4HJJH

Structure reveals function of the dual variable domain immunoglobulin (dvd-ig) molecule
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
348
structure length
341
Chain Sequence
b'EVTLRESGPALVKPTQTLTLTCTFSGFSLSKSVMGVSWIRQPPGKALEWLAHIYWDDDKYYNPSLSARLTISKDTSKNQVVLTMTNMDPVDTATYYCARRGIRSAMDYWGQGTTVTVSSASTKGPEVQLVQSGTEVKKPGESLKISCKGSGYTVTSYWIGWVRQMPGKGLEWMGFIYPGDSETRYSPTFQGQVTISADKSFNTAFLQWSSLKASDTAMYYCARVGSGWYPYTFDIWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-18
publication title Structure reveals function of the dual variable domain immunoglobulin (DVD-Ig[TM]) molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 66
structure length 341
sequence length 348
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH01
1DLHA 4M5ZL 4NHCL 4WUUA 5E99L 2RGSA 2YC1A 5LGJB 3EJJX 2CIIB 4MCYB 2KKQA 3FQXA 2Z9TA 3SGKC 3C5ZB 1DVFC 4D0BB 1UJTA 3T0WA 2CH8A 4R3SA 4OZIB 3S37H 5F7EL 1G7LA 2ICWB 5F89A 5C6TL 2CUHA 2R39A 4L8SC 2G2RA 4A6YB 3KPPA 2AEQH 4JANB 2CD0A 5EBGA 3SO3C 1P7HL 5CJQH 5BRZB 2ZCLL 4HHAB 1E6OH 4JR9L 3V5HB 4R0LB 1IL1A 5IJKC 4PV9A 3MFGB 3P0VL 1CL7I 2P5WA 3C5ZD 1KPVA 4RRPG 5IIEA 4MXWH 1CE1H 1NEZA 4RGNC 4XPBH 1G7PB 2VB5A 5BVPL 4LPVA 3HCVA 2DL2A 2X42A 2VUYA 1GGIH 4YZFF 4Z7WA 4E0RA 4RFNB 1A0QH 1Q9KB 3BP4A 4JFFA 2ZG1A 4AZ8A 4YR6B 5EPMA 5H37H 4LARH 4O58L 2MPAL 1DEEB 4KRPB 5F88B 4WV1A 2DQIL 2YD9A 1WCBB 1AHWA 3RZCB 5HI5C 2PYEA 4L4TE 1BVLB 2IWGA 1PSKH 3OKDB 3OKEB 2W0PA 4XPGL 3HAEG 1FN4B 4YZFE 1LQSR 3D39D 1A6ZB 5L2KB 1AO7A 2WMPA 4NZUH 2P8LA 4ZNCD 4F3FB 4I3SH 2DYPA 3HS0B 6CGTA 2OI9C 1GCFA 3RVXD 4CW1B 4MDIB 2VJXA 1FVEB 5F7KC 2W59A 3KS0H 2C1PA 2VDNH 1ZLSL 1PYWA 1I75A 3K0WA 3B9KA 5MEOA 4NQEA 2ADFH 1RUQL 3ORJA 5FUZH 1NCCL 2A73B 3RZCD 2FH8A 3RWCB 3KJ4B 4GMTH 1A7PH 1IGFL 3OJVC 3B3IB 3T4AA 1RHFA 3SY0A 1LO2H 3BPOB 1J1XL 3C87A 4OJFL 2Q3ZA 5I1GH 1BEYH 5EU5B 4XB7A 4WO4A 1K3IA 3SQBA 2F8XC 2EYTB 4S0TD 3QYCA 2F54E 1J0ZA 2VITA 2QL1A 4HWUA 4FG6C 4LSUL 2NY2C 4QO1A 4YHIB 5ICZB 3QXDA 1CFVL 4EUPH 1D9KB 4PJIE 4Q0XL 2B4CH 3TBWB 3OKLB 4PGCA 1V5JA 4M6NH 5HYJD 4U1JB 4EOWL 2WP3T 1WC7B 3RZWA 4GKNA 5AD0A 3CLFL 5HHOE 1MELA 1A3LL 3U7YL 4I9WD 2Q20A 1J8HB 4G7YH 5GSVA 3O9WB 1MFNA 4AIXA 1MCNA 4M8QA 4MMZC 1G1YA 4JY6B 5IFAH 2HTLC 5DJAB 3NCYP 3GJFH 1WISA 4PJXF 5F1NA 2V7NA 3RL1B 1T80A 3BO8A 2F19H 4JO1H 1JNNL 1DUYA 3O2WH 5IB3A 2W92A 1B3JA 2VTFA 4DUWA 4RFEB 1DR9A 4CVUA 2WLZA 1BD2E 4DN3H 4NN7B 4IIQB 3QHTC 4P4KB 2BXYA 4XNXL 2B1HH 2H2PC 4P2RE 4P2QD 3J7HA 4PGEB 3SPVA 2EH7H 2BVUA 3NA4A 4ISVB 3TO2A 3C60B 1HHIA 4R7NB 3E3QC 1KPUB 3H9SE 5HYEA 1U8QB 1FCGA 1CGSH 1H5BB 1U3HA 5JMRA 2OK0L 4ETYA 4QRQB 3QG6B 2AQ1A 3GK8H 1XAUA 4PJXE 4YPJA 3SCMC 3SE9L 2B20A 1G6RL 4ODUA 3V9FA 1G9NC 1PDKA 5EO1B 4LHJB 1YNKL 2NY3D 3ULUD 2E9IA 4XP9H 1T6WA 5MERB 1XIWD 2JCCB 2ZNWA 4F57L 3RVUD 1NCBH 3B9VA 4PLOB 3GEWB 1HXMA 1MHHA 1BIIA 2OL3L 1AKJD 4QT5B 4Y16D 3D0LA 2Q76A 1NUFA 3MOAL 5DZLA 5I1DB 2DMCA 3ILQD 1QNZL 2AJSL 4UT9H 1K6QL 1QQDA 3SE4C 4PUBH 5DZOA 2X9YA 2HVKA 2NY4B 1BWMA 4R96B 2YOCA 5LAXA 4MWFB 3C2AL 2YSSB 1A4KB 4LSRL 3RI5F 3BYYA 1GPOL 3T3MF 1TQCC 4HEPG 3FFDA 3LRGA 4JAMA 1XT5A 4X99B 2PO6C 4ZXBC 4UDUA 4XP6L 3NIDE 4IJ3C 4MQSB 1CIUA 1ZWIB 3TV3H 2CGRL 1F11A 1I3VA 1KELH 4P2OB 3GMMB 5EUOB 3FQRB 4KUCD 3K46A 2XQBH 4HIXL 4Y5VC 4N5EC 1AXTL 5GGSB 2V5SA 2GJ6A 2F74A 4HK0A 3STLA 2J8UA 1TCRA 2O5ZH 3RRQA 2OZ4H 3FAXA 5D8JH 1X3DA 4JZJB 1UM4L 4HGWB 5FYJU 4YHYB 2H3NB 1AC6A 4M4PA 3VXPB 3T3ME 1G7IA 1MFDH 3X12A 3N1QC 2AERT 2Y25A 4RX4A 3CC5B 1GOHA 1SEBA 1K8IA 1QYGL 1UH2A 4NFBA 4QRPA 5KW9L 5AYUL 4C58B 3U30B 4JRXE 3ZKND 5JOFB 1PG7H 5IFHL 2BCKB 1P84J 1DN0A 2IQAA 3U48A 1MOEA 5KSBB 2WLYA 4MD5B 1H3PL 2ZG3A 5FYLE 3HE7B 3VFOA 3SKMA 1VFAB 1MEXL 3U36B 1J86A 4OLWL 4GBXB 1R5IB 5F70A 4XXDA 2W91A 4TULL 3FOLB 4LDLB 2IG2L 1EEYB 2VKXA 5KBNC 3LPGA 3GSWA 2HT4C 3TWCL 2GKIA 2NY6C 4LSTH 1FG2A 1N2RA 1RULL 3F65A 4XPHL 2F5BL 4L8BA 4UAOB 5B39B 3RGVA 5IMLA 4WTZA 3BRDA 1BAFH 2GJZA 5DJ0B 2BNQA 2LV4A 5I66B 5DRXB 2X4QB 2J5LB 4NQDE 1QD0A 4LCIH 3IDXH 1K4DA 4KY1H 2HRPL 2J88H 3RX8A 5SWZB 4PJBB 1XR8B 4F7MA 1R3LB 1JUFA 4X7FC 3T1WA 4RSVA 2DLEA 3QHZH 5JA9A 5M95B 2D31B 5CD5D 3VWKC 3I3EA 2EO1A 3CVIH 3QRGH 3VGDA 4UQ2A 1PKQB 5CP7A 3OWEA 5JHDA 4AQOA 5L0QC 3S6CA 1CTNA 1SY6H 4P0DA 4UIMA 1FGVH 1W8NA 4G80A 3ROLA 5CMAA 1UB6A 1TMCB 1A7OL 5D1ZB 4NWTL 2AVGA 4KHTH 4WFFE 4DZ8B 2GK2A 5D93C 5SWSB 4GRLC 4JN1L 2ILLA 4WHCA 3QDAA 2VQ1B 1OW0A 1I1CA 1HN1A 3QDGD 1A8JH 3B83A 2FX7L 1HEZA 3QFDB 4JDVB 3TJEL 1FLRL 1O5DT 4K8RC 3HE6C 4X8JA 1M6OA 4PLKC 4JEGB 4LCWB 1IGCH 3FFCB 4Z7OF 5CZXC 5JW5A 3QJHA 3WDJA 3AMLA 4DCQA 5FAAA 3MRRB 2VXSH 4NNXA 4NCC2 1SBSL 3U7AA 4LVOB 3TYFA 8FABB 1BP3B 1JPFA 4FFVD 4QWWC 1QR4A 1EA9C 3ARDB 5I1CL 4JFDA 2R2CA 5AAWA 1MCPL 3QG7H 2Y9RT 5SX5K 3FO0H 3GSQB 3PHQB 4PRPE 3MA7B 1JHKH 5FECA 4OF6A 3KWWA 4ZQKA 4Y4HB 3TPKA 4EDWH 3VXTB 1RJYB 1NCDH 4YXHL 1PQZB 2X4UB 2YXFA 2J6EH 4Z7OE 5CSZB 1OSPL 2CIKB 5LGJA 1D6EB 2JE8A 5EZIL 4ALAH 2DTSA 4MCYA 4TUJB 3JZ7A 4PRDB 3BN3B 4O2CB 3WS3B 4D0BA 3V0VB 3PXJA 4M1CC 4YBLB 3SDDB 3QI9B 1MJ7H 1CS6A 1U6AH 1FFOB 2JELL 2LAAA 4OZIA 1BREA 2ICWA 1CXIA 3TNNB 5T3XD 4AMKH 4A6YA 3O3AB 