4HJJH

Structure reveals function of the dual variable domain immunoglobulin (dvd-ig) molecule
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
348
structure length
341
Chain Sequence
EVTLRESGPALVKPTQTLTLTCTFSGFSLSKSVMGVSWIRQPPGKALEWLAHIYWDDDKYYNPSLSARLTISKDTSKNQVVLTMTNMDPVDTATYYCARRGIRSAMDYWGQGTTVTVSSASTKGPEVQLVQSGTEVKKPGESLKISCKGSGYTVTSYWIGWVRQMPGKGLEWMGFIYPGDSETRYSPTFQGQVTISADKSFNTAFLQWSSLKASDTAMYYCARVGSGWYPYTFDIWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-18
publication title Structure reveals function of the dual variable domain immunoglobulin (DVD-Ig[TM]) molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 66
structure length 341
sequence length 348
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH01
3SQBA 1FIEA 4P2YA 5ID0A 1C1EH 2EH7L 3T77A 2A6KA 1NDMB 1HZHH 4TUOB 3KWWB 4KJYA 1JV5A 1YQVH 4H5SA 2Y07H 2DTML 4ZS7H 3UAJC 3I2CH 2M26A 4MSWB 4P23A 2Z91B 4LSVL 3TYGL 4MAYD 5A1AA 4KWUA 4GAYB 5IB4A 1I3RA 5DSCB 3SJVB 1Q1JL 3VFMA 2J5LC 2FGWH 4S1RL 1RUPL 3O4LB 4LF3A 1ADQL 2E7MA 5KSBE 4UUJB 1MFAH 4MJID 3A6OA 4WU5B 4BSVB 5GGUA 1HHKB 3S4SA 5FFLA 5HHPA 2EDXA 2P8LA 1FNGB 5CUSH 5GGVH 1AKJA 2P48B 4X98A 1MVUB 2HTLD 3HS0B 4JRXE 3MODL 4UAOC 3I75B 1A8JH 2DN7A 3HA0A 1I8MA 1KTLA 2AJSH 3BXNB 3MRDB 1M6OA 4KHTH 4AK1A 5I18L 1MUJA 1IGJA 5ID0B 4JG0L 4NUJA 3T77B 3DX9A 2AGJL 2A6KB 3AAZB 4R0LA 4NO3A 1CLOH 2UZYB 2CLZA 1ITBB 1QSFA 4XCFL 4YHZH 4ZTPL 4NQUA 4JZJA 4R97C 3GBLA 4FZEL 5IB4B 1I3RB 4P2RB 2D7MA 2YD9A 5DJCA 3SKMB 1IGYB 3VFMB 1RJLA 1AD9A 2XNAA 3L5IA 4HX1A 2I9LA 1A6PA 3SO5A 4FQHA 2DKMA 3DVNA 2B20A 1L7IL 5GGUB 2BHYA 3QAZB 3HNVL 2BJML 3D87B 4OUOA 4RIRA 2GI7A 3CDFA 5MENA 1YEGL 1Q94B 2NXZD 4L1DA 5F72S 2ZUXA 4X7TB 3V2AR 3ULUC 4X98B 3V5HA 4LCYA 3GHBH 4EI5B 4GRWF 1P7HL 1U3YA 4J6RH 4ZAKD 4MWFB 1KLUA 2ILLA 3QFDB 5JPMB 1I8MB 3REWA 5EOCJ 1NCDL 1MPAH 4OCRL 4I0PD 4XP9L 4EXPX 1KEGL 1C08B 4F80A 4G6JH 3I6KA 4XPGH 3FB7A 4NUJB 1Z5LA 4MQXD 3DX9B 2VKWA 1QA9B 5EFIA 4NO3B 2CDGA 5BW7C 5IWLC 2DOCA 4EKXA 1RK1B 1QSFB 4KUZH 4OUUA 5IM7B 1IBGL 5DWUL 3MLPA 1FFRA 4LMQE 3QH3A 3PABA 1NCCH 4G80A 5DJCB 1UWGL 1RJLB 3DX7A 5E56A 3RUGE 1AD9B 1NLBL 1C16B 1CFTA 2I9LB 4FQHB 3PHOA 1J1OH 5CIPA 1YMHA 4I0KA 5K9JL 5KSBF 4P4KA 1EEUA 5F97E 3KPSE 4RIRB 4RGNB 5MENB 3O11B 4X9FA 4N90E 1T0NA 3BZEB 3MRGA 4OQTH 3S36L 3OKEA 1ZANH 1QQDA 1BZ7A 2L4OA 5DUPL 3BP5B 2OR7A 3V5HB 5FOBA 5DHVA 5DD3H 5D5ME 2IPTH 2X4TA 2CKBH 3VA2C 4BQ6A 