4M3KB

Structure of a single domain camelid antibody fragment cab-h7s in complex with the blap beta-lactamase from bacillus licheniformis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
116
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSISSITTMGWYRQDGRELVALINSVGDTTYAGSVKGRFTISRDNAKNTVYLEMSSLKPEDTAVYYCNAFMSTNSGRTGSFWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/immune system
total genus 30
structure length 116
sequence length 119
ec nomenclature
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m3kB00
5SV4A 5JW3L 3EYOB 3IJSA 1CK0L 3QEHA 1WWBX 4TULH 3AREC 2Y7QB 2YPKB 4UU9B 2PXYD 3MRMB 5TPWL 2DQUL 4PJHA 5GRVL 2NY0B 4CNIA 1IAII 2OTWA 5T5FH 4BK4A 5D72H 4JRYD 4I13B 2XY1A 2D31B 4JN1H 5AUMA 2NQCA 3VA2C 5IWLC 3FQRB 2PTVA 4RISL 3BVNB 4F9LC 4GRWE 3RWGA 4GFTB 3CDCA 2NCMA 1YN7A 1F8TL 1R5VB 3LD8C 3TEUA 1IEAA 3OG4B 1QSEB 1DBJL 1ZGLA 1TJHL 4LLMA 2JJWA 4X83A 1OQXA 2AXJA 4KJQD 2RR3A 4Y1AB 4Y4HA 2E3VA 2LQRA 3QIUB 2D4DA 1MCSA 3SGDH 2DJ4A 4OFVA 2OSLB 1RMFL 4PRPB 2V17L 3A6CL 2HH0H 4S0TD 4V1DB 2AXGA 3TV3L 1NSNL 2D7OA 3RVTC 5AD0B 5K9KA 5D7IF 1Q9LB 5HYEA 5HHME 1RHHA 3GNMH 4ZUUA 3NCFB 2AJXH 2YWZA 1QLRA 2XZZA 2WUBH 1SEBA 5T1DL 3HE7B 4G6ML 4PJGE 4PJFF 4W4NA 4NO2B 5IBUG 3QUXC 4O5LH 5C0RH 2R1XA 2QJDA 1OTSC 4XC3H 1FN4B 2YHGA 2IANA 5IW6B 4JVUA 43CAB 3DGGA 1KCVH 4UDUB 4HK3J 3UDWA 4HULB 4ZUTB 5BS0E 3HC3H 4J7RA 2MCG1 3QIWD 3QIBC 4OQTH 4Q58C 2V2WB 3ROLA 3GI9L 1M7DB 2YXMA 3LRSB 3DV6B 1FJ1A 3N85L 4PIRF 1EEQA 4BK5A 5J8OA 5KTEL 1BD2E 4YDKH 3TO4C 3M45A 4L1HA 3QEUA 1IM3B 4PV8A 3U9PH 4P2OD 1DN0A 5CINH 1DUZB 3UO1H 5DTFA 3KYKH 3U83A 3NIFE 4FQHA 3PDOB 1LP9A 3IVKA 4YDLB 3PHSA 1D5XA 2VAAB 3BIBX 4J1UA 3FFDB 3NN8A 2CKBL 2GSGB 4KGLA 2XYCA 3VE0A 2VXSL 3DI2B 3JSSA 4XNYL 4NM4H 4OCRH 2E6PA 3ARFD 1EZVX 5E8PB 3G6AA 4Z7NF 2JCCB 5D96C 5C1MB 4HK0B 3F7RA 1IGYB 1RVFL 4X6FB 1AGFB 5T1LD 3MUY1 4XTRC 5ACLA 1BPVA 3CXHJ 1I9IL 3THMH 4XBEL 1FLTX 3REWB 2R56H 5D7JD 2V5TA 5FO9B 3CH1B 4LL9A 5IFJB 4R0LB 4XPAH 3MCKA 4OZHA 1N5AB 1HEZA 5C9KA 1RUQL 4AM0B 1NMCB 3RNKA 1IC7H 1GJIA 5J0BA 2ZKHH 3WIFA 1UB6A 3ZTNH 1PG7H 3LIZL 3ZSTA 2VN7A 3MRPA 3NACL 4W81A 2MHAB 1CR9H 1EO7A 1ZT7B 4OM0L 5HGHA 3BP7A 4LEOA 5JHDA 5EC1A 4XC1L 5DA4A 3U46A 2YA1A 3O4LE 3PQYB 3LKQA 4HPOL 3BRFA 3HC4H 3P4MB 2X05A 1JPTL 2HKHH 1QHOA 1V5JA 3JWOC 2WQ8A 2IGFH 4LLDA 4M02A 5HYSG 2XG5A 3RDTA 3O6FA 4P5KB 4DN3L 5EBLB 3MLZH 3LQMA 2AXFA 3BPLC 2PTTA 4FZEL 3HUJB 1QBAA 3QCTH 1XR8A 2HAZA 2NY4D 5MI0B 5FUCE 1ZLVK 1KLGA 5I66B 1HZHH 2IAMB 2IG2L 4Q9BA 2P8PB 3RTQA 2ITDA 5F8RC 2M8XA 1EFXD 4HIJA 2I26N 1FSKB 2FHFA 3W82A 4POYA 1XIWC 3KPOA 4XP1L 4CKVX 4HJJL 2AI0L 3NOIA 2NW2A 1KYOK 3BKYL 4IIQB 4QY8B 4PJXB 3NABL 3DO7B 5D1QC 2QADC 5JPNA 2Z8RA 4JZJC 1FL3B 4FTVD 2ZG3A 3DTXB 2R4RL 5CLTA 3QHZL 1AY1L 3UZEA 1F6AB 3EZ8A 3D39D 3O3EA 3RX8A 2V2XA 4KMTL 4G8GA 2E7LA 3CU7A 4ZQKB 4EI5A 5CJOL 2YK1L 3DX6A 5KG9B 4XWGL 3I3BA 2ZZUT 3EOTH 4WV1C 4LBEB 5D2NC 1LO2L 5A2LH 1S7XA 4YX2L 3QISA 5GS0D 5GISL 3RUGE 3NCBB 2D7NA 2H8PA 3QBTB 5HHQB 3DYMA 2AEPL 1J5OH 4E41A 2IH1B 2AK4E 4NNYB 4F7CA 1IQWL 1T2QL 4FZ8L 1FZOB 4JGUA 2NXYC 4D9RE 3WLBA 1ZANH 5IEHA 1CFTA 1J1PH 3TZVC 3RWDB 1ZS8B 1KJ2H 1U8JA 4NC2B 3TFKC 4XH2A 1CXHA 1CE6B 5D2NE 1BOGA 4Y4HD 4XNXL 5C71A 4NKQB 1ZSDA 4KHTH 3MLWL 1YPZB 1VENA 5LCVH 4ZS7L 2QQQA 2VDOL 2VZVA 1CLOL 1LK2A 5E4EB 2BSSB 5SWZA 3W11D 3QQ4A 3HAEA 4WEBH 3CK0H 4WY7L 1P5VA 1SJXA 1CGSH 4M1DL 5DJ0B 4JY4A 2W07A 4ODHH 1S7QA 5ABDE 1RUPL 3DXAB 2CO6B 4ZTOL 4BH7B 1LE5A 2NX5A 3PNWA 4P99A 5T5NF 1S5HB 3VCLA 3ILPA 2DKUA 2ZCHH 4GMSH 1NL0H 2BNUA 1BFOA 5HPMA 2IAND 1U91A 1N6QH 5MHSD 1JHKL 2VSCA 5ALCL 2Q76A 4X7SH 4KRMB 2X44D 3OXRA 3K4ZA 1QSZA 2P1YA 4TOYL 4ZPTB 2VRAA 3SDYH 2FX7H 1DLHB 1OAQL 5IGXH 4PV9B 1XAUA 4P23C 3WLWD 1FORL 3HR5A 2HA1A 1UG9A 4KI5C 4NYLA 4EUPH 4Z7OF 5EOQH 4PY8I 4Q2ZB 4POUB 4I3SL 1HNFA 4OD2B 2QHRL 3NAAL 1HWGB 5C70A 1CFSB 4ZUWA 5JXAH 1ODAA 5T33L 3EFFA 2NW3B 3LSOA 3QUYC 1CQYA 4LVEA 3S3PA 5B4MD 5MENA 3B9VA 1U3JA 1SYVB 2V9QA 2GTWB 2X1WL 3QEGH 4ZXBC 1XZ0A 3NH7L 3TT1L 1J05B 1KIQB 5F71A 3SDXA 5E7FA 3SKMA 5K59E 3J7HA 4YEEA 1JGEA 4D9QE 1KN4H 4U1IB 2X9YA 1T03H 2ZOLA 4KI5E 4BKLB 1I85C 2ZSWB 3NIGF 4PJHF 1F2XK 2VAJA 4YHIA 5DJYA 3V95A 4LCWA 1REIA 2FB4L 5I17A 5T1MA 3C2SA 4J12A 3T2PA 1H8SA 1AP2B 3TIDB 4OLVH 5I19H 2F53B 1TJIH 5E5RB 2CLVB 4KPHL 1XGPB 3V8CA 4WHYG 4YXKH 3CVHH 3KVQA 1D5BA 5ESAB 5HHPB 4HWEH 4ONHA 2E9IA 4J8RA 1I7TA 1UC6A 2D9CA 3WDHA 4YFLI 1DTUA 2PYEB 3I02B 4NKMB 5J13B 3QG7L 5M7QA 2VZ1A 4RSVA 3VXTA 1D5MA 5TDNA 3C5SB 1R5WB 2HVJA 3BD3A 5DMKB 1I4FB 3PWUA 1FNLA 5JHDD 4OF8A 3FQTA 5HGBB 1XGRB 4TTGA 2PCPA 1B2WH 3O9WA 4YQXL 3W9DA 5D1ZA 3IU3B 4YGVB 5C92A 3MRGA 3WKML 3MPCA 1ZLVH 2IADA 3RDTD 3HA0A 3O6FD 4X6CE 4HCRH 3GJEB 1F4YL 4GUPB 4HS6A 1N7ML 2V9TA 1NJ9B 3BHBB 4P5TC 1MHEA 4WUUD 3O3UN 4NBXB 1HKLH 4I0PA 2R8SL 5TH2A 1A6ZB 4IRSC 3RWHB 1EEZA 3QDJD 1U8NA 3K2MC 4AT6B 5LBSL 1JGUL 4ZUVB 3F5WB 4JEGB 2ICWJ 1QPPA 4ZSOE 4PTTA 2F54A 4OLXH 1HIMH 2EE2A 2HMIC 5FHAH 1ZHLA 5KVGH 2MJWA 5GQBA 2G60L 1EO5A 1K4DB 3CPLB 3O8XD 3BXNB 2PF6A 4WFGD 4JO3H 3NCJH 1GGIL 1W72H 1IJ9A 1INEH 4G8GD 1XF2B 4EI5D 1LP9F 1E4WH 