4ZOBA 2H6PB 3FB7A 4PYGA 1AY1L 4JANA 3AVEA 4YHMH 1OOAA 1D5XB 4PJEF 1XF4B 3GIZL 2F5AH 1I1FB 3JV5A 5BRZA 3NTCL 3H7BB 4HHAA 3HAEB 5EBMB 1CL7L 4G6KL 3V5HA 1UM6L 5C0AB 3Q3GB 2DLGA 3T0EC 2PTUA 2DLTA 3MXWL 5I16B 3P0YL 2VE6B 1QSZA 3VXME 4NP4L 1G6VK 1WZ1H 1G7PA 4ZS6D 3SDDD 3U7WH 1RQ5A 3WJLC 2E6JA 2A6IB 3V6OC 5BCAA 5C0BB 3PWJB 5IVNA 3NH7H 2M8XA 1Q9KA 3TVMB 1UM5H 4PJEE 1IKFL 4DKFH 2VDRL 4AEIL 4HH8A 1NGXA 1WICA 1L0YA 3WMSA 1DEEA 5JUEL 5F88A 5C09D 1LMKA 2J12B 5FUCE 3I50H 3U9UA 4OCXL 4RMWA 1IKNA 3CSPA 5C0AD 1WCBA 3HA0A 4BUGA 1YC8A 2A38A 3RZCA 4TYUA 3PHOB 1BVLA 1OP3H 3OKDA 2V2WA 3MRIB 4TPRL 3QXVA 4OGYL 3OKEA 4Y1AD 1K8DB 3BVNB 2JJTC 1UWXK 2IGFH 1FN4A 4C56A 2EDYA 1J1PH 4HG4K 1A6ZA 2AV1B 4KTDL 5C0BD 5L2KA 2LTQB 4X4ME 4F3FA 3UZEA 3LEXA 1CI5A 5ACZB 5EC2B 2VZ3A 1JK8B 4CW1A 4MDIA 2H45A 1FVEA 4UTAH 1U0QA 5SWQB 1OPGH 4KVNH 2F53B 2VYRE 1X5LA 1INEH 3CZFB 3GSVB 1U8LB 2BVQB 4HIHB 1ND0B 1I9JH 1T7YA 1NCNA 2A73A 3PDOB 3UEZA 5F9AC 3RWCA 5KJRL 3HZVB 1MUJB 3B3IA 4DZBB 2I24N 2ZUTA 4J4PC 2OMNA 1C5CH 4WI9A 1NFKA 4HUWB 4LEOB 4PTTB 5IT2L 5EOCH 5EU5A 2N56A 3DARA 3WN5A 4R0LC 1YUHA 1CDGA 2BERA 1DBKH 4MQTB 1RUPH 2AJVH 1MFAL 5BS0E 3P11L 5E9DE 3PWPE 3SE3A 1V7MH 1CIDA 4M9PA 2EE3A 2AEWA 2R0ZH 4YHIA 5ICZA 5T5FL 1A3RH 3BPLC 4D94A 1D9KA 4JKKA 3TBWA 3OKLA 1R3JB 1NGZB 4JHZA 4U1JA 5IP4A 5IQ7L 3ULVD 1WC7A 2VRAA 3KR3H 3OAZK 1AGFB 1J8HA 3UPRB 3O9WA 5TF1H 3L1OH 5I17B 4OI9A 3QNYB 1ZHKB 2IAMD 3RTQD 4JM4L 3ARBA 4JY6A 4NT6B 4CVXB 1NBYA 2OTUB 3VFRB 1E27B 4JRYA 4JO3H 5F6IB 1P9MA 2LU3A 1S9VA 3LS4H 4XP5L 5MHSE 3O2DA 4UV7L 1OGAE 3O11B 4P4KA 4IIQA 1YC7A 4JB9L 4PGEA 3N50A 2GT9B 4ISVA 4KK9D 3C60A 2VXVH 4R7NA 1KPUA 4OZ4B 1H5BA 4MQXD 1CDUA 4Y4FD 4QRQA 3QG6A 3WL9A 3UJTL 4X5XB 4GRWB 4PV8B 4KGJA 1NAKL 4KDTA 2CQVA 2VWEC 4P4RB 1I85A 3MUGA 4QYOB 4MA8H 4FQJL 1MNUH 3QEGH 4N0YH 4HPYL 5EO1A 2R69L 4NKDB 4XNUH 1S7QB 4MS8D 5MERA 1JGEB 4GW4B 2JCCA 2HKFL 1DCLA 5T33H 3V4UH 4FRWA 2APBA 2PR4H 5JOEA 1MJ8L 3M17A 2VN7A 5TE7H 2VSDA 4HS8L 4DK6A 2DQDH 1EO7A 4QT5A 1ZS8B 5I1DA 4OT1L 3GMQB 3CCHA 3LV3B 3KYKL 1W0VB 4ZDHB 4KDVA 4R96A 3D6GA 2RQ8A 5I1HL 4TUOB 4MWFA 4MJ5A 1JI1A 2YSSA 4MNQD 4EI6A 1A4KA 4RISL 4FNLH 1NUGA 3FTGA 3DUHA 1JWSA 2VLRD 1DQLH 3EJZD 5L2JB 5B8CC 4OGAD 2E6QA 3PWLB 1LO3H 1N8ZB 1B0RB 4X99A 1IC5L 4CMHB 4QF1B 4XNZB 4L9DA 1ZWIA 2MSPA 4HCRA 4FABL 5DHVH 4XC1H 2X1QA 4UZGA 4M62H 4P2OA 3GMMA 3FQRA 3ZO0A 1IAIM 2NY3C 3QEUB 4QCIB 3ULUC 2E3VA 4M5YL 5T3ZH 3OKNB 4JO4L 4TSBH 1XIWC 3UTSB 2EYRB 5GGSA 1JPTL 1JYXA 4X5WB 1OM3L 4W4OC 3ARPA 3TA3A 4JZJA 4HGWA 2H3NA 3OKYA 1ZA3B 3VXPA 1EO8L 1JI2A 1TNMA 4Y16C 4DTGH 5JHLL 4HUUB 1CF8H 5JW4R 1P4LB 5I18L 4JPKL 4FZEL 1KJ3H 3ILQC 3LHPH 3CC5A 1XF2B 3VD9A 3T2NH 3RU8H 4XVTL 3S36H 5CEZL 5I8KL 2BCKA 5CZKA 4XAKD 5KSBA 4MD5A 1JP5A 3HE7A 1CQKA 1X5FA 1N59A 1VFAA 1WSST 3U36A 5ADPL 3OG6B 4GBXA 4GMSH 1R5IA 4ODSL 3EFDH 2FGZA 1MAMH 3ESUF 3AREB 1UACH 2UZXB 1EEYA 2ENYA 1A1MB 4CN1A 2R8SL 5CJ8A 4G3YL 1BX2B 5GIRA 4B41A 5F7LB 3RJDA 2O5XH 2XZCH 2D7OA 4O02H 5B39A 5CUSL 4U05A 2R4RL 3IT8D 4DGVL 1X5HA 1R3IL 1XGYH 5D71L 5DJ0A 4NM8L 2EC9T 3L5JA 5I66A 3WHXB 4G8FB 5DRXA 4NJ9L 5LWYL 2X4QA 2EIZB 2PN5A 4G9FE 3FQTB 3QUXD 4NRZB 1IC7L 1KCLA 1AXIB 2ARJB 3MROB 3MRKB 5SWZA 2DLHA 1XR8A 1R3LA 5HHMB 3WD5H 3BPNC 4AM0B 3L7FB 3ZKNC 1T0PB 2D31A 1UWGH 3RIAK 3MJ9A 4JY4B 3X13B 2F58H 2WQ8A 1ZVHA 4PD4K 1F4YH 4JG1L 4X5LA 1JPSL 1PKQA 4XMKL 5I1JH 1QFPA 3RL2A 5FM8A 4L29B 1IQDB 3OF6D 5A40E 5KVGH 4BK5A 1UXSB 3MV7E 5D1ZA 4KV5F 3NFSH 4NNPH 1IC4H 5IJVB 3LRSA 1CFSB 4DZ8A 2XKNA 1MPAL 5HVFB 4LHQB 5SWSA 1INQB 2A74B 2WQRA 4K8RH 2VQ1A 4Z18A 4JDTH 2FATH 2NYYD 5I30L 1KPRB 4DKEH 1ZMYA 5CP3A 3QFDA 4JDVA 3MODL 1XR9B 1WLHA 1YMME 5HGBB 1JTTA 4NFDA 2QADB 35C8L 5EWIL 4JHWH 4JFPB 3DGGB 4LCWA 3LH2L 3FFCA 2UY6A 4Y89A 1UG9A 3S88L 4G6AD 5K9QG 3MRRA 2X1WL 3UYRL 3CK0L 4KV5E 8FABA 2VXQL 1G6RB 4HGKC 4P3WA 3RY6C 4HAFA 3OB8A 4ZPVB 5CD5C 1I1AB 3EO9L 3ARDA 3IXTA 3BH8A 2YPKB 4IDJL 2B2XL 2FH6A 1FVDB 3K2UH 3GSQA 3FCTB 3PHQA 4KKAC 3MA7A 3MV8B 2OL3B 1NFDF 2IBZY 2HKHL 4Y4HA 4JZOB 2O61B 3VXTA 1RJYA 5EOQL 1NEUA 1PQZA 2X4UA 3V4VL 2Z31D 4YK4B 2QADD 4GG6B 3AXLB 4AQ1B 3MRDB 5CSZA 2CIKA 1D6EA 2X9WA 4M7KH 1NMBH 4TUJA 4PRDA 4NJAL 3ESVF 3RA7H 1ZLVK 3EO1B 4HKBB 5SX5H 4O2CA 3WS3A 5DD0L 3QIBD 4YHLL 4OCNC 3V0VA 2GTZB 2XKUA 5DJYB 1MIEL 4JM2B 3QI9A 1FFOA 3ULSB 3OAUH 3TCLB 1N4XH 5DRZA 4BKLB 1KCSH 1U58B 3O3AA 2H6PA 4F15B 4HJJH 1NFDE 1KYOJ 3CMOH 4FP8L 1D5XA 4LSQH 1XF4A 3MV8D 1DP0A 1P69B 5TH2A 5FHAH 2X6MA 2Z35B 5EBMA 4FFVC 2HN7B 4JPWH 1MCWM 1UXWB 2KH2B 4FQIL 1HH6B 3Q3GA 5C0AA 2Q8BH 5I16A 1MCDA 2VE6A 4M1DL 5F93C 4MJ4A 3QHFL 4ZOEA 4G5ZH 2CRYA 3OB0K 3WUWG 3ARGB 2A6IA 4TNVF 1BJ1J 5C0BA 1X5AA 4KAQL 3PWJA 4HMDA 4DVRL 4EXKA 1O0VA 1RZ7H 4YXKH 3TVMA 3IU4L 3K7UA 2WBKA 3FRPA 1RUMH 3DVGB 1UA6L 4PFEA 4POZD 1Q8MA 5IEKB 3QEQD 3IDMB 4OKDA 5HD8D 4GUPB 1N7MH 1L0QA 1S3KH 1DFBL 1J0JA 1KN2H 1HILB 1CD8A 4RFOL 3RIFK 3PHOA 4HQQL 1EPFA 3MRIA 1VFBB 4B0MM 1K8DA 3BVNA 5D5MF 3ARGD 5DJ8B 4NQCB 5ANME 3DETD 2R0WL 1R6VA 2HFFB 2N1KA 2AK4B 5ACZA 5EC2A 4OQTA 1JK8A 5E2TH 3PWNB 1SEQH 5C6WH 1IGIL 1NBZA 4LPYA 2FCBA 3OZ9H 2D7TH 4A6YH 2F53A 1UWXH 3H9SD 4MNGE 4YBLC 4ZS6C 