 4NSKA 2Y36H 4M7LT 1HQ4A 1L7TH 1S7SA 7FABH 3BRDA 5EA0H 1JUFA 1Q1JH 4Y4KA 5ACZA 4ODUA 2HKFL 3WFDH 3C8DA 3VFRB 1FVCA 3TBYA 3D39E 4M8VA 1OT2A 2ZUVA 1MJJA 1TMCB 2QKIA 5D1QD 4LKXA 5T3XL 4Z7QF 5F9OH 3U1SH 2P8PB 4W81A 1CU4L 4OF6A 3GI8L 3O9WB 3RI5F 4P4RA 2BVQA 4LVHC 3ULVE 3X3GH 3ZTNL 4GLRI 2RJMA 3O9WC 4HS6B 1XGQA 2KZWA 1EJOH 4KGLA 3TGXA 2JJSC 4IRSA 4PJCA 5IHZB 1L7IL 4NGHH 2CO7B 2VIRB 4ODVH 1NC2B 2VUOA 2VJXA 3S4SB 5AAMA 1BZ7A 1C7SA 5JMOC 1OWWA 1N26A 1PD6A 1TDQA 3TH4T 3W11C 3WIFA 8FABB 4AQOA 4YFDB 4Y2DC 1KCSL 5EOCH 3HAEH 1CFQB 2NY2C 4XGZA 5ILTL 2AEWA 4U2ZA 1XGUA 2HTKC 4GQPH 5GGQL 4OGYH 1HEZA 5I1LB 1DQTA 2F54A 3LPGA 4OAWB 1NC4D 3NFPB 4P2RD 2WV3A 3VGAC 3CMGA 2Y6SC 3ZHLA 1PG7X 3TN0B 5INDA 3MRFB 3PDOB 3FHQA 3Q3GB 4G43B 4L4TB 3P0VL 3RVVC 3JTSB 4GRMA 3VXNA 2PO6C 4YHLH 4NQCE 5EFIB 4HZLA 1JNNL 5I2IA 3S37L 1FFNA 1QLEH 4MXWH 1CFTA 5D5ME 2DLFL 5EZOL 1WIUA 3VD9A 2H6PB 1CE6B 1U8JA 3HRZA 3VWKB 3PL6A 3UYPA 4LBEB 5JLZA 3FO9A 3ARFD 1I1YA 2KDGA 4KAQH 5CCKH 3OJDA 3P9MB 2W0FB 1CD9B 3CVHB 4HG4J 3CSYB 3F5WB 1MCKA 2EDHA 4DKEH 1C1EH 4GS7B 4WHDA 3ZT7A 1RUAL 4XPHL 1S7VB 4KFZC 3HC4L 4FFVD 4Y5VA 5DRZA 4LU5H 1HDMB 3C8HA 4Z7NE 1JHKH 3AU1B 4MDIA 4XC3H 1M1SA 1HYRC 1UKQA 3QHFH 4PJBA 3QUZA 3BH9A 1XR8A 3NOIA 3ARYA 4NKMB 4LSTL 1AGDA 4XWOC 3I50L 5KOVC 3B9EA 3J8F7 1WK0A 1CFNB 3BYTA 3IDYC 3GI9L 3MRNA 4UTBH 3MV01 4YHKH 1T5WB 3MLTB 2CJUH 2OXGA 4P46C 4W4OA 2K1MA 3P9LA 1IM9B 2I27N 4NZTL 2O61B 3CSBA 4EDXB 3DRTA 4IIQB 7FABL 2VMFA 3QEUB 3ARGD 1HSAA 3HLAB 4GW4A 5MI0B 2CR3A 5CJ8A 2QKIB 3MGTA 4GBXD 4PGBB 2ED7A 4I0PD 3DVNB 3LEYL 2XWTB 4OIIL 3S35L 3SY0A 4Y7MA 3PUCA 3VD7A 5DMJB 3N06B 2VDNH 4MNQA 3BWAA 3GBMH 1GZPA 5D7LE 3QG6A 3BPLC 3ZDYE 1E4KA 3RA7H 4TOYH 4OZFG 4OT1H 2CKBH 1N2RB 2WNGA 5EPMA 4OAWA 3T2QA 3UTTB 5ISZB 4X6FB 1J9CT 1MY5A 4R97B 5FCUL 4KZEH 4FZ8H 3O2DL 5IB4A 1A6AB 4PUBL 2OI9B 1REIA 5CGYD 1N64L 5CJXA 3MRCA 1U8NB 3KHOA 3OKOB 3AMKA 2XZAH 5CJBA 1FG2A 2C3VB 5BW7C 2VWEC 5L88L 5CUSH 5EZLA 1HNGA 2W9EH 3VW3L 1U3HD 3OGOE 3VXRB 5TQ0L 1IGCL 5D1XD 4ZO7A 1U8IA 2EIZA 1OSPL 1QQDB 2Y06L 4LMQE 3C60B 2OM5A 1HK6A 5DT1H 4HXAH 5DK3A 