1Z66A

Nmr solution structure of domain iii of e-protein of tick-borne langat flavivirus (no rdc restraints)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
TYTVCDKTKFTWKRAPTDSGHDTVVMEVGFSGTRPCRIPVRAVAHGVPEVNVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGDLNHQWFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Major envelope protein E
publication title NMR solution structure and backbone dynamics of domain III of the E protein of tick-borne Langat flavivirus suggests a potential site for molecular recognition.
pubmed doi rcsb
source organism Langat virus
molecule tags Viral protein
total genus 13
structure length 93
sequence length 93
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2005-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1z66A00
4UTCA 5KVDE 4X42A 3UYPB 2GG1A 3C5XA 4GT0A 4GSXA 3WE1A 1Z3RA 3UZEC 1Z66A 2R69A 4ALAC 3MUUA 2ALAA 5LCVA 3P54A 4BZ1A 1OK8A 3N41F 3IRCA 1PJWA 1TG8A 5KVFE 3J2PA 1OANA 1SVBA 3C6EA 2JSFA 5IZ7A 1URZA 3UZVA 5AAWC 5KVEE 5GZNA 4AM0Q 3J27A 2P5PA 4UTAA 2I69A 4L5FE 3N43F 1UZGA 2H0PA 3UZQB 4BZ2A 4FG0A 3G7TA 4UT9A 2JV6A 5JHMA 3N40F 5IREA 1OKEA 4FFYA 3VTTA 3N42F 4UTBA 2R29A 1S6NA 2JQMA 2V33A 4AL8C 5JHLA 5H37A 3UAJA 5LBSA 5GZOA 5AAMC 1ZTXE 2HG0A 4UT6A 5KVGE 5B1CA 4FFZA 1RERA 5LBVA 3N44F
chains in the Genus database with same CATH superfamily
4APXB 1OE3A 2PYEE 3KPMA 2L0DA 4GXUN 2DQJL 2AJ3A 1BVLA 3IDXH 1SDYA 1CZ8H 2HRPH 5JXAL 5FHBH 2QKIA 2WSPA 2V3FA 4QHKJ 1T6WA 3RURA 5EBLA 1Z9LA 2BVQB 5I8OL 3B1TA 1UWXK 1CGSH 5C0CD 2L04A 2BIHA 2AJZA 2RTTA 3QPXH 3BDBA 2O5XH 3F58H 1JGDB 4M00A 1IVTA 1V3LA 4ALAC 3DDFA 1F11B 3VD0A 2UYLB 4OFVA 1ERNA 2NY3B 1L9MA 3QZWB 3LKRA 1NAMA 4WCYL 4WJG3 2ZPKH 2NW3B 3STZB 2GUOB 4G6AC 3PL6D 1TPXC 2Z92B 4IOFC 3WY4A 3QIBC 4I89A 5A6LA 1HHIA 1MWAH 3PHOA 4OSUH 1CDGA 3GMOA 4XCYA 3IJEA 2BMKA 2MWCA 4TTGA 4W9DC 3ZKMC 1X5ZA 4HC1H 3CVHA 3LKOA 2OL3H 3PIQA 4FTDA 3TF7C 1OXYA 5FFGA 1WV7T 1KLGA 4JKPH 4XVOA 4B3EA 3LHPL 3EZ8A 5I76A 1S7WA 5EUOA 3ABKB 4J8QA 2EKJA 3LHAA 4L5FE 3OAWA 5I16B 4H1LG 4LFHD 4XXDB 4LLYB 4A68A 1P7QB 4YHOL 3ILPA 3V52L 3U9PH 1NCDL 4KHXH 5I73B 2ZSWA 2VJ8A 1BVNP 4M7LH 3RX7A 4UQ2A 2Y2YA 4JFDA 4HJ1A 2UWEA 3K2KA 2CIIB 4BCZA 1ZT7A 2PABA 3E38A 3D18B 4J3OG 1YDPB 2FB4L 4OIFA 1A8JH 2GW5A 1TENA 1WIPA 1XTLA 5E6RB 1KY6A 4JVWA 5D1XE 4I87A 4NIYE 5HJDA 4ATWA 3FU7B 2N3JA 4L8SB 1FNSH 1UB5B 3WIHA 3A6BH 4TOYL 2AXWA 1YJDL 2VDRB 1VACA 2JKTM 3II1A 4WFGD 1QSFE 3BAWA 4P2OA 4N2NA 3QFJB 2CRYA 3PP3K 4JG1H 4OGAC 4OFYD 4TQPA 4K8RL 1M7DA 4Q0XL 5CEYB 2YARA 2H6UA 2OPCA 3MV9B 3QUZB 4JVUA 3MUGA 1BJ1J 5SV3A 3RWHA 4OQ1A 1UXSA 5F21B 3RIKA 2XA3A 2VLME 3QYCA 1JWSA 1AY1H 3ATFA 3V6OE 3QWRA 1FC1A 3PGDB 4PRPE 4UQBA 2X89D 1JZDC 1KGCD 1HXMB 2ZXBA 1HHHB 1WF5A 2PCYA 3ARDD 5E4OA 2UX7A 3QQ4A 3F8UB 4NJAL 4GQ9H 4XHQA 2J5WA 2H6OA 5L9DL 2PF6A 3MLTB 5GS2H 3F7YB 2CKBL 4MD4B 2HWZL 5DVLA 2R2BB 3Q5OA 5AZUA 4EE2A 2EDDA 4L0PB 5LQBL 3OKKB 4ACTA 4YGVA 4OI8A 4Y1AD 4NYLB 5TF1H 1IE5A 2BIOA 4JRXA 3UPAA 1T6BX 4ZSOB 5KBKA 1UD6A 1TZHB 4ADJA 5HDWA 4F33A 5CEXB 2AP2A 2O5YH 2Y69B 1NICA 1RZFH 2Y24A 4IDJL 5C3IA 4ZO7A 1PKOA 1BM7A 3B2UD 4MCZA 2IAMA 5AKRA 4R3SB 1F4XH 3TA3B 1XZ0A 3GXMA 1G94A 5GJSL 1HX0A 1KIUB 5KJ4A 5GS1B 5HSFA 3HPJA 4LASL 4MNGA 4P46C 2DQEL 3FOMA 1DBJH 1FPTL 1I85C 3O3BB 2DBJA 1UYWH 4XX1G 1JFQL 4Y1SA 2XUWA 3VFWA 4C83B 3QXDB 5CSZB 4DTGH 4FZEH 5J6HA 5LVEA 3T3PB 1GVIA 2MTPA 4PUBH 2GABA 2YRBA 1SEQH 5J9PA 2WQSA 4MJ4A 2D7QA 4FN0A 2OTPA 5AW1B 4WU7B 2ZUSA 2WANA 4LNVA 3S35H 4F7MB 1A7OL 4Q2ZA 3TIDA 3TJEL 4S1QH 4Z0XB 3AABA 3MJ7A 1UZ8B 2BNQA 3HZVA 3DHMA 3KPSA 4G6KL 5GSRB 2DEYX 4L23A 5KZCB 1E28A 2B9BA 4ZUVB 1YECH 1SLWA 5T33L 3Q13A 4W6XB 5KSAC 3FCGA 4GRWF 1QBLL 2EE9A 1F6AA 2OMBA 1LNUB 3KPOB 5EU4B 2PPEA 3U36A 1T21B 2Z91A 3ARFD 4NQDE 4I0KA 3DECA 2DWXA 2Y07L 2YA1A 3CMOL 4NM4L 1KB5L 3CFKB 2R29A 2LU7A 4PLJC 3QUHA 5GGSA 3A6OA 2XXMB 3QDGB 2IBGA 2ZKHH 1UH4A 2A0LD 3LXAA 3O8XC 3QNZA 2FUTA 3Q6FA 1UD5A 4FQQB 5ALCH 2EYTA 4P5KB 4YFEA 2VO5A 1OF0A 4JPKL 4BGDA 3I6LE 1ZTXE 2AFNA 1AIZA 3MLUH 3FTXA 3L9RA 4RAHA 4MJIA 1A6VL 4KX8A 3US9A 5E7FA 4N22A 3FQXB 1O9WA 4AQEA 3T1WA 1KXTB 1IC1A 1WGVA 2JKSA 4UBDC 1NCCH 3FUHA 1JZIA 2OYPA 4KMTH 1G84A 4ZOCA 3BLKA 1EZVX 2CJSA 3QP3A 3NH7L 5DQ9B 5J56B 3AGWA 3E1F1 4NZ8A 5IHLB 3IF1A 3VI4E 4JM0A 5JIDA 1OARL 5DUML 4Q9QL 2ZYIA 1ICTA 4AK1A 3CDFA 1ECZA 1S3RA 4WHTA 1F4WH 5DI8B 3D4GA 2NY3D 3RNQB 1NMCC 1R3HA 1ADQA 1T1WB 4PJEE 1QWNA 3B6SA 1FBIH 4NQEA 2D2CC 1CXFA 1FZMA 2YD2A 4EI5A 4TLUA 3CFDA 5EWIH 35C8H 2V4LA 5HHPB 1VRSA 2WLYA 3OSVA 3PP4L 1PKQB 3A47A 5E2VL 4NI6A 3D48R 3FUDA 1HT6A 2AQNA 3P54A 5HY9A 4OZIA 3PHOB 3KPRE 4Y89A 2WK2A 3SD5A 4MDJA 2VC2H 3UBXB 2R0WL 3GSWA 3OQRA 2MOQA 4N3UA 5LB1A 2V5RA 4AQ1C 1QX1A 1S7SB 3B2VL 3BAKA 3QCTH 3SBPA 3U7WH 2X4OB 2BP3A 2UX6A 3BAJA 1S7WB 1JNJA 1F2QA 3QI9A 1RPQA 1IKNA 1DP0A 2HMIC 2ICWJ 4UV4L 3VI3E 2CIKA 2ZAGA 3K8MA 4WHCA 5DC2A 5AEAA 1I7RB 2DH3A 4RBPH 3IJSB 5ACLA 2L7EA 4FOMA 4BFJA 4HU8A 1NOAA 3BLPX 5FR3A 1QFOA 2WNKA 5I9QC 3C5SA 3MODL 1ZT7B 4PB0H 3K1KC 5DUPH 3ZKXB 5ADOH 5CEZL 5L0QB 1J48A 2X10A 4MB1A 3CX5J 3NACH 1ZXKA 2MQ0A 3PWLA 5H4ZA 2CK2A 5HHNA 4XTRD 2Q8AH 3IGAB 