1I3GL 1JFQH 3O6KH 2C26A 2R0LH 5C08E 3SDDC 2FO1A 3GSVA 1U8LA 4F9PA 2BVQA 2W9DL 3LIZL 4HIHA 1MRDH 1ND0A 3GNMH 4ORGB 4UUJA 3BGFB 3PDOA 4OLYH 4XHJD 3EW3B 4U6YB 3VI4F 3HZVA 1MUJA 4MLIA 4DZBA 3SEPA 2VLJD 3D3VB 4HUWA 4LEOA 1NLBL 5T5NF 1FL5B 2ZUQC 1WAAA 1TJHH 3PJSB 2X41A 5I76B 5D7SL 5EA0H 4HBCH 4U0QB 4Z7UA 3P4MB 4NC2B 3U9PH 2W9EL 5MP6H 2DF3A 4KKLD 3ZZ1A 1KUMA 4M9OA 5GGTA 3CLEL 4XVJH 5CGTA 3WXVH 2XKSA 5ADOH 5DJXB 2FHBA 3VI4E 4UDTB 5D7LD 4WEBL 1R3JA 2KQMA 5J8OA 1NGZA 4J23A 3T1FB 3R8QA 1IAIH 2UV3A 4NZTL 2CMRL 1AGFA 3L5IA 3UPRA 5I17A 1ZHKA 3QQ9D 3TT3L 4NT6A 4CVXA 2OTUA 1Z6JT 3VFRA 2GQHA 2HT2D 3IAPA 5IMOB 4K7PY 3MRLB 3O11A 3OAZH 4W6XB 5EU3B 1U92B 2W0KA 4BJLA 2LU7A 1H3VA 2GT9A 3N85L 2R9HD 1P53A 4M8VA 3FB6B 5FEBA 3DV4B 1ADQA 4S1QL 4F7EB 4OZ4A 4YDLB 1FORH 1ZANH 3G9AB 4PV8A 4X5XA 5GGRY 5F8QC 4P4RA 4H8WL 5JW4N 4QYOA 4PJ7F 4K3DL 4JRXD 2ATPB 2G5RA 1KCRH 4NKDA 1NGYA 2JB6B 2YD2A 1S7QA 1KJ2L 3RDTB 3ULVC 1JGEA 4GW4A 1TJGH 1YEKH 3EYUH 4BSVB 1ZLUK 3L95B 1XH3B 4NGHH 2IAMC 3RTQC 5ICXA 1RZKC 4IOIA 1T4KB 3MRMB 1ZS8A 15C8L 3EOYG 3GMQA 2XV6B 3FT4B 2UVEA 4LAJH 3LV3A 5IW1B 5GS2D 4E41B 1W0VA 5DD3H 4U0RB 5D2LB 1AFVL 2GY7B 4EZMA 2DQUL 2XA8L 4TUOA 4BQ6A 1F4WH 3VXNB 2DQGL 4AEFA 2DBLH 4F37K 3JWDC 4KK9C 3RDTD 3G5VB 3MRBB 2MCPL 5L2JA 5JXED 4MQXC 3FO2B 3PWLA 3ULUH 4Y4FC 1B0RA 4OD3H 5ID1B 4NQDD 3VMOA 1NL0H 4MD0B 1TITA 1IEAA 2OR7A 4OSUH 2QKIB 4L5FH 3F12B 1BF8A 5L9DH 3MLZL 3QEUA 5FYJD 3AY4A 4QCIA 4PJGE 2V9RA 1CQYA 4MS8C 3OKNA 3AM8C 2V6HA 3UTSA 2EYRA 2BVOB 4N0RA 2PYFB 4H26B 4X5WA 4FQLL 1P6AB 4YQXL 5EH1A 4J1UB 1A6VH 2L4OA 3N0PB 3MC0A 4K9EH 4OZHB 2VDQH 1BM3H 1ZA3A 5IROC 4GH7B 1IGTB 3EO0B 2Y6SD 4HUUA 1P4LA 3P77A 5CCKH 3QDMB 2OJEA 4WFFD 3RVWD 1IM9D 2Z4QB 3QCTH 4ODXA 4X6FB 5H35B 3TN0B 1AGCB 4F58L 1L7IL 1T6VN 5GHWH 4S1RL 3EJZC 4U2YA 4OGAC 5MEPA 1CFTB 1VEPA 4JHAL 1TLKA 1OAYL 4YLQT 3MLXH 4I3RL 4OZFG 3AREA 1RZFL 2YKLH 3KPRB 2BNRA 4O5LL 3QDMD 1RURH 3GUTB 1BX2A 3H3PH 4ELKB 4PGDB 1QFHA 1L7TH 1HI6B 1PKOA 4EN3B 3O6FC 1OAKL 3BWUC 3TP4A 3WHXA 4G8FA 4N0FB 1MHEA 1MCKA 3BUTA 2EIZA 4M02A 3ALPA 1E4WH 4HCRH 4HJGB 3FQTA 5DEFB 2IANE 4OM0H 4NRZA 5MENE 2ARJA 3MROA 3MRKA 5DUMH 3ELAT 4AM0A 4QXGL 3MLRH 4FQ2H 5I1EL 1GIGH 3L7FA 4L8DA 1MRFL 5C0RL 4JY4A 3X13A 3LEVH 1I1RA 2X9XA 5HJ3B 1UKQA 1FYTE 2PCPB 4Z7VF 1HINH 1KACB 1QSEB 3DXAD 4OB5H 5JO5B 3DYPA 4Z77A 3JXAA 5TGBB 1CXKA 3LCYA 2FIRT 4EN3D 1RUAL 4L29A 1U8IB 1UXSA 3NPSB 5EORL 3SDXF 3T08A 1UT9A 2WW8A 4DN4L 4LEXL 5IJVA 5C0GB 2I25N 1MCOH 5E5RB 1INQA 4Z8FH 3D69A 2ZPKH 3VDCA 4ZG1A 4GKOA 4KTEH 2IJ0C 4PJAA 2XY2A 4BUHA 5J0BA 4FA8A 5K9QI 1AR1D 1JPGB 5HHQB 3S8WA 3VGAC 4Z7VE 1F6LL 1KTDB 4ZAKD 5ISZE 3H9ZA 1XR9A 3WUZA 5HGBA 1B90A 1B4JL 4JDZB 2LAGB 1QSED 4K07A 2FRGP 3O8XD 4JFPA 3QUXC 1UEMA 3DGGA 3BEWB 1QA9B 3AU1B 2BJMH 5JW3H 3SDXE 2VLKE 1KB5H 1VGEH 1JNLH 4ODHH 3D9AH 2WINA 1G6RA 4ZPVA 4NSKB 1I1AA 3G6JB 1A6WL 4P9MH 5ALBH 1Y18B 1V3KA 2YPKA 4OLVH 1E4KC 1IM3B 1JHLH 1PLGH 1YZZA 4FS0A 3U0TB 1FVDA 1WBZB 1P84K 1YPZB 3FCTA 4X7EC 2X05A 4WW2C 4NNYB 1MREH 3MV8A 2OL3A 1T7XA 1T83A 1T03H 3CDCA 1FNFA 1M4KA 4JZOA 2O61A 1OAQL 2GY5A 4XAWH 3MJ9H 2Q87A 4GG6A 3MRDA 2I26N 3FQNB 1AR2A 2VDKL 3EO1A 1QBLH 4HKBA 3T0DA 3WNPA 2XG5A 2XTLA 4S1SH 5DJYA 3LQAH 4JM2A 4F33A 4MDJA 4YDIH 3ULSA 4LLYB 4WI8A 5HDBE 3TCLA 4BKLA 1RK0A 4AEHH 4ONHB 1U58A 1FFNB 5FGCB 1QLEH 1ZLVH 3CPLB 4OV6F 2A9NH 3NZ8B 3X3FL 3O6LL 1F4XL 4W6WB 1NMAH 2Z35A 4C57C 2HN7A 4LPWA 4RGOL 1MIMH 1UXWA 3X3GH 3QZWG 4XTRD 1A6AB 1HH6A 5CKAA 1Q0XL 2YRLA 3GO1H 5E4EC 3H3KA 1Z3GH 2M2DA 3I2CH 1PD6A 1IGMH 4F8TA 2P5EE 3DMMB 5F9OH 3V7MA 4IHOB 5E9DD 5BS0D 3KLHC 4MB3A 1EFXD 2AS5M 2Z31C 1KTRL 2ED9A 1YYMH 3VWKA 3ARZA 4QOKA 3QCUL 5T3XH 5L7XH 3EFFB 3DVGA 3QR2A 3QIBC 5IEKA 3MV9B 3IDMA 3AUVA 3OB0H 5ITBH 4YHZL 4U6VL 4GUPA 4NUJA 4U1SB 3BKYH 5T1DH 3UTTE 4X98B 4YBQD 2XN9E 1VFBA 4OLZH 5T5NG 2B39A 3MFFB 2BDNH 4OI8A 3DMMD 3OPZL 4TOYL 4J3SA 5AWNL 4NQCA 5IBTL 1XCTA 3UJIL 3O6MH 2HFFA 4DGIL 4OD2A 1OGAD 1OL0A 1A3QA 1HIML 1URLA 2AK4A 2BVPB 4XNYH 3PWNA 3P3YA 3HNTH 1BQLH 1HQRB 3L5HA 2Y23A 1NKOA 4LIQL 5CEZD 3MLUH 3UBXG 3QWOB 4WRLA 3FAWA 5F7NC 1WBYA 1FE8H 5MI0C 1X6LA 2GJJA 4ORGA 5KAQF 3HAEH 5K9JL 4CN4A 2B1AL 1TQBC 4U6YA 1RV6X 2XRAL 4DW2H 5I73B 1HCVA 2NX5E 2R23A 4I2XB 1F45A 2R4SL 4MA1B 4XNMB 2IC2A 3D3VA 4R90H 4ONGH 1OHQA 4POZC 3G9VA 1FL5A 2EDEA 3FN9A 3HUJB 4Y5XB 5HD8C 5I76A 4XCYB 2XTJE 1LO5B 4XMPH 1NGPH 1CD9B 1D5IH 3P4MA 3SGEH 1TNNA 3KS0J 4NBXB 4QNPF 4JE4B 4HWEL 2ICES 3DETC 3CXDL 3EGSB 5DJXA 1MRCH 4X6DF 1TZGH 4UDTA 2Y1VA 4LVNC 1W0YT 1JE6A 4H20L 2FX9L 3TJHD 4XMLL 3MJ7B 4GO6B 5K59F 4EBQH 3MLSH 2DL9A 3I6KB 2B0SH 1EEUA 5DHYB 5GISL 3O2VL 4RWYH 3LPFA 4XHJC 6FABH 4QNPE 1R24B 3L3HB 1DZBA 2ZUUA 1IRAY 1FC1A 4OQTH 3W39B 5IMOA 4ELMF 5GRUL 2BHZA 3VA2C 4KJWD 1KENH 4X6DE 1EFQA 2VDOH 3ZDZF 4B7IA 1CZ8L 2DLFL 5EU3A 3WJLA 2XG4A 2JJVA 5D1XA 1FZKB 43CAB 1BFTA 1OAXH 1UWEH 2YPLB 1EEZA 1C5BH 4KU1A 4RDQF 3DV4A 1PX4A 4F7EA 4KKLC 4TN9A 3MGTB 4HPOL 4I0PB 3ULVH 5C0FB 2HFTA 1UADC 4PP2B 1BFSA 5DJ2B 1DQML 1E6JH 2KDGA 5FYLL 3BGFC 1QFWH 2E7BA 2Y06H 5CJ5A 5SV3A 4ZUSB 3U0PB 1FZMB 5I8OH 2JB6A 4DGYL 5I8CB 5F1IB 5H37G 3RI5K 2D03H 5JXEA 3RPKA 