5GGSY 2LTQB 2VDQH 1JZ8A 5E2WL 1TZHB 2CO7B 1RZ7L 1NAKH 5JDSB 4O00A 4ETQB 1FYHB 2VITA 5IK3B 4KK6C 2AEQL 1WBZB 3ULUD 4E41D 5K93A 4MCZB 5D70H 4FABH 5FGCE 5ADOH 2VLME 1Q94B 4I9WD 5F1IB 3RZCA 3MXWL 5JIKA 2M1KA 4LPYA 4Z7WA 2X70A 1P84K 4OZHF 3TN0C 1KF9B 4K9EH 3FFCE 4X6DB 4OZGB 1S7RA 2X4PB 4OT1L 6FABH 1MAKA 4WHTA 4LSQH 2UVFA 4P57A 1YEHL 1XH3B 1P4BL 2H32A 4X5LA 1HHHB 4HV8A 4XZUB 3DMMB 3VXUB 5SWZD 2VDKH 1ORQA 1G7JB 1KB5L 4D0CB 4N5UA 4XPGL 4JJ5B 3CFEB 1AIFA 1JGDB 4R2GB 4BUGA 3Q6GL 1D6EA 3U7WH 2A2QT 3D9AH 4I48A 2EDQA 1JHLH 4G3YL 2NX5D 5JA9A 4RGOL 1F13A 4KWUA 4HXAL 3OAZK 1LEGB 3MRCA 3C60C 3LPWA 3N0PB 3RHWF 2FCBA 3QRGH 4JHWL 4MD4A 1A14H 2FLBT 4IRJA 4P4KB 5HGDB 1JRHH 3ARDB 3HG1B 4D2NA 5I16A 4B7IA 1CIDA 3T0EA 2GUOA 5TDOB 5HYJE 3NCMA 3ARQA 4NP4L 3SE4C 1MI5B 5EFIA 4A2MA 3MO1A 1ZLSH 5B39B 1YEEL 2IALA 4UNVA 2DBLH 3BJ91 4APQA 4BM7A 4P3DA 4NM8H 5ANME 3CSPA 1IAIH 5MEND 3CU1A 4RZCA 1HOCA 4HKJA 1OAUH 5TE4H 5FF6A 3U7YL 2W0FB 3EJYC 4DGVL 4KH2A 5SWQB 5GRVK 4QXUL 5GS1C 2V9RA 4M7JH 5DJCB 5FYJL 5AZEL 3QXDA 2LU7A 4HJ0D 1JK8A 3WFHA 3HI5L 4PLNC 2WIMA 1NUNB 4PY7B 1AGEA 4KZDH 3G6DL 1KJVB 4HUNB 4U1JB 3IF1B 4LCWD 4U1KB 1C7SA 4ODSH 1G1CA 3CUPA 3HCVA 5C3LD 3O2DL 3MNVB 3S37L 1I1AB 4LSDA 3TESA 5DD5H 1X5ZA 1JN6A 1TZIA 3ULUF 2CR6A 1YC7A 2WWMC 1T66C 1D5IH 5DJ6A 4OQ1A 1WICA 5FGBC 5HDBE 1YYLH 4G6JH 5C09B 1CGWA 4H1LH 1BLNA 4JFEB 4HF5L 4OI8A 1GGCH 4HSQA 1S8DB 5DFVC 3WBDA 2ESVE 4Q0XH 4Q7DA 5GSRA 4C56A 1Q1JH 1NAMA 3LY6A 3QI9B 4EBQH 4PJIE 1JWUB 4JO2H 2F8OA 1ZGLP 4GKSB 4DZBB 1DZBA 1LO5A 4QHKJ 3V5HA 5BJTA 1I3RA 2EXYD 1WEJL 4J6RL 1KPVA 1JV5B 4NPYA 4Y5VA 1FP5A 3QUMB 3KXFD 4G42B 2CUMA 3C8KB 4DEPC 2VISB 4FXLA 1QACA 5H2BA 2O5XL 4NRZA 4A6YA 2OJZH 1FFOA 3O9WD 3TYGL 3BKCL 2HJFB 5D1ZD 3BH8A 3VXMB 4U3HA 1I3UA 5ENWB 4LLVB 3OKDA 1D5ZB 2XWBA 4I0PD 1T7ZA 4YXLH 1P9MC 1A7OL 1RZKL 3IJYB 1UM6H 2FD6H 2RBLA 2VXQH 4POZC 1TJGL 1CU4H 3QHTC 5E2VH 5C2UB 1NGPL 1HHGB 2ZP0T 1XCTA 4GRMA 4UT9H 1DUYA 2F54D 3G9AB 1VEMA 4LKCB 3UMTA 3BN3B 5JOFB 2GW5A 2P5WB 1BBJA 1BJ1H 2MTPA 4JR9L 5EU3A 5KSVA 1UH2A 3B9KC 5DJZB 3DETC 5JQHC 1BMGA 3X3GL 5HYQA 1HINH 2R9HD 5I75B 1KCRL 5LGJB 3GHBL 5JIHA 1T1WB 5DR5L 1CZ8H 1JJUA 3VWJB 3PHQA 2ADIB 2AV7A 4FS0A 3SDXF 1WZ1H 2E9WA 1KV3A 2HTKD 3QAZC 3HKFA 2HN7B 5DJ2A 2N4IA 3SDAC 3CSYA 4FQCH 4TSBL 5I76B 3QNXB 1FIEA 1A6WL 3DURB 1UH3A 4PRHD 5CP3H 2HYMA 4BYHA 4NQEA 3HE6A 3W0WB 1CDHA 1JCKA 1A0QL 5IOPB 3MMEB 3GSNL 4LSPL 4K7FA 1PDKA 4AH2A 3O81A 2VLKE 4R96B 3TJEL 2FO4B 3CCHA 4LCCA 1RUKL 2EEAA 3OQ3B 2CDGA 1ZXQA 4RX4A 5DMJB 5FYKH 3PHOA 3C5ZD 2J8UF 2C5DC 1T1XB 2IH3B 2J4WL 4NKDA 1V7NL 1HXMA 2X9WA 2DQJH 1ZT1B 3L6FA 4Q9CA 4RCAA 3KS0J 2FRGP 1BHGA 1UKTA 3WEXB 4R7DA 4AIZA 2PNDA 3SCMC 4F58H 2BJML 1OLZA 3WFEL 1E6JL 4JDZB 1QUNA 4RWYL 4K8RD 4HC1A 3PGCB 3FCTB 1OP5K 3OR6A 5EUOB 1RAMA 1I3GH 2FZ3A 3WN5A 1LDSA 4XHJD 2B20A 3FZUC 5SX5K 3X3FL 5J12C 4QXGL 1OARL 1INDL 1UZ6F 4XPBL 5C2BL 1CIUA 5KSBA 3MJ6A 5GRZA 3LN5A 2DWDA 1MLBB 4IRJD 2D0HA 4PGJA 1FFPB 3QRFM 5TQ0L 3SQOH 2A73A 4GAJH 5BV7H 4G9DA 3T0ED 4JJHA 2X4UA 3OJVC 5L8KB 4YNYA 1P1ZA 4JM4L 2IPUG 3WJLA 2D3VA 4DUXA 2UWEE 2X40A 4MD5B 2R0ZH 2JK5A 4R8WL 5JW3H 1CK0H 4APQD 3PDDA 1ZT4A 1MNUL 1ETZA 3AMLA 4YFEA 1TQBB 2XA8L 3QG6A 5TPWH 2DQUH 3ZT6A 3R0MA 1AGBA 2P45B 2P8MB 5DK3A 2NY5L 5E8NB 4RGNC 3I6LE 4LHJB 2R29L 4XMLL 1CYGA 3GMNA 3VFTB 4H26A 4JRXB 5DRXB 3QUKB 4RAVB 3DVNA 1IC5L 3NCCB 2FLRT 4EEEA 3TBVA 4WI4A 4X98A 1Q8MA 1FL5A 4MNGA 1YUHB 3ZYJA 3AC0A 1QRNA 3WCYA 4NQSA 3WS6A 1RZJL 3V8OA 1IGTB 2HJLA 5E8EB 3S36L 2DLFL 3ARUA 3W2DL 4HIIB 1HHIA 3WO3B 3SDDC 1KEGH 1NKRA 1A6PA 4RGNE 3V6FB 1FZKA 1YEFL 5D7LA 2F5BH 3MJ7A 4ORGA 1UM5L 1RMFH 1A3LL 5C0CA 2V17H 3A0OA 3KR3L 3TV3H 4C56D 4Z7WF 2KDGA 3SKUD 3B2UC 1Z0MA 1D9KC 1N6VA 5JW5A 3BWAB 3BSZL 2ZUUA 5T1DH 3QA3A 4G6MH 2DJSA 3QH3B 5HI5D 1JNJA 3P73B 3FQUB 1BQHG 1KACB 2M2DA 4PJ7E 2A77H 1DFBL 2OR8A 4PRAA 4N0UE 3G08B 4XAWL 3RL2B 2AEIT 2XPGA 3MV8A 4ZAKB 2Q6WA 5GGUB 2WLYA 3ARZA 4XXDB 4TVPD 5EOCJ 4PG2A 2NY1B 5FIEA 5JXEC 1F11B 3CX5J 5H35B 2F19L 1M7XA 3AU1A 1TNMA 4ONGL 3BZEA 3T77A 1JWSB 4OD1L 3N85H 4XI5D 3CZJA 5GGTL 3GGWB 5KTEH 2NZ9D 2BSRB 5D71H 4JG1L 5CZXC 3RY4A 4KUZL 2DM3A 5DMYA 4I5BB 5M94B 1DVFA 3B8YA 1Q9OB 1N3NB 4K9EC 1BBDH 4R4BB 2RGSA 4OZ4B 4E9LA 1XGQA 1NEZA 2A74A 2E6QA 3L3JB 3G6JF 2VXSH 5CEZD 3UTTE 1H5BC 4XNYH 4Y5XB 4Y16A 1A1OB 4WVRA 2W59A 4OF7A 4Z7QF 1UVQA 2EYTA 4OM1H 3LKOA 3MUGA 4S1DD 2PW1B 4Y7MA 5M95B 1RVFH 4PJ5E 3ARBB 4LLYA 1JTTA 1Z9OA 3VRJA 3W5NA 1I9IH 4XBEH 1G7PA 4FQ1L 2YZ8A 1K8DB 1NDGB 5DD0L 3MACL 3V2AR 2ITCB 3VRLF 4NQED 3HE6D 3UBXA 4U1MB 5CBAA 5E6IB 3VGEA 5JPMA 2FGZA 1X3DA 1RUAH 3NACH 5K33A 4YO0B 1WBXA 3DIFA 2H9GA 4Y19A 1XR9B 3GI8L 5IB4A 2UV3A 1ONQA 2HLAA 2YN3A 4RX4D 3BGFC 4R3SB 5ELIA 3DHJA 1JI2A 1FNFA 1WLHA 4HPOH 4WW2C 3JV0A 1JPTH 5D9SB 3L5WB 1H3XA 3IDMB 3ARGB 3PG2A 3LRGA 5GGSA 1OP5H 3EGSB 1QZ1A 1LEIA 5D7IB 3X13A 5SX5H 1T0NB 5GS3A 3CFKB 4FZEH 2HT3C 5T3ZD 3RX7A 3X11A 4R97B 2GFBA 1A22B 3KPQB 4PJFB 4AIXA 4PLKD 1MJUL 4GKZA 1MJJB 1ED3B 4IJ3C 5DS8B 2IG2H 3CNKA 4PJCE 1UWEL 5EBMB 4GXVL 5HHNA 1B0RA 3EO0B 4OFDA 2FR4B 5C0BA 2HRPL 1F02I 2YUZA 1FNSL 5F7WC 5FM5O 1ZA6B 