4RMUA 5IJVB 3OMNB 1AGFB 1D7CA 1RMFL 4V33A 4KKAD 1L9OA 3HRZB 3RZCD 3O4OB 1IJ9A 3R1GL 4YR6A 3S5LA 3KR3L 3U9WA 4AUYA 3ARWA 4CA4A 3GUTA 2VN3A 3CHRA 2FGWL 4Z3FA 5BMFL 3O2WH 4DF9A 3K81A 4KK6C 4G8AC 2KT6A 3GHPA 3EBAA 3KCWA 3QFJD 4IU2B 4KTDL 5CJQH 2V3EA 1UT9A 2PO6A 3MV9D 3LEXB 3QUZD 4LEXL 4P2OB 1ZVSB 1GY1A 1OCWH 3FPYA 4ODHH 4Y9GA 3VGDA 1B4TA 2P26A 1BFOB 4AMXA 3EKCA 4I77L 4FQCL 3GHBL 3QUYA 1MAJA 5FOBB 2C9PA 4KPHL 4PS3A 5GZOA 2B1AH 2OJEA 3MUGB 2VDMH 2GAZB 4JFXA 1BQRA 1RY7B 2QV4A 2VDQH 5DVPA 4XC3L 4UAOB 3MNWB 1XMEB 2Z65C 4KKLD 4JUSA 4A7SA 2DI8A 3GB7A 5DJAB 3DJTA 4MX7B 1JPGB 1N8ZA 1HHGA 5FKPB 1QUNA 4M8QB 4AJVA 2D3JA 3CDYA 1SQ2N 2FWOA 5I74C 5JHDE 1MFEH 3KM1A 3NTCL 1KPVA 2I9LA 3LZFH 3SQBB 4PRBA 5HYQA 1OP3H 3U83A 2XQYA 4JRXB 1ZLVH 1QTSA 1KCUL 4B5ZA 5FYLE 2OMYB 3U4EB 2DMGA 1GZQA 3NCEB 2YQBA 2GHZA 1LO2H 3TA3D 1QFHA 4TNVF 1NKOA 1RIVH 2W59A 1XH3A 3WFEL 2LOEA 1SLUA 1IRAY 2N7BA 2C9VA 2IAMB 2XG5B 4A7QA 4H8HA 3HNTH 1MHPH 3K2UH 1F6LL 1XZ0B 3GS7A 3B7RL 1KB9K 3O2DL 4RMTA 3WEOA 2UV3A 3DVNA 4ZBJA 3A6CH 4N0CC 1KCKA 2D0FA 3UAFA 4QKTA 4ELMA 4URKA 2BS8A 4XMKH 2KDYA 3CN1A 4GI8A 5MEPA 1RL1A 4Y9BA 3VFGH 3MV8A 1T83A 3NGBB 2EDBA 4M1CC 4OTXL 5KSBA 4NEHB 5IJBC 4OF7A 3QO1A 4MD5B 2R1XA 5HDOA 3T09A 4C56A 3U6RB 1IL1A 1YHPA 1FFNB 3OPZH 2AJYH 1IUZA 2DB8A 4GRWB 5AW2B 4ZXBD 5KZCD 1CU4H 5IFHH 3FQUA 3M17B 5C2BL 6CGTA 4JRYE 4LXFA 4ZTEA 5CBEB 3DX8A 1HN1A 3HZVB 5KSBF 4J28A 4LCCA 5I6PA 3H9SA 4YNYA 1H6UA 3LN9A 2COVD 2YGVA 3Q2LA 2NXZC 2BSTA 3AAZA 3HN5A 3MREA 4NAMA 1S7QA 1F6AB 1BZQK 1A6WH 5TDOB 4RGMC 4K71C 3SDAD 2LAAA 2IADB 4MS8C 2HRLA 1OHQA 1RPKA 4Y2OA 1BIHA 2E7LA 2VABA 1Q9KB 3QEQB 1K4CB 2WWMD 3PHQB 3PQYA 2A9MH 3L3GB 1OAQH 1F90H 5TGBA 5CFHA 4YDMA 4L3EE 1J0YA 4QT5B 5E9DB 3BP5B 1NGXA 3B3IA 4G9FA 3UBFA 1Y0LB 3ZRCC 1PS3A 4G8EB 1EEYA 3OLIA 3X17A 3WOVA 3S37H 3ZXAC 2BFVH 2ARJA 1CLZL 3I9AA 3KEDA 4Y88A 3AM8C 1MRCL 3L9RB 1GMIA 4J6RH 4MJIB 1YYMH 2WCPA 4ZUUA 5AW7B 4OIIH 3SGDI 3WIAA 5I1CL 3F85A 1GYAA 5FGBC 4PTTA 3K5RA 4AYID 5F3BB 1V3KA 5C0IA 1E5BA 3HAEA 3L2MA 2C9XA 4IU3A 4IBVA 3GMQB 5C8JB 1TTUA 4F24A 1ML0A 4JN1L 2B8OT 3WNMA 5AZ2L 3EUUA 4N24A 2A6IB 4LLVA 3DOSB 4B41A 2WVTA 3O6ML 3D39A 4NQEB 3FFCB 2XWBA 1FZMB 1I3GH 1CJYA 4GRMA 5CIPH 3ULVL 4G8GB 2J21A 5IFJA 3MA7A 3WTVA 3BWAB 3PJSB 4OQTA 2VLKB 1BFVH 4OT1H 2WBXA 3HW7A 1TO4A 3DURB 1Z3RA 3KCPB 4OKDA 4XPBL 3HN3A 3C5ZA 4M4RA 2DYRB 3APFA 4DW2L 5I1AA 2X12A 1IGML 3W39B 4I3RH 1UM4H 1IGCH 3FN9A 1L5GA 3L3OB 2A9AA 3UJIH 1HCZA 4NWUL 4LNRA 4QRUA 4AV5A 1U21A 4TNGA 4X4XA 1LEGA 2AEQH 4X5WA 1RP8A 4PJXF 1RLBA 4LKXA 1V5JA 5I18H 2J72A 2PPFA 3FO9B 3K8KA 5CR1A 3L45A 4LCIL 3BDXA 4DUWA 1RFDL 5TQ2L 1WFJA 1AOHA 2I69A 3IJ7A 4UZUA 2WLNA 5FYKD 5EBWA 5TJWK 2ATKA 1G6VK 1DN0B 4FQ1L 4ZPVB 1QWHA 2BWDA 3FT3A 2EQDA 5F6IC 1T89C 2Z8VC 2BOLA 1OVZA 3BVNA 1P1ZB 1RIHL 3V0DA 4KVNL 5AALA 4S1SH 4Y5YA 4Z9KB 3SDCA 2OMXB 2OMTB 4YR6B 3S5LB 4I5BB 3L3KA 5F7EH 4FTVA 1J05B 4Q58C 2QTVA 4P2OD 5BV7L 1YN7B 4ZFFB 1H6TA 4M93C 1U36A 5GGQL 5HDQH 1HE7A 5DJCA 3SO3C 1NBCA 2A7BA 2PO6B 2VLRB 4HK0A 1N8OE 5ESVA 5SWSB 5DD1H 1ITBB 3OF6A 2DV6A 3GO1L 1K9TA 1YO4A 2W95A 4ZFQA 4DQOL 3P11L 2OJEB 1BD2A 3QEUA 1MY7A 3QWRD 4FNLL 1EXHA 4X6FA 1E4WH 4DN3L 5IB1A 3V0HA 1A7PH 3NCJH 3VGHA 5DZAA 1IIKA 1AC0A 2MCG1 3C75A 3SDDA 4BZ2L 4IHOB 4N0FA 4PGCA 2X41A 4ZNCD 3U9UB 2UY6A 2AQ2A 3TVMB 2V2WA 1D5ZA 1DVTA 1X7QB 3DO7B 1UGKA 3DMMC 4L1HA 4JO2L 1J5CA 5KG9A 4JRXD 1JGIA 4F7PA 5E5MA 2X09A 4Z7UA 5E51A 5CD5C 1G9NL 4NRZA 1G7PA 5HYQB 3QVAA 2BZDA 3HZ3A 3LKQB 3V0IA 2IFGA 1RURL 3UTTA 2IAMD 4Y5XB 4JHUA 5DT1H 1GZQB 2ZG3A 3OWEA 4ODTL 5DSCA 2QPFA 1GC1L 4QIRA 1XH3B 3ARPA 4YWGL 4FG6D 2X4SA 1Z9NA 2E7BA 5ITFA 2VZVA 1NGQL 2HX7A 5AVVB 5JR1H 1TZGH 3MCKA 3EJYD 3ETBJ 1F58H 1MAML 3FOLB 3BSZH 3DVNB 2J4WH 4ODSH 1DE4A 1HINH 3JV4B 4XPTH 1EX0A 2VAJA 4AV0A 3CVIL 4JRWA 4TLTA 1AGCB 1WP6A 3MV8B 1INDH 1YC7A 4BZ1A 3AS3A 2X44D 4D9RD 5BQ7A 1UASA 3KZ8A 2WXOA 4WWNA 3J2PA 3WS6C 5KSBB 4LOVA 1MHCA 5AW5B 1P4LA 3FAWA 3RILA 4PIRF 2R1XB 2HJFA 1KCLA 1J1XL 3F12A 3BAIA 3P3TA 2W80C 3VAEA 1E6OH 1SBSH 4RX4A 2F8IA 5JTWA 4OR1A 3LNFA 3SBWC 2BP5M 3CZNA 3FQUB 3MACL 4O51B 2VJ0A 3NN8B 1PZ3A 2CGRL 5EF3A 2WWNA 1EFQA 2M26A 4LCCB 1S7TB 3BP6B 4AEEA 4WUUE 4LEOA 5CMAA 3SOTA 3ARXA 1ACYH 1IV8A 1NJ9B 2BSTB 3WO4C 5CJ5A 1T5XA 3WDJA 1E40A 3IJYB 3DETC 3QEQD 2CUIA 2R83A 4KFMA 2D73A 2WVVB 4YSPA 5DJ0B 3GZOA 5E9DD 3RGHA 5C3LD 2YA0A 2O6EA 1JPSL 3NJXA 4N2AA 4RRPG 1EHAA 5TGBB 1J5IA 4J3XA 4WJKB 3RAJH 3RU8H 3U0TA 4BYHA 3VMOA 1HH9A 2AW2A 3B3IB 5GXBB 4K3HA 3KH3A 2XVBA 4MJID 1VKXB 3I02B 1GGBL 2R27A 2Y22A 4Y4KA 4OGYH 1TJIH 1JZ6A 4JQIL 1IX2A 3CZUB 2DKSA 2UVEA 2VNCA 1CDHA 1UUSA 1PEZA 5KW9L 3NJJA 1B0RA 1N5AA 3DV4B 3QULB 3NJGA 3Q9PA 3KXFB 3W81A 4CMHC 1DBBH 4N0UE 1LE5A 1J9SA 3FCSA 4F27A 5JIQA 4FKKA 2MQ3A 2NDFA 3IBOA 3RPIA 4UDUB 4NQED 4E42B 3FFCD 4BUGA 2FL5A 5DA4A 4ABQA 4LLVB 4PGJA 2XVGA 5HGHA 2F53A 3EGSB 4Y2NA 1PCSA 1T1ZA 2CJUL 3A4EA 3GXIA 5FO7B 5ETUB 3ZL4H 4FLOA 3QXVA 4RDQG 3MA7B 1P5UA 2X0VA 4HIEB 1OSZB 4LLQB 4LSDA 3KPPB 2X3AA 1BBDL 3OZLA 1YN6B 5IKCA 2NXYC 4MA3A 4M4RB 1JGVL 2J5LB 5I8EB 4AG4H 3ULUL 3QZBA 5BRZA 3ROLA 1NCAH 1Q38A 1S9XA 1ZA3A 1AFVH 1S7VA 4PJXB 3S88H 3TYGL 