2MMXA 2FR4B 2GTWB 4BSVA 1CLOL 1WIUA 3DIFB 5GGTH 3QQ9C 5HXMA 4HFWA 5C3TA 3B9DA 3RWFA 3MRMA 4N1HB 2DRUA 2J2ZA 5GJSH 4LVHC 2HT2C 3FT4A 3JWDH 5DMIL 2OSLB 3RKDD 4BZYA 5IW1A 4E41A 2AKRB 1FPTL 2YD1A 3GZKA 4N0UE 5D2LA 2DDQH 4WUKL 1ZLUH 5BMFL 1VGKB 1Z2KA 3VXNA 4P3CL 2J4WL 3GBNH 5ID1A 4J4PA 4K3EL 1INDL 4PBXA 3ZKSD 1NFIB 2V9TA 3R4DA 4M1GL 4WFEE 4MD0A 4XHQA 3KJ6L 4I13B 2QKIA 3F12A 5B38B 5F1SA 1U8PB 3JWOL 3IKCB 1ZSDA 2BVOA 3S5LB 4XGZB 3I9GH 4H26A 1ROWA 2AGJH 1MCFA 5ICYB 5INDB 4OZGA 4Y2OA 1SBSH 1S7TB 1IBGL 1WEJL 1T04B 4OZHA 3WO4C 1FAKT 1ZK9A 2AQ3A 4NHCH 1IGTA 1MVUB 2YWZA 3TZVD 3GI9L 5D7IB 2YUWA 2NXYC 5IVXE 4QHUA 3BX7C 5CJXC 5EDXA 3IGAB 2FWOB 4LRIC 5C0DB 4X6FA 3TN0A 5H35A 1AGCA 2X4TB 5F7EH 4WUUE 4X9BA 1BQHB 2VDLL 4Q74A 3RDTC 3TYGL 1J5OL 3S9DB 1XZ0B 4K7PL 1TDQA 4ZO6A 3GSNL 4W68A 2ZCLH 1CXHA 2IQ9L 1HYSD 4JR9H 5E6ZA 1BGXL 3KPRA 3G04B 3AB0B 1NSNL 5IFJB 4X0KB 3W0WB 5D7JD 2D0HA 2NXZB 4QTHB 3GUTA 4ZFZB 4Z7WF 4ELKA 3E6HB 4PGDA 4R97C 1WZKA 2R1XB 1HI6A 1N64L 2E5EA 5GS1C 5BVPH 5KS9B 4EN3A 3U2SA 1U93B 1ZT1B 4KHXL 3W81A 2EEBA 3H0TA 5D2NB 4N0FA 2XICA 3F7QA 2Y6SC 5DEFA 4HJGA 2YUXA 3REVB 4IOFD 5F8RC 5TQ0L 5EU4A 2X89D 4EIGB 4O58H 3RVWC 5JORA 4HWNA 2MPAH 3VXRB 1QR1B 1IEBB 3CX5J 1FQ9C 2CKBL 4V1DD 3B8YA 4Z7WE 4H0HB 3VFNB 4E9LA 5HJ3A 1G84A 3W0WD 2PCPA 4PG9B 1H3XA 3NPZB 4JFFE 3VXUB 4PTUB 1JGDB 1QSEA 5JO5A 5LCVL 5TGBA 4XPGH 2DI7A 5F9WC 3LDBC 3OJDB 2HMID 4Z76B 1U8IA 2D4FA 1DL7H 4BFEA 5C0GA 3QSKB 2PYEE 2VDPL 1CR9L 4XVUD 2FDBP 2Q8AL 4JGUA 4PRHE 2V5MA 2AJUL 1PY4A 3H8NA 1ZLSH 1JPGA 5HHQA 4Q9BA 1XEDA 2QQNL 1AO7E 1RUQH 1KTDA 4YHPB 3RWGB 1NCCH 2YD5A 3DPBA 1FJ1B 4JDZA 4ODTL 1IGFH 5IMKB 4OCMC 3BEWA 1QA9A 3AU1A 4BM7A 3TBYA 1J1XH 4OJFH 2WAHA 5C9JB 1TPXB 1ZHLB 4XBGA 3S3PA 3VRLE 1CXEA 2ZUVA 2J1KA 2WBJD 4NSKA 1KJ2B 3G6JA 1Y18A 1I9RL 2DKMA 3Q5TA 1IM3A 1ZHNB 3U0TA 3VD5A 2JJSA 2ZOLB 2CRMA 1WBZA 4OIIH 5HY9B 1YPZA 4LSUH 4KRMB 4NNYA 1CT8B 1JMXA 4OFIA 4FMKA 5D5MB 5DQDL 5A1AA 4Q0XH 3H3BC 4ONFH 3FQNA 4EOWH 3MYJB 3CLFH 1A3LH 1DBAL 4PJHB 1AR1C 4MVBD 3ZYIA 1J9CT 4TSAL 4U2ZA 1JBJA 3WJJA 1NGQL 3BDYL 3UPCA 4ZAKC 4LLYA 4KJYA 5C08D 5IBLD 4KWUA 4ONHA 2XT1B 5DJZA 3S34L 3O8XC 1FFNA 5GGVY 3MBED 3DNKA 2DKUA 4AH2B 3CPLA 3NZ8A 2GSGB 3HN3A 5GJTL 3KPMB 3QIUC 5GQBA 1YY8A 1A6AA 5BV7C 5FUCC 4U3CA 3L9RB 1F2XK 4PRIA 2JB5L 1GOGA 1GC1C 1KTKE 4N90D 4WI4A 2HFEB 3H9HB 3SE9H 3OBAA 2OJZL 1G6RH 5T3ZE 2B7DT 5HYSB 1YNKH 4XP4L 3T2OA 1B88A 4F57H 4MXQD 1GVIA 1CVSC 1YNTB 3EFFA 4X83A 2ZUYA 3WLWD 1DSFL 3MV9A 1AC0A 1D7FA 1J87A 4EIZC 2VZ1A 2D0GA 1FNSH 4OCRL 5IB4B 1LEGB 2OL3H 3MOQA 5KAQG 2VZTA 4U1SA 4LLVB 5F7UA 4X98A 1I8MA 1EDQA 2E9JA 3EYOB 2AJSH 1YEGH 3PIQB 1CD1B 4NBZB 3UBXI 2ZUWA 4U1NB 1GZQB 3RWHB 3C2AH 3VGEA 3EDEA 2P47B 3GJEB 5BW7C 2X4OA 5HGAA 2BVPA 5C07A 4XTRC 1Z9SA 2IADB 4JREB 1HQRA 3L5XL 4Q2ZA 4L3EE 4Q6IB 1GPOH 4K71B 2C3HA 4R8WL 3IDGB 4X80H 3QWOA 3S35X 1GGCL 2HFGL 4XP6H 2J8UF 2CGRH 1DANU 4PJ7B 2YEZB 2FHFA 1U2HA 4HIXH 4IRJB 3QUML 4X7SL 2CXGA 4J12A 1AXTH 4XNMA 4NKIL 1JNJA 2DQJL 1KIPB 5DA4A 5KSAD 1RD6A 2RHEA 3HUJA 1UM4H 2QHRL 5E2VH 4RNRB 4Y5XA 4XCYA 5HPMB 1DQDL 1LO5A 1HKLL 1RJZB 4OGXH 1RJLB 4U31A 3F58L 3KPTA 3TT1L 3QDJB 4JKPL 3NACL 3HG1D 3ZDXE 2P8MA 3CFCL 1AP2B 1CXLA 1K9TA 1MVFA 1ITCA 2J8UE 3DMMC 5DURD 5AYUH 4KXZH 5KW9H 1P7QD 3BZ4B 1ZGLP 5IFHH 3EGSA 4HXBL 2XIDA 1KYOK 5FGBA 4YUEL 4PJ5B 4QRUB 1N5YL 4RDQG 2C3XA 1B0WA 3BPCB 4IRJD 3MJ7A 1MEXH 3GM0A 4OLWH 2X1OA 5EOCJ 2X7LB 2EE9A 4QRPE 3I6KA 5DHYA 5J13B 2IPTL 4TULH 4XPAL 2IG2H 4HX1A 3WLBB 4UBDD 4G42B 2V5YA 3TWCH 1R24A 1QUNA 2E9WA 3L3HA 4KPHL 4D9LH 2MKWA 1RULH 2VERN 1F3JB 3W39A 1K2DB 1W2KT 4LPXA 2BSTB 5K33A 4F8QA 2YPVL 4PJ5D 1GAFL 1RK1B 43CAA 4GAJH 2YPLA 4C83B 1AE6L 4JFEB 3SKJL 4CU6A 2HRPH 4ODWB 4ZMAT 1HOCB 3MGTA 2HJLB 4X9GA 4I0PA 5C0FA 2PNDA 5F9DC 3U46B 4IS6B 1JTOA 2BNQE 4L4VE 5DJ2A 2K3TA 4ZUSA 1FZMA 5DQJB 3R06B 5I8CA 3TJHC 5F1IA 5EB9A 1GHFL 4UV4L 4KVCL 3MRJB 2GTWA 2R56L 4OF0A 3DIFA 3MNZB 5IW6B 3QUKB 1HHJB 3S3JA 5DXWA 5D9SA 4JFED 3JV6B 4JN1H 2OSLA 3X17A 4XXCC 2AKRA 2F54B 4OLXL 1ACYL 4KJWC 4J3OC 3MRGB 3TJEH 1FLRH 1VGKA 1L9MA 4D9RE 4XPFL 2B5IC 1UJ3C 1F42A 4PJIB 4WWID 1A2YA 4HH9B 3DX6A 4KZEL 1YY9C 4QHNB 4CMMB 5HHOB 4B5EA 5B38A 2G75A 2R1WB 1U8PA 1EGJA 1MCPH 3IKCA 3VFPA 1Q94B 3S5LA 4XGZA 5FA3A 5FYKL 1QO3B 3C09B 5D7KD 1NEZG 4ERSL 1G9ML 4FQQB 5INDA 1S7TA 4YXHH 1T04A 2WUCL 3Q6GH 1KIRB 4F7PB 1MCWW 5IB5B 1BD2B 4DOHB 1MVUA 1NBVL 3BWAB 1OSPH 2X5PA 3DURB 3NOIA 1RPQA 5EZIH 3IFPB 4OZIF 1FFQA 5JIKA 3VW3L 3BD5A 5D7IA 4D8PB 4H1LB 3RKDC 1FG9C 5E2JA 5T1LD 4QKXB 4KJQD 5C0IB 2VR4A 3NN8B 3EIFA 3IGAA 3MOBH 3VD3A 3VWJD 1O7VA 3VRJB 5C0DA 2JELH 4FXLA 5KSUB 1AGBB 2X4TA 1P4IL 3I6GB 3PDDA 4LDEB 1BQHA 4RMQA 5GRWA 2DIAA 4F2MB 1SJXA 5E6IB 1XZ0A 3IKKA 4Y5YA 5FYJH 4KROD 1JGVL 3NTCH 3OR7B 4MA7L 4R9HA 4X7CC 5ESVB 3WNLA 3VMNA 4G6KH 1J05B 4OZIE 4EI5B 1HHGA 2EE2A 2DQFB 1CFNB 4X0KA 5IFJA 4QTHA 3MXWH 4ZFZA 3P0YH 1CBVH 3E6HA 2DWDB 5E94B 4NP4H 2C7UB 2AW2A 2R1XA 4X6CB 1ZT4B 5BRZE 5KS9A 1U93A 1ZT1A 5KZCB 2HWZH 5D2NA 1IKFH 5H8DA 3REVA 2BRRH 3TZVC 2CRZA 4AEIH 4GQ9L 3BKJL 3WFBL 3SO5A 3VXRA 1QR1A 3GRWL 5JUEH 1YA5A 1DBML 5FUOL 4EI5D 5DD5L 4OCXH 3VFNA 