1Z66A

Nmr solution structure of domain iii of e-protein of tick-borne langat flavivirus (no rdc restraints)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
TYTVCDKTKFTWKRAPTDSGHDTVVMEVGFSGTRPCRIPVRAVAHGVPEVNVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGDLNHQWFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Major envelope protein E
publication title NMR solution structure and backbone dynamics of domain III of the E protein of tick-borne Langat flavivirus suggests a potential site for molecular recognition.
pubmed doi rcsb
source organism Langat virus
total genus 13
structure length 93
sequence length 93
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2005-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1z66A00
1Z66A 1RERA 4GT0A 5AAWC 1OANA 4UT6A 1Z3RA 5LBVA 1OK8A 4L5FE 3UYPB 3C5XA 5AAMC 1URZA 5H37A 4BZ1A 2JSFA 2JV6A 3UAJA 2ALAA 5JHMA 5KVEE 2R69A 3N41F 5IREA 3MUUA 5KVFE 3WE1A 2GG1A 4AL8C 4UTCA 3N42F 4FG0A 1TG8A 3J27A 3IRCA 5GZNA 3P54A 2HG0A 1PJWA 1ZTXE 4BZ2A 5IZ7A 2V33A 4UTBA 5B1CA 2I69A 3N44F 4FFYA 3UZQB 2R29A 3UZEC 2JQMA 2H0PA 5LBSA 3J2PA 4X42A 5GZOA 3N43F 1OKEA 5KVDE 3N40F 3VTTA 5JHLA 4UT9A 4FFZA 4UTAA 4GSXA 1UZGA 3C6EA 3UZVA 3G7TA 4ALAC 1S6NA 4AM0Q 1SVBA 5LCVA 2P5PA 5KVGE
chains in the Genus database with same CATH superfamily
4Y1TA 5CZXD 5A7EA 3CXFA 2RJMA 3VUAA 1QEWB 3PWPA 1S7VB 4PRHD 1KCKA 4FTDA 3GYRA 4AKOA 1V27A 1L3WA 4C56A 2YAPA 2QQQA 5KYXB 4PGEB 3HE6D 4AGPA 1JL8A 4ODSL 3WIHL 2NY1B 4WEUD 2O6CA 4RQQA 5JO5A 1N0XH 3JWOH 3Q44A 4HV8B 2WY3B 4A6YA 1F02I 4DEUA 5C2BH 2EUXA 3D9AH 4XP6L 3KLQA 1QAWA 2VM9A 4KV5F 5AWNH 1A25A 5LB1A 3S96A 3UC0H 3MR9A 3SKJL 1A1OA 1R3LA 3IN0A 4PRPB 3WUWA 4UANA 5IM7B 5GS2D 5IOPA 1KWGA 2VXSL 3F64A 4P5TA 5B4MC 4C47A 5DRZB 3TH3T 3WKYA 4CGTA 3QG7L 1KGUA 1CO1A 4D9LH 3GM8A 5BOZG 4ACTA 3CLFL 1FUNA 4KXBA 3CIQA 2PXYA 4OLZH 4OZFA 5MEOA 3DXAB 4IGBA 4O2EB 1IL1A 2VZ1A 3V0VB 2E7MA 1U58B 2XYCA 4L29A 1RXLA 2AJZA 2YEZB 3UTTA 1T1YB 4PREB 1WE5A 2AK4E 3QJHA 4P2RB 3VMOA 3HS9A 4PJXA 4ZT1A 4EDWL 4JY4B 2F9BT 4G43B 4JPVL 4NN5C 2ZUWA 2EICA 1N67A 2BSBA 3T8MA 3R8QA 5IQMA 1R4XA 3ZRSA 2GT9B 1QHQA 2EKSA 5T3ZL 5D7JA 2F15A 2P46B 2RBLA 2WQAA 4TSAL 4A2GA 4XP1L 4BH7A 1OD7A 1PZ5B 3OKYA 3GEFA 5GZOD 4R26H 1VKXB 1KJMA 1E6JL 3MUHL 4OM0L 1PMYA 1QFWI 2FX8H 1IGTB 1NMBL 2K6ZA 1XO8A 1I7UB 1U3JA 2G5UA 3ETBJ 2BY1A 2EDKA 4LSVH 4EE2A 4XMPH 4ENED 4YHNA 2DV6A 4ODWB 5HD8C 2Z1PA 3Q5TA 4Q89A 5B38B 4JFSA 4PJAE 5KS9F 3QFDB 1U92B 3QJZA 4NUJB 2VM3A 5BZWA 2Z4QB 3GMOA 1KOAA 5F6HJ 4DQAA 5K1NA 4ZTOH 4XWOC 1BZDA 4QRRD 3VXTB 4ZX3A 2XWBB 3VD1A 3DK2A 5KSVA 5C07B 1S78D 4Y5YB 1BQRA 1QLRA 3PWNB 1FNLA 2OTWB 3EFOB 3CU7A 4G9FB 4R7DB 3QUHA 4BFEA 4JL2A 4OCNC 1S5IL 4N0UB 1C5BL 3G04A 3ARGA 4X4ZA 5EIIG 3PDOA 4H8QA 4N2BA 4NP4L 5HDWA 1FZJB 5DZAA 4AZ8A 1MJJB 1X5IA 4JANA 3C5JB 5T8IA 4BZ1A 4R96A 2PPFA 1JXKA 1ZS2A 5SWZA 5HJ3B 4HLZH 2DIEA 2WXHA 1WZ1H 4HGMA 1LGVA 4TULH 3NZ8B 4FI7A 3IS1X 4U0RC 1HHHA 5FO7A 1FNAA 5HVHB 3W2DH 2CZNA 3GBNH 3O9WD 2OZ4L 1MCSA 5J9PA 1X5KA 1EDHA 4UILL 2EDDA 1JI1A 1HHIB 3V0WL 5KG9A 2CGRL 1X6NA 2MPAL 1UASA 4WSKA 5L8LB 3WFEH 1XSKA 3NA4A 4J3UA 1JZ4A 1OPOA 5BS0D 1O6SA 2C3WA 3TN0B 3QCVH 4XCNA 4YBQC 4I18C 1E5BA 2MH4A 4JAMB 3UJTH 2Z92B 1Q9OB 3NABH 2VABA 4S0SD 1J10A 4NOFA 3QW9A 4KRPB 4CDGC 4JCWA 3C2SA 1T4WA 2FHBA 3O2WL 3PGDB 2CK2A 3TT1L 4ZO9A 1DZBA 2Z6FA 4QKTA 4UQDA 3UXFA 5FHBL 1RI8A 3OAZH 2ED9A 2JH2A 2FEDD 4DQOH 4NT6A 3H2PA 4KK9D 1KUMA 2HG5B 2VXUH 2FZ3B 1NUGA 4MDJA 4YL9A 4JDZB 4LVHC 5D7LE 3VCLA 4ANWA 5ABDE 5KW9H 2VLME 5JHLH 3OL2A 4FQ1H 4WWOA 4LAQH 4JRWA 4KXZI 4NM8H 4BKTC 3CN3A 4NENB 1PKQE 3GMQA 4JFOB 4NQDD 4ZZFA 3LIZH 1A7QL 2V2TB 2OXHB 4N2DA 1BEXA 3K6DA 4I87A 2KC0A 3MRKA 3GD1C 4GAGH 4PR5A 2CJUH 1QX1A 1A4JB 4KKLC 1URLA 4M7ZB 2GK0B 5GRJH 1MQ8A 2K4WA 4MKMA 3BH8A 4X8JA 1ZANL 3MRMA 3FO0L 3GSQB 1S7RA 4F5CA 3RUGB 1PDKA 2IGFH 3WEXA 1HHKA 3PP4H 2Z7WA 1WIOA 2FJGB 4D2NA 3KPPB 5D4HA 4ZAKD 2IH3A 5C08B 4WI9A 4U3SA 2OFQA 2ZTBA 1W15A 2AEQH 1PAMA 2HKFL 4XPGH 5E00A 1MCQA 3IDIB 1RJZA 4HQQH 2MTAA 2DQFB 4LKCA 4MNHB 4MJ6A 1BZQK 2EH7H 3D39B 2QQLL 1P7QA 1ODUA 3TO2A 2V7HB 3MCKB 4XXWC 1RJYB 3NA9L 4BGLA 4NQSB 1EBPA 2BFVL 4NQVB 2B7DT 1QTPA 3MMEB 1JPST 3UBXB 4POZD 5MENE 1FNEA 4IRSA 3GI9L 2QVTA 4C55A 5EU5A 1YECL 3QI9A 1LK3H 5CP3A 3OMIB 2HFEA 1GGBH 1PQZB 4FQJL 4GAYB 3V8OA 1R33A 1X5GA 3FOLA 3WFZA 4A7UA 2UZYB 2FWOB 2A1WL 4DKEL 4JMXA 4IOFC 1U8NB 4N8CL 2L04A 1R1CA 2AQ3A 3LRLA 4Y1AA 1Z7JA 4I2XA 2ENJA 2FLMA 3FQWA 2GEQA 4P9MH 1KGCD 3WE1A 1Q0EA 3MV7B 4J3XA 2VDRH 3F85A 4FJYA 1QI4A 4F33A 2X4UB 3OKKB 4FDWA 4M7JL 2YGQA 3LRMA 3TBBA 2QKIC 1A9BA 3N3EA 5IMOB 1UT2A 1NC4B 1IAOA 4D8PA 3Q06A 4LLDA 4NDMA 5I8EB 3BMWA 4ECNA 1YNKL 4YHIA 1YUHB 4XNUL 2X3CA 5I15H 3HHMA 5I74B 1NEZB 4JY6A 3QULA 1SLVA 3MDJA 3A21A 4KFMA 1BGXH 1HC1A 1VFBB 2AV7A 1FSKC 1ZDQA 4P2OD 4UM8A 2OPCA 1JTTA 3QHZL 5E6IB 3DK0A 3UERA 2R8SH 4P4KC 3MZTA 5DZVA 4OGZA 1FFNB 2OMUA 1UWYA 4BH8A 4U3HA 4Z7NF 2CXGA 5GS0D 1PCXA 1NGPL 3N1QC 2GKIA 4Z7UE 5EBGA 1CXKA 3QZOA 4XWOD 5FDWA 4QRFA 5I6XB 3EH5B 1CPUA 1HNFA 2C9PA 2AQ2A 1PS3A 5F44A 3H6JA 3VFGH 3WXWH 2GSIA 5HYJE 2GI7A 3GSRA 5SWSA 2EYRB 