5IQOA 1L5GB 5CAYB 5JW3L 1ZGLM 2FYYB 3QI9D 4HPYL 5A2CA 2Y6SD 1O6SA 5HHVH 2OYKA 1C16B 3QJHA 1PSKL 1JAEA 4LLUA 4AGQA 5EORL 1LQBC 5CJOL 3QNXA 4JFFE 3ZVVA 4F5CE 4MXVE 1RZ7H 3A23A 2DLHA 4LKXB 5DWUL 4F7CA 3TP4A 1YEDB 4L4VE 2PR4L 1A1MA 1UA6H 3SJVA 4X7SL 3ULSA 4YH6A 2OTUB 4G8GE 1UTDA 3S34H 5BXFA 2D0HA 3LS4H 3PFUA 5GGSY 1AQHA 4HPHA 1DSFL 2VLKE 2QQQA 4XVSH 5LBSL 3VFNA 4X7EC 3V5HB 1GS8A 3KYNA 3V4VA 4NQCA 5GZND 3RWGA 4XP9L 1HSBA 5T3XH 1A5FH 4Z3HA 2J3SA 2M2DA 4L5FH 5DFAA 5EF0A 4WWID 4ETYA 4Y5YB 4EDXA 5I6KA 4BE5A 1QHOA 3NQKA 1BF2A 3O3AB 5E0QA 2ITFA 3TASA 2PO6D 1XGUB 2EDOA 1A64A 3APDA 1BEXA 4UAHA 2HKFH 5KSUA 4JG0H 4ZAKC 3QJZA 2A6JA 5GZOD 2V2XB 3VD2A 1OZTG 1IIIA 2AGJH 3IMVA 2DBLL 4X6FB 3RBGA 1IFGA 2DM7A 2CALA 2IOOA 3BVUA 4G1MA 5IB1B 3HOGA 5JQ6L 3TVMD 4I9WE 2L3BA 3L4WA 3MRBA 3PWVB 4FXTA 4N0FB 3DLQR 5CO1A 5CD3A 1MHHA 3H2QA 1CE6A 3DGCR 2YUZA 1JWUB 5ISZE 3KGRA 1NAML 5IT2H 5C09E 1JZ3A 5IBTH 2BC4A 4UT9L 3LRGA 4DPBX 1BZ7B 4HAFA 5IJDC 2VE6B 3LH2L 3CVHL 5AOJA 3WXWH 2FLMA 2VLRE 5SWSE 3MUY1 5JXEC 2X4SB 1HZHL 3NYKA 4RETB 3V5DB 3BFWA 4GJTB 3OR6B 5SX5H 5C6PB 3QWOA 1KG0A 4Z0BH 3MV8D 3DUUA 3NJKA 4JRLA 5KVDL 2VDNH 4CBPA 3QXUA 3ZN6A 5I71B 3PJNA 4NUGH 2YEZA 5CR8A 4U2YA 4I4WA 5K9JL 5F44A 3EFFA 3WFDH 3IDGA 2ZE0A 2Q87A 3H9YA 3CBJB 5I1EL 2H41A 2BX5A 1BZ9B 3IMUA 4LMQE 2E9IA 2XI9A 1A4KA 1FGNL 2WSDA 5J5EA 1N12A 4AT6B 4L8CA 1AH1A 1VIWA 4HIJB 1AKJA 3TFKD 4EIZC 1HYRC 4X8GA 5HJGA 3KEHA 4PSPA 4H2AA 2A1WL 4LOEA 1L7IH 2R0ZL 4Y2DA 3P9LA 3GGWB 3G5ZB 4G3YH 3WNOA 3W38A 2BNRB 1INEL 3GBNH 5ECJE 1F3JA 2KUTA 5B1BB 5L7XH 3SYOA 2K0RA 4FFWD 4XOBA 5AYUL 1KWGA 2QHRH 5GSVB 3WJLC 1JUFB 1EGJH 1R5IA 3ECQA 2IPKA 2JJSC 2CJTA 4GRLA 4PTUB 4ZMOA 4G9FD 5K93A 5K39A 1A1OA 3LPWA 1ADWA 2FBJH 3KNBA 5JHLH 1R6VA 5HGAB 1QQDB 3UOAB 4RISL 4HJTA 4XCEA 3KWWB 1G1YA 5C0DA 2LVEA 3EYUL 4RSYA 4ZW7A 3P0YL 4DKDC 5KYYA 3KXFD 2ICWB 2BSBA 4RH4A 4X6DE 4RFEA 4ZG1A 4UB0H 5C0FB 1ZGLP 3OB8A 3HNSH 2KKQA 1DEEB 4N87A 3W0WB 5I0VA 5ALBH 3JWDH 4DCQA 4JDZB 5EA0H 4BK5A 3MRIA 2FSEB 5JUEL 3FCSB 4WK0B 2OP4H 1QFWH 1S5HB 5EU6B 4OM1H 1EFXB 2FL5B 3RY6A 4NNPH 1RUML 4MJ5B 4HIQA 4R7XA 4H8VA 1FFOA 2R9HD 3VGAC 1BHGA 3E6HB 3QR1A 1OQXA 1UWXH 3BW9A 4CSSA 3L4VA 1NBYB 3C5ZD 3D34A 3FHQA 1WZKA 4RFNC 2HTKC 5F7FA 2VMFA 1YNTF 3NOIA 4JKMA 3BZDA 4CADA 4IOIA 4X99A 1VPOL 4IOSA 4XXWC 1E3FA 3TL5A 2DMCA 4KXAA 3ECVA 1EJOL 5DYOB 4ZOAA 5BRZB 1D9KC 2R4RL 3LKSA 4XB3A 1ZA3B 1S7VB 1MFBL 4MJ6B 2XFXB 2EVIA 2I60L 3RTQA 5FYJD 2ITDA 4W4NA 5B3SB 5HI5C 1O6SB 1XAUA 5T5NF 3RWEA 1AR1C 2QPEB 4HEPA 3U0WL 3KL0A 5E6YA 5IW6A 5DD3L 2J8UF 4QRRE 1NTDA 3ALPA 1XTMA 5D1XC 4I8DA 4W9JC 1UJ3A 1QG3A 2EDMA 2F6AA 2UZYA 1A1MB 1SVBA 1FNEA 3SJVB 3ULSB 3VD4A 2IH3A 4KK9D 3EYFA 4NHCH 2IANB 3NIGE 4Z3TA 5F1SA 4XXCA 2G9HA 3SDCD 3V4VB 2JK5A 5KJRH 3RWGB 4Q89A 1HSBB 2XETA 2WBJA 2EUZA 4R4FL 1CGTA 1MCWM 4FTVD 1OF2B 3FU9A 4XOAA 4NUMA 4EDXB 5C0EB 5HPOA 2YAEA 1PW3A 2B5IB 1ZLWK 3AG4B 1PDKB 3FXIC 4XVTL 1GGCH 5D7LE 1DUYB 3MRPA 1GSKA 1FFRA 3OF6D 2XDHA 2A6JB 4NZUH 4CVZA 4NM8H 3REVA 3V6OC 1AO7A 4FHJA 2R59A 4FGMA 1RD6A 2WKGA 4RZCB 4LOUD 4KZEL 1C08A 4M6MH 4Y4FA 1T66D 3ETBF 4YBHA 1IT9L 1JYVA 4K2UL 3TZVC 1KYAA 1MCIA 4NN6B 1YUHB 4FFTA 3PP3H 3B2XA 2ERJB 1FYTE 4XP1H 2B4CH 5BPPA 1UXWA 4LE8A 4A1RA 4E9LA 3S8GB 3WNLA 1JD7A 1I1YA 1ZHKA 2I07A 3BPLC 1CE6B 4QWWC 3TONA 2XTLA 2XRAL 1T7WA 2A4EA 4WLCA 2D3VA 1ACCA 5E4IA 2EIKB 1OSPH 1R3KA 1V27A 4U1NB 3ELAT 3K74B 3ZOAA 4MNHB 4MAYC 3BD3A 1CCZA 4PBVC 2M8XA 4GEIA 4GINA 2IOIA 2A74C 3D87B 4QRPE 3CCHA 2X70A 2A77H 3IFLH 1PG7W 2WCGA 4P9HH 5KSVA 1XCXA 4H4NA 2C5DC 2PLTA 5F7AA 5B4MC 2PWDA 4XO9A 5AAWA 3TESA 4WW2C 4E36A 4L4TA 1IMHC 4N68A 1LO0L 3SYQA 4QTFA 3DX6B 2BSSB 1U8QA 2HUHA 1KG0B 2QZ5A 2X38A 5LXGL 1VZHA 4FHKA 4CGUB 2GSGA 2YSTA 3FB8B 3N9GH 4AYGA 1KBKA 3QG7H 4GG6F 4I4WB 1MPAH 2WUCH 3ZLQC 1I9JH 3IDGB 4BFKA 2FWSA 3UO1H 2BSCA 3P77B 5FYLH 2KH2B 4RX4D 1ZEAH 1QLEB 3ESNA 5EU3A 3WTTA 3MUUA 1SYSB 4L2LA 5ESQB 3T2PA 3LRSA 1YEJH 2HRGA 3B83A 2K3TA 3CN0A 1P9MC 2CQVA 4APQC 4F2MA 1GYUA 4NXSA 3FH5A 3V6FB 5HXMA 2MH4A 3PABA 3ALWA 5E2UH 1GIGL 2IF7A 2BNRD 4HUCA 1OM3L 2GJZA 4F57H 2IV8A 3WUWA 4Y2DB 2ADGA 5J6SA 1A14L 1V7ML 4PP1D 3QRGL 3VB9A 3RJOA 1CYWA 1JN6B 2F7OA 5CLZA 4FP8L 4OAWA 4NKDB 1M56B 3VE0B 2ZUQC 2WBKA 2AQ3A 2AC0A 1T2QL 2F1EA 3F83A 1U92A 5IOKA 3ZE0E 1QI3A 3VQ2C 4AI7A 2A9CA 5DZNA 3MLVL 1S9YA 5DEGA 5FCUL 4HIHA 4TQEL 4Y4KD 3N6YA 5IMKA 4GO6B 4Z8FL 1GS7A 4K9EL 1TDQA 4YHNA 4CDHA 1H5BB 4U6HB 5FHAH 4XCEB 4G2AA 2VL5A 4PV9A 3EYOA 4PJDA 3CHOA 1S9VA 5ICYA 6PCYA 5KYYB 1N3NB 3QYMA 3X3GH 3GMLA 4HJ0D 4OB5L 3W0WD 2Z35B 3H1ZA 3IDIA 3QXAB 4WZ9A 3BP4A 1HCYA 5EU6D 1E8ZA 2KLSA 1KLUA 1HU8A 3VRLF 1BVKA 2OR8A 1QNZL 4YFLF 4PJDF 4HHAB 4EBQL 1BGXL 4OZFA 5FGCB 3EG9A 4GT7A 3UCQA 2VISB 3PDDA 1D5MA 4X9BA 4YBLC 4G7VH 3BVXA 3SQOH 2YN3A 1UB6A 1YNTB 4N2HA 4R4ND 4RFOH 5TE6L 1HOEA 4F91B 3BE1H 2MHAA 2IDQA 3MGOB 4P2AA 5FM5M 1TZAA 3O3EB 4V1DA 4IEFB 3GKZA 4JDTH 3SCMB 2XN0A 5D7EA 3GSRB 4IBTA 2GKIA 3RGVC 2BOCA 1ZT1B 5DLLA 5BRZD 3U46B 1BIIB 1ORQA 1RSYA 3QCVH 2NNRA 2AJXH 2XWRA 4XHJC 4E68A 1A2YB 4A7GA 3CG8A 4ZTPH 4N9GB 2A6KB 1N64L 2CUMA 4U6XA 4PR5A 2ADJA 4PJAA 1M6OB 2Y06H 3NJNA 4PJIA 2J8UB 3D1MC 3IFNH 