1JGUH

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYLDSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Antibody Light Chain
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH01
3ZE1E 3GBLA 1F2QA 4LCWE 1AXTL 4Q0XL 5DD0H 3PGCB 4ONFL 4LNRB 2AEQL 4YIQA 4L4VB 1BQLH 5BMFH 3FQWB 1FRGH 4XVJL 3QUYA 2W0LA 4JDTH 1BIIB 1H9VA 4PY7B 3VFOA 1JHKL 5DI8A 3NGBC 1RJYA 5BRZB 4PJEE 5GSRA 4Z0XA 5C0ND 2E8ZA 2VXUL 1DN0B 1X5LA 2XNAA 5KVFH 3NCBB 1JWUB 3VXRD 5IIEB 3QG6B 1KLFA 4BFIA 5KSVB 2C3VB 2EDWA 2VITB 5GIRA 1NDGB 4E42A 4HUUB 1UVQB 2CR6A 4M02A 1TVBB 1HXYB 4YDJB 1EEZB 3TIEA 3MRFA 2ZUXA 1KJVA 1KPUA 2DRUA 2XT1B 3MLZH 2A73A 1L6XA 4R4ND 2B4CC 2H32B 4JRXB 4RMVA 1YEEH 2QKIB 3PWPA 4Y4FB 3TN0D 3TBSB 4Z7OF 5DJ8A 3SDXB 2APWA 4IMLA 4YPGA 3HKFA 3DETD 3CAFA 5GS0L 1CXLA 1B0WA 2WLYA 2AV1B 3I6LD 4DKAA 3O2VL 2GSIB 3WD5H 4NFCA 2WW8A 3U4EB 5GJTH 1HHKA 3RPIA 3GIVA 2H26A 4Q6IC 4YXHL 1FGNH 1N7MH 3HI6L 5M94B 1HHHB 4JFDE 2P7TB 1PEWA 2E6PA 2GJ6E 1P1ZA 3I84A 3REWB 2JLLA 5KSVA 2IPUG 4PJHB 5LGKA 2JB5H 3TN0A 2XTJB 2ZNXA 1TVBA 3ZT6A 2NMSA 3LQAC 1AI1L 1T03H 3TN0C 3QO0B 1Y6MR 1I1FA 4FOMA 1FNEB 4HIXL 4HGWB 4CMMA 1L0YA 5EO9B 5C0DB 2ADFH 2VIRB 3T0XA 4NT6B 4CJ0A 5J56B 1WK0A 3OKKB 1KCLA 3TBSA 3BRFA 1HQ4B 1HILB 2PCPA 4QRSA 2PYFA 4PTTB 4YO0B 4KY1H 2DBLL 4ISVA 5HYJA 3I85A 4ZUWA 5DHVB 3MRPA 1UEMA 4PG9A 5CEXB 1IMHC 1UACL 5KSAB 4GXVL 5J8OA 5JW4M 2CLRB 4QRUA 2YK1H 4Z6AT 1RZFL 1SMOA 3ARED 1Y0LB 2A38A 3NOIA 3E6HA 2AI0H 1DR9A 4U1JA 1ERNA 4Y19E 3RUGE 3NTCL 1UENA 3GNMH 1ZSDB 5E99H 4Z77A 3M1BB 3T2NH 5E95B 1XFPA 5KG9A 1MCSA 3DX9B 3PP4H 4W68A 1LP9A 4XBPB 3EO0A 4XPHL 4FXLA 5JNYA 4I0PD 2R1WA 4IOIA 5ICZA 3UBXB 4JJ5B 4GBXC 3N0PB 3VG9B 3QUMH 2C3GA 2FATL 3W81A 3KYMA 5HVHC 2ZUUA 3KXFD 1G1YA 5EUOE 1P7QA 3DX7A 4JFPA 5J6HB 5D1QD 3O8XD 1S9WB 3ULVC 1XH3A 2IPUK 3IXAB 1KXVC 4XVTH 1UA6L 5SWSD 1FZMA 2RBLA 2HFGL 4YHKL 1FV1B 3DVFA 2YRZA 2YRLA 4GS7C 5HYSG 5DUML 1ZVSB 3AY4A 3VFTB 2LU7A 1I7TA 3GJFB 4AL8H 2EXYC 1OGTA 4EI5C 1JYVA 5JPNB 4G8EB 5LGHH 4RNRA 1JGDB 4XC1L 3EO9H 3G6JE 5E03A 1U8HA 2W60A 3VGFA 1A9EB 4RWHA 1VFUA 3IAQA 1QRND 2YPLD 1AP2B 3IFPA 3UYRL 3TBWB 1XGRA 3A6BL 5CIPH 4LLYA 5SWSA 2IANE 3F6LA 5ISZE 3RWDB 5FOBB 2Q7NA 3K4DA 4U6TA 3X14B 2H32H 2AVGA 1JUFA 5JIKA 5J1SC 3IXTA 4Z7QE 4WI4A 1J0YA 4NKIH 5JHDD 1CXIA 3C60B 3MO1A 5IM7B 1FV1A 1NFDA 2EECA 5EIIA 3O3BB 1ES0A 3WUZA 3T65A 1YY9D 5E2VL 4KJPC 5DVOA 1CVRA 3SCMC 5I15H 2D31A 2OTPA 4KMTH 2B4CL 1LO3L 2IQAA 4HJJH 5DYOB 4HWNA 4GMTL 1HHJA 3HFML 1U3HB 1W8OA 3FO9B 3OR6A 5F6IB 4LFHD 1K85A 1T89A 5E24E 2FZ3B 2DQIL 4NQUA 4MDIB 3U9PL 1MY5A 1FJ1A 2UUDK 5EOQL 4PJ7F 4G6AC 2UZIH 3TBWA 1S7RA 5EBWA 5CCKH 4FABH 1A6ZA 1KLUA 4WI8A 2DJUA 3CFDA 3MNZB 3TNNA 5F1IB 1B0RB 2ZG1A 1S7SA 4OB5L 3DX6B 4FFVD 1QSFA 2ZJSH 4HF5H 4HZLA 3VFRB 2CGRL 3B2VH 4M62H 3IDJA 3U36A 3QUMA 4JG0H 1JGVH 5A40E 3C5ZB 1CLCA 3C8HA 4X6FB 4YHOL 3BN9C 1N6QH 3HE7A 1U8LA 2VB5A 2VDRL 1CICB 1MIEH 3ZKMC 3DIFA 2J6EH 1JYNA 4TVPE 1RQ5A 3DV4A 2HMIC 2IFFL 2AJZB 4LASH 1B6DA 3KGRA 3C9NA 5IMMA 5FV1L 3MLYH 2R9HD 4JM2B 2X4UB 5IWLC 3W9EB 2DLEA 4X6CA 4QHMA 1LDPH 4MWFA 1KB5H 3MRQA 4GW1B 4PTUB 3RVWC 1FJ1B 5D93B 4F2MB 2DOCA 1BVKA 3RZCC 4PRNA 1BZ7B 5I74B 1Q8MA 2X7LB 3BAEH 5C9JB 3VFMB 4HWBL 3PWUA 3VRIA 4MS8D 1AGDB 1KLUB 1ETZA 3I6KA 3ZTNH 1FGVL 5KSBB 4HXBH 2O93L 4TULH 4X9BA 3UTZA 2EYRB 5F7UA 1DUYA 2J8UB 5H35A 3O4LB 4ORZC 3RP1A 3J7HA 2DWEB 1DQJB 5D5MA 3QI9D 4OLVH 3MRKB 1BMGA 4JKPH 1CGSL 4XMKL 4R26L 5CJOH 3ULUE 2JELH 4H88H 2XTJD 4FQXC 5KOMC 2R9HC 5ID1B 3WE6A 1C1EH 1R24A 4PD4J 4KJQD 4YWGL 4YXLH 1M71B 3IAGC 1BWMA 4AYFA 2Z35A 4PR5A 4PJFB 3SDYH 1YEHH 4MD4B 3ULSA 2VH5L 1MCCA 4XGZB 5DT1H 1PKQB 3DXAA 5TDNA 1OTTD 1BF2A 1IEBB 3GHBL 1PZUB 4IOFC 4MB3A 4C56B 3SOBH 3U9UA 3CLFH 1R3HA 1KIPB 1A22B 4CDHA 2DI9A 2HFGH 1BAFL 2I60H 5FGRA 2EH8L 4FXGB 3PUCA 4WEUD 1ZLSH 4ERSH 1U8MA 2XN9E 4GMSL 4J3XA 4G80B 5IW3A 3MRMB 2DQTL 4GW4A 2CD0A 4GSDL 2IAMD 4O5LL 1JZ7A 3MCLL 3K1DA 3QEQE 3BEVA 1KCKA 5TF1H 1JGVL 4ZFOA 1JNHB 1OARL 5HYEA 3NH7L 1ORQB 3S34L 4YFLF 2QQNH 1RZIA 3FQTB 4A6YA 4PYHA 5GS1B 4FG6C 3SJVE 2ID5A 3MRHB 4PJ9B 3OG6B 1DFBL 1BQHA 3NPSB 3HR6A 4WV1C 2V2TA 4MAYC 5D2LE 4U49A 4LARH 3U7WH 4WUKH 3O9WA 5F88B 3S5LB 3LKPA 5I76A 5D2NC 2VLRD 1W72A 3NCYS 1E4XL 3EJZC 5GS2H 4FXKA 1Z3GL 5E70A 2B4CH 4HJGB 2H8PB 1I1AA 4E5XB 4RWYL 1SY6L 3B9KA 2D7TH 4OZ4B 4EXPX 1FNFA 2DLTA 4M00A 5L2KB 4Y89A 1K4CA 2VZ1A 4G7VL 5D9SA 4PRHB 1OQXA 2FB4H 4R9HA 3RX8A 3VWJC 1MFAH 1JGLL 1V7NH 4PD4K 3UX9B 1LDSA 4K94L 5F3BA 4GSDH 2G5BB 2P8PB 3HN3A 2BCKA 4LRIA 4OD1L 3MCLH 2DKUA 3FQUA 2QQLH 4DGYL 2FSEA 3OJDA 1RZKL 4FQQA 3UYRH 2V2TB 3BYYA 3Q6GL 2DD8L 4QTIL 3VXTB 3TV3H 3MRIB 5FUOH 1QBLH 3MUJA 3SE8L 2ZOKB 4HCRA 2D4DA 2VDOL 3CLFL 3MUHL 5IEKA 2D0HA 1A4JB 2WNGA 3LN5A 4U6XA 4LSRL 2UY7A 4NN5C 3I75B 5INCB 4O2CA 5JHLH 3RJDA 4D9LH 1A1NA 1NEUA 2EIZB 4MDJA 1D5XA 1MFDL 3CVIL 3QDJB 3T0EE 1ZVYA 3V6FB 2UWEA 1KB5L 1FNGB 5F89A 3VXOA 1J8HE 1JNNH 1BX2A 3OKOB 5FHBH 2KKQA 3S35H 2WUBH 5F9JA 3JSSA 4QHLA 1I7RA 1ZEAH 1BFTA 2HH0L 3GSNH 1MCBA 2BCKB 3HZVB 1T1XA 3I9GL 1BGXL 1G0YR 1Q9OB 4I3SH 3D2UA 