1JGUH

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYLDSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Antibody Light Chain
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguH01
5GIRB 1NUNB 1GRWA 1AD9B 1TVHA 1N0LA 4PGCB 4HPOL 2ITDB 4U1NA 4G8GD 3MRDA 4PJ5B 1YEKL 4NQCA 2P7TB 5E1HB 4JQIH 4ONFL 4WWID 1FFPA 4X99B 5C0GA 4CW1A 1ZTXL 4P2RE 1CZ8L 4OZIF 5JA8B 1F00I 5KTEH 4G6JH 3SDCA 4OCXL 4TVPD 3S3JA 3X13A 3FMGH 4I0KA 4OT1H 5ICZB 5JDJA 1CXEA 2C3XA 3IB4A 4Y4HB 4XH2A 1R3IH 2HFGH 1RD6A 1GIGL 1N0XH 4NRZA 3KLSA 1XGRB 3DX7A 3VGFA 3CX5K 3BP5A 4NOFA 3ZL4H 5L2KB 1NCAL 5L9DL 2FIRT 2DD8H 3TBYA 3JV6A 1IC1A 3QIUB 5MEQB 3ALPA 3B9DA 5EOQL 4G8EB 5HHQA 3QULB 1A9EA 3TT3L 1MHPH 3ARBA 1T4KB 1R3KA 4U6XA 5EBWA 3KGRA 4P9MH 1S7RA 4OIIL 3SDXE 3V6ZA 4LSVH 4RGNC 2LE9A 1F11B 1IC4H 3CJJA 4JPVH 4LKXB 4Y19B 2HFEB 3QO0A 3T0EC 4YGAB 5EULV 3SDXF 5IMMB 4H88H 2OXHA 4OFYA 1RIHL 4OZIA 3T1FB 3QWOA 1FL6B 4ONHB 4YR6A 1SEBA 5FKPB 5CHNB 1CGYA 2IF7A 4PGEB 7FABL 4N9OB 4XVTH 3WFDL 3MNVB 5B8CC 1UM5H 4X99A 5E2VL 2DQEH 4DEPC 2F58H 4DEPB 4D94A 2X41A 3CH8A 3TVMD 4J3VA 3U0WL 2ATPA 1MEXH 3WS3A 4JY4A 3DOSA 2VLMD 5HGBB 2NTSP 4U33A 1JHLL 1N6VA 3A6OA 3LIZH 1FYTE 2R8SL 3MSPA 4YDIL 4NO3B 2WP3T 3KVQA 4POYA 2VIRB 1RK0A 1PQZB 4RGNB 2EDWA 1SYSB 1I3GH 3HI5H 1I9RL 5FYJD 4W81A 4BZ2L 1UJ3A 2H32A 4O5LH 2CKNA 3AMKA 3GGWA 1A22B 4HS6A 4XC3H 2I24N 2EE9A 4KUCF 3AM8C 1XGPA 4POZD 3MLZL 1R5IA 4NJAL 2WBJA 4LLQB 3HZKA 3LD8B 4GSDH 2BSRB 3QI9D 5IOPA 3IT8D 1JE6A 2BY0A 5EPMA 3QO0B 4QOKE 1CLZL 1KBGH 3B9KD 2DQFB 2Y07L 1P5VA 1IRAY 4ZTPL 3LKOB 5GGVH 5BV7L 3G6JF 2EKSB 3GK8H 2H8PA 3EYFB 1OHQA 2GT9A 2BY3A 5HVFB 8CGTA 4U49A 5T3ZL 4OF0A 1B0WA 3MRIA 1OLLA 3OJDB 3UAJD 2J6EL 5I19L 2BSED 4R4BA 1IKNC 4TVPE 3VFSB 5JXAH 4BFIB 4YHOL 4UT7L 1PLGL 4XWOC 4CADA 2OP4H 3QEQB 4HIEA 4JZJA 5CKAA 2IQAB 5JW4Q 5IB2B 5E6IB 1OTTC 4RAHA 5I16A 5EUOB 1IGIL 3STBA 1NBYB 2NY2C 2VIRA 5KSUA 5F93C 4NJ9H 4NKMA 1J1XL 3QUZD 2DQJH 3ARFB 3FQWB 1S9WB 2CPCA 3Q5OA 2EE3A 5KN5A 1PEWA 4D9RE 3MV9B 4NKOA 4DVBB 5FO9B 4DVRL 5ADOL 3ZE2E 3KPOA 1J10A 5SX5H 2BCKA 3HE6C 5SWSA 4R90H 4XWGH 4OM0H 1T1ZA 4K23L 4WFEE 2YD6A 2VLME 3MOQA 4JHWL 4KJWC 2XQYG 3IDNB 3EO0B 3ARGD 1D5XA 3DVFA 2X05A 3ECBB 4MJ2A 5EU3B 4D0BA 4YE4L 3WFCH 1PY9A 2H8PB 2ICEA 5EC1A 3ESUF 4O2FA 3CDGA 1NCWH 4XP1H 4NNPH 3NN8B 5SV3A 2HLAB 3MXWH 2EDXA 3GHEL 3AS1A 3F58H 3P9LB 1ADQL 4YQXL 4ONOA 3QDMB 4PBWD 1QFUL 4GAGL 3GI8L 5IR1B 4DCQB 3W11D 4AIZB 4WGWB 4P9HC 4NQED 3MFFA 4PJGB 1QRKA 3SGDH 3BEVB 1WITA 4Y4FC 5B3JE 3NCYS 3C5JB 4EVNA 1E6JL 2XWBB 4WVRA 4ERSL 1FFPB 3TGXA 3ALWA 1JF6A 1JYNA 4ODSH 3ZHKA 3GMOB 4KUZL 1IGMH 1DQJB 3LB6D 3ARGC 4OJFH 1KGCD 4L1DA 4PB0H 3LRHA 3QZWG 5HYJA 2OK0L 3MA7B 3GKWH 1U91B 4HLZG 4M7LT 1FGNH 4NKOB 5JOEA 1LE5B 5L0QB 1Z6JT 3BKYH 3REVB 3GHEH 2YOCA 3MXWL 2GJZA 4WU7A 1ZLSL 4KRPD 3HKFA 3O2VH 3HTLX 3DXAB 4KTDL 1BWWA 5DJXB 3GI9H 4UINL 1T3FB 3V52H 4OSUH 2BVPA 3JV5A 2R0LL 3ARBB 1QRNA 3D69A 4U6XB 3Q1SH 3TT1L 1U8IB 3K4DA 4PJEB 4X0KA 4WI2A 4JFYB 3ILPB 3VXSE 1KC5L 5DD1H 5FO7A 2NY7H 1TDQA 1I9IH 1YC8A 3GMLB 2PO6B 3EO9H 1K8DB 5K9OB 4M7LL 4R3SB 4U1HB 3N85L 5E8PA 1HI6A 2IBZX 5TGBB 1QVOB 4Z7QE 2VLKA 5IMLB 4PYHA 4K3JL 4H26B 2LU7A 1C1EH 5D71H 1RK1B 3QZWB 4DGYH 4I2XB 1S8DA 4YBLB 2QSTA 4C58B 4UTAH 5DHYA 4UOW1 4FQJH 4F8TA 4EQ2A 3VRLF 3VXQA 3ULVF 3R0MA 2GSGB 4ZUSB 2GI7A 4WFFE 4PJ7B 5D7JB 5C9JB 2A38A 4NCC1 3W0WA 2LTQC 3TO2A 4MXVF 3ULUE 4LNVA 3QIBC 4Y19E 4OZFB 3UTTD 1BZ9A 1NBQA 1MFAH 2FEEI 5D7SL 5FKAB 1I9RH 5DJCB 5IB4B 5T33L 1B0RB 1MQ8A 3IETB 3SDXB 4P23A 1SHMA 2BVYA 4MXVE 4LOUD 2EEDA 3Q6GL 5CSZA 2XNAA 3U36A 4Z7WB 2BZDA 4J4PA 5IBTL 1NCTA 4QTIH 2QADD 1IKFH 1ZEAH 2AK4B 3TJEL 1N6QH 5AWNH 1T7XA 4ZSOB 1QR4A 4MD0B 5CEYB 3JUYA 5T33H 4CKVX 4O51A 1UKTA 3WUWB 5GGVL 3MACH 2W38A 1NC4D 3BWAA 4NKQB 4L4VE 3HG1B 4HFWA 3PDDA 5D1ZA 3V0VB 1NAMH 4PJEA 4X0KB 4RQQA 4PTUB 4PP1C 1DVFA 2VR5A 3NAAL 1BF2A 1GZPB 1HNFA 1JUFB 2D31B 4P2RB 5I1AA 1EXUB 5JW3L 1AJ7H 3V5KB 4W6YB 4J3SA 2A77H 5FK9A 1R5VB 4MZ3A 2DICA 4KVCH 1L0QA 3EO9L 5CAYB 1KIQA 3S3SA 3KPMA 3GBNH 5J13C 4HKXA 1CD9B 2AI0L 3FN9A 2NXYB 4UV4L 1G7QB 4BKLA 4GW5A 3O41B 4LMQE 4M03A 1ZLWK 3WN5A 5HYIA 3GIZL 2Q76B 5F88A 1FCGA 2IMNA 3HZYA 4P2OD 3O45A 2E7MA 4QWWC 2EXYD 5ESQB 2ADFL 2DKUA 4XPHH 2YBRA 1HXYA 4F2MA 4ZUTB 3KYNB 1IAII 1U0QA 3BKYL 4Z7WA 1MFDL 1YEGL 4M61B 1MRFH 4JRYB 1QBMH 4M5YL 3WHE1 1UM5L 1NGYA 1S9YA 4TVSa 4NKMB 4PJAF 2OK0H 4WIQA 1MPAH 1OQXA 3FQRA 1YUHA 2G60L 2OLDA 4CVWA 4JRXE 1JGEA 5HHPA 4GAFB 3W11C 4MAYC 5GS1B 2P8PB 4KK9C 3V4UH 1XGTA 1W2KT 4QRRB 2Z9TA 4M62H 4P46D 5KAQG 3DUSA 4M7ZC 5SWZA 5HDLA 1SVCP 4G5ZH 1QFUH 3V5KA 3C09B 3D9AL 3ECBA 3GMNA 1OTTD 1MFBH 3MA9H 3MCLL 1BFOB 1U8KB 3SOBH 1MCQA 2OQJA 4PR5B 2A2QT 1WZ1L 3RJQB 2ARJQ 5IV2B 4P5MA 3O6FA 4N5ED 1ACYL 2MWCA 4JGMA 3QXTA 2HTLD 1OB1A 3EDDA 3JV6B 1X4YA 4OBSA 1OAYL 3I9GH 5DO2D 3PWJA 4JM2F 1XEDA 5E9DB 2MSPA 3MRKB 1A7OH 1KCRL 1VB9A 4YPGA 3GSNA 3CUPA 4G3YH 3ROOA 4M61A 4CN6A 1FDLL 1CYGA 1ZTXH 1TENA 5EU6B 4XVUD 3TBTA 1YEEH 3RL2B 4PJEF 3BIKB 3TH3T 2RCSL 1BLNA 1AGDB 3BRDA 4AG4L 4Y19A 3LB6C 1QSEB 3UZEA 