2UXVA 2BP0B 4YSCA 4N2KA 1XCTB 2VZSA 4LPUA 4DEPB 1HCYA 3DPBB 4H8WC 3BZEB 5EO0B 2I07B 5BV7C 5B21A 1EMTL 2NCMA 4Y9EA 3ZE2F 3UL4A 2BZDA 1WAAA 5GGVH 5TDOB 2A9DA 4X6EA 1MCNA 4TL4A 5E24E 3HN8A 3UYPA 3F7QA 3RX7A 2P52A 4LKXB 4BSWB 4YSQA 3EGSA 4X7CC 3BPNB 3MN8A 3V0FA 4CKVX 4LZKA 1A3RH 3QGVA 3KYOB 3APCA 3TBSB 1SXAA 1BIIA 1J9RA 2EP6A 1L0QA 1UQSB 3GMLA 4D3CH 3UTSB 4HLZG 3ARDD 3CHPA 3L4UA 2R9HC 3QUYC 1T3FB 1K8DB 4IOSA 3M7OA 1TJHL 4R5VA 3WMPA 4AGQA 3GB7A 1I9JL 1RUKH 2NNXA 5JOFB 4JMNA 3BT2H 4QTHA 1BAFL 2VW7A 2HA1A 5FFLA 3NJKA 5I5IA 1TETL 3GKWL 4LPXA 5AVWB 4EN2A 1SJXA 1FJ1B 5ILTL 5L6YH 3LAFA 2VLJE 3BCFA 3KVPA 3PWLA 3KLHC 3UYOD 4UNUA 3B1UA 1KELL 2JK5A 2CA4A 5CZRA 2HAZA 2I5YL 2X09A 2OCJA 2R4SH 3LS4L 3MBEC 3G08B 3ELAT 4J39A 1VDGA 3DX7A 4V1DE 4PJIA 1SJHB 2BIHA 3ZDYE 2DH3A 1V7NL 5FOBA 1BVKB 5C0GA 5L88H 3MRFA 3TPUA 4GNKB 1A47A 4DSYA 1KLFA 3AMLA 2UY7A 3C5ZB 1GOFA 1M71B 2FRGP 3A6BH 2DM3A 4KKLD 2GTWB 2NDGA 2R0WH 3O8XA 3B6SB 2L7JA 3WJJA 2X6AA 2WM0A 1JE6A 1ZGLB 5D2NB 5IBTH 1UD6A 3WCYA 4Z3GA 1PFOA 3TCXA 1S46A 3HIZA 3GS0A 4U6XB 2LU3A 4HWNA 2A6JA 4MD5A 1WV7T 5F7WC 4NN7C 3U2JA 3BP4A 3EYSL 5ACZB 3QUXC 1CTNA 4HXAH 3VXPA 4H2AA 4E0RB 2AEWA 4U1MA 1I3RB 1DBAL 3QWRA 5B39A 1A0QL 3DOHA 1D5IH 4H5SB 4XNYL 3REVB 5T1LB 3CGTA 1T6WA 4WIQA 1AVAA 3NIFB 4JZJA 4K5LA 1BQUA 4GG8B 4LBAA 1KY6A 2HLAA 4QHUB 1ZLUH 4NXKA 3ZIYA 1CF8L 1Z32X 5G4MA 3UAJC 5EU3A 5FYLD 4U1JB 1A8JH 4JHBA 5E1QA 1EEYB 4OLVL 3BE1L 1D9KC 2ZX8A 4P2AA 5I8KH 1CFSA 4W68A 4FFYL 2AANA 2OULB 5HGGS 1BFSA 3GLAA 1A7OH 2BIPA 3V8CA 4NGHH 4PJAF 1GPOH 4F57H 3RIKA 2YARA 1FORL 3BGFB 5DMKB 1WP6A 5I1JH 1MJ8L 2VIRA 5SX5K 4CVUA 4OQTH 3TVMC 2YRLA 2Y25A 1CK0L 1INQA 5E2VL 3MRQB 3ZSTA 3MNZB 3V0GA 1RUAL 2O6PA 4NFDA 3BKCL 5DJYA 3QHFL 4MLIA 2VJ8A 4H26A 4MNQA 4NQXB 5EULV 3VWKC 1IE5A 4ZQKB 2E56A 4PP2B 2IJ0C 3B3BA 4LRIC 5IB5A 1MFAL 1JGLH 1QMUA 2ZKHH 3FCGA 4MSWB 4AUJA 1GSKA 2AJ3B 4DP4X 1N19A 2VDLL 2FO4B 3QARA 2VLMD 3NK3A 2FHCA 3FRPA 1EZSA 3CAFA 3B9KC 1F58L 3DX6A 3QEUB 2B59A 5JDSB 5C0EA 1ZEAH 2IFFL 2BWQA 4TVPH 1KYAA 3TU6A 3HN5A 1KPRA 4FQIH 3AG3B 2IANB 4QT5A 3GUTA 2PWFA 4KI5C 1DVQA 3Q7JA 1IVTA 4CN1A 3ZYIA 3K71A 2NCEA 4UF7C 2QMJA 3ZVVA 1BXAA 3VI3B 1GJUA 3FT3B 3II2A 1A8ZA 3DYPA 2ARJQ 4EZKA 5FHAL 1ROWA 1V7MH 1J0HA 4HIEB 3CFKA 4AQ8C 3MFFA 1OK0A 1LE9B 4XAWL 4R7NA 5DVNA 1OP4A 1P6AB 2Q8AH 3SYCA 2QPFA 43C9A 5C71A 1RQ5A 5D6DC 1F41A 3LS5L 2BWDA 5F7DA 3PQYE 1U8IA 4FFTA 4FQLH 4X6BB 1I9IH 1TFHA 4ADGA 1UXWB 2JXMA 2LHAA 4BKSC 4OZIE 4OCLC 3MRHA 4UNTA 5MEND 3LHAA 3RFZB 1EXUB 1HH6B 2YAFA 1F4XL 4HKBB 1SXNA 1OP3K 4BGDA 1N4XL 1MCDA 1LD9B 3HG3A 4LEOA 5LDSA 4HU2A 4XHJC 4Y9CA 1MI5E 4WU5B 1B0RA 3DGGA 3SDCB 4EDXA 1KTDA 2K45A 3AQZA 2EEDA 5CN1A 4POUB 3QUYD 4IIZA 2ERJC 3MRGA 3EOTH 5E9DA 2EEXA 5JW5B 5K9JL 2C1OB 1FFPB 1GMEA 3V4VA 1KEGH 2AEOA 4PJHE 4RRPA 3TWYA 4EAEA 1I7RB 3VAEA 2J1XA 1G0DA 2RACA 1J5OH 2ZG3A 1E40A 5E8PB 2X4QA 4F15B 1ZE3C 3BDYH 4JM2B 4ZSOB 3WTTA 3B2VH 1I3VA 1X4YA 5D5MA 1NFKA 5EBWA 2I60L 3VXUE 4LLVA 3I9IA 3CVHL 2EO1A 2DWXA 1CZ8H 2DTMH 5AKRA 1AG6A 4NOBA 1CQKA 3G5XB 1WFMA 4JQIH 2NYYC 1U8MA 3LH2H 3VGDA 1QOKA 6PAZA 1K3IA 1RZIB 3VD4A 4KUCF 1UM4L 3MYJA 3D3VD 5CD3B 3RLSA 4CVZB 4W6WB 1D5RA 1IC5H 1NGWB 3H3BC 4NN6B 1KENH 1IEHA 1P1VA 1J9CT 1UFUA 1ZA3A 4JB9H 4LCYB 4XNAA 3ESOA 2OYKA 2SODB 3EJZD 1CU4H 3GIZL 2ENQA 1ZAGA 1XH2A 4AEFA 3L17A 2XY2A 5BW7C 3E0GA 3PIQA 1ETZA 5HYJD 2FT6A 1TTGA 2H0EA 2X4PB 2B2XL 3QXDB 3U7AA 3VFWA 3N1GC 3AM8A 4FQHB 4Z7VE 4BZ1L 1LQBC 4IKNA 1WWAX 3CZEA 3WD5L 2DJ4A 1NDGB 2VDPL 3NJLA 1GCFA 4F37K 2EC8A 5ID0A 4NLAA 1KT2A 1JPEA 2ENPA 4JPIB 5HPMB 4I48A 1QW8A 1U8KA 3JVGC 4LARH 3S5YA 4L4VE 4E9LA 2WJ5A 3AABA 3OKEA 4PJDE 4Y19A 2WXNA 3OKOB 4LSQH 3FCSB 1RHHB 1PSKH 4JG0H 4Y7MA 5FXCH 4RDQF 1V54B 5HXMA 4ZXBD 3BP6A 5T5NG 3Q0HA 3FN3A 4N6RB 4CVXB 4N1EA 3QNFA 5B3SB 5TQ2H 2UWEB 4F20A 4JHWH 1GIGH 1Y6NR 1DBKH 3QH3B 1M9SA 1JOIA 1U3HB 3RHWK 3QXUA 3TBWA 2VUYA 3BQUC 1FYTE 3F12A 3KL0A 4PWIA 5DO8A 3IJEA 4APXA 1W72H 4Y16B 4GYBA 4Z7UF 3U9UA 3KPNB 5IJBC 1YNTB 2MTPA 4JPKH 1FI8C 1CD0A 2AQRA 2N56A 4G82A 3AW5A 5IW1B 1UJ3C 5HHXH 5E8NB 1EAPA 1IBGL 3LV3B 2B1AL 3RDTA 5FUOL 2D8KA 3GBDA 2WYZA 4NWUH 3RIAK 2G75B 2EVFA 2X3BA 4Q9QH 5BVJA 5F7MC 5F89A 1XDTT 2BLFA 3MRJA 4IBZA 1E27A 1G7MB 4Q4IA 2CKNA 4BQ9A 1QBAA 2IG2L 1GZHC 3EYVA 2BOCB 4LLWB 4M6OH 3T0EA 3HG0A 1AGFB 4S1RL 2E74C 1GGYA 1WBZB 3WTSA 4PCYA 2G4EA 2E27L 2X05A 1BX2A 3GS7A 4E9YA 1ZTMA 4OF6A 2JELH 1FZOB 3CFCL 4UWQB 2RAMA 3DYOA 3NJHA 1JTOA 5GSRA 1AKJB 4B9CA 5GZNC 3F5WA 2WQVA 3QJSB 1FE8L 5I0DA 3NJVA 1AQ8A 1N6QH 2P8LB 3QORA 5MEQA 4J4PD 3AVEA 5GGQL 1RZKH 4PTUA 3T65A 1G9MC 3UC2A 4JVPA 2PYEE 3FSVA 1ZWIB 4F58L 4K8RH 1AYOA 4HS6A 3VFTB 4KHTL 5I1AB 1S7XA 3MLRL 2VO8A 4KQ4L 4XVUC 4E41E 4O58L 4WHYH 1DJGA 4QHKJ 2BVOA 4RZCA 4ISVA 4OR1A 5DD5H 3TLRA 1A7NH 2ICEB 3KPOB 2VDQB 5KOMC 3VD9A 2Q76A 4K55A 1GRWA 3EF7A 3L9EA 3DOIA 2W80C 3FOMB 3TP4A 2CLRB 3ARRA 1G4RA 3U0TA 2VISB 4I88A 1E3FA 4Y8DC 2MKWA 4QD2E 3ZDYF 2YD5A 3GZOA 3ZKNC 5J1AA 2WAQA 1UZ6E 3DHUA 4M61A 4LSPL 4XHJD 1U8HB 4B5EA 1ZPUA 1OARH 4JGMA 5EOQH 3X13A 5AW0B 5E2WH 3S5LG 4AYMC 3BHBA 3ETBF 2N7SA 1XB8A 4MA1C 2XWJA 5ENWB 2BNQA 3GO1L 4F8TA 2IFGA 1JYWA 2ZX5A 