3WL9A 2GI0A 1WG3A 3GBDA 3WYRA 4WI9A 3DKHA 2ITDB 5B7MA 2X53A 5I0ZA 1EEUA 4ELKA 5IVOA 3ZDZF 4A7GF 1J5DA 2JCCA 1YSOA 4PJAF 3VDCA 5IW6B 3SJVD 3ULUF 4NBXB 4PJIF 1NQBA 1UJTA 3CQQA 2IAND 4ANVA 2HZHA 2PYFB 3NJLA 5EO9B 1V10A 3IJHA 2JI3A 1FNEB 5I26A 2IH3B 2XV2A 3EYFB 3TX4A 4NQCD 3CX2A 1HAUA 2ZWKA 3KBFA 2VUKA 3SOBL 3ZMRA 2UZPA 3IBEA 1T3FA 3C6EA 2X2JA 4D0BA 4E9RA 5I2IB 3D69A 5BS0E 1R75A 1EDYA 3WGVB 4DN4H 2DL2A 4MXQD 4ERSH 4JZOA 1IAMA 4NSKA 3L6FB 1DL7L 3AB0C 5D1QE 4POZD 4E9SA 5I28A 4H1LA 4TVPL 2NUTB 1TTBA 3US1A 3ILQD 4MFHA 1Q0YH 4AOFA 1PY9A 4JZJC 7CGTA 1NUDA 2GJ6E 43CAA 1UZGA 2VSKB 4FNUA 1TSHA 3CVCA 4Y5VC 5DZ9A 4BFFA 3LN5B 5E00B 1OCOB 4YDZA 4AJYV 1CWVA 4P9HC 1UC6A 15C8H 2H8PB 2YPLE 1SVZA 3D4YA 4ZQTA 1PZUB 1H9VA 1P4UA 2EDNA 5F0PB 4E41E 1KBWA 2ICCA 5M7QA 4L8SC 2QQNH 4YL9A 4H8WH 2WP3O 3WXVL 4Q9RL 5FLUA 2WZPA 3POHA 4DGVL 4J3OF 3KPQA 1I1YB 1ZHKB 3QDJA 4K5NA 4H25B 5JPNA 2HVKA 5CEZE 2JKRM 2HLAA 4OQTL 3T4YB 1HL8A 3H42H 4FA6A 1KPRA 4MJJA 4Y4HB 4OD1H 3QUMB 5LGHL 3VQMA 2Q86A 1WC7B 1IBHA 5L8KB 4HUUB 4D8PA 3K6SB 4AVIA 4GQZA 5IM7B 4KOCA 3G5WA 4TNEA 2AEIT 1JTTA 5F6HI 3K72B 5K5YA 2C9SA 2Q6WA 1KEGL 4FZ8H 5DVMA 1NSNH 5GGTA 1KSRA 4FQXB 4NO0A 4GG6B 4PWJA 3W9DB 1ROCA 3W1ZA 3OJDA 3G6JA 5FUZH 4CL7A 5E8EA 4YK4B 4L4TB 1PG7L 4NHUB 3RFRA 2IPTH 1MVYA 1HESA 25C8L 2W65B 4ZFGL 3QIUB 1E2ZA 1KJ2A 4KC3B 5DMIL 2A3TA 1P84J 4GAJL 4KQ3H 3ZKNC 1DJYA 3TBSB 5C07E 1IKFH 2GHWB 3NZHH 3IAPA 2AV1A 2EDRA 3CC5A 4DGUA 4AMKL 1R46A 5KVFL 3WJJA 2VDPH 5IWLA 5IJKA 1JHLL 3LRSB 1AKJD 3GEFA 2WLLB 1G7QB 3WEXB 4F2MB 1EHNA 4QJ4B 5FW6A 3RWDA 4N2EA 4DK3A 3PABB 1H3VA 4Y2DD 5CFAA 4EZLA 4PJHA 1DDHA 4KNUA 3LPFA 5J7CC 5KS9E 3ATDA 1B2WL 4MRCA 3BGMA 3T71A 5GRJL 2J55A 2ADGB 2LVCA 1WO2A 3VW3H 2YSSB 4ZT1A 2CR3A 1W80A 4YSEA 4G7SB 4GRLD 4HD9A 1THCA 4LQFH 2ZOUA 3DBXA 4HIIA 4R7DB 3V0EA 4Z18A 4X80L 4OF6A 1CFNB 4R8WH 4ANKA 1U93A 1U92B 4NKOB 1F4HA 2FWLB 2IALA 5MEOB 2N0MA 3W2DL 5F1KC 5DF0A 3T08A 5IMKB 2GTWA 2CH8A 4GS7C 4YHNB 2HFEB 4YDKH 3EOAA 3PU7A 3SYAA 2NY2D 3EYOB 4PJDB 1QKZH 2KS0A 5IBLC 4JO4L 2YD8A 3LZOA 4JDVA 2WKOF 5DJZA 4ZX3A 3GMLB 4XP4H 1V3MA 3MRLA 3DGDA 4K5MA 5ELIA 2AV7A 1AQMA 1JGLH 4KU1A 3FB7A 4CN4A 5IB4B 1EEZB 1X7SA 3FB6B 5EU5B 1I1AA 3KWXA 4HWEH 4K3GA 4PI2A 1BQSA 4YSAA 1DLFL 4DH2A 1LMKA 2YRLA 4QHPA 5GS0C 3JV6A 4HHWA 2FT6A 1MIMH 1PZDA 2FX8L 1U3ZA 3V4PH 2XTJB 4JJOA 4R96A 4JQVA 3KVQA 2FUQA 2V7HA 4D9QE 4LCWA 3UYRL 3FQWA 1LP9A 3WNJA 1E27A 2EDTA 1ES0B 1SJHA 1QLRB 4NI3A 5E6IB 2BWIA 1KIRA 3ZTJH 2BRRH 1WBYA 3QRBA 5KYUB 4V1DB 4IOSD 1L0PA 4H88L 4KBPA 4QXTB 4HUVB 5KYXA 3RVWD 3VXPA 1XF1A 4IRJC 3N06B 2CCWA 3KE0A 3FONB 4Q6IC 1FA4A 4MQ7B 2PW1A 3ZDZB 3BGFC 5KVMC 5ABAA 3U1PA 2VDLL 3RTQD 1DO5A 4PMEA 4PR5B 3T77B 4PJAB 1IAIH 4G82A 4PJIB 5DMYA 3V55A 2AJSL 2HJKA 2F19L 2JB6A 4KUCF 3VNZA 4X6EB 4POUB 3MJ9H 2Y0SA 4JFPA 4KXCA 4ELKB 2XQBL 3BO8A 4FFVD 4W9FC 1ZWIB 2NOYA 3F00A 2F15A 5HJ3A 4KI5E 3VWJB 2YIHA 3UZEC 3O11A 4P2RA 5C0NC 4XZUB 1XGPA 2WYIA 4WO4C 4XB8A 2WLZA 1XH1A 5LNGA 1A6PA 2K8MA 2O5ZL 3IJHB 4XCFH 4LVNC 1IAKA 3I3EA 5LWYH 5AW4B 2VCOA 2HYMA 4ZOEA 2PCFB 4MVBD 3ULVE 3GMPB 2FCBA 1O0VA 2R2EA 1RVFH 2NX5A 5ERWB 3T9WA 3DK0A 5JNYA 3NCXA 4JZOB 3AG1B 2XJKA 5JA9A 2N59A 4H1LB 1A3QA 4H26B 3JXAA 1E50A 4BFOA 2DJUA 3W11D 1AO7D 1UWGH 5DRXB 3UG5A 43CAB 1FN4A 2Y2TA 3RGBA 4Y4FD 4XR8C 4YXLH 1E9QA 1EH9A 3QDMB 5FDYA 2C1OB 3RI5K 4KZDH 4K3JH 4QRSB 2JVUA 3AREA 5AG9A 1N19A 1RUPL 1E4KC 4NUQA 2AITA 1PBYA 1KBGH 3IDXL 5EPMA 3UP1A 1U8LB 4TUKH 3Q2VA 3WSQH 5EF2A 3C9NA 1A9VA 2VN5A 3N40F 4GOSA 4U0RC 1WZMA 3MNZB 5LKNA 1EVTC 1N6UA 4Y4HD 3QDJB 5JPNB 2HVKB 3SGEI 3L5IA 1A1NB 1FAKT 4JB9H 3ASNB 2VR3A 3EO0B 5D7HA 2FYVA 3HFMH 3NCBB 4YLBA 4L9DA 3F58L 4IS6A 4RAUA 3F2LA 1SJEB 4D8PB 1WZLA 4FA7B 4KKRA 1RZJH 2ZPKL 3C5JA 2P48B 4XBMA 2CA4A 2DQGH 3UTPE 4ZFOA 4ZRGA 4M6NL 1T22B 4L4TD 1MWAL 1VGKB 4PEEA 4K94H 1S4IA 4Y19E 5I66A 3QYNA 1XGQB 2FBRA 3FN0H 2EYRA 4H20H 5KOMC 1NEUA 3G6JB 3OJDB 5C92A 4FCAA 5K59F 4NKIH 5DWPA 4HC1L 5AW3B 2OL3L 4MTMA 1NLBH 4TULH 1KJ2B 1PY0A 4JKPL 4RAVB 3UEZA 5E08H 4B9ZA 2VLJA 2WTOA 3N04A 2PNDA 1BLIA 3C60C 3X11B 2WZ0A 1NCUA 4EQ3A 3U9PL 4K0OA 2XZQL 4KHXL 4CNIB 3TBVB 3VXNB 4M7LL 5FW8A 5ACZB 1AAJA 4B96A 1MCSA 3D52A 1WT5C 5AB1A 1MCQA 3PHAA 3IDYC 3EOBB 1JF6A 3BC9A 1KPUA 3GK8H 3AXLA 1QLFA 2AVGA 2GIYA 4LGSB 5C9JA 1HQ4B 3NA4A 1IBDA 4B27A 2BRQA 2OXGA 4BD4A 3UAJC 1FAIH 3B9VA 1YEHL 3BGMB 3CQFA 4XOCA 2YWZA 3FB5A 3GMNA 3UYOD 1FNSL 5F9JA 2YS4A 2DWDB 3H54A 3LKNB 4U2ZA 4FNSA 5DVNA 3MBEB 3OSKA 2CO6B 3QZOA 1CTOA 1PCXA 3EOTL 1NDGB 3VYPA 3PWJB 2XOTA 2P8PB 2NLJA 4I88A 3D0LA 4PS8A 4U1MB 1EIBA 2GTWB 3PWPA 1EGJA 3EBHA 5B3NA 1BQHA 3A24A 2ZKMX 3VXTB 3DSNB 3VJ6A 1AY1L 4RA0C 4A7TA 3H9ZA 4XMXA 1IBYA 2RALA 4PJ7E 3FTGB 4WKZA 5BUGA 3E8UH 2ZJSL 2D03H 3MRLB 3QO0B 4JUTA 4KFZC 5DQDL 5FM4A 4GQ9L 2MNUA 4WI5A 4WNQB 2AEPL 3COOA 3SBQA 3DYOA 3L4UA 2VW7A 2BZ7A 2G0KA 4DZ8A 1ZLUK 3BKMH 3GSNH 3HR5B 4P06A 1K6QH 4FYQA 2UXTA 5TF1L 2APFA 2EEXA 4DESA 4I18A 1WBZA 3IU4H 2V7HB 3O81A 3P4OB 4WY7H 4RNRB 4V1DD 5C0JA 3E3QE 3H55A 1E6JH 2O5YL 4KJWD 4A55A 1RZFL 3PXHA 4I2XE 3LB6C 1XT5A 1AD9A 4GMSH 2LR4A 3CQPA 3TN0C 3IN2A 5DRNB 2EIZB 4YHYB 4OUOA 5B1JA 1VFOA 5B38A 4HX1A 