1FRGH 5FF6A 5JZ7D 3KXFE 1TPXB 3JXAA 4JN1L 3EGSB 3AVEA 4LNRB 1M7DB 3KYMA 1CDJA 3V6OC 4UZGA 4I18C 4XPHL 5FECA 5BXFA 1MVFA 4AL8L 3FOMA 3BYTA 3G5YB 1FC1A 1GGIH 3QAZC 2CKBL 3MX0A 4XC1H 3SKJH 3H3PH 3KPQA 4YO0A 5MENB 4OLYL 1J5OL 3D69B 1QFWM 1ADQA 1KCUH 1QSEE 1XF3A 3ILPA 1XF1A 4Y1AB 4WW1A 5L2KD 4GMSL 4PJEE 3H9HB 2OYPA 4XNZC 3MJ7A 1NGQH 2X6MA 3BT2H 4NNXA 3NZ8A 2HT2D 2VDQH 3IDYC 4R3SA 1OSPL 5JW3H 1OP9A 3S36L 3UDWA 1NSNH 1IM9D 4BSVB 3F7VB 5BZDA 5DD3H 1W0VB 1J1OH 1F02I 1DDHB 4L8SB 3VXMD 5D6CA 2A1WH 3TCLB 1DP0A 4M93B 4Z0BL 3KJ6H 4KXZI 2OBGA 4LAQL 3HE7B 4JZOA 1IKFL 1ZEAL 4HCRA 1CQKA 1UJTA 3FQUA 5DURD 1BVKB 1FJ1B 5EZLA 3B9EA 4HDIA 43C9B 5K9JL 1TJIH 5CMAB 5IP4A 3RUGF 4E0RA 4KTYA 4JQXA 4YDIH 4I5BB 4ZFOB 5A2KH 3B5TA 3FT4B 3S5LB 2R4SL 3IJHB 3VGBA 2ZCKH 2C7UA 5D5MA 5FB8A 3FT3B 2O61A 1QEWA 3NCJL 1KGCE 3CXDL 4WGVB 3IFOA 4WI9A 2AJSL 3G5VB 4LAQH 2IPTH 3VFTA 4JFQB 4M1GH 1X5AA 4OZGA 1NC4B 4LCIH 5FHBL 5H94B 2WANA 1OOAA 2IC2A 2GFBB 5CINH 1MFCH 3HG1A 4HFWB 1QFOA 3Q5TA 3SBWC 3BQUC 3NABL 3SCMD 3CD4A 3B6SA 1WBYB 3UROR 1ZLVK 3LH2H 3ZKQD 5ICYA 1LDPL 2DL9A 3RI5K 3EJJX 1H3PH 4TPRL 3ARBD 3OZ9H 2XQBL 1RMFL 1F2XK 2V7NA 4FQXB 1RU9L 1CLCA 4I0PA 4WU5A 1BJMA 4MNQA 1UB6B 1PKQE 3C08H 3LHPL 5J8OA 1U3HD 3ULUL 3U46A 3L7FA 3MRCA 1G7QA 3QHFH 2VWEE 4Y16C 5EIIA 1A1MB 4K8RC 1BF8A 1T22A 4JDTH 2EYTB 3TN0C 5HDBF 2C3VB 3S35L 4IRJC 4OF5A 2G2RB 1KNOB 1I4FB 3TIEB 4FTVD 2Q76A 3OAYK 4JZJC 3VGDA 1E28A 2EEBA 2HMID 3IDNA 1C12B 3HCVB 4RGOL 3ZE0E 3RFZC 1DQQB 1TJHH 3ZE0F 2WBJD 2XZZA 4G8IA 4G43B 3MBEC 1MAJA 4YGVB 2CXKA 2AEIT 4F7CA 4Y88A 1GAFH 3FB5B 1XAUA 4DTGL 1QEWB 3GHBH 2D03H 4LCUB 4Y5YA 5E4EB 1P4BL 5D8JL 4CVUA 2FO4B 3RA7L 1V3MA 3WKML 2XFXA 1QRND 2W65A 3WHE0 4BK5A 1KN2L 4EUPG 3P0VH 2OTUB 4M7ZB 3QHZH 5D70L 4L4TE 1HZHL 4WI4A 2VXVL 3GJFB 3VFNB 1JNJA 1XZ0A 1HKLL 4XNUH 2NY4C 3VD5A 1IC5H 2WWKO 4X80H 3DNKA 4O00A 3UJIH 3V52L 3X3GH 1WLHA 4KRPB 2XA3A 1U91A 3VGAC 4TQEL 1IBGH 2MCPL 5FYLL 5IESH 3ARFD 1CDYA 1NCDL 5FA3B 3QQ3B 2Q6WB 2KQMA 3FONA 1AKJB 1QHPA 4MNGA 1ZLSH 3MLVH 4KJQC 5EIQA 3QCUL 3MRMB 4NZUH 1JPGA 2XACC 5I9QC 1NJ9A 1UCBH 3CFKB 3RBGA 1U8HA 2OTWA 2HKHH 3REWB 4OJFL 4P2YA 5C1MB 4LLMA 1IGML 4IMLB 5BMFH 3HE6B 2H26A 4XCYA 4BELD 4V1DB 5JW4M 4HUKB 5DRWB 1AD9A 3T2NH 5E2UL 2IQ9H 2IEPA 4XCEB 4JJHA 4XAWH 1X3DA 3EYVA 3QNYB 1N2RA 4OFYD 1EO5A 3MOAL 3L5WB 5C09B 4NDMB 1OM3H 5CJOH 2IALA 4H5SB 2JB6B 1SQ2N 4YEEA 4DOHE 3DXAE 3DYPA 4NUGL 4NWUL 3SE8L 5C0GB 4OZFA 1S78C 5IFJB 5I19H 4CRPA 1JWUA 3NIDE 1QSFD 2VR4A 3MRGB 2IFFL 3OHXB 3SY0B 1ES0B 2ZSWA 4AZ8A 4OI8A 2VKXA 1U36A 3GSRB 3CDCA 3VXUA 2EKJA 2YPLA 3O2DL 2AKRB 1UB5A 1AJ7L 4LVNB 4AEIL 1P4IL 4ODUB 4UAOB 5DS8B 5CEZH 1FZOA 1X5HA 5F1NB 2X4NA 5IEHB 3QUYC 3BPLC 1X5YA 3QRGH 5HI5C 5FV2A 1X5FA 1RZIA 5EBWB 1EHXA 4NFBA 4O5LL 2RHEA 5C08A 3WL9A 5D7KE 1ACZA 1N6UA 4NQDD 3MCKB 2XKSA 3GSOA 4X9GA 4P2RA 3C2AH 3BP6A 3KDMB 1YY9D 1BOYA 3TVMB 2E7LC 3S34L 1GOFA 3WXVL 5DF0A 4HJ0C 4TNVK 1R6VA 2J6EH 3CZFA 4ESKA 2X9XA 3PHQA 2I5YH 3BX7C 2FHCA 2LQRA 1F6LL 4HEPG 2BK8A 2ITCA 4QHUB 5D7LD 5DJDB 1R24B 5GQBA 1LP9A 4NO2B 3T0EA 2X89D 4OV5A 1UZ8A 2B5IC 3QIWB 5GGUA 2OR7A 4CJ0A 2ZSWB 4XI5D 3OKYA 4XP4H 1WCBB 2B1HH 5FYKH 4FQJL 2O93L 5J6GA 1D6EA 2AJXL 1QG3A 4HKJB 5D71L 5FCSH 4KMTL 3BD4A 1DBAL 3L5XL 2WLZA 3E0GA 2FDBP 5TE6L 2V7NB 3LZFL 1LO2H 4LPWA 2RQ8A 1JZ3A 3QQ4B 3BZFA 4HIIB 2VZ3A 3RGVD 3O9WB 3CSYB 2X1OA 3U2SB 2DIAA 2ICWI 1KJ2B 5DA4A 3Q0HA 5IFAL 1JNLH 3CZJA 4AEHL 2LFGA 2Z93B 1U3HC 4IDLA 2YC1B 4F9PC 4A6YA 2YS4A 1OW0A 3FO1B 5C08D 1UJ3C 1YEFL 5F72S 4X6DE 1DVFD 1MH5A 1VADA 1JI1A 4KMQA 3BKML 3QXAB 4S1QL 4XMKL 2VH5H 3WDJA 5BCAA 2GYSA 5BJTA 2XA8L 3RWGA 4F7TA 4JO2L 5EU5B 4LHUB 1JMXA 1RUQH 4GRWE 4BFIA 4X7FC 2HWZH 4JZJB 3AFLA 3BJ91 4RMUA 5TFSH 5FM5O 3HC3H 5E8OB 1BD2B 4HV8A 1PZ5B 2OZ4A 3N9GH 4TUKH 4KKAC 5HJ3B 1KJVB 4AT6B 4GMTL 1BEYL 1MCRA 1A47A 2H9GA 4ISVA 4JKMA 4PBVC 4WFGD 4K3HA 3P4LA 5IJKA 1WIOA 3K8LA 4XVUC 1IKNA 1RZ8B 5MEND 1WUNT 1PAMA 1SJHB 2EH7H 1W0WA 2NY4D 5DD0L 4U3CA 4DN3H 5A2IH 4LSDA 4G6AD 5FO9A 4DVBA 4KTEL 3PWLB 3FQWA 4I77L 5D6DA 3HNTL 1YQVH 3ZL4L 2Y06H 3OKMA 2QLVB 4U6TA 1JYVA 5ANMA 3QG7H 4LRNL 1VGEH 2F54E 4O2EA 1OWWA 2P48B 3ZHDA 4Q9BA 2W59A 3G5YA 1TVBA 1EZVX 3CDYA 1FZJA 3QRGL 4U0QB 1J0YA 4ZTOH 2IAMB 4EN3B 4ODXA 5SWZD 4PJIB 4PJ8D 4O2FB 3HE6A 2R4RH 4Y4FD 1I8IB 3G6JA 1ETZB 3TA3C 4OLZL 1VFAB 3B9KB 5J56B 1UWEL 4HWEL 5GRJH 2VLKD 3FHAA 3DMMB 3GSUA 3DURB 3UCRA 3O81A 4NUGH 4JKPL 2Z4QB 3EZJB 4HGKC 3LOWA 2XWBA 4YDJB 5HJ3A 4RA0C 5EWIH 1IAIH 3GMOA 3EDEA 3FZUC 4XCCH 4WV1C 5DHVA 3SY0A 3BP4A 4U1KB 5IJVB 2R2BA 3LEYL 5F6IB 5I1JH 4UIKL 2VITA 1L0XA 2ESVD 1C16B 3GO1H 3H6JA 4ODVL 1NUDA 4JKPH 2NY6C 1LNUB 4TOYH 2O5YH 3R8QA 2GJ6A 4E42B 5J1TC 4J4PD 5LKNA 3DGGB 2PCPB 4XNYH 3I6GB 1A7QL 2X4UB 1UCBL 2BOBB 1CLOL 1DBML 1NFDA 5F9JB 1S7SA 5DR5H 4LVOB 1NC2D 3GMRB 4KRNA 2D4DA 5LCVH 3MMEB 2WQ8A 2UWEF 1I8KA 2AV7B 5DDHA 4U1IA 3OKOB 3G6AB 1VFMA 5TDPB 3DSNA 3O3EA 3VRJB 4I18B 1ZT4A 3C60D 2MKLC 2GAZB 3H3KA 1V7MH 3HI5L 25C8H 2V5RA 2X1QA 5TE4L 5FUZL 4U1HA 5E8PB 2EC8A 4LLUB 5MP6H 1ZHBA 4K8RL 4NFDA 3QG7L 2YXMA 5KSBE 