4M3KB

Structure of a single domain camelid antibody fragment cab-h7s in complex with the blap beta-lactamase from bacillus licheniformis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
116
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSISSITTMGWYRQDGRELVALINSVGDTTYAGSVKGRFTISRDNAKNTVYLEMSSLKPEDTAVYYCNAFMSTNSGRTGSFWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Beta-lactamase
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
source organism Bacillus licheniformis
total genus 30
structure length 116
sequence length 119
ec nomenclature
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m3kB00
2FYYB 4AEHL 4YXLH 3ARGB 4M7LT 4NOFA 4JM2C 4QHMB 4FTVE 5HXMA 3EYQD 4ZMAT 4XCYA 5FHAH 1QSVA 4NO3B 4E5XA 3OX8A 4P99A 1B88A 1F8TH 4ZFOA 4M8QA 2DQEL 3FFCD 4UBDD 1FVCB 1RUAH 2YN5A 5FUCC 5BV7L 1GXEA 2VLLB 2BVQB 2XRAH 1FVDB 1RJZB 2Y6SD 4G9FB 4C83B 5C92A 4GRWF 1OAYH 4Y0GA 5INCA 3GSXB 3CC5A 4YQXL 5B3JE 3FTGB 2M8XA 3MLYH 4RIRB 4DTGH 4W6XB 3FO1B 2APTA 4ZS6C 4XI5D 3CU1A 2PXYC 4PR5A 4HIEA 2HKHL 4Z7UF 1KC5L 4KU1A 2HG5A 4JDVA 4K3DL 4CVZB 4ZSOE 5IHUL 3VFSB 2WV3A 1WT5A 5EOTA 3PWUB 3RFZC 1DFBL 2NY5C 2J88L 4X7CC 4BSVA 4HJJL 1J1OL 1CYGA 3HFML 3LKNA 1HHKB 1IGIH 4PV8A 1WGOA 3HMXL 1KIPB 3QUKA 4Y4KC 1I8LC 1U8NA 2VH5H 4N8VG 3CFJA 5TF0A 1Z9MA 2NY4B 5L0QB 3TJEH 4Y1AD 3H9SA 4JY4B 2PO6D 2V2XB 5LGHH 3BE1H 2LTQB 4QOKD 3PQYB 1G9NC 5T3XD 2EYSA 5F7YC 4UV4L 2J3SA 5C07A 4OD2B 2JJVA 1JWUA 2H45A 1HILA 3O2VH 3V0VA 4HWUA 3C5ZA 3WS6A 1FZJA 4CN4A 3ALXA 1NGXB 3DXAD 1HOCA 4Z0XA 1ZV5A 3RWJA 5HJ3A 4LBEA 5HHQB 3B9KB 5LXGH 4GS7C 2LU3A 2XFXA 3ZTNH 1ZLWK 4J7RA 4ALAL 3OKMB 3JV0A 4EOWL 1K8DA 1IEHA 3NA9H 5FYJL 1BBJB 2DBLH 3SPVA 1A1MA 3HE7A 4NZUL 4TUOA 4YZFE 3VGHA 2QV2A 1UM4H 4LSTH 1MFCH 3MLWH 1R5IA 1V7NH 4WW2A 1P7QD 1JWSB 1SYSA 4JHWL 1KPUB 4XPHL 4EVNA 2KQMA 5C3TA 4J8RB 5L8KB 2DL9A 1KIQB 4GRMA 3P77B 2J8UE 3THML 2HJFB 4N9GA 1D9KB 3FB5B 5EU6D 3HZYA 1XZ0A 1QRKA 3QDAA 5C9JB 2ZUTA 4ZPTA 2X70A 4PJXB 1FPTL 3EYOB 5SWZD 1ZSDB 1IM9A 1U8PB 4GAYA 4FZEL 4I3SH 2HT3D 3WD5H 3DVGB 2P1YA 1RZFL 2FEEI 2RQ8A 4KROD 5D9SB 4MNQA 1NQBA 3EFDH 1GGCH 1N3NA 2PW1A 2H32A 4J4PC 3VGAC 1NCWH 4JO4L 1XR8B 3OXSA 3MJ8A 1CFNA 4Y19E 4G7VH 1AQDA 4NQSA 3P30L 3GMPB 1TJHH 1PY4A 3PP3K 2EH8H 3RBGA 3MJGX 4X0KB 2Z8RA 4IIQB 5DJXA 4BQ8A 2ATPB 2GKIA 3BZ4A 3MRMB 5LGJB 4YHIB 1CFSA 4CDGC 1JHLH 2DWEB 4LPVA 3DX9A 1HXYB 1IT9L 3C6LB 3HNTH 3RZCB 5DR5H 5E8EA 3D9AL 5DD1H 1CFVH 1N26A 12E8H 2WP3O 5HD8D 4LDEB 1INQA 4FQ1L 1NGPL 2YD9A 4MA7H 2HVKA 1QSFD 3LSOB 5GIRA 4RFNC 5C0ND 3O8XA 5TE4L 2VLKA 3V7MA 5JW4Q 3I02B 4RRPG 3DI2B 1YEIH 3L5WB 3FQNA 4JFPA 2NY0D 2EYTB 1XF4A 4DQOL 5CAYB 4LQFL 5AAWA 3FO0L 3L3OB 3LEYL 5EA0H 4PJ5A 1YMMA 1G7PA 1JJUA 4IS6A 1YEGH 4NC1C 2NTFB 3VFRA 2CRIA 5C0IA 1DE4A 3TT1L 2X4QB 2AJYH 3V5KB 5JDSB 4FS0A 5FDWA 5JXAH 3IFLH 4GBXC 2YD4A 3MV7D 1TETL 3E2HB 1ZHKA 4OM0H 2YA0A 3UJIH 4TUKL 4HSQA 3MUY1 2X4TA 3CLFL 4FXKA 3U0TA 1CVSC 3MNVB 4X99A 3VFUB 2MKWA 3OKNA 3VXSA 3B5GA 4EZMA 2HT2D 1QLEL 4ZUSB 4ODSH 4XX1G 4U1NA 5EOCJ 2NW2B 4S1DD 3ARYA 3EO1A 3MGTB 2DKUA 3HNSH 3GMQB 1V8HA 5L2JA 1NMCC 4GQPH 5IWLC 3C60B 3KYMB 3QXTA 3VFNA 4LP5A 1VFAB 4OZFH 1R24A 5J6HB 5I8EA 3BQUD 1UG9A 1G7JA 2DI7A 4JFHE 4EDWL 2YZ8A 2DTML 3WFZA 1YNKH 4L8DA 1LO0L 3K81A 3VRJB 5IMKB 5IJKA 1UA6H 2AEIT 1EGJL 4ONHB 5C0BD 3EYUH 3ROOB 1LGVA 4XHJC 3DUHA 5IBUG 1JPFB 1L7TH 4R7NA 5I1JH 4HKXB 3SGEH 3L3KB 4Y4HD 3TH3T 4AH2A 3DX8B 4MB5A 3VFTB 4Z7VF 5HY9B 4YXHL 1MCEA 4O2CA 4OLXH 3T65B 5HYEA 5SWSB 2FJFB 5FO9B 1E4KA 4JZJA 1MI5E 2CSPA 4Z76B 4PRAB 2B2XL 1EGJA 3LB6D 2EKSA 4UU9A 2FJHB 4C58B 3U6RB 5E5UB 2EDBA 1KTDA 1JTTA 4R4ND 15C8L 2VXVL 1H3PH 4OCWH 3F12A 3VFGH 4G6AD 4K71B 4NM4H 3D1MC 4LMQE 1G84A 4YHKL 4KMQA 5D1QB 1ZT4B 4FHBD 1GH7A 1VSCA 1G9MH 4KY1H 4JPVH 2Z92A 2C9AA 4M9PA 3TF7C 5D2NE 3TA3A 1CU4H 1JGLH 3EHBD 4UV7L 4HWBA 2LU4A 4KMTH 4M93B 4MA8H 5JXEA 5MEQA 2IPTL 1IAIH 1Q38A 4JR9L 5TE6L 2H3NB 4U1LA 4NJ9L 4BJLA 3VXOA 5HPMB 4JQIH 2X9WA 1N6QH 5I9QB 3A67H 1BLNB 1LDPH 1DLHA 2W9LA 4U1GC 3FQXA 1FFQA 1ZVSA 2QSCL 4TSAL 4HBQA 5CJOL 1OB1B 1C1EL 4MX7A 3NIDE 3WXWL 3FHAA 4DUWA 2P5WA 5CLWA 3WNNA 3JTSB 5AEAA 3SDXB 2XNAB 3IDNB 2YK1H 4FTVB 4QXTA 5TH2B 4KQ4H 5F9AC 3VWKD 1R3HB 2GW5A 5L7XH 4K94H 4JEGB 1HQRB 3P3YA 4C56E 5BO1H 4M8VA 4NQDD 3C5SB 3QI9A 3AB0C 3QIBA 3UBXB 1UCBH 2ZCHH 4JFFA 1Y6MR 3KYOA 4BFEA 1KCKA 1NAKH 5BVPH 3RUGA 2X9XA 3HUJA 4PRID 5ICYB 5D6CB 1Y18A 2W92A 2FHBA 2X4NB 2MCPL 3H42L 1YN6A 1YQ2A 5DK2A 1ACYL 2VDMH 2Z93A 3RVUD 1DQML 2FH8A 3F7YA 1QR4A 2AGJL 4LEOA 1CF8L 1PQZA 3PGCB 3PWLA 4XI5C 4DKAA 5MEOB 1KELL 2XPGB 4U1IB 5K59F 3BXNB 3L5XH 2R4SH 3MV8D 4I1NB 1F90H 4RGNE 4NZRL 4G43A 3TM6A 3L3JA 4JRWA 3O0RH 1QQDB 2O5ZL 5HHNA 1BOGB 3LS4L 3RVVD 1EZVX 4TPRL 1WK0A 4WO4D 1HHIB 2RCSL 1OL0A 4M7KH 3V7AG 4P2YA 1T66D 4MDIA 1JUFA 4LIQH 3TCLA 4LKXA 5EBGA 2AV1B 2CUMA 3AAZA 4KKAD 4BH7B 3FOLB 3VRIA 2XN9D 3OAUL 3VFMB 3D25A 5FB8A 5AYUL 3LS5L 5GS0L 3N1MC 2I07B 1C08B 3TNMB 5FECB 2BNQD 5J0BA 3SBWC 3VWJB 2QADB 3S88L 3KLHD 4P2OA 5GS3A 3QDJD 4X5WA 1M71B 1AQKL 3UTQA 4PP2B 5GGTH 4NHUB 3QXAB 1W72B 1IC7L 2B4CH 3JVGC 3QZWA 3QFJB 4PRHA 5C07E 1WC7A 2V9TA 