2XX0A 1Y1DA 5I23A 3WTSA 1QO3A 4Q74A 2WIMA 4KJYA 2OMWA 4X4ZA 4HWBH 1DBJL 3CFBB 3VXPB 1NGYA 1ZV2A 1UYWL 4OZ4A 5IVXE 2D3LA 3V9CA 2ORBH 3LN4A 5H35B 1SN5A 1KTDA 4DTGL 4KQ4H 5DK3A 3SSGA 1OW0C 3VFUA 2J6WA 3PNWA 4QY8B 2BHFA 5HHMD 1SEQL 4N25A 1HHJB 3ZYOA 3HZKB 5DK0A 1JHTB 3S35L 3VWJD 5C0BB 3PGCA 1HILA 2BS9A 3NMEA 1Q72H 3CZGA 1NGZB 2XTJE 5AZEH 3CUPA 4IBSA 4X7CC 2HXAA 4GW4A 2W92A 3BUIA 2BERA 3RLSA 4EN3A 2YOCA 2WQXA 4Y16A 4P2RB 3ZKSD 3VXRE 2EILB 3DSFH 1E67A 3HCVB 2EIEA 4UT7L 2V9TA 3J8F7 2VRAA 4U6VH 4Z95H 4F2FA 3WKYA 3O6FC 4M03A 4YBQC 2XZCH 4AGOA 5BOZG 4ZMYA 5MENB 3X12A 4ZW5A 1MCNA 3WNIA 1L6XA 3M8OH 3RKDD 1HS6A 4YQXH 5TDNA 3RZWA 1B3IA 5JNYB 2YAHA 5HDLA 3MKKA 2ZKHL 4FQJH 1I4FA 2R51A 1T1XB 2WD0A 5I8OH 3ULUE 5ALCL 4MB3A 4X6CF 5EO0B 4LHUA 3QDMD 5BQDA 2YKKA 5KAQG 2E7CA 1OT4A 1TQVA 3Q8FA 4XNBA 3MLUL 2APXA 1L9PA 1NC2A 1H3GA 1O5PA 1I31A 4G71B 4NXKA 5J06A 2LU4A 3IMBA 1JPTL 1GCFA 4O2EA 4JM4H 2QR0A 3RVUD 5D7JC 1TVDA 1PZCA 3AREB 4J4PC 5EEZA 1K85A 1NCCL 1OZUA 2WZPD 4KMTL 5T3ZH 3EHBB 4L8DA 4QTIH 3G04A 3AMKA 3QDJD 3R7QA 4J2XA 3ARBA 1IEAA 2CKNA 3E7JA 3MOQA 4X7TB 2VN4A 4BSVA 4FXGB 5DS1A 1F4WL 3SYPA 2J1ZA 3OJMB 4MMXC 2YAFA 1FBIL 3EZJB 4HP5A 3SGKC 3VD7A 5C7XH 3FU5A 2AQ1A 1WHOA 5EWIL 2XXGA 1W72A 4OZHA 2IXQB 4R5XA 2DZEA 1MJ7H 3S3DB 3GRGA 4WWKC 3G5VA 3QK0A 3GXPA 4PREA 1QPPA 3V52H 4HUXA 4NO0D 4FXKB 4TTDD 3UXFA 4JJHA 2NMSA 3B56A 1V8HA 1MFDH 3B9KA 2DYSB 1MN4A 2G30A 3T4AC 1C12A 5I66B 3ZDXE 3EJRA 5DURB 2O61B 4MMZB 3DWTA 1ZHLA 4M6AA 1O7SA 2FZ3A 3VD1A 4UMSA 1AP2B 5D4QA 1YCSA 3U7WL 2Q9OA 4AM0A 2VH5H 1MFCH 5MP6L 3MV01 4OZGA 3PREA 3PHSA 1N4XL 4EZMA 4U49A 5EOTA 4A04A 2NTSP 1SDDB 3V0JA 5T1KB 2VW4A 4JQXC 2AKRA 4PB0L 1BVNT 5DUPL 1XCQB 3P4NB 1TQWA 4OJCA 4MCYB 5ADOL 1E7UA 4OZGF 4U1JA 3AXLB 4XRCA 3MSPA 1QLFB 4IKJA 4UINH 3D07A 5E9NA 2GCYB 3GRWH 3DRTA 4O02A 4R26H 3JUYA 3BOVA 3KLHD 4XPGH 2Q76A 3MBED 5TE4L 1FE8L 4EO5A 1YUKB 2F8XC 1IFHL 2VRKA 1G6RA 1YMHB 5EUOE 5JIMA 4NJAH 3LH9A 2WMPA 3D25A 5L9DH 3BZFB 3TO2A 5E1QA 2XV0A 1XXFC 1OGTB 4LLWA 5MHSD 1HWHB 1DQDH 1OCWL 1U8OA 2NDGA 4ODHL 5LQBH 3W37A 4JFDE 4XAKD 3WEMA 2JSFA 2NLJB 2UWEE 5IROD 4G43A 5DHVH 2VDML 4P8QA 2R7EA 2ENSA 3EYQC 2VM4A 1KCSL 4IDJH 2VDQL 4N86A 4WTZA 3L5WB 4AL8H 4F3FB 2IV9A 1J86A 3QUXC 4WKZB 1WCBB 2WXKA 1GJWA 2YD7A 5F96H 3WLBA 3C09B 4LGPB 4FG0A 1FL3A 1CD0A 1R3LA 3GUFA 3KWVA 2WM0A 3FCTB 5LGKA 1FPTH 2YAPA 5FB8B 3JVGA 3KLAB 1JFQH 1MCKA 1JZ5A 1MFEL 1FVEA 3BWSA 2YLKA 1FVDB 3CN2A 5H37H 2XZAL 4YZFF 4I18B 3TC9A 1LO2L 2VITB 4HHGA 3H3PL 4XN4A 1XR8A 5AVWB 4KRNA 4XZ4A 3P2TA 1MFAH 4KUCD 4ZUSB 3TJEH 5DRWB 4NERA 5KBLA 1Q94A 3K2UL 4P57A 1SY6A 3CXFA 5J11C 2E9WA 4FX5A 3WO3B 1A7NL 5KEZA 4G6KH 1G9ML 3A6CL 1FHNA 2VMDA 2NYYC 5T33H 4XMKL 4R6UA 4FQLH 4QHMA 4F8TA 2PXYA 2O6DA 2X4QA 3HHRB 5D70H 3VFUB 5C0BD 1KXVC 2V8MA 5E6UB 2HT2D 2Y07H 3ZK0A 5IVNA 2XWTB 2P5WE 2WAQA 4UM8A 2KQNA 3HA0A 3OPZL 1A6AA 2AJYL 4WFHE 3SEPA 1Q8MA 3PGCB 4NAJA 1CU4L 4P2RD 5IFHL 1D5IH 4TNVK 3L08A 3N55A 1FL5A 4BKLB 2QGEA 3LDBB 4EN3B 2YR3A 4JPKH 2OCCB 3VFRA 4L37B 3V5KB 3G08A 4W4OA 3SIKA 3IFPB 4UQDA 1M6UA 2BY2A 3VO0A 4MNGE 1CFQA 1WFUA 3K8LA 4Q9BA 4RDQF 5C08A 4X6CB 1YPZA 3QORB 3GZPA 3DOHA 3TBYB 3WFBL 3ISWA 1TYRA 1T0MB 2HT3C 5C70A 2W1NA 1MI5A 5D7IF 4P46A 2NY5L 3NH7H 1M71B 1I85A 1IAOB 5ID0B 4GQRA 4JKWA 3BFOA 1OAQL 4GG8B 4AYMC 2FEDD 3ZDYE 1FLRH 1SYVB 3DRQA 3GJFA 1EMTL 1VFBA 2KERA 3ZBMA 3S37L 2AEOA 2BFVL 3LRLA 1LTXA 2BNQE 3KPSE 2BJML 3ARED 5FOJA 4J6RL 1AXSA 1YYML 3K6OA 1XR9A 2LGNA 3PP4H 4OIIL 3EHBD 1U8PA 1X7TA 2WUBH 2ZYHA 4B9JA 5TE7H 1P69B 1X9LA 3DA0A 1TKWA 1SM3H 3FK3A 3NFSL 1DBAH 4OFDA 1Z0NA 2GT9A 5DO2D 4FFYH 2JKWA 3FQYA 3MYJB 4CJ1A 1IEAB 3UC0H 4QXWA 2DS4A 5KSAA 3QQ3B 3LIZH 2R0WH 4UTBH 2XKNB 5ID1A 4HOXA 5HYSA 5MENE 4HCGA 4B9PA 3OKNA 1AGDB 3KBEA 3B2VH 3Q06A 1NCTA 4UM9B 1YJDC 5DFVC 5EZLA 4KVPA 3VFOA 4BA0A 3ECUA 1KT2B 1W72B 1TSRA 3ARGB 1WTGT 1R3IH 2YC1A 1HL4A 1N10A 5I6OA 3G5VB 4NDMB 4HIPA 5I75B 4XMWA 4OT1L 4K8RC 4JGJA 5ANMB 2DKUA 5DURD 1U8NB 5E9AA 2CGYA 2WYZA 3B9KB 4XVUD 2R2HA 4OLVH 2XWXA 3MODH 3BP7B 5E5LA 1PZBA 5CEZH 9CGTA 2L7JA 1BCIA 4I3RL 1E43A 3FULA 4M4PA 3F7PC 2EP6A 4CMMB 1UM4L 1IGCL 3UJIL 1MCFA 1EHXA 3FN3A 4AM0B 1WGOA 1RMFH 1UKSA 3QT2A 4C47A 2Q3AA 3QEHA 4UU9B 4XE5B 3ZIMA 2A6DA 4XWGL 4OZGB 1OO2A 4I48B 1INQA 3V6ZA 1HKFA 1W0WB 2AEQL 2FGWH 2R23B 2XVLA 5T1KD 5BMFH 4KOBA 4KTDH 4N8PA 2SEBA 5I18L 1AZZC 3CFTA 2Y5TA 2OS7A 1UOVA 3JWOH 1RK7A 1YY8B 4DZBB 2AKRB 4OZIE 1SOKA 4PV8B 5TH2A 5JLZA 2Z7WA 1AS6A 3BAYA 5AYQA 5J89A 4OIBA 4P4KC 2MSPA 5I71C 4NPYA 4XBPB 3QIBB 4O02B 4H44C 5LXVA 2DQ6A 32C2A 3UPRB 2HVJB 1KXQE 2VIRB 2GC7C 2WV3A 5F7EL 4JBSA 4YIQB 4ATTA 2DYPB 5T5FH 5FIEA 4AQ1A 2BSRA 1K5NB 1U3YA 3F64A 5HDQL 3QJUB 1KTCA 1O6TA 4U3SA 1HL5A 1FRGH 3U2JA 4TRPH 3H9HA 2WO3B 2NR6D 4KK8C 3U25A 2ICEA 3ABGA 5A16B 1GZHC 4KZCA 1SUHA 4NQUA 4I0PC 4WHYG 2HJLA 5EOCH 4XNMA 1KCUH 5B8CC 1E4WL 2R7EB 1A7PL 1CPUA 2J20A 3NCJL 3WU1A 1EAPB 1S8DA 1B0IA 2D7MA 4A66A 3ARRA 3DVGA 4N1CA 4ZI8A 2GBAA 2GITB 4O9HH 4MJ2A 1R3LB 4A6YA 5IW1A 9PCYA 4N6QA 1UENA 5GGTL 3DJZA 2FJGA 4ZO6A 2XHNA 5DEFB 4PJ9A 4HISA 1E5CA 4OTXH 5L2JB 1EXUB 5H94A 1R3JA 5D5MF 3OLGA 4OJEH 2OMVA 3VWKA 1Z32X 5B3JF 3RIFK 