3CIQA 4DK6A 1O5DT 2GSGA 1CFBA 2HG5A 4RAVA 1AI1L 4KQ3H 5EBLB 1C7SA 5E99H 1MCFA 1T1YA 2CLZB 4D2NA 3O11A 1L9MA 2QADC 3HUJF 3NIGF 4XPTH 2F58L 3D87B 5D8JH 4S0TD 2A6DA 3UC0H 4Z7UA 4OGXH 4EIGB 1ZHNB 3DSFL 3SDXA 3JBG7 3KYKL 4Z78B 5H37G 3IXTB 4PJAE 2V9QA 3LEXA 3STZB 4KK6C 2R1WB 3QUXC 3WS6A 3ZE2F 3MOBH 4WY7H 1GGYA 3NCYP 5T1MA 3TJHC 2PTUA 4TUOB 4Y16A 2CSPA 5HI4D 3TYGL 2ILLA 3D2UB 1ZVYA 4XMKH 3JV4A 5I75C 3QDME 2AXJA 4RQQB 2HT3D 4ZOCA 3SE3C 4CDHA 3L3GA 1YEJL 4LSUH 3GBMH 1ITBB 3BWAB 4EBQL 1D5ZA 1UADC 1EGJH 4XNXH 2PXYA 3VGEA 2YSSB 3ILQC 1IEAA 1OPGH 4PB9L 4ZUWB 4FXGB 1X6LA 1GGBL 5DJ0A 2F53A 3DYOA 3NTCL 4OF8A 5JLZB 2VXSH 4OV6F 4CN1A 4FFZL 5EBLA 4UIMA 1Q0YL 4FQHB 1P4LB 3ABZA 2XPGB 3T8XA 4WEMB 1LDPH 1BD2D 3C5SB 3BPNB 1K6QH 3VMNA 1J05B 2HRPL 2HVKB 4JVUA 2I9LB 3RWEB 1AFVL 1K3ZA 4X6BA 4ONGL 1I8LC 1A7RL 1KPUA 4CU8A 2X40A 1FNFA 1AC0A 2H6PB 4WUUD 2EZ0C 4IRJB 2Q7YB 2R1WA 4MDIB 5B38A 4RBPH 2NCMA 1ONQA 5I71B 4Q2ZB 1WZKA 1TQBB 2CLRA 5C0IA 3IU3A 3P4OA 2R29L 3CLFL 4KI5C 1H8SA 4C83A 1SVZA 5C09A 4OZGE 4P4KA 5CZKA 3D0VA 3TEUA 5GGTH 5HPMA 4HS6B 2P46B 4FQXC 4DUXA 4JAMA 4OFPA 2VYRE 1AGEA 4I3SH 3B4NA 5LGJA 4YLQT 5FM4A 3H7BA 1UENA 3QUMB 5C7XL 5IOPB 4YUEH 4GBXD 3SDYL 3ARRA 1WISA 4ELMF 3ZTJH 3MRQA 2HRLA 1I8IA 1OTSD 1KTLB 3O8XB 1QTYT 1A6PA 5ILTH 1B2WH 3O9WC 3UAJC 4G7YL 4N0RA 4RFEB 1RV6X 3CCHA 4NZTL 1FZOB 3GO1L 4ODVH 4PLOB 3LRGA 4UQ2A 3P4NB 2AJZB 2DQHL 4XAKE 3P9WB 4ORGB 2ZCHL 3LEYH 3O3AB 3SE4C 3E6FA 3ROOB 3TPKA 1S7TB 2CDFA 3C9NB 3RKDC 5ADPL 3QT2A 5IK3B 2VDKH 3MRKA 3KR3H 4QCIB 4BH8A 1YNLH 4UU9A 3TWCH 3U4EA 3IDMA 1NBZB 2GEEA 1IAKB 3VD7A 1K2DB 2H41A 4M8QA 3BP6B 1IGCL 4UQ3A 5GGSB 4WHCA 1B6UA 4TUJB 1QSEA 4F7PB 3BGMB 2A73A 3O4LD 1GHFH 3PXHA 1RUAL 2J6EA 2X09A 5L8LB 1HHJB 4PUBL 1ND0A 1LP9E 4IMKC 3T0EE 1X4ZA 4LIQL 2BCKB 2NZ9D 4IMKA 3VWKA 5ITBL 3QUYA 5CLTA 2UY7A 2NXZB 5BMFL 1FV1B 4PRAA 1L0YA 3WDIA 3SHSA 1CG9A 1ORSB 3NFSL 4NM4L 2ZP0T 1EO7A 1U8OB 2CRYA 2X70B 1QLEL 5GS0H 5J06A 3CFEB 4XNZB 1SYVA 2LV4A 4NWTH 4GJTB 3TNNB 1YN7B 3QO1B 3VU2A 3PGDB 1AY1L 1YQVL 4K3DL 4JR9H 3ZT7A 2UZYB 3HR5A 4D9LH 1DSFL 4XP6H 2PYEA 4EXKA 5C2BH 5IBUB 5I6XC 1IC7H 2DTMH 2Z35B 4S2SB 3QULA 3O11B 3V95A 4HAFA 1VACA 1G6RA 1FSKB 1DQLH 3MRPB 4I4WB 4U3XA 1U41A 3UDWC 4BH8B 3U0PA 5F97E 3WIHA 3LQAC 4HKBB 1BVKA 5I8EA 1HEZA 1ZA3A 4J8RB 2A73B 4GKZB 2NW3B 3UJJL 2VH5L 5H8DA 1H8OA 1MRFL 2BNQB 4B5EA 1CE6A 2WUCL 5BS0A 2FX7L 3BP7B 3FO9B 3PHOB 3IXAA 3MV8E 2YRZA 2ZUUA 2Q86B 4XMPL 4PGBB 2C26A 3ARQA 4MD4B 1Z5LB 4UOW0 5ALCH 4HIJA 1XIWB 4G42A 4QRRE 2CGRL 3DXAA 4ZYKB 5T5FH 3KLHC 4ZO6A 2VXSL 3D2UA 5DVMA 3VCLA 1E4KC 4R2GD 3BESR 5HYFA 2ESVA 4JKKA 5DJYA 2HJLB 5L6YH 5GHWH 1LK2A 5DTFA 1MCPH 2BNRD 1NDGB 1CWVA 4M9PA 4Y5XC 4TVPL 5TQ2H 2PXYB 4QRUA 2EZ0D 2PO6A 4E41B 2BC4A 3UBXB 1DE4A 5K9OA 4H0GA 4PJ9A 4CU7A 3FO2B 4FQQA 4UT6H 1KG0A 4UV4H 5HI5D 4U6HA 2FX9L 3BEWA 1T5WA 4MA7H 3VFUB 3QEGH 1SJXA 5LWYH 3VD3A 1B0GB 1WGOA 5T1DL 1XIWC 2CUIA 4RWYH 4NC1C 5FCUH 1Z3GL 3QA3B 1BQHG 1P7KA 1YMMD 2AJXH 3M8OL 5TH2A 1C12A 5HGHB 4XPFL 2EIDA 1F6AB 4KKCD 4PLKD 4QTIL 1QFWI 2DI8A 5F1KC 1FNGA 5EPMB 3GEWB 2DI7A 4ODXB 1F45A 4NN5C 2WK2A 4F33B 4KJYB 2Q7YA 2AJYL 2C9AA 4IRJA 5DJ6B 5IEKB 3E3QC 1C08A 4GG6B 4RSVA 1MCOH 1FYHB 2XRAL 3MJGX 3LKPB 4KK8D 4ODTL 4HWZB 3VFVA 3MBEA 2DJ4A 1REIA 5I1HL 2XN9E 3CSBA 5K9JH 4JAMB 3W2DH 2PN5A 4YXKL 1AGEB 4R9HA 2VISA 2W60A 1B4RA 1DEDA 4KAQL 1HCFX 1FVEA 3RPIA 3KJ6L 4LDEB 2NNAB 1CTNA 2BC4B 2MOVA 2X1PA 5E8NB 3UBXA 1KIRA 1G6RL 2AW2A 1OY3B 1ED3A 3L6FA 2RR3A 1NEZB 4NYLA 1IGJB 3ZKSD 2DDQH 3LEVL 5L7XL 2J8OA 1FIGL 1KCVH 4Y1AD 1IE5A 2FBJL 4D9RD 3HC0B 2C4XA 3MUGA 1RI8A 2AK1L 5IFHH 2NY4B 2DJUA 4E42A 1JL8A 5D7IE 3TT1H 3GRWL 3ZYIA 4C4KT 5BRZE 2DLFH 3EHBC 3BI9X 2WQRA 3I6GA 3PV7A 3QA3A 1MRDH 2YD5A 2EH8H 3BT2L 5LVEA 2YD7A 4LCCA 1F4WL 1OGTB 3GB7A 3QCTL 3G9VA 2FYYA 4JM2C 1B4JH 4XBGB 3MOAH 4MNQE 2RJMA 3IDJA 1A21A 5IEKA 4MVBC 4BJLA 5E94B 1CT8B 1QFWL 3P9MA 1S78D 1S9XB 4ZO8A 4AL8H 3OF6A 3VXSB 4RMWA 4Y4FA 3BKJH 2E8ZA 4OZHB 2EDTA 1NGPH 3V4PH 4JJ5A 5KVFL 1MF2L 1S7QA 3A6CH 3BYYA 4WI6A 4HUUB 2FSEB 1CXIA 1T0NA 1FRGL 4BSWA 5I1GL 4R7DA 1YMME 5GSVB 2CIIA 4LBEB 4PRBB 1LO4L 5DC4B 4MWFA 5DD6A 4CMMB 3TBVA 5DMIH 1A4KB 4KUZH 3DUSB 4S1SH 4LCWB 2O5XH 2X4TB 4BUGA 3E6HA 1BHGA 3VFGH 1F4AA 2B0SH 2XQYK 5EOTB 4Z7VB 1BJ8A 1ES0A 4FQ2H 3S4SB 3KPPB 1TQBC 4G80B 4U7MA 4P2QE 1BBJB 3UPAA 3LEXB 3STZA 1SM3L 2NR6D 4XP1L 1NCWL 1F13A 4WFHE 1J18A 1ZT7B 5GRUL 4I77H 3P4MB 5EC2B 4QRSA 1J8HB 3QIBD 1MRDL 5JQHC 3VI3E 15C8H 4OLXL 1G6RB 2HT3C 4GG8B 5IVXE 4PJDF 1NUGA 3CFCH 1GPOH 4J7RA 4R90L 4JFYA 4GXUM 2V5MA 4JPWL 3T2PA 1U8NB 3C60B 2GITB 3SKMB 1G0DA 4JVWA 1PSKH 1C5CH 3VXSA 4KROB 5KJRL 4M7KH 4Y4FB 2PYFA 3SGEI 2H32H 5C3TA 1HI6B 5IMLA 5MENE 3CZFB 1CGVA 3G5ZB 3T4AA 1DEEA 4YXKH 1NFKA 2MQ0A 2OM5A 4R4FL 5DYOA 5CIPH 1FPTL 4LDOB 1ZWIA 2YK1L 4HHAB 3RUGE 3SKNB 5BW7C 4LARH 3VXPA 1UZ6E 4KZEL 5DFTA 5BXFB 4LFHD 1X44A 1IAOA 3RWDA 2J8UB 1DUYB 1X6NA 1BVLA 1L7TL 3D39B 3LQAL 3X12B 5DVNA 2E9JA 4P49A 3RZCA 4LSSL 1EJOL 3CFJA 3VFRB 3VWJC 1A8JH 1A6AB 5JOFB 4OV5B 1I1AC 4BK4A 4KGLA 1EPFA 1RJZA 4XHQA 