1Z66A

Nmr solution structure of domain iii of e-protein of tick-borne langat flavivirus (no rdc restraints)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
b'TYTVCDKTKFTWKRAPTDSGHDTVVMEVGFSGTRPCRIPVRAVAHGVPEVNVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGDLNHQWFQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Major envelope protein E
publication title NMR solution structure and backbone dynamics of domain III of the E protein of tick-borne Langat flavivirus suggests a potential site for molecular recognition.
pubmed doi rcsb
source organism Langat virus
molecule tags Viral protein
total genus 13
structure length 93
sequence length 93
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2005-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1z66A00
5KVDE 5AAMC 4UTCA 4AL8C 5KVFE 3UYPB 2HG0A 3N41F 5LCVA 2JSFA 4FFYA 5LBVA 3N40F 5KVGE 4GSXA 4AM0Q 4UTAA 5AAWC 1PJWA 3UZVA 4BZ1A 2P5PA 1TG8A 2JV6A 3UZQB 4L5FE 2JQMA 3MUUA 3UZEC 2R69A 1ZTXE 1Z66A 3WE1A 2GG1A 3P54A 4ALAC 4GT0A 4FFZA 3N42F 3N44F 4FG0A 3C6EA 3UAJA 5IZ7A 5JHMA 3J2PA 1S6NA 2I69A 1UZGA 5H37A 5B1CA 1OANA 5IREA 1Z3RA 1OK8A 5GZOA 4UT6A 5KVEE 3VTTA 2R29A 3N43F 2ALAA 3C5XA 4UT9A 1OKEA 3G7TA 5GZNA 5JHLA 3J27A 1SVBA 1RERA 2H0PA 4X42A 4BZ2A 2V33A 5LBSA 4UTBA 1URZA 3IRCA
chains in the Genus database with same CATH superfamily
1S7QB 4ZG1A 3QEQA 3O6FC 3SE4A 1BXVA 3FQ1A 1N0LB 2EC8A 1YPZB 2XPGB 3MRRB 3EFFB 1CYGA 2HFEB 3MGTB 4HFWB 2KPNA 1QA9B 4YZFF 2M26A 3VI3A 3NJFA 1UGNA 1ZS8B 5JR1L 2X4PB 1B0IA 4XNUL 4HCIA 3VYOA 4OBSA 5CBEB 3BUIA 1PYWA 2A3TA 2IAMB 3C5ZD 1SEBB 3LZLA 4HSQA 4JFHE 4M43H 4X7DC 5C0CA 1NCAH 2F53A 3NFPA 4LCIH 1KWKA 1IGYA 1IIKA 4JO1L 3FN3A 4PREA 4DH2A 2IPTL 4MJID 1AY1L 2Z31B 5IOKA 5E4AA 3PABB 4A1RA 2Z92B 4KO9A 3WEXA 2IWEA 1QUPA 3GM0A 4G5ZH 3N44F 4HIPA 4JPIB 4R4NC 3SE8L 4DGIH 4ZW3A 3MGOB 4OCLC 3JTSA 3FQWB 4PJFB 1TIUA 2VB5A 3WXVL 2HVKB 2ZNWA 4AQAA 4N2EA 1FYTE 5ISZA 5LBSL 1DE4A 1P7QB 3ARFA 2YOAA 4KJPC 5F9AC 3G08A 1J0KA 2Q0ZX 5EZJA 4NWTH 1FZOA 4QO1B 3KPPA 3BVDB 3QUZC 3UYRH 1IARB 3K91A 2BY0A 5BV7B 5GSRA 5L6YH 3NCWA 3QARA 3LZRA 3HG4A 2ALWA 2R2CA 2YPLA 1XH3A 2DQIH 4MJ2A 1QWNA 3MJGX 2JKRM 4PRHE 3W9DA 2P52A 1WBYB 2Y0SA 2CE6A 4S10A 4NUJA 2BSED 1A66A 2DEYX 4L8DA 3FZUC 2GK2A 5L4IA 2CUMA 1MHPL 4KTDH 2CDGA 4XT1C 5I71B 3BH9B 2BNQE 5KAQG 4PQXA 2NLJB 2CKBH 4BGDA 5T3ZH 3L6FB 4IRJD 4K8RH 3T1FB 6FABH 3P69A 3VH8G 1AQDB 3HZKB 1BZOA 1HXYB 4G1MA 4MXQD 5F97E 1KIUA 3PHOA 1XEDA 3J27A 3RWDA 3GLDA 1MXGA 3GHEH 4M61A 2J4WH 2UX6A 1RK1A 1KN2H 2GW5A 4R7DB 1PAZA 3P4LA 4X9IA 5C92A 4PJ9A 2F54E 1G7LA 2WMPA 4PN6A 2FK9A 2IFGA 3LDBB 4HLZG 2R1YA 2XKNA 3QDGD 4UAHA 3BPLC 3KPSE 4WWKB 2Q6WA 4JDTL 3DTUB 4B97A 3O3AA 2IDQA 2FT7A 3GRWL 3ZL2A 5IVXF 3D85D 4E2OA 3VXPA 5BUAA 4YJZL 4B96A 4WRLA 1GA2A 4Y5XA 1QACA 3VB8A 3GRBA 5AZ2L 4B0MB 1TU2A 3L5XL 4R3SB 5HGDB 4XNYH 5FOJA 3PDGA 3ZRFC 2XJLA 1MRDH 4HF5L 1XB6A 3QE5A 1J48A 2D03L 4OUOA 4N6RB 2X1PA 4DZ8B 5DD1H 3I85A 2NPLX 3D6GA 4DK5A 1U95A 3MLYH 1TG8A 2G0KA 1EEYB 2B9BA 1C5BH 1TLKA 2WLLA 4GRWF 4OLWL 1ROWA 1CLVA 3FTZA 4L1TA 4RBPK 3N44B 3UGUA 2CCWA 2RGSA 2NTFB 5DURD 5D7KD 4ZAKB 1JVOA 2X12A 4RGNE 3LMJH 1R9FA 1SHMA 4MNGA 5CD3B 2O6EA 2NY6B 1EHNA 2MCMA 2L7EA 1TETL 5AD0B 2IG2L 3QJZA 4H8QA 2O6DA 4WTZG 1G5AA 4J3OD 2HT3C 1U92B 4NSKB 2I5YH 3HBGA 1E4XL 4Z7VA 2OSWA 2WAHA 1J8HA 4KRLB 1CFVH 4BFOA 5ICYB 2Z8SA 1NBZA 5I6XB 1RUQH 2LW3A 4OCYH 1XGQB 5AW4B 3U0PB 3TO4A 3WJMB 3QNZA 1KIPB 1R3JA 1EHAA 2ZPKH 1JWUB 1ECYA 2TSBA 3I6KA 3MBEA 2JLPA 4GAAA 4E9WA 2ADYA 3RGBA 3GS0A 3QEHA 4UB0L 5EC1B 4HVBA 3L13A 4QRAA 3KLSA 2DH2A 3O45A 4P59H 5IG7A 5JMOC 3TYFB 2EDJA 5AOZA 3AAZB 1C8PA 3DDFA 1P5VA 4QRTB 1WBXB 4OB5H 2JMRA 3KYAA 2ZOLA 3QAZC 2J2ZA 4Q6IC 4KXZH 4WW2C 4CN4A 1IAII 2R1XB 5C0NC 2VQ4A 4Z5RA 3PS6A 5E6UB 4UBDD 1J88A 1Q0XL 1S7XB 3L5IA 4OF0A 4DN3H 3S37X 4UTBL 1OKEA 5E2TH 1F42A 1FFNB 4GEJA 4MX7B 5D2NA 5TDNA 1A3QA 1FG2A 3U7AA 4OF8A 3ZE1E 5FKAA 1HESA 3GKZA 5DRNB 1BBJB 3D0LA 2W65B 3FF7A 2YUZA 2ICWJ 1TYJA 1NMCB 4OJYA 2XTJC 4KV5F 1P4LA 5DK0A 2AKRA 5DUPH 3P3UA 1P7HL 3DV4A 4FKHA 5SWQB 4JN2B 4A7VA 4S1QL 5IVXB 1OAXH 3I9PA 2B14A 3QPQC 3ZO9A 4YZWA 5A2FA 1OHZA 2AJUL 2P5WB 1M1SA 2UZIH 4XPHH 4KPHH 1E3ZA 1VGKA 2EDHA 5TE6H 3MJ8A 3NUKA 2H3NB 3BX7C 3DX1A 1W6LA 2XN0A 3JWOL 4XPAL 4K8RC 4J3VA 4POZC 4HEME 4NI3A 5TDOB 3VFOA 1HXKA 3OB0H 1CIDA 4GRWB 4BFBD 3M7FB 1MEXL 1WIPA 5F7AA 4Y4FA 4XPTH 4TM9A 1KOAA 1B0RA 3DPDA 5CCGE 3BE1H 4P8QA 3U7WH 3P4MA 5D7LB 2WWMD 3F00A 3NEOA 5IFJA 3UABA 4F8OA 3CFKB 2A77H 4Y19B 2G75A 4KY2A 4YPGB 1DVFD 3BLKA 1LEKA 2JIXD 3KE0A 4G9FA 2VRKA 2LVCA 3EFOB 1WV7T 1FFQA 1WAEA 2ICWI 1S4IA 4ZSOA 5CJOL 5IMOB 4ELDA 1LO3H 1AO7D 1GGIH 5HHNB 3N3EA 4HXAH 5CCHE 4NWUL 4Q6YA 1MZYA 1F4AA 2NXZC 5FF6A 1QUNB 1U3HA 3E6HA 2W0PA 1EBAA 1N70A 4TNWK 1L9SA 3JWNG 3KLQA 4YQXL 1TJXA 3S3DB 4CJ1A 2MHAB 2H0EA 3P9LA 1YN7B 4O2EA 3FN0L 4P48A 2E0PA 2E9JA 3BZFB 4N2BA 1XXDC 2OKMA 2RBLA 4TQ8A 3T09A 2YXVA 5L9DH 4WO4C 4DEUA 4ONFH 4F5CA 4YMPA 4UQBA 5KYXA 4TVPL 3HG2A 2DDQH 1SQMA 1Z3RA 3A0OA 1L0PA 3IJ7A 1M6OA 2HLFC 1WJ3A 4I4WB 4XN9A 2WCSA 2IDCA 3V0JA 4U0RB 3SCMB 5EEWA 4EOWL 3SDXE 4NN6C 4OFVA 2C7FA 