4J3VA 4HJJH 4IMKA 5CJQL 1KPRA 4F80A 2Z4QB 1LD9A 1KJMB 3T04D 2E7MA 4DOHE 4EXKA 3BDXA 1IAKA 1YN6A 3NABH 1MQKL 4C83A 3QJFA 4OGYL 1P7KA 2BY3A 2DICA 2UZIH 4NN7B 3ELAT 2W0KA 2R4RH 4DGYH 1X5KA 4ZFGL 1UQSB 1VFBB 2W9LA 4Z95H 3WFBL 2J5LC 4KMTH 5L2JA 3TBWB 5CEXB 1DBML 1DBAL 4UINH 1VFAA 5CJOH 2YK1H 2WBJC 4JKLA 4LKXA 4PRIB 4XWGH 3S37X 3UTSE 1MH5B 4O2EA 5HHOE 2VTFA 2G9HA 3QXAA 4I2XB 4D9LL 4YX2H 1UWXH 4ZFZB 4O9HL 5FYLE 5GISH 2OK0L 5JQ6L 4PJ8C 3CZFA 1J12A 5TQ2L 2AEPH 4JANA 4F9PC 5BVJA 3IDNB 1M7IB 3EIFA 1IC4L 1MCPL 2PXYB 1IQWH 4B53A 3VFPB 3GDBA 3M07A 5DQJA 2WAHA 1XF5B 3VXSE 1A7NL 2GITB 4P49A 3G5YB 1LE9A 3PABA 1QRND 4A6YL 4L5FL 4JRYB 4DW2H 4UT7L 4ZUSB 1UXSA 2WWKT 1VGKA 4FQPA 4X7TA 3KJ4C 2I24N 3ILQC 1G9MC 5K9QG 2JIXA 2VKXA 5JUEL 4YHYB 1G84A 5D7LD 5C8JA 4ZS7H 2H2PD 1HXYA 1ZWIA 2FL5A 2V6HA 4HLZG 5C0CD 1T04A 1CLOH 3P0YL 4HWBA 1GGBL 1FO0A 3DGCR 3AREA 3TJHC 3U0PB 3S4SG 3OKMA 3FO9B 4NNXB 3RX5A 1EMTL 3QNZB 4GRLC 1A6VL 1GGTA 2PW2A 4WY7H 3I3EA 5CWSB 4J3XA 4M1DH 1G7QB 3VXRE 3MRFA 2LAAA 4CBPA 1RUPH 2YOCA 2V7HA 2KZ1B 4ZTOH 5F3HB 1EK3A 1U58A 3MTRA 5IWLA 3IXTB 2LVCA 3H0TA 5F6IC 1Q9KA 4QHNA 1JHKH 5ALCH 3L7FA 1L6ZA 2IBGA 1VESA 2VXUL 4TOYH 3DLQR 3NPSB 3EYVB 4I18A 4PJGA 3V6ZA 3MUHL 4UMGA 1OAQH 4OD3L 4OCSL 3DNKA 4MCYB 1KTDB 3GJFB 5HI3D 5C0AE 3RWCA 1MWAA 4Y4KC 1FORH 1MVUB 1WFTA 5KSBF 5J56B 1DR9A 4I3SH 4YE4L 3NAAH 5J6GA 1R3KA 25C8L 4KGJA 4U1LA 3BP5B 5EULV 2EZ0C 4G6AC 5ICYB 3QIWB 3UTZA 2DQGL 4QHMA 2J6EA 3MGOA 4QRQB 5EN2A 4QNPF 3TT1H 2BVEA 1AHWC 4LHUG 3QUXA 3U0WH 1BD2A 1JE6A 5EO1B 5AG8A 1OW0C 3T3ME 4Y16D 4GAYB 5I8OH 4P2OB 1K5NB 3NIDF 4RFEB 4N0CD 1BVKB 3MRQA 5J6HB 4MMXC 4LU5L 4JO1L 2FB4H 4WUKH 5I6XB 2CGRL 3FB7A 1DQJB 2YRLA 2P8LA 4UI2A 5CEYA 1AC0A 3VW3L 4KPHH 4HIHB 3LEXA 4WU7B 1AXSB 4TTDC 2AJ3A 4S1QL 1OF2A 3LAFA 4HHAB 3ARFB 3B83A 4QLRA 3VJ6A 5F3BA 1D3CA 4UAOC 2V7NA 2DJUA 1KLUB 3JV6A 4HGWB 1Z5LB 3TO4A 2G5RA 4DQOH 3VFOA 5T1LB 4JLRA 1IGCL 5HYSA 5LXGL 3WIHA 4PLOB 5E08H 4PLJC 5LG1A 3RHWK 2EDDA 3DV4B 1C12B 3RPIA 3QZWB 2IC2A 3O3AA 3ZDZE 2FEDC 4JDVA 3QPQD 4G6FD 4D0BA 3EYFB 2COQA 3VXPB 2LVEA 2C3WA 3O3BA 3WE6B 3EOBA 1EO8H 4DKDC 1QLEL 4YQXH 3E6HB 1KJ3L 1FDLL 1Z6JT 1R24A 4GLRI 4KTYA 1PKQB 4XCCL 5DRWA 1UXWB 2HT2C 5IB2A 2PO6D 3QXUA 1HILB 1JUFA 1VPOL 1MRDH 4N9OB 4L8CA 2BY0A 3C9NA 4MA3B 1F4YH 1N7MH 3IAGC 4UDTA 3PL6C 2XNAA 3O4LA 2QR0A 3QNYA 4CVXB 1LILA 2R8SH 3DECA 4EXPX 5LBSH 1DE4A 3OWEA 1JGUH 5E2TL 2IPKA 3Q3GB 5C0BD 5C0EB 4LLWA 1AE6L 5I0ZA 2BVPA 1LHZA 2X41A 1W8OA 5DRNB 5C3TA 2W92A 2NY4B 3O11A 4OLUH 4KFZC 1FG9C 4LPWA 4KKBC 2R1YA 3MRBA 2G60H 2EDKA 3H9HA 3OZ9L 3LKSA 1VKXA 5AAWA 5DQDL 5T3XH 1A1MA 1XF4A 1EFXB 5EBGA 1OAZL 4LEXL 1GGIH 4UV4L 3S7GA 3BUYB 4EIGB 5DDHA 3QDGE 4JZOB 2JB6B 1S9WA 3HNVL 4KROC 3GSWA 3OKNB 3F62A 4XBPB 4PUBL 3L95A 5C0ND 1RZ7H 3S36X 1W2KT 3QQ3B 3BGMB 4FTVB 1XGYL 4U6VL 4N8PA 4NO3B 2AEQH 1F58L 3ET9F 3QEHB 3WMSA 3D39B 1FGNH 1MCIA 4IMLA 2W9DL 1AKJA 1MELA 4PJHB 4GBXD 1I8MA 4ISVA 4CNIB 2OTWB 5EU6E 1XIWA 1O5DT 1JGVL 2QEJA 3M1BA 1S78C 4GW4A 3RUGA 4YXHL 2Y07L 5AUMB 1BF8A 1ZV5A 3ZE2F 5D1QA 3UJTL 2JIXD 4JZJA 2AK4A 4OT1H 4O58H 3KNBA 3RWGB 1BVLA 1YN7B 3CXDH 4HDIA 4NQTA 1YEHH 3UJIL 1P4BH 3BYTA 4ZOCA 2NYYD 4LLAA 2BY2A 2VL4A 1ZGLB 2NY2D 3BWUC 4LLMB 4XPGH 2X4TA 4Y4HB 4HS3A 4R9HA 3Q6GH 4QT5A 1T5XA 4NQDA 1MCBA 3C6SA 4G3YH 2J8OA 5I1CH 2D9QB 3FB8A 3JTTA 2L4OA 1KN2L 3IYLW 1C5CL 1CICC 2AXGB 2HFEA 5K9KB 4HKZA 1RHHB 4NZUH 1OP9A 2GK0A 1QLRB 1SEBB 1S7TA 1KBGL 3MJ9L 5GS2H 4FFVC 4NP4H 2I9TA 2R1XB 2AXHA 1KTKE 5EIIA 3QWRD 5GZOC 5FYJU 1SEQH 1MFAL 4HT1L 5F7DA 2IANB 4ODWA 4DZ8A 1YEEH 3DGGB 1C16A 3MV11 1R3IL 4C4KT 3RVTD 1EHXA 5JZ7C 3SKNA 1NGXA 2Q86B 2G5BA 3ROLB 4PRDA 2OTPA 3U7YH 4DGVH 1FJ1B 2MNUA 3BEVA 4OFYA 3BZFA 5C07A 4QXUH 1HNGA 1AJ7L 1BD2D 5AZEH 1EGJL 2BXYA 1WFOA 3QEUB 12E8L 1FPTL 1KT2A 4PV8B 3HI5H 1HH6A 1DN0B 3TLRA 5E9DA 3K81A 1VERA 1OP3K 3G6DH 4QRPA 5DTFB 3P11L 4U6TA 1SYSA 4FQHB 5BOZG 1LP9B 3S37H 3U7AA 3IVKB 1D5XB 5GGRY 4J1UB 2ADJA 3VE0B 2R15A 4NKOB 2RCSL 2IBZX 2FX9H 3FTGA 1AGDA 2ADFL 2DWEA 4P23A 2XKSA 3G6AB 1NCNA 2DLTA 1DQDL 3RGVC 3LZFH 3DX9A 5I73C 1WBYA 5F7UA 2C4XA 4HF5H 4U7MA 2HFGL 1N5YL 4K94C 3OAYK 2K7QA 5I1DA 3EO9L 3U0TA 4CMHB 3HNSL 2QSTA 5DWUL 3TT3H 1H3UA 4ZXBA 4XMPL 4GRWF 4OZHB 5DYOA 4QRTA 3HC0A 2CLZB 4QWWD 3TYGH 1I9RL 3R4DA 3WIFB 1S7WA 2R0WL 1UB6B 1DBBL 3TP4A 3N1MC 1S7UA 3RI5F 2YD5A 4KVCH 1JP5A 2A83A 3MRPB 3OKKA 2YPVL 5HGHB 3SE9L 3BP7B 1BFVL 4LEOB 5JHDB 5EC1B 4QXTB 3U46B 3K1DA 3TVMD 1HK6A 3O4LD 3LKQB 3UXFA 1Q0XL 1RZFL 5FDWA 35C8L 1TJGH 2AJZA 2R69H 5DJXA 5INDA 3QSKB 1UACL 3BZ4A 4LLDB 4UBDD 1NGPH 4KQ3L 3RDTB 3O6FB 4F8QA 4X6CA 4XVJL 1A6UH 2PTTB 4PJGF 1LK3L 4OIAA 1XR8B 4WUUB 3S9DB 5JLZA 1WJ3A 4PRNA 5L9DL 3HE7C 4JR9H 5ICXA 2O93L 2FSEA 4YGAB 3B2VL 1QSEE 1GYAA 5FA3A 1NBVL 3MNZA 3X3GH 1E28A 1EERB 1SBSL 4PP2A 3QDJB 4WO4C 4XXCC 3ZKXB 1KPUA 4Y1AE 1AR2A 4HIJB 1KCRH 1BAFL 4WHDA 4ZSOA 5DR5H 4HGMA 1YY9C 2QQKL 3KPOB 4GO6B 4KZEL 2HRLA 2NW2B 4UQ3B 3FT3A 3FHAA 1O7SA 4PJEE 4XCYA 4G7VL 5JPNB 4JHAL 4WGVB 4HWBL 4MXWL 4P5TA 4KJWD 4X4ME 3O8XB 1HE7A 3VD9A 4L3AA 4TSBH 2VXTL 3HAEH 2YKLL 4C57C 4KKAD 3WO4B 4KAQH 4IRSA 3O3EB 