1DUZB 1PLGH 1BQLH 3HPLA 1EHAA 3ZDXE 1M71B 1ZHLB 2R0KH 1Y6MR 4E41A 3H9HA 1DE4B 1AO7A 4TPRH 3INUH 1TZGL 3O9WD 3BPNC 4PV8A 3QQ4A 5EBMA 5E9DE 3RDTD 4Q2ZA 1BZQK 2P49B 3LN5A 4UBDC 4ALAH 4D9QE 3GBNL 4QXWA 2P5WE 3MGAA 4I3GA 1NBVH 1JV5A 4O51B 4Z7WF 3D0VB 2FATL 3FCTA 2CR6A 3GSVB 3TZVA 2FJFB 5HHXL 2OJEA 1MCSA 4MDJB 1RFDH 2IMMA 5J13B 3NAAH 4MXQC 1U58B 1EEQA 1G7LB 4GQPH 3HE7A 5ECJE 3BHBB 2ADJB 4HCRH 1JNHB 4QOKA 2FWOA 2R4SH 4XCNB 2D2OA 4YZFF 4HX1A 5GS0D 2WUBH 4S10A 1KCKA 2KPNA 2VQUA 2WINA 4IIQA 1MCPL 5MEOA 5IQ7H 3QXDB 3RWGB 4UUJA 1KIQB 4LGRB 4P2OB 4BQ9A 5I30L 4HMDA 3FOLA 2R8SH 3L9RB 1CE1H 4PPTA 2QKIB 4Z0BH 3JUZA 2FNBA 3Q2CA 4UQ2B 2G75A 1DBJH 4K3GA 4OLVH 5ISZE 1A02N 3S34H 1H0DA 2BNRB 3K4ZA 3EKCA 3C9NA 2F8XC 3KXFD 4LSRH 4L4JA 1R3HA 1Z9SA 4P57B 1MFAL 4PJXB 4DKFH 2NXZD 4DZBB 1D3CA 3T3PE 5D1XC 4GAJL 4U6YA 4R97C 1QO3A 3EO1A 3W9EA 1JPFA 5TPWH 4YC2C 3EFDL 4OIIH 3D85B 3EDKA 2R69L 4X6DF 5IMKA 1NLDL 3C09C 2JELL 1Q9KA 4Q6IC 4ZFGH 5F7HA 5IJKC 1VKXB 1DL7H 1P4IH 3LKNA 5EIIB 4JRXA 4Q6IA 1IC4L 1X5GA 1QA9B 2CKBH 4BFEA 3VWKB 4UBDD 1F42A 5DK2A 1SBSL 4JR9L 1G7LA 3WJLA 4HS3B 5ESAB 1EGJA 1Y0LA 2IAMA 1CG9B 1U3YA 4B41A 2YA0A 4DN4H 3R4DA 1IQDB 1JHKL 2X4QA 2BNRE 4LEOA 2JB5L 3B9KA 3BDBA 3D18A 3L3HB 2SEBA 1JN6A 2ICWB 4FABH 3B9KC 1TMCB 3GM8A 3WSQH 5I9QB 5IGXL 3TO4C 3ZSSA 1Z9OA 4Y4KB 4XVJL 2AQ1A 1WBXB 4R4BB 2G75B 3WO4C 4HWBH 2DN7A 3LCYA 1GOGA 2V5TA 2P7TA 5DHVB 5KVDL 2XOTA 3RPKA 5DXWA 1A1OA 4QNPF 4NN6C 5CJQL 2B1AH 5F7DB 2ZUVA 2NXYC 5IGXH 1EFXA 4PJ9D 3MREB 1FYTA 5BRZD 3P11H 3VDCA 2NYYC 3RNKB 3R1GL 4TRPL 2ARJA 5HYJE 1HSBB 5C0BA 5KN5B 5DUBB 2NXZC 1NKOA 4HPYH 4L9DA 4G8FB 1K85A 3EYUL 3SGJA 4QHLB 3ARGB 2ZJSH 4PGBA 3PWNA 5I73C 4Q6IB 4IBLT 3SEPA 2ZCHH 4HIJB 1U6AL 1CVSC 1K5NB 1H15A 2VDNH 3T77A 4ELKB 4PJ5E 5SWQB 3VXTA 1MWAA 4D0BB 1MJUL 4JLRA 5LAXA 4YHML 3EFDH 1CDIA 3FFCB 3HE6D 4FQ1L 1QLFB 3NCFB 4HGMA 4ZFFA 4YUEL 4KJPD 2F5BL 3DHMA 4OLUL 4U6HB 3P9LA 3RRQA 3CGTA 4DVRH 5LGHH 5AYQA 2ED9A 3QEQD 4JANA 1DR9A 4RFOH 5JIHA 2DQJL 3VXPB 2GTWB 3PV6B 1VFBA 4FZ8H 1AR2A 4BSJA 1GAFL 5D1QC 4QKXB 3I3BA 1E0OB 4D3CH 5TH2B 4Z7UB 5GSRA 1A0QL 3ALXA 1CXHA 1TJHL 1FFRA 1HHGB 3MA7A 3R0NA 1OARH 3FQUB 1JTTA 1OGAE 5LXGH 4HUVA 2B20A 2YN5A 3PJSB 3H42L 3MLPA 2V2XB 1XH3B 3EFFA 1WWAX 4MJ5A 3O6LL 3BQUB 5KS9F 4WU7B 3MZTA 3MRRA 2QQQA 2NY0C 2OL3A 4ELMA 1OF2A 3QEHB 2P24A 4AH2B 3U9UB 3SCMB 4CDGC 4XNQB 5FHAH 5HYQB 3MBEB 3GGWB 1T3FA 3OR6A 4OB5L 3ESVF 4XZUA 1V7NL 1R0AH 1CDBA 3VD4A 4G6KL 3I02B 2FGZA 1BM3H 5JW4R 1F97A 2FIKA 4Z7VE 3N1PC 4GSDL 2X10A 1DJSA 2AABL 4NKDB 5HY9A 1N8ZA 4J3WA 1D5MB 1FG2B 2QV2A 4WJ5A 4WDIA 4HUNB 1YMMA 2IGFH 2O5ZL 3HB3C 5CILL 3A6BL 2J8HA 5GHWL 4PJBB 4QTHB 5HI3C 2Q1EA 3LN4B 5DEGA 3C5SA 4PJ8B 2VTFA 2C3VA 4PJ8C 1QSFE 3W9DB 3O6MH 4N90D 5IB5B 5T5FL 1H0DB 2ICES 5E9DD 5E08H 1E4WL 1BBDH 5E7FA 1IQWL 5IB2A 3PGFH 2VSDA 1M7IA 1O7VA 1C5DA 4GKSA 4XXCA 4P57A 4BUHA 5JR1H 3ZKNC 1VDGA 3FB6B 2Y36H 2FD6L 3RVVC 5EOCJ 1GVIA 4I3RL 2YA1A 1RUKH 1CL7I 4QF1B 3CC5B 4V2BA 2GUOB 3FB8B 2ADGB 3QEQE 4NN6B 1ONQB 4P4KB 1S7QB 4NC2B 1D5IL 2WUCH 1KJ2A 4GUPB 3MYJA 4QGYA 5ENWB 4LFHG 5JHDB 4I0PC 4MJ4A 2AXHA 3P77A 3RTQA 4D8PB 1YNKH 4QLRA 2Q8BH 5KVGH 4JG0L 1P6FA 5CZXD 1DQDL 2HT4D 3SDAC 3TM6A 4PJGF 2VDNL 4JM2A 4Z95H 2W0FB 4K94C 3ZLQC 2VDOH 5BZWA 1QP1A 3BN9D 4NWTL 1V7ML 3GI9L 4UINH 4YHZL 3GKWL 5ISZD 3LMJL 5TDNB 4D9LL 4M1CC 4APQC 1J8HD 2VLRE 1CN4A 1HIML 1EO8H 3O8XA 2Y7QA 3P11L 3C8KB 5E6ZA 1WFTA 2RIKA 3E2HB 3BFOA 1CIDA 3EYUH 3BW9A 1R3IL 3D3VD 3N0PB 4LIQE 2XZCH 4LVHB 5I1CH 1EHLL 5DMJB 1U42A 3UTSE 4U1JA 1A1OB 5F7DA 4PUBH 1WC7B 1KJVA 2O5YL 4AT6A 1D9KB 2AEQL 4PG9B 5C6TL 4HLZH 3F58L 4PGDB 2G9HA 4MCYB 1RVFH 1NGXA 3MV11 5FXCH 3L7EB 4XNMA 3B8SA 1S5IH 5I66A 4JPIB 2ARJB 2ADGA 2YPVL 2CUHA 1R3JB 4EI5B 5C07A 2VABB 1I7RA 3VI4F 4G7VH 1G7PA 4HK3J 1NAMA 2ESVE 1I9JL 5KSBF 5DGRA 4U6VL 3EDJA 1KN4H 1N4XL 3HFML 5F7NC 1KYOJ 2K3TA 4H5SA 5F1OB 1ND0B 5D2LB 2HTKD 3L5JA 1FC2D 3HMXL 1U8MB 5GRJL 3BKCL 3HAEG 3MV8A 4ORZC 2JTDA 3SOBL 5ADPH 5J11B 2C1OB 1MI5E 3OGCB 3MA9L 1MAMH 5I73B 4X6EB 2P5WD 2CDEA 4JHAH 5FO7B 1QBLL 4PJIA 5CKGA 2MPAL 3B3IB 4ZNCD 4HBCH 1UM4L 5CBEB 5TPWL 2AEPL 1IFHH 4IJ3B 4IOSD 5E2WL 2PR4H 2VLKB 1DL7L 4UDUB 2AQ3A 1LEGA 1YJDC 3SDCC 5CBAA 4NQXB 3SO3B 3MLTA 4ZUSA 1NFDE 1OLZA 1MPAL 1VACB 2GTWA 2YPKA 1HILA 5L2KE 3W0WB 1ZXQA 1FVDA 3MLUL 3MNWA 3LKSB 2BNQE 1HKFA 1IGIH 1OTUC 4PJ5D 1ZA3B 1CD1B 3OB8A 1J11A 1WBZB 1DANU 3L3IB 5I66B 2C3WA 4GKZA 4OZ4B 4P46A 2E9BA 2AJYH 2Z91A 2ZUSA 4KPHL 4POZC 2FWOB 4S0SD 5GRVK 1MJ7L 5I8EB 3BP7A 3OQ3B 2XTJE 3IFPB 3GIZH 1PX4A 3IFNL 2IG2L 1WWBX 3MODH 4R96A 3UTTB 5J12B 1F58H 3VXSD 2XY2A 3LRSA 3QXDA 5F7WC 1MJJA 2W9EH 3GK8L 5C0EA 1KTRL 4HEME 3BH8A 2VLKE 3T3MF 4U1LB 3V0AC 1TQCC 4LSTH 4MQ7A 3MV01 2EDJA 3KPRA 5EU4B 3UBXI 4WUUA 4KI5D 1IGFL 4QT5A 5FYKD 4QRUB 3MRBB 5HHMB 3I75A 1RZFL 5D1QD 2VDRL 3MO1A 4KJQD 1EXUA 2PW2A 4PJCF 2VDML 3D39E 5B39A 1JPSH 1QO3B 4RRPA 1JWMA 3OR7B 5DJ2A 2NY1B 5CEXA 1EUTA 5JPNB 2J4WH 5B22A 5FKPA 2R39A 4NP4H 1PG7X 1DFBL 2E3VA 3SO5A 4X5LA 5EN2A 1FNHA 3NTCH 4AENA 1L7IL 3AGVA 2CDGB 3B2UC 4YHLL 