1JGUH

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYLDSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Light Chain
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH01
4AENB 2V5YA 2YA2A 1NJ9A 4HF5L 5F1KC 1X5YA 2AK4D 4J3SA 2H9GA 1PQZB 1T66D 3U4AA 5LQBL 1NEZB 4KQ3L 4K7PH 3EOYG 5BZDB 2DJSA 2WBJD 4UAOC 1NUNB 3QQ4A 5IHZA 4KRPD 5HGDA 2D4FA 4BUGA 1AD9B 5AG9A 4HKXB 2C1OB 4HUVB 1NFDE 4PRNB 5E2UH 3RY4A 2X4UB 1HEZA 1NC4A 5IQ7H 2F5AH 4BYHA 3BPOC 5HHXH 3DGGB 5DRWB 3SJVA 4I4WB 1MCFA 3RWFB 1G7JA 1E4XI 5HDQL 3RDTC 1YQVH 3EYOB 4FXGB 2F15A 3U36A 5CEZL 2SEBB 1NFDB 1ZLSH 3V6FB 4DQOL 3QHTC 1LP9E 4TQEL 1CQYA 2VXVL 5KVDL 2N7BA 1KJMA 1ZANH 5AG8A 3BEWA 4JRYA 3MRKB 4LKCA 2D7TL 5HPMA 1RZFL 5CJOL 1S9XA 4M5YH 3S36L 3VG0L 4M7KL 4OKVA 4LDOB 5HHOA 5T5FL 4S11A 2QHRL 4LSUH 4WJ5B 2D7OA 1RULH 2XTJD 4HBCL 2E7LC 3N1QC 3N9GH 5TDPB 2EDDA 1YEHH 3HLAA 3AY4A 6FABL 1KGCD 1LP9B 4G42A 3REVB 4F7TB 1B2WH 1FFNA 3RWDA 5CKGA 2HT3C 5EU3A 4CKVX 2P8LB 1U93B 4YFEA 5ITBL 2PXYC 4NN6C 5ECJE 5JW5A 1G6VK 2G60L 1AO7E 2IH1A 5IW1A 4HWEL 4LPYA 4L8BA 1INEH 2CIKA 3O9WD 1XF2A 3F12A 1ZXQA 4FA8A 4IRSC 5IGXL 3I3DA 3D6GA 4GKSA 3B6SB 4LPVA 3G08B 3CFKA 4JDVA 4YDIL 4JVUA 1JF1B 5IEHA 5MP6L 1A6UH 3PDDA 3MMEA 1AO7B 2W9LA 3Q6FB 1I85C 3S34H 5DRZB 1CD1A 1FGVL 4MMXC 5I17B 3RI5F 2VLMD 2CO7B 4YEFA 3HE7A 4EN3A 4YDJB 4BFEA 5C92A 3UCRA 1LO4H 3CMOL 2VRAA 3HCVA 5E9DE 4R26H 5C07A 3AMKA 1F58L 3MFFA 4XX1G 4CGTA 4RZCB 4YBQD 3L7FA 5CJQL 1HINL 4P9HH 2QADB 4XVTH 2ZNWA 2VTFA 1ZHKA 3CUPB 1ZVSA 5J06A 3BIAX 3T0AA 2AKRA 3BT2H 4WI7A 4LVEA 3EO0B 1D5IH 3MRPB 3NN8A 5DEZA 5E9DB 1INQB 3LOWA 3QWOB 1OCWL 3WL9A 5HI3C 4H1LH 3S88H 4FS0A 3X14A 1AGFB 4KDWA 2BNUB 2OR7A 3MOQA 3FO1A 4LVNC 2QKIB 4PJGA 5SWZA 4AIZB 1FORL 1HXMB 1OWRM 1RK1A 1IEAB 3BWAA 5DQ9A 3VFVB 4RIRA 5E8DH 1JGUL 5JIIA 3MRJB 4G8IA 3LQZA 1AE6L 3M45A 2K7QA 4LAQL 1CGWA 1FL5B 2MKLC 5IMOB 2A6IB 5CD5D 5CAYB 4OTXL 3VFNA 4KRNA 3NTCL 2ADJA 2IPKB 2X4NA 3K80A 3TZVC 1QFWL 1MCPL 3S7GA 1C5BH 2RAMA 2A74A 4S1DD 1F4YH 4LARL 3U0PB 2ORBH 2P7TB 2VKXA 4Z7NE 4KFZC 1FG2B 3HRZA 4HUUA 4U1LB 3DX6B 4POUB 3VA6A 1UGNA 3MRIB 1ZSDA 2A77H 2G5BB 5KAQG 3RNKA 3T0BA 3EJZD 4PR5A 5HI4D 5EUKA 5CBAA 1DQDH 3IDXH 4MLIA 1G0YR 2QQKL 1AO7D 3IS1X 5IFHL 1MY7A 2X4RB 2CDFA 4YHIB 3K8LA 5TPWL 4XMKL 4NFBA 4ZOBA 1MAKA 3EAKA 1KT2A 5B22A 4FQLL 2UY6A 4P4KB 4X5XB 3IFNH 2A2QT 4FQJL 1RZ7L 4MNGE 4V2BA 1MFEH 3UYPA 1HIMH 4ZOCA 5GGUB 1F11A 1ZGLB 2CRMA 5F7DA 2QADD 3OXSA 2NR6C 5C0DA 1I7RB 4TN9A 4X4ME 4YK4C 3ZYJA 2JIXB 3DRQA 4X7TB 2E3VA 5E9DD 3QCVH 4RRPA 4MNGB 3QDJA 1JHTB 2CKBH 2ESVA 5GZND 3O2DL 5GRYA 4QLRA 2EYTB 3QEGH 5IOPB 3CVIH 4F2MA 2NY4B 4X9IA 2VWEE 2H6PA 2WWMD 5A3IC 2BX5A 1UQSB 1M7DB 4LVHC 4TSCL 5GHWL 1GOHA 5FO9B 1BGXH 1MFNA 4YNYB 4UIKL 5TH2A 3P9MB 5ICXA 4XVSH 1AI1L 3QO1A 4NQEE 1OPGL 4G6KH 3MRBB 3GJFK 3HS0A 1IMHC 5DRXB 3X3FH 2D9QB 4PRIE 4JZJA 3T2PA 1OGAA 1S7QB 4BJLA 2VQ1B 1AQKL 3FFCA 4XPBL 3MV11 5ACZA 2EEBA 5FYKU 5CEXB 1CFBA 1G9EA 2KUTA 5A2IH 5KANI 4DOHE 2X7LA 4ONOA 4NQEB 4PV9B 2FYYA 2YKLH 3MLWL 1S7RB 2FR4B 4LVOB 2HRLA 5GRWA 1MFDL 4HW6A 2HTKD 4PRIB 4NRZB 2CK0H 1OW0A 3VGDA 5E5RB 1TETH 2OXGA 5IM7B 1OY3B 5I73C 3QUZC 4MZ3A 3TYFA 1G0DA 4F37F 3WO4C 2IPTL 4EUPA 1BVLB 1ACYL 1AHWC 2AI0H 2DQFA 4JAMA 4DOHB 4AEFA 1LO0H 1T22A 2N56A 5IJVA 2FD6H 4KI5E 3THMH 5FYLL 1U92A 3CSBA 3DI3B 4X6DA 3QWRD 4XNUH 4P2OC 3BKYL 3SDDD 4WHTB 1S9YA 3DARA 4P4KD 2KZ1B 3LQMA 2XV6B 3ME0A 1GGUA 1T2JA 1RZGA 4V1DA 1XCTA 5K9QG 1A6PA 4DCQA 3S5LA 5CSZB 2DTSA 3CVHL 1YNKL 5HTSA 1SJEB 2JIXD 3RVXD 5F9AC 5FA4A 3VWJA 2HWZH 4X6CA 1HSAB 4PLKD 1YECL 4AT6A 1FVCA 2VDNL 1IAKA 4ZXBC 2BRRH 3AS2A 4K55A 3MOAH 3RWCB 4P5KA 2X4OA 3ARFA 1YEDA 2NY4D 1ZWIA 4PJAA 3NMEA 3VFWA 4AQ1B 5MHSD 1S5HA 2NY2B 2FIKB 3CFDB 4LKXB 4POYA 4I3GA 4N68A 2P5EA 3KPMA 1S9WA 4U1IB 3QFJA 1T1ZB 2XPGA 2VABB 5ERWB 4GAFB 4WEBL 5JQ6H 5DR5H 3V79C 4UILL 2JB6B 1HHKA 3AU1A 4QRUB 2DQUH 3PL6B 4R3SA 4ZMAT 3GSRB 4I2XA 3JSSA 1OAQH 1XGPB 2MQ3A 4RDQF 3ULVF 5KVGL 4JG1L 4OV6F 1DBAH 2QSTA 3OKDB 3F7RA 4MQ7A 3TO2A 4TOYL 5CCKL 1NUGA 2V5SA 5I1GL 2PW2B 3K74B 1YQ2A 1K3ZA 4NQED 3WHXB 3P4OA 4M43H 2J88H 4PRDA 5DURB 3A6BH 4OCWL 2R2BA 1T04A 4JZNB 2EH8H 2CRZA 4HBQA 4HH8A 4P57A 5MI0B 4PRID 2VXTL 4ETQB 1MFBL 3QDME 1P7KB 5IB2B 1TZIA 3TVMC 3V4UH 4QF1B 1AP2A 1CYGA 1OSPH 4X4YB 1TLKA 4WV1C 5D7IF 4C55A 5ALCL 2EO9A 5DLMH 1U6AL 4FNLL 4JHZA 4M1CC 5GS2H 2HA1A 2IAMC 3KPLA 3LKRA 5EOTB 3EO9H 3QDMB 3GMOA 4JVWA 4MWFB 1IC7L 1B9ZA 3D0VB 1OAZL 1CFSA 1F6AA 3N0PB 2J4WH 3LRSB 3LEYL 4LSSL 2BOCB 3SOBL 3SDXF 3VCLB 1K5NA 1BAFL 3K2UH 3OKEA 4KI5D 4TSAH 4O9HL 1WBXB 4OCXL 4LSVH 4KQ4H 1DQTA 3U7WL 2ZUUA 1I3RA 4OZHF 4XVUC 5IBTH 2HFTA 5GGRB 4XNQA 2Q6WA 4P3WA 1NCDH 5J57B 4ZFFB 5F7KC 2FH6A 2XA8H 2J6EA 3PF2A 5I1DB 1FVDB 4S2SA 1NGPL 3QIWB 4NO0B 1HI6A 1A6AB 5KW9L 1NAMA 5FCSH 1SBBA 3BE1H 5CZXC 3S3PA 5FGSA 2VZTA 3AM8C 1CLYH 5D6CA 4XXCC 2FX9L 4Y5VB 2NY2D 3LN9A 4NHCH 1U8KB 2NYYD 4O58H 5F9JB 5DYOB 5HDBF 1T0NA 3VI4F 5B8CA 5CIPA 3ZL4L 4HIIB 5FF6A 2X4PA 3OKKA 2DRUA 1CBVH 2YD2A 2ZCLL 5EN2A 1A6ZB 3MBXL 2P46B 4NJAH 2C7UB 3FOLA 5I74B 4ZOAA 