3BSGA 4WV1A 1QVOB 3SPIA 1X5AA 5E8OA 4L3CB 5C2BH 2K45A 2QPUA 2FK9A 1UEMA 2ZAIA 4F7TA 5I1DB 2ZF9A 4P57B 5BZDA 5JR1L 5K9KA 1TZGL 3JZ7A 4QOKA 4LP4A 1MCCA 2EVHA 3BSZL 2J4WL 4U1KB 4ODSL 1HINL 4XPTL 2K9FB 1THAA 4OVUA 1INDL 2EIMB 2EO1A 2X6AA 2YGQA 4OV5B 4OCWH 4EIUA 2QVIA 4JO3L 3T2QA 1WS7A 2VDLB 3APMA 4B9KC 2ZUWA 1I1RA 4UM8B 1MVUB 1E6OL 1KJMB 1SBSL 4IRSA 4EN3D 4IBUA 5CP7B 4QRBA 1KTRL 1Y18B 1R24A 2EINB 2XVKA 1BQKA 5DMGC 4H0GA 4J8RA 4RMBA 4GW5B 4MLSA 4EIBA 4N5UA 1IGYA 5ICXB 2HH0L 5F3FA 3VFRB 4U7KA 3MJ9A 3QORD 3G08B 4NZRH 5D7IB 1UOWA 5E8NA 5HI3C 1MRCH 5D1QC 1FFQA 4PWEA 1MW3A 1WE5A 4GSQA 4Z7QE 1IBZA 3NSXA 1CFQB 4LDCA 3BKYH 4ELME 2FT7A 7PCYA 4I0CC 4ORGB 1BQ5A 4JY4B 2ZYRA 3GLZA 4AENA 1M7XA 3AC0A 2JE8A 4HWNA 1P5VB 1MI5B 4GKSA 4JRFA 4M9OA 3GNMH 1IGIH 4P46B 3WE6B 4C56E 1BAFH 3INUL 2ZOKA 4JFHD 1NBQA 2D8KA 1F86A 2CJ3A 1U95B 4OKVA 2VQ1A 4Y2LA 3ZDWA 4BXSV 3BPNC 4PRNA 1K4DA 4JN2A 3P4MB 4FQPA 4ODXB 3Q3GA 4OGYL 4JLRB 1TJIL 1XGTB 1QEXA 3CSGA 5HHOA 4UTAH 2E3VA 3H9SE 1XD0A 1XO8A 1KCBA 3ZTJG 3GMRB 4O2FB 4NRYA 5EEUA 4UOW1 2L7QA 4BFGA 3GLEA 1DBBL 5E99H 4BDVB 1QEWA 2GT9B 4H5SB 4KJQD 5FWQA 4DNLA 3ZMEA 4DW2H 1WA0X 3ZW3A 4LSSH 4X6CE 3ATAA 3K80A 4UM9D 1TJXA 5PCYA 5I1GL 5ID1B 3CDGA 2C8NA 3PQYE 4KTYA 3ZPDA 1BYOA 4G80A 3OKNB 3FO2A 2CRMA 2EC9U 2ROXA 1CGVA 2IC2A 1Z9MA 3DK2A 3H8NA 4NKMA 4ZPTB 2A83B 4JFYB 3BRFA 3ZL4L 2VO8A 2FATH 5FA4B 3BN3B 3O8XB 5MERB 1OTSC 4TVPE 1TQUA 3B9KD 1OTUC 1TJHL 4NN6C 5IMMB 4LCIH 2IWEA 4U3HA 1HE8A 1RFDH 1XHHA 4K7PH 4AG4L 2YFOA 1I3VA 3V0FA 1MWAB 2MQGA 4LSTH 3VXSA 5FO8B 1S6NA 1AFVL 5FGBA 4FQ1H 3S88L 4DGIH 1RUQH 1E4JA 4PJ5B 4BSWA 1HHKB 1L6ZA 2X0WA 2OL3B 1X9RA 3T1FA 5F7DA 3DI3B 5BZWA 5HHVL 3D39E 2BZCA 6PAZA 3DV6A 3C6LC 3V6ZB 2D9QB 3UYPA 4JDEA 2I7SA 3UDWC 1RZ7L 4J3VA 2SEBB 2F1BA 3CX5K 1JPFA 1NMCB 3HZYB 2Z6FA 3HLAA 1UA6L 3GI8H 3PV6A 1ETJA 4WK2B 3MNVA 4MQTB 4G6AD 3GPEA 3OKEA 4HJJH 3S34L 4AE0A 3IRPX 4F20A 4IOFD 3QIBD 2BP0A 4XVSL 1RJYA 3P11H 3LEVH 3O3DA 4FNLH 1TNNA 4DN3H 5T3XL 3QAZC 1A5FL 2XWZA 1QSEB 4Z7VF 2G75A 1HXKA 3B43A 3BZEA 3ZKMD 2PETA 3ZE2F 2QJDA 1GKEA 2E7HA 4NENB 4MA8L 2C34A 1MLCB 2HKFL 2DQTL 4JG0L 1D6VH 1HJCA 4JZNA 2N56A 2XXCB 4W9ZA 5F1OB 1TJGH 3VFMA 1I8MA 3G6AB 4TSCH 4AE1A 43C9B 2NY4C 4OD2B 3MQIA 1KC5L 4NGHH 4OLUL 1Q9WA 2AJUH 1NUNB 2AGJL 2YKLL 1IFRA 1P2CA 1R19A 3CFCH 1YQ2A 1HFUA 5KVFE 2J88H 1ZT4A 5FFLA 4ODTH 1N59A 3T0VA 1JDDA 1XH2A 1JZEA 2OX5A 3TPUB 3H85A 3GSVB 3L3DB 1TMCB 5TDPB 4ZUTB 4ETQB 5I9QB 4XNAA 1A9BB 1IQDA 2QSTA 3TT1H 1NGQH 2W07B 4LPTA 1HK6A 2PWEA 5D5MB 3GSUA 5IBTL 2ZICA 5INDA 4X4YA 4ZFOL 3E9TA 3L3IB 4EVNB 1UM6H 1AZUA 4LVEA 3DUSA 1QYGH 1U58B 4HJUA 3FQNA 4BUHA 3VG0H 3PAUA 1USZA 2ENPA 5GS3A 2Z8WC 2O6PA 4P4RA 2NYZA 4X9HA 3SPVA 4EI0A 2QVTA 3VWKB 3LZPA 1J1XH 2OMZA 4JCLA 1UD2A 4JKKA 4LPXA 4OGAD 4BH8A 5JOFB 3NVQA 1BD2E 3BKJL 2OQJA 5E8OB 4CVXA 1TITA 1DUZB 4QTHA 3L7FA 3TNMB 5BZDB 1L9QA 5K9KB 2A9BA 4QOKB 5EHFA 3VXMA 2E56A 2VDNL 2VDRH 3F3HA 4NUGL 5F93C 2W60A 5IIEB 2ZWZA 3WFDL 5B7EA 4GUCA 3PCYA 3SY6A 1TETH 4M3HA 2G60L 1N67A 1VZGA 4KI5C 5HGDB 3X13A 4Z7UE 3RUGA 2GTQA 4GLRI 1BXAA 2W9LA 1HI6A 2EEAA 1A4JA 1DBMH 2ZXEB 3UTTE 3BAXA 3MRJA 1AI1H 4DP6X 3SCMC 3I6GB 4PY7B 5I74B 4NB7A 3ULVC 1O6VA 1O75A 1LYQA 1L7IL 3BQUC 1GGBH 5C08D 2DPKA 4PLKC 1CXEA 5AOZA 5MEQA 5JO5A 4JQIH 2B1HH 4G3YL 5DFWH 3KYAA 5D6DC 4OGQC 3TBTA 2HLEB 1A25A 3MLPA 3GBNL 4I1PA 3ZHLA 3NIDE 4PG2A 1MI5D 4WWPA 2PCPB 3BMWA 4P46D 5H2BA 5IHUL 4TUOA 2QHRL 3MAWA 1EGJL 3FRUA 1G4MA 2XY1A 2A4ZA 4Q4EA 4WIQA 5FUOL 2MTAA 4ZK8A 4J5VA 1J8KA 1HKLL 2NZ9C 5EN3A 4N5EC 1RK1A 3KLSA 3SPCA 3VFTA 5J57B 4UCFA 4K55A 3IPBA 4OKVB 2K1MA 1MZZA 2VQ1B 2HTLC 2FBOJ 1ORSB 4JN2B 1PLBA 3FFDB 3P3YA 3PFQA 5IR1B 3AXHA 1PLGH 1Z9OA 1QTPA 2CJUH 4PJFF 1IM9B 3PUCA 5HHOB 3SBWA 1QA9A 3Q5TA 1H6EA 3BUPA 4OD3H 3L3JA 3OMZA 3HNSL 3GMMB 5HYJB 5KSAD 3WN5A 5D7IE 4J23A 3STLA 3J07A 2NT0A 5ALBL 3RVXC 3JWDL 5EA0L 2H3KA 2OP4L 3CGTA 2NXZB 4OM1L 2BVTA 2GBTA 4NNPL 5BNXD 3MV7B 4K71B 4PLJD 4RGMB 2Y7OA 3AW5A 1KYDA 5JW3H 1T1YA 5BV7C 4YPGB 4R4BA 2G5BB 1AQDB 4K3EH 3O8XD 3MRRB 4NKMB 5ADPL 3BN9C 1PSKH 3IS1X 5C0GB 3MA9H 5D7KD 1NBZA 2EE0A 5EORH 2FHFA 3WHE0 4XBGA 5CJOH 1HXYB 1LK3H 4PW3A 1HVXA 3ZHFA 3WJMA 4X7SH 4F92B 2QLYA 4PJ5D 4P3DA 2FJHA 1N68A 4UBDD 5LBSH 2V2TB 1FFPA 1I7TA 2K3HA 5EDSA 2VC2B 1K2DA 5D1ZI 3K6IA 2OFQA 2WOBA 5I15H 5FXCH 4PYGA 4UOQA 4PGBA 1U91B 3B5GA 2IJ0C 4CVWA 4GAGH 2X40A 2ZP9A 2ZAHA 3P1VA 2F53E 5IB3B 4OGZA 5D2LF 3EH5B 1ND0A 2BSEA 1AZVA 4PJCA 1P4BH 1AZNA 1G9NC 1MNUH 4FQXC 2VERN 4Z7VB 4ACPA 1MCRA 1L3NA 4HS8L 5EN2B 3VU2A 1ZRUA 3BESR 4DP8X 4ONHB 4NHCL 1KEML 1GC1C 3ZE2B 4HDIB 4GMTH 5B39G 3DXAB 1W0VB 2P5EB 3QIUC 4PJCF 3DIFA 4U3CA 1XF4A 4AMWA 4AYFA 4LPCA 3V0VB 1A7BA 3VXUB 5KJRL 5L2KB 3QNFA 5JQ6H 2E9BA 3AGVA 1ZOXA 4YAQB 1DVQA 4GB9A 3BZEB 1NPUA 3UTZB 1SHXA 1DR9A 2CAKA 4BFRA 4BHUA 5D2NB 1GGCL 4NO5A 5DJDB 1COBA 5IF0A 3K7UA 2EH8L 3OX8B 4HS6B 2IPUG 1L4IA 4HGWB 5GHWH 3FRPA 4GAYB 1T0NB 4NZUL 4JZNB 2HMID 1DQMH 3KS0J 4NM8L 1GS6X 4L0YA 4RQQA 1I8MB 1XCTA 5KYWB 4AIEA 4G1EA 5F8RC 1LO5B 4M6ML 3QRFM 5BJTA 5JMRA 2EVJA 3DX3A 1Q9WB 2Y23A 4A67A 3CVHH 1WFIA 1P2CB 4IMLB 4G6FD 4N90D 4U4IA 1AGBB 4G8IA 3G5XA 3SKJH 3OR7A 4F9LC 