3R8BB 1HFUA 1H19A 1UOWA 5IJKC 4CVZA 1DBJH 1I8LA 3UJIL 3VTAA 4CAGA 1EDHA 1QSZA 3DBSA 3TNMB 4HIXL 3MO1A 1WCBA 3OGCB 1HHHB 5DRXB 1VCAA 2H2PD 1WLHA 1Q72H 2EYTA 1MWAA 4AGLA 1MFVA 1GL4B 2W60A 5CZRA 4GYBA 2E4FA 2B3RA 3O3BA 4P4KC 5LBGA 1WCQA 4RSYA 2CUHA 3FB5A 1JGUH 5FB8A 2XN9A 1QD0A 2VJ8A 3P30L 5GS1C 4K71B 3BJ91 1U8OB 4A2FA 4OJAA 2XY2A 1W72H 3FHQA 2OMNA 4NQCE 3ZOAA 5C08B 3ARSA 2DMBA 4UZGA 1ZTXH 4GRLD 1U8MB 1X4XA 3AT9A 2C3VB 1M6UA 1TT6A 2X4NA 5LGKA 2Y7SA 1NMAH 5IW3A 3GSQB 1LE9B 1GPOL 4XHJC 4QHLB 4M3HA 3VWKD 3PGCB 5SWSE 1W80A 2Y7OA 4NEHB 1UENA 1NBQA 2XG4A 4PYGA 1HOCB 1RUML 2AXWA 3MRFB 5FA3A 3MROA 4KKNA 3UZQB 5E9DA 3GFUA 2OTWB 3U6XS 2V3FA 2IOIA 1YEHH 1AQKL 2GFBA 1ED3B 3LNEA 1P4UA 5DZ9A 2R0LH 1VFAA 2ZOOA 3T8MA 3IDGA 4DCQB 4X4ZA 5E8EA 2ZWYA 4YLQT 3FUMA 4I13B 2WWKT 3ILPA 1BAFH 1J9SA 2P1YA 4GH7B 4MAUL 1FL6B 4DPBX 4BFIB 1ADWA 4HMEA 4RLDA 3WGUB 3F65A 1HXMB 2B15A 4K07A 4ZMWA 2A74A 9PCYA 1CE6A 2HX7A 1D6VH 4AXWA 3AMLA 3QZWB 3W82A 3MKGA 3NRPA 1YEKH 3VFVA 1ZA3B 1UJ3C 3VMPA 1FGNH 4YXKL 1AGEB 1U8PA 1O9VA 3FONB 1BZEA 4LCUB 5KUKA 5L4MA 1ID5I 2NY1C 1AKJA 1W16A 5D72L 2DQHL 1DJZA 3MRMB 1EBPA 3GJEB 4OIIH 4LFHD 4JFED 1IJ9A 1OGAA 1WFMA 3AWEA 1CDJA 4FFYL 3LKRB 3SKNA 3HC0A 5DS1A 3I50L 1KACB 1MLBB 2WKOA 1OM3H 5E00B 2QQNL 3MV01 3RURA 3UTSB 2E74C 3TV3H 4XBGB 3OBAA 4DPAX 3ZX1A 3C5XA 3HMWH 5E4IA 2YC1B 2ZWLT 4LCCB 1ZA6A 2BVQA 3M1BA 3MV9D 3DI3B 4Y4KC 5J56B 1ZSDA 4NQEA 3LNGA 4XP6L 4JO2L 1TUPA 1LD9A 1LO2L 1UVQB 3BLPX 1W9XA 4ZXBD 3PY9A 4C4KO 3Q6GL 3RTQC 5FECA 1H0DA 3M46A 3TWCL 7FABH 3PGFL 1YNKL 4A39A 1J0IA 1KB5L 5FM8A 3RZCD 2IMMA 4HPHA 2XVLA 4IK6A 4QNPF 3DHJA 4S0TD 1IM3D 4JFXB 4LSTL 2X1OA 5TFSL 4A7UA 5C9JB 2ZCLH 4ZUWA 4DSYA 1H15B 1CUOA 3MOBH 5E99H 1P7BA 2X4TB 5CMAA 4N87A 3VFWA 1XAKA 3L3KB 4B9IA 1B4TA 4K94L 2P44B 3PL6D 1M71B 1K3ZA 4DN4L 5KVGH 1JFQH 2NNAB 5C0RL 1LGVA 4JQIH 3T0DA 3ME0B 1H8OA 4OCSL 3QFJD 1E4XI 4ZUTB 2AMGA 1GS7A 2MQGA 4QRRA 3HMXH 3M1OA 4ODTH 2IF7A 4H1LB 3FOMB 1JF1B 3EYUL 4LSRL 5DMJB 1INEL 4OCWL 3WTWA 5DD3L 2MH4A 5KW9H 4TXVB 3RHWK 4WUKL 4IOFD 1ZTXE 2A4CA 4P23D 2EINB 3W11D 4PJGE 1FYTA 2DEWX 1QO3B 1HZLA 1FAIL 2ZWZA 1Q9WA 1T66C 4NCC1 4TOYH 2ZCHL 3QUZA 3RUGE 3HVNA 1KJ3L 2B0SL 3QA3B 4N1EA 2OP4H 1JNNH 2X4SA 4MDIA 3MRQB 4PRHA 5BXFA 1NWOA 2HRLA 2WAQA 4D0CA 4D0DB 4OM0L 3SDYL 2AXGB 3TT1H 3QORD 4YHPB 2OS7A 2NZ1A 2H7WA 5GRWA 4JAMA 2DY2A 1FSKB 3JV5A 5A2BA 5KTEL 2P24A 3A4FA 1PU0A 1TEGA 3MMEB 3ZL1A 2CK2A 1KTLA 1XGTA 5EG6C 3PHQA 3P3YA 3V0WL 4XMXA 5MEQA 3GO1L 1IC4L 1OCWH 5I8EA 5C71A 4JLRB 4AUJA 4NC1E 3MNWA 1OB1A 2PYEE 4NC1C 1JHKL 2ZXWB 3OAUL 3P11H 5LGYA 3Q2WA 1MI5E 2RACA 4PS8A 1KB9J 4GQRA 3WNLA 3G6JB 2OL3B 4TQIA 2VQ1B 4AJWA 1P1ZA 1SXSA 2CIIA 4UM9D 3RL2A 5LWYL 4FCHA 12E8L 4WVRA 3VFRA 4YHMH 3S8WA 3I02B 2VXUL 3T4AC 2F54A 1J10A 1RZKL 4FULA 4WW1B 3LD8B 3UAFA 3E6FA 3MNVA 3IEAA 5D9SA 3TFBA 1RJYA 3D2UB 5IK3B 4ES8A 4LSSL 3KPSA 1DVUA 3VXOA 4GSRA 1RJCA 4IRSD 3BP7B 3TZVB 4KFMA 3PWNA 3RIFK 1MQKL 2C9QA 5LAXB 3SPVB 5F9JA 2IEPA 3A6OA 3FB6A 5HYQB 4HCGA 5EH1A 1FN4A 1O6TA 4YHKL 2BPBA 3K71B 3Q3GA 5D7HA 5FA4A 1EGJH 3VYPA 2K4AA 5DTFB 1LXMA 4GAJL 1LK3L 4O2FB 1WWAX 1JZ8A 3MV7E 3O2DA 4I1NB 1KLUB 1WIUA 3ULSA 4OZFA 3VXRD 1SYVB 5AZEH 1NFDE 2Y25A 4DO5A 5CZVL 2DTMH 3ZZLA 4AMWA 4KITB 5EIVA 1KCLA 3W39A 1AXSB 2QQLL 1XF4B 1V54B 2CGYA 1HL5A 3BRGC 2CLVB 5A2JH 3QWRA 5CEZL 4MD0B 1MFEH 4LLAA 1QRKA 5D93B 4AV0A 1BXAA 4JFDD 1QFUH 5T1JA 4ANWA 2YHGA 3IGAB 4P04A 1HHJB 1E43A 2EC9T 3LXAA 4GW5B 3ZSTA 3KL5A 1KEGL 5DJ8A 3QWOB 5I18L 1ZWIA 3UTPE 2E76C 2WTRA 4PSRA 4JFQB 1JI1A 1ZLDA 3GMMA 4Q8BA 2F6AA 2X4RA 2J73A 3WSQL 3EXJA 1MKFA 2V6HA 1DN0A 4NENA 1YMMB 1EAPA 2DOCA 4JR9L 4QCIB 1YYLL 2NX5B 3NPZB 4HQQL 5FGCB 2EADA 3OAZH 4M62H 3V9EA 1YNTF 3HNTH 3OKDA 4IGBC 3QUXD 4LEXL 1DL7L 4NHCL 4D9LH 4OGZA 4WW2A 4Q6IA 5ALCH 4XWGL 3EYFB 1NCJA 4MJ5A 5CP7A 5JIKA 4XN1A 2HXAA 2PP9A 1DDTA 1BPLB 4S1SL 5I17B 3O41A 1AZVA 4WWID 4A6YB 2BOCA 4PWFA 5FGBC 3QRFM 5IR1B 3QI9D 4P3DA 3NJGA 5A6IA 4P2QD 3LB6C 1M9SA 3EG9B 2WYTA 4IKLA 3GI9L 3CDZA 4GG8A 1MVUA 1RIUH 1HNFA 1ML0A 1RP9A 1OWWA 5C70A 5E2WL 3NJMA 5DMKA 3MCLH 2YSSA 4G83A 3QJVB 2YAFA 2VDRL 2NZ9D 5H37G 4YDLC 3S5LB 5GRJH 2C9RA 4CL7A 5J3HD 3RE0A 3PDDA 2R83A 3ABMB 3UYPA 3WN6A 3IETA 5KS9B 4D9QD 5K9OB 3GLEA 1JWSB 3IU4L 2ZG3A 2CKBA 4L4VB 1CXHA 2CALA 5B3NA 2B5IB 4X6DF 3DC0A 2OX5A 4H40A 4HEMA 3EZ8A 1PCXA 4IS6B 5BRPA 1DVYA 1SLUA 3EJCA 4LVNB 1TCRB 1R5IA 4WHDA 4CN1A 1BQKA 4G7VH 2WQAA 3X3GH 4DNLA 2NUTA 4S11A 3QSKB 4N90D 1D7BA 5E2VL 4CDGC 3L4ZA 3CSPA 4JFYB 1G6RB 3HG1E 3RVTD 1NPUA 1T22A 3OXSB 3PP3H 5LBVA 2NY0C 1WG3A 4JRWA 5EUKB 3KZ8A 2A4ZA 2BP0B 3II3A 4EKXA 1DQJB 4OF5A 1L0YA 3TVMD 5CIPA 4XXWC 3X13B 2EEFA 1AOHA 2VR5A 4M48L 5I1IH 4KI5E 5AW1B 1HI6A 1IE5A 3VJ6B 1LK2B 2DJUA 3KCPB 4IJ3B 4O2CA 4NO0D 3GEWB 4OZIF 5FLVA 1CICC 2A99A 2F18A 4PHXA 2VZUA 3D18B 5KVEL 3Q2CA 4P5TD 1YZZA 1DANU 2ZIDA 4Y2DB 5F7DA 4KMLB 3LSOA 3I74A 2BINA 4WO4A 2VERN 3FTYA 5C1MB 4J3TA 4UU9B 3WO3B 2ENQA 4UZUA 3AG2B 3JZYA 2JNZA 5A16A 4O9HL 2VLRE 1DQTA 1FNSH 3AXIA 3US1A 4RA3A 2HFTA 4TNGA 5F1NA 3C9NB 3X14A 1IBGH 2OZ4L 3ZK0A 1DVZA 2HKFL 2VDPL 4MMXB 2BNUA 3ARED 1IGFL 1EANA 4KROB 4RAVB 3MRIA 1HINH 1AGBB 1DVTA 4O02L 