3IRZA 1RJCA 1MCQA 1ZHBB 4XPAH 1JZ6A 4HUVB 2ICEA 2OTUA 4ELMB 2R2EB 3BH8B 3E3QE 2VO5A 2BSRB 1FNAA 3IU3A 1MIEL 2KL6A 1AH1A 4PJ9D 1FAKT 1YJDC 2E27L 5DJ8A 2AKRB 1F45A 1A4JB 1ZLUK 4R90L 3EDFA 5I19H 1FO0H 2KKQA 5T5FL 5E2VL 5DT1L 3FRUA 4PD4J 1IGYA 2HT3C 3C2AH 2BNRD 1EEYA 3IJYA 4Y5XB 5D7JB 3A0OA 5EWIH 1T80A 3ARBB 4KROC 1I3GL 1Z5LB 3K8KA 1QBLL 4NWUL 4F3FA 5A43C 5MP6L 1G7LA 5FYJE 5CWSA 2G75A 4S1RH 3KYKH 1I8IA 4F33A 2EDTA 4ETQA 2X4SB 2A6DB 1KULA 1U8MA 1SMOA 3HG1D 1N59B 1ES0A 3VFPA 1HI6B 3TEUA 3RWIA 1A3QA 1XF2B 1F2XK 4R97C 5E03A 4R3SA 1UWXK 2W60A 3WYRA 4MCYB 5MEPB 2DKSA 2DM7A 3MBED 4F58L 4MNQE 2NX5A 3WFDL 2Z0BA 2VAJA 5IFJA 5HHMB 1NDMB 3O11B 4ISVA 4NQCB 3L3DB 3S35X 5HD8C 1LNUB 4UTBL 4JG0L 4LASL 4P9HH 3MRQB 4JVWA 3OR6B 1MCRA 3AC0A 4L4VD 3SDAB 3WXVH 3ZHDA 5C0NC 3VFWB 1MRDH 2ADGA 1FGVL 1ZLSH 1K3ZA 5DJ2A 2DQIL 4YHYB 2NY0C 3HAEH 1R3JA 5J11C 4FQJL 4FQXA 4JN2B 3MRFB 3MUGB 3SOBL 4GAJH 3WSQH 4UQ2A 2HFEA 2ERJB 1EFXA 3UJJH 4PJAA 2Y23A 1WEJH 5GSVB 2N1KA 2WZPD 3TBTB 3L3HA 3QUZB 2VLKE 1KJVA 1NJ9A 2HRPL 3OSKA 4G8FA 3TGXA 3VH8B 3ARZA 1MHHA 3D2UA 3MRGA 2EKJA 3TNNB 4OFYD 1NFKA 3RDTB 3ARDB 2FJGB 2HT2C 1XGUB 4KK9D 4DFIA 4PTUA 1A21A 3N9GL 4S1DC 1UM6H 2VERN 4I13B 4NZTH 4PJ5E 2DLFH 3ARFB 2AP2A 4YWGL 1EX0A 1T89A 1XT5A 3U36A 4CL7A 3LPFA 4G5ZH 2CDEA 4YAQB 5K33A 1AGEA 1HHHB 2ZZUT 4EUPG 1MVFA 5ITBL 3MZGB 4LLVA 4M61A 1MRCH 4EXKA 2E7LC 2R29L 1NL0H 1MCWW 5SV3A 3BQUC 4XCFH 5C8JB 5IW6B 3ZYOA 2HLFD 2HLAB 3VXSE 1A1OB 3TT3H 1Z0MA 1CGXA 3VFTA 4LRNL 1I75A 4KVNL 3GMLB 4LSSL 4HG4K 4HJ0D 2VZSA 3RWDB 1NMAL 3OAZH 1GRWA 1BX2B 3KJ6L 4D8PB 4XMLH 5I8CB 4XC3L 4Y4HC 4KGJA 1AJ7L 1U3ZA 5FUOH 2Q6WA 2R9HD 4BZYA 1T1ZA 5IB5A 2VXSH 1D6EB 3RKPA 4JPKH 3QEQD 1O7SA 5F1KC 4KK8D 2OL3H 3DURB 3S7GA 2BVUA 1UYWL 3OJMB 4JG1H 4OZGE 3BVNA 5JNYA 3LB6C 4YNYA 5KTEL 3MA7A 1DUYA 1KLFA 4WCYL 4UDTB 4WFHE 3UO1H 1XIWD 3ARSA 1H8OA 4L8SA 4HK0A 4MA1C 5ADPL 4R4NC 1GGBL 3BPNC 2C7UB 3IXTA 2OR7A 5DUML 4ZNCD 1L6ZA 1G7HB 4G6AC 4HC1H 5CZXD 2C3GA 3ILPA 5B8CC 2XKNA 3NAAL 3S98A 1F3RB 5C6TH 5D5MF 1BZ9A 1Q9LA 1E28B 4Y5VB 4Z9KB 5T1KA 5FYKL 4UT6L 3V8CA 4JRXD 2V2TB 2XTJB 4APQA 3GK8H 4NQUA 4X4ZA 5CFHA 4LGRB 5E5RB 5E56A 3EHBC 2QSVA 2P47B 2JJSA 3IB4A 2P5EA 4O02L 1YY9C 1KACB 1TTGA 2IGFH 1PAMA 1JMZA 3E1F1 1IKFH 4YGAB 4U3CA 1BFVH 5DRWB 4KKBC 4ZUWB 4LQ1A 5T33L 4Q2ZB 2GUOA 2QQLH 1ZS8B 1CFTA 4B7LA 1UACL 4WU5A 1T7VA 4PGEA 3HA0A 5HI4D 1AC0A 3OKKB 2P24A 3I75A 3X13B 4IHOB 5CIPH 3T4YA 1CS6A 1CGYA 4IJ3B 4XCCL 5ESQB 2D31A 1RIUH 3NIGE 1SBSL 3VWKC 3I6KB 1OF2B 3NZ8A 3CFBA 3QJFB 1DN2A 1WSST 4U6HA 3TN0A 3QG7H 4P2QB 2BOBA 5ENWA 3HS0B 4JFEA 4E42B 4PJDE 2OJEB 4BYHA 2NNAB 4PY7A 1U58A 5ID0B 2NZ9D 4XVJL 4AIZA 3RVUC 2P5WE 4F2MB 1FNGB 2C1OA 3OAYH 3IF1A 3MLUL 2FECI 5DSCA 5IB4B 2NXYD 3I6LE 4GW1A 5DD5L 3FFDB 2F53A 4AQ1B 2Z9TA 4J1UB 5D72H 5L2KA 3MYJB 1NCCH 3RWEA 1BVZA 1NBZA 1OHQA 4KI5E 4TYUA 3SGDH 2QKIB 5FXCH 4PJIA 5GGUB 3RUGE 3BPOC 3HUJE 4KVCH 1FL5A 4WI4A 3H0TB 3IU4L 4J6RH 4PRNA 4HWEH 3BX7C 2JB6B 4LCIH 4F9PA 2NZIA 3RVVC 3U48A 1RULH 5I1IH 5K9KA 4WO4C 3QWOA 2GJZB 4BH7A 4YEFA 1RVFH 4H1LB 5D2LF 1T66C 4MJ5A 4NQXA 1W72L 1BQLH 2I07A 1IM3B 3W39A 5EN2B 5FECA 4KKAC 2GTWB 1TZGL 4P23A 3CDGA 1H8NA 4MNGB 2VLJD 3AU1A 3BDYH 1F4YL 4KH2A 1XGQA 3BAEL 2BVTA 5EZOH 2IH3A 2XV6B 5I1DA 3VXMD 1NCNA 5KVGL 2R0WL 2W07A 2W0FB 4HXAL 5HVHB 3KLHC 5C08B 5HHVL 2X42A 3KPPA 3P4MA 1R3KA 1F4XL 2Y07H 1NEZG 3BJLA 3IVKB 2ZUQB 1YY8B 1MH5A 1T4KB 4MCZB 3TBYA 4ZAKB 3DV4A 4ZFZA 1BJ1J 2WK2A 3MLTB 2XIDA 1F42A 4RA0C 4NN7B 3CSYB 2P7TB 4KKCD 1Z3GL 4PRDB 3PGDA 1A3LL 2OJZH 3DROA 2NY5H 4Y2DD 1A4JA 4DKEL 4F37F 1QBML 1SJHA 4XH2A 4BSWA 4IMKC 3DSFL 3LEXB 4AM0B 4HKZB 2B0SL 1S9YB 5JPMB 2H41A 3VGGA 2BVPB 3QEGL 4PJ9C 4Q97A 5JHLH 1S9VB 1HIML 3IKKA 1OAQL 3KJ4B 4PYGA 2ITDB 4OAWA 4YIQA 4PRHE 3NZHL 4PLKC 3IFNH 3ZTJG 2F54D 3D87B 3LZFH 5FKPA 3G6DL 1TXKA 3RGVA 1I9RL 5BRZD 3G5ZB 1E6JH 3L5JA 3ALPA 2FECL 3QDGA 4NUJB 3EO0A 4PJCE 4PJXF 1FFNB 3BIAX 1U3HD 3QQ3A 4OGYH 5A2FA 5CBAB 1H15A 1Q9KB 4QRPA 2R56H 5E8OA 4BQ9A 5BW7C 3FQRB 5I1AB 1RK0B 2BERA 1T7YA 1JPGB 1P69B 2YD1A 3PV6A 5AZ2L 3T0EB 5C71A 4O9HH 1Q9OB 4HW6A 1GC1L 4MSWB 4OCNC 1II4E 1OAZH 3G04B 1IC5H 4DKDC 3MBEC 3OKEB 5FO7B 1FGNH 2H26B 3HZVA 2R0KL 3CK0L 1J1PL 3BYYA 4NRXA 4DVRL 5DWUL 1NLBH 5H94A 5I74B 4I5BA 4XTRD 2MHAB 5F6HI 3STZA 2YPLB 1KT2A 4GQ9L 2FSEB 4NJAH 1YEJL 5LG1A 3TZVC 2Q8BL 5JW4M 2A77H 1TVBA 4GOSA 2OBGA 3REVB 3GB7A 1S7SB 5I1HH 4KDVA 4ZXBC 5LVEA 5H37H 1U91B 4KJPD 3PDGA 3P2TA 1UKTA 3BKMH 1ORSB 2Y5TA 1AGDA 2XZQL 3HPLB 5T1LD 3ULVL 2NXZD 1H3UA 4ENED 1J0ZA 3OG6B 3WO4C 4JDTH 3CLEL 5I8OH 4QHLA 4EI6A 3FONA 4JHZA 4S2SB 4TOYL 4V2BA 5CKGA 2FZ3A 4LNRA 3LEVH 3JUYA 4RZCB 5D71H 1TMCB 2GK0A 3NH7L 1Q0YH 2ARWA 4UILH 4KK9C 4G8GE 4H25A 5I1LA 2JJWA 3UTPE 3WFEH 4X4XB 3PUCA 1VFUA 3U4EB 1MOEA 3KPLB 2XKSA 1AGFB 1NC4A 3HRPA 3HR5B 5DC9B 1T5WA 2DQTL 2Y72A 2ICCA 3WDJA 2FX7L 2HLFC 4AIOA 4XVUD 3LH2H 1J10A 4JZNA 5F9DC 3VE0A 4FQ2L 4OZ4B 4OZIA 1HKFA 2X89A 1D5MB 4HJ0C 8FABB 4ZOEA 4LCCA 4DVBB 3RIFK 1WBYA 3L95A 5IB3B 1N0XH 3DO7B 1AFVL 3N50A 5DLMH 3MV9A 3IXAB 2G5BB 1MNUH 3F58H 2R9HC 5GGRY 1UB5A 3BSZH 3WEXA 4Z0BL 4NPYB 4Z18A 1IGTB 4KK8C 