2K7QA 2QQLL 3WMSA 2NZIA 4DETA 4XP1L 5SX4H 2B4CL 1EO8H 2HX8A 3H2WA 1DBKH 1HZHH 3PPSA 1EZUA 3FQTA 1V05A 2GJJA 4HLJA 5F89B 3C2AH 5GS2D 5KVDH 3E3QC 1QSEE 5F6IB 1P0SE 3ASWA 2XQ0A 4MS6A 3GBLA 4X4MA 4YVNA 4HJGA 3ECBA 5K9JH 1J5HA 4AKQA 1BPLB 2CDEA 1NIBA 4KK6D 3VWKD 2J2ZA 3P73B 3BRDA 5F88A 2LFGA 3ROOA 3SPVB 4QGYA 1ID2A 3L2LA 3TBCA 3CHQA 3TBWB 2AK4A 1MH5B 3IFLL 4PJGF 4GW1B 4ZAKA 4M93B 1I9RH 2YD1A 5C0AA 3MCG1 4QOKD 3SO3B 2FO8A 1NEZG 5K9OB 1CR9L 3GSQA 3OKOB 3NBNA 3WIHH 2NQCA 4NNYA 5DEZA 3CHPA 1OHZA 2O30A 1PZ5A 1UD4A 5HDBF 1I7ZB 2I26N 2IGTA 3QG7L 2EUWA 2KMWA 1AGEA 3QQNA 2WUCL 1XSJA 2XTJC 3UO1L 4DO6A 2H47C 4JANA 3PLYA 3D3VB 2L4OA 2VXQA 3O6KL 5AYUH 2OMUA 1G7LA 5B3JE 1XSKA 2RQEA 4HCIA 4CC0A 4X5XB 3DMMB 5E6IC 3RUGB 1RU9H 4OF3A 4Z7WF 4YSTA 4YE4H 2JKJA 4FE9A 4HBCH 4PS7A 2YRPA 3Q44A 4MMYB 3LPOA 3P3RA 5DLMH 4JAMA 3FTVA 4U6YA 3O9WC 5E2UL 1Z5HA 2BIMA 4CKVX 3TO4A 2A99A 1G6RL 3CDZB 1J0ZA 5TQ0H 4F57L 4P23C 2B39A 2YPKB 1ONQB 3M7FB 2HT4C 3P0YH 4F15C 1WBXA 4IHBA 4M8RA 4F7EA 3FZUC 5JXEA 3TBTB 1YYCA 3K1DA 3HG4A 4N0CD 4I85A 1PLCA 1DVFA 4MYWB 3OKDA 3U4KA 3V8CA 1D7BA 1YMMB 1G7JA 4A2EA 2CBTA 1JK8B 4F37F 4N1HB 1L0YA 4PJFB 4ZXBC 4M1CD 5CLYA 3IVKB 4MXWH 1RK1B 4XMPL 1ZVYA 3VFTB 4FNRA 4UOZA 2JJVA 4QRFA 1FNAA 5HHOD 4PW4A 3PDOB 2B2XL 5H37G 2WOYA 1KLFA 3IMTA 5HYJD 4KV5F 3VACA 4OLZL 5IHZB 3X3GL 1U8IB 4A39A 5A43C 1ZLDA 3MJWA 1ET8A 4YSOA 5DMJB 1CL7H 1FGVH 3MLSH 1QFUH 2A38A 1YNLH 2NXZD 3WV0A 1VPOH 1Q9OA 2QGBA 3STLB 2MPVA 4F2EA 3MV7D 3DTXA 3GFUA 4MS8D 3D0VA 3QH3B 4GRWH 4X83A 2W0PA 3QCUH 3WO4B 4G7VL 1IJNA 2F61A 3SQOL 2VZ1A 3MXWH 1MFBH 4NFDA 4RFOL 1SY6L 3NFNA 4JMXA 1UKQA 2VXTL 1WAAF 4JKLA 4LBEB 3WJLA 3WN6A 4JO8A 5CF3A 5L6YL 5EC2A 2JJSA 4J3OC 5I1HL 5DZVA 3U0WH 4XODA 4L1DA 1PG7X 1VZIA 1NM4A 2QKIC 2PYEA 5CIPB 2V8LA 2F0CA 3BX7C 5EZIH 1F5WA 2QV2A 3NIFF 3PY9A 1M7IA 2AXGA 2R29H 2E7DA 2H26B 1DLHB 1SRDA 5D2LB 3OMIB 2FJHB 4ZTPL 3CE1A 4ONOA 1J9TA 1ESOA 1I7TB 1MRFH 1RZ8A 1U3HA 3UROR 2F54A 4UF7C 3IFNL 1K2DB 4LU5H 2CM5A 4JFEB 4R4FH 4CMHB 3GKWH 2DTML 4AIXA 4U1HA 4QHLB 1N5YH 1DN2A 3K0YA 1QFPA 4PJCB 1KMGA 1QNIA 2ODHA 3DXAD 4HIXH 2P5ED 3CLWA 4ODUA 4XNQB 4HFWA 4JFUA 2VQUA 3QFDA 5L2KD 3VXUD 4BHUI 4G42A 2AK1H 3ZZSA 1MG2C 3DIFB 3S98A 1IT9H 2F1AA 3W82A 4R7LA 3X3FH 1EXGA 4AYFB 4HH9B 2DIBA 3BUYA 1ADQH 1H8LA 4DN4L 1TFHA 3FT2B 4ERSL 2NXYB 1I8IB 3KYKL 1DANT 4EUPA 5IV2A 5BUPA 2Y5QA 2Z0UA 2AAVA 1D9KA 2H2PC 3D85A 1OCRB 5IFAH 5C0RL 1I1FB 3UTQB 1EHLH 3MOBH 2XRAH 2VZ3A 1J9RA 2FX7H 4U1LB 1GMEA 2O1AA 5C0CA 1JZ4A 4TVUA 1WVZA 4LP8A 2PPAA 2ZUXA 4G1EB 4BQCA 2XKUA 1H3WM 3T04D 1WFNA 5T5FA 2GTZB 2XPGB 4Z7VE 5D1XA 1N7MH 3OR7B 4UQEA 1VJSA 2NNFA 2QQNL 3INOA 3PL6A 4H8WL 2DLGA 5LBGA 4AH2A 5E23A 5KOVC 2ZOLB 4FL4C 1MUJA 1PFOA 2FIKA 3DX9B 2WWOA 2H1XA 5F7NC 2ZWYA 3H42L 2VQTA 5KUMA 1KV3A 2FD6L 4OD1L 5IVZA 3UZQA 4PJGB 2AAAA 3S3JA 1QSFA 4NP4L 5INCB 2BY1A 4R90H 1QWUA 3KGSA 2NCEA 4PRAA 2J2ZB 1AZRA 5D2NE 1SEBA 1GYCA 3EADA 3Q1EA 4X0NA 2KC0A 1JV2A 5DMKA 2X9WA 3EDKA 1AZBA 3NSYA 3DGGB 3OXSB 1LHZA 2BXYA 5HDBB 3EO9L 3S4SA 4ZAKB 2PTTA 4JM2C 4J1UB 5FUZL 3J27A 5JIKA 1F4YL 3IDMB 5J1TC 4M5YH 2Y72A 3MRDA 4ANXA 3F65A 4KTEH 1OM3H 5IUCA 4LSRL 4Z7WB 1DQJA 2Q7YA 3PV7A 5CNHA 4KQ3L 2AXFA 1XGYH 3D3VD 3J7HA 5JW5A 3QRGH 1IKFL 3NZHL 4XMTA 1LO3L 3DMMD 1IEBB 1JPST 3HE7C 4KDTA 1Q4NX 4GUPA 3OB0K 3NQIA 1HDMA 4JMNA 3N5AA 1UFGA 3CD4A 1G7LB 2VDPL 5EDXA 1FC2D 1E42A 1T2QH 1ZK9A 5CD5D 1I7UB 2VR6A 2Z93B 2K7PA 4LF3A 1JXGA 1NIAA 4TQEH 3O4LB 4Z8FH 5C9KA 5EEYA 3RY5A 4NUJB 4RCAA 2WQAA 1C5BL 1W8OA 2CCLA 3TIEA 1KCRL 3MO1B 4K7FA 1EAJA 1Q0XL 1KELH 4B5EA 1YMMD 1WBXB 1FG2A 3SE4C 1DFBL 4OB5H 2O6CA 4BXVA 3VH8G 1EK3A 4LQFL 1JIBA 2ZKWA 3LV3A 3OKDB 5GJTL 4WF7A 2NW2A 4YLCA 4QRQB 4KKCC 4UYPA 2WXFA 3ARDA 1QNZH 2X88A 4EBQH 1BGXH 1JJUA 3VRJA 3L5XH 1I3RA 3MI6A 3IXTB 3BISA 4UTCA 2F7PA 4ZMQA 4ONFH 4WW2F 1JFHA 1XF3A 1H3UA 2DW5A 3CFJB 4JFZL 4S2SA 1HEZB 1QBBA 1WISA 8FABB 4Y1AA 3NCMA 4A6YL 2CXKA 4F93B 4MAUL 4WI0B 1JF1A 2FO4B 5A2FA 2CHDA 4GIOA 2A73A 3FFOA 4KDVA 1DJWA 1I9IH 4ZX4A 2LLGA 1JGLL 1TCRA 4GKOA 4NQDA 1B4JL 4HCRA 4HKJB 2PW2A 3KPNA 3BXNA 1Q9OB 1S7RA 2YWYA 1JZ8A 1G4RA 3DETD 3VXQB 5TK4A 2D2OA 3D0VB 2V0AA 4QF1A 4X0KB 3MRCB 2Y1YA 1ZHBA 2ADIB 4R7NA 3QG6B 2EYSB 5BOPA 2DM3A 1X4ZA 1T5WB 3NIFB 4HXBL 5FYKU 1IGTB 5EC2B 2BRRL 2CLZB 1S9KC 2IQ9L 1Z5YD 1JK9B 1H0DB 1HH6B 2PYEB 1UM5L 2XIDA 4GSRA 4UV7L 3CFEA 4FI7A 5KAQF 3FUMA 4NQVB 1OTTC 3DJ9A 1QP1A 2P45B 4JFED 5DJ6A 4EI5C 3O41A 1LK2A 5I1KL 2IGLA 3SOBH 3IMWA 2H0JA 1DYZA 4XPAH 2BSED 3CH1B 2CR0A 3MJ9L 2X28A 1SLXA 1DL7H 2B15A 4JFOA 3EFDL 4U1HB 1OE1A 4GXFA 4IYKA 4TVPH 2JTYA 2P1YA 3VI4F 2YK1L 1ACXA 5I17A 4L9LC 1E9OA 3DROA 1C5CH 1KGWA 3CDCA 3EBIA 3HAEH 3OMAB 4PJEF 5DTFA 5T1LA 1HJBC 1D5BB 1GZPB 1NLDL 4PP2B 3VGAB 3KPRA 4XCFL 3WD5L 1A3RL 3C8KA 4PRIB 2C3HA 5KVGL 2EO7A 2R1YA 3MRMB 2CO4A 2NXYD 3CHXA 4RFNB 1GAFL 5DD0L 1U8HB 1IKNC 1RVFL 3RGVA 5BRPA 3WTYA 1JNNH 3U1SH 1K5WA 4R0LB 2P46B 1JGEB 2ITCB 3VU1A 2BVQA 4EDWH 4DGVH 2NSQA 1D9KB 2WXMA 4N4YB 3VI3A 5F8QC 3TGXA 3FO1B 4OQTH 5JDSB 2PMZA 1JGDA 2WJ7A 5EC1B 5LGHH 5DD5H 4MJHA 2ZXGA 4YXLL 1F11A 2UYLA 2Y1VA 4PB9H 2EICA 1R5VB 3QZWA 5DJXB 2P8MB 4K3JL 1AR1B 2NW3A 3STZA 