2JF1A 2Z9TA 3NZ8B 1CXKA 2GY7B 4JDVA 4MA1C 5IJKA 1XR8A 3PLYA 3GKWL 5EN2B 3QCVH 3QPXL 2Y9RT 3OAWA 2CSPA 1KB9K 3OKEB 4LCWB 4OD2A 3PDOA 4MAYB 4Z0BH 4PJXB 5GGVY 3L1OH 1BOYA 4CN6A 1MUJA 2OAAA 3RX7A 4IDLA 4GSUA 4GW4A 4MDJB 3MUJA 4P4KA 1XCWA 3T2NL 4BWUA 1ZGLP 5I1EL 4EPSA 5LJYH 1H6EA 5FYKH 2LLNA 2OM5A 1WHOA 3ECUA 3FDWA 1CGSL 5GS1A 3E2HB 2IPUG 1N8ZA 2D7QA 5BQ7A 3AABA 4Q4EA 2WXMA 4NQCA 5KJ4A 4QT5B 5JHDB 3GSVA 5IQLA 4X6DB 3S5LG 3FQRB 5FR3A 3RAJH 1AIZA 3T0EE 3T0EC 3H9SD 4M29A 4JFSA 3CVHL 1F90H 2EIEA 2MOVA 3BGFC 1MCOL 2BSSA 4JGJA 1N2RB 2GUYA 2DMKA 3KPNA 5TQ2L 5SWSA 2X4UA 1GZQB 4NKMA 2Z91B 2VM3A 5MI0B 2MJWA 1M7IA 1MVFA 2NSXA 1N0XL 3JV4B 1DVQA 2V2WB 2YS4A 1LO4H 3CK0H 4JRYE 3B2VH 5C0GB 2BM3A 4FQLL 5G4MA 3IJHB 3RFZC 4FXTA 4GEIA 5CHNA 5E1QA 2OCJA 3MN8A 5T1MB 5LQBH 1TQTA 1IRAY 2R9HC 4K23L 4KDTC 3H9HB 4OZIB 2UXTA 2A9DA 4LHUB 3ZHLA 5LGHL 4Z7AA 1KJ2H 3CSGA 2Q76B 5HYJB 1G7PA 4H44C 4NQQA 3V7AE 1NUNB 3MNDA 1MLCB 3CFNA 3E9TA 4H20H 4H25B 4G6FB 3VXUD 1JIBA 3L3DA 2ZSWA 1C08B 5F7MC 2AAAA 1NDTA 3EJSA 1ADQL 3C5JA 4LPXA 4NFBA 2J20A 3D3VD 4ZFFA 3SKOA 1OARL 3U25A 2V7HA 3LIZL 1I7TA 5F7EL 1AMYA 4D8OA 4OCNC 3LH9A 3QJHB 2JKNA 1UJ3A 2JKTM 4F8QA 3B5HA 4AGPA 4NIYE 3O6KH 2UVEA 4QTHA 3PIQB 4UNIA 3MA7A 4LRNL 4PWEA 4ZI8A 3DMMD 2X6UA 1EZVX 1UM6H 4DVBA 4WHYG 4MQ7B 3A67H 4K5OA 1BQRA 3E3QE 3E3QC 2BDNH 5KZCB 2DLGA 4W6WB 5EU5B 1O9ZA 5F1IA 3MRBB 4W9IC 3CGTA 2YXWA 3CU7A 2J3SA 1BJ8A 3F7LA 5T33H 4MHHG 3VGGA 4I9WD 1IGML 4X4ME 3QR1A 2Y7QB 5IREA 1VHPA 1JK9A 3FNKA 4L1LA 1KPUA 1SEQH 3NCBB 1GZHC 4UQ3A 4KU1A 3K2KA 5CNHA 5E08H 4Y4KA 4APQB 4UT9H 1KY7A 1ETZB 5H8DA 2NQDA 4G7QB 2FX7L 1I3RA 4E42B 4OT1L 2WCGA 3C8HA 1DP0A 4HOXA 4PJIE 2W38A 3DX7A 3RTQA 3S7GA 1CFNB 1KBPA 1KTBA 4KMQA 3ZU8A 2YKLL 2HTKC 3V8CA 4LSVL 3V0VB 4PVNA 5AWNH 1BQUA 3EBHA 3Q48A 3DJRA 4GOSA 3UCRA 4AV5A 3K7UA 3KYNA 2ORBL 1P6WA 2J8UB 1KBWA 1OALA 4YK4C 5DHYB 3EO9L 4HJ1A 2RA1A 2HN7A 5DJXB 5AVQB 1XR9A 2AQNA 2JK5A 2X0VA 2NY3C 4C56E 4EI5D 4Y16B 4BQCA 2BW4A 5LVEA 2FJGA 2IIJA 4X42A 4IU3A 2F74A 3PWVB 1TKWA 4HAFA 3VU1A 3OJVC 3S37H 4TVPD 5C6TH 1Y6NR 4WEEA 3QT2A 3AFLA 2AEPL 3D12B 2MNUA 1FH5H 4D9RD 4E0RA 4XMPH 1T04A 3OVUB 4PS4H 3FU6A 2VN4A 5FYKE 3P73A 1QTPA 1VACB 1IGCH 1W72A 3KG5A 4MB5A 3TPUA 3T3MF 2W9DL 3CE1A 4EMZA 4PCSA 3FT4B 4GAYA 3MRPB 4OFQA 1XBDA 4PJ5E 4IJTA 4B5EA 4EXKA 2DD8H 5E2UL 1BVOA 4R6UA 1GHFH 1C12B 3EGXA 4K3JH 3D4GA 1KV3A 1ZVNA 3BGMB 4B3EA 1R0AH 3ZYJA 4F91B 1V5JA 4FFWD 5J1AA 5FLUA 3BUYB 3VVWA 1E8YA 3L3IB 1IEHA 3DYOA 3WY3A 1LILA 5H2BB 3LH2L 2H0FA 1ICTA 3IKKA 2K6ZA 3V6ZB 4N0CD 4Y4HC 1Y0LA 4PJ8C 3SDCB 3RDTD 1A0QL 4AJYV 1D7DA 1RUPH 1JPFB 1UWXH 5E8OA 2WQWA 3SQRA 4HH9A 3S8GB 1TQSA 2GK0A 4BZ2L 4G70B 3KJ6H 4PRDA 4WNJA 4GI6A 2JCCE 2PYEA 1D5ZA 2H26B 2Y07L 5BUGA 4AMKL 4G43B 1DEEB 4LGRB 4LMQE 5GIRA 1MI5A 5DEFA 1RFDH 2XUWA 4PJAF 1J18A 5ICXA 1JDAA 4Y1AA 2IO5A 1DQIA 1O7SA 1UZ6E 2L7UA 4NHUB 1ZHKA 4X6CE 2FH8A 2VNCA 3AY2A 3K3QA 2ZYSA 3RNKB 1I9JH 3IDMA 3S35X 3T4AA 3AY4C 4ABUA 4ODVL 4BQ9A 2AEQH 4FA7B 1I1AB 1KGCE 2PMZA 4XCYB 4DP4X 2AV1B 4RGMC 5FHBH 4ELME 4KK9C 1T03L 4N2LA 2VAAB 3TT3H 1YEEL 1IAOA 3P9MA 4M3JA 1GRWA 2YMOA 5GGRB 3ZL4L 3NH7H 4AYFA 1L6PA 5DQ9A 4HIIB 2B39A 4PAZA 4UQIM 2DMHA 1BVLB 5EO1B 1BM3L 1CLZL 3U0TB 1ACYL 4FQPA 3FFCB 3QIUB 3GMQA 2Z7YA 4EN3C 4ZS6D 5CWSB 4OVVA 3SOBH 3U9UB 4NPKA 1PZSA 4GIOA 1EUTA 2FT8A 3EO1B 3C2SA 3CZFB 4RFNC 4A7GA 4BM7A 5BV7L 2LAGB 4WUUD 1U8JB 2YA0A 4TLTA 3FB8A 3QP3A 4M1DL 2DQEL 2AABH 1NFDA 1ZVYA 3VSVA 4A04A 5CJ8A 3ZW3A 3QIBC 2CDEA 3D4YA 2DLEA 1HWHB 5GGQH 1E3FA 4GQ9H 3UH8A 4YDMA 4X83A 5A3IC 3MRJB 3HI5H 1BWWA 2WLZA 1MVYA 1QP1A 4D7PA 1R5VB 2C8NA 3WTXA 4URTB 1NGWA 3LN5A 4HKZA 2EVIA 4E5XB 3NA9L 2FJFA 2FYYA 2ZYRA 1KXHA 4RIRB 4YR6B 4I89A 1LP9F 4LARL 2OMWA 3IPEA 1UCBL 4N9GA 5E9AA 2CIKA 4ZTEA 3ARQA 3FRUA 2QHRH 4F2ME 4JGUA 5JPMC 2R56H 1ZLUH 5DRWB 1DJWA 2P5EE 5IB5B 3UIYA 1NDMB 1JUFA 4XNXL 4JFFD 1G4MA 3B7YA 5DUML 5HDQH 2VH5H 3RGVB 3DPBA 3QC6X 4GW1B 4XPGL 4Y5VB 2HFGL 2JJUA 1VGEH 1NFIA 3BQUD 3HMXA 4HXBL 4IGBA 4Q0XH 5FYJL 3RWCB 2A9NL 3U48A 3IYLW 3HS8A 2DLFL 1P5UB 4RRPA 3DX9B 1UUSA 2EE2A 4YDIL 1WEJL 3EFDH 1KN4H 2OSLA 3JUZA 2CGRL 1RXLA 4P9MH 2PO6B 1RCYA 5EU6D 2H9GA 5FGBA 2X3CA 1LL1A 3QZLA 4R0LC 2AHIA 2DQUL 2O5XH 5AB2A 4R26H 1FRGH 1P84J 2P45B 3VI3F 3X17A 4BQBA 3IGUA 3ULVF 1CG9B 4N4YB 3FTGB 2AJSL 2EZ0C 4KO6A 4BCZA 3R4DA 1A5FL 4FMVA 1TVHA 2PW1A 3HUJF 5CAYB 4G6MH 1FCCA 4H8WC 5BW7C 3OZ9L 3WFCL 2P49B 5TH2A 3O2VL 4B9FA 5AOLA 3CFCL 2XWTA 5ALBL 1FORH 4LGSB 1CDYA 1CFBA 1XO8A 4L4TE 4WGKA 1ACCA 5MEOA 2VZSA 1Q0YH 4JM2F 4U7SA 1NA8A 1A7OL 3MV11 3MFFA 4J3OH 1DCEA 3M7OA 4B9PA 5EA0L 1WAAF 3QAQA 3NEEA 2W07B 4Y5YB 3LQZB 2DS4A 3QR2A 2DQCH 3ZIMA 3SOTA 2XYCA 2BY1A 3HE6B 4ECNA 3C5ZC 3FCUB 4MWFA 1T20B 4ESKA 4FQXD 4P57A 2FQFA 3SDAB 1NBVH 1MHHB 2GCYA 3UTTD 1ZT7A 3GGWB 1OM9A 1JYWA 4HHAA 3A4DA 1OW0C 3DK2A 4U1IA 1I1RA 3U1SH 3DYMA 3MV8E 1BM7A 1FVCB 5JW4Q 3HG1A 5DQJA 5KJRL 4RMWA 2AQSA 2ZF9A 2P48B 4UTBA 4NO5B 4TQHA 5I5RA 1W15A 1MCFA 3IDNB 1I1YA 2DQTH 4TNFA 1JNJA 1EK3A 1T1YA 2WWNA 2WVUA 3HE7D 1SYSB 3L3OC 2C4XA 4G6JL 3LNHA 2G4EA 2FCBA 1GR7A 1DO5A 5AAMC 3WNNA 2XWBA 1NC2D 3U9PL 4O4YL 3OMZA 3U83A 4WU5B 3IMVA 3ASNB 