4DTGH 4NO5A 3REWB 5CILL 5D7JD 3VD4A 1MNUL 1CXKA 4YX2L 4G8GE 4JZOA 4PP1C 4KVCH 1FL6A 3WHE0 2WQRA 1F02I 2NY6C 4RBPH 4FA8A 1LHZA 5E94B 1WVZA 1MFEL 3QUKA 4P5TA 3OPZH 3E0GA 4S1DC 1WZ1H 1BD2A 4MX7B 1KF9B 4F7EB 3DX6A 3VI4E 4CU8A 1WC7A 3QH3B 3PABB 3WD5H 3WFEL 3FN3A 1LILA 5IVXF 1W0VA 4JRYD 3VFRA 5DT1H 3PDOB 4X6CE 3ARFB 1YMHB 5D1XB 5I75B 4CJ1A 1K3IA 3EYFB 5IB3A 2DBLL 1YUHA 1OAKH 3R06A 5EH1A 1T0NB 4ORGA 3MRGB 5I1EL 3S97C 2EO9A 1TNNA 1OAZH 2OL3A 4L8BA 3ETBF 2OI9B 3ARGC 1PBYA 4YQXH 3O3UN 3JZ7A 5IHLB 5JIKA 4LCIH 3TFKC 1G84A 1MFDL 4KKCD 4WFED 3SGKC 3ARSA 4MQSB 5E1AA 1ZS8A 2NXYD 4JZOB 5I71C 1FL6B 5MERB 2CK2A 3KLDA 5F7MC 1CICC 1XF5A 5JNYB 1WISA 1RIUH 3PWLA 4UB0H 2AJZB 4U1LA 1CFVL 3QUKB 1NC4D 1YYML 5KVGH 3NCCB 3O41B 1NFDE 3UMTA 4XRCB 2EEBA 1FFQA 3DX6B 3O2VH 1J86A 1WC7B 2A77L 4HEPG 1FVDB 4K7PY 1BFOA 2Y7QA 4FFZL 1BWWA 4PTTA 3L1OH 4EUPH 5BJTA 1W0VB 3VFRB 5DD0H 1F4HA 5JUEL 4F9LC 2PN5A 3NA4A 1V7NL 4TRPL 1REIA 15C8L 3RUGF 1YY9C 1DVFC 3H9HA 4OKVB 3ZT7A 1DN0B 1KCRH 1T5WA 1UJ3C 3A0OA 4F3FB 1LE9A 4UNVA 1VFAB 2IJ0C 3LPGA 2YKLL 1F11A 5IGXH 3R06B 3MA7B 4ORGB 3I6GA 5KTEH 1RZ8B 4CNIB 3EYOA 4KAQH 3AS2A 3ULSA 1AQDA 4J8RA 1IAKA 4Z7OE 4L8BB 1UACH 4FG6C 5IJKA 3P0VH 4DJMA 4CVWA 3T2NL 4PJGE 2F19L 2KZ1B 3TJEH 3BEWA 3SJVD 3WL9A 2XZCL 5HHOA 3O4LD 1WFUA 5E1AB 2CXKA 1CQKA 2PXYA 5DA4A 1SBSL 3C6SB 1NUDA 2YUWA 5TQ0H 4LLYA 1J9CT 1RK0A 2D7QA 3ROOA 1KJ3H 1FC2D 1XGYL 2A6DB 1D5IH 4BFEA 2VZVA 3QXAA 1NL0L 2XZZA 4GXUN 5FYLE 1TJIL 1ZTXH 3VI4F 5BJTB 3BEVA 3MX0A 2Z92A 2DQCL 1L0QA 3TNNA 1BWMA 1CGSL 4H1LB 2ITDA 5ADPL 3D85D 2B7DT 5K33A 3HNTL 1SBBA 1MHEB 4X6CF 1P1ZB 1TTGA 1IC7L 2ERJB 5GGSA 1RZKC 3BGFC 5EWIL 2P8MB 3EYOB 2I24N 1XFPA 4Y5YA 4EN3A 4J8RB 5CINH 1IAKB 4R6UA 2K7QA 1J5OH 2XN9A 1E4XH 4ZO9A 4QRRA 3IKCA 2NY0C 4P2RD 5I66A 4PJHB 4LHUD 3RVWD 3WL9B 5JMRA 4W70A 5HHOB 4ZXBA 1JPSL 2APWA 3Q3GA 2OK0L 2FHFA 3I6LE 3OHXB 5EO1A 2F74A 2WP3T 2LAGB 4GKSA 2AQ2A 4LPUA 1XIWA 4PV9A 4P5MB 3WO3B 4LLWA 2FIKB 1AIFA 4LLYB 3RY5A 4K07A 3VFGL 1JWSA 4NQSA 1NFDF 3QXAB 3KS0J 2QQKH 3B5HA 4W4OA 3ZYJA 4OF0A 2WINA 3IF1A 4BH8A 5A3ID 3BEVB 1MQKH 3C5ZC 3GJEB 4UI2A 4EI5D 1EZVY 4NIKB 4ERSH 1C5BL 4HKXA 4JFOA 3TNNB 4FABL 5JIPA 2UYLB 2ITDB 1ADQA 4RSVA 4RWYH 2VXQL 3QHZL 1KOAA 2OXHA 3QI9A 5CKGA 4I18A 5GGSB 3SPVB 3SE8L 4NZDA 3P77A 1YDPB 4YHMH 3MLWH 1MCQA 2X4SB 1X4XA 3VMOA 4OM0L 4Y5YB 1NFIB 3BKCH 3VJ6A 4QRRB 3MUHL 3FJTA 1PEWA 2Z0BA 5IFAH 1XGTB 4XP6L 5I8OL 4JM2D 1JYNA 