5DQDL 3VWKB 4J3WA 5FHAL 3L3KA 3B6SB 4Y5YA 1BBDH 1R3LA 3L3OA 3MGOB 1NC4D 5CEYB 5D72H 4EBQL 2XNAB 2CDFA 2DTMH 3K81A 3LMJL 3EYSH 2OR9H 1UB6A 4GRMA 3RA7H 4ZFOL 1FRGL 4YHLL 1JJUA 2FH8A 4O2CB 3BPCA 4GKZA 4WWKD 3TO4D 1R0AL 4N5EC 4LSQH 3WIHH 4S10A 4RA3A 5CIPA 4POUB 1A7OH 4PS4H 1ZLUH 4I18B 1T0MB 1NC4A 4ZTPH 2IBZY 2H32A 4JRXA 4HIHA 4B0MM 4KRLB 1BX2B 1T1WB 5I73C 1EERB 4JPIA 4I13B 1H3VA 4QGYA 1RIHH 1QSEA 4Q6IA 2D3VA 2BRQA 5D96C 5LCVH 3ZMRA 3CSGA 3CDCA 1S3KH 2GHWB 3D6GA 5CAYB 5HI4C 1DP0A 2H2PD 1HH6B 3R06A 1QKZH 4O5LH 2J1KA 3L3GA 3U6RA 3D85B 5HVHB 1EIBA 1OL0A 4TSCH 4RRPG 5FM8A 4QTIH 1FBIL 3Q6FA 4DUXA 4PGBB 4L3CA 4MQ7B 4YAQB 3MACH 3PABA 2F58H 1FCGA 3A6BH 5DEGB 3S37H 4LDOB 1IAIH 1TVHB 4MXVF 3S9DB 3BP4B 1IGTB 1CICD 2EYSA 3VFNA 5E6ZA 2B1AH 5IGXH 5H2BA 1AQKH 1ORSA 4J3UA 4J3SA 4MD5B 1KJMB 1RVFH 2Y36H 1AKJA 3DSNA 4UAOB 1F58H 4K2UL 1OTUD 4F37F 2E6QA 3UYPA 1A7RL 1I7ZA 3BEWB 5C0BA 5HYSB 2ZG3A 4FQCH 4M7ZB 4QXWA 1ULVA 1Z3GH 1PKOA 5I1KH 1IM9D 1H0DB 2UYLA 3T08A 3HNVL 3ME0A 1CDCA 1FHGA 2W9EH 2NY6B 1EEQA 4ZXBD 5GGTH 3QDGA 1T80A 2I5YH 1KGCE 4YHZH 4F7TA 4B53A 2YEZB 4KJYA 4Y16A 5DDHB 2VDPH 3FAWA 4MMZC 3BQUA 1S3KL 3O4LD 4FHBD 3ARFC 2XYCA 1DLFL 1J5OL 3WL9B 4MJ6B 2JJSA 4OT1H 5I17A 4PV8B 3OF6A 3QWQB 5C3TA 2VO5A 3HMXA 4U2YA 5IMLB 2A6IB 2P8MA 4OF0A 4ACPA 2X9WA 4U4BA 3STZB 3WFDL 4X6DA 3GSXA 2XA8L 3ZL4L 2AI0L 1AR1D 2ZUSA 3RGHA 3SKJL 2GKIA 4KZEH 1F11A 3G5XB 4Q9QH 1XGPB 4ZYKA 4H0HB 2IH1B 3QBTB 4Y5VA 5C07D 2BC4A 4LPVA 4PJAF 1XH3B 5L2KE 4X98B 4OF7A 1OLZA 2F54A 3NFSH 2XRAH 4NN5B 2BHZA 3UZVB 4EDXB 4XHJD 2YEZA 2OSLB 3C08L 1NLBL 1CI5A 1T2JA 3DETC 1JF1A 5T3XE 3VFTA 2HJKB 2MKWA 4M1DL 1A7NH 1J1PL 5D7JA 1F3RB 3MJ7B 2P24B 3MMEB 4PRAB 5CJ8A 1UT9A 4JAMB 5BJTA 1NFIB 1NDGA 1A9EA 2IBBA 5DI8B 3BKYH 1FL6B 4PJIB 3P4NB 3O3EA 3OXSA 5I8KL 4G6KL 3BW9B 5I30H 5FA4B 3DMMB 4LLMB 2J8OA 3MOAH 2XWBA 3LKNA 4K3DL 1KEGL 4MHHG 3OGOE 3D5OF 4YQXH 2EIBA 2EEAA 4XB7A 4Q2ZB 3EOTH 5LAXB 4JZNA 1I9JH 2BC4B 4Z0BL 4MJ5A 5HGAA 5DK0A 3HUJF 3IFOB 2XA8H 4XI5C 5DO2D 5DZNA 1PG7W 1F4WH 2D7OA 5CZXC 1W72L 3WNNA 1GGYA 3GMRA 4Y5VC 1LO5A 4X9IA 5CMAA 1HH9B 1C8PA 3S4SA 4MNHB 2IMMA 5C92A 1CVSC 5DUMH 5C0CB 1ZK9A 2BVOA 4I4WB 3VXME 4HS8H 2HJLB 3S36L 3PWVA 4NC2B 3SKMB 2R15A 1GL4B 1XIWC 2CXGA 5BJTB 1V8HA 4I0CC 4QRTA 5KW9H 2WIIA 5DTFA 3EZ8A 5B3NA 4ZS7L 2F8OA 2OLDA 3W11D 4UU9A 2HG5A 2ITDB 2V5YA 3GKWL 4NUGL 2H41A 3T0EA 3WMSA 2XWBB 1UXSA 1I4FB 1QBML 4ZXBB 1KB9K 4U0RB 3HS0A 4RX4D 4D3CL 3MJ9H 4J4PD 2IFGA 3WSQL 5T1LB 5ISZA 7CGTA 1E4XI 4NC0B 3MLXL 5BZDA 2X4TA 2VZ3A 4F3FB 3IFOA 4JDZB 4ZNCD 1DQTA 3ULVH 1QFPA 4FQXD 4APQB 1KEGH 3MRRB 3W39B 4OD2B 2B1AL 4YQXL 2ATPA 3QIUB 5EC2B 3AUVA 3UCRA 4NBYB 4R8WL 4JQIL 5T1KB 4KKBC 4M6ML 1F6FB 1K8IA 5ICXB 2G60H 3QJHB 2VQTA 4ZPTB 5HHMD 1RUML 4FZEL 3VE0B 5IJVB 3SDDB 2MSPA 2EDTA 3MPCA 4UU9B 4UV7L 5BXFA 4QWWC 3RTQA 1IC4L 4K55A 5CKAA 2PTVA 2PNDA 2EXYD 1FORL 1SBSH 3H0TA 4P3CL 1IILE 1G7PA 5HYJD 2PTTB 4LRNL 4KK9C 4F58H 4HS6A 5K9OB 4WUUD 4QXUL 4TNVF 3GMMB 5DVKA 4FRWA 1T89C 3FT2B 4PV9B 3DROA 5IVXA 3UTPE 2IMNA 3MCKA 4CVXA 3HNSH 3AROA 3O4LA 4G7YH 2XKSA 3PDGA 1FLRH 3T4AB 2VN4A 1ODAA 2IGFH 3LPFA 3VWKC 2P47B 1BQUA 4G9DB 4TSCL 4YLQT 3DV6B 4HEME 3SE3C 1RK1A 5TQ0H 2QQLL 4DGYH 4ZDHB 4APQA 3BDBA 2FJHB 5C0AB 2V9QA 1EHNA 1OAKL 4JPKH 4OLWL 3WE6B 1MCHA 3MRGA 2RGSA 1UM4H 4PJ8A 3QAZC 5E8EB 4XPTL 1W0WA 1A2YA 5D6CA 3TYGL 2F5BH 4WHTA 4RGOL 1EHXA 1CTOA 3FB6A 1E6OH 4J12A 2D7NA 1E0OB 1NC2D 5C0IA 4F7CB 3LQAH 1NL0L 1FFOA 2EDOA 5EZIL 3RL2B 4P5KB 3GJFA 4BELD 4R4BB 5HHME 3RHWK 2OL3H 1OTSD 3GSUA 4HKXB 4P4KB 4M6MH 3KPSB 1JIBA 4FXGA 5TQ2H 4RNRB 5IQ9A 2IH3A 2ORBL 1WEJH 3RBGA 4WFEE 1UKSA 1PFCA 1D9KD 4PGDB 3CSYB 2FGZA 1JPST 2Y7QB 4OFYA 4OCLC 5FUZL 4P57B 2FO4A 2ZCKL 2VDNH 3Q2CA 3TZVC 5HI4D 2ADGA 5F93C 1YEJL 3HI5L 5FV2A 2C3XA 4A6YB 5DMJB 1CL7I 4GJTB 5DD1L 3BZ4B 5TF1L 3L3HB 3EYOB 3FT3B 2W9LA 5KS9E 1PYWB 3LEXB 1E28B 2UWEF 5JDJA 4X8JB 2ESVB 2PR4H 1MLBB 1QACA 3EDEA 2IEPA 2NW2B 1N6VA 4PIRF 2DBJA 4EQ2A 4AT6B 3C60D 4EOWL 3ILQC 3WNPA 1L0XA 1OAXH 2DQEH 2YMXL 3SKNB 4CADB 5F7WC 3S96A 3N1MC 1D6EB 4WW2F 1INDH 3VFRA 4J3OC 5HHQA 3K8KA 5ESQB 5DD6B 3BISA 4UZGA 4DVRL 1P7KB 2FWOA 1IGIH 4WEBH 1G84A 2X4RB 5I8CB 1YNLL 4BZ2L 1SY6H 4JE4B 3U79A 2DIAA 1I3UA 3F58H 1AO7E 2DQFA 3TNMA 1LQSR 4QRRB 1GRWA 5C0RH 4PRHE 4OZHA 4Z5RA 2AXFA 1TNNA 2CK2A 4ZFGH 1SVZA 3U7WL 5B4MD 4OGAD 2O61B 3TLRA 1KT2B 3O41B 4E9LA 2Y4SA 5K93A 4D9QE 1FG2A 4M62L 4ZAKA 1NGYB 4R7DB 1U2HA 3AXLB 4JG1L 4Q58C 3SKNA 2C4XA 4NQDE 4XAKD 2VZVA 1OTTC 3DI2B 5I1AB 4K23H 1A1NB 3GI8L 5FO8B 1QHPA 5JQHC 2ICCA 1I3GH 1JWSB 1FFNB 3PWNB 4MXQC 4X80L 5I9QC 5FXCH 4QT5B 2QHRL 2XN9D 4RGMB 1FNGA 1EHLH 4DCQB 5IKCA 5FCSH 1CL7H 1Y18B 3KPQB 4OTXH 1L7TH 3SGEI 1T0PB 5FKPB 5KSUB 3HI5H 1M7DA 2GJ6D 5KVDL 3RI5F 2VAAA 3SDAC 4HUWB 4LLWA 1BIHA 4PUBH 4RGNB 4PR5B 2H2PC 4OZHB 4Y4KB 1YC7A 3MBEA 2J7LA 3BI9X 3RWHB 4NQSB 4FFVC 3RUGF 1D9KC 1HOCB 1CG9A 4GRWE 1FAIH 2FHCA 4EN3C 3RAJL 3HG1E 3AC0A 4NNYB 3M8OH 1HDMB 2Q1EA 4X7SH 5DK2B 4RISL 1XGUB 2V9TA 3ULSB 4RA0C 5C0AD 2RQ8A 2IWGA 1OPGH 1NBYA 4U1MA 1VACB 2F53D 1QP1A 3D3VD 