5C9KA 1XH3A 5D1XC 3VRLE 1I9EA 2CLZA 1YEKL 1M05A 4YXKH 4NM4H 4QHKJ 2D03H 3V0VA 3TPUB 4EXKA 4JJHA 2D7MA 5I71C 4M8VA 5FOBB 25C8L 5E1AA 4KZDL 1JP5A 2EXWC 3DVFA 1BOGB 4YC2C 3TBSB 1AIFB 5I18L 4TULH 5DURD 1I7ZA 5FKPB 4OCSH 2K1MA 3HPJB 4G8FB 2LE9A 3MACH 5F7EL 2YXFA 1UWGL 3VXPB 4X4XB 2PW1B 2E8YA 5J9PB 1TJGL 4K71B 4NPYB 3N1PC 2AK4A 4NO2A 3RX8A 4LLQA 2IADB 3M17B 3V7AG 1KENL 1VB9A 2WBJA 2FCBA 1MRCL 4KMQA 1FCCA 5TQ2H 4GRMB 3NIFE 3BQUC 3I02A 4Y4HC 3QDMD 1UACH 5EUOF 3EYQC 4OLUL 4AY0A 3TYGL 2N4IA 3N50A 1H3XA 2OLDA 5EIIB 4KMTH 4X6BA 1I8LC 1GGTA 1T3FB 3C5JA 3FZUC 1I9JL 1OB1B 5BMFH 3FB6A 4OAWB 2GSIB 5ESQA 4LU5H 2EE6A 1YPZA 1LE9B 5MENE 3FQRA 1A2YB 5CZKA 2FZ3B 4MAUL 4JLRA 3WFCH 1WZMA 1JNJA 3MJ7B 5DJAA 3WLBB 1CI5A 2IFGA 1TQBC 3QIWD 4NO0D 3FCTA 3B2VH 5HDOA 2YHGA 4UV4H 3V0WH 2XXMB 1KTLA 5DVMA 1HWGB 3ZMRA 5CP3A 2APFA 3O3EA 3X17A 4B0MM 1A47A 2R4SL 2ZKHL 4N5EC 3RL2B 2Z9TA 3OJ2C 3AB0B 5DZLA 3CZFB 2XKNA 4G7YH 1N7MH 1NSNL 2GFBB 1MH5B 5CZVH 3HC4L 4W6WB 3RWJB 1AKJB 3SKOA 2GJZB 3TO4C 4NCDA 1JWMB 2DQEL 4K3EL 2YOCA 4TNWF 5TF1H 4RMWA 1T0PB 3LH2H 1V3LA 4XBGB 4MA8H 3SY0A 3K46A 4PJHE 4KJYA 3JWOH 3WN5A 5BO1H 1KC5H 3SKMA 4ELMF 3O9WA 2OSLB 1G9NH 1WAAA 3WE6A 3U82B 43C9B 1YMHB 1T83C 4DFHA 3FQXB 1YMME 2X1PA 3MZGB 1IILE 3V6OC 4DN4L 3ORJA 4GSDL 1ZK9A 5D5ME 4HGWB 4PJ5E 1WBYA 2GAZA 2APBA 1VEOA 4LCWA 5J12B 5JIKA 4BFIA 3ETBF 4LPUA 4PJHB 4Z7OF 4EXPX 5HI5C 1QBML 3KLAA 5JW4M 3OAYH 2NX5A 4PG2C 4DEPC 4LLAA 5IESH 4OZFA 1MRDH 4YFLF 4AENA 1BD2E 4PP1D 1H5BB 1X6LA 1YMMB 4DGIL 1GHFH 2ZCKL 1HZHL 3KPPB 4EI5C 5D5MB 3T4YB 2ADFH 2GY5A 3VDAA 4PJ5B 1PQZA 3I9GH 4IJ3C 3VFMB 1NEZA 4YHYB 3HFML 5BZDA 5C8JB 2BERA 5FYJH 3VWKB 1AGEB 1AD9A 3VH8G 1VENA 3B8SA 4HKXA 4GRLC 1BD2B 1G9MH 2C1OA 3EHBC 4HUVA 4ESKA 4M03A 2X4UA 5EA0H 1C1EL 4RFEB 3V4VL 4WO4C 1KJ2H 3MSPA 3DGGA 5DRWA 4JN1L 3RWFA 1UA6H 4WTZA 5CGYD 1DBJL 1DSFL 1NBYB 4I77H 4ZFZB 5DS8B 4P23C 2NXYC 3J8F7 5FV2A 3LPGA 1LGVA 3QH3B 4GXVL 1VACB 5FYKH 3EYOA 4JFFE 5C0RH 2CR3A 3L3OB 4ZO8A 3HC0B 2SEBA 1ZTXL 1NFDA 2KPNA 9CGTA 2XI9A 3B83A 2ZNXA 3MLYH 3QUMH 1MCOH 3RY6A 3L9RB 1CE1H 5C0BA 5LCVH 3MRKA 3SDYL 1D9KC 2XQYG 4PY7B 2ZPKL 1JNLH 3UYOD 4HPOH 5E5MB 4JFFB 3R1GL 4JB9L 4WJ5A 1FDLL 3LDBB 2Y4SA 1DQMH 1AKJD 5B39G 5TDPA 2VDMH 4G43B 1KCVH 1LP9A 3BGAA 3ZYOA 3REVA 4F7TA 1S7UB 5CJ8A 2P8LA 5DMYA 1U93A 1XIWC 1GJIA 4B7LA 1KLGB 4MB5A 1XGUB 3L3KB 3H42H 1J0KA 5F9OL 3LN4B 4WTXA 5J6HB 4UV7L 3VXOA 2AJUH 1BFOB 3B6SA 5CJXA 5FXCH 4O4YL 3F7VB 2NW3B 3G08A 1ZLVH 4MJ2A 3FN0H 1JF1A 3GBLA 3HN3A 4IS6B 4KKCC 1FZJA 1NMBH 2W59A 4IBLT 2NXZC 1AO7A 3Q6FA 4GFTB 5DRZA 3MXVL 5C08E 1KB5H 3TA3B 5I17A 2F19H 2VDRL 3HG1E 4MXWL 1F3JB 4ZPTB 1YMMD 4YDJA 2V7NB 1JBJA 4OZIE 3KYKL 1NGQH 3BHBB 4JQIH 3BI9X 5B3JF 4PJ5D 4TRPL 5B38G 3MOBL 1U3YA 3U1SL 3E6FB 4XWGL 1SVCP 2BY0A 4HPYH 4FG6C 1UKTA 4RZCA 5DJCB 1X6NA 4X9HA 2ERJC 3VWKD 5C08B 2Y5EA 4PGCA 3QCUL 1RHFA 2MOVA 1BD2D 3CUPA 3HG1B 3W9EB 3GKZA 1F4WH 4OZIB 1JCKA 1UT9A 3EO0A 3TT3H 3MRPA 1B0GB 1YYLL 4QKXB 4QXUH 5F72S 5E9DA 3TH2T 1INQA 2C9AA 3VGHA 2AEPH 1P84K 3QWOA 3UO1L 3JBG7 2AS5M 5MEPB 2UZIH 2I26N 4HZLB 5K33A 5K93A 1AGFA 3RAJH 3MLRL 1MIML 2B1HL 2BNUA 3O3BB 2FO4B 1U42A 1KCUH 2QKIA 5EZOH 1HYRC 3WO3B 1CTOA 1X5JA 4AIZA 3NIDE 5D7LE 4BQ8A 2ZZUT 1HXMA 4Q6IB 2YK1H 4MD4B 4UT6H 3VFVA 2QQNL 4IDJL 4WDIB 3MRJA 1E4XL 2YEZB 1GC1L 1FL5A 1AR1D 1IGCL 4XX1E 3RNQA 3FAWA 4FQXB 1CL7I 2A6IA 3I84A 4JFFD 5F9DC 2HRPL 3MQIA 4PJBF 4D0BB 2KH2B 3LKPB 5D7LB 1PAMA 4WHYG 3BGFB 1SY6L 4PJ9C 5IBLC 1B6DA 2XOTA 3Q2CA 5DUMH 4F9PC 1WVZA 3BH9B 3U0PA 3ISWA 5EU4B 1A3RH 4FXKB 2XA3A 5EOCH 3VFPA 5JXEC 3P2TA 4KGLA 4U1LA 4J3VA 3DX6A 5TJWK 3BMVA 1P4LB 3ZKSD 3MRIA 1DR9A 2G5BA 2A1WL 4H0IA 3W82A 5MEQB 5C09E 3A6CH 3ZTNL 1A6TB 3WCYA 2X4RA 1IGYB 4TVPE 4U49A 4KJPC 5DF0A 3TA3D 3BRDA 4YHIA 3QWRA 5D2NC 4PG9B 3SDDA 2JELL 3ZDXE 1YEJH 4H8WH 4P4KA 2BHUA 4X5XA 3RWGB 1IC4H 4FQ2H 2E9WA 2A38A 2DQIL 5C09B 1YA5A 5GGUA 1ZGLA 1MJ7H 1RFDL 4F33B 5DWUL 3QQ9D 5C08D 43CAB 4OCRL 3HG1D 2V2TB 1K6QL 1I7RA 2GYSA 2HJFB 2JIXA 4X7TA 1EMTL 3L3JA 3RVVD 5J6GB 4MNGA 1JHTA 2NZIA 2DQTL 5E6IB 4MNQA 5F7WC 2EYTA 4R4FL 5IOPA 3CX2A 2V9TA 4YHZH 3PXHA 4L8DB 3X3GH 1J1OL 3BP7B 3FO0H 4U05A 2E9IA 4X4MA 4OLYH 4X9BA 3RGVC 3T2NL 2BHYA 3KYAA 5DD5H 5T3XH 1UQSA 1M7DA 1JZ3A 3MLXH 4Z95L 3TC9A 2DQJH 2W0KA 3MBEB 3CIQA 5FO9A 3L6FB 2NY7L 4YNYA 2X9YA 4WIQA 3P9MA 5ABDE 4FQXD 5EO9B 4UB0L 4GMSL 1FAKT 4I18B 3MRBA 3W39B 4WY7H 1AXSB 5D7LD 5TDNB 1EHAA 3KJ6L 5DRXA 2GY7B 2PO6C 5DK0B 3H7BB 1WCBB 1S7QA 2OR9L 2VQ1A 1ZS8B 2HVKB 4RWHA 3PHQB 4DKDC 5HYFA 3H3PH 1SEQH 4H0HB 4O51B 5CEXA 4KTEH 4Z0BL 3ZKMD 4AH2B 1PYWB 2KL6A 5ALBH 3EBAA 4NQEA 3S3JA 4PV9A 4Y19B 4WW1B 2EXYC 1BZ7B 1S7RA 2FR4A 2WUCH 4PRIA 4NRZA 3TIDA 1PGRB 4KWUA 2LFGA 5IM7A 5DJ2B 5L8LB 1KYOK 1MVFA 1BVLA 3F65A 1I9IH 5F71A 5BZWB 5IVXE 5GGTH 4PJEF 4OFYD 5C0NC 1IM9B 4HXBL 4YDKH 1MHPL 4WHTA 4H26B 2BNQE 2CMRH 3PGCB 1KJVB 3QZWB 1JFQL 4KKBD 5EC1B 4K3JL 5C09D 5T33H 4HFUH 3UEZA 5IVXB 3G6JF 4FRWA 4TVPD 5JMRA 1BWWA 1N5AB 4MJ6B 5D71L 4OGXL 2VXSH 5CSZA 4GW5B 1HHGB 3ULUE 1SJEA 1A21A 1XCQB 1FPTH 2XNAB 2BNQB 5GQBA 