5I74C 2H8PB 4PG9A 3VXUA 4ENED 2OS7A 4PTUA 1JGDA 4PLJD 3PF2A 1U42A 4TPRH 4OGYH 1RIUL 2AJYL 3CMGA 2XXMB 3OJDA 4Z76A 2E9BA 4H25B 2A6DB 3OHXB 5KZCD 4KTDH 4TVPL 2NY1B 1I8LC 4U7SA 4AJ0A 5D7JC 5C9KA 4KI1A 3HC3H 3P2TA 5C0ND 3ARFB 4M03A 4NO0B 3V6ZB 3MCKB 3S96B 4U1GB 3NIFE 7FABH 4YHNB 4GAGL 3W9DB 3QJFA 2BY3A 3K4ZA 4M7ZB 3QWRD 4YHPA 2P5ED 3GMLB 1FJ1A 4YHOL 5KJRH 2FECL 5E2UH 1X5IA 5TF0A 3WEXB 4OFYD 4G8GB 1RI8A 3HZYB 2NY1D 1GGYA 5C9JA 1ZHLA 2AJZB 4ZSOB 3MO1B 5A3ID 4H88H 1KJ2A 1KEGL 3ARFD 1T2XA 1ZHNA 4Z7NF 1MFAH 2ZOLA 1PGRB 3P11H 5HY9A 3LY6A 1QSFB 1WT5A 1CT8A 1RZIB 1C5DB 2HMIC 3BE1L 2XOTA 5T5FH 4BFGA 2ESVB 5DT1L 1TENA 4KMLB 4G6ML 2A6JB 1U2CA 4F9LA 3KHOA 3JVGC 2MFNA 4IRSB 2H41A 3WKNA 5IQ7H 3MYJA 4XVUC 2X09A 3VFVB 1U8NA 2OXHA 1Z0MA 4G8GD 2EDFA 4PJHA 3EJYD 3IRPX 3WFCL 4KZDL 4JM4H 2MNUA 4P2QE 4X4XB 3TESA 4TNVK 3UTZB 5GZOD 1DDHB 2K1MA 4XP5H 1RZJL 5BV7H 4V2BA 1CDHA 4UV7H 4Y7MA 2QQKL 1J8HE 3KPMA 3PP3K 4JB9H 3O6FA 4NZDA 1C7TA 4JQVC 2WBJC 3BEVB 3ZE1F 3CU7A 2XTJD 3ULUE 3L9RA 3MMEB 2ICEA 4LGPB 1OQXA 1T1ZA 2JCCF 1H3GA 4LSPL 3I85A 1BHGA 1NAKH 2HFEA 4JGJA 4FQJH 4Y19D 3DBXB 3LD8C 4HPYH 2R69H 5HYSA 3QQNA 1TVDA 5A2KH 5I8EB 2HKFH 3I3DA 1YNTA 4KUCF 3EHBD 1I8IB 4WCYL 4MVBC 2ADGB 1MJ8H 4L1DA 1CGUA 3QCVL 5IB4A 3ZE1E 4PIRF 1IGJA 2X1XR 4P9HC 4HS8H 1XCQB 1C12B 2UUDH 1N6QL 4LLVA 5IBLC 1YJDL 3O4OC 4GLRH 4PRBB 3EYOA 5DK0B 5TE6H 2JCCE 7CGTA 3GSNB 3MBEC 3PIQA 3EUUA 1CD1A 1I4FB 1T7WA 4U1NA 1GZQA 4U1LB 5I1HH 1T1XB 3FO1A 3RWHA 1ZTXH 3CFDB 5GXBB 5C0EA 3GJEA 4HWBA 5KOVC 4RISH 1LHZA 4UTBL 1UVQB 4JPIB 3BP6B 4TRPL 3OMZA 4Q6IA 1NLDL 3NGBC 2YD6A 4OBSA 5EUOF 3PGDB 1KCVL 5GGRB 3GIVB 1P5UA 4CN6A 1IC5H 1KC5L 2Y36L 4OCSL 1HNGA 1UKSA 3ZE0E 2Y07L 4BSJA 5KVEL 4D3CL 1MLCB 2YEZA 3HKFA 4UMGA 3ZT5A 4M5YH 3THML 3BQUC 1YQVL 4P23D 2NLJB 4JO4H 2HYMA 4IRJA 4I3GA 2Y4SA 3WLWC 3IJSA 3L3GA 3TNMB 1OM3H 2CKBB 1KIPA 2DM3A 4WTZG 4RNRA 5HPMA 5EC1B 2IALA 4LGSB 1RJZA 4J3VA 1EO8H 2ICWJ 1OARL 5EUOE 5JHLH 1S8DB 5I18H 1TFHA 4JPKH 5EU6B 1H9VA 3QDJA 5KSBF 3NCYS 1AP2A 1G7QB 3INUH 4XVTH 5JDSB 5DUPL 3BZ4A 1SMOA 2W60A 5CEZH 5I8KH 1NQBA 2AEQL 2FGWL 3FMGH 3PWVB 5J11C 3VGFA 1BZ7B 4PJ5A 4QRUA 4DVBB 3O2DL 1RMFL 4GXUN 2UZIL 3TBSB 2NY7L 3DX8B 4WWKA 3BPCA 1JRHL 3C5SA 5GGVL 2E27L 5ADPH 2X7LA 1UYWH 3MLWL 4ODSH 4X4YB 5E8OB 5J12B 3WLBA 4G42A 1QVOB 3D85B 2ZKHL 5KSBE 4QLRA 5D72L 4WFED 1EK3A 2V9QA 3C6LD 3QBTB 4DEPC 1F3JA 4WU7B 1K2DA 3MRPB 5CUSH 2R4RH 2YC1B 4DGVH 1R3IH 5D71H 4L4TA 4NM8H 4PJBF 5KSAC 3C8HA 4PBVC 4Y8AA 3PUCA 5LWYH 1RK1A 4LARL 4C83A 2EH8L 2AK1H 3GSXA 5I1AB 4ODWA 1HOCA 2AJXL 5F89B 2YD8A 3W11D 3U46A 4IS6A 2BNUB 1EAPA 3D85D 3NCFB 4M43L 1CCZA 4JG1H 4JKWA 5DQJA 3R06A 4KQ3L 4XMKH 1VCAA 1GH7A 4I3SL 3CDGB 5LGKA 1WFOA 1P1ZB 1VFUA 4PJBE 1YECL 2VZOA 3MRJA 1CGXA 2CR3A 4PV9B 5FDWB 3QUKA 4UBDC 1U8HB 1HHJA 1B6UA 2ZJSL 1MPAH 2NZ9D 2VDNL 2Z8VC 3LS5H 3JV6A 1PKQE 2E7LC 2ADFL 3KXFB 4HGMA 3AGVA 3S4SB 4DAGH 5FM4A 2F54A 4CDHA 5DF0A 4PBWD 5I30H 3DVIA 1TVBB 5IHZB 3MRGA 3HB3C 5EPMB 3V0WL 1JGLL 1CN4A 1L9NA 4TTDD 35C8H 1ZEAL 3LH2H 4PJIA 3S88H 4HH9A 4HFUL 1G7HB 3LN5B 3CK0H 5FOJA 2P5WD 2ID5A 2VXQH 1IZJA 1OP9A 4P2CG 4W81A 4CMMA 5HHOA 2Z93B 2IPKB 3EO9H 4MGXA 3MA9L 2R1WA 4BFIA 4G6JL 1YQ2A 4BQ8A 2B2XH 3TCXA 4LCWE 1PX3A 1PZ5A 3FFCE 1Q94A 4BQCA 2B4CL 4YDJB 1K3ZA 2PF6A 4JFFD 1QO3A 4M6NL 4NOBA 3WFZA 2UWEB 4P5TB 5EZJA 4FQQA 2HKHH 4FHBD 5EOQH 1KIRA 3V4VH 4F7PA 4XP1L 1BD2A 3TH3T 2E8YA 5I71C 3SJVB 3BWAA 3DURA 5MEOB 1GOFA 5T3XE 4P2RA 3IFPA 5CEYB 4NJAH 5IB1B 4D8PA 3RIFF 4H1LA 1LWRA 3J8F7 4YHLH 3SBWC 2PYED 3NN8A 3VXSB 3S7GA 1MIEH 5GRXG 5A16B 43C9B 3VRJA 2FBJL 3G6AB 2CLVB 3M8OL 1S9WB 5KSUA 1AGBA 3I6GA 4C4KO 3FZUD 4DN3L 1VKXB 2W0FA 2AEIT 2DYPD 4F2MA 4PJXA 4Y4KB 3QXWA 2CXKA 3I3BA 4FP8H 5E6IA 1WJ3A 3VGGA 1OAZL 3OR7A 1VB9A 4MYWB 3LEYL 2LFGA 5FF6B 4NPYA 4LLAA 5ESVA 3MACL 1J05A 1ZOXA 3B9KD 4FQIH 4NQED 2DQFA 1CFNA 4HEME 3FN0H 3QUMB 1DN2A 2DWDA 4RQQB 5E94A 1A1OB 1GL4B 2C7UA 5EBWB 3K3QA 3QHFH 5E6YA 3VXSD 3AS2A 2R0KL 4X6CA 2GIYA 4GKNB 1IQWL 4RGMC 5C09E 4KAQH 2JJUA 4DVRH 4LF3A 1DANT 1AJ7L 1OTUD 5C0AE 4KKCD 3IU4H 4WO4D 3MREA 1Z9LA 4Y4KD 2LABA 2ATKB 1PFCA 4M7LL 1UA6H 4Y1AE 4KJQC 5F1NB 2V7NB 4DFIA 3VWJC 1R3HB 5C0BE 3O4LB 1CLYL 4UT9L 2P7TB 4DKDC 2H8PA 1VESA 1WVZA 3JTSB 4RFOH 2PXYC 3ZHKA 1CU4L 4HQQH 4YWGL 4GW5A 3S3SA 5GGUB 1BVKB 1J0KA 1AXSB 2MJWA 4KROC 5CWSB 3OHXA 2A6DA 5E08L 2R0WH 1A9BB 4J2XA 1BBDH 3VXQA 5D1QA 5ILTL 1IGIH 2APTA 5F7YC 4XWGH 3A6BL 1Q9OB 4NO0A 4Z7QF 2MWCA 1CDYA 3V6ZA 3S96A 3LQZA 3NABH 1CICB 2IEPA 5LVEA 1I3GH 4ZUUB 4U6HB 4YHNA 3WIHL 3W9DA 3O4LD 2XQBL 5FOBB 2W9DH 3LIZH 2C1OB 5TDOB 4UIKL 3MCLL 1X5ZA 1WAAF 3GMLA 2DQCH 1LO0L 1YMHB 2OZ4L 5F72S 2P4AB 3WEXA 4Z7UF 4M7JL 2HJKB 4NQVB 2Q76B 2KPNA 2F53E 4G8GA 5GRYA 3HZYA 3U4BL 1X5JA 2YD7A 3MUHL 5D6DC 1U3HD 2AJZA 4CGTA 4ZSOA 5D7SH 5E8EB 1PEZA 3W5MA 3WV0A 4HT1L 3BIAX 2Q7YA 2ZNXA 4ENEC 4IMKC 2W9EH 4PLJC 3ULVE 3B9AA 1MY5A 2EDHA 1QSFA 3CLEH 5ALCL 1RZIA 1C5DA 3K74B 5M94B 4ESKA 2ESVA 4QRRB 1WAAE 1FFPB 3B5GA 3WXWH 2A6JA 3SQOH 4WEBH 4IRSA 4UDUB 2AV7B 1HCFX 5C0NC 4NZTH 9CGTA 3VFVA 1PEWA 2CMRH 3B4NA 4RZCB 4I18B 4G9FB 4YNYB 1FZJB 3TT3H 4LSTL 3ES6B 5C6PB 2HA1A 