1HXYA 1W9XA 3BWAA 3HC4L 4PJCB 5LBSH 2FQEA 4CGUB 1B0GA 3T4AA 2OR9L 5IP4A 2XX0A 3N44F 5TF1H 4HCRH 3VWJC 1FVEB 2YMXH 4KI1A 4I3RH 1NGXB 2VXVL 4M6AA 1GGUA 3NRQA 3WBDA 2J5WA 3WTWA 2R7EB 3BWUF 4PRBB 2IWFA 2BMKA 2J88L 4FXLA 4GKLA 3ZKMD 3FT4B 4ORGA 5TK2A 4OUUA 1JHLH 3L3OC 5FCUL 4NRZB 1MF2L 1WUZA 2NYYD 5FKPB 3WIFA 5IIEB 1WBXA 5L0QB 3CFDA 4UTAH 5ANMA 1AJ7L 2XG5A 2KI6A 1MHHA 2AW2A 1AO7A 1J0ZA 2FB4L 4HC1H 5D8JL 1YEGL 3TBTB 4F9PA 4KZDL 2MNWA 4YO0B 2V4LA 5BJTA 1MLBA 5TE6H 2DY2A 1WLHA 2LU4A 3POHA 1BBJA 5IQNA 2FTAA 2I9LB 3MRBA 1A6VH 1MCOL 3GHEH 2OCCB 1XGYL 3STZA 4AKPA 4E5XB 3RQ3A 1LEGA 4YUEL 2NNRA 5BPPA 1OB0A 3QPQD 5K93A 1SDDA 4M5YL 4P3DB 3ULSB 1HJCA 1J9QA 4JLRB 2R0KH 1Q9WA 4R4BB 1M42A 4HJ0C 1HEZB 3U1SH 2JB5L 4O5LL 4WI5A 5J4MA 1E5ZA 2UX6A 3QYNA 1FL6B 3AU1B 3GRGA 3PQYD 4G8FB 4XPTL 3B5HA 3TCLA 4KC3B 4TN9A 4XCCL 3OM3B 4WV1A 4M7LT 5CHNA 3U1PA 2FD6L 4JKKA 2NZIA 1A3LL 4HALA 4MA3A 3LQAC 5I8CB 1F11A 3IPBA 1Z5HA 5D1ZA 3SDDC 3U30C 1AH1A 4NNYB 2I85A 4F7TA 1A6ZB 4FNTA 2XPGA 1YYCA 4ZYKB 4HK3N 1TJGH 1YAIA 4AT6B 4S2SA 2R69H 2Z1KA 3FO1B 4GUOA 4G6KH 3RGHA 2Y7NA 4E9SA 1THAA 3D4YA 3IFLL 2DWEA 2OV0A 5TDNA 3C5SB 3ARPA 4N2AA 5F8RC 5D7IE 5DEGB 2PPDA 4UMGA 4O02B 4UMSA 1IT9L 5I18L 1MVUB 4RRPM 1M7IA 4RMBA 3SEPA 2VGLM 3GBML 2WB1A 4LEXL 4JNXA 5DT1L 3L5XH 4NC0B 2Z91A 3VRLE 4J23A 4LDCA 1OB1B 1EO7A 4YX2H 4XN8A 1EFXD 4YDMA 2ZXBA 1QSFE 1X5ZA 2A5UA 2JNZA 1JZIA 3H2WA 4G6ML 3VXUD 4BFFA 4ZFOL 1BCIA 1A6AA 3N42B 3D85A 3HBQA 2VMFA 3HAEB 3O3EA 5ESAA 1UVQA 2D7TL 3QRGL 4LSRH 3RDJA 2C9VA 4WUKL 2B20A 2W0LA 3CPLB 3FQNA 2EC9T 3UIYA 3V5DB 4YHYC 1R46A 1CLCA 5GGSA 4P59L 4A63A 3LDBC 4KAQH 3DV4A 4YPGA 3WE6A 3LY6A 3M46A 3U83A 4UTBH 2NQ3A 4IDLA 4NQEA 1XL6A 3ALPA 4WCYL 4XMUA 5GRWA 5C0FA 1QNIA 35C8H 3FB8B 4KY1H 1Y07A 4IQHA 5LGYA 3SD5A 5F7NC 1XB3A 4OD2B 2WVTA 5DCCA 3VSTA 4EO5A 1TTUA 3CDGB 3JWDH 2ZCKH 1FO0A 1JV5B 2DQUL 4IRZH 3MPCA 4CMHC 2EUWA 1X5YA 2ADFL 2ICWJ 3DX0A 4N2IA 2DLGA 4Y4KD 1KCLA 3LPWA 3PPEA 5AVVB 4FLOA 4JFFD 4PJHF 3T2NH 3NCYS 4EN3C 4XO3A 1DUZB 1SXZA 3KCPA 4PY8J 4H0HB 2X1QA 1EIBA 5E1IA 3W9EA 5I1JL 1WEJL 3ARBB 4TNEA 3TZVC 4M03A 1BBDH 2F0CA 4U1KB 4YE4L 1PZCA 4I5BB 4L4VD 3MGTA 3R4RA 1Q94B 2BVQA 1F2XK 4RDBA 2HJFB 1CL7I 1XGUB 1JZ5A 2HWZH 1WBYB 2WXPA 3GEWB 1C08B 4AYFA 4EZMA 3B2DC 1WHPA 1AXTH 4WHYG 2CHZA 4LCCC 1MJ7H 5F9OL 1KNOB 3IDYB 2H8PB 1IAKB 3KPRE 4B95C 4M93B 3K6SB 5CP7B 1F4AA 3EYOB 5DJ2A 2AJUL 2IWEA 3SDXA 3ELQA 1FYTD 1KIUB 5GGSY 3INUL 4HHAA 3DV6A 3FHEA 3P4NA 2YSSA 4JRXA 4F7PA 3VD5A 2QR0B 2BOBB 2CR6A 3O11B 1T22B 3DO4A 4AK2A 4KHXL 5C0NC 4I0PB 3IMUA 4XN5A 4YDIL 4L0YA 3HG2A 3S37H 1I53A 5FF6A 4MCMA 1PY9A 1WT5A 3VXMA 2H4EA 5IW6A 2VZ3A 5FA3B 1XF4A 2EYSB 2QDVA 3U0WL 3O6KH 3TIEA 3AWGA 5EEXA 5LN8A 5DQJB 4AC2A 3L9YA 4YXHL 3U0PB 3C60D 5B38G 1FGVL 5KYYB 4XE5B 4OT1L 1Z3GL 5KYWA 2DYPD 2IPKB 3EFFA 3ZE0B 4BUQA 1VEPA 1UM6H 2XTJE 2V2XA 3OGCB 5IMMA 2H45A 5HVGB 3MRLB 1S7SA 1KJ3L 4WHTB 5JHDE 4EIZC 3IRCA 3BDBA 1Z0MA 4FFWD 1CICC 2E6QA 4MNGE 3S4SA 4BQCA 1QSEE 4EIBA 3FFCA 3Q6GH 4RLDA 3PUCA 4NIYE 2O5XL 3KYNA 4FXKB 2HRPL 3QDHA 5C09A 4NO2A 1MAKA 2F7OA 4P2QB 1R17A 4L05A 1BQSA 1FNHA 1LP9E 3QEQE 5CBEA 1KDIA 4HD9A 4PG2A 2PYED 1VFMA 3U4AA 4MA8L 3GIVB 1YG9A 1U8CB 4HJ0D 4LLUB 2C9AA 3WYRA 4BZYA 1NPNA 4E41D 2OJEB 1OGAA 1YYML 1AXSB 4WEEA 3D69A 1EPFA 3VD3A 1HDMB 3VVVA 1O9VA 1ZT1A 1IEAB 1CJYA 4UQAA 4FP8H 3RWDA 3P0GB 2COQA 4Y4FC 4AQ1C 1CFQA 5E2TL 4J6RL 3VXSB 3ZUNC 2CO7B 1B4JL 2N7BA 1X5XA 4OB5H 3SDDD 3QJFA 1FLRL 4Q52A 2NDFA 3S36H 1JV2B 4AG4H 3DVNA 5FLVA 1DBJL 3QWQB 2GFBA 3VGAC 2YLKA 2G0LA 1NGYA 5DD6A 1RIVH 4APQA 1JGDB 3V4VL 2W60B 1IEBA 1CMOA 4OV5A 3FU7B 1HN1A 4TRPH 5IJKC 2IBZX 5TE4L 3O45B 1DO5A 4GKNA 1L0PA 3F83A 2FEEL 5E56A 1IUZA 4BFRA 5FV2A 4M9OA 4XPFL 3ZHDA 3GTVA 2J8UA 1BFOB 4F7CA 4Z95L 1ZDSA 5DDHB 2ENYA 5KYUA 5JNYA 1T0PB 2X4OB 3AT9A 1WC7B 4WKZB 3KPQA 3NZHH 3TGXA 4V33A 4ZUUA 1TNMA 1BD2B 1DZ0A 2J6EA 1IBHA 2OBGA 1MFEL 3VGGA 1DVFA 3QDMA 1SOQA 2UY6A 3ZBMA 4GKSA 2Q10A 4WDIB 4ONFL 4JM0A 2EVGA 1J1OH 1WSST 1AD0A 3PNWB 4GW5B 1BYNA 5B8CA 1Q1JL 4I1NB 2A2QT 3B1TA 1EA9C 2J2ZB 3OHMB 5KN5A 2CNYA 4HWUA 1YEKL 3NTCH 4W9HC 4UT6H 3X17A 3L1GA 5J12C 2OM5A 3VTMA 2WIIA 1MKFA 4CNIA 4PJ9A 3ZHNA 4DAGL 4M02A 2R0LL 2OCFD 2J20A 3R7QA 1L0YA 1YJDL 1G5AA 1BZEA 4DW2L 1BFTA 1QVOA 4RGNC 1RIUH 1QUNB 3SYPA 1IM9D 5I0XA 5I1DB 3GXTA 1W0VB 4IHOA 3PHAA 12E8H 2EXWC 3HE7A 3AT0A 1JGVL 2WPGA 4B96A 1RVFL 1MCPH 3TZVD 3UBXG 4TQ8A 2YD2A 3P3UA 4ODTL 2BK8A 3P0VH 1NSNL 1X5AA 1JK8B 3V4UH 3BUDA 4AUUA 1AGBA 2DD8L 2ZG2A 3UBGA 4F7EB 1P4IL 1E43A 3JUYA 4YC2B 1MNNA 3RWJA 3JWNE 1H0DA 1CGUA 3WLBA 2FX9L 1Q9LA 4Z23A 1JXDA 1QPKA 5EZIL 2CIIB 1RPUA 2HRLA 3CMOH 2CLZB 3OPZH 4YEFA 1XVSA 2JE8A 2CSPA 3V6ZA 2B9AA 4JE4B 4MJHA 4YHLH 4OAWB 3LRGA 4HZ1A 5D1QA 3RNKA 1G7QA 1BEYL 3M1BA 3HZMB 2B4CL 4LB8A 2PF6A 3BRFA 3IJHB 4Z7QF 5EEYA 4U6VH 2NT0A 5DJZB 5F97E 2QHLA 1KPUA 3DVFA 5F88A 3MOBH 3MXWL 4OD1L 4JFDD 2K78A 3CSTA 2ATPB 3O0LA 3EH1A 4ZMWA 4MQ7A 3TFBA 3BUYB 3O4LB 1I1AC 4YSEA 3O2VL 2Q3ZA 3VFUA 4F7MB 1RY7B 3OXSB 3TA3A 4MJIA 1NEZG 5J11C 1KLUA 4AIXA 1AI1H 2WLZA 4WEMB 2K70A 2GJ6D 3G7TA 4L8CB 3RWGB 1KV3A 5CM1A 2VR4A 4P5TC 4X7DC 1NM4A 3LEVH 3MV9B 2NW2B 2YD9A 