4QCIA 1BD2E 5AZEL 1ZLVH 1Q9KA 2OM5A 3ZTJG 5J4MA 5D2LB 3V6ZB 5C09A 3S97C 2Z4QB 3V5HA 5EULV 1YJDC 1PVHA 4ZAKC 1EZVY 1UQSB 5J13B 1J0KA 2J88L 1WV7T 1F97A 3QQ9C 4URTB 5CP3H 4Y8AA 4LLDA 2FGWH 4OM0L 4OQTL 2R39A 1B4JH 5E6ID 2VDKL 2YD5A 1S7XA 1GGIL 4HUXA 1MHHB 1RHFA 1YEDA 2WWKO 2F74B 3BESR 4LCCA 5T1DH 3V52L 1CG9B 3ARZA 4O2EB 3S5LA 5I76B 3EAKA 5I1IL 2VRAA 4OV5A 1W72B 4AEFA 1XEDA 4M7JL 5EG6C 3SEPA 1JWMA 4JQVA 1KB5B 1QUNA 5TPWH 4OV6F 1X5GA 5L8JB 1WCBA 4APQC 3MV7E 3FHAA 4OZ4A 5D1QA 3SGEH 3AU1A 4N0UB 4P3WA 3NPZB 2YUZA 4QRRD 4YZFE 4QTHA 1MVFA 4HKBB 4P2OD 5F7DB 1NBQA 5FCUL 1VGKA 3GNML 1H5BB 1P5VA 2JCCF 4AIZB 2CO6B 3O2WL 2J5LB 1L7TL 2G75B 4LSTL 1KN4H 4EOWH 1FE8L 3HR5B 3QHFH 4P2RB 1RULL 1AD9A 4L9LB 2GT9B 2QADD 3GRWH 4KU1A 1D7FA 4JDVB 3U4AA 5C0FA 3MV9D 3L6FB 3NZHL 1QNZH 2WBJD 4FP8H 1FL3A 1G7MA 5J11C 1C5BL 4WUUB 5JXEC 4A2LA 2A9MH 4J1UA 1T1ZB 3LHPH 3H9HA 5FYLE 4JFYB 1AKJD 2YKLH 3P4MA 1T6WA 1OY3B 2X9XA 1IGIL 4JRYE 3SDAB 3LDBB 2ATKB 4UBDC 3DSFL 3I75A 1MF2H 2IPTH 4UDTB 5EUOF 4KUCF 1QO3B 1FDLL 3V9FA 2ESVE 4RQQA 1HXYA 5E5MA 1WCBB 1DSFL 3FB7B 1CCZA 1KTRL 4A6YL 3RZCA 4OLEA 1KTDA 3HUJE 3QG6A 4MGXA 3GSXB 1BHGA 4R4NC 2EE6A 3V6FA 1U8JB 3OAYH 5F7DA 4E42B 4Y4FA 1H5BA 4ONFH 4PLKD 3T2PA 3QDHA 4ZYKB 1RZKH 3IRPX 4LP4A 5DFVD 1I7RB 2E9BA 3C2AL 2NXZC 3DYOA 5F9WB 3VGGA 5DJZA 4FQJL 4NDMA 3C5JB 2DLGA 1T1XB 1YMMA 2PR4L 3QDJA 3RVVC 3MV8D 3KPRE 4C4KO 1DZBA 1IC5H 4P4KD 4XXCA 3OKOA 3TO4B 2VLRA 2APFA 4IRSD 3T0EC 5F9JB 2W65B 2R0KH 3RDTC 3KAAA 4XXCC 5E8OB 5ECJE 1IC4H 3F7YB 1BQLL 5BMFL 2I9TA 1XCTB 4JKMA 1MIMH 3BAEL 3RGVA 2I25N 1T7ZA 4NP4L 3W0WE 2RFXB 4KROD 4GG6B 1JI2A 4GRMB 1PG7L 2XZAH 3B5GA 3WEXB 4YHIB 5GRYA 4PRHD 1AIFA 1JHTB 4PJXB 3SE9H 3JWNC 3O3EB 3OXSB 4MJIB 4WGVB 3R8BB 2Y9RT 5CGMA 2HRPL 1FNEA 1BJ1H 1BFOB 1WFUA 2C1OA 4LVOB 4WHYG 3VFVB 4LVNB 3G9VA 3VA6A 2Z91A 4FA8A 1ZAGA 4NHUA 4J23A 1EV2E 3H42H 2C4FU 4WENB 5F72S 5D1XA 3RL1A 1G7JB 5EB9A 4WNQA 5T5FL 4Y1AE 5HI5C 4WCYH 4NQCD 4TVSa 1EFQA 4UTBH 2HKHL 2Y25A 4Z7WA 1CFVL 5EO9A 5C0DA 3R8QA 5AUMB 1FYTB 1H5BC 1FCCA 3ZDYF 5L88L 3GSVA 4XP4L 4R0LB 3X13A 1T1WA 3ESVF 4MNQB 3OJ2C 1U95B 3SQBA 3GMRB 1OTUC 3FHQA 4QRUB 1HH9A 3BZEB 5FA3A 1UZ8A 4LEOB 4BSWA 3TCLA 3PHOA 3IJHA 4OKVA 1OSZB 2HJLA 3VWJB 4I0PB 3SKMA 3WBDA 3R06B 2QBWA 5BZWA 1PSKL 1WEJL 4WI7A 4EUPG 1N6QL 4EI5B 4NO0A 3SDXF 4PJ5E 1KCVL 2PF6A 1IKFH 1AIFB 1E4WH 1JHTA 3IDMB 4JRXD 4P2RD 4R6UA 3MLTA 5L0QC 4XRCA 3QWRA 2EYSB 1HCVA 1LK2B 4L8DB 4NP4H 3OJVC 4FQ1H 4Z7UA 1ZE3C 3OKNB 2X4OA 3QFDA 4HXAH 2EE2A 1DEEB 3LKSA 5C71A 3LIZL 4M7JH 3F7VA 3EOTL 1MRFL 4Z95L 3IF1B 3SDAD 1KXQE 5JA8B 3KLHC 4DZBA 1LEGB 4WDIA 4L8SA 4Y16C 5E9DD 4TYUA 1R3JB 3HCVB 1UC6A 1YNTB 3FQXB 4LHUB 4MA3A 2KL6A 1HWGB 4Y7MA 4KI5E 2E9IA 1WC7A 3S37L 4D0CA 4U6VL 3G08B 1IAIL 4G43A 2SEBB 2EEDA 4F57L 5C0JB 1XF2B 5EBGA 5FCUH 1VGEL 4I0PA 3BH9A 5BOZG 4L4VA 3VRLF 5E0QA 1FVCA 5IVZA 2FJFB 3WL9A 4ZPTA 4P5TD 4PJEA 1MAMH 3N50A 4PLNC 3ESUF 1U36A 4OLXL 4XVSL 4I9WD 4JFFB 1CQYA 3T1FA 5IMLA 3EYFA 5J1TC 1LO2L 4GKSB 5TF0A 3Q3GA 2PKDA 1MFBH 3WIFB 1IQDA 5I17B 1H3GA 4DVBB 1RIVL 5SWSB 3FT2A 2AK1H 1KJ2A 4J6RH 5FGSA 3OZ9H 4X5XB 1P53A 5INDB 1KJVB 3IFPB 2PO6B 3LZFH 2R2EB 3IXTB 3QPQC 15C8H 3QCVH 3BVNB 5M95B 3HCVA 2NR6C 4LU5H 4WU7B 4WJ5B 3ULVL 3H9YA 1QRKA 3MUZ1 1QLFA 4MD0A 2IC2A 1BECA 3LIZH 4GXUN 3STLA 4BQBA 4OZIB 1CICC 3GSWB 3V0WH 2LTQB 4M48H 2Q8AH 4LFHG 5F7EH 4YGVB 1AGEA 4XH2A 4XI5D 1BZQK 4TTGA 5C7XL 3O3BA 1B3JA 1OAKH 1A1OA 2MQ3A 2X4QA 3O6FC 3C6SA 4XMPH 3IDXH 1MCNA 4HWZA 4M93C 4PJHE 1MOEA 2HFEA 3L9RA 2Q7YB 4NOFA 4YHPA 4YZFF 3G04A 5ICYB 2EYTA 3VCLA 4GMSH 3OR7B 2B39A 4Y5XC 3NA4A 1NMAL 3VWJD 4Q2ZA 5IVXE 4S1QH 5A3IC 3QFJA 2BP3A 5I0ZA 4OZFA 5I15L 1U3HD 3VGDA 4KHTH 5GISH 2DM4A 1A7NL 3RJQB 4AY0A 1NDMB 5F21B 5DQ9B 2ZPKH 3E3QC 3STLB 3W0WA 3CD4A 2FX8L 3QQ3B 3WKMH 5FO7A 1YEFH 1TZIA 3RWIB 3QO1A 2NCMA 4WI9A 1LO3H 2MCPH 4HJJL 3ZYOA 3DGGB 1YQVL 4MA7H 3BYTA 1QRNE 2YPLE 3W0WD 4G8FA 1OB1A 2Q7YA 4LHUD 4PRNB 3GZKA 1UYWH 2GSGB 3PP3H 2P5ED 1MVUB 1KF9B 5KN5B 4HFUH 4IRSB 5FFLA 3STBA 4Z78B 5LCVL 3FTGA 5B8CC 1P69B 2R0KL 5IP4A 2FIKA 4XNYH 4MSWB 1JK8B 2BVEA 4S1RH 3H7BA 1IKFL 1E4WL 5BVJA 1NFKA 4PJDB 4CKVX 3ARFD 1P7KA 2FWOB 1LK3L 2VLRE 3NMEA 4JFFD 1DQQA 1TQBC 1REIA 3RVXC 1N4XL 5CEZE 4LCIH 1DEDA 2WWMD 1OT2A 2HJFA 1U8OA 1VESA 3T1WA 3CVIH 5D7SH 3MCG1 4P48A 2JCCB 1CLZH 1K8IB 3C8KA 5IB3A 1WZ1H 3QNZB 2AGJH 1NCNA 3UMTA 2GCYB 1IBGH 3WHXA 4JRWA 3RTQB 3ZKQD 5EOCH 4NWTL 1DQMH 5IQ7H 1XR8A 1KIPA 3DECA 5L9DL 1KCUH 2AQ3A 2D2OA 2PYEA 3GB7A 3D0VA 3G6JA 1JV5B 5GRXG 5HI3C 2R2BB 3MLRH 1MVUA 1FFPB 1VADA 5CD3B 3L3DA 1CD1A 1QQDB 1PKQA 3DXAB 5ALCL 3DHJA 4CNIB 3QISA 3IU3B 3IETA 1XF1A 3RIAF 3MYZA 3U9UB 2F9BT 4Q97A 4X7TA 2A77H 2HYMA 5SWSE 4NZDA 1C1EL 1YYLL 3HNVH 3ISWA 1X5FA 3NA9L 1KCRL 5I18H 1S78C 3BGAA 1U0QA 3DROB 1RZJC 5IVXB 5JMOC 3GMOB 1P4BH 3DHMA 3BE1H 4OM1L 1JUFB 4OZFH 2P8LB 4S0TD 3NACL 3TZVD 1R5WB 2L4OA 1F02I 1ZHBB 2JF1A 4H25A 3VXUD 4KQ4L 1EJOL 4FQ2L 5IEHB 1K4DB 2G9HA 1WIUA 4JFXA 4YWGH 4Y2DA 4RAUA 5GGRA 4FQ1L 3B5HA 2QEJA 3GKZA 2PO6D 3Q1SH 3PWLB 3ROOA 1EFXB 3PGCA 3FOMA 1YQVH 