1RUQH 3MUZ1 4LHJB 5FYJL 1OTUC 5TE7H 4OD1L 4FP8H 4QRTA 1I1FA 4YFLF 1CXLA 1I1RA 1MRDH 3QCUH 1X6NA 2CRZA 3CDGA 4JN1L 3LKRB 4NOFA 4K7PY 3HNVH 4X7SL 2HH0L 2FR4B 1T04A 3HE6A 5DRZB 2FX9H 3K46A 1ONQA 4E42B 4NHUB 5T33L 1WVZA 3NZHH 4OI9A 3VXSE 4JR9L 4RNRB 2Q7YA 4HIXH 5KS9E 1UXWB 3IKCA 4HPYL 3BT2H 4HK0A 5IKCB 1RJZB 4MJ5B 1NGPH 2EYRA 2YZ1A 5H8DA 3QDGB 4YHPA 1RIHL 3PXJA 2VQTA 4ELME 2FB4H 1IBGH 4YPGA 4RAUA 3K4AA 3NN8A 1EHAA 4P49A 4ZUTB 5EIVA 1S3KH 2N7AA 1D6VH 3RUGE 4LSVL 4NKDA 4JFEB 4LNRB 1DBJH 1JF6A 3L7EA 1M71A 4UINH 1FC1A 4PR5A 1H8SA 1LEKB 2OQJA 5GISL 4I5BA 4PGCA 5EUOF 1MQ8A 4DKAA 5DEZA 1WAAF 3NN8B 2YPLA 3RX5A 5LAXB 4PJEE 4N0YH 4U7SA 1AXSB 1YEJL 2AXHA 2CO6B 4H0HB 4LCWE 2XZQH 1Q0XL 1S9XA 2E7HA 2FL5A 4JFEA 5LBSH 3VG9C 4PTTB 4KK8C 4YUEL 5FDWB 3EOAB 1IKNA 1Q9WA 5FGCE 4G8GE 1UM6H 3LRHA 1RPQA 1IFHH 1GAFH 4H1LB 3F7VA 1ORQB 3MV9A 4YX2L 4UTAH 4I3SH 1H8OA 2BSSB 3FT2B 1N0XH 2I9LB 1PG7L 2MHAB 1UQSB 4WFGD 4GBXB 4MXQD 4L9LB 4O2FA 3NPSB 1AHWB 3HAEB 4MCZB 1W0VB 1S7WB 5TFSL 5K59F 1KIRA 1LDSA 1VFBB 2Y07H 4JVUA 4GLRH 4XRCA 2NLJA 5EU3A 4NNXA 3QXDA 1C5DB 3HCVB 5CP3H 1UG9A 3DROA 1XGTA 3RPIB 1GGBL 5JW3H 4NN7B 4ELMB 4OD1H 1JGEB 5EN2B 5FA3B 1T0MA 3CDGB 4F7EB 2VR9A 1J1OL 5JXED 1WAAE 2DQGH 3LRGA 1ONQB 5INDB 3BGAA 3C2AL 2YBRB 1ORSB 2GAZB 1PDKA 2N4IA 3WL9B 3MYJA 1EO8L 2O5YH 3E0GA 4HS8L 3K1KC 4RRPG 5ESVB 3BGMA 3QJHB 4JR9H 3IJYA 4LQ1A 1F3DJ 3T4YB 1QSEB 4ONFL 5HVFB 5IP4A 3I75A 4LPWA 1CTOA 3FB7A 1TVDA 4OBRA 1DN0B 3NTCH 4RQQB 1MI5D 3T1WA 2I24N 3WIHH 4OF0A 2YBRA 1OGAA 4OCXH 5F1NB 4W70A 3MRMB 2VC2L 3MLRL 4J1UA 4ZD3H 5DJYB 1A6PA 4LL9A 3VG0H 3VXUD 2E7LC 4WWID 1W0WB 1KF9B 1N3NB 4JY6A 5KSBF 4DW2H 5GSVB 5E5RB 2UV3A 3K74B 4JY4B 4PB9L 1KV3A 4JG1L 4KQ3H 1VADB 2VLME 3O41A 4I0PB 3T0VA 4UOJA 3BUTA 4UQ2B 1FG9C 5EIIB 1VB9A 2CKBB 4BQ6A 5DJXB 3WKMH 4JB9H 4BZ1H 1R3KB 1G9NH 1XAUA 3WFEL 3HA0A 1ITBB 4KWUA 2P5ED 1HOCB 2NY0B 3DSFL 3H2WA 4TQEH 5C71A 2HMID 1A4KA 3BP6B 5CFHA 2DB8A 5I75C 3G08A 5C9KA 4NC1C 4JFQA 1INQB 3SE9L 4FQQB 1T0NA 4GXVL 4NKOB 2L7UA 4F7CA 5ID0A 5D2NC 2MOVA 5CWSA 5IG7B 4PY8J 2I9TB 4KHTL 5F7DA 5KVDL 1H0DB 3CVIL 