5C0BB 1BAWA 4X6DE 5TPWH 2AC0A 3PHQB 4N2HA 1GMIA 3GGWA 1XH1A 4QOKA 1RHFA 3LQZB 4XOBA 2NRDA 1NMCC 1XBDA 4K3EL 2JIXB 4YR6A 3ZQWA 3RTQD 4ADIA 2ZCZA 5IVXE 2CGZA 2PXYC 3RL1B 4HJUA 3LXAA 4IGBC 3TH2T 5IFAL 4OGAC 4WY7L 3INOA 4FG2A 1HEJC 1MNUL 1BIHA 3OHXA 3SKOA 3IXTB 4AGNA 4NM4L 3ZQ9A 1TFPA 3R18A 4MNGA 2Y1VA 1R0AL 2J8UF 3QPXL 3MX0B 1WS8A 2SEBB 5D7IF 5HJGA 5GRXG 2ZUUA 3H9SD 3UBXI 4U4IA 1DQVA 5JUEL 2AI0H 2YQBA 4U49A 1XH3B 1XR9B 5F9JA 2ZXDA 5D7JC 1TU2B 4WI4A 3TS8A 3D51A 2XHNA 2PR4L 1ITBB 4Q0XL 3VRLF 2J44A 3TIDB 1IAIL 1T66C 5KVFE 3VX0A 5JR1L 1EHAA 2VITA 5E8OB 2YFOA 4IW4C 4NUPA 3NH7L 2YD3A 4P46A 2Z31B 5E4EC 4U05A 2K8QA 1J0YA 2XIIA 2UYLB 3HMWL 1I9RL 2AQNA 1PNDA 3O6ML 5AW9B 4CL7A 5DRNB 2X4SA 3LEXB 4BYHA 3L7FB 1U42A 3NPSC 1LNUB 3IXAB 3SPHA 3KPRD 5ADOH 2ZOUA 4JR9H 3NGBC 5JXAH 4UQ9A 1T2QL 2QHRH 4OLUL 1A14H 3NP3A 2F1BA 4OZHB 2GAZA 1XWVA 4XCEA 3E6HB 3I6GA 5I75B 2BSRA 4WI7A 5DUBA 4QNPE 4EBQL 2UXFA 3BJ91 4YHOL 1LE5B 2VERN 4QRQA 1Q90A 1SYSA 2R0ZH 5IQ9B 1K3ZA 3QNZB 3HLAA 2DIJA 3O3DB 2WUCH 4MBOA 3QDGD 1R24B 3UOAB 4ZTPL 4I3SL 1U91A 3ARGC 4QY8A 4MD0B 3I85A 4DUVA 2WYIA 4PM1A 3MV8E 4TNVK 2YAMA 2CRMA 1NFIB 5MEPA 3K1KC 5GIRB 2H2PC 1AS6A 3JV4B 1R47A 2NY5L 3QCUL 4MZ2A 1YUKB 1P84K 2F54B 5JHLA 4MJ2A 4N8VB 1ZVYA 2J56A 2XTJD 3OR6B 3R1GH 5JHDD 4IEFB 3B5TA 1EJOH 3FQ4A 4Y2DB 2P8MA 4ONGL 3SQOL 1ZIBA 2XZCH 3W56A 1J7VR 4U1NB 4IYKA 4HJGA 4KJYA 1QR1A 2WANA 3T3MB 5EF3A 4NKIH 3KWWB 4K9EL 5CLZA 3BJLA 2DQEL 4LPYA 4BFBD 3QEQD 3QR2A 1FV1A 5F0LB 1JVLA 3V4PH 1CYWA 4JZNA 4OCSH 2Z9TA 4XCFH 3ZDXE 3TX4A 4XWGH 2ZWSA 2Y22A 5DF0A 2YPKB 1DVTA 1EFQA 1DN2A 3MRPB 5FCSH 3BVTA 4U1GC 5HI4C 3HI6H 4WO4B 3E6FB 3RJQB 2EYTB 5GHWL 1HQRB 2IV9A 1XGTA 2ESVB 2XTLA 3WXVH 2XWTB 3I50L 2YGVA 5IB4B 3AS1A 2H2SD 3FTUA 4TQEH 1X6LA 3BUPA 3UO1L 5K9KA 1CGSL 1HYRC 3DWTA 2R2BA 2AITA 3HI1B 3DI2B 1HKLH 3TH4T 4PJBE 1OCOB 2PABA 4PRHB 3LKNA 1DFBL 3PWPD 1E5YA 3W82A 3TOPA 5HJDA 3Q8BA 3HE6B 4F8QA 1MREH 3MLWL 1WO2A 5I0ZA 2RIKA 3UGUA 3OAYH 5DZ9A 3VDBA 5SWQA 1JHTB 2XPZA 2NTSP 2DQJH 2Z3FA 2IIJA 1KSRA 3OJDB 1QFWL 5F7UA 3IFOB 1NDMA 1LP9F 2AP2A 3QQ3A 1OF2A 4M3JA 3O4OB 1EVTC 4DT2A 3US9A 1NANI 5K9OA 5EEVA 3HS0A 5F9WC 1G9HA 2A7BA 1MELA 3B5GA 3MQIA 4PLNC 4TSBH 4H4NA 3H7BB 4JDTH 5JPMA 1U36A 3CC5B 3F3HA 3O2DH 4TVPE 1TPXC 1KFAH 2AV1A 2O30A 2HJKA 1L5GB 5A7BA 1GW6A 1CYGA 5KS9B 4EVNB 4K2UH 4IRSC 3KGTA 4X6CA 3QI9C 1LYQA 1L9OA 5GGRY 3C8HA 3CZKA 4MRBA 4IBSA 2PXYD 5I6PA 4IGBD 2P5WE 4OGAD 1G5GA 5F1IA 4YSAA 4AVHA 3WAJA 1YO4A 4MXWH 4WFGE 2BIOA 1EEZA 4Z78B 5CEZE 5EO9B 5BXFA 3RI5F 4YSUA 3CH1A 4IOIA 1ZLVH 5GISL 2VDQH 3LD8B 5H8DA 1FVCA 1GGTA 4MTMA 1I7ZB 2MCPH 2QFPA 4HIXH 4M8QB 5INCA 1T4KA 5DK0A 4N4YB 2YKLL 1MCCA 1HZHL 1Y0LA 4QRSB 4Z7WA 5FGCB 1JSYA 4DETA 4NO0D 3MACH 1IGCH 1M1XA 2LW3A 1Q4NX 1RZ7H 1SXBA 2A6DA 1F45A 3HB3C 5JPNA 3D30A 5F7AA 4WGKA 1EBAA 2V17L 4F7KA 3C8KA 4PW3A 4OU3A 4B3EA 1BG1A 5I76B 1OAJA 5DO2D 2Y7OA 1K5NB 4MYWB 4NHCL 5A6IA 3FU5A 3MCLL 3MJ6A 1KLGA 2XFXB 2KT6A 1IIIA 3FXIC 1TMCB 2Z93B 1WFJA 4ZFGH 1MJUH 1X5LA 2ICWA 5LCVH 32C2A 3QC6X 1JGUH 1KBWA 4JO3L 5I30L 2NW3A 2PCFB 4PN6A 4NZUL 5J3HC 3RWCA 5JXED 1IE4A 5L2JB 1DJZA 1BM3L 3WEOA 1WF5A 3REWA 3S8GB 1NAKH 3MJWA 4NKMA 4RFEB 5DHEA 3HZYA 4JFYA 3ECBA 4QRRB 5EOCL 5F7EL 3IETB 1LO3L 3BRGC 1RULH 4C83B 4MB4A 1TO5A 1I3GH 1V55B 2E3VA 2WK2A 5E94A 3TF7C 4GG6A 3TT3H 1S7TB 4XCYA 3KWVA 1GY1A 2VDOL 5HHQB 3C6LD 5C0CA 5J8OA 3P11H 1CDIA 4NJAL 5LGHH 1MUJB 4HOZA 4X80L 4IK7A 4A68A 2H2PD 4XZ4A 4KPHL 3IFNH 4UQ2B 3VRIB 5T3XD 3KCWA 4NWTH 1P4UA 3O9WB 1FVDA 2P26A 5EIVA 1JZ7A 2G2PA 4BUHA 2R2HB 3ZLQC 3SBPA 2XKNA 4N5ED 3MXVL 2RR3A 1TMQA 3ROLA 2ITEA 4U0QB 3QAZC 1KXQE 3KM1A 2OK0L 3MJ9H 4LAJH 1CR9H 5MI0B 5BS0B 4JFWA 4DKAA 4WW2B 3CK0L 4JGJA 3APMA 4GSQA 5LKNA 4QWWC 5D70H 5HHME 3FCTA 4H44C 4PJEA 3L6FB 1IFHL 1MHCB 2XWCA 2EE6A 1SOXA 1HXMA 3BVDB 4Q2ZA 2YJQA 5C70A 1NLDL 2LGNA 5HI4D 1J8HE 2NNFA 1SMOA 4WRLA 1S8DA 1DEEA 3J7HA 1X7TA 4YHZH 4AYDC 2DICA 5A2KH 2J4WL 3FNKA 4NZRH 3B7SA 3VGEA 1J88A 1QKZH 1W0YT 2B5IB 2WZPA 2HLEB 3FSWA 3LRKA 2ZSVB 3DI3B 2BC4B 1PAZA 4NQDB 5HDBF 5F0MB 5FGSA 1FDLL 3DRTA 2VLKA 4HG4K 4X6DF 4AIOA 5CEYB 2XACC 1YQVL 3B9VA 2ZOTA 2X2YA 5JOPE 2N59A 5D4JA 1KJ2L 3Q5YA 3HAEH 5AD0A 5DD3H 3EJCA 4HGWA 3HN3A 5JZ7C 5DU7A 1S9XA 3O8XC 3WJJC 2ODIA 2RCSH 5DD0H 5BO1H 2CKBH 4OQTA 4ZAKB 3WN5B 3B7YA 2FYVA 3HNTH 2ROXA 4KTEH 3I02B 3DETD 2ARJB 2NY0C 4XBGA 4XNZB 1IBZA 1FL5A 3SKUD 1A64A 3MV8D 2W65B 4N5UA 1XF1A 2EECA 1XV8A 3WHE0 3CBRA 4W4NA 3IGFA 4PJ8B 4XVTL 1P7QD 3N41F 4YK4C 4JZJC 2X87A 3VI4E 4JG1L 3ERXA 1TENA 4GJTB 3TURA 2WINB 5CN2A 1J5CA 2BW5A 4PRPE 4JO8A 1AXIB 5GS1B 2H6PB 1GZPB 1SZNA 4ONHB 4PVNA 2TSBA 4K7FB 3R06B 3UJJH 3W0WB 4KO6A 2FSEA 4ZUSA 1V3JA 2AXFA 1TZIA 1INEH 1R5WA 4P4RB 5AW8B 1U93A 3JWOL 1GC1C 4IBLT 1JNJA 3MI6A 5KVMC 5I0YA 1NKGA 5AWNL 3WHXA 4Y1AD 3SE3A 3LRHA 1D5XA 2E9GA 2X4NA 2KMWA 1UD3A 3V0IA 2V5TA 3PGCB 5F7YC 3L3KB 2WBXA 5I1CL 1C8QA 3BPOB 3MNWB 1F1GA 3HB3D 1CDBA 4LSUL 3ZGIA 3WIHH 4D9LL 4J3OD 4ELKB 3M17B 4Z7IA 4TS6A 3HC0B 5BQDA 1SGKA 2WOBA 3ULUH 4P2OB 1OSZA 1W0WB 5BMFL 2XN0A 4LF3A 3S5LA 1GL4B 4G5AA 1QTYT 5G5DA 1MY5A 4MMYA 5DJ6B 3ZDZF 2Y1ZA 5J3HD 3RA7L 5JORA 4XOEA 3IFPB 2VXSH 