2BCKB 4LAQH 3AY4A 4OZGB 1MIML 2NCMA 1YYML 4MQXD 4LVOB 1D5IL 1I1RA 3IT8D 1XIWC 3FN0L 5DJZA 3MRBB 3UTZB 3G5VB 2QHLA 3U7WL 1HQ4B 2AJXL 1DQTA 3VGFA 3P4NB 4CVXB 2J12B 5L6YL 4WHYG 3REWA 2ILLA 1GPOH 3T0XA 3UZVB 2AK1L 4RNRB 1WBXB 4WFFD 2YXFA 3PWVB 1LE9A 4G3YH 1AY1H 3G08B 3MRHA 5GSRB 1I8KB 1BD2B 3VXRA 4QRUA 5JOFA 5FKAA 5FYLH 5DVKA 3UCRA 4X6FA 3JV6A 1EUTA 3TCXA 4LLWA 1KTKE 1JF1B 4DEPC 2DQGL 3GI9H 5HDBF 5EBMA 4MA3A 4GW4A 1HH6A 4PRPA 1DBKH 3I50H 5IKCB 1NUDA 5IMMB 3GI8H 3MJ7A 4G9DB 2IC2A 1CK0L 5HI4C 4FZ8L 5B21A 1U6AL 1SVCP 1X5KA 5JW4R 5E2WH 3JTTA 2CLZA 2IH1B 4P5KB 3WKMH 5IT2H 2P5EE 4BZ2H 2NNAA 5DQ9A 2EDYA 2EIDA 3FB7B 5K9QG 1G7MA 2P45B 5CZVH 2MQ3A 4E41A 1S5IL 4KHXL 4M48L 5DMGD 4E0RA 5C0FB 4PJDB 2V7NB 3BGFB 3QUYD 32C2B 1ND0B 2R69H 4MYWB 5FYKE 1CFQA 4HEPG 4WEBH 4EIZC 2NZ9C 3ORJA 4O2EB 4P0DA 3SDXF 1QPXA 1SQ2N 5EFIA 1WBZA 4A6YL 4KC3B 2NXYC 4PV9B 3TV3L 1I1FB 4KGLA 4L8BA 2ZUUA 4M5YL 3SDCB 2AQ3A 1XR9B 2OXGA 3MXWL 3KPMA 4KPHL 4EN3D 2BSSB 2ZOKB 2RFXB 5FCUL 3WIHL 4RFOL 3HE6A 2X05A 2MKLC 5B3JF 4JFEE 2KDGA 1CT8B 5IIEA 3TJHD 5C0RL 1YEEH 1TTFA 5LWYH 3T0AA 1HEZA 4A6YA 2GFBA 1ZTXH 3SCMB 4N0UA 2AEQH 3K3QA 5DO2D 3F5WB 3H6JA 2CQVA 5IW3A 2Z91A 2F53E 3B4NA 3WIHA 3INUH 1UWGL 4UAOB 4YBLC 5EIQA 2CDGA 2SEBA 4ZUUB 5I16A 3BWAA 3MXVL 1LWRA 2P42B 3W82A 1IAOA 1BP3B 1HSAA 1DLFL 4CN6A 3QIWD 3EYVB 5IB2B 4ONGL 3MFFB 4HS8H 1MPAH 4Y4FC 1C8PA 3LQAL 5J9PB 1A7BA 1FNEA 2EE9A 1XGRB 4NO0A 2ICES 1EFQA 1UB6A 5EO9B 2APBA 3V52H 2PTUA 4D9QD 4YHLL 3MACL 1RUPL 5IR1B 1UJ3A 1IBGH 2J4WH 4MWFA 4QEGA 4DZ8A 4P9ML 1B4RA 3LAFA 4U1HB 4PB9H 2BC4A 4YX2L 1OPGL 1QZ1A 3TLRA 4MQSB 3GSNH 5ALBH 2VAAA 3NGBB 1CGWA 3KPRB 4I2XA 4NO5B 4KKCC 4Z7WA 2VXUL 4Y2DC 5EO0A 3QEUB 1DR9A 4GAFB 2X09A 3NCJL 5C7XL 5KSBB 1BAFL 5E6IB 4YZFF 3MODL 3CVHL 5A1AA 1I1AD 4H8WL 3HHRB 1AHWB 5E8PA 2FATL 2F5AL 3LN4A 3DHJA 4YXLL 2XA3A 2X1XR 5ACMA 5GISH 1CD0A 3RPIB 2CIKA 3BDBA 1J11A 5ERWA 5FHAL 5HYJE 4RSVA 3L9RA 5E5MB 1SHMA 1F8TL 2GCYA 4KAQH 4U1MB 1MVUB 4TQEL 4ZYKB 3OKOB 4ELMF 4DGVH 2V9QA 1RUAL 3AM8C 4PJCB 2IADA 3CVHA 1EUUA 2XRAL 3MC0A 5C1MB 1OAYL 1ZT1A 3MOAH 3PG2A 3L6FB 1VDGA 2HYMA 1LD9B 1U3HC 4LCWA 1QLRB 3MLYL 1NC2D 3IDJB 1T20A 4LSUH 4DTGL 5BQ7B 4NSKA 3F7VA 3S35H 2QL1A 4Y19D 3M17A 1C5DA 1NUGA 1GCFA 4RX4A 5IJVA 3QEHB 5GS1B 3N1QC 3QDGE 3H3PH 2P8MA 3BZFB 4U6XA 4LVEA 1U3YA 1IGIL 1BGXH 5H35B 3GGWA 3VFOA 4QRPE 4XTRC 4Y2OA 2VH5L 1NLDH 1BQUA 2OQJB 5IFHH 3TJEL 4IBLT 3FB8B 2VL5A 3CPLB 2CIIB 1F5WA 1F4HA 5LGHL 1R3LB 3BE1L 3RWFA 4CADA 4QY8A 5JW5B 5ETUB 4LRIC 4P46D 4F7CA 3DVFA 1JFQH 1JGEB 1S3KH 2EDWA 4KJPC 5GGRA 3O2VL 4RMSA 4Z7QF 1FORH 3O3BB 2VR5A 4U1SA 5B39G 4YJZL 2NXZC 4HIHB 3FFCA 1T7XA 4H26A 4ENEC 1HN1A 4HDIA 4LLAA 2WBJA 3WO3B 5LXGL 3GKWH 3ZTNL 4H5SB 5IVXB 5J06A 2XXCB 1IC1A 3QHZH 3NA9L 2RB8A 4Z7NE 4QT5B 1T5XB 4CU6A 3HC0B 2DBLL 2EC9T 5CGMA 3BRFA 4X6DA 2Q7YA 4KKLD 1HCFX 2WAHA 3RY6A 4HKJA 1FE8H 3KPOB 1FYTE 1UM4L 4LSTL 4G8GB 5DRXA 1MJ7H 1CLZH 1FN4B 3O9WA 1CE1H 3MLWL 1V7NL 3QR2A 4WI8A 2CKBH 4Q58C 4IRJD 3HZKB 4QHUA 3GIVB 4XPFH 2YUZA 4U4BA 4G80A 4DUVA 1K8IB 4NRYB 5HHXH 4HMCA 4LLUA 3RIAF 3DO7A 5F96H 3FOMA 5I17A 1R0AH 1EV2E 4GAGH 5IW1B 1BVKB 3MLXH 4XVUC 1LE5A 2D4DA 3P4OB 4I3SL 3WD5L 2ZPKH 1ZE3C 2GJ6A 2PO6A 4NN6B 3EFDL 1NUFA 1GGCL 1NCWL 3CZFB 5DGRA 5F89B 3ULVF 1VKXA 4EI5B 3CDCA 7CGTA 4G7VL 5TGBA 5C0AE 2CDFB 3RTQB 3WIIH 1TJHL 4L3EE 3QDMD 1CICD 2EH8L 3P4NA 1A47A 1ORQA 4NNYA 4MQXC 2DL2A 3VDAA 4QWWD 4OZIE 1BQHB 1HHGB 2AS5M 3ZHKA 2VR4A 3OGOE 1URLA 3PWVA 2AK4A 5GRVL 2WSKA 2C26A 5D1ZD 1JHLL 3MV9E 4JVPA 1OGAD 3GIZH 5EDXA 5D7LA 3GSUA 5B22A 3ZSTA 4X7TB 3R8QA 1MI5D 2DMCA 3HNTL 5DR5L 4NT6A 4ZOCA 1ERNA 5DD1L 2V5MA 1CFVL 2W9EH 4IDJH 12E8L 2BVOB 1K5NA 4YDVA 3WJJA 4ZFFB 5C2BH 1KIRA 1X6LA 2XWJB 1QYGH 4IRSD 1WWCA 4JRYA 3JZ7A 2YKLH 2HFGH 1CLCA 4TN9A 5F8QC 3NCEB 3L5HA 3EGSA 1G0DA 3SDYH 5EU6A 1VFMA 3MJ9H 4PG2A 4PJ8A 4DCQA 1YEIL 4PBXA 2PF6A 4XXDB 3FO9B 5HHPB 5EUKB 3D3VB 4RBPK 3ULSB 4GH7B 1OGTB 2GJJA 1JWMA 5IOPB 1R5WA 1B2WH 4QRRD 4GRLB 3RWHB 2CMRH 1CD1B 3D39A 2GIYA 2VDKH 3UPRB 1YEGL 1QSEA 4JFOB 1RJYB 4M5ZH 4CMHB 4RAVB 1RPQA 3VXRE 2AJYL 2BFVH 3IFLL 1EAJA 3V8OA 4LPYA 4OM0L 5E8DH 4OKVA 1OSZB 3UJIL 5DJ6B 1T1WA 3HI6H 1HYRC 2UYLA 4WIQA 1LO5B 4KUCF 1EAPA 3IDXH 5DMGC 3STLB 3JWNC 2DYPA 2YRLA 3EAKA 4PV9A 3VXPA 5BJTB 3C8KB 4PRPE 3NIDF 1NMBH 4ODSL 2P8PB 3QUYC 5AUMA 3HAEB 1WIOA 3O45A 4HH9B 4C56D 3HNSL 2EDNA 4EXPX 5EZJA 1QVOB 3DI3B 2A0LD 3T0VA 3ZDXF 4EN3C 1UQSB 2MWCA 5F3BB 1RZ7H 2VITA 3BKCL 4XNMB 5F9JB 1A6UL 4PJ7B 3D18B 5E1AB 3SCMA 4E41E 3QZWG 2DQDH 4ODTH 5EO1A 1QSFA 3VMPA 4MJIE 1MFEH 1YNKL 4WY7H 5T1DH 1EHNA 2ZG2A 1UA6L 3TJHC 1FL3B 5T5NG 3SN6N 2V7HA 3BIKA 2ESVD 1V3LA 4HJGB 1KFAH 3DLQR 3DV6B 4N0YH 5I1JL 1L7TL 2C3VA 4ZUUA 5DO2C 4OZFA 5C0CD 1A4KB 5F21B 1Z9OA 1CQKA 3H9HB 2UWEA 4OLXL 3HKFA 5LQBH 1JMXA 2V9RA 1D5XA 3FT2B 2Q76B 4Y16A 1RHHB 4JGMA 4ZQKA 4M3JA 5J9PA 5EH1A 3MO1A 5JIHA 1ZAGA 3MV7A 2D0HA 2IBGA 3LKRB 3UTTD 5B38B 3Q6FB 3S3SA 3C9NB 5F44A 2EDDA 1H3PL 4OCWL 1CTOA 5A2IH 1FNSH 4N0UE 4R2GD 3VFGL 4NM4L 4X6CA 1Q0XH 3GM0A 3FAXA 3QUXC 3Q1SH 4I8DA 5J13C 3VA6A 1D5ZB 1TPXB 1AE6H 1DEDA 1CL7H 4NC1E 1G9ML 4KY1L 4JPVL 4N8PA 