2VL4A 4X4XA 2F74B 5DMGD 4HK0B 2Q1EA 3UTZA 1M7DB 1DDHA 3Q48A 4FQXB 4LCYB 1S7XA 3T0VA 2XZAL 1G7IB 4QRRD 3DX7B 3N1GC 3O45A 3VRIB 4LCIL 4L9LB 2C3GA 3JV0A 2ZSVB 3NA9L 1MFBH 2PTVA 4GRWF 5A3IC 1MCEA 3N85H 3BEVA 2HVJA 3CGTA 3CX5K 3ARFC 4S1QH 3MMEA 1FYHB 2YHGA 1Z9MA 2IQAB 5FO8B 1UCTA 3DO3A 3T8XB 3CFBA 1MF2L 4TVSa 4HAGA 3GI8L 3C08L 3PP3H 2GJ6D 1V3MA 1H8SA 1U8MB 4MJ2A 5I6XB 5IF0B 4FQXD 3U1SL 2L7UA 1KJ2H 3BJLA 3D48R 5I8EA 4K3GA 4OQ1A 4KHTL 4UINH 3EJYC 5DD1L 4RX4D 2ADGA 1FG2B 3DX9B 4IMLA 4QRPD 1XCQA 1C12A 4RBPH 2Q86A 4MNQE 15C8H 2J8OA 5CGYD 5FYKD 1B0GB 4PJFE 4PRBA 5DK0A 4OI7A 2OMBA 2VLRE 3LOWA 3GSNA 3GHEH 1W0WB 4WGVB 4KGLA 2DQUH 2XA8H 1K4DB 1T1XA 2A2QT 3O3DB 3PE9A 4O9HL 5JOPE 4UILH 3CFDA 5I9QB 1JYWA 2KZWA 2BMKB 2DQGH 4F7MB 3TM6A 1UVQA 5BJTB 4JPIA 1KB9J 3BP6A 3L7EB 2IPUG 3CSGA 2MCPH 2XTJC 2YRZA 2NW3B 2QQLH 1RFDL 3PGDA 5GGRA 4ZOCA 3RAJH 3GIVA 5KANG 1EZVX 4P5MB 1A6TB 1QSVA 3IFNL 3PQYB 4UQ2B 5JHDB 3QG7L 3RGVD 2EIEA 3G6DL 4KRLB 1OLLA 1MLCA 4HMCA 1HHKB 1JTPA 3L3IB 2NLJA 2FLBT 4EDWL 4HD9A 3VGBA 4BSWB 3EHBC 5B39G 4FQLH 2CKBA 3TNMA 4YQXH 3VFTB 5FCUL 3IAQA 4PGBB 5KTEL 4KKBD 3LQMA 3GSOB 5EC1A 2KBGA 3MV01 5HVHC 4XAKE 1NCUA 3QQ4A 3UC0L 4OFDA 4E5XB 4PJ8B 1L6ZA 1MJ7L 1ED3B 1U6AL 4JG0L 5EU6A 4Q6YA 4P2YA 1WV7T 1CGVA 5HGGS 1G7QA 5E95B 5JDSA 5JHDD 4J3TA 3PWVA 1NPUA 4LL9A 4YHML 1BZ7A 8CGTA 5HBBA 4F58H 5I15L 3EYSL 1C16A 1L7IH 3TBSA 3DX8A 4ZFFB 4S1RH 1JPFB 4GRMB 1BOGB 2DJSA 1Q9WB 4JFDB 4N8PA 3RWJB 1OAYH 4I3RH 5DC0A 4Z6AT 1JWMB 4X4YA 5E8OA 2DBJA 1RZFH 1ADQL 1QVOA 1WZ1L 4O5LH 4TUKL 4UNVA 4PJ8D 3U7WL 3DVFA 4MXVE 4WU7A 4P23C 2NCMA 4TVPD 3MRPA 4MD4B 1FSKC 2BFVL 5TDNB 1F4AA 4J8RB 1OAKH 3HC4L 2FO4B 1DBJL 2VXUL 3LKQB 3HMWL 5B3JF 4S11A 4HF5L 3MLTB 4R2GD 3IF1B 5I1AA 1HXYA 4X4MA 2CKNA 4OD1H 3UTPE 2DS4A 4JFDD 3VG9B 4KTYA 4QXGH 5I1EH 3FB7B 2BNUA 3BESR 1RVFH 5J4MA 1FVCA 1S7RB 1XF3B 1R3KB 5F44A 5J57B 3CDGA 1P1ZA 2X40A 1D5BB 4K7PX 1T3FB 4PJAF 4PG2C 5FDWA 4DN4H 4UTAL 3V6BR 4LEXH 1U8HA 4JFYB 4KVNL 1JZ8A 3BDBA 3C6LC 1INEL 3WDHA 3KXFA 4Z5RB 2DM4A 3S4SA 1OP3K 5DEZA 1T89A 5FHBL 5IHZA 1JF1A 1TVBA 3V0AC 1NGXB 2BHUA 3PWPA 5BRZD 1RAMA 3A6OA 1C5CL 5DI8A 1ZHBB 5I75C 3U9UB 4HC1L 3SE8L 2EYSB 1FH5L 1YEDB 1G7HA 3LN5A 2BX5A 3W11C 5I1IH 5ID0B 2AJVL 2V2WB 5L8JB 3BP7B 1AGEB 2IMMA 4X9FA 2Z93A 2IPKA 1MY7A 2JF1A 3IFLL 4C56B 1A6WH 1QRKA 4YDVB 4JFOB 3LEXB 5JZ7C 4PY7B 4GG6F 4POUB 4YDJA 2UWEA 3HFML 2C4XA 4P5TA 2FYYA 3QFJB 3RP1A 1OAQH 4JM2F 5HGHB 4KRPD 3SJVA 3QNZA 3IETB 2EC9U 5CEYA 2XACC 3E2HB 1TVHB 5IB1A 1IAII 1G0YR 5GRVK 1QRNB 3OGOE 3FRPG 4K94L 4NN5C 3VXSA 3MV8E 5A16A 43C9A 4JO3L 3G6AA 2CLVA 3LS4L 4RWHA 1S9WA 1UB5B 4KK8D 5ECJE 4C56D 2AP2A 1VKXA 5L2KD 1G1CA 3DV6B 4TTDC 3WIIH 5HTSA 1FV1B 3WN5B 4Y4KA 3V52L 1YUHB 1IMHC 3X3FH 3O6LH 1F4XH 5FF6A 1U3ZA 2WUBL 4LCCB 1QBBA 5CIPB 1G9NL 4X6BB 4YC2B 3RNQB 3QUMA 2EDBA 1Q0XH 3RUGB 4RQQA 4UOW0 1A1OA 5EBWA 2EDNA 3Q1SH 1QRND 1MNUL 4PYHA 4XNUL 4UNTA 3QEQE 1UZ6F 1C1EL 3KYOB 1KNOB 2XZZA 2GK0B 3WE6B 2PR4L 4WV1C 3QUZB 1Y6NR 3ARBB 5DR5L 3QCUH 2ATKA 4HV8B 1NBYB 1AHWC 4AL8L 1JZ4A 3BOVA 4M6AA 4JRYB 3AAZB 5A2LH 4PJCB 1S9VB 1UC6A 4APQB 1R3HA 1FNLA 3O4LA 4U6VH 5A2IH 1A7NL 2P7TA 5JA8B 3LAFA 3QWQB 2NR6D 4HIIB 3JTSA 1D9KD 2RFXA 5JIIA 3HR6A 5GGUA 1BVKA 1UZ6E 4XXCA 1AXSA 3OPZH 4TOYH 5CWSA 3MZGB 4FNLL 4PGZA 5IVZB 1A9BA 3UJIH 3B2UD 4GQPH 4DGIH 1DQLL 5IBUG 4OIAA 2OBGA 1HIMH 1J8HD 3O9WD 3WL9B 3B9KC 3ARBD 4PRNB 1X44A 3MUGB 1Q9OA 2UVFA 3TF7C 4PJ9A 4LIQH 4LLUB 4JRYD 2VLJE 1CICA 4N8CH 1WFNA 3ZKXB 1KGCE 5JXAH 4ZUUA 4NQCE 4U6HA 5E4IA 4APQD 5FOBA 5DUBB 2C1OA 1OD7A 5TDOA 4P4KD 4E42B 1YEEH 2AK4E 4C55A 5K9JH 2B1AH 1OTUC 4KKCC 3M17B 4WO4C 1YMHA 2Q7NA 2XRAH 3KPSB 2HP4A 2F8OA 3IFOA 5FGSA 1MWAL 2CR6A 2V17L 3X14B 2R4SH 3ZT6A 5I2IB 3C60D 2HJKA 4NQVA 4MAYB 1X6NA 1LE5B 4NHUB 3SN6N 3CCHB 2HT3D 4N0CD 4KC3B 3SGDH 5E8EA 3RWEA 3T2NL 5D7LE 3PGCB 1J0IA 4MJ5B 1B2WL 2W07A 5CKGA 4EI6B 3QAZC 5ELIA 2GHWB 4HWEH 1KJMB 2JIXA 3FTGB 1JWSB 4QRRA 3CXDH 1FFPA 3WCYA 3BHBB 3DUSB 1AD9B 4NBYB 2FX9H 3KPSD 2AV7A 4XMLH 5IHBA 4RZCA 4KMQA 4MAYD 3CVHA 4I18A 1I7RB 3UYOD 4G9FA 4YNYA 1FZJA 1X5KA 3K4AA 2A1WL 2IANB 3ES6A 1SQ2N 3O2VH 5MENB 4URTB 5SX4H 2XWBB 2NY4D 1M7DA 1KIUA 1XGYL 4FQXA 4LCYA 3TA3B 2DICA 2GUOB 1XGQB 2FEEL 5GRUH 3MSPA 5IESL 4JJHA 2D7NA 3R0MA 4XI5D 3DX7A 3VRIA 2DLFH 5KSVB 4L9LA 1U3HC 4ZS7L 2ZSVA 1VEMA 4Y2DB 5LGHL 3QRFM 4GXUM 4P2OD 3MV7A 5FO8A 2YA2A 4HPOH 5C8JB 3T8XA 5JMOC 1F90L 3K80A 3ZSTA 1N59B 3QQ3A 3IS1X 1U8MA 3C9NB 5IF0A 3TA3D 4DUVA 4M93B 4DGYH 4MHHG 4XBPB 5ACMA 4HXAH 5ISZB 3GJFB 4NNPL 3IVKB 5LG1A 2VXTL 1CLOH 2VQTA 5GIRB 5L8LB 5DHXB 1XFPA 1U3YA 3DX9A 5D2LF 4G8EB 5DMGC 4JDTL 3TO4C 3KHQA 1LEKB 3Q0HA 1B0GA 1KLUB 2AQ2A 5FDYA 5DMIH 3ALXA 4GW1A 3BW9B 4R4FL 3HE7D 1FPTH 1W0WA 1KBGL 4Q9QL 3TH2T 5BMFH 3O3DA 2APWA 4N8VB 4GBXD 2BMKA 1DTUA 4P3CH 5BJTA 3L7EA 2J4WH 1ZT7B 3VDAA 5FYJE 1JVKA 3MUJA 2CK2A 2NW3A 4E41E 4K3EH 1INDH 4P5MA 1A6TA 3PQYA 4M1GH 3KJ6H 4CKVX 4LOUD 5J3HD 3K2UL 3RL2B 1B6DA 3DI3B 1HHKA 3JWOH 1R5VB 4OZHF 5TQ2L 3L3IA 4ZUVA 3GRWA 1UH4A 4BSWA 3LRSB 5E8NB 1KLFA 2XKNB 4NKMB 4YGVB 3VFTA 4M7KL 5SWZD 3IDYB 4PGBA 1IBGH 3GSOA 4LRNL 3OJ2C 2CLRB 4E5XA 4PJ8A 