1J8RA 1LL1A 2QSVA 4YAQB 1DQTA 4PHZA 4E42B 2IADA 2WVVA 3MO1B 5FFOA 3ZT7A 3QFGA 2D7PA 4R26L 2BNRE 2HLFC 3UJIL 2FX8L 4HJSA 2CMRL 5SWSD 1FC1A 4ZZKA 3D07A 1UWXH 2MRYA 2ZP0T 3AACA 3ZDXF 5LHDA 2YSTA 1AZBA 1T0NA 1T0OA 3FO9A 5T5NF 2CCWA 5JDJA 1BVLA 2F61A 4LSVL 4RVBA 2GYSA 4GBXA 3T77B 5C07E 5C3TA 1U2YA 2Y5TA 5KVDH 1TQCC 5FB8A 4EDWH 3M7FB 2WNKA 3GRWH 4JPVH 2DQHH 1B6UA 4XX1G 1GYCA 4J3OF 2L7UA 2BP8B 5IY5B 3PAYA 3T1FA 3QUKB 3KPTA 3WG7B 4LFHD 1XB6A 1OOWA 4E5XG 5K59F 2FH6A 2ALAA 2P5WD 2AEIT 2LLNA 5HI3C 2Z34A 1PZAA 2JJWA 3OKNA 1NINA 3ARED 1JNHB 4PJBF 5CEZD 3ARDB 4BSJA 4P9HH 1YEFL 4IJ3B 2AK4B 5A6LA 5HGAB 1UKSA 1XF3A 2MQCA 3ARUA 3IB4A 1I1YB 2Q2EB 1KXQA 4I9WE 4QWWD 1XZ0A 5TQ0H 1L9TA 2B0SL 3F7VB 3S37X 4FZ8H 2NXZC 1AD9B 4HT1H 1ACYL 1BWWA 1DJSA 1TVHA 3OF6A 2Q3AA 3L5JA 4JFEA 1WZ1L 2WCSA 3A23A 4BZ2A 5KSUB 4TULL 4G8GA 5B1CA 2NTFB 4F2ME 2I24N 5DMJB 4F8LA 1IQDB 1D5ZA 5ISZA 4DP1X 3GBNL 4LVHB 1HIMH 3FU8A 3I3BA 1CE6B 3B3IB 1WCQA 4G3YH 5EBMA 3V79C 3K6IA 1DVUA 1AZCA 3LZQA 3VRJA 1S5IH 4J2XA 1C5BH 2F18A 4FMKA 4P57B 4PJAB 3WFEL 3MOQA 4MZ3A 2OR8A 4A66A 1IAMA 1ORQB 3VE0B 4R90H 3IDGB 2WO4A 1XCQA 3F58H 3UJTL 4AW4A 3NABL 3DJRA 4DZBA 2MJWA 2BNUA 1XR8A 1D3CA 5JZ7D 1GSMA 4XRCA 5FKAB 1E7UA 1VFAB 3BCDA 2AKRA 2DLIA 5AYTA 3TF4A 5JIDA 2Z35B 3HAEG 1R9FA 1S7VA 1AQKH 3AM8C 5FYJE 3GT6A 1DBMH 1YRKA 4RWYH 4E9TA 2EDEA 1ZXKA 4PI0A 5DFWH 2C7UB 2CGRH 5KW9L 3RUGE 1PZUB 5KYXA 3DVGB 4IKKA 3DSFH 1JVOA 4LAQL 4PGEA 4NM8L 1E2ZA 2VN4A 2VB5A 4WI0B 3LIZL 4FFZH 4JHAH 3MU3A 2VN6A 5HI5C 4NSKB 4HJEA 4AE1A 3L7EB 1AQDB 3O3BB 1YN7B 3GK8H 4H8HA 4GAGL 3S36X 3V6OE 1EANA 4R3SB 1NUFA 1MG2C 4M6ML 3O2WH 5KVFL 3TT1H 5GRJL 3VH8G 5FHBH 1GAFH 3R0NA 1KPVB 1E50A 4LU5H 1DO6A 2IGFL 4RX4D 3VFPB 1MRDL 3PP4L 1JWSB 4MASA 5IM7A 1AG0A 1JK9B 1B4LA 4D7PA 4GSUA 2IC2A 4L5FE 4I0KA 1S9YB 5DRZA 5HHMD 2FNBA 2AEQL 4XPGL 4PGDA 2ICES 1U8JA 4HD5A 4WNSA 4WLCA 2FIRT 1A7QH 3CG8A 4DGUA 1WVZA 1IFGA 1RK0B 2EH7L 3DXAA 4L1TA 1AMXA 4O2EA 4LHUD 4ZFOB 1N3NB 3LXBA 1H3WM 4MCYB 5AENA 4XE0A 4TL5A 3V0VA 1U58A 3RDTC 4AX3A 3SPIA 2Y23A 3UMNA 5D7LB 1J12A 1ZANH 2GSMB 2Q5BA 4MCZB 5ICYA 1PU0A 2YEZA 1T1YA 4PREA 1LK3L 4P2RA 3TTSA 2V9TA 1GGBL 1IC1A 4JY4A 4M5SA 4G43A 1PKQB 3J27A 4DO4A 5M95B 2P24A 3RY4A 3BPCB 1FSKB 4F1ZA 2GT9A 1OAQH 2Y7QB 3KJ6H 4YDZA 3T0EC 3HZVB 4J1UA 4UDTB 3FTGA 1G43A 4QAMB 5EA0H 3UGXA 5JOPD 3VMPA 4OW6A 4Y1SA 3AXIA 4A7GF 3HVNA 1G1OA 4EUPH 2XT1B 3X11B 4PHXA 1OAUH 4P9ML 5D93C 2NY7H 1IGTA 3NIDE 3K46A 5EB9A 1I7UA 2CO6B 3ATAA 1GW0A 1O9ZA 1U30A 3VXRE 5DS2A 3QORC 3GI9H 2M83A 3DO3A 3K7UA 1YECH 3PV6B 2JQZA 4HFUH 2NY2C 2AJVH 5T5FL 5LBSA 4MJ5A 5TE7L 3FPXA 3J2PA 3MA7B 4ODWA 1Q8MA 5EF2A 5B38A 2HLFD 5C86A 2DAVA 4HCRA 4ERSH 2A1WH 4DKEH 5I15L 3EJRA 3QFDA 1U92A 4NUJA 5AVUB 5FWQA 3WNLA 1TVBB 3LVTA 4ZW7A 2W59A 3SB3A 4Z7OB 4LNRB 1XXFC 1RL1A 4R7XA 4WFHD 2V8LA 1PD1A 3HR5B 3L3DA 3HTLX 2R1WB 5MENB 5I73B 5I0VA 2R8SL 3WO3B 3KLDA 1LHZA 4W70A 4N2GA 4Y5YA 3EHBC 4UTAA 1AOHA 2OTWA 3EFOA 4X8XA 4G9FA 4R7DA 4KDWA 5E5RB 3TWCH 4HC1A 3VQ1C 3Q13A 3FUDA 4N0UA 4OJFL 2D7NA 3CN1A 2KQNA 4KTDH 1E3ZA 1FZJA 1CD8A 5H2BB 5HI3D 4H7VA 1MJJA 5K1VA 1QHPA 2ZKWA 5AVXB 3VFGL 3C5JA 3WXWL 4DK3A 4XNUH 3ZGHA 3GJFK 2OSLB 1CFTB 1ZXQA 3L3HB 5E9DD 2H6OA 3GSUA 3UGEA 1ZGLP 3JYCA 3UTSE 3H1ZA 4DK5A 2QPSA 4MAZA 2VKWA 1KB5B 3P4MB 5GGVL 4YH6A 3T4AC 5ESVB 2B1OA 4LOFA 4AL8L 7FABH 5GRUH 3RWHA 5AVQB 3RURA 2EDOA 4ANVA 5A3IC 1NGPH 4PGJA 2NXZD 2O5ZH 5C2UB 1HHIA 4RNRB 4XB7A 4RMWA 3ILQD 1COBA 4NRXB 3NEXA 1YA5A 2YLHA 3TN0A 1A3RL 5DWPA 1YVLA 3MJ7B 4JAMA 1WD9A 1HESA 2CPUA 4G59C 2Z92A 3UX9B 5D7EA 4PJFE 3D3VB 3MREB 3MOAH 4FNUA 2R69A 4PFEA 2CK0L 1HFUA 4F9PC 3G5YB 3CZSA 3PGDA 2XN9A 1RUKL 1AZVA 3GZKA 3BT2L 3U82B 4KNUA 4ZOAA 5LGKA 4WI6A 4Y7OC 4Z7UB 4OZGE 3D52A 3AUWB 2HG5A 2FZ3A 3GSXB 3CZFA 4JDZA 1M3IA 4NLHA 3C12A 2E9BA 5L6YL 3OX8B 3MUY1 2BSSA 2DEXX 5HYJB 1DLHB 2BNRD 4NENA 2YQ2A 4JFOA 1BXUA 2OXHA 2B3IA 2ZXAA 2V2TA 4Z0BH 3KPSE 4RGOL 2R4SL 5AAWA 1UXSB 1WG3A 4ZOCA 2F5BH 2MIZA 4FNSA 4MFHA 4L9LB 1R3KB 1JDCA 1BQKA 2PCYA 1A4JA 4PH8A 2GK0A 2FH8A 5A40E 3LQMA 1IM3D 3CV5A 4LHJB 4WV1C 3AC0A 3GC3A 5L88L 3GSQA 5HHOA 5IOKA 5D1ZC 1GKEA 1X9UA 2WZ0A 3WOVA 1FGNH 4H20H 5HI5D 5C9KA 1KIPB 1TETH 1E8YA 3KPPA 4GP4B 4ZXBB 2E0PA 2BY0A 4CU7A 1H6FA 3JVFC 5C08A 5H4ZA 2ZE0A 3A6BL 4PEEA 1OLZA 2R0WL 2XG4A 4P8QA 4B9KC 3IDIA 4RESB 3PL6A 3NIFE 3HA0A 2A99A 5IBTL 2A6KA 2DQFA 3B56A 3K91A 2PWDA 3P9MB 3T9WA 3LKPA 3D39A 4LP8A 3A4FA 3V9FA 2X28A 2OA9A 2V7HA 3MCKA 3OTTA 3QNXB 2XQ0A 1RJYA 4MMXB 1R5IB 3FSAA 4NQVA 4X9YA 1WWBX 4IRZA 5HY9B 1FBIH 1E9PA 3EJQA 3MMEA 4HXAL 3RE0A 4GSRA 4YLCA 1TYEB 1ETJA 2R1XB 4WNJA 1A2YB 4HMCA 1D5IL 3RPIB 1PQZA 4GAYA 4P3WA 1QATA 1SFDA 2FWOA 1UOWA 3BQVA 5DMGD 4B9IA 3G5VB 2W92A 1U8NA 1Y7VA 2W38A 3RDTD 3W11C 1G7LA 1TTFA 1NH6A 3DUSB 2AJSH 3O81A 1PD0A 4AVIA 2G2RA 3P77B 5IJVB 1NMAH 5FPIA 3F6JA 3RAJH 5I8OL 5I8KL 1L6ZA 3ORJA 3MV7A 1HE7A 1A7OL 1RPQA 3BVXA 3T0ED 3CU1A 2KBGA 3HJEA 1GPOL 3T6WA 2X4UA 3OKKA 4F57L 2NY3C 5CCGE 5IMOA 5GS2H 1NC4A 3RPBA 1A0QH 2YPVH 4ZPVB 1XSIA 4XNYH 5I8EA 4ZMAT 4OQTL 3T0XA 4KXCA 1HH9B 1T1WB 3HMXA 4HCFA 2O93L 1D7DA 3N44B 1NEZA 3ZQXA 4BFKA 4TQIA 5JIQA 2EUZA 3WLWC 1VFBA 4EUPG 