4HBCH 4QNPE 3DUSB 4MJ4A 2EDXA 5TDOA 4ZPVB 1CU4L 1JGLL 4KMTL 4U3XA 4MA8L 2NY3B 1IAIL 3LV3B 3H9SD 4PGZA 4OZHE 2ADIB 4BKLA 5J12C 3BD5A 4JY6A 4JQIL 1N6QL 4GKSB 3A67L 2W59A 1LDPL 5C07D 5F1NA 1A7PH 1PG7X 2FHCA 3D0LA 4W4OC 4HQQH 4Y5YC 1I1AC 4POZD 3C5ZD 1TLKA 3KXFB 1IE5A 4U0RB 1FSKC 4U1MA 3CH1A 3PHOB 4KJWC 1MY5A 4TRPH 1VHPA 2YK1L 5HYJB 4KQ4L 1KLGB 1BWMA 5L7XL 2XTLA 4K94L 3V6BR 4Z7WE 4WGVB 5BO1L 1PVHA 3CD4A 3HE7D 1UCBL 2CK0H 2ZCHL 1I3RA 5BVPL 5F3HB 1LEKA 1IKNA 4AT6A 3QIUB 1U93B 2AJZA 1KJMB 5I75C 1OTUD 2DQHH 2VDML 3KWWB 4LLYB 4R8WH 3QNXB 4MHHG 2FBJH 3MPCA 1ZVHA 3I6GB 3V4VH 2BY1A 3I3EA 5FYJD 2ITCA 4ODXB 3S96B 3TO2B 3IJSA 4OSUH 3P9LB 4OI7A 4P5MB 1OQXA 1J05A 3L5XL 5GZOD 3OBAA 2R4SL 3R4DA 5IBTH 2CR3A 1IM9D 3KYNB 1IGCH 2VE6B 4L8CA 4EJ1C 3O0RL 2DJSA 1P9MC 1DEEB 4LCWE 4MNQD 1Q94B 3IKCB 2CLVB 3PJSB 4M7KL 4WVRA 3VXQA 1VGEH 2CRMA 2IPUG 4LIQL 5D7KE 4OUUA 3PABB 1AXIB 5F7DA 3DYPA 1WV7T 3BYTA 4P3CH 4JKMA 2IALB 4JAMA 3BOVA 2FWOB 4ALAH 3I9GH 5A16A 5H2BA 1X5GA 1S5HB 3VGBA 2VDRH 2AABH 1NCUA 2Y7QA 3PWPA 1U8KB 1T0MA 2YUXA 2JJUA 4XPHH 4JHWH 2D7NA 5F7FA 1KB9K 1Q9WA 2XKUA 5GGTL 3DJ9A 4AMKH 5KANG 4KKLC 1FYTB 2B4CL 5E24E 4U1KB 1EH9A 4JM2B 5HYQB 3O8XD 2VLKD 1CG9A 1IL1A 4G42A 1MLCA 2GSGA 1AIFB 4YH6A 3ZO0A 4XPAL 2NR6D 3BZEB 5DHVH 4IRJC 1YQVH 3FFCE 1RIHH 2YD5A 5GS2D 5GGVH 1DN0A 1YNLH 3QB7C 3ULUF 2Y9RT 4YO0B 1B0RB 5DZLA 4QYOA 5HGBA 1YMMD 1JGDB 4XNZC 2AV7A 5E94B 4ZS7H 1RMFH 4X6DE 2HJLA 5ADOH 4WHTB 1FDLH 3MCG1 4IOSD 5I19L 1FO0L 5TDPA 2PXYB 3C2AL 2EZ0C 1T21A 5EWIL 3S37X 3QFDA 4L9DA 1FFPA 4NKDB 3RA7H 4JFQB 3CFKB 5EOCH 3B43A 3VXSD 2VL4A 5IMOB 4YHMH 2IWGA 3WHE0 1BQHA 4HLZH 5C0JB 2PKDA 3QYCA 5C0AB 3QO1A 4PJHB 4S1RL 3KYKL 5JW4N 4L3EB 5D6DC 1LO4H 3P9WB 2JK5B 1J87A 1FO0A 1CICC 4Y4KB 2DRUA 1LEIB 4Q9QH 2QJDA 5F1IB 4QWWC 4MD5A 5IROA 1J8HB 1FZKB 3HCVB 1WIPA 3QHFH 4MXWH 4PUBH 5D1ZC 3OKDB 1QFWH 3ZYZA 4QOKE 4TUJB 5T3XE 5D8JH 5ANMA 3U46A 3SGJC 1J7VR 1TZIB 2V2WA 4WV1C 4I3RH 3WLBB 4OZGF 1EEQA 3IDIB 3GMOB 4P9HL 3BP7B 4GLRH 1NCAH 3DXAE 4IRSC 1A14H 5FO8B 3WXVL 2XZZA 4GS7B 1RZIB 4PJFB 5IHLB 5K9JH 1P7KB 3S6CA 1MRDL 3TBVA 1MHEB 1ZLSL 5AZEH 4NZJA 2X1QA 1IAKB 4BFIA 5D2NC 1B0GB 2K9UA 4NQEB 3SKNB 2VUYA 3SKJH 2DOCA 3ECBA 4GAJL 3WSQL 4NKOB 3V0WH 3WBDA 5I8KH 2DKMA 3UJJL 4WUUD 4JRYE 1WEJL 2VQUA 1MHCA 4FQPA 5M7QA 5C0DA 1TCRB 5EU6E 1QR1B 3CFDA 3SKOB 1FLRH 1VEPA 1CXIA 4OF6A 2FLRT 1SMAA 1SJEB 5SWZE 3O6MH 3TA3D 3KLDA 3U9UA 4N8VA 1UM6L 4NZTL 5JXED 4O51B 2DLFL 1MRFH 1U2HA 5A40E 3E8UH 3H7LA 3NIGF 5JPNB 4G5ZL 4C54A 5E8NB 3VGAB 5I76B 1MFAH 5TQ0H 3RNQB 1G0XA 1MEXH 3ARGD 4OV5B 5DJDB 2NW3B 1MRCL 3KLAA 5DURB 5EU3A 3O6KH 2A0LC 1NL0L 1JF6A 4XCFL 4YBHA 1MELA 1XCQA 2GTZA 4K3HA 4BSJA 2P5WD 4PJDF 5KJRH 4RMTA 4MJIB 4OLUL 2IQAB 1PLGH 4UTAH 3TT3L 3V5HA 3I6LD 4KDTA 1HH9B 1TNNA 5IBLD 4OCSH 4XMLL 2F5BH 1T2JA 3QI9D 3QIBD 2GY5A 4JFFD 2Y06H 4KI5D 5FUOL 3SGDI 5JIIA 1BIIB 4RGNC 4WWKA 1T0PB 2VXSL 3HZMA 2A73A 4JPKL 3ZDYF 4CDHA 3C9NA 1WFUA 2OL3L 3PP4H 2A6IA 3BISA 4XNXL 4JG1L 5HHOB 4RFNB 1QSFE 4I77H 4MQTB 1T3FB 3UO1L 1C7SA 4GG6A 4U2ZA 5CJQH 4OFYA 5INDA 1LP9A 4W68A 2APFA 4R2GC 4WJ5A 4HC1L 3UJTH 4L3AA 4MAUH 1WT5C 2OL3A 2UWEE 5C6TL 1G7QA 4ODUA 4TNVF 1LEGB 3GK8L 4ZD3H 2CRZA 4WTZG 4GBXB 2D4FA 1YEHH 1F6LL 3P73A 3MV7E 3HC3H 4K7FA 4OZHB 1B0WA 4HC1A 1MWAB 1I4FA 2R23B 5H8DA 2IGFL 4I9WD 2A9MH 1AO7B 1CE6B 1IKFL 4WEUD 3UTOA 3NCYP 1BFVL 4L29B 4X6CE 5C0GA 4LPCA 2QQLL 5EU4B 4JANA 4MDJA 1AD0B 4POZC 4K3EH 3C5ZC 3WS6C 43C9B 5TQ2H 2BDNL 4LF3A 1YPZE 1RHFA 1NMCB 3PWJA 1RIUL 2Y1VA 2H6PA 4YFDB 4CMMA 2EDOA 3CAFA 3G5XB 4QRTB 1EMTL 3QNZB 1JV5B 5CD3A 2X6MA 3HE7C 3MV11 3QG7L 3ZT5A 5GS0D 4PRHD 3PHQB 3VD5A 4HGWB 4R4BB 2E6JA 4WW2C 1L0XA 5CIPA 4D94A 1PKQB 5SX5H 3GBMH 1I7ZA 4K7PX 1VACA 3EJJX 5CCKH 2YD8A 3KDMA 3MRJB 4NZRH 3IGAB 1PFCA 2ARJQ 5D72L 3DBXB 5KW9H 4PJCF 4HUKB 1NCCL 1T7WA 3X12B 1MCPH 5J6GA 5GZOC 3N85H 1Q94A 1JBJA 1S78D 3O6FA 4KVCL 3MRKA 4J6RL 4HWEL 4L1HA 4LCIL 2M2DA 1RULL 4XHQA 5I1IL 3GJEA 2NY7H 4MD0B 1RVFL 1KPRB 1BQLL 1KENH 1N5AB 5T3ZE 4YFEA 2R2BB 1U8IB 1KCVH 2C1PA 2HJKB 3FQUB 1F3JA 4OD1H 1NGQH 2EDJA 3BGMA 3N0PB 5CP7A 2X9YA 4TVPE 5MENB 3BDYL 2VXTH 1H8SA 5J3HD 2AXJA 2ZOLB 3QULA 5EZOL 4HFWB 2NX5D 1IC7H 4U1GB 5FK9A 5DMKB 1VENA 2LVCA 4TSBH 2YRZA 5DFWH 3OKLA 4HIIB 9CGTA 1MJUH 2Y07L 4J3XA 2ZCKH 4HUUA 4ONFH 5IEHA 4XCNB 2GYSA 4AL8H 1XGPA 3NPSC 4P48A 3HMWH 2NR6C 3G6AA 2OJZL 3AB0B 2NY5L 5SX4H 2W65B 4NQDE 3V79C 2D2OA 2CUIA 4XP6H 5IVXF 4LIQE 4FQXD 2R0ZH 4XWGH 4PLNC 5E00B 3PWPE 5BS0A 4MZ3A 4ERSH 1Y6NR 5JO5A 4KK6D 1MCOH 5FOBA 3T0DA 5JHLL 1YDPB 3QDHA 1EFXD 3P4LA 1AD9A 1EZVY 3U30C 3IFNL 1MCSA 4P4KA 4HS6B 1YEDA 3LZFL 3D2UD 4FQQA 3EJYC 3GHEH 1PBYA 1E6JL 2IPKB 3V4UH 2YPKA 3P9MB 5CMAB 3C60D 4BM7A 4U1JA 2GHWB 1BECA 3QO0A 4KI1A 1A1NB 2PYEB 4OGYL 5GXBB 4X6BB 3OKDA 1F13A 5IK3A 4GKZB 2R56L 1ZT7B 2E6PA 1CWVA 2I60H 4HZLA 4XVSH 4Y1AB 4O9HL 3QISA 3ALWA 4MB3A 1A3RH 1OAZL 3OR7B 3QT2A 1IC5L 2I9TB 3PWNB 1T1YB 1GZPB 1U95B 4RAUB 3T3PE 4Q6IA 2XN9E 1FGNL 4IOIA 1WAAA 4PJFA 3VCLA 4H20H 4PP1C 1NDGA 4UINH 5IJKC 5EPMB 5DYOA 1L6XA 3PL6A 1U2CA 3MRCA 4PTTB 3DXAB 1ZKAA 5CEZH 2AJVH 1NLBL 3LY6A 1ZHLB 2BNQE 1CDGA 1BFOB 