1ED3A 1F8TL 3GI9H 3Q5OA 5A2JH 2P49B 5DLML 5F3BB 1JL8A 3BKMH 3EDDA 3QUYB 3WS6A 1KCSL 3ARTA 3ET9F 4OFPA 1J10A 1E4XI 3C8KB 2C4FT 1F2QA 1LVEA 3MYZA 4ZFFA 2YK1L 3QDME 5D1ZD 4GRMA 3TYGH 3OGCB 1J5OH 1BOGA 1CGYA 4NZJA 3IXTB 1TTFA 5SWSD 1I9IH 3GSNH 1Q9WA 3RWJA 3BH8B 3MZTA 4CAGA 1JWMA 3RGVC 1S5IL 2I5YH 5B4MD 3ZSSA 4FQPA 4JQVA 3LB6C 3SDYH 2EDDA 4NRXB 1FLTX 1N64H 1BFVL 4MD4A 3BMVA 5TDNA 4J8RA 4LCWD 3UTTB 3S97C 4NN6B 3FFCD 1P4BL 1QEWB 4YHKL 2FO4A 3PL6C 3LKQA 4MJIB 4Q9CA 3P30L 1R0AL 1T20B 3MLTA 5TQ0H 4JVPA 3IF1A 2OR9L 3DXAE 3ARDD 2A9MH 5DRZB 1NC2A 2V2XB 2ZSWB 2K9UA 2GI7A 3LKRA 1E4JA 4R26L 1RZ8B 5TH2B 3D18A 4Y4HD 4LQFL 1S7RA 1XF3A 1R3KA 2HLFD 5LCVH 2HH0H 1D5BA 1EBPA 4KUZL 1BECA 4K2UL 4NQUA 3ZYOA 1T3FA 1SEQL 3DWTA 1JWUA 3U83A 1OW0C 3BI9X 3OZ9L 1NMCC 2NX5B 3P9LB 3ZTJG 4JFYA 2N7AA 3QI9D 2VDPH 1VPOL 1QSEE 4Z5RA 2Q8AH 2AJUH 3GNML 4GAFB 4OLYL 2V2TA 3VFGH 4OTXL 4OCYL 2QQNH 3H2WA 3SDCB 4HUVB 2YWYA 2GEEA 4OUUB 1PVHA 4C59B 4YX2H 1AD0B 3ILPB 1VSCA 3QIWB 1ZHBA 5T1KB 5AZEL 4ODTH 3KLAB 4R2GC 3BRGC 3BQUA 2EYSA 1YEDA 3G6JF 4LK4A 1BWWA 2G9HB 4IM8A 1J12A 2DTML 5ID0A 1BZQK 1YPZF 3PV7A 3Q2CA 3BP7A 1AGEA 2X4NB 4NDMB 1V3JA 2QBWA 3NAAL 1U41A 1I9RH 2D9CA 2YXMA 3SGEI 4UT6H 4YDVA 4JFOA 4PY7A 3TVMD 1HYRC 5HYQB 5DQDH 5KN5B 1NBZB 2P44B 3C5ZC 3QFJA 3SDAB 1TZHB 5I1KL 3QIWD 5HGHA 2GSIA 4K23H 1FNEA 5T1KD 3G6JE 3IETA 4OM1L 2RCSL 4CVZB 2X4RB 1TVHA 1N26A 1AIFB 4UUJB 3N9GL 2ERJB 1YPZE 1QRNA 2W9LA 2O93L 4JVWA 3GSRB 1MI5B 3C6SB 1NGQH 3BDYH 4L4JA 5EOTB 1UB5A 5DQ9B 4DQOH 1SJEB 4NIKB 4BK4A 3DV6A 3S34H 3VD7A 1FV1A 1SVCP 2NY0B 4LLWB 3C2SA 4Z7UB 2ADIB 5GJTH 4LCCA 3SDAD 3UTOA 3UDWA 5CIPA 4I8DA 2F53D 4X6BA 1DVFB 4LSSL 2FJFB 3F7RA 3RNQA 2YZ1A 1IILE 5IBUB 3CNKA 3RUGA 2J3SA 3UPAA 4RFNC 5L6YH 2JB5H 4NQSB 3RVXC 1BIHA 4L8SB 2XWTB 3PWUB 3KYOA 1KNOA 1TJGL 2GK0A 1QFWI 2OJZH 3WE6A 3SO3B 4KRPC 1QLRB 3QUZA 3OAYH 4XP4H 3BZEB 4HV8A 2NY0D 1IKNC 2V5TA 3RZCC 3IDUA 1DSFH 1SYSA 4MLSA 1GGBL 2KZ1B 3AAZA 4OCRH 4PJCA 3HZKB 4APQA 4WFGD 3PDGA 2BY2A 2UYLB 4KK8C 4Y0GA 4RGNB 4HIIA 2A6KB 4HKJA 4K3JH 3MUZ1 3UX9B 5CEZE 5IVZA 2XA3A 3MV9E 2EDOA 3BD4A 4PJGA 1HWHB 3S35L 4ZNEA 1MFEL 3ULUL 2YMXL 3NFNB 3L5XH 4BH7A 4PRNA 4LLUA 4R8WH 3MUY1 3KJ4C 5KVDH 1NGYB 4YEEA 2HFGH 4X7TB 5DUBA 3BPOC 4YXLL 4E42A 4RGND 5IVXB 5GS0L 3O3EB 4PREB 5J1AB 4U1HB 3HUJF 1VADB 3WN5C 5ICXB 2ENSA 1HQ4A 2MHAB 3KPSA 1A6VL 4IOIB 2QHLA 3QUMH 4IEFB 4X7SH 2OTWA 5TFSL 3X14A 4U33A 3MGOB 5I2IA 1CDJA 2OI9B 1T1YA 2DQJH 4MAYA 4XCEB 3SGJA 1LE5A 4NHUA 4U3XA 1MCCA 3SE3C 4H0IA 1DQDH 1HKLH 5CBAB 1J1OH 5DFVD 2NR6C 3PGCA 1D9KC 1Q0YH 3F58H 1AQKH 3TT1H 2X4SB 4JKPH 4I2XE 2D2OA 3PHSA 1KJMA 1TTGA 1ZE3C 1CK0L 3B2UC 3HUJE 4JKLA 4YUEH 1JNHB 3O9WC 3BHBA 5F71A 4O00A 3DUSA 1M1SA 1AD9A 5FK9B 5JOPD 1N5YH 4WI5A 1I9EA 2AEPL 1IEAB 2MQCA 4JN2B 5HDLA 3VDBA 4P59L 4C4KT 5EO0B 1I7RA 1P9MC 2YUZA 4NFCA 1I8KB 1K4CB 2IANA 2IPTH 4QTIL 3H3PL 5MENA 4XPAH 2O5YL 3KNBB 4NN7C 2XWBA 4IIQC 4P4KC 3RVUC 2NY2B 4KPHH 3HMXL 4LPUA 3MBXL 5DK2A 1PJ9A 4NQXB 3KDMB 2GUOA 1XGQA 1JHTB 4WI7A 4WI6A 3C60C 3AC0A 4ZUTB 3P77B 1E4WL 5J6HB 1C8PA 2YPVH 2OJEB 5KSVA 5F96L 1H5BC 2HT3C 4Z95L 4Y2DA 4U1MB 4K9EC 1LEIB 1A02N 1AE6H 4KDTC 4ODXB 3SKJH 1I85C 1QHOA 3T3PF 3BSZL 2LU4A 3DLQR 5C8JA 3ZKXC 1JN6B 2QV2A 4UU9A 3KLDA 4WHTB 3UTSD 1HWGB 1HZHH 3REWA 3JTTA 5MEPB 2RAMA 2EDWA 2VLME 4HUNB 3C9NA 2YPLE 4XBPA 5DVOA 1DEDA 2DQHL 1EIBA 5ISZA 3GJFA 1GHFH 4UV4H 2BNRB 4KVCH 3IVKA 4H0GA 5DEGA 2R56H 1MCOL 5FM5M 3CXHJ 3PGFH 4QXUL 1SJVA 1EJOL 3N1MC 4G8EA 2NY4C 3DROA 4D2NA 1LEKA 1KLUA 4ODBD 1FBIL 1FNGB 1MHEB 2R2BB 3SCMB 3FONA 3BW9A 3DJ9A 4OLXH 2BOBB 4XI5C 1T0NB 4N8VA 1ORQB 2BJML 5GGQH 1KB5L 1WQVT 4KKNA 4PJDB 4L8DB 4XPFH 1ZT7A 1H15B 3ARED 5KVMC 2BNRD 4P2OC 4P46A 3E8UH 2BY1A 4HJ0D 4C54A 2IPUK 4Z77B 1NCWL 3UTPD 5D6DA 1MAJA 5IV2B 1R5VA 2Z91B 3TA3C 4JZJC 4YHYC 1T03L 1LDPH 3SCMD 1FDLL 4J7RA 3WNNA 5FYKH 5E8NA 3D2UB 1YN7B 4NKMA 5HVGB 5D7IF 4ERSH 4YGVA 3D69B 1FAIL 4PJAB 5HYFA 5HHMD 1QBLL 3MLYL 1TQCB 1F13A 3U30C 1A5FL 1NBVH 2OP4L 2CLRA 2PO6B 4ZXBB 3STBA 1ZAGA 4IJ3B 5F3BA 2MQ3A 3HE7C 3QUYA 3P4OB 3BAEL 5JW4Q 3L3OB 4Y5VB 4GBXC 3ZHDA 3C8KA 1D5ZB 3DYMA 3RBSA 2X1PA 2WINB 3OGCA 5F9JA 1JGVH 4WEUD 4FXKB 5IEHB 3WIHA 4LASL 3QP3A 3PP4L 4UAOC 4LOUC 3STZB 5DVMA 5KS9F 2OZ4A 1JYNA 4B7LA 2P46B 1MWAB 2UZYB 4MZ2A 1GRWA 5F9OL 4NRXA 1KCUH 2P24B 2ITCB 1FRGL 2J5LC 1XGRB 2CRIA 3UTTA 2BVTA 1QEWA 2XN9A 2YA1A 1D6VL 4TSCL 5T3XL 1SVZA 4MJIA 4V1DE 4ZUWB 1LP9B 4IOSD 2PKDA 3W0WE 1T20A 4F33B 3F8UB 2HLAB 4MDJB 4GQ9H 4GSDH 5CJOL 3BKJH 3WFBH 5ITBL 1I1AD 1KIQB 1RK0B 3ZTNL 2V2XA 2ZSWA 2NY6B 5FUOH 3LQAC 4L3EB 5DD5H 4NRYB 4OLZL 1KFAL 1RZ8A 2BDNL 3QB7C 3WSQL 1V7NL 5D1ZC 4HMEA 2AJYH 1SJHB 3DSFL 1TIUA 5CILL 1BFOB 3IDYC 1KB9K 4QGYA 4TVPH 4M48H 3R1GL 2NX5A 3P9LA 5B4MC 4CRPA 3N1FC 3MLUL 3B8SA 4JM2D 3V8CA 1ULVA 4PGJA 2QLVB 5IWLA 3VWKB 2G60L 2NY6D 4QOKB 3SDCA 4GAGH 4HUVA 4YDKL 4QY8B 5I19H 1EZVY 5FFLA 1EGJL 4OUUA 5C7XH 4AT6A 5L0QB 1AD0A 3B5HA 4LVOC 3ILPA 3QIWA 4YHOH 1SMAA 5T1KA 3KLAA 3EOTL 4NUJB 3ARDC 2G9HA 1LILA 3EYQD 2YBRB 5D93B 4GRLB 2X4NA 1T5WB 4NOFA 4NDMA 4ZOAA 1KEGH 2NY0C 1XCTB 4Y4HC 2HLFC 4OD2B 2DIBA 2ITDB 3VWKD 5I0ZA 1HNFA 1NC4B 