1QR4A 1HSAB 4POZC 1H3PL 3ZT5A 4E41B 3QIWD 4O9HH 1YN7B 1Q9WA 3BFOA 1XGUA 2FYYB 5T3ZL 4DGVH 1AC0A 3IU3A 4HJGA 4JY6A 1RURH 3LKPB 3GM8A 5CILH 4HD9A 4DKDC 5C09B 2DQGL 4N0FB 5IBLC 4PGDA 1UH4A 4GKNB 5DJXB 4PJFF 1DBKH 4YDJA 3WNOA 4M5YH 5IHZB 1IKNA 1I7UA 2ICES 5F1IA 1MNUH 1U91B 4KHXL 1AQDB 5JZ7C 3B9VA 5I16B 1MCWM 2QKIA 3PWPB 5EWIH 3T3PF 3OKDB 5DFWH 1AD0A 3HC3H 4KI1A 5HVFB 5I1HH 3WJJA 3E6FB 3RU8H 3CC5A 3E2HC 4DKFH 2XTLA 2O5ZL 2A74B 1RD6A 5D7KD 1G6RB 3TPUB 3OJDB 3WDJA 2YS4A 1KB5A 4PREB 3LEXA 4JZJC 5I73B 1EPFA 4L4JA 2FJGB 5MENE 2NLJB 4HEPG 1PQZB 4QEGA 3K8LA 5GSVA 3RBSA 5GS3A 1J0ZA 3PP4L 2R4RH 4MB5A 5E2TL 1F45A 1T7WA 3MXVH 4I18C 1F6LL 2UWEB 4NQXB 5INCA 4Y19A 3QG7H 1A3RL 3PHSA 5DJYA 5A2LH 3S96B 3V0AC 9CGTA 2AJSH 4P2QB 4P5TB 4RMQA 2DQDL 2X4SA 3S7GA 1DUYB 5H35B 3V4PH 1QBBA 1FIEA 4MXQD 2AEWA 3HLAB 3S36H 2LFGA 3MBXH 1HNGA 2H3NA 3SGDI 3E6FA 4WHCA 1JRHI 5T3XL 3O2WH 2NQCA 2PXYD 4U33A 3H9HB 1NUDA 5CGTA 5LBSH 2WM0A 4YFDB 3OB8A 3IDIA 3BT2H 4NKDA 4X6BA 2AJ3A 4U1LB 1CFNB 4Y4FC 5LWYH 4XTRC 1WAAA 4P23C 3LKOB 4PREA 1ITCA 5FUOL 1BQSA 2VMFA 4M7KL 4UINH 4JJHA 1ZT1A 4MNGA 4TQEH 4DOHE 4BZ2H 5AG9A 1AHWC 1S9VB 4LASL 5DHYA 1FP5A 4LVHC 4BQ6A 5BW7C 1SJEB 4U3CA 4R7NB 2ADJB 2DMKA 3HUJB 4NKQB 4XPBL 5I2IA 1FZKB 1FVEA 1VKXA 1QZ1A 4Q7DA 3KJ4B 1RZ8B 3ALWA 3BKYL 5DHXB 2VZTA 2ITCB 1VHPA 3EO0B 1M7DB 1U6AH 4HPYH 1MI5A 4JQXA 4N8VG 2O26U 5C0EB 3UTTA 4X8XA 4NKOA 4NJAH 4U7MA 5D5ME 4M8QB 4NZTH 4LLQB 4M5ZH 4DCQA 5IKCB 3FO0L 4M93B 2J2ZA 4GBXD 4EUPB 3KYMB 4I9WE 1KTLB 2MWCA 3KNBA 3MREB 4P49A 1OVZA 2EC9U 4NKMA 3DO3A 5JLZB 3C08H 4YPJA 1HI6B 1RUAH 5GJSL 2AEPH 2D7PA 4M61A 4HQQL 3QYCA 4OFVA 1JCKA 3PABB 1P5UA 4KRNA 3REVA 1CGSH 1X4YA 1HXMB 3TFKD 4LIQE 3ARFB 1GC1H 2UVEA 5JW5A 1PZ5B 4BFEA 1XGQA 2E7CA 4ODVH 1S9YA 5B39B 5I6XC 1BFOA 1BJ8A 4NC1E 5HHXH 4P9HH 1HQRA 2DLHA 5E2TH 5DEGA 5DK2A 3PXHA 2GUOA 3D39E 4WIQA 4LSQL 4NHUB 5E56A 2ADJA 3HUJA 3WYRA 2OI9B 4CW1A 1OAQH 4ODXB 1Q9KB 4WNQB 5C6WH 3QIWA 2BY0A 4XNZC 4OB5H 3TVMC 4OGAC 4OSUH 1FZOB 4U7SA 4LNVA 1BJ1J 2HN7A 1DVFB 5E08L 2F5BL 4HIEB 4PP2A 5MP6H 4UDUA 3ILQD 3JTTB 2OK0L 5IVOA 5DS8A 4PJEF 1XR9B 3WJJC 2DQTH 1FLTX 1N6UA 2VXQL 4JHAL 2V7NA 1TETL 4PJ9C 3R4DA 3T0VA 5J57B 3MLWL 4XNXL 2UV3A 4PJCE 5BZWB 5E1AB 3KJ6L 3B8YA 4XNQA 2BMKB 5D7JC 5JW5B 4U3HA 3MV11 3DO7B 4NUJA 5KOVC 3WIHA 5B39A 5I8EA 1A7RH 4KK6C 4U2ZA 4I3GA 5D1QB 1OAZL 2A83B 3MOBL 1ZA3B 3DRTA 3TT3L 1AFVH 4RIRA 1KC5H 1F4HA 4KY1L 1U58A 3H42L 4ODXA 5ANMA 2A6IA 4AEHH 4Y4KD 4KVNL 5B4MC 2XXMB 1WWAX 1J8HA 5ELIA 4L3EE 2V5MA 2BVTA 3SPVA 1B90A 1FL5B 3WKML 1YEFL 1ZOXA 1H3PH 3G5YB 4QXUH 1ZHLB 4WUUA 2QV2A 3HR5A 3QUZD 1MHPL 1AD9B 3BIBX 4Z95H 1TCRA 5SX5H 2CK0L 4RBPK 4XP9L 3X17A 4XX1G 1SEQL 4QHKJ 2XZCH 2H45A 3GGWA 4XP5H 5HI3D 2Y5TB 2YMXH 1QR1B 2AJXH 4Z7QF 3NABH 1GZQB 4P2OA 2EKSA 1J05B 3DV4B 2NY1C 2AJZA 4GH7B 3BSZH 5CINL 4UV7H 4WFED 5IV2A 3L3OB 2HJKA 3MGOA 5E9DA 5D5MF 5SV3A 2FLRT 4DN4H 3MJ7A 2CKBA 4PRAA 1NAML 4BM7A 2X05A 5MEND 1RMFL 5MI0C 4JDTL 2LABA 3BH8B 1UJ3B 1U58B 4XBEH 4EVNB 5JO5B 3H3BC 1LGVA 1EGJA 5B3JF 3FT4A 4ODUB 3BP7B 2X7LA 5E7BA 2OS7A 5JZ7D 3ECBA 4BA8A 4OIIL 4LLMA 2YBRA 5DK0B 4H5SA 4XT1C 4ZD3H 5GJTL 5EFIB 5EUOB 3OKKA 5IW6A 5J1AB 4YC2B 2BSRB 2R8SL 1MF2L 4AJ0A 3S34H 4MJ5B 5C0CA 3F7YA 5FYLD 1W0YT 4LMQI 4UMGA 1JNNL 1ZANH 4HK3J 4YHIA 3MOAL 1GZQA 4P2OB 4MNGE 2OL3B 2QLVB 2WUBL 1QFHA 2ZOLA 1SYSA 3S4SB 3U1SH 4P2QD 4UTAL 1I3GL 3BHBA 3VW3L 4XPAL 4AENA 1OD7A 3JWDC 4WVRA 4V2CB 3VI3E 3C5ZC 3O0RH 4K3JH 1MFBL 5ABDE 2MFNA 5FM5O 3VD3A 4JFHD 3IFNH 4ONGH 4P5MA 4JFFE 1GSMA 3KXFA 2VISA 1I3RA 4N68A 4UUJA 1MCKA 2EDYA 3EOBB 3ECBB 4X7FC 5C0CD 4PJ7E 2JJWA 2JIXA 4CU7A 4EI5D 4PJXF 1YPZA 5IT2L 4NNPH 4PGEA 1NBVH 1N0LA 1QFWL 1NKOA 1CN4A 2MCG1 1A9BB 3QEGH 3FB8A 4ZOBA 3QXAA 4OZFG 5CSZA 4X7SL 2F58L 3B9DA 3EDDA 3V6OE 4G3YH 1WAAE 1QFWI 4MNQA 4OQTA 4R96A 4XCCH 1QLRB 2UZXB 3OB0H 3OKEB 4G9FB 4JFZH 1C08B 3VXQA 5E08H 3QQ4B 3HNTH 3QEHB 2YD2A 3H0TB 3I02B 1QFUL 4PJAA 3SBWA 1A6UL 5LGJB 4N1HB 4L8DA 2YUXA 2HKHH 5GGVY 3FCTA 4P4KC 1KELL 5EOTA 2PUQT 3UBXG 5KN5A 4LEXH 4HKJB 3GMQA 3HZKA 3NCEB 3QFDB 4Z9KB 3MV8A 1J87A 4WWID 3NAAH 4NUGH 3WNKA 3RVTD 2HRLA 4LLVA 2FIKB 3FN0L 4KK5C 2CKNA 4IRJC 3GMMA 1HE7A 4RMUA 1KGCD 2BHYA 2X4OB 3LEYL 5C08D 5AZ2H 3UTQB 1PSKH 3U0PA 3F7VB 1TTFA 2YSSA 4OZHF 4YDIH 3QUXC 5IR1B 2VQ1A 4C56D 1FYTE 1FFRA 2BY2A 1RK1B 4XNYL 2QHRH 1B2WL 3GI9L 4JGMA 1BWWA 3T0AA 1CDBA 5DO2C 3GUTA 1UWGH 3DVIA 4HK0A 5J11B 2GK2A 3QNYB 5FYKE 3RI5K 5F9WC 5D2NA 3LN9A 5CD5C 4XCYA 4YE4H 4OCNC 3A67L 2FLBT 4HWEL 2FL5A 1HHJB 2V6HA 1MH5B 1S7TA 1JPSL 4Y2OA 5BW7A 3B2UC 3KPSA 1GGUA 1CU4H 2R2BA 4IRZH 3RVVD 2W0FA 4NSKB 4F7PB 5BRZE 4FQXA 5HDLA 3DVGB 5TQ0L 1KJ3H 1SM3L 2W9EL 1A1MA 1GGBH 4U1NB 2D03L 3QI9A 2Q86B 4GBXB 4LSTH 1I9EA 5E6IA 3HC0B 1JWUA 4QKXB 1HHIA 5L2JA 2NY2B 4LMQE 4C56E 5HVGB 3CPLB 4PJ9D 4JJ5A 1X5KA 4D94A 3TIDA 3ULVE 4PRDA 1N5YL 1OP5K 1QFWH 1TDQA 3VFPB 4ODTH 4Y0GA 1MAML 3ZSTA 2L0DA 1K9TA 3RNQA 3MLSL 4P4RA 1EXUB 1KIRA 3VXOB 5GZNC 3L5WB 3CFCH 3ZHLA 4EDWL 4EN3B 5SX5K 4XH2B 2G9HB 3GMLB 2O5XL 5C1MB 1VPOH 2WINA 4JFXB 5DK3A 4RGNC 1NCDL 