2R23A 3TCLA 3QULA 3NIFF 4G8GB 1QTYT 4EI5B 1A0QH 3DX6B 3L5XH 3RY6C 2VN4A 4UV7L 2EDRA 4LSPH 4KHXL 4BZYA 1S7XB 4YDLC 2BSTA 3FQXA 3TJEH 2H8PB 4LPXA 3CFBA 4G9FE 4E41B 5D1QD 2J4WH 1V7NH 3SY0B 2AK4D 4F7CB 4X5XA 2VUYA 4JFOB 3KPRA 3DRQA 1H8OA 4MA8L 1L6XA 2EDTA 4D9RD 2XACC 5AEAA 3WLBB 2WIIA 1UM4L 4JPKL 1X9QA 1MEXH 2GEEA 2B7DT 3BPOB 5EU7C 1NCWL 3IRZA 2XXCB 1E6JH 2ATKA 3JVGA 5ITBL 4U33A 1U8JB 3BN9C 5T1KA 4XH2B 2EKJA 4MQSB 3FFCA 1BOGB 1JF1A 1ZSDB 3GZKA 4NQDD 5KANG 5DT1L 3FB5A 1MFBL 1I1YA 3X3FH 3QXTA 4K71B 1RFDL 4QXGH 4WFFE 1ROWA 4XPBH 1LK2B 4U6YA 1AQKL 5SWZB 2JCCE 3QQ4B 3HAEB 3O2WL 3MJ8A 4QTHA 4BFGA 3RKDD 4HEPG 3WJJC 5TQ0H 3UJJL 4OQTA 3ZDYE 1P7HL 4JY4B 5EU7E 3S88L 5ITFA 1S7QB 4NN6B 32C2A 1EJ6A 1JTOA 1NLBL 2B1AL 4MA7L 3GUTA 2AEWA 1LE5B 2NX5B 4JM4H 3PNWB 3TFKD 3RIFF 3VCLB 3ILPB 1YMMA 4DN4L 4ZPVB 4MNQE 3GSOA 5A16A 5A43C 4YBLB 1BFOB 5HPMB 1ZVHA 1U91B 4GKOA 4R8WH 3H8NA 1MNUH 4CUCA 5CD5C 3OXRB 2XA8H 4HUWA 4P2RD 3ARWA 4NFDA 4F7PA 1GOGA 2WZPD 4ELKA 2NY5H 1BQLL 4TUJA 5MI0C 3HR5B 4WW1A 4F7TA 3QO1A 4NYLB 5C07D 1OP3H 4OFYD 3DX8B 5KVDH 2ICWI 4XMLH 3UBXI 2IAMC 1GRWA 2VLRA 4FQLL 3PQYE 4JFHD 5ANMA 4ZUWB 5E9DD 4P9HC 3EFFB 2EH8L 3MV9E 3LSOB 4FNLL 4QRPD 2APWA 5IIEA 5MENB 2DMBA 1YEDA 1G6RL 5DSCA 4LPTA 2XKNA 1XZ0B 3L5HA 1RZJH 2C4FT 3KPMA 3SDXB 2YXFA 4OAWA 2DLFH 3S36H 1OPGL 2MFNA 3BE1L 1FG2A 1JGEB 3W2DH 4WGWB 4YK4B 3SE4A 5KVEL 1NH6A 4P23D 4U49A 3OAYH 1YEFH 4LF3A 4YHIB 4LPVA 4ZO6A 1UM5H 2IBBA 1A3LH 5DJYB 4LCWB 3TM6A 1CDCA 5I17B 5T1MB 2P42B 1G9NH 3AS1A 3KR3H 1JHTA 3FL7A 3RUGF 1DP0A 4F37F 3IFPA 1U8PA 3BSZH 1NFIA 1L0YA 3MLVH 5EUKA 4XVUD 2OP4L 4NUJA 4ONHB 4J8RB 1I7TB 2NY0D 2JJTC 4I1NB 1CFVH 1DFBH 4HIEB 2ESVA 4XAWH 2A0LC 2EC8A 3VXTB 4NJ9L 4M7LL 3L7EA 1CLYL 5TDNB 4BUHA 2HVJB 1L9MA 1F42A 1UADC 3PWUB 1GAFL 3KXFB 3PXHA 2F19H 3FQTB 1T6VN 4XP5L 4ZYKA 4XVTL 4ONGH 4NN5B 2FWOB 2PCPB 2ORBL 3JWOL 4LCIL 3O9WB 4JCMA 5GGTH 2FHCA 3W9DB 2EDXA 2AJYL 5D1ZB 1T83C 4I77L 3MZGB 5E24E 4JG1H 5EORH 2IADB 3QQ9D 4N8CL 1XMWA 5E4EC 3BMWA 2EC9T 1UJTA 3STLA 3QIUD 3HI1B 4LVOB 3F7VA 4HH8A 4HS6B 1MHEB 1QR4A 2X7LB 4I0PB 7FABL 2CK0H 3QWOB 4JPWL 5TH2B 4HAFA 1EEZB 4DJMA 1U8NB 5F9WB 5FGRA 3KYAA 3UPAA 3MSPA 1F3RB 1T4KA 1YPZE 3PDGA 3N1FC 4PTTB 2F54B 3MLTB 1KSRA 3WNOA 1EAPA 5CGTA 1IL1A 4JHBA 1PVHA 1OAYL 2DM7A 2H32H 4P5TD 1HQ4A 3N1GC 5DD0H 3MACH 4X6EA 4EVNA 5JTWA 1P9MA 3DXAE 4IRSD 4CJ0A 1LQSR 3WHE1 2MPAH 5DUBA 3L9RA 4RDQG 3IDXL 5K59F 4L9DA 4ENEC 2VZOA 4JB9H 3FB6A 1KJ2A 1WZLA 4MJ5A 2AP2A 4M3JA 2Q3AA 5E6YA 2HMID 3GI8H 4WI6A 4LCUA 1KCKA 3REVB 4KI5F 1TCRA 3B9KA 4PRHB 5EG6C 2W0PA 3AXLA 1SBBA 4GLRH 4J4PA 3RVUD 1ITCA 3KPRD 4UUJA 3B6SA 1IQDA 2YSSA 1OT2A 1MIEL 1WGOA 1QFUL 3D3VD 4BFIA 6CGTA 2VLKA 1QYGL 3I75A 4Z7WB 5ESVA 2X70B 3OJDA 1S7RB 4FFYL 5ISZA 3MODL 1MJUH 2YC1A 4HZLA 1IC1A 1X5GA 4WHTB 3T3PE 3R8BB 4GXVH 1RUML 4HV8B 2I9LA 2DDQL 4OGXH 4QHKI 2HRPH 5FAAA 3IKKA 1U95A 1FNSH 5J13C 4M93C 5IVZA 2ENYA 1CL7L 4KKCC 1AIFB 5IG7A 1D6EB 4I48B 1MJ8L 2F53E 5CUSL 4BSVA 4EUPA 1YMMD 4U3CA 5FYJE 5IM7B 3P77A 1AO7A 2W0LA 1RZ8A 4MD4B 4X6CF 4ZFGH 5KAQG 1JZ6A 1QO3A 4IRJB 2ZUTA 3IDGA 3WFBH 1DBMH 5I16B 4LGPB 1I7UB 2MQ0A 3SCMA 3T0EB 2GUOB 3H9SE 1DQML 1FRGL 4J2XA 3MO1B 4O9HH 4L4TE 2UWEA 3F58H 5DEFA 2OK0H 5JQ6H 1EVUA 4I4WA 4NFBA 1IM9A 1Y0LA 5IW3A 5TQ2H 2B5IC 5EZOL 2IALB 5GRJL 2VLRD 4APQB 4P3DB 3VG0L 1MCPH 3E1F1 4OZIA 1WAAE 1W0YT 4RZCB 4KDTA 1A7NH 5IFHL 1HOCB 4HKJB 3DUUA 2VR9A 1Y6KR 5FF6B 4A6YH 2V5RA 3RFZC 4D8PA 1CFBA 1RZKC 3BPNC 2Y5EA 5DEGA 1EVTC 3QXDB 2BSED 4H8WC 4P48A 3TPUA 1YEIL 5D1XA 3WFHB 5JUEH 1AGEB 2OL3B 2W91A 4WFHE 2GT9A 3OHXA 4XNZB 1GSMA 3P0YH 3CLEH 1GGBH 3CUPB 1VCAA 5DJDB 1QFOA 1EMTH 2LTQC 3SGJA 1A6VH 4E5XA 4UIKL 4W4OC 1JN6B 3GIZL 1VSCA 1F4AA 1YA5A 1CLZL 3KG5A 5DJ6B 4PP1D 5KN5A 1PLGL 2VO5A 4W70A 1BLNB 1T89A 4HGKC 4C55A 4MXQC 3FOMB 2ESVD 4C56B 4YDJA 3SEPA 1NAMB 4XPFL 1G7HA 2BVTA 5IVNA 1LO5B 3V5HB 5BJTB 1I3RB 2VXUH 3RNQA 1I8KA 4MS8D 2A9ML 1KPVB 4NPYB 4Y5VB 4BH8B 3WNMA 3EO1B 3MROB 5KSAD 2ZWLT 5H2BB 4XAKE 4NRZB 3AFLA 4AEHL 1FFOB 4OLWH 4PJ7A 3SDDA 1B4RA 1ZE3C 4X4XA 5TDPA 3BH8B 5IV2A 5F1NA 3DMMC 4YE4H 4K23L 1P2CA 4HS8L 5CP7A 3EHBC 2DQGH 3MCLL 4BQ9A 1A4KA 2XWBB 3BPCA 4R2GC 1BEYL 1MUJA 1X5AA 3NCEB 2EDJA 4OZGE 2VDLL 1XGUA 5EBWA 4KK8C 1W72A 3EJZC 5K9OA 3VFUB 1DUYB 2ZPKL 3AM8C 4JO1H 4P4KC 4NCC1 4OFPA 2WP3T 4M6NL 2CGRH 5F70A 1BBJB 2CQVA 1YNTA 1TPXB 5EU3B 5KSVB 4OIBA 2AERT 3VW3H 2EXWD 5JXEA 3ROOB 5HYQB 1X4XA 2C9AA 3UTTA 4S1QH 2GJZA 4X80L 3WHXB 4G7YL 4ODTL 4PR5A 2NR6C 4HC1H 4WJ5A 1NCBL 2PYFA 1IGCH 2R0LH 4PJ5A 5AWNL 3FO2B 5LXGH 5HBBA 1KCSL 2UYLA 3PHQB 1SY6L 3QEQE 1AD9A 2AV7B 3WFDH 5F7LB 4MAYA 3IXAA 5DJ2B 3HG1E 3MOBL 3CSYB 3P2TA 3PV6A 5B22A 4NQEB 3HE6B 4HWNA 3D1MC 4J4PD 1S5IL 1H5BA 1QLEH 1KJ3H 3CDGA 2VDML 3PV7A 3IDJA 4BQ6A 1JGLL 4R90L 4XCCH 3LB6D 5CSBA 3MZTA 1AFVL 4AH2B 1X5FA 1VPOH 3MLUL 4X7CC 2VLKD 1I1AC 3CCHB 1NC2A 4S10A 3AB0B 2CDGB 5FKAA 3PHOB 5HDBF 3QFDB 5IMMB 4NKDB 1H3PL 5ISZD 1HXMB 4IOFC 4UILL 1EH9A 5IW1A 1TETL 2DQFA 1IT9L 2A6JA 2HT4C 1CD9B 3OKEA 4M4RA 4R7DB 5E2TH 4AIZB 4PJIF 5FECA 4L29A 1I7ZA 1AE6H 4M1CD 3QI9C 5F89A 3SPVA 3BGAA 3SKOA 3GFUA 1ND0A 