4HAGA 1FH5H 3FRUB 3U9PH 1A3LH 4XGZB 1R3LA 3V2AR 1OVZA 3S88H 2DQEL 1T89A 4M93C 3RWJB 1BQLL 5ALCL 1RHFA 1FP5A 4PBXA 5ESVB 5DJ8A 1MFEH 1F4HA 2JIXB 1HXYB 3TZVD 4F2MB 5I1EL 2LABA 4X5WA 2VUYA 2C4FU 2PO6C 3PABB 2JJWA 1OWRM 5A3ID 4GRWF 2UZXB 3S96B 2WSKA 5D1ZC 5D7JD 1HQ4A 4XVTL 2IANE 2EDDA 3FT3A 4GG6F 3C5ZB 3MOBL 5HDBE 4Z8FL 5LBSL 4ZPTB 1I85A 2XXCB 2GY5A 5DRZB 2VSCA 4H1LG 4P3CL 4C56D 5C0AA 4EQ3A 5HI3D 4MMZC 2WLYA 1LP9F 3JV4B 3QI9A 2NY1C 4IOFD 4ODHH 4U2ZA 3TO4D 4P2QA 2AJVL 3I6KB 3W81A 5KJRH 5MHSD 4G8GE 1YYLH 5E4EC 3WJJC 4DZ8A 5I0ZA 1OSZA 1MCHA 3JWNC 4WFGE 5A1AA 4JM2B 2NNAA 3L1OL 5E8NA 1YPZB 2DD8L 1X5XA 2WW8A 5KSVB 1AXSA 1AD0A 2CRMA 3WN5C 2K9UA 1QLEH 4X4MA 2ZKHL 3O3DB 3U46B 3FMGL 3MBXL 3VWKD 1JPSL 5IBLC 3QDGA 5KTEL 3RAJL 1CZ8H 1GIGH 3ARUA 3OKMB 1P7QB 3QDGE 3RWJA 1RZJH 2YRLA 4CADB 1BFVH 1E28B 2OMBA 3EOYG 4MX7A 4Z5RA 5KSAC 4Z7NF 2CMRH 2BRQA 4NQVA 2YZ1A 1INEL 3HRZA 4IOIA 3ZDYE 1N3NA 2VDPL 1TLKA 1WFOA 1HNGA 1NGWB 1FFNB 3RIAK 1LQSR 3OKEA 1T1XA 4L8BB 4MDIA 4ZFFB 5B38B 3BN9C 1T1WA 5HHOB 5DRZA 1KJ3L 1NCUA 1RURL 2H3NB 4NO0A 1QSFB 1G7HA 3QAZB 1N64H 2ATKB 3IFNH 3A6CL 1FZKB 3L3KA 5D7IB 2BOCA 2YXFA 2XXMB 2GSIA 1Q72L 3BSZL 1BWMA 1VSCA 1OSZB 4PJHA 1F4WH 4M6AA 1JGDB 5GSVA 4IJ3C 4P59H 4KWUA 5IWLA 2FJHA 5D6DC 1YN6A 3VJ6B 1XF4A 3TO4B 4OF6A 5GSRB 1C8PA 4PJAA 4OI9A 1S7WA 4IS6B 1F5WA 4LLWA 2Q20A 2F19L 2C3HA 3AROA 2ICEB 4Y1AA 4RISH 3PIQB 1MQKH 1BFSA 1RZ7H 3IKCA 3LQMA 3U30C 5DC0A 3GMQA 2HT2C 3BXNB 3DGGA 3TBYB 4NRYA 3PP3K 3BZDA 3OXRA 3O0RL 1AIFA 4Q0XH 1AQDB 4MCZB 4EUPH 3OR6B 2DMBA 2IANB 1FIGH 2YPKB 3W2DL 2VLRD 3TFKC 1S9VA 3E6FB 5JNYA 1DLFL 4GRMB 3MBXH 4AIXA 2FIKB 3HMXH 3RIAF 2PNDA 2CK2A 3UJIL 1ZLVH 4ZUUA 3ZT6A 1TZIB 1F11A 4EKXA 5HHOA 2DQTH 3HE7D 1FJ1A 1WQVT 1ODAA 3VFOA 4LLUA 2W0PA 4KK6D 4Y2DA 3VWJD 4OCWL 4KKAD 2XZQH 4N0YL 5DRNA 5CP7A 3UTTA 1RIVH 3HI1A 2DQDL 32C2A 3MZGB 1J7VR 4NRXA 3SKUD 2ZOKB 5KSBA 1SBBA 3FQTB 2BVPB 4ZXBA 3PWPE 1QRNB 3WS3B 3MRGA 3S5LG 1MCCA 4IS6A 1DUYA 1HWHB 4HC1L 1MNUH 1EH9A 1TETH 4LLWB 3X12A 4CMHC 5ALBL 1AQKL 1HHKB 4HIXL 3U0TA 1PBYA 1ORSA 1EBPA 1I7TA 4XXDB 5E2JA 4C57C 4OGYH 2EDRA 3QEGL 1AO7B 4JREC 4PB9H 1EV2E 4DW2L 3HZMB 4R8WH 3VW3L 3BXNA 3IXTA 5I1EH 3PL6B 5D7IF 1SYSA 1VFOA 3PGDA 1CIUA 2I07A 2J3SA 3QH3B 1V05A 3GBML 1JV5B 4NNYB 5T1MB 5T3ZE 4PJ7A 3O4LE 2X4NB 5BVPH 4R7NB 1AXTH 3QHFL 5TE7L 4JQXC 2VXQL 3SE3A 1YEFH 4EOWL 4MDJA 5BVJA 5BO1L 4PJCB 3LIZL 3LHPH 1P6AB 4MSWB 2QEJA 2JIXD 3TZVB 5ESVA 4ZS6C 3O2WH 3HCVA 2OCFD 3G6JE 4XXCC 1Z0NA 1A14H 3GSQB 3G08A 1BOGB 4M9OA 2OR9H 4XBEH 4FP8L 2CGRH 4HX1B 5JXEA 3PHQB 3NBNA 4I3RH 4MZ2A 5D1ZD 5D7JC 1ORQB 3MGOB 3QB7C 4HUWA 3KPTA 5EUKB 1DBAH 2X4SB 5IIEA 4NSKA 4QXTA 1F3RB 1ZANH 1A14L 3WFHB 3MNZB 3PNWB 3D85D 3P30H 1G6VK 2ZUXA 3N1QC 4NQEA 3O3BB 4WW2F 1XR9B 2WBKA 5EUOA 1DSFH 5INDB 1YPZA 2QSCH 1CBVL 4PREB 4PFEA 1NDGA 4FG6D 9CGTA 5D5MF 3DVGB 3BN3B 3TNMA 3NZHL 1M05A 4P0DA 1R3HB 1RAMA 2X4OA 5HVHB 1G7PB 2FEDD 2YKLH 1KELH 3QDGB 5C0RL 5K93A 3BH9A 3WIIL 4Z7OE 2W9DL 2CO6B 3MRMA 4MSWA 1MCJA 1XF5A 3FO1A 5FOBB 5D7LA 2OI9C 4NM4H 3FHQA 5EU6D 4D0CA 5E2WH 4YHPB 1BFTA 3B8YA 4UMGA 4LLMB 3W39B 1NGYB 2WIIB 3BO8A 3C5ZC 2C1PA 4XP9L 4O2CA 1CD0A 5DZOA 5B38G 3BAEL 3OKEB 4ZFZB 3Q6FB 3SDAB 5KSAB 5ISZB 5DJAA 5DRWA 4G8GB 2HKFL 5EU5A 4XVSL 1HWGB 4E5XB 4YAQB 1BIHA 5F7MC 2VDKL 3JTTA 1U2CA 3P3YA 1P69B 1CLYH 1I3VA 2E7HA 4YWGL 1KJ2H 2P8MB 3S37X 4PYGA 4PJHB 5I6XB 4U1SA 4HF5L 4PREA 1YY8B 2F74B 5AG9A 1H3WM 1QSVA 2JJTC 4XAWL 1W72B 4PG2C 4XVSH 4L3CB 5A16A 4X6DB 5E2UH 4FZ8L 3AB0B 4LKCB 2X4OB 4OZ4A 4P46B 3ROLB 2RCSH 2JLLA 4WO4C 4GKNB 3WNPA 1UVQA 5FFLA 4YDKH 2IPKB 4UNUA 3HC0A 4M7JH 5C8JB 3CVHH 1UWXH 4Q7DA 2NY3B 2A9ML 2HH0L 4P5TC 3F7YA 3IJSB 1BPVA 2Y6SD 2R0WL 3HS0A 4WFHD 2A6KA 4LSQH 2AXGB 3BH8B 4P3WA 5GGQH 2NTFA 3NMEA 1T04B 2W9DH 2JCCA 5IF0B 3SGJC 3OB0K 5D1QB 1ACYH 3ARDD 4GQ9H 3EYSL 5I8CB 3S8WA 2IAMD 3VXTB 4I9WD 1JGVL 3VXRA 5EU6A 4JVPA 4MAYB 4F3FB 4KKLD 1WAAE 2R29H 3CLFH 3DRTA 2A74A 4QHNA 5DRXB 3QDGD 3HLAB 5I15H 4LRIC 3LS5H 5F6HJ 4WTZA 3BIAX 3RVTD 2QQNH 4OI7A 2VLLA 5E6IC 5HVGB 3DX9A 4UT9H 2BXYA 4IOFC 4X98B 1WVZA 2WM0A 4LVNC 3VFWB 2IJ0C 5HGDB 3KPSD 2P8MA 3HR5B 3T08A 1FORH 4HQQH 5ITFA 3X3GL 1A6ZA 4JN2B 1K4CA 4NKIL 1QYGL 5C07D 1M7XA 4XP9H 1DQML 3SDDA 2R9HC 5ACMA 1IZJA 5FAAA 4BFGA 1HKLH 4XNUL 2FZ3B 3DO7A 3IETA 4LCWA 2BNQD 3MJ9A 4P23B 3RVUC 2X4RB 3TBWB 1KB5A 5E7BA 5EOCH 2OXGA 4RA3A 1K6QL 3HHRB 1NUFA 3U6RA 2GK0B 5DWUL 1CICA 2DB8A 4XRCB 4CVZB 3BP5B 1TQCB 1HQ4B 4A2MA 5I1IL 4JY5L 4Y4HA 3MRRB 1MIMH 3PHOA 1IARB 3FAWA 1TNNA 3WIIH 1NCNA 2ADFH 3JWDC 5MEQA 2BOBA 3V4VL 2QR0B 1BJ1J 1NCBL 5CCKH 5L2KA 4KRLB 4G42B 4H20H 4FFWC 4Y5XA 4EBQH 2VXUL 2BVUA 5D1QA 3U9UA 2Y23A 3QJHB 3STLB 3CFBA 2X9WA 2Z93A 3JSSA 4R97B 2BY2A 4NN7C 4YJZL 4L8DB 4MHHI 1FE8H 3UYOD 4NKDA 1KIPA 4LSUL 4EDXA 4AIOA 1YNKL 4X9HA 5DQ9B 1AXSB 1RZGA 3U7WH 3QWQB 3P30L 2XQBH 1NAKL 1PG7W 2E7CA 3QDMD 2C7UB 1T5WB 1A5FL 5AYUH 5KOVC 2JK5B 3M17A 4IRSB 5D2LE 1YMMB 1NAML 5FOJA 2E8YA 1AP2B 1GZQB 1PJ9A 2IH3B 1J1PL 2WWMC 4JDZA 4LHUA 5FGCE 5HGGS 1XCTB 4NT6B 3W9DA 2Y36L 2ATPB 5F88B 5FHBH 3RWDB 