4JFQB 4Q9QH 3RJDA 5SWSA 3FOMA 1S5HA 3VE0A 1RZFL 4PJGF 5C0AB 4NN5C 3LH2H 3MRRA 4K7PL 3UBXI 3WMSA 1I7TA 5FYKH 1F4YH 4LSUH 1INEL 1KB5L 1XIWB 5C3LD 2W59A 4RGND 2XPGB 5MEND 4HJ0D 5D8JH 4OCWH 5E6IC 4C83A 3V0VA 5J1AB 3VD5A 3W2DH 5E2TH 1J1PL 2BNRE 2PETA 1MRFH 4O2CA 1XAUA 1SQ2N 4LSTL 3Q1SL 4Z8FL 1FGNH 4HKXB 4JFOB 5E8DH 4CVXA 5K9KB 1DUZA 2D4FA 2DIAA 4HFWA 1A2YB 4NZUL 4XP4L 5HY9A 1AE6H 1S7TA 3GM8A 4HEME 1CN4A 2HG5B 3QYCA 4I18B 5DEGB 1W72A 4XX1E 1MAMH 2EKSB 2W38A 3ULVH 1XR8A 3LN4A 5E9DA 1LDSA 5JHLL 3T04D 3L5JA 4J23A 1AHWC 2FL5B 3CMGA 3P0GB 1D9KC 1VADA 1ORSA 3MBEC 4X6BA 1MFNA 3C87A 4OCNC 3O6FC 5SWSB 2IALA 3VE0B 4F58H 3MRRB 1I7TB 5BRZB 4WI9A 1AXSA 5L2KA 3ARFD 4G6ML 5D1XD 5MP6L 4F8TA 1AQKL 1X6LA 3W0WE 3MACH 3QNYA 2G9HA 3H42H 3OJDA 4C83B 2HLFC 1DQDH 2A74A 5I15H 5SV4A 1S3KH 4Y19E 43CAB 2HT3D 5TF1H 4X5WB 5C0IA 3H0TB 4O2CB 4JO1L 1AI1L 5CJ8A 4P9HC 4WFGD 3OKMA 5K9OA 4GBXA 5I1IH 3QUMA 1CGXA 4UILH 1LO0H 4HFWB 4OLVH 4HPOL 1S7TB 3OXRB 3IVKB 3U4AA 4WTWA 4MNGE 1EHXA 2A83B 4RISL 3NIFE 1FO0L 3QUZC 2YMXH 1WFTA 4U1IA 4APQC 4RFEA 4HH9A 4IJ3B 2X89D 1ZHKA 1X3DA 4JDVA 2G5RA 1VADB 1ORSB 1DQTA 1A5FL 1QLRA 1A6WL 2IALB 2HH0L 5FGCE 5IK3B 4IRJA 3P4NA 3PGCA 3EOYG 2JB5L 5HPMA 2C3WA 1RHHB 3UJTH 3OJDB 1YNLH 4MQ7A 2F53A 1ZLWH 4K2UH 4OF6A 1OP3H 2A74B 1PKQA 4XBGA 5T3ZD 1T1XA 4KMTL 5EPMA 5D7IE 5D1QB 4HHAA 5C0FA 5DXWA 3S35L 4K8RD 2FB4L 5K9OB 3KPQA 1I85A 2BX5A 2J8UF 5DRZA 1FLRL 5E7BA 1KXQE 4DQOL 4YHOL 4WENB 2DD8L 3G6JB 1ZLUK 1I8LA 1L6ZA 1NLDH 3QUYC 2CR6A 4QYOA 2VL5A 4OLXL 3TT3L 4U1IB 4I48A 3BZ4B 3TP4A 1ZHKB 2VN7A 1OM3H 1KPRA 2FIRT 3R0MA 4JEGB 3OR7B 5EBMA 1QLRB 5CJOL 4RRPA 3WHXA 2XG5A 2IPUK 4LEXH 4IRJB 3R0NA 3T1FA 4HJJH 5D96C 5CGMA 3D0VB 5DZNA 1DBBH 4K94C 5DQ9B 5FYLL 1FRGH 1F4WL 1LEIA 4MQ7B 2F53B 5LBSL 3T0EE 4G6AC 1OY3B 5B38G 3TWCL 4JM4H 1PKQB 5EPMB 3TZVC 3MUJA 5EN2B 3QO1A 1Y0LB 5C0FB 1RD6A 4JDTL 1UVQA 3V5DB 2XI9A 4QHLA 3H3BC 4ETYA 3TBTA 5DRZB 1S7XA 1JHLH 4PJIA 5HHOD 4O9HL 1RZIA 3EJYC 3JVGA 3ILPA 2X44D 5DEZA 3LRGA 1BBDH 2QTEA 3EO0A 4YDKL 4QYOB 4LPXA 2BXYA 2VL5B 4KKAC 5DTFA 3BQUA 4XMPL 4NNYA 4HFUH 1YEKH 1ZT4B 3RIAF 4M93B 3NIFF 4JFYA 4XWOC 5F8QC 5INDA 1DSFH 1IGFH 4XNXH 2Q7YB 5EIQA 4J3XA 1KGCD 3EDJA 4PYHA 32C2A 1SEQL 4TTDC 1JGVL 5HDQL 5JW4Q 5I74C 4B7LA 1HHGB 2F5BH 4P59H 1HINH 2O5YH 4F9PC 1KCUH 3AY4C 4Y5VC 4TQEL 1XGQB 5L0QB 2YD2A 1YEEL 4LK4A 5GZOC 4CU7A 4YR6A 3PL6C 1WWCA 4DEPB 4K3EH 4ZQKB 4ZO6A 2A9MH 4WEBL 3QDGE 5I1CL 