5HYFA 4S11A 2AV1A 5JIPA 3F62A 4J6RL 4OBSA 2FL5B 3UJJH 5I1JH 4L8CB 4U0RC 3RWFB 3H3PL 3S98A 4Y4HC 1CGXA 2NY2C 3V4UL 4JM2A 5JOFA 1JPGA 1AJ7L 1F4XL 3AMKA 3ZE2E 4D9RE 4I0PC 2DQUL 3P9WB 1AP2A 3QUZB 4KKAC 2KDGA 5L6YL 5CGYD 4IS6B 4CU8A 1T66C 1F6AA 3TWCL 4WFFD 3BPCB 1T2QL 2V9RA 3D39B 4ZUVA 2XOTA 1JI1A 3MRLA 3K8MA 1UWXH 4S1DC 1IAKB 3O4OB 2ZUTA 1ACZA 4LF3A 4BQ8A 3W0WB 1RUQH 2ZCKH 4MAYA 4NRXB 2VIRA 4U1IB 1G0DA 3QULA 3GSRB 3TBVA 1YEIL 1OSPH 1YUHA 3E3QE 3MO1B 5EORH 1G7LA 3C87A 2BNQA 1UG9A 4FABL 1DN2A 4JY5H 4W6YB 4B50A 3K4AA 1ES0B 2E7MA 3TNMB 5D70L 3GSOA 5GGTL 4Z5RB 1Q9LA 2PW2B 1R24B 3MA7A 1FE8H 5DQJB 5CS7A 1VFMA 3WFCL 3KPRD 4PLKC 1IFHH 4JZOA 5K33A 2Z35B 3BIAX 4Y4FD 3D18A 3GEWB 4LGSB 1W72H 3RGVC 3WN5C 2NLJA 5E6IC 3DGGA 5FO8A 3DGCR 3C5SB 1T20A 2RIKA 4IS6A 4KJWD 5HHPA 5I19H 3WLWD 5EBWB 2PTTA 1J86A 3F7RA 4G42B 4LHUG 1NGYA 5EU6A 2EDKA 3F5WA 3V4UH 4C57C 1X5IA 3QHZL 4IRSA 5GQBA 4G9FD 3V95A 3GK8L 1YJDH 1F3DJ 4OD1H 3BMVA 5D7LE 2NX5A 2C3HA 4Y4KC 3EFFB 3NFNA 4S2SA 3VMPA 2MCPL 3U36B 3B2UD 3N1QC 2VDML 2R69L 4LEXL 3VW3H 1CZ8H 2JJTC 3SGJA 4DOHB 3BUYB 3EYUH 1ND0B 2HWZL 4UIMB 2UWEE 3NIDF 5TFSH 3QNZA 5B38G 4I3RL 2AK4D 3CFJB 3V0VB 4PBVC 1ACYL 4Y4HA 3RWJA 1MHCB 2EEBA 2XN9B 2NYYD 5F9OL 4WHTB 2X4UA 4MLIA 1Q72H 2HP4A 3ZO0A 4F7TB 5JHDA 3KXFE 4YDIL 2Y07H 5CFHA 2LTQC 1F4XH 5I8KH 1I85C 4CAGA 3H2WA 3MLZL 3CZJA 3M45A 3TZVB 4JQIH 4PRBB 5C9JA 1NCBH 3NCJL 4LPYA 4F9PA 5J9PB 2WBJC 4OD3H 2XXCB 5TE7L 1WBXA 1EGJH 3HAEB 4MX7A 4R7NA 5EU6B 3SJVA 1IGFL 1VACA 5BS0E 4OGYL 1CDIA 4X80H 5CHNB 4M7KH 1I8IA 3BWAA 1LILA 4UIKL 4E41D 2C1PB 4ZUTA 1RUQL 1BVZA 1DBML 1RJZA 4LLUA 3VJ6A 1LEIA 1IM3A 5FHAH 1MHHA 4H25B 4F37K 4WFHE 4XPGL 4Z7VF 4JRXE 2APVA 3CIQA 3NIFE 1A5FH 1HI6A 3MLVL 2P8LA 4KDWA 5TE6H 3BQUC 5JXAL 2BVQB 5EIIB 5IVXF 5HVWA 5IEHA 4GW5A 4NNXA 1OAUL 1X5AA 3VXSD 3ARRA 5I1DB 5TH2B 4XGZA 2ENYA 5KW9L 4CBPA 2QSTA 1RFDH 5GS1C 3LEYH 4C56A 4U6HA 4F80A 2YA1A 3CU1A 4XC3L 5FF6A 4HX1B 2ED7A 2XWJA 2ARJQ 1LEKB 3MODL 3OJMB 3QCTL 1IJ9A 3MZGB 4JAMA 4LP5A 3ARGC 5SV4A 3T2NL 1NCDH 1WJ3A 2DN7A 4GG6E 3BJLA 1IAMA 3I3BA 4M6NL 4PJIF 2EC8A 4Q6YA 3BRDA 4LL9A 5T33H 3CFEA 4LVEA 1J88A 1IC7L 1PAMA 1AO7B 3U7YL 3DYMA 2BRRL 5DRNB 3V0WL 5BV7H 4OUUA 1KENL 2NY7L 2BJML 2CSPA 3LKNB 4WO4A 1G6VK 4KQ3L 2VDMH 3UROR 1CFSB 4LGPB 1B0RA 2HTKC 1SY6A 4UT6L 5C0GA 2Z8VC 5A1AA 1U91A 4MLSA 4M1GH 3CFIC 4J1UB 2VTFA 2VABB 4LSUH 4QHNA 3LVEA 4JDVA 5C0FB 2OMBA 4TOYH 4UT7H 5TDPB 3ABZA 2JKXA 2VUYA 1D5ZA 1XZ0A 4TPRH 2ATKA 2BMKA 2DQFB 1IAIM 3K2UH 1YYML 3DYPA 2CLVB 5C08B 1PDKA 5HYQB 4OLYL 3SDAA 1GHFH 2HT2D 4QHMB 2OMNA 3IS0X 3P4OA 5IFJA 4DWHA 5I1AA 3U2SA 4P5TA 2APBA 3ZHDA 4J8RB 4YK4C 3G6JF 4ZXBA 1G9MH 2IJ0C 3I6KB 3B3IA 5KSBA 4KZEL 1UM6L 1X5XA 2OQJB 5C2BH 4LRIC 2J8UA 4LVNC 4L4VE 2AJUL 5BZDB 5E4EB 4NDMB 2R56H 3RZCD 2BJMH 3QUKA 2DTML 4ZUSB 1S7VA 3MLUH 4XPTH 1N3NB 3W39A 2BX5A 3INUL 2BNRA 3TWCH 3L3GB 3JWOC 4N0UE 3UZEA 4NZRH 4PJXA 4TNVK 3HMXH 3U30C 1MRDL 4OF5A 4TUKL 4U6XB 4PJGE 2CKBB 2M2DA 3SKJH 3C5ZD 4OLZL 5TQ2L 1LK3H 5FDWB 4X7CC 1X6NA 3VFUB 3P4OB 3TT1L 1N4XH 1S7UB 1N7ML 3MRFB 3HAEH 1EMTL 1A3LL 4KPHH 1DANU 1IEAB 2Z4QA 2X2YA 4GRLA 4ZTOL 3UDWA 1H15B 1AKJB 3C6LD 3GI9H 2DYPA 5BO1H 5C6PB 4OCWH 5IW6B 3X13B 2R0LH 5FYLL 4ZNEE 2NTFA 3F8UB 3T4YB 1EVTC 3GSQB 1I9JL 2CGRH 2B0SL 4LLDB 2RJMA 2XQYK 4ESKA 5C0EA 3RNKB 1NGZB 5F1KC 1JNHA 3VWJA 1HHKB 5EU6D 3RPIB 2ZCHH 1BLNB 3MRGB 5ALBH 2DYPD 2CIKA 4HLZH 4Y5YB 3BZEA 3EJYC 3ES6B 3FQTA 4M7LT 1E27A 1W0WB 2UY6A 4OV5B 3P0VH 4NQEE 4NOBA 2OI9C 2CDEB 4TUOB 4O4YL 3O6LH 1U8NA 1EEUA 1F58L 1JWMB 2FX7H 3VXMA 3X11B 3O9WB 1NMCC 2VR9A 5C3LD 5B38A 3TCXA 3F12A 4UV4H 2BVYA 1G7QB 1B4JL 1DEEA 3NCMA 5CIPB 1NEZA 4XP1H 5DEZA 5DRXA 4AMKL 2YPVL 4KKAD 4F9LC 4TSAH 2NXZB 4I3RH 5LKNA 1V3JA 3L5XL 4IHOA 4IMKA 5DA4A 1BM3H 3DBXB 2H8PA 4KUZH 4RGNE 4JFEA 1KJ2H 3MV9E 8FABB 1NGWB 3PL6B 5EU4B 1SQ2N 4BJLA 5C70A 4Y5VB 1NPUA 4DZBB 5HD8D 4WDIB 4HIEA 4PP2B 35C8H 1WICA 1YNTA 3FQXA 4LHUA 1LO0L 4K7FA 2FX8H 4KKNA 4XVUD 5DC0A 2JB6A 3U7YH 3ARTA 3Q5TA 3U7AA 5IB4A 1FL3B 3BKMH 3VD7A 2ENSA 2Z93A 1JNLL 3VFSB 3VG0H 4Q9RH 1A7PL 3HMXL 5CZXD 4KJPD 3BO8B 3WLBB 3E6HB 3KLDA 1U2CA 3KJ4C 5CUSL 5D1ZB 3DVNB 1ZA6B 4HSQA 5DT1L 3QUYC 1DBMH 4I8DA 1N59B 2B2XL 4JFFA 2AGJL 5SWZE 1NJ9A 1TJHH 3PDOA 5SWQB 4BSJA 1RSFA 2AEQH 3QDAA 3BW9A 2BHUA 4HDIB 5I1IH 3QIUD 3PGFL 4MD5A 1LO4H 3VXNA 2JJTA 4KJWC 3QDGE 1R5VB 1BEYH 4LCWD 5D1XC 1UCTA 1HEZA 3WN5B 3UTQA 1MLCB 2PW1A 2DWDB 3RY6A 3KPNB 1QLEH 4DN3H 4YC2C 3S3JA 1HKFA 3MA9L 1S9WA 5ERWA 1G1CA 1QFOA 2R0ZH 1FG9C 4QXTA 1BIIA 3D69A 2WMPA 1P6FA 3MOBH 3VFWB 2D9QB 1AO7D 3WXVH 5MI0B 4ONHB 4ERSL 1N59A 3ZKXC 3LV3A 1YNKH 4HIJB 2GYSA 5SWQA 1YMHA 4BFBD 3FB5A 4N8VB 2P8MB 2VLJB 1ZT4B 4HWEH 4U0QB 1FGNL 2BDNH 4QRPA 3E1F1 3S36X 1QPPA 1R5VA 5HGDB 1WFOA 3QJFA 3BH8A 4J3TA 2PW1B 3V6OC 3SDXA 4I18A 2D7MA 5FK9A 3MRNB 1DBJL 2DQGH 3BE1L 3BPNC 4OKDA 1SJXA 3TO2B 1DJSA 5TE4H 4X98A 1FYTA 4DEPB 5FO9A 3CX5J 1UB5A 3QRGL 3QSKB 3ZHKA 2BERA 3TESA 1W0VB 3BKJH 4YX2L 2BFVH 2ATPB 3SQOL 4DN3L 2YUWA 4FFYL 2EE9A 4YDVA 2CRIA 1ZLWH 1DVFC 4YFEA 3A67H 1XCQA 2AXJA 