3O45B 5ESQA 4JY4B 3U83A 1MLCB 1SY6L 2DYPA 4Y2OA 3DSFH 2AJSH 3CFJB 3CVHA 4OGXL 3CXDH 3JZ7A 3FFCE 4RCAA 1NDMA 2HP4A 1EVTC 4XRCA 3KYOA 3LVEA 2MNUA 4Z78A 1F90H 5F71A 2UV3A 1U8QA 4UILH 1B88A 5K59F 1U3HA 3QRFM 4M1GL 5MP6L 1LDSA 4G9FE 4L29B 1AH1A 5GPRA 3W82A 1NL0H 3NCJH 3DVNB 3MRCB 2ATKA 2F54A 4BM7A 4GAYB 3AY4C 3CC5A 5ID1B 3PWLA 3PWVB 3MRHB 3BQUD 5BRZB 1PX3A 3RL1B 5K33A 3VDAA 4WTZG 1EDQA 4NHUA 4DGYL 2LU4A 5HGAA 3IAQA 4P2QD 3D3VA 3LQZA 1MHCA 4MXWL 3HRPA 2CLVB 4EN3A 3FTGA 4OLWH 4JG1L 4WCYH 4OB5H 4HXBH 4L4TB 4Q74A 4FQ1H 2QJDA 1EX0A 5FHAL 1WT5C 2ADIA 1GC1C 2A9NL 4HUXB 2EKSA 2XI9A 1CGWA 5CJXA 3E3QE 3ET9F 3ZYZA 3GMMA 1UEMA 1LEKA 4TNWF 3BWUC 2XZQL 4N0YH 4GMSH 4O58H 2IANA 1X5KA 3O4LB 2PKDA 5D93B 4GS7C 4HBQA 1A2YB 3CSGA 4U1SB 3T65A 3TPUB 3KYOB 5I2IA 1FBIL 4YXHL 3K8KA 4MCYA 3UTOA 4K94H 3SKJL 4YHIB 5CWSA 1L6XA 3QFJA 4PRHE 4M3KB 3ARFA 4KZEH 1TZIA 4L29A 4M43L 2F54B 4N5UA 4Z76A 3C5ZD 3D85A 4OBRA 1PG7H 6FABH 4GBXB 3QXUA 1MCWM 4M4RA 1I1FB 5HPMB 1HOCB 4X7TA 5JOPD 1HK6A 2NY6D 3F7QA 1QA9A 4PJBE 4XMLH 3GI8H 3AXLA 3RUGB 5IMOB 1JPGB 2EXWD 2VN7A 4U31A 1N7ML 4HS3A 5ESAA 2CO7B 2DQIH 3SGKA 4K2UH 3G6AA 5IESL 5T3XH 1D5XB 3FZUD 3DETC 3L95A 1VPOL 1C7TA 2JKXA 4TNVF 3TCXA 2A6IB 3OMZA 2E27L 3LV3A 2J2ZA 4MVBD 4Y2DC 1OAZL 4U6VH 1Q72H 1N7MH 4PLKC 5IR1A 3B9AA 4RFEA 1G7JB 4HJGB 4K23H 5HGDA 3VG0H 4Y5VB 2BMKA 5J1AB 2ENSA 4NNYA 5HI4C 3FFCD 1U8PB 3D1MC 4GMTH 5ITFB 1A7PL 1I1AD 4JN2A 4MJIA 5T5NF 4DGVH 4ZFGL 1INDH 2PW1A 3KLAA 2GCYA 4P23D 3DO7B 1P4BH 1UT9A 4ZAKA 4OLEA 3NGBC 2R15A 3B9VA 4FQLL 1JPTL 4W70A 2GITA 3SKMA 1A7NL 1WICA 5BW7A 3ARSA 4QXGH 1TITA 4L5FH 3NGBB 2LAGB 5ACZB 3LSOA 3BPOC 5E6ID 3PWNB 3VWJA 3IFOB 5DYOB 1B90A 3SCMC 4NZRL 4C54A 2DBLL 4K3EH 5DI8A 3RY6A 3EJZD 3F12B 3WBDA 5IROA 1GC1H 3FJTA 4WHDA 4Y5VC 5T3ZH 3VE0A 1NEUA 3NCBB 3X3FL 1XFPA 3IGAB 3IJYA 3PWUB 3N1MC 4KROC 4HH9A 2JCCF 4MA8L 5BV7H 3MO1B 3FQNB 1ZT1A 2YSSA 1U93B 4MXWH 3DJ9A 1FNEB 2HYMA 5DHVH 1QR1A 2J8UE 2RFXB 4J12A 3ORJA 4X7EC 1AE6H 2BX5A 3TZVC 2JELH 4K7PX 5EN2B 1U8PA 2VLJB 1WTLA 5D7JA 3HC4L 2F8OA 1VEPA 5DJ2B 1A1MA 3NABH 3A67H 4JFDA 3V0WL 4WENB 5AAMA 1DBKL 3QPXL 4NT6A 4OZFG 2K1MA 4JRWA 4KKBD 3TYFA 1W0YT 1KTDA 1KEMH 3FRUA 2FJFA 1I3GL 4DAGH 4PLJD 1EERB 4KDWA 4OZGF 4OGAD 3SDCB 2DQCL 4M00A 5IVOA 4D0CB 2BRRL 3OAYH 5F89B 4UILL 5DJ8B 2R0KL 2KBGA 3HNVH 4Q9RH 4LEXL 4ODTH 3IXAB 2F9BT 2V2XA 1T89C 3AS0A 3RQ3A 3S96A 4F7MA 1L6ZA 4FFYH 2X4PB 3SKOA 4LLYB 4JGJA 4F9PA 4E5XA 4L9LB 2FHBA 3NCCB 4AH2A 4MYWB 4QRRD 4ZPTA 3ZHLA 2C3GA 3FOLB 4MQTB 1HQRB 3QPXH 3MLSL 2DLEA 1FAKT 2J1KA 1FPTH 5C0FB 2YHGA 4HH9B 5DD3L 2H1PL 4R26L 4Y4HD 5HDQL 3T4YB 5E8EA 4K3JH 1U8JB 2VDQL 2NY3D 3ULVL 1JCKA 2CH8A 6CGTA 3MJ9H 4L4TA 4DOHB 3WJJA 4MD5A 1E27A 5D1XB 3QDJA 5H37H 4BKLB 5E5RB 3U7YH 4NM8H 2YWZA 5JHLL 1MAML 1MCWW 3K0WA 2BSSB 3F7YB 1Q9KB 3IJSA 4YDVA 3T09A 3P73A 1CD8A 4H20L 4JRXB 4Y4KC 4OD1H 3U48A 5J7CC 2FGWL 2NTFB 2P5WA 1WV7T 1NMCC 5IB1A 3O2VL 2DLGA 2YUVA 5F89A 3U1SL 2QHRH 4JN1H 1H3TA 3TP4A 2ORBL 1S7XA 1GCFA 2X1XR 1NMAH 4ZUTA 4ZD3L 4OSUL 3WNOA 1MVUB 3K46A 2LVCA 2VAJA 3UTSA 5J3HC 3MROB 4LHUD 1A7NH 1LO3H 1QSFA 1S5IL 4UQ3B 4YBQD 5GGSA 4Z7NE 4F7PA 4L9LA 5LGHL 1FFNA 4U1GB 5KVMC 4QXGL 1F4YH 1I1FA 2FHFA 1NC2B 5E00B 4P9HH 3VH8B 4LPTA 1X7QA 1EK3A 2UVFA 4JPKH 1UM4H 2PXYD 5KVFH 4X4ME 4X4ZA 3KPNA 3TA3A 5E95B 2AK4D 2OL3H 1O0VA 3NFPA 2DLHA 1OAZH 1UC6A 4WWKA 4JDVA 3IRZA 3IVKA 1UACH 3GIVB 2OQJB 4PR5A 3L5IA 3WJLC 1JRHH 1D6VL 4WHTA 2DBJA 1XR8A 5K9KA 5IVXA 4X80L 1A6VH 4TSCL 5F9OL 2PYED 3WXWL 4KRPC 2P5WB 4OM0L 5IB1B 2P8LA 3NFSH 1WIPA 4MJIB 3WLWD 5D5ME 4P9HL 1CK0L 4K2UL 4NHCL 5DURB 2NQCA 4YDKL 4OFKA 2OL3L 1DN2A 4WEBL 1A6WL 2W1NA 4M3JA 3G04B 3MV7B 4RMSA 4XMLL 3TBTB 3QHZL 3UPCA 1LO4H 1S9XA 5IW1B 1JNNL 4JPIA 1FL5A 1DBBH 1QRNE 5ACZA 5CUSL 1MF2H 3PWPB 1NC2A 5E00A 4N8CL 3HI6H 4Q6YA 4HK0B 2P5ED 1MIEL 4LASH 1HIMH 2IH3A 5FIEA 3O6ML 4ZXBB 5DQJA 4EZMA 3QIWA 1FBIH 4YXHH 3FRPA 2Y9RT 3O3EB 3VRJA 2ESVB 3SPVA 1E6OL 1BREA 5MHSE 3X13B 4LPXA 4XP5L 1QUNA 2YMXL 3UJTL 3EOBB 3IKKA 1MUJB 3PJSA 2IBGA 4G7YH 4ZOEA 1WEJL 3ARDC 3VXRD 2GKIA 3AC0A 3L3OB 3PL6A 3U7YL 4K9EH 5D6CB 1C5BL 4OLWL 1OAUL 4ZTPH 2X44D 2I9TB 3BEVA 3OZ9L 3TYFB 2IADB 1MFCL 5E03A 3QIBA 1RUML 1P9MA 4HSQA 4JHZA 4KK5D 3ZKXB 5HGHA 5I1KL 4PJCA 3C6SA 3MRJB 2VL5B 3MLZH 5CMAA 4LL9A 5EFIB 4AQ1B 2BVOA 5IG7B 1FL5B 1NFIB 5KS9E 2D4FA 4KVNH 3H42H 3IYLW 1ZLWH 3WNLA 1W8OA 4ZG1A 1QACA 5HHNB 3G5ZA 4Y16D 5I30H 1QNZL 4K8RD 1CL7L 3UTQB 5HBBA 3IJHA 4FXKA 4PJFE 2XRAH 4PJBA 2DLIA 4ZAKD 2DL2A 1HHHA 4DUWA 4YHYC 1N5YL 3GZKA 1BQUA 5EO9B 2EE6A 4OZGB 2AJ3B 3RZCB 2MHAB 3JV0A 3O3BA 5JXEC 5D4QA 3MNZA 3PNWA 4OIBA 5M95B 4GS7B 3I3DA 3HPLB 5FO8B 2DYPD 3K81A 4OLUH 1OAKH 4NO3A 1J1PH 4MNQB 5GZOD 2OJZH 4QRPB 1OAXH 4MAUH 1NGQL 3V0WH 1JWMB 4CVXB 3OR7A 1P7HL 2EDFA 5EDXA 3GRWA 3FB8A 3F65A 3VXQB 1DQLL 1NSNL 3TN0A 3PL6D 2FX9H 1HOCA 4BH7B 1IILE 3FCTB 4YDVB 5I1LB 4LDLB 1KT2B 2APTA 3IDGA 3KG5A 2D7TH 1RIUL 4RX4A 4XGZA 3TC9A 5GRYA 2BNUB 1I1CA 3RDTC 3ULSA 3ZTNL 5EOQH 2PO6D 5CZXC 3QFJE 5CCKL 2OX5A 1H5BA 1HSAA 5KZCB 3KHOA 5ERWB 1E4XL 5I18L 1KUMA 1H5BC 