3BQUD 3OR6B 5I74B 5FCSH 5CJXA 2FZ3B 4LSRL 3WN5B 1CL7I 3WS3A 4PJCA 3OZ9H 2EDLA 3IFNL 3LKRA 5DQDH 1AO7D 3OXSA 4YDVA 5KSBB 4WW2A 5B39G 1OAZH 4LEXH 4UV4H 1IGIH 5C0GA 3LN5B 2DWDB 1G7IA 5B38A 4HUMB 1SJEA 4IHOA 5DGQA 2A73B 3AGVA 3HNVH 4W6WB 1VACA 3PWVA 4PUBH 4ZNEA 4YNYB 4PYHA 1P1ZB 4OZFB 4H0HB 3NTCL 2X4OB 2HTLC 5DD1H 3CDFA 1XGYH 4U6VH 2OCFD 4I8DA 1F58H 2JK5B 3VG9C 3TBSA 1ZT4B 3OSKA 3LH2L 3R8QA 2VQ1A 3OKLA 3QG6B 1MAML 1W0WB 3D5OF 1C5BL 3SJVE 1AGBB 1TTGA 4YUEL 5HHOA 3RI5K 1KIUA 3X12A 4BSWA 2OXHA 4JKKA 5L7XL 4WFEE 3I6LD 1UWGL 1JZ7A 3FT2A 3D0VA 3GMNB 2LFGA 3KWWA 4H26B 4NZJA 5E2JA 1VFUA 3UJTH 1EIBA 5D1XD 4KY1L 5I75C 3DVNB 1E4XI 5FK9A 4H1LA 1UZ8A 3TBVB 3FHQA 3UJIH 3VGDA 4X98B 1FL5B 3VWJC 1QRNB 4NQSB 3V5KA 5BQ7A 2AVGA 3VXNA 2HJLB 3BP6A 3IETA 2WBJA 3U36A 2DYPA 1HHIB 5EU4A 2YR3A 3SKJL 1FZKB 2RFXA 5D7LB 2AJVL 1CG9A 3MJ7B 4GG6B 4ORGB 4PJBE 4F9PA 1QA9A 4M6OL 2E7BA 1U9KA 5C0CB 5LAXA 2CRIA 3MLYL 4M5ZL 3NMEA 2Z9TA 1KN2H 3T08A 4RA3A 1C5CH 5A1AA 1VEOA 4JG0L 1I1FA 2DTML 4WU5B 4ESKA 3MFFA 5KOMC 5JW5B 2VZSA 1M4KA 3VXRA 3T2OA 1AC6A 1KBGH 2GHWB 2YBRA 3MJ9H 4RFNB 3WIIH 4LHUA 4XGZA 4XPHH 2D7QA 2DM4A 3BAEL 4HT1H 4PRAB 5EWIL 2X1QA 1R3JA 5DD6A 2FECL 1PY4A 4V2CB 2XPGB 3MV8B 2X10A 1JYWA 2Q6WB 4GKNA 3NGBC 2D7PA 3W0WE 3FOLA 3UZQA 1Q72H 2NY7L 1FVEA 3CC5A 1PZUB 4GRLA 5CBEA 1N2RA 3AU1B 3B2UD 5D93C 4B41A 4C54A 1KB9K 2CXGA 4L8SB 5C0AA 1P7QA 3T77B 3BZEB 4TVSa 5F9AC 2GSIA 4BFBD 2R2BA 1EGJH 12E8H 4Z7VB 1FPTH 1SHMA 4YC2B 3P4OA 1DSFH 1IEHA 5F7FA 3HZVA 2HFTA 2Q87A 4ZFFA 4YHNB 4L3CA 1NEZB 4MJ6A 1L7IL 2UWEF 3G5XA 5I1KL 2VABA 2A74B 2RCSH 4Y16B 1HCVA 5CP3A 4Y88A 4Y4KA 4OZIF 1UVQB 4QRRA 3F7YA 3TPKA 4NZRH 3LKOB 3MUGB 3U1SH 4OJFL 5I1GH 3GSXA 4K7PX 1TQBC 2CPCA 4PJ5D 1A02N 4LLYB 2HFGH 1N5YH 1NGYB 4QYOA 5IQ9A 5J9PA 3VRJB 3MRDA 3EO9H 3QDAA 3OGOE 1G7PB 4MAYD 3H2WA 3VFRA 3HNSH 5D6CB 5C6TL 5DWUH 3VWKC 4ZO7A 4AG4L 4XMPH 4A2LA 4M62L 4MHHG 1AHWA 2XQBL 3RIFK 1PYWA 3BT2L 3C87A 1FAKT 1I9RH 3UBXB 5J57B 2R0WH 5CBAB 3KYNA 1DBBH 3BX7C 5JPMB 1UKSA 4L9LA 1Z9LA 2JJVA 4NCC2 3HRPA 1WBXB 3CLFL 3PWJA 3DIFB 2H9GB 5HHVH 1IGFL 3N9GL 2YPVH 5A3ID 5IB4B 1ONQB 1QSVA 2HLAB 4G6FB 5MEOA 2VE6A 3LVEA 5DK0B 1S9XA 1FC2D 3ARXA 2VC2L 4OLZH 2BNQE 1Q0XH 1RZFH 35C8H 1IZKA 2OMNA 1UACH 1LEIB 1KEMH 4XNQA 3X13B 4XVJH 1LK3H 4QTIH 2NPLX 3X11B 4MDJA 1NDMA 2GFBB 2ID5A 4AYFA 5L9DH 5CIPA 3EYQD 3B2VH 4PJ7F 1EV2E 3RIAF 4WTZG 1NBVH 3VGGA 5HHNB 1B0RB 5I15L 5C0BB 1MCLA 3LS5H 2QQKH 1EJOL 1ZHKA 3TBTA 3DUHA 1MAJA 4GRWH 3VGAB 3TH2T 5TFSL 3GSVA 2RAMA 4LLUA 1IAKB 1YN6B 4C83B 4G7VH 3QJFB 4F37K 4HWBH 4MXWH 3RJDA 3PL6A 3VXMD 4ETYA 3FN0L 1FQ9C 4AQ1B 3MNWA 3H3PL 2DOCA 1EBAA 3K1KC 5L2JB 2KZWA 3IT8D 1VFAB 4YAQB 4LKXB 2ZSVA 4O2EB 1DANU 2K1MA 3QXAB 4KHXH 5JW4Q 2WANA 3CD4A 3MFGB 4YHKL 5FYLD 3KPPA 3CZFB 5BVJB 4JANB 3J8F7 4JAMA 2UUDK 1TQCB 4EOWL 2QV2A 4Y5XC 1J11A 4NGHL 4ODUA 7CGTA 2P5WD 2YA0A 4GBXB 1H3VA 4MA8H 5DQJB 1MPAH 3NFPA 5EU6A 1UM4H 1LE9B 3PABB 3DSNA 1NCWH 1N59A 2XTJD 2QQNH 2Q8BL 4LDLB 3GBLA 4K07A 2WBJD 4UQ2B 5ITBH 1VGKB 4X7TB 2AAVA 5EU5A 5I1EL 2JIXB 3Q48A 4XCEB 4GRWB 1A64A 5DT1H 5C8JB 1LEKB 4ZO8A 3OR7B 2AKRA 1HXYB 1RFDH 1ZHBA 1ZWIB 1A3RL 2FL5B 1T04B 1FO0B 3PWLA 1AQKH 3OKMB 1OTUC 4DAGL 1CXIA 5E6IC 5C9JA 2XICA 3O2WH 2PW2B 1ZLUK 1N4XL 5IHZA 2NY2B 3UJJH 1V3MA 4PJ9D 3TBYB 1JNLH 1MCEA 3MRFB 4HUKB 3F6LA 3LS4L 2V7HB 4MA7H 3V7AG 2CLRA 4MZ3A 1GZQA 1U58B 4DN4H 3ILQD 3UTQA 1QOKA 2Z8VC 5CCKH 1CF8L 4UT6L 3W81A 1OAKL 2FECI 5JIPA 3DOSA 4U6XB 1QHPA 3L7FB 4X0KA 3TJHD 3O2VL 1OWWA 4I3GA 3WHE0 4I18B 3LD8B 1EUUA 1T7YA 3V6ZB 3CX5K 4R97C 5E1AA 4PJCF 3RWCB 5C0AD 1MWAB 1P7QD 3EBAA 2CKBA 3VGHA 3WIHH 1B0GB 2BC4A 4WW2F 3ZL4H 4DKAA 4FQLH 1U93A 3FKUS 2Q3ZA 4KRPC 1R3KB 4U1LB 5CGYC 1XF1A 5D6DA 2BFVL 4HX1A 1OB1A 5E8OA 2FNBA 5ILTL 2EH8H 1CICA 4FNLH 3UP1A 2APVA 5CZVL 3UTZB 4MLIA 1G6RH 3V79C 4QHMB 1OAXL 3GO1L 3MGOB 4HJGB 4ZD3L 3R1GH 5EN2B 4FOMA 3WKNA 2C7UB 1U8LA 2FJHA 5DZOA 2BXZA 1OPGH 1TCMA 4KTDL 3SQBA 3BE1H 4QEGA 1CTOA 2GK2A 3QUXB 1BD2B 5L2KE 4NN7C 5ACZA 1QNZL 2H2SD 4IOSD 5KVEH 2VLLA 4Y4KD 5B3JE 3RWEA 4QRRD 1BOYA 1IBGL 4NJAH 2XXMB 4N1EA 5CEYB 2P8LB 3L3GA 1X6NA 3LEXB 4M7KL 3WD5L 5SWSA 1U8OA 2AJ3B 5FYKD 1OF2B 3RVWC 5FM5M 3VJ6B 3HZYA 3JWDC 5F3BB 1WUNT 2OP4H 4OCWL 2V7NB 3JV6B 1PSKL 5J89A 1PZ5A 1U36A 1LMKA 3TO4B 4QHUA 4JLRB 1F90L 5HVHB 3ES6A 1U2HA 2EKSA 5KBNC 2FH8A 4NJ9H 4M7LH 3RPIB 1CE1L 1CLYH 3LEYL 1QFPA 2A1WH 1JIBA 3O6KL 3P30L 4PTUA 3O3AB 4TRPL 1U41A 3INUL 4JDVB 4PRIE 4OLYH 4KJPD 1FGVL 1YDPA 3KS0H 4GXUN 3VU2A 1LDPL 4I2XE 4HWUA 3WUWA 4XVTH 3O3BB 3RRQA 3LV3B 2QHLA 3EOBB 1C1EH 2ORBH 3JWOH 4PRBA 4YHYC 1YMHA 1R24B 2X4QA 5IMKA 2AJYH 1INQA 5ALBL 1MLCA 4I77H 3RGVA 3T0XA 3DVGA 5DRWB 5IB2B 4V2BA 1JUFB 1J1XL 4H88L 4L8CB 1U8MB 3C9NB 4HFUH 5IB5A 3L3IA 4KJQC 3RA7L 3O45B 2XNAB 3TVMB 3O4LB 4JRYE 2QR0B 3ALPA 7FABH 4JPWH 4WTWA 3MRKA 3BIKA 3FMGL 4XX1G 3CFIC 4NUGL 2EICA 2VZUA 1D7FA 2DQTL 2IPKB 5GGVY 4GMTL 4LLWB 1A8JH 2CRMA 3T4YA 2BVPB 1F97A 2VLJE 4PFEA 3U2SB 4ZMAT 2DLGA 3T4AB 4PB9L 4LMQE 2Z31C 2R1YB 1DANT 3MRBB 2AQ2A 1OAYH 3H9HB 2GTZA 2QSCL 2G2RA 3PL6D 1VKXB 4Y1AA 5CMAA 1B6DA 5I1AA 1NANI 3O4OB 4O2CA 5GJTL 