1JGLL 2ZKHL 5FYJD 1BHGA 5E6IA 3LB6D 2APWA 4L1DA 1D2OA 5ITFA 4XNMB 3VI3E 1O5DT 2QADC 1ND0A 5I71B 1L6XA 1TYRA 1LTXA 2DWSA 1ZEAL 4PJ7E 4TVPL 4QRPD 1MJ8H 5J56B 4OKDA 3WFBH 3PDDA 4Z0XB 2CCVA 5F96H 4ZX5A 3V5KA 1MZYA 4K23H 2ZWYA 4FD0A 4XNDA 1XQ4A 1CFVH 5BOPA 1B0IA 3N04A 3BZEA 2H1PH 3DARA 2GUOB 2I07A 5EO0A 2ZUTA 4PP1C 4X9IA 5AAMA 2D3LA 1L7TL 3BIKA 3SGEI 2IALB 1EO8H 4H8VA 2Z0BA 2O4EA 1DE4B 1OAYL 3ZTDC 2H47C 1E5AA 1KBGL 2Q8AL 2X70B 1F58H 3AWFA 1AIZA 4J28A 3TV3H 1I9IL 4X5PA 1MAML 2QV4A 3V55A 1UQSA 1WT5C 3U79A 3UTSA 2WV3A 2BSDA 3ZTNH 3VXQB 3HBGA 5A3ID 1U4FA 2EC9U 1T3FA 2D4DA 3B9AA 3U48A 4AH2B 2Y24A 4AIEA 1CC3A 5JOFA 3RUGF 4WUUA 3VXOB 4D0CB 1HINH 1ZT4B 1CFMA 4ZSOE 1QQDB 4XAKE 4BHUI 1IB5A 4LQFH 4LXFA 3DTDA 5IMLB 1QBMH 3EOTL 2NNAB 3HS8A 1TIUA 3JV6B 1KEGL 4XP4L 3RZWA 3OQ3B 4K3GA 4P07A 3CFJB 4LPWA 4PB0L 1RERA 2DWYA 1IVLA 1EV2E 3BDYL 4JHUA 3VXRD 3N1MC 3D34A 4FQ2H 2ZPKH 3K80A 3B2VL 1IZJA 1VGEL 3S6CA 1JF1B 1E28B 2R23B 4PG2C 1BVKA 2X2UA 2DTML 2P9RA 5BNXD 2R15A 3P2DA 3NDZE 3EG9B 4HHGA 3PQYB 4JQIL 3QUZA 3C5ZA 1P7HL 4QHLA 3K2UH 2IBBA 4N8VG 2EH8H 3P9LB 4OZIB 2GTWA 1TZ8A 4G42B 4ZUTB 4CADB 3B6SA 1ZGLA 1EAQA 1HKFA 4L1BA 5D2NA 5ES4B 5JQHC 4NZDA 5D1ZD 1KENL 2Q1EA 3NFSL 4JB9L 1J0KA 5A2FA 1T0MB 3ALXA 4AQEB 4JJOA 2F8IA 1MI5B 3WFCL 5ACZA 4NPYB 4APQC 5KBDA 1V8HA 4B9ZA 5IR1B 3WEAA 4N9GB 3RIFF 4H5SA 1HL4A 1K2DB 1ES0B 5T1LA 2EIZA 2WLNA 3ABKB 1FLTX 1HHGB 3BDXA 4GG8A 4LASH 4S0HA 3PWVB 1MCLA 3NIDF 4X9BA 1YPZB 2VQ1B 1AE6H 1UM4H 4QHUA 2JKJA 3BSZH 5I6LA 3Q5OA 2XI9A 4LARL 1EFXB 4U1JA 4NNXA 1EEYA 1CL7L 3VXUB 1UJ3B 2QGBA 2YPLA 4LSQL 1DVFC 2DJSA 4U7SA 1VGKB 2QGEA 3KPLB 2AXGB 1PSKL 3D85D 4JG0L 2FX7L 4O4YL 3QWOB 3W11D 5DMKA 4UB0H 4IU3B 5B8CC 5TQ2L 2XTSA 4HUVA 1MCWW 3MRQA 3MNVA 4JHWL 1GIGL 3MNZA 4LVNB 5IQOA 1RLWA 2WO3B 1V3MA 5IF0B 3VTAA 1XF5B 1MG3C 2WWKO 3QDJE 4ZQKA 4PP2A 1W72L 4PJ9C 5BRZE 1E8ZA 4NZJA 1MSPA 4MSWA 2GC4C 1X5FA 3X12B 2AJ3A 5I6NA 2FO4A 1RK1B 4JPKL 4FOMA 1WYJA 2LV4A 1K8IB 2P45B 4RA0C 3SQBA 1NCGA 2LVEA 5JDSA 4Y4KB 4Z7VB 4X6FB 2Y1YA 3WLWD 4JFFB 5GPRA 1N5YL 5DI8B 5LGJA 1ZJBA 1YHPA 4NWUL 2YD0A 3ZE1E 3FHAA 5EZPA 5DFVC 4Q9QL 3HE7C 2IANA 4ZNEA 4UQCA 2V9RA 4L4VB 1NCTA 2QADD 3GMPA 4PJDB 1OE2A 4M3HA 2YOAA 1UKQA 3FT3A 1OK8A 4WTXA 5CIPB 5CLXA 5F3BB 5D1XE 3OZKA 3RTLA 4HIEA 3WJLA 3UROR 1JXJA 2JELL 1RZFL 1LE9A 3BESR 1FIEA 5FO8B 1AR1D 4NKQB 2B1AH 1G7HB 1UUSA 4KQ3H 1N6QL 3T4YB 5DJCB 2X38A 2NXYD 4PP1D 1B2WH 1FYTB 4X6BA 3SD2A 1CDGA 5D1QC 1UXWA 3ZTEA 1CG9B 1RZKL 3DDFA 4AC4A 5CZVH 1BFVH 1LXMA 2WXRA 2ZD0A 3Q9QA 2IG2H 3RFZA 1YY9C 5F7KC 1EXUA 3KNBA 3BEVA 4S1RH 1NIAA 2BP5M 4HKBA 3L4XA 2W0PA 2ITCB 4WWID 3WS3B 2HT4C 3QJQB 1CVSC 1WK0A 1YC8A 2LR4A 4Z3EA 2BS9A 3CSPA 4WU5A 5AEAA 3NSJA 4ZK8A 3SDCA 3TA3C 3UH8A 3VXMD 5CCKL 1MH5A 2F53E 4IU2A 4PBVC 5DHDA 1CVRA 5BO0D 8FABB 2WXJA 3WDJA 5A16A 1F4YH 2Q0ZX 3C60B 1FFPA 2HH0H 1SMDA 1FFOB 2EE0A 4A7TA 2CDEB 2DYPB 5EU4A 2DB8A 5GGQH 4CSZA 5E8PA 1NIEA 1TLMA 1DFXA 1OARL 2ZNXA 3BN9C 2UUDH 5EOQL 1U3YA 2DL2A 4OM1L 1CF1A 5E2WL 3IDUA 5J89A 1R34A 2AABH 1AHWA 4GY4A 3EUDA 1MCBA 1BSIA 2E8YA 1TITA 3OHXC 5LBSL 3NIFF 1PX3A 3G5XA 1OO2A 3EO1B 5C09D 5TF1L 1YEIH 2W9EL 2YMXL 3D0VB 1KCUH 4QF1B 4BK5C 1NPJA 4XX1E 4I3RL 1RZIA 3TNMB 2PYEB 2ZAHA 5DXWA 1NOFA 3DROA 3Q2WA 5CD3A 2QZ5A 1BQHB 1OZUA 1UA3A 1NGWA 5L4FA 1AZNA 4E41B 5IFHL 1D2PA 5KJ7E 3WL9B 4X4YB 2DIAA 2PW2B 3QUMH 1H15B 4LLQB 2W0KA 3DMMD 2R27A 3AADB 1I8LA 3RWIB 3EJUA 4HC1L 2WNWA 5DS8B 4P46C 3SDDB 1XEUA 5J7CC 3L8QA 3HC4H 4R4ND 1YMME 5LWYH 3GUFA 5CMAB 2X4PA 3QXDA 5DJAB 4FL4C 5DWUH 2AXJA 1OTSC 2ADJB 4FQHA 2B8OT 1UACH 5JW4R 2HYMA 1NDGA 2GBAA 3CUPB 4AE0A 5I5MA 2VXVH 1OXYA 1CIDA 1S7QB 3U4BL 3QFJE 4JPIA 1U8QB 3RGVD 4MJ4A 1TNNA 4NJ9H 1CCZA 1D5BA 1MF2H 3U1SL 4BFNA 1WGVA 3FCSA 5LVEA 4OF5A 1X7SA 1RHHA 2VR5A 4KJQC 4GRWB 2RQEA 2E47A 4M62H 2VLRE 4LP5A 2OL3L 4ZFFB 4CVXA 1YEGH 4N6RA 4AUYA 4P06A 4KZDH 2DH2A 2OMXB 2YBRB 3FQUB 3U46B 3DRQB 5JYLA 2WZAA 2UWEA 3OSVA 3QIBD 5IB2B 2AEPH 4YBLC 4G6AD 1UADC 2DMHA 1DVFD 1MFNA 1U3HA 3HEIB 1V10A 3IMTA 4GIOA 3VI3F 3L5WB 1INDH 3FMGH 3SE9L 2YUWA 3JSSA 5EPMA 3L9RB 4G6KL 4Y16A 1EXHA 2ZXEB 4XAKD 1KBVA 5INDA 1DCLA 4BQ8A 5IG7B 3KPNA 3OLEA 3D2TA 4PRIE 4L3EE 4UI2A 5I5RA 1R5VA 1YNTA 2FSDA 2JB5H 1BZ7B 4O5LH 2ZQKA 1ACZA 3LDBB 2IDFA 1YN6B 3QZMA 5EIIB 4EZJA 5F70A 5IW1A 3TEWA 5C0AE 5EUOB 1OOAA 5E8NA 3ZX1A 4XOCA 3EH4B 1FH5L 4XCCH 3VO0A 5DFAA 5IEHB 1TZHA 4JY5L 1YEEH 2G75A 4KK6C 3L5XL 2HPTA 2YAQA 4HIHB 4UAHA 4GLRH 4RFOL 3UTPE 3OJMB 4QTIL 3WFHB 1G7MA 3U2IA 4OFYA 3QIWD 2WCGA 2BOCA 3D4CA 3BXNB 2E6PA 3DX9B 4LLWA 5FYJL 4UOJA 2VTFA 5FYLH 3SE8H 2XWRA 3KXFA 1WBZA 4LSRL 4WTZG 2VMJA 3WY3A 5F72S 1UUNA 2CO3A 1XHHA 3L13A 3HE7D 1RZJC 4JQVA 4NZ8A 5DFVD 1FZOA 5LAPA 2HVBA 1JF5A 5CSZB 3ZOAA 4PPTA 2YUZA 3GHPA 4KROD 1AKJA 5EN2B 5I18H 1GS6X 4XP9H 3NFPB 1ZGLM 4PBXA 4GRLD 4N0CC 5DHYA 3GBMH 5AYUH 1R3JB 3WKMH 1TQBB 2A3TA 4UTBL 4ABVA 3HKZA 1KXTB 4JM2F 4LLMB 2WP3O 2JI1A 1OE3A 4H0LC 35C8L 1ITCA 4KY1L 4J27A 1JN6B 3VFTA 5I1AA 1F3DH 1OP5K 5D7IB 3BAWA 4HKJB 2CALA 3Q8EA 4Z5RB 1XGQB 1E4JA 2AAVA 2KH2B 5D1QD 4OCYL 2BHYA 2XJLA 3BP5B 3KPOA 2GTQA 4JFDB 1BBDL 2CLRA 1T5WB 2LLGA 4RSYA 3FL7A 1NCNA 1X44A 1QSFB 