1SFDA 3FUDA 1CICA 4E5XG 5FCUL 4NZDA 2I9LB 3CC1A 3IDXL 3U9WA 1JPGB 2BCKB 4OGQC 1AG6A 4YDVB 1QLFA 3RI5K 1CXIA 2D7PA 4YEFA 4GINA 1RZJH 3GXMA 3D39E 5EU4A 2HPTA 1YUHB 3QEQB 4NPYA 2O5ZL 2VLRA 3QHZL 5K1JA 3RVVD 2EVJA 1DBAH 4PUBL 2HH0L 2AJVH 4KTYA 1IEBA 4HUVA 5CILH 3FB7A 1DVSA 1SJVA 4XMKL 3VDCA 2BY2A 3BAXA 4MXQC 3VI3B 3BWAA 3MNMA 3PWJA 5DC2A 3ULUD 1PKOA 3VUAA 1VKXA 3CNKA 2NY7L 1UT1A 3QRBA 5DYOA 1PGRB 4N0FA 4JREC 4F15C 1PYWB 5IKCA 5FM5M 2WQUA 4NKOA 1LE5A 3QDGE 4MD4A 4RDBA 4XBMA 5C0CB 3GBEA 4BSWA 2H4EA 3D9AL 2F53B 3NFPB 1IGYB 2CM6A 4PG2C 4PREB 1IO4C 1U3ZA 4M7JL 4LNRA 1LMKA 1F4WL 3E8UH 3VXTA 1UM4L 1PG7W 3WEXB 1NCBL 1J5DA 4JE0A 5SWZE 3JTSB 5I74C 3BPNC 4WK4B 1JV5A 5KVEE 5F88A 4KX8A 5EOCH 1WFNA 4AQAB 1W8EA 3LXCA 4GXUN 2R0ZH 1CLCA 2OTUA 3T0EA 1ZLEA 5ISZB 3GMOA 2A6JA 1DE4B 4Z7QE 4GBXD 3ARFB 2WO4A 3K1DA 4PW9A 3G08B 1FIEA 2ATPA 4KRPD 1FZOB 1C8QA 4EQ2A 3KPPB 4AIZA 5GS2D 3D51A 5GSRB 4ZNEE 1WZKA 3Q1SL 5GGVH 2VLJE 4P99A 2YPLB 1XH3B 5D7KE 2J88L 4E9SA 1V7ML 6PCYA 3W9DB 1MJ7H 4H0IA 4Z3IA 4NUJB 2CO1A 1X4ZA 4XVJH 5FCSH 4L8DB 3VVVA 3CXDL 3RFZA 1QBBA 4I88A 3V52H 4J3OC 2ESVD 1E27A 4AEHH 2CDGB 4KDTA 4M1GH 3BWUC 2BERA 3GNMH 4ODSL 1G1OA 1YEGH 2XT1B 2EO7A 4KKQA 1UWGH 2BXZA 2DWEA 1V8HA 2JXMA 2YD7A 1UYWH 2HCZX 2OI9B 4JVUA 1G7JA 3MAWA 4FERA 4G1MB 1KIUB 2HG0A 5J11C 3PHOB 3S88H 4IHBA 1A21A 3RWDB 5JORA 1KBGH 2IH9A 5F6IC 4M61B 2NT1A 5F7UA 1RK1B 4PJ6A 3TC9A 2AXJA 2QFPA 4WQOA 1MIEH 5IT2L 1AZBA 4PJ9B 4IRZH 1G7LB 2WMPB 2X6AA 2TRYA 3GXPA 3WTTA 1CU4H 1WD8A 2B8OT 5HDRA 5CGBA 5EIIA 2R1YB 2F8OA 2XKNB 3A6CL 5IF0A 1N6QH 4RFEA 2Q6WB 1U3NA 2D9CA 3HNVH 4UBDC 4MS6A 3O3AB 4PWGA 2JJTC 4ZS7L 1UZ8A 1MNUL 2ZSVA 4V1DA 3F7QA 3VXPB 2WVSA 3ZKND 4ZZKA 2VO5A 2BJMH 1FE8H 1QPPA 4JBSA 4Y5XB 5KSAC 4PJCE 4Z7UE 1I31A 2FLBT 1TU2B 2N56A 2YZ1A 3FOLA 1JZ5A 4LIQH 2X5PA 1OAYL 4UANA 5I1DA 4TUUA 1P84K 5F1KC 4G8GE 3V6BR 3UG4A 4X4MA 3S9DB 2LHAA 1U95B 1GZHA 4W9EC 5A6LA 4IKNA 2WLLB 1ZJAA 3ARVA 5KSBE 1N5AA 2ZNXA 4AI7A 3H2WA 3NSXA 1OSPH 3D0AA 1A6WH 1DQML 4BUHA 1EFQA 2NDGA 4PRIE 4TLKA 3SSGA 4F57L 4M6ML 2VERA 4PJIA 3NIDF 2EUXA 2OK0H 2HB0A 4DKFL 1S5IH 4JFZL 4MNGB 4PRAA 4P2OD 3JBG7 2IWKA 3KLLA 4DGVL 1KTCA 2XRAL 4OF6A 3T08A 1BXUA 4ENED 3BVNA 4KVCL 2VE6A 1RUKH 3KPRD 3U4BH 2KYIA 1THCA 4P49A 4XP5L 1CFTA 4F8PA 1UB5A 4Y2NA 4Z7VB 1QKZL 2RCSL 1J8HB 1S3KH 3S35L 2WWMC 4FFTA 4PGBA 4ALAL 8FABA 1NBZB 4ZFQA 4C56A 2J8OA 1DVFC 3H4FA 3TO4B 3QNZB 5E0FA 1R3JB 5E8PA 4AL8H 3I6KB 1Q90A 3MBEB 5C09E 3ETBJ 1AXTL 3QEHB 3O3EA 4LSQL 4ZMLA 1HNYA 3O45B 4IKIA 3SE9H 5IG7B 2JCWA 3OG6B 3F7PC 1AO7E 4YHLH 1P5VB 5G4NA 2MCAA 1F2XK 2ZOLB 2J2ZB 3B7UX 3T0BA 3LKNA 3K6IA 2V33A 2HUEA 3O2WH 3WV0A 4Z5RB 5BMFH 1X5ZA 4XMUA 4BJLA 4BH7A 3C2AL 3QG7H 2Z65C 3AQZA 4BRVA 2AP2A 3TCXA 4ABQA 1PPIA 3FN9A 4FQIL 1EMTL 2ATKA 4LLYA 5D2NB 5TDNB 3U4EA 1FG2B 2KH2B 1QX1A 3NCEB 5FKAB 3K5RA 3I6LE 3QCUH 4H88H 1MREH 4QHUA 2EKSA 3D0LB 3DHMA 2J56A 2GJRA 3IJYA 4MJ6A 5DJZA 1P4LB 3GUTA 1OCRB 5DK0B 2AKRB 3ZXAC 3UTQA 2ARJA 2DKUA 3F7YA 4PYHA 3DV4B 4QRQA 1G0YR 5E7FA 5EEZA 3WNMA 35C8H 4PJ8A 4F37K 1NICA 3NOIA 1VGKB 3J8F7 4Q56A 1MFAH 3MJ8B 1JGLH 3LS5H 2K0RA 2H2PC 1KJ2A 1JCKA 1ZSHA 2ZWNA 2JCCA 2DTSA 2QDVA 2EDLA 3VFOB 1L7IL 2EVGA 2FNWA 2QGEA 2X3BA 1G9MH 3QDMD 4Y4FB 1B0RB 2KZWA 3QQ9C 4JKKA 3LEVL 4J2QA 3P4MB 5IB2A 2BCMA 2F1AA 2Q20A 3NIDB 5IFJB 3AY4A 4BQ8A 3SYAA 2XQYA 1KBVA 1LEKB 2G75B 5GZND 1JPSL 3RIAK 3RVWD 3OWEA 4G9FB 5JHMA 1QRND 4ORZC 5G4OA 2IQAA 5LG6A 5A2LH 1T7XA 2EEDA 1FDLH 4ELMA 4ZSOB 4KVNH 1MJ8H 2CDFA 4RNRA 5F9OL 3O4OB 1J11A 3NFSH 2GYSA 1KYOJ 3CPUA 1KIQA 4CNIA 5M94B 5FF6B 1U3HB 3E6HB 3FBKA 4QY8A 1FIGL 1IAIH 5C07D 4EN3A 4LIQE 1XWVA 4GNKB 2K7PA 4NUMA 5E9NA 3P9LB 4O2EB 2G0LA 1YSOA 4M8UA 3PNRB 2NY4B 3FU5A 3V0IA 1HX0A 1HVXA 4UT9A 1I9IH 1A7BA 1YPZE 3QIBA 2I85A 2H1LM 2QSCL 5DYFA 5KYXB 4YXHL 1R3HA 4YHOL 3F3HA 2BSRA 4NZTH 3P77A 4TL4A 3CV5A 1M6OB 4AYMC 3MLRH 1XH2A 2MKWA 4Z3JA 4JPKL 4OQ1A 3M07A 2KLRA 1EZUA 3VGFA 3VSQA 1BIIA 3BZ5A 4CGUB 3ARWA 2AI0L 4JB9H 1KENL 1YC8A 3ZE0F 1WP6A 3H0TA 4TSCH 5F93C 1E4WL 2DWXA 2YA2A 4W81A 1QSFD 3C6SB 5JQHC 3ATFA 3MO1B 1S78D 1MCWM 5JPMA 1WCBB 2GC7C 5LXGH 2OL3L 2WKOF 1QLEB 2EYTB 1SVCP 2X89A 1MWAB 1ZLSH 2P5EA 3UJJH 4NUGL 3WTSA 2XXCB 4R7XA 5IJCC 1G9NC 4AL8C 2W60B 2XX1A 2NY2D 4G11A 3ZYZA 3WN5C 2BO0A 3O3BB 1A4CA 1JAEA 2EDFA 4JFEE 3FB5B 4CC0A 5FB8B 5I73C 3N40P 5BZZA 4X98A 2XN9B 3DVNA 4OLVL 1DEDA 2VDKH 5EO0A 3L08A 5HGGS 3AS0A 1NCCL 2IH3A 1QASA 1OTUD 2O5NA 4BH8A 1IBZA 1HH6A 4O58H 4BFNA 1D9KD 5ITFA 3TIEA 2OR9H 2X9XA 4RQQA 2PWHA 2X4NB 2FLRT 4NT6A 3MV9E 2F7IA 4R0LA 4OLZL 5I15L 3GZKA 1BD2D 4MZIA 4Q89A 4YGAB 3VG9C 4GS7B 1RL1A 4IBSA 1F41A 2WLIA 5E5UB 1KIRA 1AZUA 4OH2A 4ZXBC 1FFTB 3D0VA 1I8UA 1KCSL 1RZFH 5BW7A 5LKNA 4GKLA 4OVUA 4ZUVA 2XG4B 5FA3B 3MROB 1PVHA 1LJMA 3UADA 3RZCC 4MVBD 2OMUB 4GQPH 5E9DB 5E1AA 3WDIA 4L4TA 2VXTL 2YAHA 2GFBB 2X2UA 3AT8A 4HMCA 3U30C 5B38G 5DXWA 3Q5YA 1VFAB 3IDGB 2WNKA 3ZDZE 4XBPA 3PL6C 5E94A 3C5ZA 5E8EB 4C4BA 3ILPB 3GK8L 3Q9QA 1MCLA 2ITEA 2J1KA 3DO4A 1NEPA 5INCA 5F2FA 3BAJA 4RGOH 3B2MA 2A74B 1CE6B 1AP2A 4YZFE 4RWYH 4AXWB 1Q0EA 4ABVA 3MV8A 4ANXA 1NIDA 4PP1D 32C2A 2ZXAA 4JPWL 3VFVB 4FQJH 3LH8A 3ARTA 1U8PB 1YEWA 