3PUCA 1HSAA 5AYUH 1JHKL 5E6ID 3SGJA 2I24N 1Y6KR 5L0QB 3RWCA 4FFVC 1JIBA 1L9NA 4EEEA 1MHCB 3LKSB 2B5IC 4POZC 3GIZL 2VAJA 1JMXA 3MRCA 3GKWL 2FIKA 3CFDA 1TENA 4LKXA 3PWVB 4U1IA 3IKCB 1T1ZA 2VABA 5ERWA 4NN7C 7CGTA 4OLVH 3V6BR 3HKFA 4GG6E 3D39E 4Q58C 3MBED 1NLBH 2JB6A 5DK3A 4OM1L 2X4SB 2HT2C 4N8VA 3GSRA 3FQWB 2VLKE 4OGYL 1XGPA 2FB4L 4NQVA 3QCTL 4WHYH 5IHLB 4M8QB 4GBXB 4P2RE 1MJ8H 3G5ZA 3OKDA 2VZ1A 4UDTA 4RAHA 1B6UA 3U2SB 4BZ1H 4GG6B 3D39B 3ILQC 5C7XH 3OB0H 1JYNA 5AUMB 1XGRB 2PW2A 5IB3B 5T1DL 2Y06H 1MHEB 1ETZA 1P1ZB 3HI5H 3QIUC 4KHXH 4Y19D 1J0YA 2VLKB 2DLTA 2VITB 4PJCF 4JZNA 5HGAB 5IB1B 3DUHA 4ETQA 1IZKA 2ZG1A 4P2RB 1P7KA 5IB2A 2J8UF 4QF1A 1IKNC 3CPLB 5K59E 3ARXA 4GUPB 4YEEA 4X4YA 3QFDA 4YPJA 2FH8A 2H3NB 4UBDC 4F9LA 3UTQB 4KXZH 3H0TB 3UROR 3DSFH 1FHGA 1IM9D 3ZE0F 4YQXL 4YBLB 2IG2H 4Q0XL 5EOTA 2B4CL 3RBGA 3F7PC 3NCCB 4MWFA 1UWEL 3D0VA 5D2LE 4X9FA 2Q87A 4PJ7B 2DI9A 2DJUA 3LRSA 3QXVA 2BOCA 3VCLA 4JJ5B 1UH3A 3TJEH 1MNUL 5GGVL 4U2ZA 3HMXH 2A0LD 3T09A 1WBXA 4N8CL 1BLNB 5BV7L 1NBVL 4FABH 1D6EB 5GGRA 5J0BA 3IU4H 4ZFFA 4WI5A 2BNQD 1GC1C 1YDPB 2GITB 2WMPA 1FVDA 5I1DA 5D2LB 3QIWA 4NO0A 4WWKC 4MA1B 1MAML 3KPRE 3TP4A 1A6AA 1XGTB 1E4KA 4KU1A 1MCKA 3AUVA 3S37X 4M1DH 4HXAL 1B90A 4ZFGL 2V9QA 3ARPA 4UT7L 2LQRA 2CDGB 3ULUD 4Y5VA 1OTTC 1ND0B 2CGRL 4DKAA 2NY6B 1BVZA 1ZEAL 5D70L 5F9JA 1W0VB 5DYOA 1J05B 5DJYB 1NANH 5DRNB 5FYJE 4HIIA 2R23B 1RUQL 2WBKA 3KPRB 1MQKH 3BGMB 3MLZH 4LASH 1A6ZA 4XPGL 1MCSA 2C7UA 1VEMA 2CUMA 2HLFC 4PB9H 3KDMB 1LO3H 4GW4B 5AWNH 2DKMA 4HKJB 1HXYB 5DQDL 1O7VA 3MCLL 3MRFB 4GBXD 3GMNB 2FJFB 3VFGH 5FYKE 4J3OC 3TPUA 3D39D 1L6ZA 3R8BB 3NPSC 1CTNA 4MHHI 4NZTL 4KK6C 4LCIH 5FOBA 5IMMB 1QPPA 5F89B 1BOGA 3TBSA 1AIFA 4UMGA 1KJ2B 2XZCH 3H9SE 3VD3A 2VLKD 4XAWL 3SKUD 5FKPA 5SWSE 4G5ZL 3HPJA 2CIIB 4LF3B 2CJUH 4G8FA 3GSQB 4P2RD 5D6DC 4LMQI 4MS8C 4KJQC 5BS0E 4OSUH 2FGZA 4OBRA 2PW1A 4X4XA 5DFTA 3VXPA 4CBPA 5J9PA 2MSPA 4NPYA 4ZTPL 3BP4B 1LD9B 3MV01 3QUMB 3H9SB 4W81A 2IADA 3M17A 4RISL 1KIQB 5SWSB 3DPBA 3FT4B 4GRMA 3S37L 1YEFH 3BUTA 3B9KB 4AEIL 3WNPA 1UCBL 3I50H 3G6DH 2XG5A 2UVEA 5BS0B 4Q9RH 3AY4C 1PBYA 2J5LB 3BSZH 5EIIA 1MCIA 2GCYB 4YZFE 5EFIB 1T3FA 4KPHL 3HNVH 4MXVE 3BWUC 1IAIH 1OB1A 5JR1L 3GMPB 1NAKL 4NQUA 4OAWA 2GSIA 5DFWH 1LE9A 2VXUH 2CRYA 5D8JL 1A2YA 1RJCA 2FZ3A 5E2JA 2Y72A 1WLHA 3MJ7A 3WLBA 5H35A 4HV8B 1F13A 2VDPH 1N8ZB 4EIZC 2AV1A 3CFIC 2HFEB 4KAQH 1JF6A 4OLWH 5GZOC 3RL2A 3TCLB 4MQSB 2DM7A 2F8VA 2EE9A 3CZFA 2NY6D 2CRIA 2GFBA 3KHOA 1MH5A 3HE7C 1U8NB 4EN3C 3RWJA 1EUTA 2WNGA 3DECA 1FP5A 1AKJA 3ARRA 1R3LB 1YNLL 1O5DT 3DETC 2MFNA 2GJZA 3KPRD 3MLSL 5DJZB 1JWMA 2PF6A 1II4E 1LO2L 2R69L 2FLBT 5T3ZL 4XBGA 5INCB 4R7DB 5JLZB 4WFFE 1ZLWK 5AEAA 3ZDYF 2VN4A 1VA9A 4NCC2 1INDL 5FYJD 2OSLA 43C9A 1YMHA 3FQXA 5E94B 4ZUWB 3QAZB 4H20L 4HGWA 3KNBB 1MCNA 1CDBA 2ADIB 4YXLL 4XI5D 4X6EB 5AZ2L 5CBEB 1C08B 3BPLB 4PJHA 3HPLB 4YFDB 3VGAC 3EYSH 4UDUB 2DIJA 5FYKD 1H5BA 1YMMA 1PDKA 3RHWF 3KPPA 1NUDA 1YC8A 3HC3L 5D5MA 2P8PB 3T4YA 3F8UB 4PJ5A 15C8L 4LPXA 3VFMA 3H9SD 3QWQB 5C8JA 5SWSD 2J6EL 4WEMB 1I1AB 3QPXH 1FNSH 4JDTL 4XCFL 4DK6A 5BRZE 2HMID 1NAML 3VWKA 3B9KD 1AGEA 2XICA 1KCLA 1BD2A 5DO2D 4KK5D 5BS0D 1T21B 5TQ0H 4QRTA 4NRXB 1CGSH 5J89A 4DUWA 3OG6B 1NBYA 4ZFZA 5IFJB 1CGXA 4K3GA 5DS8A 4XVJL 5BRZB 3QH3A 4OQ1A 3JV5A 1VACA 4OB5L 2FJHB 5DI8A 4RDQG 3L3OA 3LS5H 3HC0A 4LK4A 2KDGA 3IGAB 5DD3L 2A9NH 2V17L 4C56A 4XAKD 2CUHA 3AMLA 2YN3A 3L9RA 1GIGL 4PY7A 5KVEL 2ZSWB 5E5MA 5D93C 4JFFA 2FJGB 4BZ2L 4UOW1 4PLOB 4C58B 2WUBH 1ZHNA 4FP8L 5GRJL 1CT8B 1I4FB 1DFBL 1JGLH 4XZUB 4G43A 2I60L 1S7UA 5GJTH 2QSVA 1D5ZB 2Q1EA 3TBYB 3QEQE 1CGYA 4HJ0D 2H2PC 2VQTA 1KLGA 1RAMA 1XGUA 2CSPA 1A1OB 3L3KA 2ZSVB 3N06B 3BW9A 3I6KB 3WFBL 5JIHA 1JZ5A 3F62A 3LN4A 5J6HA 2NPLX 3VH8B 5ID1B 4G9FE 1HQRB 4U1JA 5BOZG 1BFOA 2DLEA 2XRAL 3F7VA 2NW3A 2DM4A 2W1NA 4FFZL 2QQLH 3QEQB 2ZUSA 4GRWE 1WEJH 4IS6A 4XMPL 3PHOB 2B4CC 1CFVH 1UFUA 4WFFD 1T2QL 3V2AR 3TA3A 2D7QA 5H2BB 1F3JA 3RVWC 1CVRA 5SX5H 3P0YL 4ZPTA 2V7NA 4G9FB 5LAXB 3BHBA 2DIBA 2R0ZL 2VZ3A 1EBPA 5BV7C 4GRWB 4OGAC 1W2KT 4V2CB 4OLXH 5DJCA 1I1AD 3IDYB 2HH0H 4GAJH 4OT1H 1HNGA 5JTWA 4WHDA 1QRKA 5C08A 5CJ5A 3UTPE 3Q1SL 3HG1A 4WGWB 1QP1A 3W9EA 4KUZH 4OZIA 3I3BA 1B0GA 2L4OA 3BKMH 5B39B 4NWTL 3BDYH 2HJLB 2GTZA 2BSSB 5MEPA 2X6MA 4HZLA 1V3KA 35C8H 1OSZB 5HHNB 5BRZD 4CVWA 5D1QC 4RMTA 3GSNB 1FVEB 3O3BA 2YRPA 1NCCH 4PJGF 1BIHA 1WIOA 3S96B 4DVRH 5I66B 1OW0C 2QEJA 4Q6IA 1GZQB 4GLRH 4MD4A 4CVZA 3P0VH 1WWAX 3C2AL 4JFOB 3ULSB 4WDIA 5KTEL 3BO8B 2YEZA 3LEXB 4C83B 2OTUB 1A4JB 1LWRA 4FQXA 3O8XA 3T65B 4D0BA 4IEFB 3LKPA 5D7LA 4ODWB 2Q7NA 3K8MA 1UM4L 2JLLA 4O2CB 1KNOA 1FN4B 3H2WA 1EERB 3ZHLA 1ORQB 4DKFL 4QTHB 1DL7L 1KXVC 3L95B 3DHMA 1MPAH 5B38B 3NA4A 3BH9A 5EH1A 5EU4A 3LD8B 2VN7A 4QO1A 4FXKA 3WEXB 1IT9L 1TNMA 4OD3L 2F58L 2DM2A 3O41B 3ARDB 3CZJA 4IOFC 1IC1A 5DMIH 3WS6C 3VWJC 1P4LA 1NPUA 4RGNC 4RGOH 2RR3A 3QEQD 5GRVK 1MRFL 5MEQA 3LAFA 1KCSL 2WP3O 1KB9K 3ARFC 1A6TA 1IGYA 5TFSL 1X7QB 2V2WB 4OFYA 4BK5A 3UTTA 4AEHL 1A14L 4XXDB 3CFCL 2OI9B 4M5ZH 1QBBA 4PG9A 4G9FD 