1KG0A 3ULUL 4IOFD 3PL6D 4DTGH 4D3CH 3KPSE 2OL3A 2VDRH 3SDCD 2OJZH 1IM9A 3GJEB 4LVOC 3VE0A 2B2XH 3LY6A 2X4PA 4NNYA 1KBGL 2F19L 4PJCF 3EOBA 1BOYA 2C7UA 4ODHL 2YA0A 1MIML 3HPLA 5T1MA 1JK8A 4JM2C 4XP4H 5EBLA 4ZUVB 2ADIB 3MLUL 3KPLA 2J8UE 4QNPE 4LKXA 2NXYD 2VERN 4Z78A 4RGMC 4LF3B 5FK9B 4CN1A 2DQUH 1ADQA 5MEQA 3WO4C 1CTNA 3GSRA 1K5NA 4B7IA 3C09C 5C0AE 4K3GA 4N9GB 4ORGB 2C26A 4YXKH 1G7HA 2BK8A 3RVTC 3VXRB 3DJ9A 2YC1A 1NGQL 2N7AA 5FUCC 2I27N 3AMLA 4PJXE 3HE7C 1DBJH 1A47A 3SOBL 1A8JH 3OL2A 5DQJA 1MJ7H 3ULUF 1A7QH 2VZOA 1XCQB 5CSZB 5DQDH 3NIFF 4BFGA 3C8KB 3ALPA 4MA1C 5C07E 3W9EA 4IDJH 4DFHA 5KVGH 5JW3L 1FDLH 1AJ7H 3RX7A 3DX9A 1FNSH 2OP4H 3RL2A 1BVKB 5HBBA 2ZG2A 3OKLA 4K3EL 1AHWB 4JFEE 5ESVB 3BN3B 4L29A 3VFMA 4X6EA 2JK5A 3RDTA 4GO6B 1RZGA 3QEGL 5E94A 5AAWA 5EBMB 5IQ9B 3L3DB 4AG4H 2X9YA 4Y88A 1BOGA 4G3YL 1GGCH 2GTZB 2UVFA 4HBCH 43C9B 2FEDC 2Q76A 3KLAA 5ALBL 1LE9B 2CUHA 1K6QH 3V4VL 2HLFC 3KS0J 3D9AL 3BXNA 4H26B 2QQKH 3C8DA 1ZHBA 5L9DH 4WJ5A 4FNLH 4B5EA 1BBDL 4XVSH 3FONB 5T3ZD 1VCAA 5F71A 5LXGH 3KHOA 2BVPB 3BOVA 3UP1A 4M6OL 3N06B 5AWNH 4JFED 2NPLX 3EYUL 4NO2B 4YXKL 2BOBB 2EO1A 3C6LB 1T03L 3NA9H 4F9LA 1D6VH 4OF6A 4PS4L 2Z92A 4M9PA 2AW2A 4N0FA 4ZTPL 1MJ8L 1L7IL 3WDIA 3ARDC 1HHIB 4HQQH 2HT3C 4XB8A 5ALCH 1RZJL 1FL6A 3BZFA 5JUEH 1AGBB 5FOBA 1X7QA 4P3DB 4K7PH 3LKQA 5FA4A 5EZIH 5DRWB 3V5KA 2CLZB 2DKSA 3IT8D 4UTBL 1JN6A 1LO2H 4C4KT 3AREB 3RUGB 4EUPH 3EGSA 5HGHA 3VG0L 2ZWLT 4OGXH 3GBMH 4JO4L 4M5ZL 4OM0H 1P4BL 4O51B 4OM1H 1XGTB 2CQVA 2E9WA 1MY7A 2QHLA 2VLJD 1QBLL 1RZIB 5CCKL 1F2XK 1KPVB 4DN4L 3UPRB 4DW2H 5EO0B 2WINB 3P2TA 5AZEH 5IK3B 1RUKL 1JPGB 3EOAB 4QY8B 5AD0B 4Y5XB 3QIUC 3QUZA 1MFDH 5C07B 5FECA 1U8PB 2QSCH 4ODTL 2GEEA 5E4IA 3P11L 3BZFB 2V2XA 1VFBB 2BNUA 2AXGB 4EN3D 3QXVA 2FGWL 3HE7D 1PQZA 2LV4A 2IF7A 1B6UA 3RIFF 1AO7A 4KUCD 2NW3B 2DS4A 4OUUB 2GTWA 5BS0A 4YK4B 2P5WB 2OTWA 3HZMA 3L1OL 3JBG7 1GIGL 3FKUS 1WBYB 1MWAL 1TZGL 3SDCB 2DB8A 4WHDA 3QA3A 4KHXH 4PJCA 2X4TB 5K9JL 5DD5H 2QTEA 4O02L 2VXQH 4GUPB 3LS4L 4KQ3H 4G8GB 3EO9L 4ZODA 5EUKB 1CT8A 3HE6B 2CUIA 1UZ8B 4LEOA 2BDNL 3K2MC 4CJ1A 1YDPB 3QH3A 4ZO7A 5E2WH 3MA7B 1T3FA 3JUZA 5FGBC 1PW3A 1OCWH 4I0KA 4LSUL 1D9KA 2RR3A 5HHPB 1S9XA 5F1NA 1JZ3A 1PKQE 1XF4A 3IDMA 1DQLH 1PGRB 1IAOA 1CD1B 2XV6B 3QZWA 5JUEL 1MCPL 3QDME 1XF3A 4JPVH 4PJFE 2W38A 4JY5L 2EDHA 3GRWL 5IBTL 2X70A 3CNKA 2P5WE 3GBNH 1HQ4A 2PCPB 3F5WB 4OGXL 1Z2KA 3SDCA 1YY8A 4EUPA 3QA3B 4PRPB 4ETQA 4QWWD 1CGTA 4G9DA 5F6IC 4GMTH 1A7PH 2YKLL 1MEXH 3HHRB 4Y8DC 5C8JB 5IHLB 2YRPA 1FFQA 4LAJH 3ZKNC 2EICA 4HUKB 1YC8A 3BUYA 3KYOA 1KELH 5D7IB 1EHLL 1G9NL 1KTLA 2EDQA 4HMCA 3PNWB 4H8WH 3CFBA 2DIJA 2CJUL 3PGDA 4MQTB 1MPAH 4LCIL 3ILPB 3V4VH 2V17L 2ZSWA 2CDFB 4QOKE 2R2HB 3RWCA 5JW4N 3AB0C 1JYWA 3TVMB 2Z9TA 1GHFL 1TITA 1ZLUK 5D4QA 4MCYA 5ITFB 3A0OA 4NZRL 3FO0H 4PGCA 1OCWL 5DXWA 4NZJA 1IQDB 3OAZH 1WSST 1GGIH 3VXPA 2G2RA 2YZ1A 2VL5A 1RJZB 1H15A 1ACYH 1R3IH 4C83B 5F6HJ 4ZFOB 3JWDH 4O58H 5EC1A 4G6AD 3MOQA 3HI1A 3SDDD 3C6LC 2I26N 3LEVL 3WUWG 5DD5L 1NGZA 4ELME 3PL6C 2ILLA 1QHOA 4CN6A 2NR6D 3GO1L 1LEIB 4H88L 3SGKA 3UO1L 4DGVL 5JOPD 3FOLB 1AD0B 4NNPL 1SM3H 5C09E 3MNVA 1C5DB 4QO1A 3BP5B 1FZJA 3UPCA 5IESH 1MHEA 3C2SA 4X4ME 1WWBX 4UNUA 2DL9A 2D7TL 1NLDL 1AE6L 4L4TB 5E1AA 1FGVH 1QOKA 4HXBL 2VLMD 32C2A 4OSUL 3X11A 3MJ9L 1WFNA 2CDGA 3KPOB 5F7HA 2HLFD 5DJDA 5T5FH 4X0KB 1L6ZA 4MNQD 4MB4A 5E5MB 3FJTA 4YHPB 4AL8L 3HRPA 2MPAH 4L5FL 1U93B 4M1CD 1A0QH 3MJ9A 3LRSA 1QNZL 5EDXA 1M7XA 4PYGA 4YHMH 3X14A 3P9LB 1C5BH 1NUGA 1VFAB 3OWEA 4OCSL 4BZYA 1OAUH 4WO4C 1C12A 1NCTA 4R3SA 1TTUA 5DMKB 1RAMA 4YR6B 1L9MA 3QCUL 3ARBB 3WNMA 4HUXB 4PG2A 3PF2A 4RRPA 4P2CG 3FQWA 2X4RA 5C0GB 3TO4A 4GS7B 3ZKSD 1JF6A 1QSVA 3PIQB 5MERB 4KJYB 1MHEB 1TCRB 1QEWA 4ODHH 4GRWH 4M7LH 3GFUA 3VFGH 4MJ6A 5KTEH 5GRJH 3LKOA 4MA8H 2UUDH 5CLWA 3O8XC 3ULVD 4N9OB 2DQDH 1T1YA 4JFOA 4K94C 4HDIA 4GFTB 3OV6A 43CAA 3MNWA 1ZHKA 3BKCH 5DWUH 3WFBL 1BM3L 1QG3A 1SJEA 4DK3A 2OQJA 1E6JL 3MR9B 4M3JA 3U9PH 2R0WH 5JO5A 4WFGE 3QWOB 3HE6C 2XZCL 1Z9SA 4KVNH 4ZMAT 4WW2B 2ITCA 4J8RA 3QHTC 3L7FA 5A2KH 1UADC 3WIIH 4YDLC 3UTTB 2WIMA 2VLJE 4PJDF 2GITB 4NKOB 1CFTB 1Y18A 3KPQA 1WWCA 3D1MC 1OW0C 3KPSD 4FQ2H 1EJOH 3QWRD 3CK0H 1EH9A 1ZMYA 1O5DT 4NC1C 2HJFB 4N1CA 4I48A 1UXWA 1OAYH 3BDYL 1NGPL 3FO1A 4LSSL 2EXWD 4H8WC 4HIXH 4DEPC 4J3VA 1T7XA 3IGAB 4HW6A 2VYRE 2Q3ZA 3D25A 4D0BA 4JLRA 4KXZI 1F90H 2AEIT 4I77L 2K7QA 5C6TH 2O5XH 4K8RC 4NO0B 3WHXB 4KZDL 4GKZB 1FN4B 3JV0A 4BH8A 3GK8H 1GGBL 3ZT7A 5DSCB 5IFHH 1I9IH 2GY7B 4KK9D 2AP2A 3UC0L 3LS5H 3VMNA 5DURD 2A9NH 3CDGB 1LWRA 3UTPD 3RZCB 3RWEB 3IRZA 4X83A 1M05A 4QRPB 1YY9C 1A0QL 5DJ0B 1YEJH 3NZ8A 1XF5B 2IG2H 1NMAH 5HYJE 1HILA 4QRSB 2DQJL 4WU5A 1CD9B 5BVPH 1CWVA 3LKSB 2RAMA 3C5JA 1DQJA 1IAII 5D5MB 3MRKA 3RNKA 5DEFB 4H20L 4OZIE 2GITA 1URLA 1HZHL 2W59A 2G60L 1T22B 1QBMH 1YPZB 1JHKH 3O9WD 5DMYA 4PGEB 2NTFB 4HPOH 5GGSB 2VLLA 1A9BA 1DQLL 4G9FA 5BOPA 4YDVB 1MUJB 1L7IH 5DA0B 1HYSD 3MROB 3D25B 6CGTA 1NMBH 2RFXA 4OFYD 1U3JA 3UEZA 4BZ1L 4R96B 5JHLL 3QDJD 3QRGH 3DMMC 1OWRM 3B83A 1RZ7H 4N8PA 1P4IH 