1EDQA 5DDHB 1KIPA 3ZLQC 4FP8L 1S9WB 1ITBB 3D87B 3GSWB 1QFHA 3IDXH 2NY6D 2UUDH 3KPLA 4XMKL 5HDQL 4PJEA 4U7KA 4HUXA 4X4MA 2HLFD 1RURL 3T3MF 2FATL 4N8VA 1MCCA 4NO2A 4PBWD 4KKBD 3WDJA 5DI8A 3JTSA 4ZOBA 2HKFH 3SGEI 4Y2DC 4P2OC 4WO4A 3OPZH 1UH4A 4IMLB 1NFDB 1LNUB 2CXKA 1QKZL 1GCFA 4UOW1 4ISVB 43CAA 5EU6D 1XIWB 2OR9L 5I6XC 1MIEH 4XWOD 1QFUH 5DQ9A 1FL6A 1K6QL 3M1BB 1G9ML 3RUGB 5E5MA 4JN2A 4KU1A 4G9FA 2I07B 2YS4A 5D1QB 4FFYH 4TPRL 3UEZA 2NZIA 2AK4B 3ARFC 3LRSA 3DV6A 1ZLUH 2AJUH 3Q6FB 1BVLB 3GRWL 4HDIB 3KPSE 4P59L 2ED7A 1V7ML 1IM3A 4WHYH 2DBJA 5IT2H 3ZDZF 2ZOKA 2I60L 5HYIA 1UT9A 3RY6A 2CKNA 5DUMH 5D7JC 2X4TB 1CL7H 1NMBH 3HB3D 4HS3B 4K3EL 3H42L 1KG0A 4QT5B 1T5XB 4KC3B 4NQDB 4HUUA 3C6SB 5CUSH 3FB8B 4L1DA 2JELL 1TENA 5EOCH 3AY4A 3QXWA 2IQ9L 2HFEB 5JOPE 5E8PA 1VFOA 4HKZB 2JCCA 3NCYP 1P4IL 1CWVA 1JPSL 3ULVL 3D2UA 2NXYB 1QVOA 2GK0B 5I2IA 2ATPA 4ZTPL 1HI6A 1S7TB 3VI3E 2I9TB 1DQMH 4FMFA 1FRGH 2ZJSH 4NBZB 5EIIB 1RZGA 1T21A 5E5UB 4MNQA 3ULSA 3NZ8A 1AXTL 5F7DB 5I30L 4DZ8B 4O51A 4UNTA 5CKGA 5EZOH 1UEMA 1QBLL 1N5AA 5GRJH 1C16B 3U30B 1R3HA 3QHFH 3VG0H 4P2RB 1CICD 3ESVF 3AAZA 3BUTA 3SKNB 2BRRL 1J87A 2G5BB 5IFHH 4PRDB 2C3VA 5A2JH 1GH7A 2NY4C 3DRTA 4LCYA 3WJJA 3LQAC 4M7LT 3K46A 4Y2OA 5C07B 3BZFB 5C08E 1Z2KA 3QPXH 1G0YR 2AV1A 1E4XH 1YEIH 1HH6B 4GJTB 2E6JA 5E9DB 4IRZH 5ID1B 4R4ND 5IMLA 5EDXA 3MV9A 4QRPB 4S1SL 5I1JL 3MQIA 1SYSB 1NMAL 1BM3H 1WFNA 2DQDL 2YPLA 1FBIL 3LHPH 1KNOA 2IMMA 5EOTB 2BERA 3PWPE 4LOUD 3AS0A 2ADJB 3GIZH 5SWSD 3QZWG 1M6OA 1U92B 1CLZH 3FTGB 1AGDB 2HG5A 3VMOA 3TA3A 2DWEB 4P23B 2IMNA 3MYJA 1EA9C 2FEEL 1T0PB 3DX9B 1WBYB 5J1SC 2W38A 4PPTA 1BQSA 1Y6NR 1GC1L 2F8XC 4XPFH 5I1DB 5CSZA 3U0TB 5DVMA 3VRIA 3D18A 4LVHB 4ZXBB 2A9MH 3I6GA 4NRXA 4OGAD 2FIRT 1Z3GL 1BREA 5DYOB 1QEWA 4QOKE 3TGXA 4QRTB 3HC0B 4HUVA 3TIEB 3ZKQD 4HAGA 4X99A 3D69B 4FTVE 1S7WB 2OZ4L 1E4KA 5T5NG 3RGVD 1S7UB 2CUHA 3D39E 1ORSA 5B8CC 4K23H 2EDBA 1BJMA 1H9VA 4HS8H 3OKKB 1M05A 1A7QL 3MREA 5K9QI 3M8OH 4OBSA 5HVFB 2IPTH 4Y4HC 3QO0A 2BVQA 1N0XL 5IEKA 5L8JB 1BEYH 2BOCA 2IBZY 5DJXB 1WZKA 5INDB 4MJ2A 2VDLH 3EZJB 3KLSA 3BZ4B 5EIVA 1R5IA 5D7KD 4NNYA 2JJTA 3W11C 2ZPKH 1MHPL 3U6RA 2Y1VA 4M6NH 5JLZB 2ARJQ 4PRNB 3B9EA 2EE9A 3GKWL 3JZ7A 2FSEB 5ICXB 3BESR 5FA3B 1A7BA 3MNZB 3O3DB 1E28B 1J8KA 4PP2B 1KPUB 1CE6A 4X80H 1CTNA 4JY5L 4G7YH 1RJLA 4ODTH 4ZSOB 3IS1X 1T83A 5DFWH 5AWNH 1E6OL 4LSUH 3FT3B 2A6IA 3G5VA 1SY6H 4KVNL 5DVLA 3VMNA 4PS4L 3DWTA 2HVKA 3L5IA 5JR1L 2N1KA 4P5TB 3LEVL 4Z77A 4I3RH 1ADQL 4FFWC 4YFLF 1QP1A 3RVVD 2XWJA 4WCYL 4IRSB 2R23B 4AEEA 3TCLB 3QULB 1N64L 4GAFB 4WO4D 5DRZA 4YWGL 5FO8A 2DAVA 2QTEA 2VDMH 4X9GA 5B4MC 5MHSE 5DC9B 1CGVA 1AFVH 1H0DB 1KB5A 3BDYL 5TE6L 2G75A 2BSTB 1CGXA 3CFBB 4ZFOL 1FVCA 3LN9A 4G9FD 1T22A 1BZ9B 1H3PH 5FGCB 4UILH 4X5XB 3KPRB 3DRQB 1TETH 4RMUA 5E94A 1CCZA 1SVCP 2WIIB 2C1PA 3SHSA 5I1IL 4NC0B 4MA1C 4OD2A 3D3VB 4OF0A 4WWKC 1YC8A 2ATKB 4FQXA 4CMHC 4YHLL 3OV6A 1JF1B 2DRUA 4LSRH 4W68A 1J05A 3ORJA 3FB5B 1I1YB 4XVSH 1WT5C 5FUOL 5C6PB 3WNLA 4WFFD 3IFNH 1MCQA 4O2FA 1NC4A 1R0AL 1BWMA 4KRNA 5EA0L 5DZNA 4BKLA 3MJ8B 2JJSC 4QTHB 3BKML 2Q7YA 1RIVL 2R2HA 1URLA 1FYTE 3V4VL 5ITFB 3MLRL 3V52L 3BN9D 1YMMB 2APXA 3GSOB 4MNQD 5A16B 1MRCL 1C08B 3WDIA 4OSUL 4N68A 5ESAA 5HHPA 3HI6H 1PG7W 2Y25A 5AAMA 5EO9A 2KQMA 1UB5A 3LH2H 4J3WA 3RDTC 4S1RH 4HUWB 4F7PB 1J8HD 2KL6A 3O2DA 4YUEH 1A2YA 4ELKB 3EFDL 3H9SA 2ERJC 3EYUL 4TUJB 1OGAA 3S5LA 5L7XH 4WW1B 4F7TB 2VKWA 3QO1B 4L4TA 4OFKA 1R5WA 4Z78B 4HG4J 1J86A 5JHDE 2VLRB 3ZKXC 5JDJA 1VFMA 4ODXA 5ANMB 3SE8H 2VQUA 1WAAA 3MV9D 5IIEB 1F4WL 1YEDB 1CXFA 1PX3A 5DSCB 2KKQA 4PJEF 2YPLD 3K4DA 2A38A 2F15A 4CADA 5DFTA 4JQIL 4NHCL 4CGTA 3KPMB 3ZTJG 4PGBA 4OAWB 4LIQE 3ZYOA 4JM2C 1FG2B 1UYWH 1SJHA 2EDOA 1QBML 1IE5A 3O8XC 2VNCA 4WUUE 1J10A 3TA3D 1CGTA 3SKJH 4BZ1L 4LF3B 3RIAK 3WO4C 2E8ZA 1A6ZA 4K94L 3VFMA 1RQ5A 4ORZC 1PD6A 1VHPA 3MLYH 3QDJE 3RWHA 4M5ZH 4U0RC 1RK0A 4MAUL 4EI5C 1JHTB 3WFCL 4JG0H 2LV4A 2DTMH 2VIRA 2Q8AL 3IFPB 4GSDL 2VDNL 1U8PB 4NQCA 1NFIB 4Z0XA 1NKOA 4PGCA 3ULUC 4NUJB 5I18L 4KKLD 3E3QC 1WTGT 1KGCD 1XCQB 3OGCA 2ESVB 3OBAA 3ZT7A 1A1NB 3BPOC 3L7EB 3H9YA 1JZ4A 3S8WA 2NY7H 2IEPA 5F9JA 3ARRA 3TF7C 1YEJL 5KSAB 4W4OA 5F21B 2W65A 4ZYKB 2QSQA 8FABA 4EQ3A 3VFSA 5IF0A 1CI5A 5T3XD 4K71C 2JCCF 1WBZA 3DROA 3P9LA 2WQRA 4U1GC 3JBG7 3E3QE 5JIIA 5IJKC 4DVBA 3ZDYF 4AY0A 1RIUL 4JQVC 4ELME 3QFJA 3H3KA 1L7IH 4NN6C 3LKPA 4JN1L 5BCAA 4AQOA 5DD3L 4OUUB 4DEPB 4ZO9A 4YPGB 4YBLC 1T4KB 4DVRL 4OJFH 1EAPB 2FJFA 3GSNA 3CDYA 1IL1B 1RV6X 3R06A 1G7JA 3IFOA 4D0CA 5E00B 4QRUA 3RBSA 2V5MA 1HQ4B 4AG4H 4EVNB 2RQ8A 2XQBH 4MQXD 3BT2H 5FV1L 5BO1L 3L9RB 3QEQA 4WI9A 4RRPA 3AM8A 5KZCB 3OTTA 1CGYA 3CLFH 1HDMA 3FB6B 1KJ2B 2AJXL 1IGFH 3N9GH 3KDMA 4GG8A 4MJ5B 4XPTL 1XF3A 2P24A 2QLVB 4LCUB 3K7UA 4YK4C 1TCRB 5C0RL 3PE9A 2WM0A 4HJ0C 3AXLB 2VC2H 4HZAA 3U9UB 2ICEB 4UUJB 3B6SB 5HSFA 3U4EA 3TNMA 5B39A 1WV7T 4O02L 1IQDB 5GRXG 4BFIB 5IB1A 2VLKB 5BXFA 3I75B 5DHYA 2NXZD 3HAEG 3I9GL 5ESVB 5IB3A 1MFDL 4FQXD 5MENE 3N1QC 3P4NA 5GS2D 3QAZB 5ISZB 3T2NL 2YC1B 1MF2L 5SWQA 4YR6A 4YDKL 2OI9C 1NC4D 2DI8A 2I9LB 4MNHA 2YD9A 4XNUL 1S9VA 3O6LH 