1SFHA 3LN5B 3H0TA 2HT4D 2L0DA 3TEZA 1A66A 4JPWL 1KJVB 3HS0C 1U8HA 3DX8B 2HWZL 3FK3A 3G5WA 4JKPL 1CDCA 3UP6A 2GJ6B 3EW3B 1T04B 1AXTL 2K7QA 3ULUE 5DS1A 5JPMC 1MJ7L 3CIAA 4P04A 1I1RA 5ENWA 1LO5B 4G71B 1ZK9A 3L3GB 5DHVA 2BJMH 3WUZA 1FQ9C 3FUKA 4B6ZA 2H26A 4ZBJA 4K7PH 1XMWA 4PJCA 1I4FA 4OI8A 3RTQB 4Q9BA 3UG4A 1ID5I 1OSPL 3HPJB 3WIIH 1FVEA 1MQKH 3QWNA 5BRZD 4H8WH 4JGNA 1SVCP 1CLOH 1U8PB 1UWFA 2EDXA 1AACA 1IKFH 4HEPG 4JDEB 3RVWD 3VG9B 4L37B 3ECUA 3FT4A 1EQWA 5KEZA 2R29H 4G70B 1NFDE 1OV8A 1J05B 1QG3A 5I17B 3S37L 4UINL 1SYVB 3O6FD 4DP2X 5IIEA 3H9SB 1CLZH 5F9OH 4FC3E 1OLLA 2Y2TA 4KNTA 1CGYA 2UWEF 3MZGB 1F6LL 4ADJA 4YO0A 1RUQH 2AJUH 4XZUB 1QBLH 5JPNC 1N8ZB 3VU2A 2I9LA 4K4KA 3RFRA 3MGOB 4HP5A 1GKOA 4J3SA 4GW4B 3D1MC 2E7BA 2PP9A 3APDA 3I6SA 5C6PB 3ZSSA 4HS3B 4FULA 4P3DA 3ESPA 3ULSA 3L5HA 3SDYH 1TUPA 4JLRA 4UCFA 1HXKA 2X4RB 3H53A 3Q6GL 4R4BA 2NMSA 1KB5H 2X41A 3KPRB 3VYNA 5PAZA 2WLLB 3QCTL 2XBDA 3SGKA 1UB5A 2ZX6A 3KDPB 4G8FA 3VXSE 4LSTH 4EI5D 2K4AA 4F93B 4OLXL 4RGMC 3GPEA 5FUZH 4PYGA 4PTTB 5I8CA 1CGTA 2P48B 2YWZA 2QLYA 4OT1H 4NNYA 4ZPTB 4ZO7A 3IU3B 1A6ZA 4ZUVB 3RY5A 1VSCA 3T3PE 4ZYKA 3HNSL 3BFQG 4MWFB 4AT6A 3MVSA 3SHSA 1ZKAA 3QDGB 3FO1A 4UOW1 2OMVB 3QZWB 4LCIL 3FH8A 4FP8L 1K4CB 2WXMA 5GJSH 2F53D 5IHLB 3C5SA 2AF2A 1NKRA 5JPMB 4OB5L 2ZKMX 3AQDA 1HK6A 5CO1A 3ESMA 5DEGA 3S36L 4O02A 2NLJA 4ZMLA 1MVUA 4RMSA 3D0LB 3VFVB 5IHZB 3PJSB 1RIVL 4B3VA 3GLZA 2XTJB 1FNFA 2FWLB 4TRPL 1P5UA 1B9KA 5JHDB 1BLNB 1OB1A 3QBTB 3UADA 1YYMH 1I1FB 1QP1A 2O5NA 3DA0A 2ED8A 3MODL 3KGUA 2BSTB 2KLSA 5IK3A 3EJPA 3M45A 4HMDA 4L2YA 1TJIL 2Y6SD 3SOBH 3IGAA 5E2TH 4ES8A 3B37A 4DO5A 2FE0A 4J6RH 1QSVA 3CPLA 1KCRL 3QEQB 3V5DA 4EQ3A 2A0LC 1VACA 3MLTA 4GXUN 2E6JA 1DBJH 3B2MA 2ORBH 3IJYA 2DWTA 2YHGA 1PEWA 3RVTD 5AVYB 5TE4H 2V5YA 3FB8A 1M3JA 3I75B 4PGBB 4ZJ9A 4K5PA 1PLGL 1UYWH 2ZUQC 4OD2A 4UQBA 3NTCL 4UT6L 1JERA 3WENA 3FQRB 3RVUD 2DWDB 3FTXA 1JV5A 1YMMD 2BS71 4WSJA 4N0CD 3DHMA 1IRAY 1ILSA 2ZWKA 3AB0C 4GAFB 1TQSA 1JWMA 1W16A 1DUZA 1QEXA 1MFEH 4LPCA 2QSTA 3ESNA 4U1KA 4I5BA 1RIUL 2DZEA 2LU5A 4XMLH 4DK6A 1H6TA 3LKSB 1E6OH 1N59B 1DR9A 1B2YA 1P2CB 3ZO0A 4D0BA 2ZUXA 2HJFA 2ISDA 12E8L 1XGUA 4G72B 2VLRD 1C08A 1M7UA 2P7TB 3QRLA 1MCPL 3HZKB 1YEKH 4JX0A 4RQQB 4KTYA 1DLFH 1KNOA 1RJLB 2H8PA 1IAKA 4RIRB 1OKEA 4AEHH 5JW4N 3P0VL 3V4UL 2O6DA 2C3XA 4DAGH 3HFMH 3DSNA 4HH9B 3EYOA 3S96B 4YHML 1DSYA 2A73B 3KYMB 3SCMA 2YRPA 1YJDH 3QT2A 1HZLA 2IMMA 2QQKH 1KIUA 1HWWA 4OBSA 3WIHA 2K6WA 5MHSE 1CE1L 2JCWA 3ISRA 4WFED 3CMOL 4PRID 4L3ED 2QR0A 2BOBA 2Y5QA 1ZLWH 1T22A 4XTRC 1HU8A 4I0PA 4YHLL 3IKKA 5C0AD 3VSUA 3L1FA 4GSDH 2PXYB 1E4XI 5AW6B 4IGBB 3MV9E 4U6VL 5FA3A 3VD0A 4F8NA 4ODTH 4X4KA 3MOBL 2IV8A 1AZUA 3UTPD 4Q9CA 1P4IH 5DQJA 4U3XA 3VFNA 3IMRA 1I7TB 4GLRI 3QJHB 2AAAA 3SE3C 1GOGA 5E6SB 1FL3B 2IPKA 2VXQL 4OZ4B 1AI1L 1EUUA 2X2IA 1OE1A 3OGCA 4DN3H 2ETWA 1QWHA 1U4EA 2Q2LA 4NO0B 4WHTA 4OF3A 1JZ2A 3LEVL 3AWEA 4AVKA 5AVSB 3DGCR 3D09A 1X7QB 3ZYZA 5TPWL 4FXKA 4OJDH 4W9JC 4XT1C 5EFIB 4P2QA 2Z8VC 4JFHE 5JMRA 2XWXA 1KYUA 4W81A 2WCPA 2HVKA 3U6XA 3ZZSA 3NPSB 1ZE3H 3GIVA 1U8CA 4TTDC 3O2VH 4YHNB 1H19A 2HB0A 2GI0A 3MLYL 2E5EA 3N42F 3SPGA 5TFSL 1BREA 1AXSA 3HNVL 2IQAB 1HDMA 1AGCB 5IHWA 3QQ9C 4GS7C 1IEAA 1L6PA 2VZOA 3QAQA 3BH9B 4FF9A 1XIWD 3TJEL 2Z0UA 2AI0L 4NC1E 4QRUB 5D55A 2CO7A 1MCIA 1ET5A 4UDUA 2VCOA 4XO4A 3UG5A 2E4TA 2DIBA 1JV2A 4K3EH 4UOW0 4YDJB 5T1JA 4LL1A 3WKNA 2EVIA 4JG5A 5L4IA 5IFAH 3NG5A 3P73B 1JGDA 3K4DA 1H3XA 3C6LB 2FBJH 3PDOB 1UGNA 5HGBB 2NUPA 3O45A 5AALA 4HUXB 4NM4H 4QXUH 4GBXC 1A4CA 1R0AH 3VFRB 1VF5C 4X6DB 4JR9L 1BVNP 3D50A 1BFOA 5ERWA 2QHRL 5JUEH 3LXUX 5DMIH 1BYOA 5IVXB 2E46A 4WKZA 1WC7A 4QO1B 4Q0XH 4X7EC 1BD2A 3S34H 4WTWA 2NX5E 3KJ4C 1NICA 2P1YA 5EO1A 1AFVH 4AJVA 3TO4D 1XCXA 2F54E 4NKDA 2R0ZL 4HDIB 2K9UA 5B1BB 1H3TA 4J6IA 2HSIA 4WHCA 2WUCL 4D8OA 2XV0A 3PNWA 1QBBA 2VM4A 4GW5A 1JPSH 5ICUA 3TL5A 4ORZC 1O6SB 1FA4A 3AXHA 4YPJA 4QHMB 2IWKA 2J2ZA 5MERA 3HPLB 2OZ4A 3FRUB 4EEEA 1QZNA 2L7QA 3AT8A 2BPBA 2RHEA 1JBJA 3FT1A 3V52L 5H37H 1U8OA 5I24A 4U1GB 3O3AA 5LQBH 3FB5B 3R1GL 3GTNA 4YHOH 3S3CB 1EJOL 3IAQA 2PN5A 3QZLA 4P23D 3ULUF 1J1XH 1QUNA 2XZCL 2OMTB 5I1DA 1W0VA 3PXJA 3FZUC 3GMQB 4TMPA 4NKIL 5T33H 4ALAH 1F8TL 2VLKD 4NUGH 2CIKA 5LAXB 3V4PL 1OM9A 4XCFL 3AXLB 1FPTH 3QCUH 1JK8A 2WLKA 4XWGL 5T1KB 4QRTB 2FT7A 3JV5A 1S7RB 3ZE0F 5CGTA 4Z1PA 1PYWB 3HI6L 4EKJA 2X1OA 2A4ZA 2X2HA 1JXGA 2CIIA 4K71B 2CLZA 1M57B 3WFDH 3WXVL 3A0OA 5C1MB 3H54A 5E00B 3MV8B 4TQEL 5EC1B 2FUTA 4HUWB 5F9WB 4NBXB 2P49B 1K72A 4K9EH 3RP1A 1EH9A 3HZMA 3EDKA 4K5MA 3IJHA 4OH2A 1U0QA 4KJPC 4XN2A 1P7QB 3TO2B 3VQLA 1IQWH 4MQTB 5DJZA 2NY1C 2AQ1A 3TBYB 3ZL2A 3DHPA 4Z8FL 2ATPA 4QUOA 3SDAB 1E2VA 2IDCA 3O4LA 4Z6AT 5ICXB 2VC2L 4F7MA 3OXSA 2OMWB 4PRDB 1P5VB 3FOLB 5E7FA 4L8SB 5D7SH 2QLVB 2DQJL 4ODVL 2A4CA 3IM1A 4YFLF 3ARVA 3RWGA 3S7GA 1OGSA 4L8CA 2QGCA 1K85A 3Q1EA 4WWKA 1BZOA 1E4KA 4QXGH 1OSYA 3NCBB 4Y1AB 5CIPH 1BJMA 2NW2A 3CLWA 5C0BA 5DVKA 3ZDXB 1H5BB 3F6IA 3FC8A 2EDQA 2MQGA 3QHTC 2DDQH 4TSBL 4HPHA 1RZKC 3DIFA 3T3PF 4JDTL 1RZ8B 5CN3A 2WNXA 5IBLD 4K8RC 2YKKA 5KTEL 3L45A 3O2DL 4FABH 3HB3B 1KFAL 1VZIA 4HEME 4HBCH 2N01B 2F7RA 