4IOFC 4MJ4A 1AKJB 1J0ZA 3W11C 4DKDC 2R69L 4MNQD 5DD0L 3UIZA 4CMMA 4ZW8A 4TSAL 3MLZH 5EF2A 3HPLA 3ZE0B 4LT7A 1OGAB 4W9FC 3HAEG 1MRCL 5AAMA 1O7DC 3SKNB 3HC0B 4IDJL 4M4RA 4ABWA 3DHUA 4A6YL 3IS1X 4KKLD 7PAZA 4W9HC 4ZMNA 2IAMD 4XB3A 5CINL 4LSPL 3I9GL 2DM2A 4U6HA 4QXGH 5JOPE 2ZJSH 3O6ML 2G5BA 4JO4H 4J4PC 4U6TA 3SE8H 3V9CA 1ZA6B 1FWXA 2BVQB 2BSEA 3M1BB 1PQZA 2GTWA 2XQBH 2YD3A 3VW3H 3R1GH 1ZSDB 4NQEB 5DQDL 5IQ7L 4XZ4A 1A7PH 1W0WA 4UTAH 2R8SH 1CXLA 1LD9B 2AQ2A 5KVFH 4HD5A 4UIMA 2CPUA 3LZFH 4LAQH 5DMGD 3UAEA 1H0DB 4ACPA 1R3LA 3HBPA 5FECB 4U6YA 1GZPA 1T0PB 1FZJA 3QNYA 1KLFA 3V0EA 3VGBA 4U49A 3HA0A 3K6DA 4E9QA 8PAZA 4GSQA 1HYRC 4OLYL 4ZUWB 5GRUL 3LHPL 3VFWB 5CMAB 5HI5D 4OI8A 4HOZA 1OAQH 4LDEB 2R0KL 1MH5A 4J12A 4NIKB 1SFHA 1ILSA 2WZPA 1F97A 3GXDA 2Q8BH 3QDGA 1INQA 3RA7H 5DWPA 4PRBA 4W6YB 2DYPD 3NFNA 1QZ1A 3OXRA 4IRSC 1N5YL 1GAFH 4J6RH 3FT1A 4QRRB 3D85A 4KC3B 1AACA 3UG5A 1UXSA 5D6DC 2KHAA 5E8NA 4HYTB 1XSJA 4HWUA 4KMTH 4RETB 4XZUA 2R0WL 1KYOK 3GLAA 3H9ZA 4KO7A 1DSFH 3ERXA 4BFJA 2BHZA 2NR6D 1X7TA 3DECA 1FYTB 1NCWH 2ADFL 3ESNA 3K8MA 4A2MA 4DQOL 4FLRA 4WEUD 1Q9WB 2FJSA 3GZQA 3QUZB 3DGDA 5HD8C 5J13C 4JDTH 1Z9OA 3MTXA 3OPUA 4ZQKA 1A3LH 2X4SB 1IZJA 4KJQD 1VAHA 4MDIB 3HS0A 4PRHB 3U7YH 1YG9A 5BXFB 4HJTA 4R7LA 5FYJD 4WWKD 4D0CB 4JO3L 3CMOL 5BO0D 1M7DA 3TCLA 2Y5QA 4JAMB 4AC2A 3L5XH 3GJFH 4U7MA 1JNLL 2P24B 3MLUL 2BZCA 4CSPA 2P4AB 5JQ6L 4GRWE 1KTLB 1XGTB 2DBLL 3PHQB 5MEQB 5I8EB 3MODH 4WW2F 4X6EA 5FEBA 3MNWB 4OLWH 1OB1B 1AIFA 3HZYA 1YUKB 5I0ZA 5J6GA 1PBYA 3EBAA 3TBTA 2O61A 3Q5TA 2X40A 5IHLB 1P1ZB 2CIIB 3RL2B 4PTTA 4A63A 3VNZA 4NCDA 1QR4A 4ZODA 2V5SA 1NM4A 3VFRB 2UZXA 2X88A 2ZUXA 3WAKA 2F54B 3NZHH 5T5NG 3E6FB 1T80A 3RX8A 3MNVB 4WGVB 5D9SB 1MIML 1RJYB 3BPLB 2Z93A 5EBWA 3KPSB 3A23A 3VXOB 4XCCH 2FO4A 3LV3A 5IHUL 2NY6D 2P28B 2JJTA 1UACL 2UVFA 2OJZL 4WFFE 4F92B 4W9GC 4MD5A 1NCGA 3PWNB 4DUWA 4KZDH 2EDKA 2ZXBA 4FG2A 5KSAA 5F9JB 3FB6B 4WJKB 4UV4H 8CGTA 1FN4B 4PJCA 1A7QL 1AHKA 3Q3GB 4Z7UA 5DDHA 5FA4B 2EDYA 2BRRH 3OC5A 4G8GA 2EDBA 4KQ3L 1K2DA 4JY5L 1HCYA 3ULSB 3APNA 4OZFB 1KCKA 1A4JA 4KHTL 5KUMA 1B88A 5KSBA 4X99A 3RX5A 2NZ9C 2YD8A 2YR3A 1DJSA 5J3HC 3W39B 1JERA 1Q0XH 3KYKL 1RIHL 4PRIA 1AMXA 1XV8A 3SODB 4IKJA 1F4HA 3DSFL 2YUWA 4QD2E 4YHIA 4M7KL 2ARJQ 1C5DA 3MLSH 1GGBL 2EAEA 4U3XA 2BWIA 3F7KA 1T6BX 3OKMA 1ADQA 2Y23A 3U0WL 5DJ8B 2A1WH 1Q4NX 1ZWIB 1L7TL 2WTRB 3MBXL 2K6YA 3FH7A 4N90E 3BKMH 5J5EA 1FQ9C 3GMMB 2EXTA 2X4RB 3Q0HA 1DVFA 3RVTC 1CC3A 1OK8A 1DN0B 2JIXA 4NENB 2XG5A 2M2DA 3EO0A 4AVHA 1EAPB 4HWEL 2G5UA 4HT1L 5IROC 1NEUA 3TVMC 3T0WA 5FDWA 5FO7A 2ZAGA 1AO7A 3ZT5A 3OKDB 2AK1L 2GIXA 2QV2A 1E7VA 2R59A 3GIZH 3L9BA 3GUFA 4MB3A 3QUMH 4L0YA 1AR2A 3BAEH 3QAZB 4WW2B 4Q6IB 2KL6A 4MJ5B 5CP7B 4XNMA 4JL1A 1OCCB 3N9GL 4PB9L 1CZ8L 2YPKA 2C9UA 4ZO6A 4P5TC 2VXVL 3O41B 4KH2A 4FNRA 5D70L 2BOCB 2FGZA 3W2DH 4WF7A 4MDRA 4P3DB 1K72A 3WYRA 3ZE1B 3NIFF 3QRGL 4XN2A 1W0YT 2Q5BA 3EZJB 1QSVA 5CUSH 3V55A 4XE0A 1CF1A 4WFGD 1JYXA 4QLWA 3MCKA 3EH1A 4NNYA 3EH5B 3CDZB 5KYYA 3PWPD 2EH7L 2XTJB 1MVUB 4GG8B 4Y19D 1YEFH 5BNXD 3CN0A 1DQDH 1WA1X 4K7PX 5DMKB 1IZKA 3AREC 3P0VH 2YSSB 5F44A 1UUNA 2WGNB 1K8DA 3CZJA 1GMIA 1JTTA 3GB7A 1NANI 4P2RD 3U36A 4XMLL 4NO2A 4XMWA 3UYPB 3IETB 4QGYA 1QWUA 3ARRA 4TUKH 3RKDD 1B3JA 3AG1B 4A2EA 3CSTA 1RZIA 1T4WA 3FJTA 2CKBB 4TVSa 4IBQA 3AITA 4LU5L 1TZGL 1L6ZA 2L3BA 2OX5B 4TVPH 1EHXA 1WTGT 5DZOA 3UYOD 4DKTA 1R5IB 4GFXA 2YPVH 2QELA 2JQMA 1YEJH 2HRPH 2NUTB 2R2BA 1T7YA 4FQCL 4IRZA 4TUOA 5FYLL 5FUOH 5ACLA 3CFIC 3SBWC 1T22B 4OZFG 2HJKA 3K6SA 3T1WA 4XN8A 1KEML 1PDKA 2ZKWA 4HIQA 4GP5B 5CIPB 5DHVA 3SCMD 4AYEC 4L3AA 1KTDA 2KQNA 4HSCX 5F3HA 1HI6B 2YJLA 1LHZA 3FCTA 3RRQA 3HKFA 2ZWSA 5J1SC 2MEJB 4XNAA 2OYPA 3CAFA 4O2CB 4OFPA 3EOAA 4AQ8C 2IGFL 3LPWA 1I7ZA 1E5AA 3WMPA 4PRNA 3FPYA 3K2UL 1AYOA 2NYYD 1DTUA 1E5ZA 4NGHL 4XPBL 4R97C 3ZHFA 5TPWH 1JXKA 1UXLA 5F7DB 1JGDA 4X7SL 3LSOB 4WO4B 4NUPA 3H8NA 4GKNA 1EEUA 1KGUA 3O0LA 2YOCA 4OQTL 4FYRA 2QVTA 1BYOA 2LOEA 1MCBA 1ODAA 5A16B 3L1FA 5J8OA 1L9NA 4XO4A 6CGTA 1G7IA 2HP4A 2BH0A 5F1NB 3X14B 4ZZFA 3C8KA 3IFLH 2BNUB 2FSDA 2X2HA 3T77A 3MRIB 1PNDA 5F9DC 3NIFB 1URIA 4JY4A 3NN8A 4JDVB 3ZY7A 1XR8B 4M93C 4B9CA 2H1PH 2VL5A 1T7VA 4ANVA 4CDHA 2EDRA 4OD2B 2L0DA 3PDOB 4LLVA 4FHKA 1E9PA 5ILTL 3D33A 3SY6A 3ZYIA 1MUJB 1BQLH 3GSRA 5B7EA 5IP4A 1T89C 3WN5A 4R4BA 4GW4B 4LQ1A 4P4KB 4OFKA 5ID0A 2F8XC 1JG9A 4FLSA 3DMMC 2R23A 4JFEA 3VGDA 3ECWA 1NJ9A 2C9VA 5GS1B 5ITBL 1J1PL 1N8ZB 2KLTA 2ENSA 5BQ7B 2MPAL 3A4EA 4NQCB 3UG3A 1LLAA 3S4SA 3GSVB 2LU7A 1MW2A 4JX0A 2C4FU 2Y6TE 4KRMB 3KR3L 2F9BT 4I0CC 5IJBC 2N01B 4YX2H 1CL7L 5FO2A 3MV9A 1OD7A 2DQJH 3HI1A 5TDPA 3FRPG 4JHBA 5HXMA 2BSSB 3MJWA 1FNLA 2I07A 3OLGA 3KPNB 5JTWA 1XSIA 4KXDA 1JDDA 2X4UB 4NKMB 5EOQH 5SWSB 4ZXBA 2YD5A 2AGJH 4ICXA 25C8L 5AYQA 1M7IB 4F7KA 5HGAA 1UD2A 2RD0A 3OPZL 2BIQA 3ML9A 3IWUA 4KZEL 3RZCA 5KBDA 4P9HL 4JM4H 4BFKA 2A38A 4QXUH 4YDKH 3NJXA 4N22A 2QQNH 3HN8A 1ZHNA 2VYRE 4UDTA 5CHNB 4PW4A 1UA3A 3S3JA 1BGXH 2GY5A 2V2TA 4YBLC 4WI2A 4XVSL 4IMLA 3PXLA 5B7MA 3L16A 1I7RA 5JIPA 3PL6A 1XDTT 4IK7A 4EI5C 2ZP8A 1PX4A 2J8HA 2OCCB 1AJ7H 1G7PB 4XP6H 3BLBA 4YN3A 1UXMA 3L3DB 2ZSWB 2BP8A 