4L9LA 4NJAL 3CVIH 4D9LH 1JZ8A 2A77L 1MCDA 1P4BH 3EIFA 4XRCA 3QWRA 3QDJE 2F8XC 2E3VA 4I4WB 4NKQB 4PJGB 1LK2A 2EC9U 5I1HL 1E4KC 2XG5A 4JZJC 5TFSH 2P4AB 5ANME 1I7UA 4L3CB 1CZ8H 1P7QB 3WS3B 2X4UA 3B3IA 3BKML 5DVNA 3ZDZE 3DIFB 3OJDB 5I71C 2Q87A 2PCPB 2VLMD 4JDTL 4UOJA 1T83A 4MD4B 1FV1B 2DB8A 5I8OL 5JQ6H 3LCYA 3TBSA 3TPUB 3GSOA 1ZVYA 4N5UA 3UAJD 5SWZB 3LEVL 4QTHA 1TZHB 1KB5B 5LGKA 4APQD 5D71L 4AEIH 1Q0YL 3U2SA 4UILL 3TA3C 4HV8B 5JORB 1HXMA 2X5PA 2P5ED 2YBRB 5JXEC 1ACZA 2BNRE 3WFEL 4KROB 1RUKH 2R1WB 3DETD 2NY1D 4NNXA 2N4IA 1T0NB 3W11D 4K23H 3LDBC 5SWQB 2ARJA 1KCRH 2PW2A 5FYKD 1DVFA 5KSAA 1N8ZB 1KG0A 3KNBA 3NABH 2A83B 43CAB 3GSQA 3MNWA 2RJMA 4UIMA 3MRDB 4R97B 3ARVA 4ZTOH 5DK0B 2I9LB 2LE9A 4HFUL 3QXWA 1KTLA 3L3IB 1P84J 4H0IA 5IBLC 1N0XL 2BZDA 2VZ1A 2QTEA 2VLRA 2P8LB 3M07A 3LKSA 5DLML 5ESAA 1DQDH 1MNUL 4HWZB 3QI9C 3QP3A 3QIBC 3TN0D 4Z78A 3F58L 2CO6B 4KI5C 1W2KT 2CKBB 3PNWA 5GZND 2C4FU 4JFED 1J1XH 1GGYA 3BSZL 2NPLX 1BVLB 2JKXA 4PJ7F 4F7TB 3QA3A 4MQ7B 3F7QA 1DSFH 5E70A 3FRPA 4LAQL 1KV3A 1VADB 1X7QA 2IBZX 4CW1A 3JV4A 2WWKT 3T3ME 3I85A 2F53D 2VZUA 4FFWD 5L2KD 1UZ8A 3WN5A 5DTFB 1NPUA 5EUOB 2NY0B 4P5TA 2IQ9H 3BRDA 5J11B 1GPOL 3SGKA 2AJUH 3S4SB 4OF7A 3K8LA 5E08H 5IVZA 3G6JA 5C2UB 2KBGA 1NANH 2DF3A 2ATKA 4G8EA 1U8JB 3MGOB 4HS3A 1AY1L 2VISA 3ARUA 3CXDH 1IEBA 1XF3A 3EOTH 3OJVC 3D85A 4OUOA 1M6OB 4XBEH 5FYLL 3QAZC 5L9DL 1KF9B 2IJ0C 1PG7H 4M6NH 5MERB 1IQDA 5KS9A 5FGSA 1P1ZB 4PJEE 5ESVB 2ZSVA 1B6DA 1ZWIB 5DD6A 5F93C 3GI9L 3QWQB 5DGQA 3VWJD 2QADD 4P23D 4LSRH 1DBKL 3I50L 3GI8L 3TVMA 3TYFB 1IFHH 3UX9B 1JPSH 3EOBA 1YPZB 3WUWB 3CJJA 4BQCA 5E2WL 5E6YA 5F97E 5LJYH 4P2OC 5TJWK 5IT2L 3WKML 5FV1L 5JOPE 5ICXA 3HLAB 3BQUB 4BZ2L 2W0KA 2C3XA 4WGWB 1M7DB 1AGBB 3BP6A 5KSUA 1BJ1H 3SE4A 1S9WA 1HSBA 2R2HB 2G60H 2R69L 4CUCA 2FHFA 3SHSA 5C0BB 2Z31A 4WEBL 5BVJB 4X4YA 3G9VA 3DTXA 5HGHA 4Y4HB 1RD6A 2Q3AA 5IEKA 2CLRB 4ZUVA 1M7XA 1Y0LA 2EYRB 3AS3A 3OXRA 3IDGB 1PX4A 2FDBP 1MREH 2FL5A 2IF7A 2VKXA 1QA9A 3ZMRA 4HULB 5DEGB 2AVGA 4GJTB 1DUZB 1S7TB 2NLJB 5KSVA 1S78C 2ADJA 2HFTA 2EDHA 4RWHA 3GUTA 1YEEL 4RDQF 2DD8L 5EZLB 2YUVA 4MA1B 5LWYL 3WFHA 3RGVD 3BPNB 3T1WA 1ZTXL 5CD5D 3WHXB 2AEQL 2XZCL 3W9EB 5B8CB 3QDGD 1JHTB 3ZZ1A 4AZ8A 4MAYA 3NBNA 3MR9B 2AXFA 3INUL 4NFDA 1FZOA 2I26N 4LLQB 4GSDH 3Q5YA 4QRPD 1G6RB 1RZJH 4JRXE 4OLZL 5ILTH 1EPFA 5FOJA 4N0FB 1FG2A 3B8SA 5J3HC 4HS8L 1MPAL 4OV6F 1WFOA 3O3UN 1FFRA 4WDIB 1TJGH 3T77A 4B7IA 2QSQA 3V52L 3ABZA 1IBGL 2J4WL 3C8DA 4XX1E 5EIIA 3EZJB 4PB9L 1E4XH 2YSSA 5DQJB 3SY0B 1JNHB 2ICWB 3FQWA 3VWKB 1ZGLB 2WM0A 1M05A 1S7QB 3GSNL 5ALBL 3F7PC 2AXHA 2EE6A 4Z7UA 4Z7VA 4JFDB 4I48A 2AJ3A 3HI5H 1GSMA 4FQXC 4PRIB 4MLSA 4HUWB 4FNLH 1U8OB 1S7XB 5DJYA 3EBAA 3NTCH 4KK6C 4U6YA 4GW5B 3S37H 4HHAA 4JM2F 2Z35A 4WEMB 2A6JB 5GRZA 3W0WA 2YPVH 4L1DA 2HFFA 3GSNA 1RK1A 5GISL 2PTVA 3ZKMD 2DQFB 3H7BA 3QCTH 3U7AA 2D0FA 5I2IA 2E7CA 3LKPA 4JLRB 2PYEA 4JJ5A 4YHOH 4KAQL 3BMVA 4K3JH 4DGVL 3MV8B 4FFYH 3BPOB 5F88B 1B4JH 5DRNB 3E6HA 5BS0E 3QIWA 4LVNC 3MOAL 3O4LA 4F7PB 5DDHB 1O5DT 4PD4K 1T89C 1EXUA 2X4RB 4LSUL 4WO4B 4OCXH 3UTSA 4JKLA 5C0EB 3S35L 1GGIH 4C55A 3FT4B 4QHNB 4GG8A 3RWCB 1NGZA 1QFUH 1OP9A 5F7MC 3GNMH 4XCEA 3ZE0E 2XN9B 3SEPA 1A6VH 4PJHF 2H8PA 3NACH 3VG0H 3B6SB 3H3PL 2X89D 2E9JA 3QUMB 2FO4B 1XAUA 2VLJE 4M7ZC 5J1AB 4OIBA 4Z5RA 3LN5B 4NO2B 2BNQB 1BGXL 4JKPH 5CSZA 1U8HB 3MV9D 1QRNA 2KZ1B 1A7RH 3FZUD 5DS8B 1NLDL 3QDJB 3WS3A 5IFHL 1YN7B 4JKKA 3F62A 5I30H 3KG5A 3MREB 4EBQH 3GJFH 5DJ0A 3S5LA 3VXNA 1S3KL 1WAAE 2BY0A 4HK3J 2ZCLH 3CSPA 4L8SC 1FORL 3VI3E 1VGKA 5JHDA 3BN9D 4OZFG 4TOYH 2YUWA 1PZUB 2XTJD 5T1MB 4NUGH 1A02N 2HVJA 2ZSWA 4ELKA 5E4EC 2B5IC 3GKWL 1WCQA 3QG6A 4P57A 5EU7E 3QHZL 4PJ9B 4ZOAA 4RFEA 3BPCA 3NCBB 1NFDB 3BRGC 4HKBA 5I1KL 2VZTA 3VXRD 1XGTB 1FE8L 3MRPB 4APQC 1EK3A 1CFBA 1MJ7L 1CLZL 1CE1L 5DFTA 2JJSC 2BNRB 3P0YH 4JHAH 2CKBL 2YD2A 5IG7B 3CFEA 4JDZB 2ED7A 1FC1A 2NY1C 3DETC 4XPFL 4HGKC 5JW3H 1UVQB 5FCSH 5IF0A 1S8DB 1FIGH 4XP4H 3OKYA 1NAMB 2X4OA 3GSVA 5HHXL 3SE3A 1X4XA 2JIXA 1N0LA 3MROA 4X4MA 3WKNA 5F96L 4KJQD 3AGVA 1R0AL 3HG1B 2Z4QB 4BFBD 4GAGL 5KG9B 3MLXL 1I1CA 3M45A 2O61B 5FF6A 5JIPA 1D5BB 1MLBB 3V7AE 1SVZA 2ZPKL 1V7MH 3MBEB 4E41D 3TN0C 1NEZA 4P46A 3GMNA 5GZNC 3IJHB 3KPSB 4NBXB 3DWTA 2PYFA 2HN7B 5ID1A 3K46A 3WIIL 4C59B 3BO8A 1WZ1H 2OP4H 5IV2A 5D7IE 4L4VB 4QRQB 3ZLQC 1G7IB 1KNOA 1Q8MA 1AP2B 3TZVB 1V5JA 2D9QB 1O0VA 4FFWC 4QF1B 2VLRE 3GMRB 3KHQA 2DM3A 3GIZL 4LCYA 1K9TA 4ZXBB 3HE6D 3Q5OA 2OS7A 2W9EL 1M7IA 4IDJL 5C2BL 2FCBA 1DJSA 1C5BH 4F9PC 1QYGL 1YEFH 2YKLL 4L4TA 2HFGL 3WO4B 1BFTA 1N64H 4GKNB 3QXDB 4QKXB 5ICZB 4R0LA 3O3DA 1V3JA 5CHNB 3SDYL 2YS4A 4FG6D 4CNIA 3MJ9L 4PJEB 2IPUK 5D1XA 3K4DA 2OM5A 1V3KA 4S0SD 3K4AA 5FGCE 3BUYA 3AREA 1JZ7A 4P23C 4JZOB 2X41A 2BOCB 3NCFB 3G6JE 5C08D 5FHBH 3VFVA 2YD6A 1MJJB 2CMRL 2VDKL 2PTTA 5C09A 4M5ZL 1M7DA 1HDMA 4P3DB 1K4CA 3MJ9A 3ZE2E 5EOQH 2BFVL 3IFOB 5C9KA 4OZHF 2CPCA 1VCAA 1TVDA 5E8DL 3VU2A 4H1LH 1RZKC 3HI6L 1JK8A 1S7VA 4R9HA 1UXWB 1F11A 1GGUA 3E0GA 4K7PH 4FN0A 5ITFA 3IDXL 2CLRA 4OD3H 4OCRH 4FFVD 1NMBL 1TENA 4CU7A 3B9DA 3PDOB 3VI4E 2DBJA 5HYSA 4I0PA 1E0OB 4ONOA 1N6VA 