4QRRD 3D3VE 5D7IF 3CSYA 3TBTB 3CLFL 35C8H 3GRWH 1BAFH 2OJZL 1X5XA 3UPRB 4X80H 4XC3H 1TVDA 4JFPB 4HZLA 3DMMC 5HHQA 5C0AD 4QRTB 1P9MC 3U9UA 3JWDL 3EO0B 5C1MB 4R4BB 3OX8A 2R15A 5J6HA 1B4JL 4GRWB 2PO6C 1Y6MR 2IQ9L 3BQUB 1WV7T 3GB7A 1XIWD 5A16B 2VDLL 1H8NA 2ORBL 1JP5A 1YNTB 4HC1H 3WE6A 5JOPE 3K1DA 4JFYB 5ETUB 5INDB 4FNLH 3RY6C 3A6CL 3CFCH 4D0DA 1MCNA 3ZKXB 1BQHG 5TDPA 3WFDL 1KFAH 2EICA 4G5ZL 2GJ6E 4WFFE 4BKLB 4XNZC 3NGBC 1IT9H 3GSUB 1JZ5A 1OB1A 2VL4A 1D5BB 5TFSL 4ZFOL 5FYJE 1UH3A 2C3XA 3CZJA 3M1BA 5KSBB 3NFNB 3IFNL 4DUXA 4LLDA 4G6KH 1DBML 4HAGA 4NUGH 4Y2DC 3LQZA 4Y4FB 1DANU 3HZMA 5SWSD 2ZSWB 4XXDA 5HHQB 2L7JA 4QHMB 4XCEA 3U9UB 4HBCH 3WXWH 5BRZD 5J6HB 3CXDL 3U7WL 3TV3H 3VGFA 3PJSA 3KHQA 3LPWA 3X11B 3LMJH 4QRQB 5SX5K 4JRXB 3SCMA 3QIUA 3WE6B 4P23C 2HFGH 4NQEE 1PYWA 3DYMA 3KYMA 3D39E 2ZJSL 4G9DB 4ONOA 1S7RA 1CLZH 4GMTL 4LLVA 2H45A 4LP5A 5LG1A 2VXSL 3CDYA 4Z76A 5D2NA 1U8JA 2VR4A 5DC0A 4BZ2H 4M6OH 1S7QB 5F9DC 1NCAL 2FO4B 3MLTA 1BJ1H 3EW3B 1X44A 4OM1L 4UDUA 5HHNA 5E2UH 3RGVC 3M1BB 5GRWA 3O8XA 4LLDB 4Z0BL 1FZJA 4Q9RH 4YH6A 2AW2A 3LQZB 3DUHA 4NYLA 4OI9A 3AB0B 3W9DB 2JK5B 3FKUS 2W0FB 3AREA 3RAJH 1A9EA 5HVFB 5A2LH 3E2HC 3IFLH 3KPSA 4LPVA 4OZFG 4XXDB 1S7UB 4GQPH 1ZMYA 1WIUA 4S0TD 2P43B 5HDLA 3V6ZB 3U9PH 4R0LC 1UZ8B 4WCYL 5D5MA 3PWUB 3WN5A 1BZQK 3SCMB 1BJMA 1LO4H 3QIUB 1KPUA 4JZJC 5JA8B 3NIDE 5J7CC 3HUJA 4S1SH 1NMBL 5D1QD 5FUOL 5JDJA 2QQNH 2ITCA 1N0LA 5DD5H 3TN0B 4G8GA 1S7RB 2LU3A 2AV1A 4X4ME 1DLHA 1FE8H 2VDRH 2VAJA 3TO4A 3VG0L 12E8H 4Y1AE 2R1XA 2Y6SD 4M43H 4D9LH 4IRZL 5HHXH 2G5BB 5IB1A 5CSZA 2LTQC 1LO2H 1KB5B 1BHGA 4LCUA 1ZA6A 1AJ7L 1KIUA 1YPZE 3QHFH 1GGYA 3RUGB 5L9DH 4HWUA 4ZUUA 3BMVA 2PW1A 3O8XB 4TSCL 5E5RB 3KJ4B 2NCMA 3NFSH 4NYLB 3AREB 4HUKB 4KMLB 1XF3A 3KPSB 4LCCA 4KJQD 5C6TL 5F9AC 5KW9L 1E6OH 4JFEE 2ZUYA 1T1WA 4IRJD 1IC1A 4MYWB 3GSXA 4HWZA 2CUIA 3H7LA 3B9AA 5D5MB 1U8QB 3NOIA 4QWWD 2F53D 3ZYOA 1KPUB 5C0NC 2W9DH 1CXLA 4ODXB 4V1DA 1ETZA 3SQOH 3RVTC 3SOBH 2RBLA 3DETC 1F45A 3OKNA 3BRFA 3HN3A 1DCLA 4PPTA 4UV4L 4YK4C 5GJTH 3D25A 1SJXA 4G8GB 5ERWA 1CWVA 3RZCA 4JY6B 4WHCA 2AV1B 5HYEA 5DC9B 1OD7A 4W6XB 4P4KC 1T0MA 4OCXH 5GHWH 1HKLH 1ZLVH 5FUZL 2R1XB 4KKLC 4OT1H 5HI4C 2FX9H 3OKOA 4K3GA 1CFQA 3TIEA 4G7YL 1H15A 5CSZB 1AXIB 5T5FL 2Q7NA 2DDQH 3BP4A 3PWNA 1D5XB 4Y5XC 4N5UA 1L6XA 3MV9A 4ZNEE 2PW1B 1T7YA 3MBXL 1Z9OA 4X6CB 3M45A 1GZPA 4XZUA 1X9QA 2DQJL 3UC0H 3F58L 4JO4H 4QXUH 3JV6A 4HS6A 1IKFL 