1AJ7L 2E6JA 3U30C 4L3EE 1ROWA 3RWGA 2O5XH 3NCEB 3TGXA 2VB5A 2C3VB 3DO7B 1QLEL 4P9ML 4YHOL 5C09A 3WNOA 4YDVB 4NN5C 4ZFOB 1OAKL 4F33A 3BJLA 43CAA 3HB3C 1FNEA 4BFBD 1DLHB 3FONB 4ZDHB 5E99H 2V2TA 5L9DL 3LQAC 2HJFA 5C6TH 3K4ZA 4L3EB 4JFQB 3RWHB 3FJTA 4Y16B 5I0ZA 5J6GA 2AABL 2ED9A 5E6IA 1A7RL 4D9LH 5C0FB 3IU3B 4F15C 4PJFE 3B43A 2H8PA 1HOCB 3UTPD 4L8DA 3FQNB 4YE4L 1MVUB 5IK3B 3BP7A 2G5RA 3HNSH 1DBKL 1W8OA 4N0YL 3X11B 5ESVB 3LZFH 1NMAH 2BVTA 4JHBA 4IM8A 3DXAE 4KDTA 3MBEA 3L6FA 1JGEB 4PJFB 4N1CA 4QHUB 1AY1L 2LTQC 4Y4FB 3SDCA 3T1FB 3MODL 5EO9A 2PTTB 4F7MB 3AS1A 1OD7A 4I18A 3W39A 1QBLL 1AXSA 1CF8L 1X5IA 5TDNA 3SQBA 4MLSA 4OFDA 5DK0A 1IQWL 2OL3B 3H7BA 1WCBA 1KPUB 2FX7L 5J8OA 3OGCB 3U0WL 1CQKA 5BVPL 3NGBB 2HVKA 3DXAB 4LLMB 4XPAL 4O51A 3MLTB 1C8PA 2EC9U 3RA7H 4HK3J 1JV5B 4HWUA 1CL7L 4Y19A 4WW1A 3O4OB 4XC1L 1BZ7A 3ARDD 5DJXA 2WLZA 3X13B 5HVHC 4ORZC 3LRHA 3C8KB 1IGFL 2IPUG 4N0RA 4WRLA 3E3QE 5DJ2A 4UI2A 4DN3H 2VAAB 2VDKH 1AC6A 2EZ0D 5BZWA 2YMXH 4JPVH 2OTWB 1N0XH 3O6KL 2A83B 1NCAH 5B3NA 3AGVA 4XP5L 1IM9A 4X6DF 4JG0L 4CU6A 3MJ9H 2Z4QB 3DV4B 5CILH 5LQBH 4H26A 5B8CC 4CJ1A 4JY4B 3GJEB 3PGCA 4KVCL 1EHLH 1KJVA 3QZWA 4Y5YB 8FABB 2WSKA 1W72H 3T1WA 1JUFB 5EC1A 3BOVA 3BPCB 1EO8H 5HSFA 5IVXA 3MRNB 4S10A 4P59L 1N5AA 4MJ6A 1CFQB 4R2GC 4GW5A 1PZ5B 4E9LA 1HHGA 2AQ3A 4NQDE 1R3KB 5E4EB 1XCQA 1KFAH 4L3ED 1LNUB 4E41E 4Y16D 2J8OA 2XNAA 4NWUL 2BNQA 3K4DA 2D2OA 5FDYA 4NQCB 3SCMB 2DI7A 4W4OC 4YPGB 5GS3A 32C2A 3RIAF 4LEXL 3TM6A 3MA7B 1MHCA 3LKSA 4HMCA 3EIFA 1QBAA 1XZ0B 4MDIB 5JMOC 2WW8A 1MFAL 2ICWB 1JWUB 1U8PB 3FMGH 3HUJF 5E8NB 4NQDB 4XP4L 4PPTA 3ZE2F 5KVDH 4M48L 3PWVA 3IKCA 2EH7L 4E41B 1L6XA 1RZFH 1I3GL 3VG0H 5I1IL 4JKWA 2R9HD 2WWKT 5C2BL 5J1TC 3CXHJ 1T66C 4Y4FD 3NCJL 1RIHL 1JPSH 2X4SA 2WBJC 4GQPH 4NZDA 1T20B 1UYWL 3FQWA 3MXWH 5I8EB 1IQDB 4PBWD 5DJ6B 2VLRE 2AJZB 3O2WL 4KRPC 4NZRL 4M8QA 3MYZA 3LEVL 4GBXA 5ITBH 3DXAD 1CXIA 3U2SA 3GNML 3LN5B 5EB9A 5AUMA 2DKSA 1A6VH 2UV3A 1XGRA 4YHML 5IB3A 4PIRF 1A7PH 4HC1H 1MHEA 1P1ZA 2PR4H 4JPIB 1P7HL 2VLKA 4NNYB 1KEGL 2EKSB 2VITA 2VLRB 5HGAA 3PV6B 5IB1A 1J0HA 4P2RA 2BK8A 4MMZC 3L3HA 1TMCB 4A6YB 3CPLA 3NACL 4GUPA 1JRHH 3ROOB 2DQCH 5JA9A 2H3NA 3UTQA 3GSOB 1CCZA 3H0TA 3WFEL 2XXCB 3R0NA 5GRVL 1A7NL 3MGAA 4K3DH 3CH8A 3MUJA 3WMSA 3L5XL 5GS1A 2COQA 4LCCC 1JNHB 1RUMH 2XTJC 3V52H 1GGBL 1I7TB 5JDSB 2CDEB 4N0UE 4M62L 3PGFH 1HINH 1P5UA 4PJ7A 3O6LH 5FGBA 2GSGB 2VZSA 4Y4KB 4F8TA 4JJ5A 3W2DL 1DQQB 1RMFL 1CD8A 4N9OB 3AC0A 4HUKB 1RIUH 1BLNA 1D6EA 1XF1A 3ARYA 3O9WC 4KUCD 4M7ZC 1JPGB 4M7JH 1MJUH 2GITA 1YDPA 1GRWA 5K9QI 5D2LA 4N0UB 4NQCD 2I5YL 3SCMD 1KBGL 1MCJA 1U8OA 5EO1B 3ZTJG 4RAVA 4EQ3A 4TPRH 4IRZL 1V3JA 4JY5H 1LHZA 3DIFB 3JZ7A 3MRLB 3GK8H 2CDGA 3BPNB 3CDCA 4NQDD 1ND0A 4R7NB 2AXJA 3LKQB 2VDLH 1W0VA 1F4XH 3SE8L 1J05A 5DJYA 4E41D 3OQ3B 4KY1L 2R23A 1KSRA 4DGVH 3KPRA 3NFSL 4OZGF 5E5UB 1EPFA 3BGMA 3KPQB 3MLPA 5JW4N 2MNUA 2YRLA 4OTXH 3TFKC 1Q0YH 4XNXL 4Z7VF 2AXFB 5EZIH 5EPMB 3KDMA 4GW4A 4L1DA 4YBQC 5I15H 5F7LB 4HKJA 1HXYA 3MRFA 3U46A 1QFWH 3GMNA 1MCPH 3IRZA 2NY3B 2FJFA 3LPFA 3OF6D 3WSQL 4XNZB 1F2XK 2C3WA 5JW3H 2F8OA 2H1PH 2X4QA 3QHFH 5A2JH 5F89A 4OCYL 3O11B 5EO0B 2CLRB 1KJ2A 1HE7A 2EDKA 1L7IH 2VLRD 1AR2A 2CIIA 2R0WL 4LF3A 2DMBA 2X89D 3GSQA 2YZ1A 1C16B 4BKLB 2QQKH 3U9PL 4P5TB 3I3EA 2V5RA 3FKUS 4JVPA 3RY6C 1IGIL 2HFFB 3BP4A 4FFYL 4LLVA 2NY0B 1LD9A 3QUMA 3H9SA 5TPWH 1S3KH 3DUSB 1KIQA 5SWSA 3FT4A 4FQLH 4Q9QL 1AFVL 1MCLA 3B9KA 1OT1A 5HYSG 3MROB 5BS0A 2GCYA 2VQUA 3GO1L 1P2CB 4N5UA 5EFIA 5ID0B 3QQNA 4WI8A 2NY5L 4Y4KD 1DDHB 3GMPA 4LEOB 4L5FH 1NFKA 1J5OL 1IKFL 4S1DC 2Q7YB 6CGTA 3SE3A 1U8QA 2IGFH 4R0LB 4KZEL 2BJML 3KS0J 1C7SA 7FABL 4Y88A 4JFZL 3UC0H 4X7DC 2BSRB 1PX3A 3O2DH 3D18B 4HV8A 3Q5YA 4M6OL 1DN0B 5CJXC 1N8ZA 4FXLA 1I9RL 4TNVK 2YD7A 2P1YA 2HFEA 1RQ5A 3AAZB 3QRGH 3EJZC 2ATKB 3L5JA 1TIUA 3BD4A 3TCLA 2YPVL 2PXYB 4KVNL 5GHWH 1TQCB 2MCPL 1HN1A 3G5YB 1B4JL 1BJ1H 1U8NA 1X5AA 1KB5A 4NDMB 1EDQA 1T0MA 1R3LA 3WBDA 3WJLA 5DJZA 1IAMA 3SEPA 2B2XL 4XRCB 4F58H 1OPGH 2P8MB 1LK3L 5TGBB 1UJ3B 3B9DA 3PP3H 5INCA 4R7DA 1BQHG 1JN6B 5JLZA 2WINB 4OIIL 2QADC 2YWYA 3PIQB 4I1NB 4RFOH 4WI3A 1ED3B 1L0YA 4K7PX 2NY3D 3SQOL 4G6AC 2VDOH 5E94A 4ZUWA 4PV8A 1QKZL 1OL0A 4ODUB 3KNBA 3T8XA 2ADIA 1P7QB 4PRAB 4P2YA 4X6EA 1F6FB 5CBEA 1QSEE 1C08A 3HPLA 4HG4J 1MCBA 4GO6B 4NZUL 4UDUA 2YRZA 4XMLL 2WWMC 5FCUL 4HWBH 4P5TD 1JMZA 2IEPA 4P49A 2MKWA 3T3PF 2P8PA 4PB0H 2QTEA 1F8TH 4NFCA 3A67L 3RIFK 2NY0D 1NL0L 4IOSD 1QSEB 3RX7A 1DJSA 2GT9B 1J0IA 1I1AA 1B88A 2AJYL 1KN2H 4NGHL 3BJ91 1J1XH 1GGIH 3QEUB 4WFEE 1T21A 2W65B 5EORL 3L5IA 4NRXA 3GSXB 1BF8A 3N1GC 5HHOE 1YNKH 3C60B 4YHLH 4K8RH 2G2RB 1NDMB 3DX9B 1GGYA 5BRZA 3KJ4B 3OZ9L 3U36B 5KS9F 2V2XB 2A6JA 5I19L 2YZ8A 5CLTA 2VDNH 1NFDF 3IGAA 2LAGB 3L3DB 1A7BA 3D87B 4R6UA 1OOAA 3LCYA 1SQ2N 4HKZB 4K7PL 3RJDA 3DYOA 1SM3H 4QCIB 4R97B 2VJXA 3JXAA 5HHOB 5DDHB 1Z3GH 3LIZH 4XC3L 2HT3D 2ZSWA 2PXYD 4WEBH 4QXGL 5E2UL 2FJGA 1S9VB 2DYPB 2F5AL 4ISVB 3S97C 1CT8A 1I4FA 4KMLB 5HHXL 2MHAB 1OQOA 4P4KC 3GHBH 4XZUA 1D5ZA 4H88H 3TBYA 5KVGH 4N1HB 5D72H 