2DWDA 3X14A 1A9EB 35C8H 5D70H 1CD9B 1OTSD 3QEQB 4FXGB 3X17A 3GZKA 3VA2C 1RZ7L 2HH0H 1QPPA 4X98B 5FM5O 4HZAA 3EOAB 4AYFA 4JPIA 2DQDL 4ODTL 1ZLVH 5F7UA 3U4AA 5DEZA 2J6EH 1MFEL 4WY7L 5T1DL 3UPAA 1XIWB 4UQ3B 4X5XA 2B20A 1CI5A 5K9QI 1RV6X 2VQ1B 4GUPA 5CBEB 3RGVC 1KFAL 3VXUA 5LKNA 4N0YL 5CD5C 3PHSA 4V1DA 3V95A 1W0WB 3QPXH 5IMLA 5I73C 3TO4A 1H3VA 4WFFE 1PZ5A 1RJLA 5LQBL 4V2CB 3T0ED 3RVXD 1JN6A 1KTRL 4HAFA 4LLMA 1NGWA 3WL9B 1YEKH 4JQVA 3MBXH 1XGYH 1YMHA 4JRXB 3VJ6B 3RVWC 1NGYA 1I9EA 4JFYA 3RNKA 5CLTA 4JGJA 4F7EB 5BOPA 2EH7H 2XWBB 1KLUB 2YA1A 4RX4D 5GRYA 4DEPB 3T4AA 3MCKA 1FNSL 1JL8A 1BJ8A 1BQHG 1NCDH 2L7JA 2NMSA 5EBLA 1Q0XL 3Q1SL 5I18H 1OPGH 3LD8C 4HX1A 1A6AA 5DJCB 1AE6L 1CL7L 1W8OA 4FQHB 4HBCL 2JE8A 3ES6A 1AXSA 4J3OC 1GC1C 1U92A 3B5HA 4YPGB 5IQ9B 4I18A 4BQ6A 3DMMA 1MCWM 3WIFA 1DQJB 4JO1H 2IANA 4PREA 1SEBB 3AXLB 1LO3H 1A7PL 4LCUA 1LHZA 4PG9A 2H32H 4HQQL 2FR4B 2ESVA 2F9BT 1MCBA 3LN9A 3EO9H 4GRWE 4XNQA 1NFIA 4TQEH 2NXYB 1DQQB 5IBUB 4TRPL 1TVHB 2H9GB 4G6JH 3HPJA 4D0BB 5C0CA 2WBJD 4FMKA 1S7UB 3Q5TA 4DZBA 1DDHA 2I27N 5DRZB 4QRSA 1ZA6B 1T1XA 4KHTH 5FUZH 2CK0L 4TTGA 5CILH 4FQIH 1L7IH 2ICWJ 3QH3B 4P4RB 2AI0H 4NYLA 3BKJH 3PV7A 4FABH 3VXTA 3OTTA 1B9ZA 2BJMH 4MNHB 3O9WD 4UDUA 4YBQD 4ZUTB 3AUVA 2G9HB 5MHSE 3DX7A 5D2LB 3UTTA 1U8QA 1MFBH 2X40A 2DQHL 4HIJB 5BZWB 3NFNA 4R8WL 5HGGS 3W0WE 4YGVB 5E9DA 1CDHA 1RZGB 4YHNB 2FBJL 3V4VL 3W9DB 3S9DB 3HAEG 3BHBA 1C12B 4OSUL 3GSWB 4YBLB 1JYXA 3BT2H 2ZUYA 4PGCA 4G8IA 1N5YH 3ULUH 5IBTL 5KAQF 1L9NA 3BFOA 4LPTA 2VLJB 4W81A 4X9GA 3L7EB 1I7RA 1IGCL 2P43B 3O4LE 4LCCC 3SDDA 1VFBB 3FO2A 4Y4FB 2A2QT 1OD9A 1YN7A 1A7OH 2GJ6D 5DI8A 3VXMB 1JF5A 3O4OC 4LHUA 2UZXB 3QJHA 3DUUB 4D0DA 1U42A 1SYVB 3UTSE 1VGEL 4J3VA 1PSKH 1B90A 4QXWA 1OP5H 3OB0K 4D9QE 3O3EA 3HMXA 3RWGA 4ORGA 1NBYB 1JPST 3NCMA 4GLRI 4WU7B 3AY4C 4PGBB 3HR6A 3RQ3A 1K4DA 4PBVC 2Q86A 4P3CL 1W0YT 3FQTA 2AK4D 3I9GL 5EC1B 4XP9H 4Y2DB 1QNZH 4KUZH 4JFXB 3X11A 1QRNE 3BEWA 3BN9C 5D7LD 3FT3A 1BD2D 2VDRL 2AABL 3MRIB 2QHRH 4KMLB 5FGRA 2EIBA 4PJGF 3KPNA 2A74B 4J3WA 4PGDA 2GSIB 3QQ4B 2CK2A 4AMKL 1UXSB 4HUXA 4JRYD 1JNLH 1ETZB 5EBWB 2F54B 2W9DH 3L3GB 3EFFB 3HRZB 1QEWA 5BRZB 2XICA 5MI0C 1MCHA 4PJ8D 3IDYC 2DLGA 4NCDA 1WFTA 2BSTA 4S11A 5JHDE 3MRNA 1YQVL 1DBJH 1QO3B 3GMMB 4OT1H 1RIHL 5GGVL 5DEFA 3CXHK 1YNLL 2R1XB 3K2UH 1WQVT 2LAGB 4RQQB 4AENB 3IDMB 4P2RA 1FH5L 1JZ4A 1U3HB 3V6FA 3D39D 1U8LA 3RVTD 1FQ9C 1QSED 5LAXB 3TIEB 4ZS7L 1OM3H 3TH4T 1RMFL 3OGCA 5ADOL 1FDLL 1KN2H 3U0PA 3DRQB 5DHVA 3OHXA 3U1SH 4WW1B 2VIRB 1F6FB 1GZQB 3RA7L 2R8SH 5GGSB 5EOCL 1AP2A 2DYPD 3QRGH 4YHML 1YUHA 4XBGB 1OSPH 3IETB 1Z2KA 1LO4L 4POUB 2YEZA 3MLZH 3RIAK 2OTWA 4YR6B 2IFFH 1OP3K 2VABB 1ADQH 4WI2A 3RBSA 1OTTD 2GQHA 2BRQA 4Q9QL 2KUTA 4WHDA 5I66A 3SO3C 2KPNA 2ADFH 3FN9A 3QHFL 4MXWL 4PUBL 4HWBH 3SE9H 4R96A 3LKOB 1QFWL 1FRGH 3DVNA 3SCMD 1I8MB 4HH8A 4DK6A 4O2FA 3GM8A 3HE6C 5D8JL 3ZL4H 1RZ8A 3LKQA 1ITBB 1KPVB 5E0QA 3RX7A 2OMNA 4I3RL 2EEDA 1H5BA 5F9WC 3QPQD 4XBPB 5T1LB 2NXZB 1NCAL 5EU5A 1W0VA 4X8JB 1S7WA 4JM4H 1A14L 1AKJA 4IRZH 3DVIA 3TIDB 1C16B 1UFUA 3L7FA 5K9JL 1FCGA 2VC2H 1QKZH 4FG6C 5EUOF 2F8OA 1Z6JT 3D69B 5AZEL 2IG2H 2AXGB 5K9OB 4Y16D 1KEMH 5KOMC 3TBWA 2UVEA 1BQSA 3MRLA 3SJVA 1XCTA 4YHPA 3SKJL 1IGJA 2WQ8A 1XH3A 3V0WL 2HTKD 1CCZA 5I8KL 5GRWA 2EDLA 3LRSA 1PYWA 1S9XA 3CCHB 4RMQA 5BCAA 3O3AA 1F6AB 4F7MA 1FYHB 2OSLB 1ODAA 3T8XB 3SQOH 1U41A 1UJ3C 3KPRD 1FLRL 4QO1A 3JWDH 4G7YH 4FFVC 4B53A 1H3XA 3O6ML 2R0LH 4NWTH 1RURH 4KZEH 1YPZF 3LQAC 1JRHL 4ODWA 3GHBH 3ROLA 3MRRB 1MRFL 4FQCH 4OF0A 3E8UL 1TDQA 3BKCH 4KTYA 5J57B 3EOAA 1A6UH 4XZUA 1CXEA 4KKNA 1MFAL 5TQ0L 4KJYB 1MEXL 5ISZA 4LKCA 5DJAB 1OTSC 3O6KL 4YDIH 5IM7B 3BH9A 4Z7VE 4NM8H 3QDME 3LQZB 5CGYC 3MTRA 2PN5A 5D5MA 5FYJU 5KJRL 1A9BA 1M1SA 1H0DB 5FV2A 3DECA 1PLGL 4UTAL 5B39A 4J3SA 3D0VB 5DD0H 4OCSL 2Y4SA 2JCCE 2F5BL 1OGAE 4ZDHA 5IHZA 1P7HL 2Y06L 3NCCB 4NP4L 1N2RA 4IOFD 1A6ZB 2X7LA 4AG4H 4H8WC 3WE6A 4F15C 3GSRB 1IEAA 3A6CH 1I1YB 3RVXC 4EDXB 3ARXA 3PP4L 4M02A 3EYFB 2EIZA 2GT9A 4WUUA 1RUMH 1KJ2B 1JYWA 3DHMA 4I77L 4KXZI 1R5VA 5J1TC 4QXGL 3NIFF 5ACZA 4M6MH 4PJBE 5T3ZD 5CJQL 4OCMC 5I15H 4R7DA 3PIQB 5HGAB 4NKMA 4PRBA 4TVPD 5CSGA 3UJTL 4QCIA 1JIBA 2EDKA 4MAUL 1A6TA 2I25N 2V17H 2A6KB 3ETBF 4C4KT 4QRRE 3B2UD 4YDJB 2O93L 3IFPB 1ONQB 2WIIB 4YEEA 2FIKA 2IAMA 1OQOA 5IB1A 4LLDA 1SM3H 2BNUB 3FCTB 1YZZA 6FABH 2FYYA 4ZD3L 2BMKB 2X4PB 4EUPB 2DLHA 1YEHL 4BH8B 3ARGA 3ZKXC 3HC3L 4QHMA 4Z77B 4NO3A 3CGTA 4M1DH 2VUOA 2A9ML 4BZ1H 5CEXB 2QR0B 1FVCA 1Q72H 3QUYB 3FB6B 2VLLA 2BVQA 1FVDA 1RJZA 4D0CB 4G9FA 4C83A 3EYQC 4P49A 2GITB 1P6FA 3TP4A 2AERT 3GSXA 4K3EL 5KVEH 1T22B 5TQ2L 1DQLH 5DHYB 3FTGA 4K8RH 4UBDC 4RIRA 3BP4B 3FO1A 2APWA 2WBJC 3PWPD 2Y6SC 4HXBH 4EN3B 5HTSA 3WMSA 3WNKA 3WJLA 3E6FB 1NCBH 5D2LA 1HNFA 2IANE 3K0WA 4LOUD 4CVZA 3RY6C 2ZUVA 3VFSA 5K59E 3BKYH 4YBQC 3O9WC 4AIXA 3PWUA 4OTXH 5DMJB 3ZKSD 2ESVE 3GBML 4M6OH 5CINH 4ZSOB 1HHKA 2GAZB 3ARPA 1KIPA 5CCKL 5C0CE 2LU7A 2VOTA 5L8LB 3QNYB 5TDNB 1BZ7B 5H37G 3WNLA 5KW9L 1P4LB 4JY4A 2V2XA 4XB8A 1MCPL 4OQ1A 3N85L 3PQYA 3NFSH 4FMFA 4OD2A 2FX9H 3ZYJA 2Z8WC 3UTTE 1ZEAH 2PO6C 5GRUH 4UUJB 