3QFJA 2V3DA 1P4IL 3C5JB 2VL4A 1Z32X 4B50A 1FGVL 4MHHI 2FUQA 1YAZA 4UT6H 3SKOB 3TWCH 4QNPE 4ZFFB 3OF6D 1WFTA 1BHGA 4HJJL 1XGYL 2V7HB 3I75A 4P5MA 1I7TB 1NM9A 4AYGA 5F3BA 1UWEH 1BVNT 5E5MA 4P5RA 1UJ3B 1QBLL 3S36L 3PREA 4LSTH 5DD5L 3K4ZA 3ELQA 1IBDA 2NY1B 4I3SH 4QTHB 1DQQA 2D9QB 3QEUA 3MA7B 3HBQA 1T2QH 4GG6A 1D5IL 2IC2A 4DVBB 3NIGE 1CI3M 3N85L 5I1JH 5EZOH 3Q43A 4ZFOA 1MPAH 2W92A 4QOKD 4N24A 1DUZA 1H8NA 4OCSH 4FFWC 5F1IB 1CTMA 5AOKA 3WY4A 4HKBA 4XGZA 1ZEAH 1JK9B 1KPUB 4J4PA 4U1NA 4HBCH 4UQ3B 3EYUH 3DOHA 3EUDA 4Y4KB 5AW2B 1QLRA 4K5NA 4N0CC 4EDWL 2IV9A 1NCNA 1CO1A 1I3RB 2ENPA 3RDTC 4Z76A 1NCUA 5KBKA 4ZTPH 5CJQH 3V9FA 2QGDA 4NQUA 3DX7B 4QHKI 1TQUA 4GY4A 3RTQB 2K1MA 1ECZA 4TNVF 4UDUA 5TQ0L 1SOQA 4XMTA 3GDCA 2CK0L 3ZUNC 3BKJH 5EWIH 3KYNB 2FX8H 3GDBA 3NP4A 4QIRA 1VPOL 3WLWD 3CHOA 4AG4L 2HN7B 4JRLA 4LNVA 1KB3A 1XR9B 2JK5B 5F8QC 2WQ8A 1CGWA 2HRHA 5ES4B 2FJGB 4IU3B 1ZLVK 2F74B 1TKWB 1VZGA 1U4FA 3N1MC 4A7GF 3CZUB 3FCGA 3LRKA 4U0QB 5GS0L 4WWNA 1FL5A 4E0RB 4PGJA 3ZLQC 5I6LA 1IC4H 2IPUK 1T04B 2Y2TA 5JMRA 5LCVH 5D6DA 2F19H 1ZS2A 2X7LA 2XV2A 3OAUH 2XN1A 1D2OA 3P73B 4IBZA 5IBLD 4CUCA 5I75C 3NEXA 4RISH 1JRHL 1W72B 4ZS6C 4QJ5B 3TPUB 3DXAD 1XB3A 4U33A 2YK1L 2WVTA 3DVFA 3NAAH 4WUUE 4GAYB 3VXRA 4Z3EA 4M5YL 2PXYD 5HI3D 4OJEH 5CN3A 3EGXB 1OQOA 2VDOB 2Y06H 5FUCC 4ZRGA 3ATEA 5D1QD 1SLVA 4WCYL 5CGTA 2B08A 5J1AB 3VD5A 2V5TA 1UKQA 1IBFA 4KQ0A 4QTIL 3IXTA 4AIEA 5I1HL 2V8MA 2QQQA 4JFDA 1UWYA 3UJTH 5D71L 4BKSC 4M1CC 3KGRA 5E03A 4I77H 1Y0LB 2AITA 2X4OA 4NQDD 4GAJH 3U6RA 3ULUH 4H2CA 1EQWA 5E8OB 4K3EL 3NJIA 4HH9B 3QO0A 1MCNA 3BT2L 1QFWM 4M56A 3MOAH 4YDNA 4UUJA 2GK0B 4PRDB 2VR3A 1MDTA 1ZHLA 2E6JA 2PYEB 4GXVL 5CZVH 3ULVL 2ODIA 1D5ZB 4JKPL 1FZKA 1TTGA 5GIRB 5IBUB 1UA6L 2I60L 4CVZB 1MI5B 5DEFB 1NL0H 1N6VA 1JZFA 3G6DL 5ICXB 1A25A 1WAPA 5A40E 4Y1AB 1SQ2N 1ZHKB 3T5WA 2GBVA 1E50A 3O4LE 1L9QA 3QCTH 2WPGA 3IDMB 3T4AB 4AUYA 5CU5A 5F1SA 4G82A 2FEEI 3N0PB 2LFGA 4RMBA 4L1BA 1J5OH 1CYXA 2DIEA 2ENJA 4OCXH 4XE5B 1BF8A 2CR6A 4D3CH 5GXBB 4BKLA 3C6LC 1IAOB 3P9MB 2CD0A 2UXGA 4QWWD 3C09C 4KK6D 1U6AL 4FP8L 4HS3A 4NP4L 5DQ9B 4AYFB 5IGXL 3H3PH 3NQIA 1X5GA 3V95A 4P2QA 1L9OA 1NWPA 2JKIS 2FD6L 3GMQB 3BSGA 2FIRT 2V8LA 1YY9C 3MLXL 1YMMD 1HHIA 4KUCD 1JPST 1MFMA 4F7CA 1A3RL 3FB8B 3CFJA 3MA9H 2ITDA 1NFDB 4WGWB 3WO4C 1XD1A 1PZBA 1DBBL 2CDEB 1BQHA 3ESOA 4UTAA 4PVMA 3TJEH 4DEPC 4R4FH 3BFQG 4S1SH 4XP1H 1K6QH 1LTXA 3JVGC 1B2WH 1D2PA 3QUGA 3EBIA 1H8LA 4JZNA 5GZOD 1YECH 3VFSA 1NGWB 3LN5B 4HKZB 2FJFB 2FYYB 4TN9A 4IW4C 3P3RA 2G3MA 4I3RH 2OMWB 4N9GB 3UTTE 3DKHA 1ACZA 3VO0A 4C83A 5D4JA 2CIKB 3T2PA 3FRUB 2A0LD 4AYBA 4AKQA 3AMKA 3IXAA 1ORQA 1F8TL 1B4JL 2X05A 3ZTEA 1OTTD 1JUFB 1Z7JA 3TYGL 1K85A 1A6VH 4FD0A 4R7NA 5KBNC 2DLHA 3DPBB 5IROA 3TVMA 4MMYA 2JELL 4MA8H 5FUZL 3K6OA 1TJIH 4R83A 1NFIB 1INDL 5L7XH 4IGBB 4L18A 3MXVH 4JPVL 3QQ3A 1IBHA 2IWFA 3ECVA 1J9TA 4NO0A 2O26U 3ESPA 1QW8A 5JXAH 1GY2A 1N68A 3L48A 4N85A 2OSLB 2X3AA 2UWEA 4Z8FH 3FU0A 4AEIH 3A3YB 3RYMA 4MBRA 4P5TA 2N1TE 1DYZA 2H9GB 2NTSP 4JZOA 5HHXH 1C5CH 1F11A 2VDNH 2VXSL 4KRNA 1CJYA 3DTXA 3UBXA 4LDCA 4YAQA 2CGZA 3NRFA 5E95B 4APXA 3QC5X 2NCMA 3ZKXB 3CN1A 2XXFA 4K3DL 3UCQA 1TVHB 1AE6L 2F5AL 2PW1B 3IBOA 2Q10A 3UMNA 1BXXA 5IBUG 3RVVC 4M48H 4PCTA 4GAGL 1CL7I 2FBJL 5IB4A 5TH2B 4OZIE 3S34H 5I0XA 3S2AA 3AREA 5CR8A 2XWTB 2DF3A 3GZOA 3V5KA 5MEOB 3GJFA 4JN1H 3MRGA 5FFOA 3LKPA 3MFFB 3O6LL 3X3FL 5LLIC 3ULUE 3ULUC 3WI9A 5A43C 5KJ7E 4X8XA 2GBUA 2XIIA 2ZX5A 2ENYA 3LQMA 4MWFB 4PLOB 3OMAB 4DP8X 4P57B 3L5JA 3WFDH 4MZRA 2GCYB 1DVXA 1ZT7B 4HHAB 2GBAA 4U1IB 1GMEA 4X7EC 3VFTA 1MDAA 2N7BA 2WXOA 3ZO0A 1M57B 1HZHL 1MN4A 3HG1B 4HIEA 5DQJB 3SBWA 1D5RA 3W5MA 2NY0B 3V4PH 4LF3A 3CLEH 3F05A 3GKWH 5FW8A 2UY6A 4OD3H 2F58L 1I1YB 1T1YB 1OE2A 2R15A 1T3FA 3KVDD 3SGJA 1NCOA 2JJWA 3BKYH 2WTPA 4GBXC 3WIHA 4TSBH 3ZQ9A 2J57A 4KRPC 4DGYL 4FQHA 2IJ0C 1I9EA 2XWBB 1U42A 4L2LA 4IU2A 5F71A 3VE0A 4AQ8A 4HEPA 2AQ1A 2EIMB 4LCWD 1M3IA 1CICB 2TAAA 4MAYD 4OM1H 1CB4A 2FEDC 4MJJA 4DPCX 4U1GC 1WC7A 5JIIA 2K70A 3KH3A 1CGSH 4BV1A 2IALA 1QLFB 2CZNA 1RULL 2EYSA 2QADD 4LOFA 1IVLA 1JF6A 1MCQA 2LT9A 2ESVE 1BCIA 4ZT1A 4XBEL 5ESVA 5EU4B 3VD7A 5JW4M 2O93L 1CXEA 3D87B 4Z1PA 4NPYB 1DANT 2VOTA 2VLRB 2CHZA 2YARA 4ZJ9A 2OJ1A 5I1LA 5JHDD 3VRLE 1IEBB 1YO4A 4GO9A 3FSWA 3FB7B 3B7SA 4H7VA 4P4RA 4HUVB 1JF5A 1U8HA 1Z5HA 4U6VL 5TQ2H 2CJUH 3VXUA 1UM5H 3BWAB 5EOTA 1HIML 1RZ7H 1WGOA 3PWJB 4MA1B 5GJTH 4B41A 4RRPG 5F96L 1JZ6A 1VKXB 5HVWA 5CN1A 4F8TA 1PNCA 5B22A 5DYOB 4M5TA 4N0FB 2AJ3A 4DUVA 5SV4A 1FHGA 1GYAA 3ZRSA 5IKCB 4WI7A 4NKOB 1LE5B 1CR9L 2GABA 4OZ4A 2CBOA 4MD4B 4BSWB 4KUZL 2K9FB 2HKHL 1T89A 3MREA 4HD9A 3IRPX 4FLOA 4UZSA 5JW3L 2C34A 4X6BA 4G7YL 4LNRB 3D05A 3DMMA 3VXTB 1G43A 1E9QA 1BLNA 3ZKNC 4BWTA 4JFVA 5L88H 3QIWD 3VB9A 3I9IA 3QUMA 2CHXA 1CD0A 1AQ8A 5A2CA 4PJIF 1OT2A 4DFHA 1XGRA 4LSUL 1M56B 4WI6A 1JV5B 4E41E 5F88B 2BWQA 4HISA 1GGYA 4BEIA 3T0EB 2OTUB 4G6FD 1GW0A 2BVYA 1OARH 3GMOB 2A6JB 2E47A 3TEYA 2DQDH 2ZXEB 3LIZH 2AEIT 5F7EH 1WD9A 3BGFB 1L3NA 2ATPB 1D6EA 4AIZB 3D07A 4KKAC 5T8IA 1AZRA 3D8MA 3DOSA 4QDGA 4HK3J 4YHZH 5ACZA 1AXIB 1F4YL 3INUL 3SPHA 1I1FA 1DZBA 5MP6H 3HI6L 4FQ2H 