4PRPD 1F4YH 5KG9B 1IGTA 3CX5K 4PP1C 5EZLA 3V5DA 1UYWL 2YN5A 4S1SL 3RKDC 5L6YH 1O7VA 5FYJD 1YEEL 4HFUL 3VRJB 4YHZL 3S37X 4JY6B 3P73A 4I77H 5C6TL 1EUUA 1WIPA 2AKRA 3UBXA 5L7XL 5H37G 3F12B 4DJMA 1BGXH 4NO5B 2I5YL 2NY4B 3MLVH 5JPMA 4U1GB 5AUMA 2AK4E 3CXDL 3GMNA 1OSPL 2EH8H 2MHAA 4J4PC 3U82B 5JIHA 3GUTB 1DLHA 2IBGA 4OLXH 4WHYH 2Z93B 4YJZL 3SBWC 1J1XH 4ELMF 3IJHB 1QKZL 2BXYA 2QSCL 3OGCA 1I8KA 4XP1L 5ICXA 5D1ZA 5IHUH 3BGMA 4S1DD 2XG4A 4EI5A 5IMOB 4M3KB 1JGDA 4TRPL 3V7AE 1UZ6F 4HK0B 4KZDH 5MEPB 4U1HA 5J0BA 5KJRH 5E6IB 3BO8A 2CKBH 3OKLB 4JY4B 4MJ2A 3MRJA 1GZPA 1XGRB 5DR5H 4K07A 1Q72L 4U1SA 4HUVB 3IDGB 2Q86A 4RGND 4PRDB 5IB5A 2Q76B 1T04B 3WFZA 4Z7VB 3VFGL 5KTEL 2V2WB 3QXWA 5BCAA 1MCRA 3NCCB 2Q8AL 2PETA 3BXNB 4H26A 4O2FA 4RFEA 5DMIH 6FABL 3R0NA 2VUOA 4IBLT 4OQTH 4JM4L 1NFDB 5DJZB 3KR3H 5DURB 3O45A 4Z18A 1MAKA 5E2WL 5C0JA 5HGBA 1I8MB 5DWUL 1EXUA 5FEBA 3GMPB 4LBEA 5EOQH 4JFQA 5IVZB 3F7QA 2W65A 1Q1JL 5HHNA 4NQCA 3PGFH 4AEEA 4CVUA 1PG7X 1GC1L 4XCEA 5A2JH 2ZOLB 2X1PA 3RGVB 2N1KA 2DAVA 2WK2A 3AM8A 4OCSH 3AS1A 5DGRA 1G9ML 3ZDYE 1H3WM 1DTUA 3FQRB 4G8FB 4ZQKB 2IH3B 5IHUL 1EEZA 1KJ2B 3MXWH 1ONQB 1FH5H 4X5XA 3QXTA 4JANA 1U9KA 7FABH 3OPZL 4KK6D 4X9HA 5ADPL 3S88H 3A6CH 1S9VA 5DHYB 2V2WA 1P7HL 3TF7C 3VGEA 4DAGL 5AEAA 2VDOH 2QR0A 3AREA 5CP3A 3EFDH 25C8H 2IALA 4FTVD 1BREA 4O2FB 4P5TC 3H7BB 3D39A 2QQKL 4O51A 5FKAA 3EYQD 3HPJB 3O81A 4MA7L 4HC1L 5FDYA 1KULA 3U4EA 2A6JA 4LBEB 1U8OB 1ZLVK 5HPOA 4JFDD 2ERJB 5GS2D 3C9NB 5IMMB 5I1HL 2DF3A 4LQ1A 1CDHA 3L3KB 3M17A 3PXJA 2ICWA 3ZTNL 3PHOB 1MLBA 3EHBD 5GXBB 1TJGL 2F53E 3D3VE 3L5JA 4PJAE 2A2QT 4V1DA 2DM3A 1OHQA 5J13C 5CP7B 1K3ZA 4TOYL 3D0VB 2NY6C 2QADB 1UXSB 3G6JB 4BK5A 3ZE1F 3BX7C 1G6RH 2OR8A 5E2JA 3JTSB 4NRZB 1EUTA 4XRCB 5CJOL 3GHEH 5DJAA 3S6CA 3K0WA 5IBUB 3HB3D 4R8WH 3CMOL 5T1LA 4M7ZC 4OFDA 2OTWB 4LCUB 1LP9B 2IANA 3KPRB 4KKLD 1XT5A 2EO9A 4HS3A 3BD3A 1S7WB 4JN1L 5J6GA 3MRRA 4MQXD 1OP3K 5F6HI 2FEDD 3X3FH 4UT6H 1E4KA 4Q6IB 4PJCB 1BFVL 2W92A 3VDBA 4GAFB 3M8OL 1KB9J 2GQHA 2ED8A 2LQRA 25C8L 1MRCL 4Z8FL 3ZYZA 3QEUB 3M17B 2IADA 3MLRL 3QXDA 4KROC 3PP3K 2FBJH 4ZSOB 3IVKB 5I1EL 5LBSL 4Y2DB 5GGRB 3AM8C 2FD6H 4KTDL 1KT2A 2AJYH 5CP7A 4W81A 2XQYG 3KLHD 4G8EA 3VA2C 2OJEA 2K7PA 2DQHL 4AEIH 4F7MA 2QSVA 3H3KA 2HVKB 4DUWA 2VZUA 2YXFA 3MRMA 3K46A 4L9DA 4N5UA 1U8IB 1CDYA 1ORSB 1FFNA 4JHWH 2N7BA 2HAZA 1LE9A 3A6CL 1A6VL 2PXYB 2F8VA 5IB1A 1E6OL 4JREB 5JOPE 5H94A 1WT5C 1CXHA 3JV4B 2V7HB 3BKML 3TIDB 4P2OC 4V1DE 4JO2H 3E0GA 2X4NB 4FQHB 3BWAB 5JW3H 4I5BB 1X5JA 5IGXL 4NZTL 4CGTA 4OAWB 3ZYIA 3EOYG 2FHBA 4LLWB 1KTKE 4PP1D 2CMRH 1U42A 2BVQA 2Q6WA 3V7MA 5TFSL 3MRHA 3RPKA 4HH9A 4OJFH 4NO2A 3NCJH 3IVKA 1I8LA 5CILL 2XIDA 4K71C 4TQEL 5JXED 1HDMA 4WW1A 1NCCH 1RI8A 1JGUH 2ZCHL 2NY4C 1Z6JT 5I1DA 5H8DA 1RJYB 5BRZA 5JOFB 3UTOA 3CFEB 2OR7A 3O8XA 4OGZA 4WCYL 5C9KA 4LQFL 5GSVB 4JFDB 3MLSH 1CK0H 4ZNEA 4GRWB 2AK4B 2EDFA 5GHWH 1R3KA 4Y1AB 1LP9F 1UVQA 2DD8H 4R4FH 1XGPA 1CFSA 1EJ6A 5EC1B 1OOAA 5BQ7B 1V3KA 4MJ4A 4JO1L 3WNLA 2G5BA 3TV3L 4JRYD 5EFIA 5EUOA 2XA3A 2FECL 1I1YB 3EJJX 1HYSC 3EDJA 2NY3C 2MTPA 1G7LB 4TNWK 2FX9L 1XGTA 2BY1A 1OGAA 2EZ0D 3RDTD 2XQBL 1UKQA 3T0ED 1BPVA 5T33L 1RULH 1BAFH 4F58L 2HTLD 3V7AG 4NWUL 5CEZL 3WJLA 2B5IB 1A6UH 1QSED 2O5YL 4NN6C 1GPOL 4LCWA 3PQYE 4YBQD 2AABL 4X6CB 5HTSA 3CUPA 4CADA 3C2AH 1GCFA 1JHLL 2NY5L 4HMDA 2ARJA 2EIZA 1CLOL 5K59E 4G6MH 1A6VH 3L7EB 2VNCA 3ZZ1A 1XIWA 3HE6D 1XAUA 2OCFD 1S7SB 4OZGB 4LOUC 5LAXA 2NX5E 1ADQH 1Q1JH 4V2BA 3L3IA 3EYSL 2E27H 4P2RA 3UBXI 2JIXB 3EFFA 2MPAL 2AERT 3U4BH 2WANA 5I16A 4KTEH 4GUPA 3ARBA 4H1LA 5F8QC 3QI9C 4AIOA 4M8QA 1WBYA 1U8QB 4PTTA 4YO0A 3B9AA 3PHQA 1KXTB 3DARA 2L7UA 3LN4A 4ODSH 4WI3A 3JV5A 3P0YH 4HIIA 4P9HC 4UT7L 3V0VA 4Z0BH 4ZUSA 1M71A 3G5VA 3PV7A 4X9GA 1D9KB 3FMGH 3O41A 3TPUA 3X3FL 1P2CB 4RAVA 1YYMH 5D96B 3UTTE 3HE6A 5D1QC 5FYJU 1S5IH 3RVWD 1UCBH 4PJ5B 3EYVB 5TDNB 3OKYA 2Z8RA 4AH2A 5HPMA 2JJVA 3B4NA 2FB4L 5DRZA 3L5IA 1XF4B 1J10A 1CS6A 4HKJA 5GHWL 2X10A 4GRWF 1NAMB 4OCXL 2DYPB 1A6AA 5F7FA 2CR3A 5E8PA 2M1KA 3K7UA 1QVOB 1PY4A 5KSUA 1AH1A 2VJXA 3DNKA 1U92B 2EDNA 3PQYA 2HN7B 4KHTL 1E4JA 2VDLH 3X12A 1WQVT 3IDUA 2XTJC 1W8NA 3JXAA 3Q6GH 5TDOB 5D7IA 2ZCLL 2HT3D 1MCQA 1G7IB 1KNOA 1ADQL 5IR1A 1IGCH 3VD9A 1INEL 4NZUH 2F53A 3D3VA 3GM0A 1UXWB 4I48B 2E27L 5E00A 2DM2A 4DGIL 2AXHA 2LVCA 3FZUD 4GRLD 4JPVL 1A4KA 3OAUH 4X6BB 4JQVC 1BJMA 1FZMB 1RUPL 1Q94A 4H0IA 2DTSA 1FVDA 5BS0D 1S9KC 4ZOEA 3ELAT 2WBWB 4FQCL 2X40A 5TH2A 1DANT 1MI5E 5ITFA 3HA0A 4X6CF 2K1MA 2J6EL 2R0LL 3WLWC 2NY5H 3PE9A 2ZP0T 4MNGB 1CGWA 2BNQD 2GIYA 2AEPL 1YECL 1MEXL 4ZOAA 5D8JL 4G80A 4FFZL 1XF5A 4BQ9A 1EMTH 4AM0A 3D87B 3HC0A 3UDWC 3TBTB 1T2XA 5B39G 1U8KA 3G6DH 1CDGA 3CH1A 2A1WL 2VDPL 3B9EA 1YEIH 2V5TA 4R0LA 3D0LA 4KTYA 3B8SA 5DFVC 1NGWA 3PL6A 4H1LH 5EU4A 2XY1A 4ZFFA 3IU4H 3JZ7A 3M07A 5D72L 3O2DL 3OX8A 3SGKC 4KH2A 5D93C 1O7SA 3JVGA 1BQHB 3T77A 1Q94B 4XHQA 2VR5A 5FYKD 3DVNA 2BNQE 3VGHA 4R2GB 1D5ZB 4TSAL 3OXRA 3ARFA 4JFZL 2A0LD 3MLTB 2JIXD 4HKZA 2EKSB 1GOFA 4TSBH 4ALAL 3DX8A 5J3HD 3BIKB 3ARGD 3PDOB 5HHOD 1I9IL 