2GUOA 2WO4A 3NUKA 2EE3A 4HLZG 2Z92A 5BVJB 1T7ZA 2ZWSA 5D1XB 1KBGL 3BYTA 1VESA 5D96C 4WUKH 5DHDA 3WSQL 5EEXA 2EXWC 4XCNB 4AH2B 3D2UB 3MR9B 4WVRA 2FIKB 4X5RA 5CZVH 2ZCLH 5FYJH 25C8H 3L9BA 3HHSA 3BWUC 4UQ9A 2XCMC 5DMIH 2OXHB 3HFML 3QUYC 4NCDA 4Z3IA 3S8WA 5AWNL 3NPSB 1BEYH 5I16A 5IB2B 2CLRB 4XXDA 4LLYA 4PRAB 4WFFE 1P7QA 4L18A 2D31A 1RZJL 4ZAKD 1BF8A 3REWB 2VR9A 4JZJA 5C0AD 1WUNT 1JHLH 3IAQA 4HWZB 4K9EC 1OGAB 3LS5H 3TNNA 4ISVB 4K94L 5CJXA 2CIIA 3FN0L 3T2LA 3D18A 2WLMA 1YDPA 3B7SA 4PRPB 3ZGIA 5DK2A 4HUNB 3ZE1E 3QJQB 4NKIL 4D9LH 1VSCA 2VT0A 1NLBL 3TZVB 1VGEL 2CR6A 4IGBB 3FU7A 5E08L 3BD4A 2AXFB 3S35X 2ESVE 4L8SA 5GGUA 3QNYB 2ATAA 5DRZB 3F7RA 2VDNB 1UB5A 2YN5A 4UZSA 1MQ8A 2OZ4A 1LDSA 1EEQA 3X1FA 4P07A 4H13C 5CILL 1T7XA 2WZAA 3H7BA 1EJ6A 3O4LD 5FEBA 3JYBA 1NCWH 3QFJA 4DP5X 4UDTB 4TSBL 5AL8A 3GK8L 3X1GA 5KYNA 2HFGH 5CEYA 3MV9A 3QUZA 3LRHA 4MAYB 4LCUB 3VD3A 5AENA 5JOPE 2SODB 3VTMA 5DVOA 5JXED 5HDBE 2KL6A 2Z8RA 4G6JH 2A74B 3JSSA 1FAIL 3QB7C 3GDCA 1GA2A 2J6EA 2V7NA 4JO4H 3PGDA 2B3IA 1B0GB 1PZAA 3OZ9L 4XN7A 4W9KC 3S9DB 1HHHA 2MKWA 4IBQA 4WW2B 1HL9A 2XN9B 4M62H 2NW2B 4NZFA 2ED8A 3NRPA 4U4BA 2E9GA 3MLTA 2ZSVB 3F7YA 3QR0A 4GBXC 2OJZL 2R2BA 3HMXA 3U6XA 3NFPB 3OKKA 2FX8H 1N2RB 1BG9A 5B1CA 4RMQA 5C6TL 4NYLA 4PJ8C 3C12A 4ZSOA 1UOLA 3LNDA 5LBVA 1TZHA 1WFTA 2C4FU 3UYRH 1D5XB 5CEXA 2JLPA 2VSMB 4PJHE 3B34A 4APQB 2X4UB 3VCLB 3FJTA 3MYZA 4R3SA 3TA3A 2E7LC 3E8UL 4BZ1H 1KIUA 4GT0A 5GS1A 2XYCA 5F3HB 1TCRB 4S0TD 1DZBA 4MNQE 4NQDB 7TAAA 2R1WB 1G9EA 1S7RB 2WZ5A 2P24B 1YVLA 2FWUA 2DWSA 2GB2A 4R5VA 4QF1B 3X1EA 1J10A 5CSZA 1P7KB 3BKML 3GSNL 2OKMA 1K6QL 4L3EA 2CK0L 4YSRA 4JCMA 4JY6A 4CAGA 1IGJB 3IU4L 3MGTB 2Q5BA 3F7VB 4ZW8A 3BIBX 1L9TA 2ZUQB 1E6JL 1RJCA 5JHBA 3HIZA 4WU7A 4F7MA 2EEFA 2PYED 2NCMA 4GMSL 1UQSB 2DH2A 2FNWA 4Z0XA 1ZLSL 5HHQB 3K71B 4Y0GA 1UZ8A 5IB5B 2DQMA 1NEPA 2N7SA 5GSRA 5CCKH 3VQ1C 1N6QL 3AQZA 1HTYA 3MZTA 4HWBL 1E9PA 2QVFB 3QQ9C 4ENEC 2ORBL 3RTLA 1LNUA 4QHNB 5EU4A 4XI5C 5HVHC 3VI4B 4KQ4L 2C26A 4AYSA 1RUAL 1WEJH 2VDKH 2WYTA 4RGOH 3CFKA 4PJEB 1GOHA 1BDYA 3L17A 2UY7B 3ARGC 4J3SA 3S36X 4U1GB 2YGNA 3OAUL 3QDGA 3HBGA 4LCWE 1LP9E 1REIA 4EOWL 1FJ1B 4GNKB 3TWCH 5AZEL 4YO0A 5FLVA 3LRKA 4P5KA 4YBLB 1Z9SB 2P7TB 3THMH 3WNPA 2FECI 5IQ9B 1OKEA 3DSFL 3X1NA 3AY2A 1DQTA 2HTKD 3KPRB 2FNBA 4DOHE 5I6NA 3EYVB 5CZKA 4Z95L 3FQXA 4EZKA 2HSIA 1FI8C 2JQAA 1KXTA 1RQ5A 2XZCL 3FSVA 3N1FC 3KLKA 2AMGA 3KBPA 1RUPH 4WFEE 3QEGH 3RGVB 3M8OL 1TZ8A 2QL1A 1D9KD 3D85D 4YQXL 1OB1B 5DQ9A 1EAOA 2PWFA 3Q8CA 4FQJL 2EKSA 4OCMC 4YSDA 3GLAA 5DI8A 3VI3B 1UVQB 4Z23A 3RNQA 3PE9A 3VSTA 1T1WA 2RJMA 3MBWB 5HI5D 1ZDSA 2FQDA 1AR1D 4AZ8B 4WSKA 5HHPA 1EJFA 1PKQA 5D1XD 4ILDA 4JM4L 4S0SD 1ZS8B 3CXDL 4G8FA 3D2UD 4M6NH 1SFHA 4F8OA 5T3ZL 4QTIL 4PRIE 3UBXA 2NX5E 3BH9A 1DQKA 4PGEB 3ZZQA 5HP5A 1CG9B 1QSFD 3HHSB 3BH8B 1SXCA 1S7SA 4NO2B 1SMOA 3CBKB 2X4OA 3K2IA 1HCVA 5C7XL 4HW6A 5CLXA 4PN6A 2R69A 5T3XE 1MJ7L 5LCVA 3AB0B 4RESB 3F5WB 4YEEA 4CN6A 2D31B 3L8QA 1OM9A 2B16A 1I7RA 2VLMD 3SDDC 5JQIB 2XZQH 1M42A 3PWNB 4JZJB 1PJWA 3IJSA 4PRPD 3V4VH 4Y5VB 3TNNB 1MFDL 1FNHA 3RX5A 1P84K 1QRKA 3OKMB 3VX0A 3TZVD 5C97A 4Z3JA 1NH6A 5DK2B 3ZTNH 4XNDA 2GSIB 3FUKA 3RB5A 5B21A 1CS6A 1BZ8A 4Q9CA 3RJQB 2VDOH 4HKBB 3Q0HA 4J3UA 3IGAA 5IQNA 4DPAX 3D12B 1YEHH 4AYDC 5IJVA 1AGFA 1KNOB 2VH5L 3DO3A 1MFCL 2CHNA 4QWWD 3HRZA 4LSUL 3NJVA 2DTSA 4W9CC 5EUKB 3DPDA 4FNQA 5JHDB 1XSIA 2X9XA 3Q05A 5EOQL 4IU2A 1S7UB 1WAPA 4EMZA 4DVRH 3H7BB 1JBJA 3U79A 3EOTH 3ZO9A 3LEXA 4MAYD 3CZEA 4JJ5A 1ZVSA 3FU0A 2YUVA 3UZVB 4LSPH 3RRQA 3ZSTA 4U1SB 4B0MB 5IREA 1BFOA 1QW9A 4XVJH 5FOBA 3N0PB 2XG4B 4PBDA 4UINL 3Q8BA 1OGAE 2GAZA 5B4MD 3GRWL 1DVYA 5HJBA 3GSOB 4NO3A 4FJYA 4R26L 4DP7X 5KVEH 4EPSA 2V7NB 3MNWA 2HG5B 2Z9TA 4XPGL 1TEGA 3D05A 4X98B 2WNXA 3GEWB 5L8JB 2VLJE 1QR4A 1BZDA 2ZJSH 5DJAA 3BEWB 3CFMA 1GKOA 4MX7A 5DQDH 1JPGA 3S37X 1KGIA 2F8VA 2AEPH 5FKPA 2O93L 4M8QA 1KJ3H 3FMGH 3X14B 1DQDL 1GR7A 1XIWB 3QC6X 5KBMA 3SQBA 1NKRA 5GQBA 4JRYB 1JDCA 5T1DL 4DEUA 4APQD 2OMYA 3U4EA 4K5OA 1BW8A 4PLNC 4MBRA 4XC1L 4WUUA 1WSST 2RBLA 1FVCB 3CZFB 3ZTCC 2CHXA 2EECA 4AL8L 4NQDD 3TM6A 2XG5A 1PGRB 4B9IA 4HAGA 5AAPA 2YEQA 4TPRL 2E46A 5F96L 5FYJU 5E1AB 1HC1A 5F2FA 1QLEH 2H3NB 3P30L 3D4CA 4GFTB 2DMKA 4PWHA 3H4HA 4R9HA 4Y4KC 1AG6A 3I6LD 1XZWA 4L3EB 2XYBA 1SXNA 2XN9E 4JY6B 4MD5A 3U6RA 4TKWA 3T0EE 3NG5A 1RHFA 1FFNA 5GGRA 3S96B 2XFGB 3PWPE 4KXBA 4E2OA 2BCKB 1MFAL 3HC0B 3M17A 4RMVA 5B7FA 1CXHA 2M1KA 2K4AA 5CBEA 4NRXB 3U4BL 1CTMA 4D2NA 3KPLB 3RIAF 3LQAH 4GS7B 4HG4J 1NGPH 1QR1B 3K5SA 1E3ZA 2BO0A 1E9PB 4UT7H 5DS2A 3BAEL 4FQLL 4ZMAT 1KYFA 1MDAA 1TXKA 3WTWA 5TDOA 4R4NC 2IADA 4FI8A 4ZTOH 5D70L 3NABL 2N1TE 3AY4A 1AVAA 1OE2A 4S1DC 4AGLA 1FYHB 5DJ2A 1Q9KA 2XNAB 3QEQA 1K4CA 5BZXA 3K3QA 3PHQA 1MLBB 4AW4A 3L3GA 4FF9A 1NMAH 1D5IL 2F58L 4M61B 4QT5A 5T1LD 3UJJH 4AGMA 2CMRL 4YO0B 5E9DA 3BP5A 3MLZL 1Y0LA 3KPRD 3TA4D 4G8EA 3S48A 1CLCA 4FKHA 5HGBB 5AW0B 4DP9X 2VMJA 1X44A 1BM3H 1MIEL 1M1XB 1JPTH 3RGVD 5TTRA 1KULA 5E8DH 4Z3GA 1U8MB 5F3BA 5EMYA 5I6MA 4XHJD 4X7DC 5CINH 1EWHA 2OTWB 3GMQA 3HE6C 5C8JA 4ZMLA 4IRJB 5JYLA 1Y1UA 4GKZB 4Q6IB 1S9WB 2OULB 3BGFB 2EKSB 5DC9B 1G7HB 1FLRL