1YQVL 4XHQA 3OAZH 1K3IA 2EIZB 4WW2C 1YY9D 3QG6B 1A1OA 4P3DB 1ZLSL 2ZSVA 5CCKH 4D9RE 1NH6A 3I6KA 5I1GH 5I8KH 1DBBH 4NCC1 3RVXC 1CGUA 3VH8A 5ID1A 2EECA 1HQRA 4NUGH 4JDVB 3WDIA 4FQQB 1U8MB 3ULVE 3I6GB 4PLKC 4M5YL 1P7QD 3QEQA 3PHOA 3WNKA 2I07B 4L8SC 4LSUL 2NY4C 5JO5B 5H2BA 3N9GL 4X8XA 1ZT7B 4ONFL 5HGHA 2BOBB 1SJVA 2R2CA 1PX4A 5GS0H 1B2WL 2EDFA 4G9FA 5LAXA 3W5MA 1SVZA 5HVGB 4LLUB 4BH7B 4FNLH 3L7FB 1K4CB 2R0LH 1QSED 3UZEA 3QXAB 1D7FA 2EYSB 4PJDF 5D7IE 4BQBA 2VWEC 5E2WH 2H32B 1G84A 1FFRA 3NN8B 4L3CB 3OKMB 4KJWC 3SOBH 4XP9H 5L8KB 5B39A 2HJLA 2A6DA 3C60D 4Y5XB 4LVHB 3S34L 4PGBB 3SKJH 2BSSA 3U4BH 4YGAB 5DA4A 1OSZA 5HHNA 4PLJD 3GSNA 1NGPH 3C6LB 5D7IB 4AM0B 1LO4L 4LVOC 5KZCB 5KW9H 3PWJB 5I66A 3S96A 4WFED 4CMHB 2EC9T 1GZQA 4Z78B 1L4IA 4JFOA 5JHDE 3ULSA 5HHOD 4JKPH 2FX9H 1XR8A 3WFDL 3VXQB 4P9HL 3S6CA 5HHVH 3BO8A 1JNNL 3LEXA 4C83A 2Q20A 2OTUA 1A4JA 5E8EB 3CX5K 3OBAA 1WGOA 4TTDD 3T65A 5GGTA 2DYPD 1D5IL 3MX0A 1DUYB 1N26A 4WWID 1PEWA 4RMUA 4D0DB 2X4NB 4O2CA 1ZOXA 1FN4A 3OGOE 1CIUA 2IQ9L 1ORQA 1QD0A 2FATH 3LS4H 5JHDB 4QTHA 5F1IB 3L95A 5HDBE 3E8UH 1ACZA 5B38A 3VI4E 2XWJA 4GW1B 1W72B 4JHWL 4KI5C 1Q9LB 3WEXA 1EK3A 3REWB 1RJLB 5LGHL 5JUEH 2AJVH 3O41A 3ARDA 3VGBA 5E8DL 3W9DB 4PR5B 3U7YL 3SGJC 4Y2DB 4ORGB 4D2NA 2BXZA 3VDCA 2CDFB 4FQHB 3P4MA 4OF3A 1G7LB 1X7QA 2V2WA 3HAEG 3WXVH 4D9RD 1GOFA 4LHJB 1UWGH 4XXDA 2NY2C 2NYYC 2Z93B 1R5IB 3ULVD 4NSKB 1C5BL 1F4YL 1MRCH 3L5WB 3OJDB 2ORBL 3OKNB 1V05A 2C3VA 3DO7A 4YDVA 1MIEH 3PL6C 4ZFOA 2Q76B 2HN7B 2OJZH 2WV3A 5A1AA 4WW2F 1DLHA 3FONA 5F9WB 4ZDHA 5L88L 5J56B 1C5CL 2JF1A 3MCG1 5FA3B 1VFOA 4GH7B 1I9JH 5FGRA 2A77L 4L3EA 4JFQA 4MD5B 3RWHA 4JFXB 4Y16A 1DQDL 3IDXL 4FTVE 2AW2A 3T0DA 5A3ID 1U0QA 4LSTL 2DJ4A 1MCRA 5EUOE 2QL1A 5C0FA 1UB6B 3IU3A 2K3TA 3ZKND 3UJTH 1UKSA 1HOCA 3RQ3A 3C6LD 3FQNA 1MVUA 5IK3A 5KZCD 5MI0C 3UYRL 3IFNL 3FFCE 1IAIM 5KVMC 3X11A 5ESVA 3CDGB 3GMQB 5T1MA 3NOIA 1MFEL 1HIML 2ZJSH 4PGEB 4FTVB 1ZVYA 3JV6B 5EUOB 5ICXB 4F9LC 4LQ1A 1JGEA 4PJFA 1C7TA 4QHUA 4Y4FA 3FRPG 5ITFA 3T1FA 3HC4H 4H5SB 4F7MA 4YWGH 4JZJB 4P4RB 4K3EH 2PKDA 3FFCB 3T3MF 2J1KA 2OL3A 2H45A 3O3AB 5CEYB 4ZUUB 5JHDD 4LLMA 3QEGL 3CVIL 2FLRT 3RTQB 3MLTA 5EIVA 4MB4A 3QR2A 1JV5A 5ANME 5J13B 5LBSH 4DN4H 4GSDH 4FQ1H 3HMXA 1SHMA 4P2CG 3X13A 4U7KA 2W0LA 3TYFB 3C8KA 3ZHKA 3ARZA 3RGHA 1BGXL 2IAMB 4P2QE 4XP1H 4Y2DD 4ELME 5HGGS 2VAAA 3TNMB 5KSBA 1RVFH 4LSRH 2XQBL 3IJYB 5ANMB 3IB4A 2OTWA 4M7LT 2A83A 1HZHH 5FO8B 3X3FL 4Y5VC 4JANB 4BSJA 3UTZB 3SGKC 2Z4QA 3DV4A 4HLJA 2VL5B 4OIAA 3GJEA 4ELMB 2VR4A 4P2QB 4Y5YA 4Z7QE 8FABA 4KXZI 1JUFA 1V7NL 3BPCA 3GBNL 1MWAH 2GJ6E 3PWLB 4UTAL 4PJAE 4D8PB 2EIBA 2YKLL 3ECBB 3MRNA 5KSAB 4QXTB 2EICA 1CFQA 4J1UB 4PRBB 2CK0L 1A7QH 5FA4B 1PZ5A 4EIGB 1TETL 2JJSA 5DJ0B 3KYMB 4U1HB 1R3KA 1S78D 1I1CA 1LNUA 2UUDH 5K9KB 1IAKB 4L9LB 4L4VE 3L5HA 4P5KB 4JQVA 4NQCA 2XACC 4GXVH 1LO0L 2GJ6B 4YPGA 1J1PH 2Z91B 2FD6L 4PJAB 3THML 3MA7A 4K07A 3T0VA 3VI3F 3FQUA 4XNUL 1E6JH 1XZ0A 4ZAKC 4MDIA 2WQRA 2ICWA 1JWUA 1U8PA 5I1KL 5E8NA 3V5DB 4NQDA 1H3PH 1U91B 4AIXA 4M6NL 4OF5A 4E41A 5CMAB 3TV3L 4PP1C 4LQFH 2ZPKH 4FTVD 4L4VB 3VD5A 5IW6B 2ADGB 4K71C 2B8OT 2PYFB 3LMJH 4JN2B 5D4QA 5I76B 3HZVB 4QRPE 5D96B 1T20A 4PFEA 5I8EA 4P5MB 1NANI 1IQDA 2AJZA 4RMQA 5I16B 3H8NA 5FGCE 2WIMA 3KG5A 5FDWA 3DMMB 3OF6A 5HGBB 3MOAL 4QWWD 3LN5A 4G7VH 3RTQD 4QRPB 3FB5B 5CGYC 2X42A 1T04B 3MRHB 4JPIA 5T5NF 3WHE1 2R8SL 4NNYA 2EKSA 3R0MA 2VLRA 3PV6A 1MCDA 3QNXB 1TPXB 3CSPA 5JQ6L 2X89A 5I1HH 1IGJB 4PTTB 5DR5L 2LU7A 3U6RB 4A6YA 2IAMD 1E27B 2ICWI 4B41A 1T03H 3ROOA 1X5ZA 1OAQL 3GSOA 3MNWB 1G7MB 3HAEH 1DBAL 3LKNB 3KYKH 1J7VR 3AB0C 2UZYB 4JO1L 2OBGA 3LY6A 3QNZB 4XWGH 1S7XB 1JNHA 1I7TA 5JDSA 4P2QD 3RL1B 3OAYK 4DKEL 1YYMH 2GSGA 4S1SH 2NCMA 4DUVA 1BOYA 4EI6B 4M43L 3QCUH 2JJTA 5KSAD 3A6BL 1DQQA 2X10A 2EH8L 5TE7L 4Z5RB 5B3JE 5L7XH 4RQQB 3KYOB 3Q3GB 4FN0A 1P69B 4JO2H 2PUQT 5HYJE 3E2HB 1JPGA 2RBLA 1OSPL 3DX7B 4N0UA 4ZNCD 3QUYB 1MIMH 5DLML 1ZLUH 2GJ6D 3WUWG 5JPMA 4XT1C 5EO1A 5J12C 3LVEA 1UWXK 3DIFA 3MRLA 3EO9L 2BZDA 5E2VH 5HYJB 1VADB 4NM8L 4NBXB 1BHGA 4R7NA 1H9VA 3LKQA 1OP5H 1T6WA 4ODVH 1X4YA 1H5BC 3BRFA 1E4XH 1GAFH 4L4VD 2AV7B 4LLDB 1Y0LB 4NKDA 5IV2B 3U4EB 3KPQA 1HCFX 4TSAL 3WIIL 3RBSA 4YHYC 1QSZA 5IMLB 4LSVL 1PSKH 2AXFA 1ES0B 3OKOB 5EPMA 5IBTL 3C5SB 2EXWD 4ZS6D 1SY6H 3MCKB 3OV6A 3VXNB 3WKNA 1EFXB 4CDHA 2EEDA 3VWKC 2XA8L 3HI6L 2IWGA 3P11H 3DMMD 2RFXB 5ADOL 3ARVA 3BE1L 1FZMB 1T89A 4JCLA 4QRPD 1IVLA 3O11A 5EO0A 2CLRA 3F58H 3K1DA 1OP9A 4EI5B 4NHCL 4MZ2A 1I8KB 3RFZC 3DO3A 4O58L 3VRLF 2KQMA 2A1WH 2HKHH 3IT8D 4KROB 1C16A 4HT1H 4BKLA 1CBVL 4NJAL 4LSQH 4Z0XB 3EYQD 2HFFA 4ENED 4CU7A 3DUSA 1LILA 2Q3ZA 3RUGF 2JELH 1AR1C 1CXKA 4YXKL 3IS0X 2D03L 3JV0A 2FO1A 2DF3A 2EKJA 3LDBC 5TE6H 3MROA 2EDQA 3RDTA 2HT4D 2ENSA 1FJ1B 3QT2A 5ID0A 1P2CA 4OQTH 1BEYH 3KVQA 1LMKA 3ULUL 4R8WH 4TULL 1DDHA 2YUZA 4LEOA 2FHBA 4OCSL 3MRRB 2Q7YA 4WENB 5I1LB 4R0LA 1EEYB 1NKRA 4G80B 4M9PA 3BKCH 4JR9H 1Y18B 2ILLA 1BQSA 1U8JB 2BSRA 4TUOB 3D18A 4JO4H 3QUYD 1FO0B 4R4FH 1DN0A 5GGVY 1EJOL 5I8CB 3V4PH 5BCAA 5DGQA 