5IF0A 1EGJH 3U36A 1T1WB 5TPWL 2X9YA 5CZXD 3GSXB 4XVTH 4NC1C 3X13B 4P5TC 2V9QA 4MB3A 4YJZL 4I2XA 1FV1B 1N7MH 4ZFZB 3DGCR 1ETZB 1FO0B 4LFHG 3T3ME 3OKNB 4OBRA 2P8PA 3KR3L 3CU1A 3NIDF 4MA8L 4ONGL 3D25B 4NKOB 5ERWB 3RZCB 4L8SB 3O9WA 5LCVH 4YHPA 4QXTB 3SDCA 2DQTH 1NFDB 4J1UB 4Y4KA 1N2RA 2E7HA 1H15B 3VRIB 1IQWL 3ESUF 3UZEA 1QSEA 3PWNB 4U1KB 3RFZC 1CBVL 5MEQB 2ZOLB 3RVUD 2WUBH 4TOYL 5IT2L 4PJAE 4JCLA 5TDNB 1DLFH 3VFOA 3BPLB 3ZTNL 1GZPB 1OSPH 2AJVH 2Y06H 4AMKL 1S9YA 2FBJH 2E9IA 1UXWB 5F6IB 2IBGA 3VWKA 4HXAH 1EMTH 2I5YH 3GKWH 3LB6C 5F93C 3U36B 1KLFA 5D72H 5FECB 4S11A 1NBVH 3SDAA 2B2XH 1G6RL 3FO9A 5JORB 5C0CE 1SYVA 1KEMH 1DBKL 1G9NH 5HYQB 1IM3A 3WFHA 5I0ZA 2IFFH 4PJGB 4MJ6A 3BO8A 1CDIA 1BZ9B 2P8PB 1KNOB 3O9WB 4Y4FD 3HNSL 5FYJL 2ATPB 3SDCB 2AJUH 2WANA 2MFNA 2HRPL 3L3HB 3VXNB 3B9EA 4RGOL 2YXFA 5ALCL 3K2MC 2X4NA 4U3XA 5CWSA 3RVXD 4Z5RA 1QSEB 5B39G 3U4BH 5IJKC 4GAJL 4JRXD 4LVEA 4E42B 1KJMA 5SX4I 1PW3A 4FZ8L 3OB0H 5EU3B 2BHUA 1S9YB 3ARYA 2VLKA 1I7RA 3SE9L 3VWKB 4K71B 6FABH 1I3GH 1A22B 3OAYK 2PXYC 1WFNA 4YDLB 3FFDA 5I1DB 1CDCA 2J6EL 3FO9B 3DV4B 4M3JA 4PUBH 5IW6A 3OF6D 1QUNA 5GRUH 1N6QL 5EZLB 1I8IA 2OTWB 1GHFH 4OLZH 1IM3B 4FXKA 3WFHB 4ELMF 3L7EA 2VLJE 1WK0A 4HGMA 4MJ6B 1U2CA 2DI8A 5DMIH 3T3MF 4NOBA 4XCNA 5JOEA 4L8CB 5GRJH 5HJ3A 1G7PA 1B0GA 1ZK9A 3LS5H 1JN6B 4XBEH 1QVOA 2E7LA 5F6HI 4HGWA 2AP2A 5CWSB 2BNRA 4Z5RB 1I7ZB 3HPLB 5HGBB 4EN3C 3QEUB 4OTXL 4ZFOA 1NAMA 3SCMD 4NKQB 3QIUD 2B4CL 5A2FA 3GIZL 4LLMA 1YNKL 1MCOH 5JMOC 1VACA 3B5GA 4X8JA 3EGSB 3FT2B 3PDDA 4PJAF 3T3PF 2AEIT 4ZXBC 1RUMH 2VLKB 3EHBD 5T5NF 3TN0D 4XMLL 3QRGL 2AI0H 3JUZA 4M7JL 3TBYB 4P3CH 4PJ5E 4P46A 1R3KA 4GKNA 1G9ML 1LK3H 2E8ZA 3NTCL 1H3PL 4M6AA 5IW6B 4XVUC 2LAAA 1RSFA 4X9GA 3RNQA 3DI2B 3LKOA 4FXKB 3EYSH 1FBIH 4PBXA 4RZCA 1RMFH 4W4OC 4FQIH 4CGTA 5H35A 3O8XD 1FFPB 4P9MH 5I1GL 2VB5A 4ODVL 4XCNB 5IESL 3TCXA 3R1GH 3ARED 4M1GH 5DMKA 3KPSD 1BEYH 1B0GB 4L9LA 4HCRL 3QI9C 4Z95L 4N90D 4MD0A 3OXSA 1AY1H 4HGWB 4QHKI 5F9JA 4I77H 2BNRB 4WDIB 3CVHH 4Y19A 4ELKB 4NJAL 3LIZH 4ZFOB 2VKXA 3MGAA 1SM3L 2CK0H 1HN1A 1EHAA 3BP6A 4JFDE 1FYTA 1VACB 2OZ4H 4X8JB 2JIXD 5I1JL 1CDBA 3CK0L 5T3ZH 3OJ2C 3WFZA 3MLSL 4G8GD 3QZWA 2XTLA 4MNGA 4MNHB 1FNSL 5TE4L 4P46B 1R3KB 3FONB 4K8RH 1KT2B 1PGRB 4GKNB 3VXOA 1TJGH 1CL7L 3EO1A 5DEFA 3QQ3A 3WNLA 3LKOB 4Q9CA 5SV3A 3VFVA 1A3RL 4QLRA 1H5BA 2BVOA 3QHTC 5ALBL 4OZIA 5H35B 1EFXB 2BOBB 2F5AH 4P0DA 3AS3A 4D0CB 3CFEA 4JO2H 