4J3TA 4PP2A 4U1GC 4N8CH 4F9LC 1DQQA 4OUOA 4R0LA 1GGIL 5E70A 1ETZA 4BQ8A 4X6FA 5GS1C 2APXA 1UQSB 1FAIL 1T03L 2UWEB 4FQLH 3VRIA 3MRIB 4LSPL 2W65B 1FG9C 2Y7QB 1INDL 3L9RA 5CUSH 3ULUC 4AK1A 4JJ5B 2XKUA 3OAZK 1KLFA 3JTTB 4YDJA 3RZWA 4HIEB 4QRTB 2BNRA 5EOCL 4HJ0D 5HHOD 5I71C 3EJYD 5LGJB 1UKSA 1YEEL 1IEBB 3DHJA 1UWGH 4OCWH 3SGKC 5IT2L 1H3UA 4PJ7F 1CTOA 1A7OL 1ERNA 4GKNA 5J0BA 3MRQB 1CK0H 2E5EA 2E27H 4L4VD 3UPRA 2X42A 5GJSH 3QPQD 2VE6A 3CAFA 5F9OH 5C2BL 3LDBC 3LSOB 4YNYB 4K8RH 2D7QA 1WZMA 5I8OL 5JUEL 4YFEA 4M1DL 4OQ1A 2IH1B 5I74C 1AKJD 3GJEB 4OKVB 4AMKH 4QRSB 4M62L 2BSTB 2PYEE 3REWA 3PP3H 4XCFL 4HZLA 2AXGA 4TYUA 2VDLH 4OGAC 1A9EB 1GJIA 1F4YL 1U95A 2A74B 4QHNB 4ZODA 5ILTL 3MTRA 4PRIE 2FL5B 1UQSA 3O4OC 2ZUTA 5KZCD 4GAJH 3HNSH 4H8WC 4D0DB 1QPXA 4UDTA 3NIFF 5GRXG 3BSZH 5HVWA 4OZIE 2GSIB 1ZSDA 2APFA 3EBAA 1H9VA 1J8KA 2NY3C 1KTDB 5FUCE 1G1CA 1XGQA 3OHXA 4HJJH 1NMAL 2X4RA 3P40A 3TBWA 2VZSA 3H3BC 1JIBA 3IDIB 5KAQF 2A9NH 5D96B 1M6OB 4C56A 3WIFB 4DFIA 4BZYA 4P46C 1RZKL 3OKLA 2BVQB 3HPJB 1M71A 5F44A 2B4CH 3PIQA 3MJ9L 3IFPA 3LS4H 4KVCL 3ZT5A 1IM9B 3N06B 2MFNA 3B2UD 3LN5B 3ZSTA 4OZHF 4NQCE 1GGTA 3BD5A 5DJXA 5T5NG 3ARXA 5IHBA 1ZLUK 2R0ZH 5IHZA 1BMGA 4Y89A 4JEGB 4B0MM 4NO5A 1RHHB 2ZSVA 5CD5D 1G9MC 3QIUC 4KH2A 4YBLC 4U0RC 3CFBB 4AY0A 3CPLB 1BIIA 3MRBA 1IZKA 1PZUB 5CFHA 1Q94B 2BSRA 5AWNL 2L7JA 1JHTA 1AGDA 4MB3A 4Y4HC 1OPGL 4J4PC 5EUOF 1MI5B 3RZCC 3V6BR 4ETYA 4KTEH 2KZ1B 5DQ9A 4XNXL 5HHNA 1G84A 3L3JA 3DMMD 1WWCA 3VA2C 3QZWA 5CP7B 4MD4A 5JPNA 5DHYB 1NGZB 1NKRA 3G5XB 3TV3H 5C0BD 2BSSA 2K7PA 2A83A 1XCTA 2VZUA 3VXOB 4LSSH 2UVEA 1YEDB 4DKAA 4FQCH 3VXNA 5AAWA 4NRXB 1UZ8B 2ZOKA 5KSBB 3DPBA 4XI5C 5GS3A 2F54D 1R5WA 1MCKA 3B2VH 3ARTA 4LCWD 5LBSH 2DM7A 2NY0B 4LARL 4M6NL 3QYCA 4L3AA 5HVHC 2I9LA 4NQSA 3LKRA 4PRPE 3CDFA 4UTAL 4YDLB 4UV7L 2LTQB 4FQXD 5TF1H 4DK3A 3EJZC 5DFWH 4I13B 1KIUA 1RZKC 3DVNA 1U3HB 4M1CD 3HB3D 4KV5E 2AEWA 3VGGA 3G6DH 1BD2E 3AREC 1Q8MA 3NACL 2R2HA 3BZFB 5BO1H 4OFVA 5DMGC 3AREA 4EOWH 3CSYA 2APWA 3U2SA 4BH7A 2HTLC 4OLXH 3IDUA 3NH7H 1R3KB 1I75A 4G9FD 4HS8L 4MLSA 3QI9B 2Z8VC 1A6UH 1KC5H 5DD1L 1T1ZB 3TIDA 3NPSC 4XP5H 1MIML 2YUZA 2BDNL 1FGVH 1G7MB 2R0LH 5JA9A 1EJOH 2UYLA 4KKBC 35C8L 4FNLL 5DEFA 3QWOB 3QXAA 2XN9A 4L8CA 5FB8B 3RWHA 1CF8L 2SEBB 2A83B 3OGOE 3F6LA 2D3VA 4P4RA 1CDGA 5D1XD 3C6LA 3VXNB 2EDEA 1I8MB 4DW2H 4XBPA 1HHIA 5DEGB 3DUUB 3AM8A 1WBXA 4JFFB 5H94A 1P7QA 3O4LA 4RGMC 1P5UA 1A2YA 4TSAH 1F4XH 4XNYL 1JPTH 1K9TA 1Y6KR 1KJMB 5IK3A 5T3XD 1PZ5A 1C5DB 4HV8B 3C5JA 4EVNB 3D3VE 3IDXL 3WNKA 1B6DA 4YHIA 2DIBA 1JF5A 4I8DA 1QFWH 1OP3H 2GQHA 3PQYE 5JIPA 4DUVA 5CJXC 4ZS7H 1VENA 1MREL 1FFOA 1LK3L 4S1DD 4OUUB 2V17H 4WV1A 3PWPA 1YJDH 3RGVA 3MV9E 5D7IA 3QXWA 2COQA 1A6VL 2AV1B 3P77B 3LPFA 5DUMH 3RTQB 3T0VA 3SO3C 4X7TB 4Q0XL 4H0HB 3DX6A 4FXLA 1S7VB 4A2LA 3TIDB 3ETBF 2CKBB 3MJ6A 3LPGA 1URLA 4RMTA 3ULUD 1WCQA 1YN6B 3VJ6A 5C0NC 4K7PH 2B0SL 5EUOE 2AEPH 3GRWH 3LKOA 5IFHL 1BFOA 1U8IA 1MCLA 4GQ9L 3WKNA 3MLWH 4F58L 1Q0XL 3SE9H 3D0LB 3O0RH 3S36X 5DR5L 3C6LB 4AEIH 4OZHA 1Z9MA 5ISZA 4OF3A 1XGYH 5J1AA 2ZG3A 2YRPA 1YZZA 2ITDA 4U1NB 3G9AB 4JANB 4MNHB 4M43H 2ZOLB 4QO1A 1KENH 5BS0E 5JZ7C 3CLEL 1XGQB 3U30B 2R1YB 1DN0B 4ZAKB 4G7VL 3T2OA 2F74A 5C0ND 2UY6A 4DN3L 1A1NB 2AQ2A 2PW1B 1UM6L 5A16B 2VITB 2X2YA 3IF1A 4XNMB 3VG9C 4IRSC 3UTPD 1NFIA 3U1SH 3ARPA 1IGTA 2NY5H 1FIEA 5JXAL 4HXBL 2R23A 4U4BA 1ZGLP 1D9KC 4HGWB 4Z7UE 2B5IB 2X4UA 3S6CA 5C8JA 4XPAL 4RX4D 1MWAH 4LQ1A 1SEQH 4RGNE 1S7VA 3SGDI 1I8KB 5DDHB 5AZEH 5CEYA 4ZS6D 2M26A 4XNQA 5DFVC 5DUPH 3FQTA 2WV3A 3HMXA 2Y07H 3NIFE 2HVJA 4ZTOL 3F12A 2XA8H 5HPOA 4ZAKC 3UYRH 3HMWL 3MUHL 3PXJA 4HZAA 2GY7B 3B3IA 1OL0A 3I85A 3BKMH 5HYSG 1YEHL 1PGRB 5B4MD 4DGIH 2EYSA 2HJKA 2E7LA 4OFDA 2BDNH 2CIKB 2P42B 1BGXL 1S5HB 4WJ5B 1NCDH 1DEEB 3VI4E 4RAVB 5I8KH 4E9LA 5ABDE 2YKLL 2EE2A 3QDJD 5L6YL 4KHXL 1I1AA 5C2UB 2JB6A 3DI3B 3IDXH 4WW2B 3SBWA 3HAEH 2J88H 2VJXA 3V6OE 5HYJB 3DI2B 1XMWA 5HHVH 3QUMH 4TSAL 3LKRB 3ZDXF 4LGPB 2YR3A 1A3QA 4F33A 3EYQC 2HFTA 3MYZA 3VRLE 3ULVE 4E0RB 1LE5A 1JGLH 3S7GA 4XPGL 3GSRA 3CU1A 4ZFOA 4QHMB 3H0TB 4C4KO 1SJEA 4PJDA 5D5MB 3N50A 5GRVL 1QKZL 3R06B 1OP3K 1DTUA 1J86A 1UJ3B 2H32B 3QCVH 4HUWB 1I8LA 3T0WA 4RIRA 1JGEB 5HHPB 4UOJA 1OAQL 4EUPA 4BZ1L 2B7DT 5GS2H 3GM0A 4XTRC 4XP6L 3WL9B 2YD3A 3HZKB 1FN4B 3ZDZF 4NGHL 4GG6E 3UTZA 3GSOB 3BMVA 4FZEL 3S88L 3U9PL 4N90E 2F5AH 4Y0GA 5IKCA 4F7EA 1S5HA 2UYLB 3QWRD 3ZMRA 2PETA 4I2XA 1T2QL 3MUGB 2AGJH 3EDFA 1UB6A 1ZAGA 5DJ0B 1IGYA 4WO4B 2J4WL 2PTVA 3V7MA 3GMPB 5C09E 4FOMA 4HC1H 1RU9H 1NCAH 1EAPA 4KFZC 4JFDD 4F37K 3UYRL 1RMFH 4NZRH 2IFGA 5ANME 5GS0C 3NVQA 4F37F 5ITBH 1OCWH 3BZEA 4JQIL 1ZA6A 1MLCA 1S7XB 2ZUQC 4HZLB 5F9WC 4X6CF 2PF6A 1P2CB 1PKQB 3QFJD 4V1DD 2H2PD 4JQVA 4KY1H 4FN0A 1N59A 3K7UA 1TETL 3IDJB 5LXGL 2KKQA 1F3DJ 2Z31A 1I3RA 4KDTC 5JDSB 4ONFH 3L7EA 3EO1B 3WYRA 3C5ZA 1KB9J 1JPFB 3P4OB 4DGVL 1F3DH 1NANH 3R06A 1JK8B 4ZSOA 4OIAA 3TV3L 5IMKB 3OPZH 4WWKD 2QSQA 5GIRA 4UNVA 4P5KB 4HIIA 3BRGC 4PP1D 3WUWA 2FO4A 2EECA 1PY4A 4LGSB 5D1ZB 3MBED 2OTPA 3V0VA 4X7SL 1FLRH 3JWDH 