2VYRE 3AAZA 2IBBA 5GSRB 5TQ2L 1OAUH 2ATKA 3EW3B 5CS7A 1OGTB 1C5DB 1NLDH 3FB8B 4PP2B 5A43C 5HYJD 1UACL 5CFHA 3TA3C 2PXYA 3UX9B 3G5YA 4FQCL 5DGRA 4IIQC 4KMTL 1A7OH 2DBLH 1FRGH 2NY7H 4NDMA 1RU9H 4UB0H 4HCRH 2BFVH 4LCWE 4XRCA 2P8MA 5TGBA 1UJ3A 4LU5L 3WN5B 2NX5E 1JN6A 1N64H 5IFAH 5TE4H 1EFXD 1V3MA 4Q7DA 3QQ9C 5DUPL 1EAJA 3PIQA 1ED3A 1MCWW 1PG7X 2D9CA 3B2VL 3V0WL 3MPCA 4UV4L 4Z0BH 1VCAA 3RVVC 3DWTA 4U1KB 1WZKA 4ODUA 4LCWB 1FIGL 2IFFL 3TWCL 1P7QA 4PRAA 4AZ8A 2NX5B 4EI5D 4G7YL 1N7ML 2Y6SD 4UIMB 4LPCA 4YDLB 4K8RD 4G3YH 4XCCL 5CZVL 4QOKE 4ONHA 2D7PA 5IT2L 4KROD 3TBWB 3FB7B 2BC4B 5D5MF 3LH2L 5FM5M 3EHBD 4MA8L 4X0KB 3VGGA 3JWOL 1YY8B 3OX8B 1QSEA 4Y8DC 1KC5L 4YXHH 2GT9A 2UWEF 3V8CA 1NUFA 4FQXC 5I75B 5GSVB 3F5WA 4YJZL 4QOKB 3JTSB 4JFHE 2OZ4H 3IDGB 4RFNB 5ETUB 3QEUA 2W65A 3BGFC 5TF0A 5C0BE 4PY8J 5D71H 4R4BB 3GSXA 1NDGB 3UPRB 1IARB 2YBRB 3C60A 3ZKMC 5IESL 2G2RA 1NDMA 2NMSA 5KVFH 3DX9A 4F3FB 1BQHB 2OMBA 2V2XA 1GHFL 4GXUN 4NUJB 1JHKH 1J9CT 2ADFL 3L3DA 3I9GL 1QTYT 2B0SH 3ALXA 1PG7L 5C0BB 4HKZA 1IL1B 4QCIA 4ZSOE 4ZTOH 1NCBL 3PP4H 5FYJL 5FUZH 5DDHA 3IAPA 4PYHA 1G9ML 2CK2A 2IBZX 1PLGH 1S9VA 4GLRI 3MNZB 2DYPA 5C0EB 1KJ2L 3DX8B 4ISVA 4LCUB 5K9JH 5F70A 4OM1H 2MHAA 5ACLA 5GS0D 4I77L 4P0DA 4ZSOB 3O4LE 3QCTH 3QIBB 5FYKL 2G75B 5C0RL 1H15B 5FV1L 4APQB 4U6HB 2EIZA 4KKCD 4QHNB 2AEQH 3QG6A 4P3DA 1A9BB 2MQ0A 3VXOB 3QUML 4CAGA 3L1OH 2F53E 3B4NA 3QG7L 3ARBB 4PTUB 1MQ8A 1WSST 5T1DH 4FQQA 4YHKH 4QGTA 1U8MA 4LCWD 1FZJB 3I6GA 4I3SH 4XGZB 1RSFA 1JNLL 5E6IC 2NX5D 1BBDL 3O4LB 1H8NA 2I07A 4HMDA 1Q1JL 1XFPA 3KPNB 1IBGL 4OUOA 3QJFB 3MRMB 1DQML 3O81A 5JO5A 1YN6A 3WKML 1ZT7A 2BOBA 2VDML 3H9ZA 1KCVL 2F53B 1R5VB 4L29B 3BAEH 2L7JA 4LLUA 4LSPH 4BH7A 4KDTC 2OMNA 1K4CA 2J8UE 2BY2A 3BP6B 5T1KB 1XF3B 2R1YB 4K23H 3QXAA 4PGCB 5EBMB 3H42L 4DW2H 2EYSA 4LCYB 4I18C 1UWEH 4QOKD 3RWIB 2AJUL 2H32A 5DZOA 3WIHH 5J3HC 4L3CA 3OKMA 3FN0L 3ZE0E 5BXFB 1NMBL 3Q0HA 4KKNA 4UT9L 3ESUF 2J8UB 4Y5XA 4PGBA 4KGJA 1KB5L 3WS3B 4WCYH 2F19L 1B0RB 4JFHD 3C6LA 5D7IA 5ICZB 4QRRE 4AM0A 4JQIL 5E6YA 3PWJA 1DANU 4RGMB 4WVRA 1UH4A 4KK9D 3BXNB 4NNXB 1EA9C 4ZFGH 5C0BD 5L6YL 1J0JA 4HPYL 4Z78A 5JDJA 4JRWA 3VXQA 1MI5E 3RNQB 2CGRH 2CXKA 1ZEAH 5D70H 2UYLB 2X1XR 3UBXB 1T7XA 2X4TB 5E8EA 5IMKB 1WISA 3W11D 4WUUA 1RY7B 4QRRB 1F4WL 1U36A 1JTOA 4D94A 1DUYA 1EUUA 1Z9SA 4LSDA 2AEPL 5C3LD 4D0DA 5C71A 1KCKA 4QRQB 3IF1B 1QG3A 2UZIL 5JHDA 2X2YA 5F1IA 1M1SA 3RAJL 1MI5B 3CC5B 3P30H 2CLVB 3QIBD 3NA9H 5DQDH 1KCUL 4GW1A 1W72A 3VFPB 4APQD 1Q9LA 2A0LC 1H8OA 4NQXB 3REWA 1RJLA 4NZTH 3INUH 4UT6L 2IMNA 3ARBD 4KJPD 2W07A 3W9DA 1N59B 3ZSTA 4Y2DA 4ORGA 3BISA 2ICES 3O4LD 1CDJA 5L0QC 4XPHL 4GT7A 5EZJB 4FQHA 1QFWM 1CIDA 5T1LB 1G7LA 3SE9H 1CG9B 1ZA3B 3OB0K 3SDDB 3ULUC 3BYTA 4KHTL 2F53D 4ZTPH 3T0WA 1QYGH 2Z93A 1F90H 1U8LA 5DUML 1R5IA 4NSKA 4RISH 4MNQE 3L5WA 3OJDA 1M71B 3OKNA 4L4JA 2FNBA 3S37H 3P9WB 1A3RL 5T1KD 4UQ3B 5EOCL 3FHQA 1UCBH 2Q76A 2HN7A 5MHSE 3SHSA 3NFNB 4UNVA 4QNPF 3V6ZB 4ZQKB 1TJHH 4NO5B 4NKMB 5FA3A 3L3JB 3VRIB 4GBXC 4W4NA 3PWPE 4MD5A 5EWIH 1NAKH 4JFXA 5F97E 1SYSB 1W8NA 4MNQB 3B5GA 3A6CL 5GXBB 5INDB 3QJHB 4HKBB 4XP6L 3JWDC 1BBJB 4NN7B 1UB6A 3ZLQC 3FTGB 3G04B 1HNFA 2VKWA 4NHUB 2ZUYA 1S5IL 1YEJL 4H8WL 3WFHB 4HUNB 5FYJU 3LQAH 3VFSB 3PWPB 1BM3H 3CDGA 3GMQA 4FQ2L 4MVBD 4PGEA 4WNQB 4FTVA 2BY3A 3QBTB 4UOJA 5DD6B 1FGNH 3JV6A 5EUOA 2ZCHH 4FOMA 4H5SA 4D9QE 3QQ3B 4QRRD 4P4RA 5J1AB 4YBLC 1OTUD 5C9JB 3HAEB 1LO2H 2QBWA 3R8QA 2R69H 5F6IB 4RAUB 3O3AA 5HYIA 5CEYA 4ZUUA 5FGBC 1MI5D 1RK0B 3ES6B 3RTQA 4YHZL 5CINH 3TVMA 1EHNA 4W6XB 4JFDE 1NEZG 4XTRC 3FO0L 3ZT7A 1FBIH 4OLYL 3TIDB 5F1SA 1J0ZA 5DJDB 2W0FB 5DD5L 1UM5L 5ESAB 5EU7E 5F21B 2DQJL 5C0ND 1QFUH 5C86A 5F1NA 4MA1C 3ZDYE 2IAMA 3OR7B 5FUOH 1QEWB 1T4KB 2EDLA 5E2TL 3TNMA 1NGXB 4JFDB 3IJYA 5ANMA 5T1LD 5ISZE 4WHCA 1EEQA 3ROLB 5FO8A 4JANA 3HC3H 4ZUTB 4BFGA 3UTZA 2NY6C 15C8H 1OHQA 2VL5A 1FE8L 3H3PL 2Q8AH 1JRHI 3HE6B 4KTEL 4ELMA 3GSNL 4P2QA 4MA3B 4XCFH 5HD8D 1VERA 2JKXA 4HJGB 2M1KA 1RUPL 2R29H 3PWLA 4UOW0 4D8PA 4G6JH 3OHXB 3ECBA 3QXUA 5KSAA 1MLBB 4HIEB 5AZEH 5ISZB 4QXTA 4J1UA 2MPAL 4PRBA 4EDWH 5C0IB 1HHIB 5DJ0A 4RMRA 4ZUVB 3KYMA 4U1HA 1S7WB 5DHVH 1CD0A 2FSEB 3ALWA 5AD0B 4X98B 4XXCA 2ZUQB 4MNQD 1F3RB 5K9KA 5CIPH 3FFDB 4L9LA 4I0CC 1G9MC 1I9IL 2VXQH 2VLJE 3QNYB 5GGTL 4YX2L 2GJ6A 2Z91A 5JW4Q 2Z31B 2HP4A 1TFHA 4XI5C 1HHHB 3MRCB 4X99A 1XGYH 4KDVA 1A1NB 3V5DA 3ULUF 1HKFA 1U91A 4NT6B 1JTTA 2CMRL 3MR9B 3PWPD 5CMAA 5GPRA 5T33L 4HFUL 4L4VA 3WYRA 5IW6A 2ADGA 2VLJB 3SBWA 2PYFA 3TN0B 4JN2A 4N8VB 1QO3B 1F00I 5I76A 3HZVA 3TH4T 2VXSL 1OT2A 3KPOB 4NQVB 1KELH 2GHWB 4P5MA 4XNYH 5I6XB 2HMIC 1FPTL 3G5ZB 5FHBH 4UDTB 3B9KC 5BW7A 5I16A 1KLFA 5IWLC 1H3VA 4PREB 4ZYKB 2VSCA 5DO2C 4KK5C 1FC2D 3DMMA 3BZEB 5HGBA 4YH6A 3TT1H 4GG6F 5FEBA 3CMGA 3ESVF 2E7MA 1CZ8H 1ETZB 2RCSH 3VE0B 4PRHE 4QRPA 2R2HB 3FB5A 2HTLC 2UY7A 4D9QD 3MRHA 3VD9A 3SE3C 2VR9A 4JHAL 2O5YH 4YFLI 3QNXA 4OLVL 4FFZH 2IJ0C 5CKAA 1JF5A 1IGJA 4PTTA 5GIRB 3U6RA 4ZFOL 3QFDB 1E27A 1CR9H 1P84J 1W0WB 2LVCA 1OF2B 3FHAA 4PRHB 2FWOB 4JFDD 3RI5K 3MNWA 1G7MA 