3NA9L 5EG6C 4NKIH 1RVFL 4QRSA 3W0WB 1KIRA 1OQXA 3HCVA 5KN5A 1BJ8A 2VE6B 3HZKA 5F9JB 2VZOA 1T20A 4Y19B 1MIEH 4H1LH 1TZIB 6CGTA 3RWEA 4M62H 3GSQB 4WW2A 1TDQA 4RMUA 2HFFB 4PRDA 1JGUL 3HHRB 3Q6GL 3NIGE 5FV1L 4L29A 1F4XH 1QFWL 3RZCD 3QZWB 5EOCL 1P6AB 4MNGB 4GKZA 4NT6A 4UV7H 1UB6B 1U8PB 2IAMC 4IM8A 1A3LL 5DEFB 1MJ7L 1EXUB 2NY1C 1KENH 2R2HA 4PJDE 4LQFH 1BVZA 2X1QA 1I3UA 1T7XA 5F7UA 1FHGA 3VFVB 1UXSA 4JB9L 1H5BB 2WUCL 4Z7UA 2V5MA 2Y9RT 4Z9KB 2OMNA 4GG6A 4DUVA 4UOW0 1OAQL 4GBXC 5FGCB 3HMXL 1EFQA 3WJLA 4QXGL 3WFBH 3ZE0F 4QTIH 4CRPA 4QRSB 4F7MA 1S5IL 3SY0A 4NFBA 1NGQL 3ZKND 1KIRB 4HAFA 3HCVB 3QUXB 5GXBB 3T0EA 4OFKA 3MOBL 3RY4A 5I0DA 4LGPB 1T20B 2DL2A 3EOAB 5EZIL 1I1FA 2MTPA 3FCTA 4WW2B 4DKAA 1UWXH 1VFUA 4PRHA 4NRYB 3OAZK 2C3HA 2QQLL 4L29B 1IAOA 2E7BA 1IAIM 4YE4H 4JCMA 4JY4A 2IBZX 3L9RA 3O9WD 4JG1L 3SDDA 4GKZB 4WHTA 3MJ8B 3DUSA 3SDCD 1A7OH 3GMPA 4HK0A 2X9XA 5GGRA 5F44A 5GSVA 4I3RL 2A1WL 4N8CH 2FLRT 4UINH 4UU9A 2R2HB 1B3JA 5FYLD 1X5HA 4HGKC 2EH7H 2GIYA 5DI8A 2N7AA 2LU4A 2EE6A 4XWGL 5J3HD 3QFJE 2WQ8A 2DTMH 3U30C 3VWKD 1D5MA 1BGXL 1FVEA 4UIKL 3T0EB 3GBNH 4LSVH 3L95A 3C2AL 3BE1L 3ARDA 1Q1JH 4ZOCA 3BWAB 4M6NL 4PP2A 4S1RH 1RUPH 25C8L 1ADQH 4YGAB 1JUFB 3RGHA 5I1HH 5LQBL 1A1OB 5HYSA 3ROLA 1UM4L 1S9VB 5J57B 3I6LD 4HSQA 2QR0A 2ZCKL 3L9RB 3AU1A 3NIGF 4JPWL 4MS8C 3DRTA 4Z7VA 1N5AB 2A2QT 3GMPB 4NCC1 4WUKH 2DLTA 1J8HE 4G8IB 4HK0B 3WKNA 2BY2A 5EDXA 5IP4A 2CO6B 3C5JA 2RR3A 3RBGA 1KLGA 3MODH 1YN7B 2DMBA 3GIVA 3LRHA 5H37H 1A7PH 3RTQA 3DV6A 4PJDF 1OTTD 5F7EH 4WI2A 1AC6A 3GMQA 4JG0H 4KK6D 5DI8B 4NZTH 5B4MC 2D31A 3UTTA 4ODUA 5LGJB 1F5WA 5DRWB 1PZUB 3ULUE 4M7KL 5DD6A 4XCFH 3HLAB 3ZT6A 4ZG1A 3F7VB 2Y07L 4PJXE 3FO0H 3VGHA 4ZTPH 3L95B 2ICEB 1I1AC 3I2CL 4FZEH 3OZ9L 2H32A 4YDIH 3KLHD 3ARDB 5ESQA 2EIZA 1BF2A 3QDGB 2FGWL 4EIZC 4FOMA 3AMKA 3D3VB 3MNVB 2A6IB 1G6VK 2F9BT 3CU7A 1R5IB 5EC2B 1LNUA 3TT1L 3C60C 3JWOC 3ROLB 3F6IA 3VG9B 4MJ2A 2BJMH 3ES6A 1N5YL 4K9EL 5F7LB 1YEGH 4KGLA 2QR0B 5CUSL 4Z77A 5IMMA 4X6FB 1HKFA 5D1ZA 4O4YL 3MRKA 1UGNA 4XP1H 3C5JB 2ADGA 3TO2B 3MREA 1ZLSL 1G6RB 1Q72H 1A7QL 4NQEA 1U8IA 2BNRD 4KKBC 1NCNA 3RTQB 3D39A 4ODWB 4X4XA 5J11C 4OCRH 1KEGH 3GMQB 5D2LE 1QTYT 3L6FA 3AXLB 2D31B 4ODUB 2GJ6B 3S96A 4GUPA 4W81A 4QT5A 2OR9L 5DD6B 4G6FB 4YNYA 1HH6B 3MOAL 4QGYA 5GS0L 4XHQA 1IBGH 5DWUH 1R6VA 4KK9C 4P46D 3AM8A 2ADJA 5FGSA 2H32B 1MCDA 5ESQB 1UWGH 2EIZB 1NLBH 4BQ9A 1LNUB 1I9JL 5K9JH 3D1MC 5BQ7B 4PREB 