4YLQT 1NGXA 1WCBB 2NY7L 2VKWA 5E9DE 3QUXB 3HI1B 5HHQA 3B9KA 5J13B 1KENL 2OYPA 3T3PF 1FJ1B 3OKMA 1KCVL 4MHHI 1P53A 4OD1L 1NGQL 1BBJA 1I7TB 5BMFH 3DGCR 5EC2B 3R06B 2VXTL 2H1PH 2ED8A 1JWSA 3H9SE 2E8YA 5J12B 1JGVH 1KPUA 3I3BA 4J8RA 3CUPB 4RCAA 1KIQA 3P77A 5F71A 3V4PH 4TSBL 2HJFA 1S7RB 4H88L 4Y5YB 1D9KA 5CEYB 1I1AB 3CDFA 3K1DA 3FB5A 3FRPG 3WJJC 4N8CH 3C5JB 4RMWA 1MJUL 1FSKB 5C9JA 2J8UB 4PJXA 5KBNC 2ZCKL 3EYOA 4ONFL 3RGHA 1ZSDA 3RIFF 2MJWA 2B7DT 2XWTB 4WTXA 1U8PA 4AL8L 4PG2C 4PJ8C 3HMWL 3DVGA 4OGXH 2D3VA 1YYLH 5D9SA 4UNUA 4ZFGH 2G2RB 4XP6L 2R0ZL 4XWGL 3SKUD 1XR8A 3MLPA 1HZHH 2ZWLT 5TE7H 1NFDF 4ERSL 5I75B 2QQNH 2DTSA 1MCOL 1XMWA 3RVTC 1NC2B 2DLEA 2F74B 3GMPA 3CU7A 1GZQA 3TPKA 5IQ7H 1T04B 4X0KA 4D3CH 1UWEH 4IIQA 4Y19B 4CRPA 3BEVB 2EXWD 3T2QA 2ATPA 3GHEL 5KANI 1EA9C 4NQVB 4MJ6B 3C09C 4OLYH 1CGTA 3MRMA 5LGJA 4YHIA 2DWEA 4YFLF 3V4UL 4KTDH 4M7LH 1HXYA 2VSCA 3C6LA 3RZCA 3LHPH 4P2RE 2DMKA 3U82B 2JTDA 4K9EC 1ED3B 1FZMB 1E27B 3JSSA 1OTTC 3UYPA 3LSOA 2I60L 4U7SA 3W2DH 3SKMB 4XVSL 1A3RL 3I02A 5F72S 5JR1H 2CXGA 4PY8J 3L5WA 1X5FA 4JFZH 4WNQB 3KYAA 2EYTA 3KS0J 4H20L 4UINL 1RUQH 3L3OA 3AS0A 3RL1B 1YNTB 3K8MA 5CEZL 2AJVL 1IQWH 3KVQA 2NTFA 3WNMA 2VRAA 2X4QA 4WFEE 5GJSH 3V5KA 5JDSA 3CVIL 2WINB 1KGCD 1MQ8A 4WWKD 4D9LL 1P4BL 4JHBA 3KR3H 3UBXI 1FL6B 3DGGB 5DD3H 1NKOA 1K2DB 3WFCH 3UC0H 1OAKH 2Q8AH 5TFSL 1DCLA 2YMXH 4Y16C 3MNVA 3VFUA 1A6PA 1YC7A 1LO2H 3BP5B 1BM3H 1CZ8L 5I1EH 4ZUSA 2NW2A 3LOWA 2K3TA 2HTKC 4IRJB 3KLSA 3MGTA 1FHGA 3B8YA 2QEJA 4OIIH 3GMQA 1UZ6F 4U6VH 2WNGA 4PJEF 1N6UA 3K4ZA 3C60A 5JQ6L 3KYMA 3TWCH 1VFAA 1UENA 4XNZB 1YMME 5J6HA 5EZIH 2XQYG 3ZT7A 4OI9A 5HYFA 1V05A 3RJQB 2OR9H 4AEIL 1Z9SA 5JZ7D 1XF5B 2B1HH 5IMKA 3VRJA 4WTWA 5JOPD 3C6SB 2APVA 3GJFB 4ONHA 1P4IH 1HYSD 1RUKL 3KXFD 3ROOA 1JPFA 3G5YB 4HKXA 4OLUH 3L3KA 3NN8B 4K23L 3DX8A 3HTLX 3NFPB 5HY9A 1KCRL 3T65A 5F7WC 3NABL 3PF2A 4A2LA 3QDMB 5SWSA 1CICB 2FJFA 3VD7A 2DQCH 5FO9A 5GRVK 4ZTOL 4Z76A 4PRAA 5AD0B 3QCUH 2FJHA 3MNZB 1FFOB 4JQXA 5KN5B 2MTPA 3U6RA 5D1ZB 2JCCB 4EDXA 1OGAB 3V6ZB 1DQDL 1MI5B 3QBTB 4XNXH 3TFKD 4IOFC 3AFLA 4WV1B 1J1XL 1ZHNB 1IKNC 4LPUA 4JREC 4PLOB 2J1KA 2QLVB 5D1QA 5FA3B 1ZT4A 5DUBB 1DSFL 3RI5K 4IRSB 5D5ME 1CBVH 1RZKH 5JLZB 3DX6B 4K94C 3M1BB 3WDHA 4ODBD 1P5UA 1AGCB 4MXQD 1KN4H 1JZ2A 2IQ9L 2H3NA 5D93C 2AJUL 5D2NB 1CDBA 5HPMA 1QLFB 3KPQB 3O6FD 2O5XH 1BLNA 5E08L 4QRRB 2XQBH 2MMXA 3CX5K 3B2UC 3LIZH 1OB1A 3U79A 3CXDL 2COQA 3EOTL 2NQCA 3MMEB 1I85A 3H9YA 4WUUE 4XBEL 3JTSA 2OK0H 1FVEB 1PG7L 2VDLH 4M6NL 3SDXA 1T2XA 2XNAA 5BXFB 3IDNA 4FTVA 5TH2A 1R3HA 1QFWM 1HQRA 2BDNH 1ZLWH 3C5SA 3UBXA 4LSRL 1UEYA 2MFNA 2IFGA 3BW9B 5ICYA 1A2YB 5D6CA 1WZLA 2OX5A 1IFHL 2YC1B 3DRTB 1JPSL 2X4NA 4C56B 1JHKH 1TIUA 1PKOA 1EMTH 2R1YB 4PPTA 5DQDH 3VD4A 4JY5H 5FA4B 1BHGA 5TPWH 1CLYH 3PGCA 3Q3GB 1MSPA 5MEOA 5HGDB 1KYOJ 1ZMYA 2XPGA 3B2VH 4LOUC 4U1IA 1G1CA 4OF8A 3S5LG 2ENSA 1KXVC 3BXNA 2GY7B 5A2JH 4XCYB 2G60L 4YDLC 4G9FE 3PDDA 4E5XB 1CN4A 3OX8B 1A6WH 4RMRA 4ZFOB 2BX5A 4M8QB 1QQDA 1BOGA 2YWYA 1SJVA 4RGNB 4JFFE 1HHIA 2WIMA 3EDJA 5CSBA 2CD0A 1T2QH 5BS0D 1MREL 4XAKD 3CC5B 2B4CC 1WVZA 2HWZH 3OJ2C 4UUJA 4OGZA 2AV1A 1IGMH 3RHWK 4K2UH 3FOLA 3KHOA 4GMTH 3H2WA 3VFMA 4PR5B 3HI1A 3PP3H 4HIEB 2W0PA 4P4KD 2ZG3A 2VB5A 2HG5B 2OI9C 4JDVB 2AQ1A 2UV3A 4R2GB 4U0QB 1C08A 5CJ8A 3TNMA 4Y4KD 5HVGB 3VWJA 1HKLH 5EOTB 3MV01 3SE8H 4BSVB 1M71A 3LKNB 1OOAA 4PV8B 4GSDL 4PP2A 3QUKB 1RZJL 4NHUA 1U8NB 3QXAA 1W72A 5ILTL 3CFJB 3O2DH 1K6QH 3QFJA 2CGRH 3P0GB 5IROC 2FD6H 1KB9J 1ZHBA 4I9WE 2EYSB 1TJGL 3IS1X 1EEUA 4HUVA 5C07B 5I1CL 2DAVA 1JWUB 4K55A 4ELMA 1HILB 2R2EA 3BH8A 2BSRA 3AMKA 3TYGH 4GKOA 3V0VB 3C5ZB 3PL6D 1FZJB 1HOCB 3BESR 5LCVH 4HWNA 2DQJH 2AKRA 3RWJB 5HJ3B 4LBEB 3S4SG 1E4XL 4X9FA 4K7PY 2XFXB 1J12A 4NQED 2V5SA 3QWRD 1K8DB 2DQUH 4Y5XA 5D7JA 1A1MB 3HE7B 4TUOB 3ARBA 1Z5LA 3EDEA 5EB9A 3HI5L 3RAJH 1F2QA 2GEEA 2EE2A 2DN7A 4Y88A 3L1OH 4FNLL 1G9NH 1R5IB 1GVIA 2ID5A 4WW2B 2O5YH 4ORZC 1SYSB 3NTCL 4EVNB 2LAAA 3B5TA 3S37L 4GRMB 2BXZA 3JWOC 2X4SA 2A6DA 4PJXE 3CFCH 5FYKU 2YPVL 1N59A 4N9GB 1HI6A 2FGWH 4RWYH 5GGQH 1XF2A 3MCLH 2EXWC 3QCTL 3HZYB 1XZ0B 4ZPTB 2X70B 4MCYA 4YHOL 5MEPA 4LDOB 4K3JL 3VD9A 1IM9B 4J4PD 4FFYL 1B4JL 3BDXA 4RISH 4X5LA 4XNYH 1NDMA 2J8OA 4WTZA 3O11A 4NQCA 3L3DA 2NY2D 1LNUA 2JELH 1IGFH 1T03H 4MNQB 3MRQA 1N3NB 2PW1B 3OR6A 2H32B 4OCXL 3OXSB 3SDAA 3MJ8B 1CFNB 4NC2B 1GGIL 1TTUA 1BBDH 3VFWA 3WLWD 1AQDB 4NQSB 1DVFD 5KSAD 1QFUL 2XY2A 4X6EB 3GNML 4P59H 2EDQA 2J5LC 1A6VL 5DJXB 3NACL 2P46B 3VG0L 2OXHA 4KDTC 5HYSG 4JN2A 5KZCD 4XVTH 1L9MA 5D7IF 3T04D 3MRFA 4LL9A 3BZ4B 3MUGA 1CFSB 2VLRD 4JKPL 3DX9B 2NX5E 1A7RL 5E8EB 5GSVA 4WWKC 3TBTA 1D7FA 3QUZA 1NCTA 1INQB 3VH8A 4OFKA 2YZ1A 3TNNA 5I30L 4X7SH 5GIRB 3RDTA 4EBQL 3ARDA 2VLKB 2FJGA 3MYZA 1C5CH 1XGUA 3NPSB 2ZCLL 4RAHA 5FIEA 2RHEA 3ARFA 3FQNB 4JFPB 4P5TD 5FDYA 4LEXH 4YAQA 1XF4B 4DGYH 1HHHA 4NUGL 2X1OA 4G6ML 2NTSP 5CJXA 1CGVA 4PJ5B 1YMMB 1G7PB 4IS6B 4HIXH 2XA8H 3VFRB 5C8JA 5C0IB 1DE4B 5IW6A 1AO7D 1ZANH 1OVZA 3D85D 4PJAE 5FDWB 2HLAA 3U30B 1E4JA 1A1OA 4NN5C 5JZ7C 1ZHKB 3P0YL 4JHAL 3GMLA 4ZO7A 1HYSC 2X4TB 3RWDA 4FXKB 5JW3L 3U0TB 1BX2A 