3P0YH 1OAXL 1CXEA 2DQDH 1S7TB 3LKNA 2R0ZH 1WT5A 1X9QA 1T7YA 2ZUVA 3QNZA 4JO3H 4BZ1L 1S7XA 5C7XL 3HE6D 1VFMA 3RL1A 5K59F 1GYAA 3K2MC 4LOUD 4LMQE 2Y06L 5D7KE 3DYPA 3ET9F 3HI5L 4EI6A 4KHXL 3OAUH 3RWEB 1X3DA 4HJ0C 2DQGH 5ISZD 1HK6A 4Z5RA 4RQQA 3KYOA 2H26B 3Q3GA 1Y6NR 2YS4A 2CR6A 2LV4A 2V5MA 4Z6AT 4X5WB 3DX7A 3QUYA 4RSVA 1Q9OB 3QAZC 5F3HB 2Z31D 2O61B 4LHQB 4I13B 2HKFL 2OL3L 4X80H 3UJJH 4OD2B 1LQSR 5FK9B 5IROA 4DJMA 2IG2L 4AK1A 5HYJA 1L9MA 1VADA 4HDIB 4WUKL 2R15A 2R39A 3C2AH 5KTEH 4CN6A 5GGSA 2AV7A 4LLDA 1Y0LA 2VLJD 1OAYH 3TJEL 2DKUA 3TN0D 5IV2A 4HWBA 3U4EA 3HMXL 2KZWA 4MAYC 5JXAL 2DTML 4NIKB 1T83A 4Z8FH 5IMLA 2FBJH 4ZD3H 1U3HB 1WF5A 4FABL 2O26U 3NABH 1ES0A 3OKOA 1I1AC 3C5SA 1TJIL 3MCKA 3VXNA 1EFXA 2ICCA 5I1EL 4DKFH 1P4BH 1TTUA 3DNKA 4RBPH 5ENWB 2IQAB 5EIQA 5IHUL 1RZIB 5F6HI 5ILTH 4KV5E 2RFXA 5E8OB 3EJYC 4M1DL 1FZMA 4AMKH 3VXUE 2HG5B 4OD3H 1A5FH 2F58H 3ZE1F 2MTPA 1ZLWH 4EI5A 4BQ6A 1I8KA 1FLRL 4NP4H 4Z7UE 5B4MD 1YEEH 4K94H 4FQPA 3VGEA 3DUUB 1MQKL 4FHBD 1KCSH 4LASL 3BUYB 4CW1B 4WFGE 4LRNH 3T2QA 3QPQD 3VXUB 4QTIH 4Z0XA 4KK8D 1A6WH 4PRHD 5E08H 1LO3L 4CJ0A 1QLFA 3WUWB 4AEHH 5AWNL 4KI1A 3MRDB 5FAAA 3NZ8B 4Z7UB 1HILB 3VFGL 4OGZA 2EYRB 1V7ML 1QLEH 4LCIL 1FJ1A 5CD3B 2IH3B 3OB8A 2XZCL 3PGDB 1E0OB 1VDGA 3EYUL 1OVZA 4H8WC 4KKAD 4NKQB 1PKOA 5EU5B 5SX5K 3R06B 3MRRA 3MJ6A 2CJUL 5M7QA 5I1LA 2WQ8A 2MQCA 3PV7A 4C4KT 1EEYA 1VGEH 3KR3H 4G80A 5H35B 1IFHH 1WWBX 2VL4A 1Y18A 2EE2A 4OSUL 1FLTX 1U8JA 1XR9B 4TUOA 2AV1B 1FO0A 5I8CA 1G1CA 5D7KD 4U6VL 2WBWB 1FZKB 1TCRB 4YE4H 2QSCL 5GSRA 5CUSH 3I75B 2CXGA 1YEFL 4N0YH 1OGTA 1C5DA 4J7RA 4X7SH 3FB8A 4PP2A 5C6PB 3EJJX 3I50L 1NCWH 1Q8MA 2VIRB 4AEEA 1PW3A 4Q9RL 1S7SB 3DV6B 4U31A 2R4RH 3IXAB 1AY1H 4FZEH 1EBAA 2B7DT 3MODH 4MJ5B 1CLOH 1T7WA 1KYOJ 4XBPA 1QBLH 1U3HD 2AERT 5GGQH 5IF0B 5SV3A 5D1ZC 3K1KC 3C87A 3IDYC 2VDQL 4A6YL 1N4XH 1OARH 3PE9A 2Q8BL 1J8HE 5BVPH 4JM2C 1D6VH 2EDBA 4XPAH 2NZ9D 3SE4A 2VDPL 2J12B 1DEDA 5IJKA 4XWOD 4KAQL 4HUXB 1FAIH 4U1KA 4OLWL 4JGUA 1UZ6F 4I0PB 1WICA 3W81A 4E5XB 1AD0B 1N6VA 4M1GL 4H1LB 1EHXA 3V95A 4UIMA 1J8HB 4NNPL 3STBA 1JWSB 1NGYB 1EGJH 4F37K 4PYGA 1ORSB 3TBWA 1JGDB 1SMAA 3FB7A 2I9TB 4TUKH 2BC4A 2RJMA 4ODTL 3WDJA 3VXUD 4UNUA 3O6KH 4X0KA 3DYMA 1QR4A 1DANT 4DZ8B 1YY8A 3OX8A 3NZHL 1JI2A 2Q3AA 3C08L 3CH1B 3KLHD 5GSVA 4ODXB 4KVCH 4QOKA 3JTSA 4M4PA 5LKNA 3IDGA 3M8OH 4C56E 4QRTB 5ETUA 4WFGD 2E8ZA 2LU4A 4R4BA 2R8SH 3P40A 1NDGA 3UPRA 3PQYE 4J4PD 2YBRA 3MO1B 4LFHG 2AAVA 1GL4B 3EYSL 3EDKA 1I1FB 2GK0A 5DI8B 3LD8C 4F3FA 4OV5B 1BQHA 2NY1B 4KTDL 2ZP0T 1JYXA 4NUJA 1T1YB 3ARDC 4C56B 1F02I 3B2UD 4PRPE 2F5BH 1R0AH 3CCHB 1MCCA 1F97A 4ZS7H 3OPZH 1RUAH 2XKSA 1IL1A 1MFAH 1YJDL 3PQYB 1FNSL 3QPXL 4GJTB 4XCNB 3QUKB 5FIEA 4PJ9A 5F88B 4LL9A 1ZHNB 1U95B 2ICEB 4F9PA 1VFBB 4YIQB 5T5NG 5I1IH 2H2PD 2OI9C 3MNZA 5C2BH 5C0EA 3DX8A 5TQ0L 4LCUA 4PRPB 3C9NB 1CGSL 4Q74A 4M61A 1RIHH 1L0QA 3HUJE 1KULA 3HHRB 4ZSOA 3ZE2E 1I1YB 5J11B 4RGNB 5FECB 3QIBA 4P46B 2G75A 1H15A 3BW9B 4A2LA 4APQA 4U6HA 4QHNA 1A9BA 2A9NL 2EO1A 4U1JB 4YHMH 4JPWH 4N9GB 3ARBA 4PTUA 4Y16C 4EQ2A 1RJZB 3HUJB 5HVWA 3FT2B 3RVWD 4I0PD 4XGZA 1YN7B 2CKBB 5L2JB 3LSOB 2NLJB 3O4LA 4X9GA 1J8HD 3I2CH 3KPNA 3QJFA 2WUBL 3MRMA 4D3CH 4OGAD 5F8RC 3NACH 4NN5B 2V7HB 4OLZH 4FZ8L 2F53A 1R5VA 3TNNB 5SV4A 3WUZA 1RZJL 5F7FA 4QHMA 4LLYB 4L29A 3BX7C 4WTWA 3IFPB 3BN3B 2N1KA 2PCPB 2R9HC 1Q0XH 4GKOA 3BP6A 4OF6A 3KLDA 5T1KA 4Y4FC 1XF3A 2R1YA 2X41A 3CGTA 4DZBA 3ARGB 5EBMA 3SO3B 4O00A 4LCYA 1GGBH 4JM2F 2P48B 3RWIA 4F15B 5GGRY 3BD5A 1H8SA 2QQLL 3NGBC 2JTDA 4LBEB 2GTZB 5BXFA 1BWMA 4ETYA 5HVFB 2P42B 2J8UA 2YD9A 4BZYA 3IDNB 2D3VA 3WS3A 1NGWB 2VZOA 2DLIA 1B0RA 2NY1D 5ICZA 3O4OC 2I5YH 1BX2B 2AQ2A 4C56D 2LTQB 2XTLA 4CVZB 2FEDC 1QOKA 5EBGA 3RX5A 2WWKO 3BXNA 4NNXA 1QQDB 2WP3T 2C1PB 4OLXL 2HH0L 3PQYD 3LPWA 1EEUA 4BQ9A 3MRGB 3SE8H 3O8XB 5DC9B 2UYLA 5DXWA 3UBXA 1P4IH 2X4TA 1AXTH 5IMKA 4KUZL 4QRRA 1WWCA 1KNOB 4Z7WF 5ADPH 1LVEA 4K7PY 4PRPD 3BKML 2OQJB 12E8H 4QEGA 3BDYL 2QSQA 4XNXH 2P44B 3VXME 4QRQA 4Y5YC 3IF1A 1ZV5A 5HVHB 35C8L 1KXQE 1MI5A 1VEPA 3CC5A 4RGND 2CLVA 4P46D 1NCCL 3UTTE 4FFWD 1MWAA 2VNCA 3P77B 4OZGE 4DVRL 4NQXA 4R90H 2D0FA 2A6KB 2JJSC 5DC4B 4Z7VE 4OI7A 1QPXA 1XF4B 4OCYH 5E4EC 4F7PB 1MCWM 5I30L 4XHJD 1N59A 5DD0L 3VXMB 3WIFB 1YEGH 3CK0L 4OM0H 4RCAA 4JQVC 5DHVB 3SCMC 3U9UB 3D1MC 3GSVB 3FT3B 1UADC 5EZJA 3UTTB 4OZGB 3ZDZE 5T1LA 5I2IB 4CN1A 1MF2L 2FBOJ 4NFDA 4PS4L 1CG9A 1EXUB 1ZA3A 2AXHA 3GRWH 4Z7VB 3UBXI 1WWWX 1MPAL 3NIGF 3EGSB 3GHEH 4Q9QH 1M71A 4UQ3A 5IBUG 4BSWB 1FNEB 3ARGD 4NKIH 3EYVB 3NFNA 5DMIL 3V6ZA 2YC1B 2OJEB 4ZQKA 2HJKB 4NO5A 2AGJL 3HMWH 4J3WA 4RGOL 4NKMA 1E4WH 4HS8H 3VRIA 3DRTA 1J5OH 1KJ3H 2VUYA 5C1MB 1SYSA 4KTYA 4MQXD 3D9AH 5INDA 3QJHA 4HKBA 2H8PB 3QXDB 1BBJA 4Z77B 3FTGA 3G04A 1QACA 3ILPB 3BDXA 4NHUA 1UM6H 1KLUA 3C09B 1I9RH 3WFHA 5JPNB 2O5XL 3VFSA 3PWPA 4U6YB 1GPOH 2X05A 4WNQA 5D7JB 4EOWH 5DD6A 1N6QH 3SDCB 5JA8B 2YPVH 3Q6GH 1HHJB 1LE5B 3O8XD 4EBQL 4Y19E 1B4JH 5E99L 3QQ3A 2X1OA 3O0RH 2FL5B 5DVOA 3CLFL 5J1AA 2OCFD 5C9JA 3HAEA 3GUTB 1QNZL 1ADQH 4TNWK 