1WTLA 5EU7C 1EFXD 3PUCA 3EUUA 3BT2H 2YD5A 3S36H 5C0RL 2Y36L 3O4OC 4WI8A 5D1ZB 5J12C 3W0WD 2EXYD 4OZ4A 3MRKB 4N8PA 5M95B 4WFHE 3MREB 4H25B 4BK5A 5K59E 4HUMB 4NQEB 3N1QC 4HIEB 4Y19D 4BFIA 5CILH 2W91A 3D39B 4KKNA 5JA9A 4X4XB 1MNUH 4YX2H 3VI3E 1MPAL 3V5KA 3MSPA 4AM0B 2XQBL 2VZUA 4ENED 4GUPB 3ARXA 2DRUA 4RFNC 5I73C 3BN9D 4CVUA 4BQ8A 5JDSB 4Q58C 1MFEH 4QT5B 4YNYB 1FZMB 4LMQI 5I76B 1JF1A 1XF4B 2ED9A 2GFBA 3KYNB 4NQXA 5ILTL 1KV3A 4EUPG 3E3QC 1ZVYA 2VAAB 1R3JB 4HG4K 1KJVB 4F7CA 4HCRA 4J3SA 3WFEH 3FQRA 4PJXF 1YPZA 1YMMA 3FB5A 4NFDA 3IXTA 4WWKA 5L2JB 5IIEB 2EDJA 1HHHB 1OGAA 5EUOA 2E27L 2DBLH 2KUTA 2WK2A 3CVIL 4YLQT 3ZDZE 3VXRA 3NAAL 4AENA 5I1EH 5D2NC 1IFHH 3EZJB 5EU6A 4KGJA 4P3DB 3L5WA 4YIQA 1PJ9A 4OZ4B 3V95A 2HLAA 3ZKMD 5GQBA 3QUXD 2WWMC 3GSOB 3U48A 1AGCA 1ES0B 1P6FA 2HJLB 1MFDH 3JWNC 2XIDA 4PG9B 1XEDA 4X99A 4YBQD 1E6JH 4HUWA 4YBHA 1T04B 3V5KB 3VRLE 4ODHL 4KVCL 1G7MA 1IKNC 1A9BA 1MHHA 1T6VN 1CFVH 5D2LF 4Y1AB 5JOFA 2CIIA 4LARL 3OPZL 1JF1B 1GZQA 4NQXB 5EOTA 1IE5A 4ODSL 4HK3N 3EYQC 5DMGD 2A77H 4XAKE 4FFZH 3FQRB 3LN9A 5CGYC 2HJFA 3I85A 3RWDA 1YPZB 1YMMB 4UT6L 3WN5C 3FB5B 1N4XL 2BY1A 4PR5A 4ZNEA 1E4KA 3IXTB 5DD1L 4L5FL 1T22B 1V7NH 1T03H 1C5DA 4GRWH 2H2SC 5D9SB 1CT8A 3BUTA 4OI7A 2BERA 3JV4B 3DURB 3U82B 3SO3B 5EU6B 3TO4C 3W9EA 3F65A 3QQ9C 4YHYC 1S7SA 4MQXC 3MLRL 2HLAB 1EBPA 2DQEL 3T0ED 1AGCB 3T2NH 4YQXL 3IB4A 5HGDA 1TZHA 1A21A 4YBLB 1Q9WA 2F19H 1BVKA 2I26N 2WZPD 2XZCH 5I19L 1NCBL 4U3HA 5K59F 2V7NB 4HUWB 2WBJA 3X3FL 3HI5H 5D7LE 3A67L 1SBSH 3VI3F 1JNHB 3O3EA 4LCCC 1JWMA 1RIUL 1Q0XL 3BISA 4NOFA 1GIGH 1MSPA 4AQOA 5F88A 3VDAA 4MNQE 5TE7L 1H0DB 1CDGA 5C0GB 3OGOE 5HTSA 4RA0C 2XACC 3MLUL 2I9TA 1NL0H 5TDOA 1TJIH 3N06B 4ACPA 4KI1A 3RWDB 4HKZA 3S3SA 2NY5C 3RWIA 2NY3B 3LKSA 4CAGA 4M5YL 3WUZA 3MNWB 3MUY1 5HGAA 4XVJL 4KRMB 5FA4A 2Z4QA 3RQ3A 4OFYA 3HNTH 3T08A 1CT8B 1TQCC 2VNCA 2NW3A 1IC7H 4H88H 5BOPA 1FVCB 2N56A 3F6LA 5ECJE 5KTEL 1E27A 3W9EB 1N8ZB 3RDTA 3ZDZF 1HWHB 1S7WA 4ONFL 5C0CA 5GSRA 2BSRA 1UACL 3SDXE 4N5EC 2DQIL 3P0VL 4TNWF 3TGXA 5HGDB 1TZHB 4NN7B 5FUCC 3ARDD 2NY4B 3ARBB 4JHWL 2Y72A 3QDGD 1SY6L 4UIMB 2OK0H 4QF1A 2WBJB 3D3VD 5FDWB 2UUDH 1KN2L 3FO1A 4Z7WA 1QZ1A 3VD7A 1AGBB 3GSWB 3JTTA 2VZ3A 1VGEH 4PD4J 3VRLF 1U6AL 1FJ1A 1P7QA 5CLTA 5F3HB 5CEZE 3VFGH 1ACZA 3ZSTA 1M7IA 4K3HA 4WEUD 2G75A 4U6HA 4LVHC 2ZNXA 1U91A 5JOPD 3V0WL 4PJAB 3FQUA 1WGOA 2VLRE 4X83A 1C5BH 4FABH 3C5SB 4JPKH 2PCPB 3BKYH 4JGJA 