1CICD 1VA9A 5BRZA 1ZSDB 4KHTL 4KPHH 5I17B 3O6KH 2DQHH 4F15B 3S35X 3VH8A 4YEFA 5C9KA 3F5WA 2CKBA 3HA0A 3GJFA 1JZ2A 1TCMA 4PV9B 8FABB 3MV8B 5EZJB 2HH0H 1J0JA 1RZ7L 3KPQB 2OZ4H 4UB0H 3FFDB 4X5XA 4HG4K 2R0ZL 4WO4A 3HPJA 2J8UF 2R0WH 5KVEL 1N5AB 1BBJA 2OSLB 5C0AE 5CGYD 3OWEA 3QQ3A 3NN8A 5C08E 2Q6WA 5EH1A 2VWEC 2EDHA 1OT1A 5D72H 3BKCH 4MA1B 4HWBA 4Q9QL 2V2WB 2P8LB 3HZYB 4HBCL 4U2YA 1MQKL 4MX7B 4Z5RB 4NZUL 5D93C 1P1ZA 3UXFA 3P4NA 1J12A 2AJZA 4YWGH 1JZ5A 1DN0A 4MA3B 1N64L 4GRLD 4OCSH 2Z31B 4HJJL 4F15C 1P84K 3QFJB 5DRXA 5B4MC 3IDMB 5D7LE 1T1WB 3FQRB 43CAA 5CIPB 5HYSB 3F62A 1RVFL 4TUJA 5AEAA 1LHZA 2B1AL 1FZKA 3TVMC 1HYSD 2XT1B 2BOCB 1H3GA 4LF3A 3DXAD 2HT4C 2NPLX 2W07A 2EXWC 2IALB 1BFVL 2FR4A 4HK0A 4IHOB 4I2XE 4LLVB 1FV1A 1BVLB 2O26U 4ZO9A 5JMOC 1XGUA 1CICC 1VFUA 1MWAB 2VOTA 3QUYB 1A6AA 5CEZE 1FZJB 3TFKD 2EDOA 3KHQA 4NQSB 1DUZA 4UAOC 3OKDA 3QFDA 5CD3A 4KQ4L 2RBLA 4YHNB 4L3EB 1SYVB 3L95B 2DQGL 4N8VG 3DECA 4DN4L 1NLBL 2AERT 3LV3B 5F1SA 3QIWC 1PKOA 3NZHH 1SY6A 4RGOH 4U0RB 1Z2KA 1FGVL 3VMPA 1FO0A 1S8DB 4HJGA 3L3OA 2VQ1B 4GW1B 2QBWA 5KVGL 3S35H 1MSPA 3L7FB 1PEZA 2CJUL 5J9PA 5MERA 5F3HA 4XTRD 2L4OA 1ITCA 1D5IH 2WBJB 5GZND 1HEZB 4LLQA 2YPLE 3RVXC 4RAUA 4JG0H 4FG6C 4ENED 4HKBA 1HDMA 4FRWA 4HUVB 4D9QD 4IRJD 3BDXA 2BFVH 2VL5A 1KN2H 4CN4A 5DRNB 3EFFB 5TF1L 5SWZE 3HI1B 3V79C 3RA7H 5BS0B 3RWHB 4PJGE 4PIRF 2DWEA 3WS6C 3WD5L 3UC0L 3FB7A 3UTQA 1AP2A 4MQSB 4FXKB 1XF2B 3DUUA 4JFFA 1EZVY 5JR1L 3GMRA 4PRHD 1T2QH 4FFVC 5TF0A 1DLHB 2XFXB 3VCLB 1N26A 2F5AL 3PGFL 1E4WH 4HMEA 3IGAA 3CVHB 4IRZL 5DO2C 1AGFB 5J6HA 4M6OH 3MJ7B 4X6CB 1GZPA 1SMOA 3CH1B 3FO0L 3RWIA 2AI0H 1BQHA 1KXTB 4XPBH 2P1YA 1Z0MA 2RFXA 5I1KH 1IAIM 1Q9WA 3QXVA 3C6LC 2BXZA 4OAWA 1OTUD 4GLRH 2JJVA 1BVZA 1KPVA 1BM3L 1TVDA 5TE6H 4XHJD 4NC0B 5I1LA 4GKOA 5ID0B 4KKCC 5ERWA 4GLRI 4HKZB 2NY1D 1E4XI 3D3VB 3SJVD 3EOAA 3GSQA 3IFLL 4OQTH 4MAYD 3UMTA 1UA6L 4JRYD 1IQDA 3RTQC 4LSTL 4I5BA 2YMXH 4XPTL 3UJTH 2V9TA 5EC1B 2H2SC 1GSMA 3BUYA 4KK8C 4M5ZL 4LCCC 3VRIB 1D9KD 3QDHA 1CFQB 2I5YL 2W91A 4HWZA 2W9EL 2WIMA 4L4VA 5EUKA 2FEDC 3FN0H 1WFUA 4Y16B 1I7UB 2ZCKL 5GS2D 3SGEH 3WXVH 2W0KA 5KG9A 3HG1E 4XCEA 1CFNB 5LQBH 4QRTA 4JFFD 4MNHA 2N4IA 1II4E 4B7IA 4K9EC 5ICYB 3AY4A 4JZNA 3OAUL 5GGRY 1DBBL 1RUMH 2XWJB 1YY9C 4Q9QH 4X8JB 2VO5A 5FGBC 1P53A 1M05B 4R0LC 1TTGA 1PSKL 1UWEH 4Z7WE 1BQHB 5E8EB 3O8XD 4G6FB 4URTB 4RFOL 3GDBA 5DUPL 4RISL 1MHEB 4YNYA 4MD5B 4HGWA 5DJZB 4PLNC 1T66D 4J1UA 3T0DA 4HG4J 3K8MA 4P5TB 1UWXK 3I9GL 1AXIB 4XCFH 5T1LB 4FTVA 5A3IC 3PQYA 4HFUH 2VKWA 4DFHA 1YDPB 4TSBL 2NW2A 4YPGB 2ZJSL 1LK3H 1KPUB 1LO5A 3OX8A 4BQCA 2GW5A 4X6CE 2B39A 4PD4J 3SN6N 2N56A 1BLNB 1U6AH 3GNMH 1LILA 5E8DL 1VFAA 3BDYH 1MFBL 3MCLH 5HYSA 4LASL 4MHHG 2VDPH 2LAAA 2ERJC 5FUOH 3KNBB 1UCTA 3CFDA 4G6MH 1CFNA 2YD2A 4PRID 1G7JA 3DMMA 5KVDH 4PJ5A 2R2CA 5E4IA 3MV7D 4HUUA 2Z4QA 4HWEH 4XB8A 3ZYOA 4OGZA 3ZE1E 3AU1B 1ULVA 4WW2A 4M4PA 5FDWB 2R4RL 3S9DB 3MLRL 5DD6B 1W72A 3KPNB 5C6TH 1AR1D 5GGUB 5IJVA 4S1DC 4FQPA 3WNNA 5CSZB 1UVQB 4JDVB 3UTPE 1X5ZA 4XXDA 5DJZA 2VDOL 1LNUA 2NY2D 4LU5L 4H0IA 4LCYB 4LRNH 3HG1D 4ELMB 1J0KA 4FZEH 4BSVA 1LEGB 3SCMA 1JTPA 2F15A 3HS0B 4NGHH 1IT9L 5IBUG 3BD3A 2A6KB 4L8SA 2P43B 2YUWA 4P5TD 2NX5E 5MERB 5F7KC 1RIUH 1KLGA 3I02A 3S37H 3THML 4AEFA 4X8XA 5IQ9A 1S7RB 4P3CH 1T7VA 1DVFB 4F3FA 3QP3A 4LPYA 3QPQC 3BGFB 5ELIA 1G9NH 3T2QA 4RAUB 3GBLA 2UUDH 1FL3B 3O4OB 4Z8FH 1YYLL 3CMOH 4N8VA 1IAMA 3ULVH 1U8NA 3C60A 5J12C 3DX9B 3WKMH 5AZ2L 3SDDC 1E4JA 4NOBA 3MLXH 2APVA 5CHNA 3G5XA 3KPMB 1UXSA 3VXOA 3KPSE 2D03L 3FB7B 1IAOB 3VFMA 5C0EB 5BJTB 3MGOA 5KW9L 1OP5H 3RX7A 2YEZA 1QBML 4M5YH 1YEDA 1YEGH 2ICCA 2GFBA 3BPLB 4ZO7A 1MRCL 3D39A 4PRAB 4JFHE 3KXFA 3TH4T 3NCEB 3KYNA 1JZ7A 1XR9A 2O5ZH 4GKSB 5J6HB 4PRIB 3RTQD 3MR9B 2FH6A 4MJ6A 2H9GB 1CDHA 4ISVB 2WUBL 5GRWA 5JDSA 3WO4B 4K7PY 4HS8H 4H25B 4XT1C 4XPFH 4DGIL 2GUOA 3E1F1 3KS0H 1A3RL 2A0LD 4JFPB 3NCMA 4NBZB 4AM0B 1NMBL 5JHDA 3WUWG 3DTXB 3PDOA 4K71B 2FATH 3C6LD 5AUMA 3U7AA 3QWRA 5C08B 3TIEA 1FVCA 1G7IA 2AABH 4NQDA 4MQXC 1FZMB 5INCA 3BHBA 5IW6B 1G7MA 4PLJC 5HHXH 5FYKL 3C6SB 3EOAB 5CINL 3RHWK 4IIQC 1U8KA 1WEJH 5IG7A 2Q3AA 1V7NH 3B2VL 1R0AL 1MNUL 1NBVL 2BNQA 4QOKB 3MFGB 2NY7L 2IPTL 4P4RB 4LP4A 3MGTB 5A43C 3VFMB 3DUHA 5DJAB 4N68A 2QKIA 2HMIC 2WP3O 4FFYL 5CD5C 2XPGA 3T8XB 3AAZA 3W5NA 4X9FA 4LEXH 3CFIC 4M48L 4U1JB 3MLYH 3RU8L 4OM1L 5E9DA 2HVKA 4XWOD 2Y25A 3MR9A 4MJ6B 5J6GB 3VFNA 3HI6L 3MLXL 1WJ3A 3LPWA 5K59E 4P99A 1ZMYA 4PJFF 3WIHL 4H25A 2PR4L 1DLFH 4X9IA 2DWDA 1JNNH 2HTKC 3ARVA 3ROLA 3O3DA 4YHKL 3O9WA 1KLUA 1RIHH 5BV7C 1A7BA 1MJUH 4Y5YC 3QNZA 3MLWL 4F58H 1OD9A 1B3JA 1AKJA 3S37L 3THMH 2AV1A 1H8NA 4GOSA 3RL1A 3VDBA 5DLMH 5SWSB 3O2DH 3RGVB 1KT2A 3PGCB 2BY1A 1FVCB 1O7SA 4A6YB 1P7KB 5C07E 3PQYB 1G9NL 1XGUB 1IT9H 1GPOL 1I9IL 1RZKH 5D9SA 3EO0A 1U8HB 1X9QA 5DK2B 2Z8RA 3MMEA 4YO0B 5MENA 4TSCH 4I48A 3NFPB 3QUKB 3H7LA 1IBGL 2MCPH 1DANT 1JRHL 1MY7A 1JYWA 1MREH 4JM4H 2X4QB 4V1DA 2H3NA 3D18B 1EIBA 3VFGL 1IC5L 2IBBA 4WO4D 3VD9A 1MI5D 3KNBA 4MB4A 1L4IA 3VFWA 2DLTA 1HZHH 4NQXA 4F57L 2HG5B 1WIUA