3L6FA 1ITCA 1FPTH 3IDXL 4HKJB 4LNVA 5KJRH 3O6MH 4L4VB 1K85A 2OP4L 5BS0E 4NZUL 4O51B 5CBEA 5F3BB 3MLXL 2OL3A 2R2HA 3MA9H 4NN5B 2VLLB 4MLSA 1PX3A 3SGEI 3VGEA 3TBYB 1CE1L 2DS4A 4DJMA 4JFXB 3MRDA 3HE7B 1B2WH 4DGVL 4XVJH 3DROB 5CZKA 1VSCA 3H3PL 1G6RB 4XPAH 3UZVB 4NKDB 4JREC 3WLBB 4UDUA 1JF1A 3WDJA 1LDPL 3VRLE 3TZVA 1QBLH 4U6VL 5B3JF 4I5BB 4KDTC 1SVZA 4XP5H 3RKDD 4DKFL 2APFA 3VH8G 1MIML 2YZ8A 3QFJA 2EDQA 5BO1L 2E8ZA 3IFOB 2E9IA 1QEWB 5HYJD 4QF1B 5HYQA 1EO5A 1IILE 1A1MB 1DUZB 4PRIB 1YY8A 3QZWG 4RQQA 4PD4J 4PV9A 1BBJB 2VR4A 3DMMD 2RFXA 4YR6B 4PJBF 5DA0B 3NCBB 5B3NA 2A77L 2I60L 1VEPA 1TVBA 1D5MB 5KN5B 4MD5A 2LU4A 2I9LA 3DYOA 4H8WL 4LOUD 3L5JA 1CD0A 5GGRA 3BXNB 4PJFB 1RIUH 3P4MA 4HCRH 3WFZA 5IJVB 3CMOH 3RHWK 1MHPH 1MQKH 3O4LB 5DUMH 5C6TL 5GGTA 3D69A 5BZDB 4XZUB 1YN6A 2R4SL 4Z7WF 4LKXB 2G75B 3QEGL 5CEYA 3IJHA 5IT2L 1G1CA 2V17L 4HDIB 2XTJD 5F96H 4ELMA 3VRIB 1MWAB 2FATH 4JB9L 4XHJC 4PJBE 3ZKND 3BDBA 1ETZB 1DQML 4ELMF 1AD9A 2NY0C 2FJGA 1UXSB 4DVRL 4PJ7F 4BZ2H 3ZT5A 4HBCL 3TA3A 3W81A 1JNHA 3QUZB 5C07B 1NKOA 4XVSH 5MEQB 5L2KA 1JNLL 1YEFH 2R9HD 2EE2A 4JDTH 2MCG1 2EYSA 3RHWF 3CVIH 4XAKE 5DJ8B 4PJFE 4NRZA 4G7YL 2HP4A 5DYOB 4U1HB 2H2SC 1EERB 4GKNA 2VZVA 1R3IL 2GFBB 4RBPH 1I8IA 4OQTA 2D7MA 1U3JA 2V5SA 1UFUA 4HWBA 5C2UB 1FFNB 2C4FT 3CFIC 5GGRY 4RGNC 4PJHE 4JANB 4FQCH 4HKZA 5SV4A 1TTUA 4NQDA 5ALCL 1JL8A 3PQYD 2ZNXA 1IEBA 1AE6H 2IQ9L 3CFJB 1C5CL 3TO4C 3VD4A 1QOKA 4ZO6A 2IG2H 4P23B 4QXGL 2CMRL 5J13B 5EOCJ 3RIFF 3C6SB 1IM9D 2WZPD 1CR9H 4LHUB 1A6UH 1OP3H 5C0RL 1N6QH 1II4E 1CXIA 1X3DA 2HT4D 2F8XC 4ODTL 4OF7A 3SDCC 4XWOD 1BOGB 1KENL 3OX8A 1EGJL 3ULVF 1I9EA 3G6JA 1ZANH 5JPMB 4BKLB 4ZUVB 3GHEL 4XB8A 4FQQA 4XTRD 2NX5E 2NXZB 1T20B 3MODH 3C5SA 4OUUA 4HUWB 5DD5L 4XNYL 5C0EB 3NVQA 4OZGB 2GTWA 4PLKD 3O2VH 1IL1A 4L4VA 5IVZB 3B5TA 3GSWB 3J7HA 4NPYA 3LQZB 4QRUB 2X1OA 3RDTD 1FDLL 3JV0A 1OTSC 3O6FC 3U6RB 3MV8A 2BX5A 3EJYD 4JRWA 3FL7A 2FGWL 1QO3B 2AEPH 3RIAF 2GKIA 5FO9B 4XX1G 1KFAL 1S8DA 5DZLA 3QPXL 1QLFB 2PO6D 1H5BC 5MENE 4XNMA 4A2MA 2NZIA 3V6BR 4MDJB 5GGQH 4QHNA 3BP7B 1Q9OA 1N59A 5E6ID 4S2SB 1DQMH 1YY9D