5HYQA 1NANH 3BE1H 4QOKD 4KXZI 3ZYJA 4ZTOH 5KN5A 5DT1H 4W4NA 3BH9B 3SDAA 5BOZG 4PJHF 1IAMA 1TZHA 3QI9C 5LBSL 1WBYB 2B0SL 4CVZA 2X4RA 4JO2L 4QRTB 2I07B 5M7QA 1AIFA 1EHXA 3ECBA 3GSRA 5D5ME 1MI5A 3WFCH 4KZDH 5E8DH 3C6SA 5EOTA 1DJSA 2R23B 1S7WB 5DQ9A 4AK1A 1KGCD 1VERA 4NQCD 1SJEA 4OKVA 3HNSH 1KENL 4FZ8H 4L4VB 2AK4D 4U1KB 4LLWA 2CSPA 4PJHE 5JPMA 1OAXL 2ADIA 4PLKD 4N90E 3ZE2F 3R8BB 1FP5A 1MCJA 3SGKA 3WHE0 1DVFA 2FJFA 5DVLA 2YD4A 2J6EA 1E6JL 4NQSA 1YEHH 3TVMC 1PG7X 3HTLX 5T1MA 1RZKL 4L8SA 4LSPH 2XWTA 3PWUA 5CS7A 3D3VD 2VAAB 3KYNB 1QLRA 3BZEA 3VH8B 2NY5L 4FFYL 5LQBL 4O4YL 4WCYH 5HI4D 1N0XH 5GJSL 5IJKA 3QCVH 3T0EB 3HZKA 2X2YA 2UYLA 4PG2A 3TFKD 3ARSA 3KPOB 4JVUA 1YJDH 2A6KA 4M1CD 1IEHA 2LTQC 5D1XB 2P48B 1U8OB 1EEZB 1LE9B 5J1SC 1OAUH 4I5BA 5ESQB 4ODVL 1MQ8A 1N6VA 2P45B 3DRQB 3GBNL 3P4LA 4UTBH 4FTVB 3NFNA 4TRPH 4YO0A 5E5UB 1NLDH 1F58L 4AG4L 1T2QL 1KCVH 1CVRA 4BH8B 5HHNB 1KC5H 2Y36H 4OCSH 4X7TA 5IGXL 1LK3L 2Y07H 5E7BA 1OCWH 5DRNB 5IVXA 3O3EA 4D3CH 4PREA 5J1AA 5CIPH 4U1HA 3WO3B 1VADA 2AGJL 5D96B 3THMH 1MFCH 5D1XD 1YQVH 2MHAA 5IMKA 4HFWB 1T0MB 3MGOA 4Z0BL 3RWFB 4XCEA 3HG1E 1UCBL 4HK3J 4B53A 1OP5K 1JYVA 4F7TB 5CBAA 4FTVD 1OARH 4PJ7E 2VC2L 3P73A 2X4SA 4JFHD 2L0DA 5C0CB 3VMPA 4W6YB 5DUPH 1YDPB 2VL5B 3T4YB 4Y88A 2FGWH 4NC0B 1IFHL 4O2FB 1JNHA 3O2DH 4MZ3A 1RMFH 5FK9A 2UZIH 2NY7H 1OF2B 1JRHH 4JN2A 5GGVH 4DWHA 2E27H 3QDJE 4JFZL 3CD4A 5EO0A 5F6IC 3RBGA 3MLWH 3DECA 1ZSDB 1I8KA 1K4CA 3CSYB 4GS7B 1M05B 2EZ0D 4E41D 5LXGL 4LNVA 4CDGC 3KNBA 1SM3L 4PJ5E 2ZKHH 5BO1L 5D72H 3MLVL 2AABL 4HC1A 3U82B 2QTEA 3BJ91 4OZGB 3D39B 4QGTA 2XNAB 3BPLB 3KDMA 4NQXA 5C0CD 1JHTA 4OCLC 4GKZB 1EMTH 4ZUTA 2GFBB 3IYLW 5J6HA 3IRZA 5F6HJ 4BZ2L 4QHUB 4J4PD 1CD0A 1Z9OA 1F3DH 4U1MA 5DFVC 1LEIA 2EH8H 2R15A 2IH1B 2AJXH 1BJMA 3U0WL 5CEXB 5E00B 4UT7L 1JN6A 2FIKB 4WHTA 4KJPD 2Q3AA 3O81A 4M43H 3HI6L 4PRHA 4O51B 4TQEH 4PS4L 1G0DA 5HHPA 4KQ3H 5B38G 4JFEE 3AROA 5BVJB 3IXAB 1DL7L 1ERNA 2YUVA 1KXQE 1YECH 3S5LG 4HWBL 1QBML 3OR6B 5JIPA 4MAUH 3CSBA 4L8CB 1OTSD 1YYLH 5K93A 3ZKMD 2ZJSH 1JZ7A 2VR5A 4J3WA 1ONQB 3I6LD 3GM8A 3U2SB 4WU5B 5HDQH 5F7FA 4BYHA 4QXWA 3TN0D 3H0TB 3QH3B 1FNGA 1JGUL 2R2BA 3SCMA 4HS3B 1A6UL 2BOBA 4FFWD 1T0NA 4PJIF 1EO5A 5HYJB 2ZCKH 5EU4B 3V0WH 1JGLH 3VFUB 1ORQA 1QKZH 3IU3B 3P9MB 3UCRA 2VAJA 5JORB 3ME0A 5F7DB 5HVWA 4ZD3H 1HSAB 4CMHC 4PJDA 1SYVB 5ACLA 4XNZC 1H15A 1BQHG 1ZEAH 4JCMA 3KPRD 4POYA 4M00A 5IKCA 1MCSA 5DYOB 4HFUH 3D5OF 3AY4C 3T0BA 5D7KE 4XCCL 3VCLB 4JQIL 5JLZB 4X8XA 2K7PA 4OIIL 1OGTB 2YD3A 3MA9H 5IV2A 3SE4A 2Z91A 1MCRA 4G6JH 1N3NB 4P2QB 3D2UA 1YN7A 2Y5EA 4ONFL 5BQ7B 4W70A 2M1KA 1UZ8B 5EZOL 3NZHL 1T66D 5B8CB 4XP1H 5FB8B 1WFUA 2PO6A 2WK2A 4A2MA 5AG9A 4ZXBA 1MJUH 3NCEB 2AAVA 4K7FB 3P4OA 4D9QE 2NY3B 2FBJH 2PW2B 2Z8WC 3M8OH 5HYIA 3L3OA 4Y5VA 3TBYB 1XIWB 4YE4L 1JPST 1D5ZA 4DOHE 1M71B 2C5DC 1QTYT 4CVWA 2FD6H 4K94C 5DHVA 3DO7B 3AREC 4XBGB 2H1PL 1NAML 2G5BB 4FXKA 4JFQB 5IEHA 1AKJB 4OF3A 1OAZH 3LEYH 4HJ0C 4Y16B 3MACH 4X6CF 3STZA 4QEGA 4LFHD 1MWAA 4OF7A 4LIQE 2RB8A 3MRCB 3F7YB 2P24A 2ITCA 2R0KH 1XGRA 5EIIB 1IQWH 2DQEL 3HZMB 4ZUWA 1LP9A 1AJ7H 2XQYG 3NCJH 2NYYC 1RUKL 1QACA 2HLAA 1FNSL 1E4XH 4KJYB 4M7LH 1X7QB 1KIQA 2A77L 4X6CE 3RKPA 5IB2B 3NIDF 5EULV 5DJZB 5KOMC 4L3CA 5GS0D 4YIQB 4L3EA 1CLYH 3HI1A 4G6AC 4NRYA 1YEGL 2WWKO 4GLRI 1HKFA 1CU4H 1EERB 3TO4A 2CLZB 4YWGH 2ZWLT 4NWUL 4I77L 1YY8B 5CP3H 1T7ZA 1SJHA 1BFOA 5E08H 4PRIB 2C3VB 1KSRA 4FQHB 4X80L 1H3WM 1NJ9B 5ILTH 5ESAA 3BPNB 4XX1E 3A6BH 3WFDL 4EVNB 1TZIB 2PETA 2QADC 4N1EA 5TPWL 4ZTPL 3WIHH 5TJWK 3H9YA 4QY8A 2WSKA 3MQIA 2R1YA 3RWDA 4UIKH 3MCLH 5EZLB 5C70A 3BZFB 1LO0H 3JSSA 5E2WL 1OQOA 5E2VL 1I1AC 4M7JH 3F7VB 4HULB 2MOVA 4OGXL 1I8MB 3U4BH 2YBRA 5CAYB 12E8L 4GRLA 4PRID 4EEEA 3DYOA 1T5WA 2ARWA 1NDMB 4IRZL 1T83C 4KQ4L 1KJVB 4HT1H 5E1HB 4YK4C 2ITDA 3W9EB 2X4OB 1NC4A 5ALCH 5HGAB 2VSCA 5C07B 4G8GE 1KG0B 1KV3A 3HE6A 4Q2ZB 3HC0A 3ZL4H 3BH9A 2DD8H 4ZSOE 1EVUA 3WBDA 3MV9D 5HSFA 4JM2C 5HYSG 4QRTA 5IQ9B 2I07A 1Q9LB 1QSFE 5AYQA 4F15C 3A6CL 4D9LL 2ESVE 5AEAA 3GBLA 1QG3A 1S7WA 3IB4A 1KB5B 1E0OB 1RIHL 5EIVA 3UJJL 4D0CB 2HAZA 4L4VA 3K8KA 1QZ1A 2VN4A 3T77B 5C07D 2XZAH 4U1KA 4GAJL 4WTXA 1FCCA 4MNHB 1YEJL 3EYQC 3OKKB 3K2MC 5CHNB 4NUGL 2E7HA 1Q72L 2DAVA 3NA9H 2P8MB 3PL6A 4Y19E 3ARGC 5DVNA 1NUDA 3QDGB 1FFRA 1A7QL 3S36X 3FN3A 4LKXB 4RMUA 1MF2H 3LKOB 1GZPB 3C08H 3GI8H 3VG0L 2DQTL 2VAAA 4HK3N 4KKAD 3KYNA 4YPGA 3U1SH 1FIEA 2O26U 2DOCA 3VH8A 4HX1B 3FT3B 2QJDA 5DD1H 3I75B 5BOPA 3T0EA 5IR1A 2R29L 1GJIA 4FQ1L 4RAVB 1KTLB 3KPOA 5EU7E 2IH3B 1IT9H 3V6OA 1U8OA 3QA3B 5EBLB 5FCSH 5K59E 5E7FA 2OLDA 5TE4L 1LE9A 2VR9A 4O9HH 2RJMA 5ESQA 3DRQA 4FTVA 4KH2A 4OFKA 1QLFA 1RFDH 4G7VL 5E8PB 3MLPA 2JK5B 4ELME 3HPJB 5E0QA 4BH8A 3L5WB 5HHNA 3IFNH 3ZDZE 4PR5B 3G6DH 5DRNA 1LD9B 2JJTA 4XPTL 1EAJA 1T0MA 2VLMD 3UZQA 3Q6GL 3ARRA 2YPLD 1Q38A 5D9SB 3TH4T 4HLZH 5HI4C 5FCUH 3NFPB 2CIIA 1RIVH 1CFBA 5KTEH 4I0PD 3CX2A 3C5ZA 4F7TA 3TFKC 2M26A 3UC0H 1P5VA 2Z8RA 3ARYA 3MOBL 4JG0H 4GJTB 5C0CA 2R9HC 2PUQT 2XWJB 1EXUB 1YDPA 2D0FA 4A2LA 5J9PB 2VL5A 3T4YA 1OP5H 1A2YB 2Z92B 3D87B 4O2FA 4GAYB 5FYJL 1T21B 3DX6B 3IDNB 5I15H 3EYSH 2EECA