5CINL 4N5ED 1SMAA 1U95B 4X5WA 4CAGA 4H20L 3IF1A 4MX7A 3ME0A 4Y89A 4RMSA 3BQUB 1FE8L 2J8UA 5ESQB 2EXYC 5AYUL 3U48A 5TFSH 2YD7A 5DO2D 4BSVB 4EUPB 5DHXB 3WSQL 1SQ2N 1AO7B 3FN0H 1NANH 3O9WC 1AXIB 2V2TA 2XZCL 1RZ8B 3H3PH 5D1ZC 3IDYB 2BDNL 2ICES 1QO3B 5CJ8A 4RDQF 4YHPA 3MRNA 3C8DA 1S8DA 3T0WA 4LVOC 2ZCKH 3THML 1OGAD 4I0PC 4DKFL 4L4TD 4I4WB 2K7PA 1Y0LB 3UTOA 4P9HL 3SGEH 3OAUL 3KXFE 4C58B 1T6WA 1YPZF 4EOWH 5F9WC 1IC7L 3KHQA 4KQ4L 1OOAA 4OZIB 4YZFE 4NGHH 1MFCL 1TVHA 2EDYA 3V0AC 3C8HA 5F9OH 3SJVA 3ZTNL 1I9JL 5IHUL 5HGGS 3DUUB 1U8HA 1BZ7A 2ARJA 3RTQD 4E0RA 3KPNA 4D8PB 2ED8A 2WSKA 3CVHB 3BRGC 3X14B 5ENWA 4LLVA 5DEGB 4NRYA 5I1EH 4F3FA 3V4UL 5D1XB 2XY2A 2FIKB 1F00I 2NY3C 3HC4L 3IJYA 2GT9B 5J4MA 5IVXE 1A3RH 2I5YL 3VFNA 1JNNL 2DQIH 1HHGA 4M48L 1X5IA 2N7AA 2HTKC 4Z8FH 4NQCD 5JOFA 3WNKA 3TC9A 5KN5B 4M5YH 3TNNA 4PJBA 5GGTA 2MCPL 1NGZA 1T20A 3CMOL 1GPOL 1IAOA 4YDJB 4FQIL 2Z0BA 4AL8L 4NOBA 3GIVA 5BRZE 1G7HB 3EOYG 3DSFH 3O2VH 3RNQB 1I8KB 3BP4B 2PUQT 1DDHA 3C5ZC 3OX8B 3T3PF 2VDPL 4UIMA 4QRSA 4PJ7B 4F57L 4X4XB 5EPMB 5TDPB 2V5SA 1FZMB 4HXBL 3ZDXE 3DURA 4PRHE 2WBWB 2AW2A 5D2LE 5IV2B 1KXTB 2BVOA 1FFRA 1P2CB 2BFVH 3W0WA 5ILTH 5CP7B 3HMXA 3C6LA 5CZVH 4K8RC 3MMEA 4UOW0 1NCCH 4YFDB 3QFJD 3GO1H 1OAXH 1A4KB 3EOTL 4ZD3H 3BPCB 2VR4A 4XHJC 4MJIA 4KTDH 4F7EB 1MUJB 3Q2CA 1J0YA 1XGUB 5EBWB 1QNZH 1T1XA 4P9MH 1W72B 1JL8A 4NKIL 5K9OB 1MFEL 1YNLL 3UPCA 1YNTB 2YD6A 3T0EC 3EHBD 4RMQA 3WD5H 4DUVA 4FMKA 5TF1L 2XRAL 2GJZB 4PR5B 3W5MA 3DYPA 5LCVL 5F7NC 1WAAF 4APQC 4WJ5B 1PSKH 4QGYA 4ACPA 2PYFB 1F90H 4PJ5B 4LLQB 2UYLB 1AD9B 1AGCA 4WEBL 3ISWA 4NO5A 4XRCA 4MAYB 3G6JA 3LEYH 3O6KH 5EZLA 4QF1A 4TRPH 3INUH 3PV6B 3T0EE 1PJ9A 1LDPH 2FH6A 43C9A 2FBOJ 1U3ZA 3CDGB 5C0DA 4KUCD 5ALBH 1N6QL 3DJ9A 1MRFL 3G04A 4X7SL 4KK5D 1J1XH 5HD8C 2DL2A 4H88H 4Z7QE 2MKLC 1FV1A 3WNPA 4JFQA 3JUYA 2R0KH 3SDYL 4X6BA 1A9EB 5FKAB 3P0VH 4LFHD 4HLZH 5IGXL 4X9FA 5EIQA 3RA7H 2BP3A 2BNQA 3FMGH 1MCDA 3VWKA 2DQFB 1IAMA 5KVFL 5DMIH 1BIHA 2EYSB 3OKEB 1BJ8A 4CU6A 5BMFL 2WV3A 4L29B 4GMTH 3UPRA 5FYLH 1I7ZB 3ZKSD 4GH7B 5ETUA 5JXAL 5I1LA 5F89B 3SPVB 3K74B 3SKOB 1ND0B 4OIIL 3GBNL 4Y5VC 2P43B 2F74A 5HI5C 3B3IA 4PJCB 4GQPH 3LKRB 4YDVB 3OXSB 3B8SA 4WW2B 4TNWF 2B39A 2OM5A 4R26L 4U1HA 5C0GB 3D6GA 2NTFA 1MCHA 5B38B 1G7IB 1IMHC 3GBML 1SJEB 2HT4D 4FP8H 2CIKA 3CFJA 5KS9A 2C26A 3DX7A 1VACB 2BMKA 4OLVL 3PWVB 4XMKH 4DOHB 5I19L 4QKXB 1JNHA 3UZVB 1OWRM 2E8YA 1RURH 4OZGF 4XI5C 2FATH 3SO5A 3ESUF 2P5EE 2C3HA 4OKDA 5E0QA 1J7VR 2XZQL 4HWEL 4K3DL 4IJ3B 3TBSB 3FQUA 5GXBB 2VQ1B 1F6LL 3S97C 3F12B 3P9WB 5I1HL 1QKZH 3SJVD 1BGXL 3MX0A 1ZVYA 2BY1A 3NCYS 2OR9H 4JFFA 3X12B 4H8WL 4BSWB 1G9MH 5A2KH 4XXDA 1TPXC 1LO3L 4TVPE 4WFED 3FRPA 2BZDA 4M6ML 1ZKAA 3D0VB 1UENA 1F11A 3KWWB 4JGMA 4TPRH 4FQQA 3WV0A 4I0CC 5FK9B 2FYYA 4H1LB 1B2WL 1A9BA 4S1DC 4P59H 3T0DA 1HHJA 4Z7UE 3V5KB 5BQ7B 3VXNB 2XTJB 3BP6B 1WZMA 2FX8H 3IETB 2WBJB 2I60H 4K2UL 4PGDA 2VZTA 3U36B 5HJ3B 5EU4B 2R4SL 4K3EH 3H42H 5CJBA 5JORA 2RFXB 3MYZA 1HKLL 1MCNA 5DA0B 4EJ1C 2UY6A 4KUCF 1QA9B 1DN2A 3HE6C 5LAXB 5CEZE 5CILH 2GJ6E 1FHGA 4Y5XA 2IQ9H 1U8QA 4NOFA 1IRAY 1P4IH 1A6AA 5A2IH 1I1FB 3ULVH 4OLXL 5C0FA 3IKCA 1MQ8A 1HIML 4PJ9B 4ZTPH 4BA8A 5D7SH 1RY7B 3AB0C 4RGMB 4EDWL 1AD0B 3Q1SL 5JW4R 4XGZB 4TN9A 5DGRA 1LGVA 3RZCD 1K8DA 1AXTH 4M61A 5DD6B 3RAJL 3QWQB 5F97E 4GKNB 4NQEE 4NC1C 3EDDA 3FOLB 4TUKL 1KCUH 5J11C 3C6LD 3H3BC 3CC5B 1FVEB 2EYRA 1E4WL 5GGVL 2VDQL 1RJYA 5CBEB 1N2RB 1FFNA 2DLIA 3B9AA 4LARH 5E99L 5DLML 1IGJA 1P7QB 5C0AB 5I8CA 4YO0A 4PLKC 3WN5C 1CT8B 2GSIB 2R2BB 4MJID 1EAJA 3VDAA 3GM8A 3NZHH 3D0LA 3KLAA 5ADOL 3EJJX 3ZO0A 3P4OB 5DJ8A 4S1SH 1MIML 3IRPX 3QJHB 5D9SA 4DCQA 3HZVB 4OF5A 2DQDH 4NC1E 1FBIH 4ZFFB 3MBEC 3JWNC 2WNGA 4L3CB 4MJ6B 3G5XB 4TSAH 2VABB 5L2KA 4Q9QL 2Z92A 2CR3A 4Y4KB 4N0RA 4M9OA 4QRRB 3F7YB 1ERNA 3GSXB 1A3QA 5F72S 5CIPH 1GHFL 1FAIL 4QYOB 4G5ZL 5J9PB 2HJKA 3MRDB 4ZS6D 5F88A 2O5ZH 3K80A 1SM3L 4G8EA 3VFRB 4BSJA 3AS2A 3D9AL 1Z3GH 1JHLL 4PREA 3UAJC 5A2FA 1PYWB 1JYNA 2OZ4H 3AMKA 3KYNB 1I8LC 4LSTL 3B9DA 2E5EA 4L9LB 1A14L 4P0DA 2DD8L 3WS6C 4RNRB 3NIDE 5SX4I 4BQ8A 2PETA 4RISH 1A7QH 3E8UL 1B88A 4PRIA 5MEOB 1UWXK 3V0WL 2AQ1A 1B9ZA 2AQ3A 2VE6B 2B2XL 4PJBF 3GMPA 1S9XB 4CW1A 1N0XH 1F8TH 2BNQD 2H2PC 1FFQA 2Z35A 1M7IA 1DBJH 1TJHH 3RY5A 3BO8A 4MMZC 4XNQB 3WUZA 5BV7B 1MHPH 3QUML 4K7PY 3L3OA 4RAUA 5I9QC 4MDJB 1NDMB 3I2CL 2BNRA 1OAUL 4ONOA 3A6CH 4L4VA 3UCRA 1HH9B 1NSNH 3VH8A 4OZFG 4OB5L 4CJ1A 3P0GB 1KENL 2W9EL 4JDTL 5E7BA 2F5AL 5D7LE 4GG6E 4OBRA 4P46A 3NPZB 1I3VA 2VLJA 5C0CE 2B4CL 4JZNA 4LQFL 1ZHKB 2FJGA 3P9MA 4KV5E 4ODSL 4KVNH 4H0GA 4PS4H 3MXVL 4JREC 5DD5L 5ICZA 5IFAL 5IBTL 1II4E 4L8SC 3LEVH 4JFXA 1ADQH 3PL6B 4Z5RA 3MNWB 1L0QA 3VXOA 4WCYH 1CD0A 4MSWA 3K8MA 1YYLL 1RZIA 4G6JL 1WC7B 4YWGH 1N64H 4JCLA 4YC2C 3GI9H 2ZSVB 3K2UL 2NY6B 5F1OB 1DL7L 1A7RL 2Z91B 4JFFD 4JO2L 3OMZA 1JPST 1WIPA 3KPPB 4KJYA 1DBKL 3VDBA 2ZUWA 2Z31A 1I8IA 1PW3A 3I3DA 4UOJA 4JAMB 2LE9A 2JE8A 4MCYA 4MWFA 3FO1A 1G7MA 4Y16C 4OKVB 4MVBD 4ODUB 2OJZL 4NWUL 4LVNB 4N0CC 5FV2A 3BYYA 2L7JA 5SV3A 3D85A 4FFZL 1FZJB 5EU6B 5I1IH 4Z7VE 2CKBH 3LKNB 3KYMA 3BP5A 3QUZA 