12E8L 2GJZA 4JRYB 4PRID 4JKWA 4JEGB 4EEEA 3AU1B 3MX0A 5AYQA 3S35X 2FZ3A 3W2DL 4XXDB 3H9SE 3VXUB 1S78D 3RWGA 2XG5A 3RX5A 3NFSL 1JFQL 2XPGA 1DE4A 1U8KB 1T21A 4M1GL 1YJDL 1JE6A 5L2KA 1C12B 4OFPA 5HDQH 1S7RB 5I75B 1K4CB 4KC3B 4KMTL 1A6ZB 4Y19B 5DJYB 2ADGB 3LRSB 1S8DA 5I8OL 2H1PH 1CFQA 3D0LB 5EU3A 4QHUA 5ETUA 5IHBA 4Z7WF 1KC5L 1MLCA 2HWZH 4MAYB 4NRXA 5MERA 1IEHA 4YPGB 3IDJB 1BD2A 1N0XH 2H3NB 4RAHA 1EZVX 3L3HA 2E6JA 4YR6A 4KQ4H 5FUZH 1LE5A 2Q8BL 4JFYA 2Y5EA 3MQIA 2J12B 4ODWA 2W0PA 5ANME 1HINL 3GSOB 1DDHB 5I66B 3Q48A 2K9UA 5TJWK 4M43L 3U4BL 2ICWJ 5ACZA 4PJIA 5B8CA 4OF8A 3EYFB 4PJGA 3S3PA 1NFDE 1OQOA 1YYLH 2XZZA 3CVHH 1KCSL 2YPKA 4IRZL 5T3ZH 1JPFA 3EDFA 2KZ1B 3DTXA 3LPGA 4C55A 4ZPVA 3LQZB 4KMQA 5D2NE 4D9RD 4XXDA 4UOW0 2XI9A 1DFBH 1U8JA 3ARUA 4P23B 3MRQB 4GW1A 3LV3B 2AJVH 2R8SH 1I3RB 4HS8L 4X4YB 1T1YB 1MIEL 1C7TA 2PO6A 2ICEB 3IDXL 4GAJL 1I1FB 4GQ9H 3MRNA 3VI3F 5I1KL 4HGWA 4KVCH 4XHJC 5JDSA 1JPTL 3WHE0 3QJFB 3G5YA 1RZJH 1QLEL 3IKKA 3QZWG 1NUNB 2NX5B 1LDPL 1ZT7B 4MNHA 5HDQL 3GSNA 1V7MH 4XP6L 1ZWIA 2WWMC 5CZVH 3SN6N 5FO9B 3IGAA 4JFQB 4OQ1A 4WFFE 4YNYB 5TE6L 2WAHA 3O3DB 4R97C 1DDHA 5ISZD 1QLRA 1RURL 4ENEC 5J12B 4IDLA 4MA1B 2WIIB 2O61A 1FN4A 4Y4HB 4ZFZA 1C08A 5J12C 4LDLB 1PEZA 4NQEA 5IV2B 1N0XL 12E8H 2E7HA 5KJRL 3CDGA 2Q8BH 4R97B 3HG1B 3HB3C 4JHBA 5HY9B 4KXZH 1PZ5A 1U8NB 3VXMB 1TVHA 1S9YB 1HK6A 3HMWH 3CSPA 1IC7H 1HQRB 5CSBA 3CDYA 3SE8H 3QFJB 4LLVB 5JDSB 3TEUA 3SJVB 4U05A 5JNYB 1U8MB 4JDZA 3PJSB 2XRAL 2H1PL 4N0CD 4HG4J 4NO0D 1SEBB 4D8PB 1I7ZB 2MMXA 3BEWA 5FA3B 4KV5E 4TTDC 4BSWB 5FOJA 3DUSA 5DD3H 1J1PH 2GY5A 3EFDL 4P3CH 4UDUB 3I50H 3O3DA 1JZ4A 1OM3L 2ZKHL 4QRPD 4Y4KA 3RIAK 2ICWB 4IOSD 4NQSA 5FM5M 1LD9A 5MENA 4NQCE 1T6VN 4K3HA 4OCXH 4HHAA 4L3CB 4MQ7A 5HI5D 3WUWA 1WZLA 3P77B 5DDHA 5DVNA 4PJ9A 1YPZE 4PBXA 5FYKL 2WBJA 4WFHD 1RZGB 1A6WL 3DURA 2W0FB 4F7PA 3O2DH 5SWZA 4Z7NE 4L1HA 1U8HB 2W60B 1NSNH 3O4LE 3VFNB 4HLZG 3RTQC 5KANI 3V5HB 1MCDA 3ZE0E 4HPOL 3HRZA 1TMCB 4OIBA 3H9SB 4X6EB 1Q0XH 3VXUE 1ZA3A 3DRTB 3O6MH 1TLKA 3QHZH 4L8SB 5BVJB 2DQCL 3SE3A 4E5XA 1WVZA 3L95A 1DLHB 3ARGB 4XNMB 4FN0A 4PB9H 5HHOB 3GRWA 3NAAL 4BKLB 2HA1A 4HV8B 1S7XB 1RZ7L 1ZKAA 4P2QE 5GS0H 4QGTA 1INQA 2WWKT 3MV8E 1HHGB 2X89D 5SWZD 4PJEB 2HFTA 3MFFB 3P30H 2P43B 3T1FB 2NY4D 4IRSC 2YD6A 2IQAB 3LOWA 5DYOA 1HWHB 1NCWL 3I02A 4G6ML 3ULUD 5DD3L 2J4WH 4OIAA 4TUKH 1JV5A 1KEMH 1DVFD 1MREL 3LQMA 3WIFA 3VGAB 3T04D 4XNZB 4F7MB 2A1WH 3VI4F 1NFIA 3MRCA 1D5BB 4U1HB 3IETB 3P40A 3V52H 1CFVH 1ED3B 3L3JB 4Z7VA 2E8YA 3DMMA 3BVNA 2YZ8A 1YQ2A 4HUUA 3GJFK 5HGHB 5F7EL 3AGVA 5E5UB 3KLSA 5E99L 2D7QA 4OCMC 4ZO9A 4P2YA 4HCRL 5HHMB 3RGVD 3RIFK 4L9LA 4WV1A 4LSDA 5DRWA 1NANH 3HG1D 4JZNB 5HSFA 4I5BA 3D9AH 3RUGA 5F89B 3QULB 1EAPB 4D9QD 4RFEB 2CKBL 1MCOL 2BNQB 4U6VH 2NY3D 3HE7B 4YGAB 5D71H 1YNKL 4F57H 1UCBL 1H3XA 1RZFH 5HGBB 2EDXA 2GJJA 5AYUL 4HG4K 4NQDA 4JVPA 4WW1B 1NQBA 4FTVB 2HFEB 1YN7A 1OTSC 3G9AB 4WEBL 1DBBH 2DDQL 2CMRL 4TULL 5DJ2A 4EI6A 3B6SA 3LCYA 1SYSB 4BUGA 3OTTA 4OCYL 4QRTB 3T8XA 3P4LA 5GISL 2Z31D 3WD5L 4NPYA 5C08E 2G5RA 4GKNA 5DJXA 1X5YA 4LSVL 3MBXL 4M6NH 3HPLB 5HHQB 1B0GA 3O2DA 1FNAA 5CBAB 3TC9A 2M26A 1JL8A 2NY5C 4I3SL 3V79C 3LKRA 4R2GD 4CN4A 1LNUA 5EIQA 5JXEA 4JREC 3QQNA 2EDRA 3RNQB 5JXAH 5HJ3B 5H37H 1KIRB 2EDDA 2A6JB 1R0AH 3RZWA 3ZL4H 2A6DB 3T4YA 4G8GA 5DF0A 4JKKA 4HAFA 5EUKA 3IJSA 4WI2A 5GGUA 3MRPB 1T7VA 2A0LC 4L8BB 3GI8H 3MXWL 2VKXA 3CZFB 2DJSA 5FGCB 2XY2A 3RWJB 5ADPH 3S88L 3VDAA 5D7IF 2NY1B 1AE6H 5F1NB 3VD5A 3NABL 4L3AA 5JHDB 2V5RA 3AVEA 4LCYB 5D7SL 1FO0B 1TZGH 2ARJB 4UQ2A 2ZKHH 3NVQA 1AHWA 1RMFH 5JIIA 2JK5B 2IANB 5CBAA 3N9GL 4XBEL 1TCMA 5J6GB 1IRAY 4Y2DD 4GKOA 2X4SB 4M9OA 5MHSE 1ZHNA 3OAZK 2R1WB 4IOIB 4Q74A 1X44A 3BEVB 3TVMD 3IJYB 2B1HH 3KPPB 3U0TA 1T7YA 3IB4A 2FEEI 3O6ML 4K8RD 4N0YL 3CZFA 1QD0A 1W2KT 4RX4A 5GS0D 1A2YB 5D6CB 3VU2A 3ULVF 3QB7C 3HAEG 2K3TA 4GW5B 4NNXB 3MUGA 3T3ME 1NBYB 5KANG 2KH2B 1MRDH 4UAOC 4LCYA 3QUML 3SE4C 4YEFA 4U6HB 3FFCA 4G7VH 5FF6B 3QIBA 3VXPB 1MFAL 1NAMA 1V7NL 4UB0H 5F9OH 4FS0A 4IM8A 4JKLA 1CXKA 4UT9L 3JV4A 2BOCB 3TIEB 5IVNA 1OM3H 1KPUB 1HCFX 4MYWB 1I1RA 3N85H 2X1XR 2YR3A 5IB1B 2A73B 3O3UN 4X5WB 4BK4A 3SKUD 5K9KB 4X6CE 3RWDA 5H94B 2NNAB 1DLFH 1J5OH 5DJ8B 3TJHD 5F7MC 4OLUH 1WZMA 5EZJA 2VKWA 2Z8WC 2X09A 3TO4C 2P4AB 2BFVL 4NN7C 4ZOCA 4FFYH 4Z76A 1D5MB 2F8XC 3FB6B 4QXTB 5FYJE 1Q9WB 2C5DC 1J12A 3FT3A 3QHFL 4X0KA 1VDGA 4HULB 4NFDA 5AD0A 1QFUH 1U3HA 3MBEC 3PQYD 4KRMB 4X99B 3FFCB 5JORA 4JO2L 2A9NL 4BH7A 4PRBA 3JUYA 5BO1L 1NMBL 2GJ6B 1MQ8A 4GXUM 3HC4L 2NY3B 1A02N 1SHMA 1F8TH 5AYUH 2O5ZH 3FB5B 4N8VA 5DVMA 2A77L 5T1KD 2Y7QA 1ZT4A 3RU8L 2MQ0A 1DBBL 2DDQH 1Q0YH 4M6AA 2DQIH 3VMOA 5IROC 3MNZA 1KACB 2NNAA 3KPMB 4NCDA 2W0KA 3ZDXE 4O00A 5HYJB 5D7IE 1FAIL 3CC5B 4RFOH 4Q9CA 5I30L 2ZUVA 1INEH 3O6FD 4NZUL 2BRRH 5BV7L 1P84J 3EUUA 3C5ZA 5K9QG 1Z5LB 2YA2A 1S7VB 1UB5B 3O6LL 4PLJC 3FL7A 2Y6SD 3OXRB 2ESVA 4LCWB 5KSBE 1BVLA 3VD4A 5KVGL 4X7EC 3BZDA 1I75A 3DUUA 2R29L 3IFLH 4X99A 4LPCA 5JORB 3IKCA 4BH7B 3UTTD 5I18L 3LSOB 2A83A 1UM6H 3D18B 3EZJB 1ZSDA 5DTFB 1Y6KR