1KCUH 4FHBD 1OGTA 3T04D 1A6UL 2YQGA 4ENEC 1GW6A 5J0BA 3RFZB 3KPRE 3VD0A 4EZJA 3BD3A 2F2HA 4PJEF 1E27B 3IFOA 5BJTA 4HUXA 3SKJH 1BFTA 5T5FH 1BP3B 3TP4A 3LQAH 4OLXH 4EI5A 2JXMB 2DWEB 2Y3AA 1HZKA 1R4XA 2FECL 1G7JB 1W91A 3US0A 2X6CA 3L4WA 4OT1H 3L2LA 5D96B 5J6HA 2ZP9A 5JORB 1FAKT 1MWAL 1FO0H 1XF3A 2ZUSA 3ALWA 2YMTA 5IQOA 2YKLH 2ED6A 4Q58C 2O6FA 1DQLL 5EIIB 5I8CA 3ABKB 2QDWA 5IF0B 3X1EA 4RFEB 4I1RA 3C60C 5EFIA 5DA0B 1IM9D 4LPUA 3BN9D 1SMOA 1UZ8B 2ZSVB 4V1DB 4OLUH 5E8DH 5HHVL 4M7ZC 5B1CA 4L3ED 1AGFA 3D48R 3GXUB 3FOLB 5E0QA 1PZAA 5JIHA 4DAGL 5I1DB 2W0FA 4KAQH 1BZDA 2MNJB 3V6FA 3T6QC 5E6RB 1KLGA 1VESA 4OGAD 4L1SA 4DVRH 2DLIA 1JPTL 2MIZA 5FV1L 3KHQA 1R34A 3T3ME 1IQWH 1N5AB 2R1WA 2VTFA 4YSEA 3BAWA 5IB1A 3V5DA 3RDTA 1UZ6F 5AQ0A 5C9KA 2XIBA 2W9DH 4RZCA 1G6VK 2FLMA 4PJIB 4QHNA 3CN3A 3ZIYA 3VNYA 4DKEL 5KBPA 4W9KC 5I30H 4PRAB 5K9QG 1F4XL 4UI2A 4GUPA 4UQAA 2GT9A 2W0LA 4HLZH 5ANHA 1KJMA 3GSOA 3BVNB 1EV2E 2VE6B 3N1QC 2IOMA 2P26A 4YK4B 2GHWB 3D06A 4M5SA 1CFTB 4N9OB 2Z1KA 1UB5B 1SVZA 2GKIA 2NUPA 8FABB 2V9RA 3OX8A 4PGBB 1VCBC 3VRIA 4C56B 5KYWA 1UADC 1KXTA 4RMRA 3RVWC 3DNKA 5GZNC 5E8PB 1QRNE 5BO1L 3DVGA 1X9QA 3TV8A 1H3PH 2UYLA 1M53A 3O3EB 4F58L 2YUVA 4RESB 2Y5EA 4YS4A 1J9CT 4KQ4H 4G80A 4MA7H 4TL5A 1JZGA 4CC4C 2VAJA 4PJAE 1PG7X 4FEMA 2WXFA 5DC0A 5D7IE 1JD9A 2CH8A 3LKNB 1G9EA 5JZ7D 5KEZA 5ID1A 4LLWA 4K7PH 5H94A 4BH7B 4G8IA 5BRZE 1I3VA 5IHHA 4WUUA 4XCFH 3U4EB 4LLYB 2ATKB 2WNGA 4ODVH 3ZQWA 1KDJA 2E75C 3FAWA 5F7WC 4QHUB 3E1F1 4YE0A 2EKSB 1F18A 5KN5A 3ARZA 4FI7A 4NYLA 5I1KL 4C8XA 3V7AG 3V4LA 3IJYB 4MJ6B 5DJZB 1Q38A 3GUTB 4WY7L 5FHAH 3TA3D 3GHBL 3UTQB 2ARJB 2V37A 2WSPA 3F7YB 4K9EL 4QRQB 1I4FA 4YXLH 3GF8A 2MOGA 2N0MA 1MWOA 4JZJC 4PJ8B 4PGCA 1NEZA 5D8JL 5EIIG 2WP3O 4N68A 4E9LA 3CHXA 1MCPL 5ADPL 1X6NA 2ZX7A 1X6LA 3FFCD 3LQAC 1SPDA 1U2HA 2DQEH 5DUJA 1KJ2B 2EJ1A 2JCCB 3NSFA 4M7LH 2Q8AL 2X28A 5AVTB 3HB3C 3F6LA 2NY2C 5CP3H 5GS0C 2VN6A 3W0WE 3EF4A 5DHXB 4L9LC 4EBQH 3SGEH 4DERA 2IGLA 2YAMA 4UT6A 3MYJA 5IB2B 3F84A 3O4LA 2QPSA 1LMIA 1LP9E 5AW8B 3PFQA 1FCGA 2R4SL 1OTUC 3QYCA 3FUJA 2ZX9A 2JLLA 3MRLA 3BZEA 1NGYA 2IQAB 4RGMB 1IBBA 2B2XL 3LRSA 4ELMB 4PI2A 4KHXL 3C6LA 5AKTA 2CDFB 5EU6A 3O0RL 4IOSA 4RNRB 3VFGL 2EO1A 1SY6H 3OR6A 3T6WA 1KIQB 4CNIB 3I3BA 4Z7NE 3KWTA 1BJ1J 4QY8B 2F7PA 3M88A 4UV7H 3BDXA 1OAUH 4HK0A 4C58B 5E6IC 4EN3B 1YNTA 5I1CL 5JNYA 5LDSA 1D5MA 1M3JA 3IBEA 4JG0L 4UCFA 2WW8A 1RERA 5CLWA 3L5HA 4RFNB 1ZXKA 5FYJH 1KZQA 3BEWA 2A9NH 4XP9L 3RGVD 5HDLA 1USZA 1O5DT 4MVBC 2DLFH 2VDML 1D5BA 2XPYA 1CGTA 3OLEA 1FI8C 3QIBB 4ADJA 4BELD 3BZ4A 3CQQA 3VTMA 4Z95L 1R3HB 4JKLA 2BSRB 4NM4L 4XO5A 3P77B 3WTYA 2PWEA 4J3UA 3JVGA 3EOYG 4Y9EA 3C08H 1N7ML 3HUJE 2PO6D 4DZBB 1BIIB 1EO8L 1U4EA 4R2GB 2C9PA 3FK3A 5C0CE 1IL1A 3UTTA 1OQXA 4KJYA 4JHWH 2W80C 3H0TB 5JOEA 4UAOB 2N3JA 4N20A 2GC4C 4MXVE 1VA9A 5JPMB 1EZSA 3FT0A 1FPTL 3VXQA 3DURA 4XRCA 4PP1C 2P5EB 5DR5L 1WAAE 2J6WA 3H7BA 2DW5A 5K59E 3JWNH 1QFWL 3L5WA 4MB1A 4MNQE 5DZPA 3EJYD 2K45A 4Y88A 2E9IA 5FDYA 4X98B 3DVNB 4LOVA 4LP4A 5EO0B 1NC2A 2FTAA 5AB9A 2IH3B 3PUUA 4BH8B 4KKLC 5IW1A 1HH6B 5ITFB 2J1ZA 2IAMC 4J27A 1O7VA 3TIEB 2CBQA 4RQQB 1IBYA 3C8DA 3K8KA 2VW7A 4R0LB 4NT6B 1JTOA 1L3WA 4IEFA 4OFIA 2D7OA 2G4GA 3LJ3A 5I8OL 2WLIB 1SM3H 3QXAA 4HULB 2EDNA 1KIRB 3LNDA 1TQCC 2KZBA 3D0VB 1CE1H 4NUQA 2J6EH 5DMGC 3VG0H 5F9WC 4EDXA 3KLHD 4ZUVB 5BQDA 1CGVA 5KVDL 5IFHH 2IFFL 1H3PL 3L4VA 2R27A 1LEGA 4HJIA 3Q1EA 1EO7A 4OV6F 3BVXA 5E1AB 3K72A 4L4TB 3REVA 2JB6A 5G5DA 2APTA 1YEIH 3Q7JA 4N2KA 3I6SA 2E7CA 4XVTL 2J5WA 2BIHA 4JE4B 5AYTA 1OO2A 5HI5C 1JGEA 2JKJA 4UILH 4XBPB 2FE0A 3IE4A 5E94B 3C5ZB 1IGJA 4MGXA 2VLKE 3R19A 4Z7OF 3PF2A 4UOQA 2MCPL 3F12A 2HWZH 2WBJC 4HPOH 1A47A 4YL4A 3EGSA 5AW3B 3SPGA 4AE0A 3RY5A 3ARXA 5HYSA 4Z7QF 5INCB 4M43L 2J7LA 4PUBH 1NCAL 3MX0A 1E6JH 1AP2B 3PGDA 4NQVA 3TBCA 4LCIL 4HKXA 2YRPA 2FECI 3MV8B 4KTEH 4QYAA 3T6VA 4BK8A 4L5FH 5H4ZA 32C2B 2D2OA 4JQXC 1P7KA 2XV0A 1ZXQA 2J1YA 3FC8A 1OT4A 4M8RA 3IAQA 4DGIL 4YHYC 4NPJA 2GBTA 1SXBA 3UMTA 2NR6C 1Z9SA 3RJOA 4CMMB 5EEVA 3TXAA 3HPLB 4E36A 4GBXA 3CD4A 3LPFA 3MR9A 3MBWA 4BZ1H 3TBSA 3C12A 3D4CA 4J3OF 4M4RB 3BWUF 1SDYA 4KJQC 3FS9A 4NWTL 1F4WH 3UYRL 4U6HB 3KW8A 5L6YL 4WWKC 2G5BB 2JV6A 4TRPH 2VDRB 2ZT9C 3SYOA 2DQIL 4FG6D 1PQZB 2GTWB 2P7TA 5DI8A 2UUDH 2L7JA 1W0WB 1YQ2A 2ESVA 5DHMC 4AZUA 1OE3A 3P0YH 4UIMB 2NT0A 1U8NA 3F6IA 5KYNA 1R3LB 2G30A 5EB9A 3SQOH 4U6YB 1GZPB 2BS9A 1QFPA 1FZJB 3QNYB 1KLFB 2FGWH 3F58H 4KTDL 4QYOA 2BK8A 3SJVE 3WHE0 5ISZD 1R3IL 4HPYH 4QJ4B 1WISA 1ORSA 2CKBL 5T3ZL 4EIUA 4JUTA 1ZLWH 4K8RL 3PQYE 4TTDD 2IADA 6FABL 2FX9H 5GJSL 3LN4A 5IM7A 4BFEA 4JREB 3MDJA 4JUSA 4F15B 1MH5B 2YPLD 4PJCF 4ILDA 3PG2A 5JA9A 3QDJD 3GHEL 2M83A 3QDGB 1INQB 3CXDH 1HQRA 1KN2L 4XO3A 4PRBB 4XVUD 3FBQA 1KULA 4A7SA 2PTVA 3GSNH 2UZYA 1H6FA 2F5BH 3B37A 2NY6C 4XAKD 3OXRB 4UQ2A 3N6YA 3D85B 3ISYA 4N0YH 5KSBF 3NDZE 1OPGH 1UXSB 5IQ9A 1HEZA 1VLXA 5E8NB 2J72A 3Q9PA 2V17H 1AGCA 2B1HH 2DI9A 2VLMD 2O30A 3ARDD 3CBJB 3M1CA 5DJCA 4XZUB 3BPNB 5SWZB 1K3IA 2GEEA 2PPFA 4AQEA 5I6XC 1TTUA 4E41A 4FQQA 4Z7OB 4Y9BA 3QQDA 2MPVA 4L0PB 3WLBA 3LTVA 4Z7QB 2A5UA 1GJWA 1NOFA 2FYVA 4ISVA 4EZKA 1MRDL 1GC1H 