1HSBB 3HZMB 2Y5TB 3QUXB 4RAUA 3V9FA 2YUWA 2PYEE 3CNKA 2JCCF 3PDOB 4D9LL 5JORB 1UB5A 1RK0A 3ES6A 4Y4KC 3O6MH 2JJTC 2OYPA 1IKNA 1FYTE 5DJXB 3HNSL 3ULVL 5DFVD 5DJDA 2W0FA 4Y89A 2EDNA 5F96L 3RZCB 1NMAL 1QKZH 4OUUB 4JM4L 3TESA 5IR1B 5ESAA 4DVBB 5D9SB 4NBZB 5EULV 1CXFA 3VXMD 1IZJA 2PYEB 2P49B 1LDPH 3OR7A 1QEWA 1T4KA 4LCCB 4NZUH 1X4ZA 2BNRE 3L7EB 3QULB 4G6MH 1NGXA 2O5ZH 3UTTD 3NAAL 4JFDA 1BF2A 1FYTB 5FCUH 1DEEB 3UAJD 4AG4H 4Z9KB 4Y1AE 3ROLA 4K9EH 3BPNC 4ZUTA 3A67H 2VSDA 1LEIB 4HWNA 1CLCA 3HE6A 3RVTD 3RZWA 3RKDD 4MA3A 5LG1A 3RA7L 2D31A 2AJYH 4HJGA 5FOJA 2BNRB 3PWNB 1Y6MR 4NGHH 2HVJB 1TVDA 3OHXA 1MLBA 2IPUK 4HIEA 3TEUA 1WJ3A 5ISZA 3WD5L 3T3PE 3PABB 4Y1AB 1NCUA 2YD3A 3FRPA 3LRGA 5C0IA 1YJDC 1HHIA 2BSTB 4ZUVA 2ZG3A 1S7WA 4JFEE 1HDMB 2FSEA 5H8DA 2NY3C 5AD0A 4X98A 2VDKL 3FFDA 3DURB 1T89C 32C2B 3UZVB 1FH5H 3QNYA 3OZ9H 2YMXL 4JPVL 4DTGH 1N0XL 2Z31A 5I19H 1NCAL 4ONGH 3CXDH 4MA7L 1HHHA 4MNHB 5M95B 1EZVX 3MJ9L 1Q72H 5CILL 1WFUA 2AJXH 1A1NA 4JDZB 2B1AL 4NT6A 1EHLL 4JFEB 4XCEB 3MR9A 1W72L 2XY1A 4P5TC 5D7JD 4LPWA 4XC3H 5KS9E 1EO8L 3SDCD 3WDHA 5E1HB 2VLJA 3LHPL 4I5BB 3TN0A 3D25B 2C5DC 1QO3A 2NY0C 4QXGH 3KPOA 3G9AB 2BP3A 5FFLA 3I85A 3MLVH 5GS2D 4PD4K 4U0QB 1MFCL 1KFAL 4YAQB 2C3GA 3GM8A 4PREA 4ZO6A 4ZYKA 3QUXD 1Q94B 2GIYA 4F7EB 5KS9B 5KJRL 3BZEA 1AGCB 2E27L 3Q48A 3T2OA 3G5XB 5D6DA 4B53A 2R0KH 1FV1A 1KCRH 4JKKA 3VE0A 1FCGA 4ERSH 3FMGL 2R2HA 1DCLA 4OQTA 3BP5B 1RZJC 1JGVL 1HQ4B 4JZOB 2OM5A 4R0LC 5GISH 3RZCD 3B9AA 2VZUA 5FM4A 3L3HB 4XPFH 3HI1B 1BJMA 1YEIH 5FHAL 3GMMB 4J3TA 3PP3K 3P0GB 1I8IA 5GIRA 2PYED 4PJ7E 1JPFB 5C6WH 5CGMA 2YA0A 3VMNA 3HNTH 1W0WA 1OF2A 1JPSL 2XKUA 1U8HB 5DD1H 1T5WB 4PRHA 3MXWL 2FWOA 4ONFH 1Q9WB 1FYTD 4KRLB 5GS1B 1S7TA 1P6AB 4CMMB 1JPTL 1CK0L 1A0QH 1TQCC 2G9HB 1GOGA 2UZXB 1G6RH 1A6VL 3TJHD 5DK2B 3STZA 5MEOB 1A7PL 4HC1L 4MJIE 2BNRD 2PR4L 1UJ3C 2ZUXA 3RWEA 2QLVB 4HCRA 4Y1AD 4GG8B 4FQIH 2H26A 3IXTB 1YY9C 4OCLC 3WJJC 2HLAB 5ELIA 1JRHL 4PJDE 4X5WA 1U8OB 2DQCL 1Z6JT 3GI8H 1Q9OA 4MJIB 4RAVB 3CDYA 5F3HA 2O61A 1RZKL 4GS7B 4K3DL 4PJXE 3RU8H 4HMEA 4OD2A 5FK9A 2Z8WC 5JZ7D 2A9MH 4PJ8B 4M93B 4YO0B 4DGYH 1RUML 3TFKD 3V52L 1OP3H 4HDIA 4JFED 2ZOLA 4OF7A 4YGVB 4OCMC 5TDOB 3DVGB 3WFDH 3PGFL 1U8IB 2EDYA 3O6LL 4PJDB 1BFVH 1JNNH 1DLFH 3U83A 1NQBA 4Y8AA 1X5LA 4Q97A 1A9EA 4PJXB 1RIUL 2OP4H 4J2XA 1KB9J 1U3HA 3ABZA 3CU7A 2ED7A 4HS6B 4NBYB 5GRUL 2XYCA 3EOAB 4NOFA 3SGEI 3U46B 1QR1B 4F57H 4JPKL 2IQ9H 4M7JL 1MJUL 4A2MA 5ENWA 2IQAA 3BN9C 1RZIA 2X4QB 4MB3A 5E8OA 2OZ4A 1NMCB 4JHWH 4TPRL 4JY5L 2HG5A 5LGHH 2PETA 4MXQC 3C60C 3GK8L 4N90E 3S35H 2X70B 1OD9A 2AJ3B 3BH8B 1A1MB 1Q38A 3O6FB 3R4DA 2VDLL 5I8OH 4PLJC 1F4XL 3KJ4C 3U7YH 3BZFB 3HZYB 4DGVL 3DUUA 1VESA 1L7TH 4HIXH 3G9VA 3OL2A 3BUYA 3OAZK 4CW1A 4LLVB 2PN5A 4ZOEA 3QDGE 1Q0YL 3VXUA 3VA2C 4R97C 5EZIL 3WUWA 5I15L 1KUMA 3MRDA 1CICB 4IRJB 4GQ9H 5JHLH 3NZ8A 4UNTA 4Z7UA 1K4DB 3GEWB 1HILA 1TDQA 1MEXH 4TTDC 2EYRA 4ODHH 5JW3L 2H1PL 3QHFL 1U3ZA 4XAKE 5CD3A 2WM0A 2IH3A 3QDGB 4PUBH 2Y07H 2DWDB 3PGDA 1I3VA 5EU5A 5L88H 1U8QB 1L7IL 5DTFB 1C5CH 4HJJH 3R06A 4J4PA 3Q5OA 3QHZH 4W6YB 2W9EH 3PWUB 3EFDH 1A3LH 4D0CB 1N3NB 5HHPB 5LGJB 4LSTH 5CP7B 1XR9A 4C57C 2VC2H 5J4MA 2ATPB 4O5LH 5E70A 3T4AB 4MJID 2X44D 3ELAT 4MGXA 1FZKA 4BM7A 1TCRA 1S3KL 3GMLB 2YUXA 4CRPA 2ZOKB 4OD1L 5DEGB 1F3DH 3BKJL 3I75A 3V7AE 3UYRH 4Q6YA 4MYWB 4PJ8D 1DTUA 1VSCA 4ALAL 1CLZH 2VIRA 1KB5B 2XIDA 1S7SA 1T0MB 2R56H 5EDXA 3DV6A 4GMTL 4P48A 5C0AE 1L0XA 4JQXA 1XGQB 3AREB 3IXAA 4WW2B 3BIKB 3ULVC 3MGTB 4MJ5A 4L5FL 1JE6A 1DBMH 4G6AD 1E28B 2IGFL 5IF0A 2K9UA 4X6FB 1KIPB 1FSKB 1H3GA 4OI9A 5I1JH 3UC0L 1XT5A 4U1GC 5DJ8B 1BZQK 4L8SB 2VLLB 4JREC 5KG9B 4PV8B 5C0AB 3T8XB 3QRGL 4U3CA 3BZ4B 4HUXA 3WIHA 3LB6D 2DQHH 4GKZB 4I0PA 1B3JA 2YPKB 3T3ME 3AVEA 4Y5XC 3QZWG 4E5XA 1AD0A 4H1LA 3O6FD 3ZKNC 4XPTH 1J8HA 3O2VH 4TTGA 1LK2B 2Y25A 3C6LC 4PJIE 5B21A 1JWSA 1NGYA 2FGWH 4CMHC 1ORSA 1Z0MA 4K2UH 1JGDA 2XQBH 4F58L 2I9TA 5C70A 2VUOA 1S8DB 3CSGA 4OCNC 1T2XA 4N90D 4DZ8A 1CICD 4IRJD 5I1AB 4RFOL 1MCEA 3CH1A 4GAGH 4ODXA 4PJIB 2AJSH 2FX8H 5IQ9B 5EC2B 4Z76B 2VDOL 1V7NH 2EDHA 3GBNH 4OJFL 3ZYZA 4UTAH 5D1QA 3QDGD 3QISA 1A4KB 4JEGB 1KG0B 2CO6B 1DVFB 4QHKI 3MO1A 2A6JB 1I1FA 2CQVA 1R3IL 4OV5A 1RD6A 4HWBL 1RIVH 1T1YA 5JIPA 1FC1A 2M2DA 3DLQR 4PB0L 1R5WB 2WLYA 1F8TL 4UTBH 3CCHA 3GI9H 2JB5H 4I3RL 4NRYB 3WHE0 1VFAB 4Y2DC 5I1KH 3PQYA 4XCNA 3QUKA 1KN2L 4M6NH 1UXWB 5F88A 1TXKA 3TV3H 3H7LA 1J1XL 1GGIL 1U95A 2ICEA 1VFBA 4YIQA 3QP3A 3K0WA 3MA9L 3VI3E 1TZGH 4PRPA 4M6ML 3C9NA 3ARED 1WFOA 3VW3H 4YHLL 4K8RL 5IB4B 1FQ9C 1I1YA 5HDLA 3WS6A 3C6SA 3B3IB 5F3BB 5FECA 4P46A 5IIEB 4ODSH 1F42A 3SDAB 5CHNB 5F9WC 3E6HB 4DUXA 1FNLA 5C0AD 1E6OL 1S78C 4N9GA 1SM3L 1FNHA 5CJBA 5T3XE 3HUJA 1RJZA 1U58B 1UH2A 5BJTB 3FT2A 1Z3GL 3LIZL 1YN7A 2CKBA 4O02H 3ZT6A 5L2JA 4TSBL 3LSOA 2BVQB 2NLJA 4L8CB 1SBSH 3MLUH 3TBVB 1ULVA 5HGHB 4TVPH 3TBTB 1UEMA 3DI2B 2V7HA 3GHBL 4LP5A 1EV2E 5HY9B 2KBGA 3TNNA 1X5KA 3GGWB 4H88L 4LLYA 4HD9A 1GGCL 3IFPA 5D72L 3P73B 2P4AB 2L0DA 4KJWD 2PCPA 1RUKL 4BELD 4JO1H 1K8DB 3ARGA 1FO0L 2XZAL 1DBBL