4AJYV 3NQKA 3IXTA 4K2UL 1MRCH 1NKOA 2HKHH 2LABA 2VMCA 3RNQB 5CUSH 3MX0A 1EZLA 3BUBA 4Q9RL 2SEBA 5L4MA 4JY6B 1QFWH 2H3NB 3NCEB 3DPDA 4XB8A 4PJBB 2FHFA 4MXWL 4P5KB 1XH3A 1XR9A 4Y9BA 3FAWA 3Q2CA 4TTDD 1TU2A 3P69A 1P6FA 2VDQL 5LG1A 1A6PA 3TIDA 5HSFA 3ML9A 2MCPL 1TVDA 3QQ9D 2BX5A 5E8OA 1A4KB 3MRDA 2Z31A 5D72H 4UQIM 3ARXA 3DO7A 2TSAA 1IGCL 3MACL 2VDKH 5CFAA 1RZ7L 3VFOB 5FDWB 3L7FA 1LNUA 3FUMA 2Y36H 2F7PA 2JQAA 3SODB 5SWSB 1VFUA 3ILEA 3D7PA 1C5CH 4BFGA 4OZHA 4ZFGL 5LCVL 4MZRA 2UZXA 5MHSD 1JGUL 5GISH 4C57C 4PMFA 4JEGB 1QO3B 3K8KA 3CE1A 4TLSA 5HP5A 43CAB 5DVLA 4FQXD 4PCSA 3RI5K 3S8WA 5IQ9A 3QNZA 4Y5YC 1HZHH 2HN7A 4BV1A 3O3DA 3P2BA 4CJ1A 3T2PA 1R24A 1M7DB 4DGVL 4OF0A 3ASWA 4RISH 2P5WB 3ZU8A 1JPGB 2V33A 2YGNA 1BIIB 2V17H 3AREB 4I1RA 1OTTD 5E6RB 3ZT5A 3GQFA 3RBGA 5GIRA 3H42L 3OAZK 3JV4A 5K33A 1GZQA 1I3GL 1BYPA 3K6NA 3UIZA 3AMKA 1D6EB 3TT3L 4FG6D 4UBDC 3V0DA 2F54A 2VO5A 1ORSB 2EO9A 2B3RA 4FTVE 5HVHC 4W9LC 3DKHA 3P11L 3LZRA 2WBJA 4Y2DA 5LGHL 2ZYSA 3IJSB 1LO0H 1QYGH 4HIJB 5BS0E 5HGHB 4U1NA 4PCTA 3OF6D 5H94B 2XLLA 3KWWA 1NEPA 4NWTL 5EOCH 4JFXA 1VIWA 4JFHD 3I2CH 2EDHA 3ASOB 1LO3H 2VWEC 3PDGA 4HMEA 3TN0C 4Y4HD 4B50A 2VNCA 3PFQA 1HVXA 4GRWH 5H37G 4FLSA 1YLBB 2AQTA 3ULVE 3BGAA 3FTVA 5HYEA 5KBNC 3KGSA 1PY4A 4NQTA 3MJ9L 2YPKA 3MRPA 1CR9L 3TPUB 4KXZH 1XT5A 4WO4A 3BKYH 2GITB 3E6FA 1MWAL 5D70L 1C16B 1HQRA 1B9ZA 1Z6JT 1J5HA 2ESVA 1T2JA 2XWTA 4KPHH 5IB4A 1EZVX 1TT6A 3Q43A 2FR4B 4K0OA 3KYAA 3HI1A 2MHAB 4QMEA 4BK8A 2WYTA 5AKVA 3JTTA 4YHZL 4PRHA 2XPYA 5DLMH 4M1CC 5AAWC 3LH8A 4NZRL 4Y5XB 3BP4B 4GQQA 5F71A 2KZBA 3T5WA 1OQOA 3V9CA 2WLJA 4O2FB 3HE6A 1FZMB 2MCMA 3OC8A 4M7ZC 3TJHC 1EWHA 3E7JA 4QR7A 1OT2A 3L1OH 5B39B 3CK0H 3CDZB 4KJPD 2G9HA 1JHTA 4OF7A 1IGFH 3RRQA 4KTGA 1E8XA 4I77H 2CG9X 3OJDA 5DD3L 3IFOA 3AY2A 3PAVA 2R4RH 2NX5D 5EU3B 3P1VA 3K0WA 1WJ3A 2ENSA 2ZWNA 3PL6C 3WV0A 5DD0L 5BO1L 2CKBL 4OSUL 5FGRA 5CFHA 1J9TA 1CT8A 2LE9A 1GGCH 3CC5A 1D5MA 5HHMB 4KTEL 3EDEA 3JWDC 2X10A 2HPOA 3IBEA 5KS9A 3EKCA 3MAWA 2VIRB 1FDLH 4EVNA 2AXHA 1RLBA 4KX9A 1E2WA 4UIMA 3FU6A 5A2AA 4G1MA 1FNGB 3KDMB 1CD1A 1BA9A 4LHUB 5DJYB 2BIMA 4L8DB 4OZHF 2A74B 2EINB 2EDBA 3DXAD 4FFYA 2NQCA 4IBQA 1JPTH 2D9CA 5EO9A 3L4YA 4UIKH 1KZYA 2JMRA 1KGCE 2IAMD 1I8AA 3P0YL 3ABMB 1RZQA 1SDYA 4XVJH 2X42A 3FRPB 5F9DC 4X7TA 3UJJL 2XWEA 2B59B 4WWNA 4QRSA 1INEL 4YIQB 5BVPH 5ESQB 4P2YA 2XETA 2BOLA 5GZOA 1MFBH 4JKMA 3OD3A 3A4DA 3SGJA 3GUTB 4XGZB 2F2HA 5F1SA 4XVTH 1UEYA 5I76A 3ILDA 4I8DA 4YDLB 1K5NA 4H13C 2WC7A 4NQCE 2XFXA 1E5UI 4JG1H 1OT4A 1SN5A 3JT2A 4KVCL 5AVRB 4NYLA 2Z93A 5KSBE 2BO0A 1QRKA 1G7IA 5KJ4A 1GTNA 2YZ1A 2C9XA 3QIUD 2PCFA 4XN1A 1E9OB 5E6IC 4NFBA 4JO2H 3C6EA 1BECA 2GUYA 5L2JA 4FXGB 4R7NB 3UAFA 1LO4H 4HGKC 4YL4A 3N91A 4KFZC 3VB8A 5HDQH 3T3MF 4HULB 3KE0A 4K3DL 4YSOA 3SY0B 5AL8A 3ULUL 2P28B 4RFEA 1I1AA 4QRRA 1II4E 3VI4B 4MZIA 1TZGH 2JXMB 3IETA 4G8EA 4AQAB 5JA9A 4ZI8A 5I6XC 1Y18A 3MRHB 4DVBB 4PVLA 1EHNA 4WJG3 1CFNB 1X9QA 3PGFH 4C83A 1G7PB 3L9BA 5KAQG 3E3QC 1ZV9A 3DUUA 5I1CH 5D9SB 1S7TA 2GIXA 4G9FD 3IE9A 3SJVE 4DEPC 1RUMH 4LSUH 5AAMC 2X3AA 4EDXB 1KTDB 5I16B 1KC5H 3TBVB 4EI6B 9CGTA 1MUJA 1BQHG 2C34A 3KWTA 5IROD 2OAAA 4N90D 3VQMA 4UQ2A 4UBDD 3VRIA 4LT7A 5BMFH 4PRAB 3O9WA 5IREA 2W5PA 4KVNH 3ZY7A 3RA7H 1NCOA 5KVDL 4CA4A 2XIDA 1IGJB 4LOUC 3GRWL 2DQHL 1ACXA 1TG8A 2E76C 5I9QC 5DGRA 5HYSB 1LMKA 1TTRA 4LCWE 2XQYG 1ZVNA 3KW7A 4WW1B 4WW2A 2IPTH 5CWSA 1B0WA 1XX9C 1EO5A 2N4IA 3LPFA 3NJXA 2FUQA 1LDPL 4G5ZH 3B2XA 4K7PX 5IKCB 4X0KB 1AMYA 1F42A 3UJIH 2CMRH 3L6FA 4P9HL 4AM0B 3MYJB 3MLUH 3UZQB 2XN9D 1P0SE 3CVHA 5TQ0L 4I3GA 3E8VA 2DLHA 5IJDC 1Q0XH 4FZ8L 1AP2B 2BNRB 4HT1L 2ZSVA 4JFQB 2BC4A 4GKZB 4NQDA 3SBWA 3KS0J 4GW1B 4DP5X 5I66A 5ALCH 3NP4A 5CEYA 4ILDA 2NY6D 1A02N 1ZLUK 1IBDA 3BZFA 1QHOA 1HIML 3QUZC 3C5ZC 1YEFH 2EDMA 3T2LA 1KT2B 1IM3B 4G3YL 4I48B 1DJHA 4D9RE 3FPYA 3RZCD 4HAGA 4F3FB 4M56A 4JDVA 5C7XH 3MFGB 4OKVB 5D2NC 5AZ2L 5CCHE 5HHOD 1DQQB 3GJFA 4GP5B 4QTFA 4ODBD 4R90L 4ZAKA 3UZVA 3WN5A 2B0SH 3WEBA 5I1LB 3F58L 4LQ1A 5C08D 3I02A 3RPKA 2ARJA 1ACYH 1JZGA 3X1GA 4ELME 1ZJAA 2OS7A 3QG6B 2W65A 1ETA1 3PL6D 1NUDA 3NCJL 4MDIA 1UCBH 3Q6FA 1QR4A 4PJ8A 4G80B 5I1EH 3STBA 2YGPA 3RWFB 1AQKL 3F12B 2WN3A 1DBML 2KUTA 5FYLE 4RWYL 2QTEA 4FTVD 1C1EH 3VU1A 1KZQA 2WINA 2OL3B 1HQ4B 3DSFL 2IH1B 2X12A 2XKSA 5GS1A 3JTSA 2H6PA 4KMTH 2X9WA 4YWGH 1GZPA 1W91A 4LIQH 4FFZL 2CBOA 3DBSA 4JHAL 4ONHA 4QXTA 5F3FA 3R06A 5AOLA 2WWKT 4IRJD 3W0WA 3V6FA 1O6VA 3ZTCC 4F2MB 3BVVA 4XH2B 4P4RA 3GK8L 4X5LA 3POCA 3RDTB 3X2QB 2QELA 4UM9B 3RKDD 4WEBH 3R0MA 2W88A 2ZUYA 5F89B 3BGFC 1UA6L 4AGMA 1ZHBA 3MRJB 1NL0H 5DRXA 1GAFL 1IIKA 3BLKA 3U7YH 3ULVD 1XZWA 4LU5L 4LNVA 2OYPA 1MIEL 4A6YH 1VCAA 3PGCA 4HIPA 3T0EB 2X4TB 5FW6A 3L3KA 2YWYA 1I75A 4TYUA 4N0FB 3ECWA 3T8VA 1HEHC 3MNWA 2V5SA 4JFZH 3H56A 4ELKA 3M17A 2H5UA 4NKOB 5GSRB 1KCBA 2PWGA 3HC0A 3WAKA 4XPAH 5EORH 3MROB 3BD5A 4UAOB 1DSFH 1EX0A 3HHSB 3PNRB 4P2OA 3RY6A 5MEQB 5TH2A 1W0WA 2HMIC 4FKKA 4M6MH 3JBG7 4RH4A 1E42A 5DJ6A 1O7DC 3LRSB 5E6ID 1KGXA 1MFDH 1WS7A 2OJZL 1KIQA 1MRDH 3IFPA 5I6OA 3DLQR 2FBRA 2F68X 3ASNB 4WW2F 4E42A 1OAQL 2UZIH 3KJ6L 3OR7B 4ISVB 4XN9A 4QRPB 1T1XA 3EO0A