4HBQA 1WTLA 3ALWA 4NIKB 5ICYA 1IILE 5EU5B 4ZODA 3MJ9A 1F3JB 4YHLH 2DLEA 2JF1A 3EYSL 2CH8A 4LAQL 3HMXL 4U05A 2BHYA 5FUOH 2AKRB 1ZHBB 5I0DA 2VXQL 3SDCC 3KPSA 2H26A 1R0AH 4Y2DA 3PWLB 1CU4L 5EA0H 4P2OA 1EXUB 5E2VL 5C9JB 3EUUA 4RFEA 4UT9L 1KXQE 3STZB 1RIVH 3NFNA 1RUQH 2P7TA 3N06B 3V4VH 4M7ZC 3E6FA 3QPQC 3V52H 1DQJA 2ICWA 3IDIA 1IKNC 2CLRB 3VD4A 1GZQB 5L0QC 3LIZH 3UTQB 1P6FA 2XOTA 3QDME 1MRCH 1EGJA 4OSUH 1YQVL 3JV4A 4PJDE 4OM0H 3KAAA 1KLUA 5GPRA 2PO6C 4C4KO 1Z5LA 3MLSL 4XC1H 3FQWA 1NLDL 3CVIL 4K3JL 3ZKMD 4IOIA 5DHVH 3EFDH 5E1AB 4RIRA 3EYUH 5D7JA 2CKBB 1J1OL 1UCTA 1NEZG 1I1CA 5LGHL 1QSFE 4L3EE 1QLFB 4DN3H 3TH3T 4JHZA 4F33A 1U93B 1U42A 1FVDA 1OB1B 5E8OB 4DKEL 3C5JA 3FRUA 2DKMA 5FKPA 1CICB 5KS9F 1F4WH 2E7HA 5IVOA 2R1WA 2ED9A 4IMKC 4NHCH 4Y4FA 3VFVA 3V0VA 3ZKND 5C08A 5DVNA 5FYKL 5L2KD 1QBMH 5ACZB 1R6VA 2VLLB 2DQJL 4XP1H 2OBGA 3RWEB 2AI0H 1OCWL 4K94H 3BKYH 2N56A 1ZLWK 4L8DB 4MAUH 4MQ7A 4KRPD 3UBXG 2ZG2A 5C0EA 3ECBA 2EIEA 3PWPA 4JKWA 2Q8AH 5SWSB 4M4PA 4GSDH 4BZ2L 2VDNH 3QHZH 1AY1H 4LGSB 3MV7A 2ILLA 1VGEL 4HLJA 1S7SA 1UJ3C 1KTLA 4NO0A 4QHUB 1M1SA 1X4YA 1LO2H 3ES6B 4JFYA 4GBXC 2ZCLL 2EKSB 4ZDHA 3MA9L 2L0DA 4X8JA 4PTUB 4GAJL 3I6KA 3WL9A 1YEJH 1YDPB 4OGZA 1T2QH 4FZ8H 4QOKA 5FCUL 3WUWB 4PRBB 1YMHB 2ZUQC 2X4QB 4FTVA 5IMKB 1INQB 4P4RA 1MLCB 5LWYL 3RGVB 3DVGB 4NSKB 4FRWA 3D39A 5I73B 3EDKA 2NYYC 2UZXB 3OB0K 2DL9A 5IB5B 1RIUH 2NY2C 3FJTA 4XNXH 3L3IB 5D5ME 3MLWH 1U3HA 2BNRD 5GRWA 2VDOH 3MRKB 2XN9E 3BIKB 4L4VD 1FCGA 2A6DB 1Z9SA 5DD3H 2JJUA 4MDIA 3RVXD 4MLSA 4WIQA 4ZOEA 4DVRH 4P46D 3T4YB 2D0GA 2VLJD 4YBQC 1EUTA 3OF6A 5B8CA 3VFGL 4NDMA 4I18C 3QP3A 1ZTXL 4F9LA 3RWFB 2GTZB 3MV8D 2G2RB 4NZTL 5CMAB 1KEGL 5I1AB 4O2CB 2F5BL 1S9YA 2EIBA 5DJAA 1KIPB 3ULVC 1PQZA 5BO1H 2PR4L 1A6TA 3KPLB 4PJEB 2C1OA 3DUSA 2NNAA 3O41A 4HUXB 4XPTH 5IKCA 2QHRH 4N8VB 1BF2A 3KLHD 5B3JF 2Z31D 5DI8B 5T33H 3JTSB 5BS0A 3QDHA 1DVFD 2CIIA 4HMEA 4WO4B 2A77L 4EN3C 3NH7H 3D85D 3UYOD 4O02H 1CS6A 1EHLL 4RBPH 3GSRA 1RPQA 5DQ9B 2YEZB 1FL6B 3Q5YA 4S2SA 3ULVE 3QUZD 3I9GH 5E5MB 4JN2B 1MFDH 4JFDE 3B43A 4G9FB 1HYSD 1BVZA 3H7LA 2Q86A 3T2NH 1ZHNA 1JPFA 3PGDA 1MF2H 1GL4B 2DS4A 4FXGA 1WQVT 4IDLA 5BZWB 3KPSD 4YIQA 4Y2DD 4XNUH 5HVHC 5D71L 3QIBA 4NCDA 2UZYB 2ZOKB 4H20H 4P5MA 2CDFA 4G80A 4MHHI 1FE8H 5AYUH 1VB9A 1BBDL 1KG0B 2BVYA 3MRJA 4ZNCD 2B0SL 4HUUB 2BCKA 1OTTD 4NKOA 3QG7H 3WSQH 4QWWC 2YA2A 2OMBA 3IGAA 2XZCH 5JOPD 3V5DA 3E2HB 2RHEA 4Y19D 2DF3A 2BDNH 4OM1L 1GC1C 3D2UB 1QVOB 3P4LA 5I2IB 2ATPB 2B8OT 1OSZA 1G6RA 1HI6B 1YJDC 1FYTA 4WWKA 1HHKA 2Y4SA 2X4SA 2BHZA 3TVMC 1RZGB 5CHNB 1T21B 1JWMA 3MGTB 3V4PL 4DKFH 4MNQB 3ULSB 3NZ8B 4HH9A 3WKMH 4OCYL 4P9HH 4O51B 3OAUH 1WT5A 1IEBB 1TVBA 1R3HB 4UBDC 4KQ4H 1MFCH 2CLZA 1A21A 3AAZB 1J8HB 1I9JH 1EFQA 5IHUH 1E4JA 2JJSA 2C3VB 3V6OC 3DRTB 1RUAL 4LCYB 4Y4FD 5FUCC 4KXZI 5H94A 1W8NA 4P2QE 5C08D 1ZLWH 3GSQB 2AV1B 5E4IA 4QXTA 3V4UH 2X4NA 1RK1B 1L7TL 4M03A 2CDEA 3O4OC 4Q6IC 4XNMA 5IMLB 1NUFA 3MV9B 2I5YH 1FNEA 3CFDA 2YPLB 1JNNH 2EDEA 4HIXL 2ZUVA 1GVIA 1KNOB 1PY9A 4M48H 1AR1D 1RIHL 2BX5A 3PWPD 3JWDL 3QCUL 5FUZL 4KJWC 1M6OB 3VGBA 3MV7D 4WUUA 2HG5B 1NBZB 3V6OE 3TA3B 4PJAE 2H6PA 3MYJB 1UGNA 4NNPL 4S11A 4KKAC 5GIRA 1F5WA 5BZDA 2MCPH 5E2WH 4NO0D 3CMOH 3QDJA 3C09B 4TNWK 1GPOH 2F58L 4FQIH 1ZVSA 4AL8H 2NMSA 5F93C 5CSZB 3VRIB 3D18B 2YD1A 3IJSB 3QR2A 3K3QA 4J23A 4NQVA 3I6GB 4NRXB 4UQ3A 3EDJA 2Y5TA 3SO3C 4C59B 1QEWB 5IUSA 4QO1A 4QOKD 4JM2A 2VDPH 5KSUA 3F65A 4ALAL 4HUVB 2UZIL 3O8XA 3MXWH 4X99B 4F57H 3OB0H 3BMVA 1FLRL 5GZND 4HXBH 4DGYL 4F15C 1ORSB 2JTDA 4Z95L 1NFDE 3MA7A 1MJ7L 3B5TA 2Q7NA 1M05B 4UINL 4FG6D 3MREB 4U0QB 1U3HD 3FO0L 3QO0B 2BVQB 5EO0A 5IEKB 3RBGA 3ARED 2JKXA 3GMRA 2BOCB 1CN4A 4TUOA 5HGAA 1IEAB 1U0QA 1KB5H 1RJZA 1KOAA 2DQEL 1R5IB 3SY0A 4NKIH 4LPCA 4JFOA 4WV1A 5D2NA 1MFEH 3VI3F 3ARYA 3U6RB 3RKDC 5DURD 3S3SA 3LPFA 3OF6D 4ELMA 1YNLH 5INCA 5AG9A 3A6BL 4RGOH 2IQAA 4HXAH 4DW2L 1FNGA 5KJRL 3IS0X 2E27L 5TF1H 4JHWH 4G6KL 5HHMD 2XRAH 1JZ2A 1RJLB 1UEYA 4ZUUB 4NQDE 3U30C 3TZVA 2E9JA 4N9GA 2HFFA 1KIRA 5IJKA 3G5VB 2A6IB 3D48R 2HVKB 2OS7A 3KPTA 1F4XL 4JQVA 4Z77B 2XWJB 2KBGA 1A4JA 1CVRA 5AYQA 5BS0D 5F7YC 2Y06L 5FO8B 1MCKA 5DRZB 1EX0A 4ZPVA 2D7TL 4HEME 2P46B 4G8FA 1MRFH 5KW9L 1T1ZA 1KB5B 4LRNL 5SX4H 3BH9A 3QUXD 2XQYG 5FYJH 1Q0YL 1WFUA 2G75B 4P2RE 1FVCB 4RFOL 1T22B 4X9HA 1OTSD 1NBQA 2MMXA 1T0MA 4MB4A 2H3NA 4LPUA 4FFWD 5C07E 1IKFL 3UTPE 3DX8A 3O2DH 4Y5YC 5KVFH 5E94B 2Z93A 3ABZA 2C1PB 1UFUA 1UKQA 3NN8B 5BMFH 3QIBD 4JFHE 5IBLC 5E9DE 3I85A 3SE3C 2NXZB 3HPLA 2RB8A 4QRPE 4FQXB 5CSGA 1EHNA 1ZOXA 1NUGA 4LVHC 5K9JL 4OIIH 3GBNH 4OV5A 4XVUC 3TO4D 1BIIA 3QCVL 5FGSA 2F8VA 2NY0C 1MCWW 3U0WL 2QKIA 4O2FB 1NC4B 5H37H 3QUYA 5I8OL 4R26H 5CS7A 4HFWA 1WEJH 4J6RH 3GBMH 4Q9RL 3ALXA 2Q7YB 3MCKB 2PKDA 1HEZB 2R2HB 4QGTA 4WUKL 3RNKB 3NBNA 4PBXA 1FYTD 2O5XH 1S7VA 4WWKD 3U79A 3BKCH 1IGML 4CVZA 2W60A 3I50L 1I85A 4F8TA 3LDBB 3MOQA 5HHXL 2XZQH 3VDCA 4XTRD 4K3DH 5EO9B 1X5JA 4MB5A 1UB5B 2P48B 4UNUA 3QQ9C 5DK2A 3UX9B 2ICCA 2O61A 4DQOL 3CMGA 2AJSL 5I1HH 1BGXH 3LQAL 3QIUC 4EQ2A 1ZA3A 4HIEA 5E08L 1WCQA 1A2YB 1A7OH 3MOAL 1RZKH 3H9SB 5IJVA 5C0IA