4X99B 1U0QA 4D8PA 3OKNB 3VXSB 1FIGL 5I8CA 4XP4L 1RU9H 2EIEA 4U1NB 2LQRA 4HFUH 3TVMD 1HCVA 2F8VA 4M4PA 1D6EA 4UB0H 3EO1B 5FYLD 1OT2A 1RIVH 1CR9H 4OLVH 4KZDH 1QD0A 3UDWA 4KRPD 3DURA 5L2JB 2B1AH 5GPRA 3VFNB 1IMHC 4UDTA 1R24B 5I8EB 1V7ML 1BFSA 1G7JB 3B9VA 2C7UA 2PR4H 1UCTA 4J23A 1G7HA 4L8DB 3TFKC 4DUXA 1JZ3A 1MWAH 3V6OA 3GDBA 2Z31D 4ODVH 1WZ1L 2OP4L 4M62H 1E28A 4R7NB 4Y5VA 1IRAY 4AH2B 2V2TA 5D2NA 5CZXC 4O2CB 2D9CA 1RY7B 3MGAA 4JZJB 2D7TH 2EKSB 4UU9B 5L9DH 3O6FC 5DRWA 4ZUWA 1DTUA 4Q2ZA 1ZS8A 1KTDB 1CIUA 1C5BL 1YEFL 3F12B 1T6VN 3OKKA 3MSPA 3X13A 4IHOA 5I71B 1N64L 4N90E 2VLME 5ESQA 4MAYD 4F57H 4TVSa 1TITA 3I6KA 1OF2A 2WBWB 3QJFA 4HCRH 2Z92B 3BD4A 2A9NH 4ZFOL 3TA3B 1KOAA 4P2QA 3HS0A 5MEQB 5FHBL 4ZTPH 4E42A 2OJEA 4PYHA 4OF3A 4LHUG 2VN7A 2DM2A 5ID0A 4U1LB 3VXOB 2J8HA 4WI6A 4F2MA 5JUEH 1FNGA 1DLHB 5EOQL 3FQXB 4PLJD 5IB4A 3SDXE 3LDBB 1ZVSB 1KEGH 1GYAA 1A22B 5DVMA 3FFDA 4OLWH 4MX7B 4J1UA 1LVEA 1F97A 2P5WB 4K7PL 1TQCC 3MYJA 4NKIH 4CN1A 4OD3L 4OCRL 4QXTB 1I9IH 4M43H 2QKIA 3OAZK 3ARWA 2IBZY 1CIDA 5GGUA 3NOIA 1ZLUH 3B83A 1OARH 2ZUXA 3H0TA 1HWHB 3QI9B 3V2AR 1LDSA 2JB6A 3QIBB 5FGBA 6CGTA 1FCCA 4JFFB 3KYOB 35C8L 2GJZA 3RUGB 3HUJB 5D70L 4H1LA 1Y18B 3MOBH 4OFVA 2DD8H 4PS4H 5MHSD 1YN6B 2HH0L 5DK2B 2Z93B 3S36X 1IM3A 1E6OH 3F7YB 5EN2A 1SEQH 2GTWA 3W0WD 2J6EL 2XZCH 3N1GC 4LEOB 4NOBA 4ESKA 3PWLB 1PQZB 2DJUA 4U2YA 4P4KC 4MNGA 4DWHA 4MZ2A 5L2KE 4Y7MA 2PYED 1MCIA 4GXUM 1IC4H 1UWXH 3QPXL 4OLZH 1N7MH 4G43B 4LFHG 3L3JB 2W0FA 2D7QA 4PJIE 1F4WH 5C08A 2APXA 3O4LD 2BK8A 1YEKL 5HHNB 3MBXL 1XGYL 2J6EA 5GQBA 5JOEA 5IVNA 3QAZB 1AI1H 3IVKA 1YY8A 1T4KA 4MCZA 3UTSD 4MDIB 4ZAKA 2EH7L 1JUFB 3TCLB 3MLTA 3GKZA 4LSQH 3BWUC 4LKXB 4MXVE 3CSYA 4ZO8A 2P7TA 3AAZB 2VDPH 4PRDA 1G0YR 3VRIB 1NCDL 4EQ2A 3FL7A 3D25B 4Q6IC 4X83A 2GK2A 5FB8B 5I18L 3LEXA 4AM0A 4HKZA 1S9YA 5JPMA 3PL6C 2BVPA 5B3NA 1QRND 1S9VA 4N1CA 4M9OA 4DAGH 2C3WA 2ITDA 1AXTH 4P2OB 4U05A 4Z6AT 4L9LC 2AAVA 1S9KC 3QFJE 2ZNWA 4X5WB 4DN4H 4NHCH 4AQOA 5EU7C 3UTQB 1VA9A 4JO1L 4HLZG 1OLZA 3G5ZA 5F9OH 3QZWB 4PRHB 3PGFH 1LO3L 1WC7B 4NUJA 4ELME 5T3XH 4UT9H 1NSNH 3OAYK 2J8UF 4PB0H 1FFNA 3EO9L 3ET9F 5CBAA 2ICEB 5JHDD 4N5ED 1Q9KA 2OTUB 4G6JL 3FQRA 5I1AA 1J0KA 1RK0A 3IU3B 1T83C 1JPGA 3T0EA 4FP8H 1Q9OA 4A2MA 3O2WH 4MSWA 5DJ8B 3G04A 4KHTL 5FUZL 3OKEA 5CILL 4FQIL 1L7IL 2AI0L 2ED9A 3BKJL 1F3DH 5FO7A 3VGEA 4FABL 4L4JA 4XC1H 2BJML 3FRUB 1IGYB 2H26A 5DMIH 5J4MA 1EEYB 3IJYB 4K07A 4CJ0A 2NY2C 1MFBL 4X6EA 2WP3T 4F3FB 2MHAA 1G7LB 2YPLA 3K2MC 1VEOA 3S97C 2FSEA 2JIXD 2G75B 5CWSB 3WLWC 4BUGA 3ZT6A 2R39A 1I8IB 4F33B 1DVFC 4ETQB 5C86A 3IYLW 5KSAC 3BT2L 2UVFA 1U8MB 4KRLB 3REVA 1QTYT 1S7SA 1ES0B 3VFPB 1N5YL 3ULUL 3RWIB 1YJDH 4R3SB 1ULVA 2EICA 5HHME 1U91A 1MCJA 2W60B 4NQCE 1KB5H 4LAJH 1A7OL 1ORSA 2NX5B 4YC2C 3HPLA 4Z7QE 5IFJB 1PSKL 4ISVB 1P5VA 3MJ6A 5DUPH 1MHPH 2KZWA 4O58H 4S2SA 1PEWA 1EBAA 2EECA 4RZCA 4CVWA 2ADGB 2RBLA 5A3ID 4G6KH 1XF1A 4XP9L 3WN5C 1QNZL 4KUZL 5DJ2B 5F7LB 1EBPA 4P5TC 4X4XA 1R3JB 4K9EH 5I1KH 1FNFA 4FQXB 3SGKC 2FLBT 4HAGA 3U4EA 3KPLA 2QHRL 3ZKND 1AGFA 3MLVH 3HR5A 4UQ2B 2HFEB 3EOYG 1EFXB 4PJAB 1JNLL 4L4TD 4HMEA 3L3HB 1KJVB 1NJ9B 4G8FB 2W9DL 4OZ4A 1MHHB 3D2UB 3MRGB 1D5MA 5D1XD 4NC0B 8FABA 4DVBA 2X2YA 2QQQA 5IB3A 2MSPA 1DBJL 3IXAA 2G5BA 4OT1L 3ARED 3V0AC 3K2UL 4AEFA 5I0ZA 5GJTH 4LVNB 4PTUB 3TVMC 2CXKA 3ULVE 4NPYA 2FEEL 1IGTA 3U36B 3A6BH 5C09D 1OM3L 2CDEB 1AGEB 4KRPC 2BCKA 4OZGA 1KN2L 4LLVB 4M61B 4YE4H 5E7BA 4X7EC 3MRBA 3U1SL 3UTZA 3G5VA 1HQ4A 1TQBC 4OFDA 2R8SL 4CVXA 3SGEI 3SE4C 3QRGL 2IMNA 4M7ZB 4RNRA 1WBXA 3UMTA 1KCSH 1OSPL 2Z31C 4Q74A 1P84K 4I0PD 3MLZL 1EHLH 2IFFL 2KQNA 1CD8A 4QTIH 3G08A 5GSRA 1ADQL 1I8KA 1BD2A 2Q6WB 4WUKH 2BVEA 1T1ZB 5IB5B 2JCCF 1BEYH 2ADFL 4F80A 2ORBH 4HWBL 3SE9L 3LRGA 1FRGL 1JF1A 1OWWA 3BUTA 3BVNB 1DANT 5JNYB 3ZL4L 4LNVA 4YNYB 3VMOA 4B5EA 3MA7B 1DUYB 2YWZA 2LV4A 3V6OE 5IKCA 5IMMA 4L8SB 4HK0B 1ADQA 4G9DA 3IXTB 3VXUD 1SBBA 2AEPH 4JM4L 4IRZL 4V1DD 3CMOH 2YRPA 4PJBF 2XTJE 3ILPB 5E4EB 2XKNB 1BWWA 3TO4D 2B5IB 4MAYC 2EEAA 4NCC1 2X44D 1BZ9B 1QKZL 2IH1A 1Q9LB 2VC2L 4P5KA 1YY9D 1IAII 5T1KB 2IG2L 4U7KA 3FB7A 1IAMA 1EEZB 5D96C 4APQB 1KEML 1VPOH 4KKBD 1M4KA 5C0FA 4PJDA 2P5EB 2V7NA 32C2A 1OAXH 1ND0A 1PEZA 2NY1B 4O2EA 3J7HA 4NQTA 2A1WH 4PLJC 2GUOB 1I1FA 4U49A 1CFTB 3CDYA 4WU5B 4PGEB 3SDCA 3SQOL 1XR9A 1UKSA 5IGXH 2P24B 3I75B 4R6UA 2BSSA 2ZOKA 1JP5A 1H3GA 2Z8SA 3T4YB 1A64A 2RFXA 5T3ZH 3ZDXE 3JWDL 4G7YL 4JFDD 2D31B 5F6IC 2B39A 4P2QE 1HHJB 2R0LL 4NWTL 1RURL 2V5RA 1CT8A 4TVPH 4KZEL 1G6RH 3NZ8B 1MJ8H 3CFBB 3GHBL 3DMMD 4FQCL 1PDKA 3DSNA 2IAND 4U6HB 3TN0B 3LPWA 2BOBB 5ENWB 4JFEB 3F5WA 1JNJA 4HGMA 1Z0NA 2VDOH 1U58B 4PY7B 4YDIL 2OZ4H 4AIZB 4NM8L 2C1OB 3IF1B 5DSCB 4F9LA 4GW1B 1KCUH 2UZYB 2F53B 5L2KB 5DD0L 4KTEH 3EYVA 4D9RD 5IB2A 3MFFA 4JKWA 2DIJA 3RWEB 1NBZB 2W38A 2VMFA 4PJIB 4UOW0 4AG4L 1FL5B 1XGRA 3A6CL 3QIWC 5EO9A 4PRNB 4OB5H 5IR1A 5K9KB 3QWOB 25C8H 4U1HA 5E9DD 1RUML 4MJ5B 4NQXB 4MNGE 4DKFH 4WFGD 2VWEE 3U9PH 4M6ML 3NVQA 5I15L 3W39B 3KPRA 4NO5A 5F7EH 3QEUA 4P23B 3S3JA 3CDGB 3AU1B 5KSBA 5C08E 2FH6A 3EJZD 2V17L 5E6IA 1G9EA 1XGQB 3SDDD 1KSRA 2IH3B 4LVHC 1J88A