1MFDH 3GBML 4P5KA 3MLYL 4PJ9D 2YAOA 2XOTA 4ZQKB 5DURB 1C5BL 3FU7A 4FGMA 1G7HA 2K3HA 2NY5H 3HS0B 5F21B 3RBSA 1R5WA 1CBVL 1M7DB 3TCLB 1LDPH 1SLWA 3T8XA 4K3HA 1EJOH 4WAFA 1LNUA 3KDMA 3LMJL 3KPRA 5EHFA 2H6UA 1FNEA 1P4BL 1NBCA 3CCHA 4GP4B 4QMEA 3MRCA 2VN7A 1DSWA 1BYPA 5TGBA 2ZCKH 4X6EB 2XACC 1AIFB 3HZYB 5J6GB 3FW6A 2I5YL 3SB3A 4X8GA 4AM0Q 2ZUYA 3TBTB 1CFVL 3HG3A 2H2SD 3NG5A 5J11B 2O61B 1RUQL 4OCYL 5F6IB 2PCXA 1UEYA 2PR4L 1COBA 5EU7E 4X7CC 3H6JA 5EU7C 2ZPKL 4PTTB 3P02A 3VD2A 5D7EA 4YDZA 1Q1JH 2UZXB 2KQMA 4L5FE 4G7SB 4N2MA 1DLHA 4P59L 1I85C 3RPIA 5B39A 3FL7A 2Z93B 3BP5A 5EBWB 5AW5B 4KKZA 4XP5H 2HT4D 3C60A 3UPRB 2FO4B 3LV3B 2I25N 4OB5L 1QKZH 1XL6A 3K5SA 4YH6A 4ZTOH 3EH4B 3ZPDA 4MD5B 3Q13A 3UO1H 2COQA 5KSAB 4WLCA 2Q7YA 4DN3L 3RVXC 4DOHE 3HLKA 4PJCB 4WFGE 5E2TL 4Z7UB 5DDHB 1OP4A 1GIGH 3PWPE 4QLRA 2DYRB 4BWWA 3MBED 4G8GB 1K2DB 5JXED 1QHOA 1SXAA 1A4JB 4TPRH 5KSBB 4X99B 3G5YA 3H56A 3NJVA 5DUPL 4P2RE 2W88A 4YNYA 2LFEA 3MTRA 3SE3C 1SHWA 4DTGH 2O6PA 2OR8A 4PRIB 4MQSB 4Z9KB 3NSDA 4EF3A 3GMNA 1OAXL 4C47A 2AQPA 5F7NC 3RKDC 5J06A 3ZQXA 4YHIB 1PEWA 2UZIL 4XPHL 1C5DB 3E7JA 3SDDC 3LIUA 4FXLA 4CVWA 2VABA 5IQNA 3OKMB 3D52A 5HDBF 3LKOA 3QDMA 4TYUA 2BOBA 5E6SB 2XHNA 1EAJA 4FHJA 4G6AD 1VFMA 3GTVA 5D1ZD 4XNQA 1AC6A 4UOJA 3CFQA 5IOPA 4XPTL 5GZNA 1DVFB 2JIXB 3BE1L 1QRNA 3EO0B 4IKKA 1MELA 3U7WL 2DEXX 4NAMA 4F33A 4FLQA 1GYUA 2A77L 1TO4A 5FDWB 2D0HA 2WN3A 4W9DC 4GKSA 5FO7B 1AO7B 3CQFA 4CC4A 1JK8A 4PWJA 5LGJA 4PJAA 3WFEH 5DEZA 3KHOA 5C07A 5D7IA 3P4OA 1GGIL 3SPJA 4XNMB 1QFWI 4HXAL 5F0JB 1ACXA 3LEVH 5BRZA 2YPKB 1CQKA 1S46A 3GSUA 4P3CH 4Y4FD 4LPVA 3FCBA 3VX0A 4KFZC 1BLIA 5B1BB 5FK9A 1DFBH 3MCKB 4NNYB 5FW6A 5KYYB 5L9DL 4L48A 4ONFL 4XP4H 2QFRA 1I3GH 2NY5C 4IM8A 1H3UA 5BS0D 1WSST 2HLAB 2ZAHA 3GMLB 2DDQL 3NACH 4DP0X 1I82A 2VDLH 1K8DB 3AU1A 1XMEB 3FO0L 3GB7B 5GRYA 4JZJA 1GTFA 3NABH 3U36B 2FATL 3SYPA 2X4QA 4NO2B 4EE2A 1MF2H 5T5FA 2M8XA 2YIHA 2GJ6D 4WFHD 1RZIB 2ITCA 3KS0H 1OXYA 2OMYA 3FO1A 3QXTA 3QZPA 4D2NA 1RY7B 3BVWA 4NB7A 1DBJL 5AVVB 1RPKA 5EZIH 3BFWA 2RAMA 5SV3A 4YLBA 2AC0A 3VSTA 1U30A 1ZIAA 3W0WA 4L9LA 1Q72L 3NDYE 4HGMA 3UPCA 1J0HA 4BIKA 4DO6A 2YD2A 5FO9A 3DI2B 5IZ7A 5DZNA 3T9WA 1OOWA 1XX9C 1YAIA 2R2BB 3ECBA 5MHSE 4OCRH 1S6NA 1L9MA 4TUOB 1LP9A 3LOWA 1M9WA 5GGRY 2OMZA 2AI0H 1JGUL 2HJKB 4NZUH 4ADGA 5FWQA 3K6SB 3S0PA 1SOXA 1PD1A 2E9WA 1PDKB 3D2TA 2R29H 4OF7A 3ORJA 1F58H 2ITFA 5DHVB 4N0UE 1KTDB 5E51A 5L2KE 3SY0A 4GI8A 5F3HB 1W72L 3FCTB 1PY0A 2DPKA 1BD2A 2YFNA 4NUGH 4JVPA 1UGKA 1ZTXL 2OR7A 3BUBA 5FS5A 4IIZA 3EOAB 5H37H 2LAAA 1HL4A 3QWNA 5E6IA 1IFHH 3QJSB 2EUWA 1O5PA 1I7ZB 3B9KA 2XWJA 4PY8J 4R96A 2CU9A 2AEWA 3I2CH 4PRNB 4XC3H 2VISA 5SX5H 3RQ3A 1QEXA 2UV3A 3RWGA 1ZV9A 4HKJA 3IDYC 3MRDA 1JGDB 1IILE 5I5JA 3V0AC 1NAKH 5B4MD 4GKNB 5E7BA 2HJFA 3SGKC 3KPLA 3HHRB 5F70A 3WEBA 1GOGA 3KAAA 1G7IB 3PJNA 4RSVA 4PP2A 3W81A 1YEHL 1A4BA 3C8KB 3VA6A 3WIAA 1IEAA 4R8WH 4PG9A 2R0LL 3HUJA 3MNZA 2JQZA 4V11A 3T77B 4UNVA 4GG6F 1J8RA 3C5SA 4K7FA 4NOFA 4JY4B 3NN8B 5C0AE 3ZGIA 4A2GA 1T4KA 5C2BH 1BAFL 5EBLA 3VCLA 2VL5B 4JM2A 4QRRE 4LLVB 1LWHA 3ETBF 3LZPA 3N41F 2VZVA 1E9PB 1WAAA 1BIHA 3KWVA 2R7EA 3GZPA 1D6VL 1FVDA 2IDFA 3GSRB 4LLUA 3WN5B 4R4BB 2BSDA 5ID0B 1YEKL 4MNQA 3BDBA 5E9DD 2XIDA 2R23B 1LO0L 1FGNL 2WQRA 4JFEB 4LEOA 2MCG1 5I73B 5GRZA 3P40A 4OZGF 1NJ9B 5D7SH 2YGPA 1MQ8A 1KTJA 7PCYA 2BSTA 4QOKE 4OIIL 3WXWH 1WITA 4YE4L 1HSBA 3DHPA 3QZBA 3S4SB 1XEUA 3CLFH 1SRDA 1S9XA 4ZFGH 4Q9CA 3NQKA 1OM3L 1PKQE 4KKRA 3ARPA 2XWDA 5E6ZA 4X80H 3MV9B 3TV3L 4Q9RL 3HI1B 5TDPB 1HQ4A 3HMWL 3VG9B 2I07B 2CNYA 3IPBA 3NBNA 3LEXA 4PLNC 3KL0A 2GTZA 4E9VA 4ZXBB 3ARGD 1IUZA 1ETB1 2HJLA 4CJ0A 4XAWH 1IC7H 1B9ZA 5HGAB 3T2OA 1MJUH 3HVDA 3IKCA 3QXDA 3ZDWA 3RZCB 2E9BA 3R7RA 2X70A 4PB0H 1VIWA 4UQDA 1ZHNB 1OGAD 4LPTA 4UDTB 3U30B 3DJSA 4JMNA 7FABL 4G3YL 1TCMA 5IUCA 4AGQA 2BNRE 2DJSA 4FEIA 2V2TB 1SXNA 3KDPB 4IMLB 2F61A 4PJ7F 1I7RB 3ZDZB 3PL6B 3K4DA 1Z1WA 4F7EA 3MOBL 3Q6FA 3ILDA 1E4KA 5E99L 3ZKQD 1ETJA 2YSTA 2VLKA 3RWFA 2AXHA 3TN0C 1UA7A 2WBJA 1J87A 2DYPA 5CP3A 3KWWA 4N5ED 4U2YA 2BP8B 1NUDA 2NQCA 1MHCA 3QFJB 1J1OH 3BIKA 3UROR 4TLUA 5EORH 2E7MA 3UOAB 5CFAA 5KVGL 4JQVC 1JFQL 3TJPA 5T1KA 3I75B 4P5MB 5F3BB 3QJRB 4D8PA 4P06A 4HWZA 3HFFA 1CF8H 2FJHA 4JQXA 4AX3A 2FR4A 5E5MB 4WI5A 5C7ZA 1BEYH 5SX5K 3HMXL 4MNHA 2BRQA 4ODTL 1TQVA 3A6BH 3DXAE 1DQQB 1QNZH 3QEUB 3DX6A 2ZICA 3SHSA 2NR6A 3WFBH 4GG6B 1HKLH 3CSBA 3MJ9H 5KW9L 2CRIA 1XZWA 1SY6A 3L4CA 2PXYC 4YUEH 5HI3C 1ZANL 1TJHH 3QFGA 2XV6B 3DJZA 5D1QE 3US9A 5D1QC 4ZFOB 3JUYA 4GLRI 4MRBA 3N41B 1DUZB 1F02I 1G6RH 4HHWA 4RFOH 2WSDA 3LD8C 4TOYL 4HKBB 4JFHD 4KXZI 4UOW0 4XGZB 5KVDE 4LASH 4G5AA 2D2CC 2PCPA 4U1NB 1ZDSA 4WI0A 4JPQA 2H41A 1JNNL 2OP4L 1QLRB 4O51A 4YSTA 4GKOA 3ZTCC 4NQDE 4YVNA 1MW1A 1OT1A 4NQSA 4Z76B 2R4RH 1SMDA 2IBGA 3TT1L 5JW4N 4XVOA 1RU9H 1OLLA 2L7QA 4KH9A 1JXFA 2GAZA 3CFUA 3T71A 5TF1H 1WZAA 4KBPA 2TRHA 4PJDE 4UDUB 4ZQTA 3SJVA 2DV6A 1MOEA 1BFSA 1OCWL 4EI0A 2CPCA 2X41A 1BZ8A 5GSVA 3PQYA 1PG7H 2LVEA 1S9VA 3P11L 2GIYA 2A7BA 1KZYA 1VFBA 2WXKA 3DBXA 4GPVA 4PVLA 3S4SG 1N64H 4PFEA 5C3TA 5GISL 4WHYH 2HLEB 2R2EA 4PRHD 1S7WA 2XETA 5CEYA 4AEEA 3DK0A 1CGXA