5HGAB 3RTQD 2VXQH 3TVMB 3QHZH 2DQDL 1M7DB 1TVBA 1WLHA 3MRCB 3KPRA 2GJ6D 4RX4A 3KPOB 1XR9A 4WFFD 1TVHA 3NVQA 4HS3A 1HSBA 1E27B 1UKTA 3RDTB 1S7WB 4G6FD 1V3JA 3C8KB 5C0CB 1HDMA 5CINL 5GSRB 2BSRB 4Y4KC 3IJHB 1KIPA 1L9MA 1QP1A 4XP6H 3TYFA 4O51A 5LAXA 5I8OH 5EU4A 1EAJA 1J0IA 1RZFH 2EYTB 1B6UA 4K7PH 1MEXL 3KYOB 4HW6A 4X5LA 3VDBA 3WCYA 1AO7A 5DLML 5KVFH 5FKPB 1INEH 1KB5H 3BJ91 3RNKA 2JELL 2IANA 1U93B 2QKIA 1OD9A 1RY7B 3MO1A 3QXDA 5CEXA 3SDAC 1J1PH 1M7IB 4U6HB 2FWOA 4P2CG 3DPBA 3LKNA 4LPYA 3RPKA 2PTTA 1AGFA 2YD1A 3Q1SH 5KZCB 2H26A 1MQKL 4Z8FH 1OF2B 2A38A 4ERSL 4NQED 1CXEA 4G7VL 3D39D 1H3WM 3BI9X 4GRMB 3N85L 4XP4H 2HT4C 5HDBE 1TVBB 1GRWA 4Q6YA 1NBYB 5H2BA 2W0LA 4D3CH 4XB7A 4HWBL 1TVHB 2BSSA 2YD7A 4YHML 3MMEA 4OFDA 5JHLH 4RMTA 3QWRD 3BKCL 3W82A 4I5BB 1K85A 4IRSA 1P84K 4OD3L 5KS9A 2VLJB 4O51B 4PJ7E 5D71L 3SDXF 5CEYA 4Q9QL 5CGTA 2I07A 1WCBA 1RZGA 4GG8A 2GJZA 5ANMA 1TZGL 4LQ1A 2ZUWA 4G6MH 3IDNB 5HYJE 5MP6H 1AQKH 3RWGB 3MLVH 4HBQA 1QHPA 1VDGA 2IANB 5B21A 2X09A 3IU3B 1J12A 5DJZA 3LHPL 3MO1B 5DJDA 4YHNB 5C07A 3MLYL 4I0CC 4OFIA 3HE6D 1U8OA 2FWOB 1IILE 4R2GB 4JO1H 1AI1H 1XGPB 5IQ9A 1II4E 4OB5L 2PTTB 5BCAA 4ZUTA 3V6OC 1ZT1A 3OQ3B 3P30L 2IBZY 3PNWA 4U6YA 1FSKB 3V7AG 1NMCB 4ZO7A 5GZNC 2EO1A 4N0UE 4HPOH 1AE6L 1I9RL 3FTGA 4KRLB 4PJ5B 5ICYA 5FM5M 5H2BB 3BRDA 2YUVA 1CDUA 2BSSB 1GOGA 1FO0H 4Y1AD 2AK4A 4IIQC 3EDFA 1FL3A 4LU5L 1AP2A 4QHNA 3CH1A 5FF6A 3MGOB 4IRSB 4GO6B 1YMMD 1A6WH 5CEYB 2HH0H 3PXHA 3STBA 3MCKB 4N8VG 2AERT 4GG8B 5F7FA 2GJZB 5ANMB 3DRQA 5LJYH 2GTWA 4G42A 1IGCH 4LDLB 4QY8A 4NFCA 2JB5H 3MACL 4I8DA 5DJZB 4JFED 3CZFA 4QHUA 2NNAA 1FNHA 1CFSA 4KMTH 4AEHL 3P9MA 1TTUA 2B1AL 2CKNA 1S3KL 5IQ9B 3S35H 4UTBL 3L3KA 2FB4H 4JFDB 3PNWB 4U6YB 3VRJB 1FLRH 2PYEA 5T1LA 1G7LB 4KRNA 2EXWD 4DQOH 1LO0L 4DGIL 3QISA 1VFBA 3LKQA 2DD8H 4O2EB 4GW4B 4OLVL 4LBEA 1F97A 1YEFL 1FL5B 4L9DA 2H8PA 4NQTA 4JM2C 3CCHA 4RFOL 5ICYB 4OLXH 3NACL 5HDBF 1G7HB 3HRPA 3CFJB 4L9LC 3TT3H 2WSKA 1LEGA 1IL1A 4JKLA 5C0JB 3UBXG 2DWEB 2XKNA 3NPZB 4MXQC 4PJDA 3CH1B 2ARWA 2MKLC 5MHSE 5D6DA 5CJOH 2UWEA 3E1F1 1AGDA 2E6QA 2NY3D 4PJ7F 5FO7A 1K9TA 4PJ8A 2GTWB 1LWRA 4G42B 3E6HA 3I84A 3VWJA 5FYLH 1F4WH 1OWWA 1HEZB 3QEHB 3CZFB 3TWCH 4QHUB 5E95B 4M1DL 3GJFA 3B2VL 4NPYB 1KCSL 5IBUB 1U8LB 1TQBB 4M1CD 1Q9KB 3T0WA 1BECA 5DQDL 5ESAA 1JE6A 1U58A 1FFNB 3HR5B 4U1NA 3T4YB 3DROB 4OBSA 2UZIL 2NY4D 3ARBD 5T1LB 3KAAA 4O9HH 3WIIH 1VFBB 3VXMA 2WBJD 4CBPA 4LBEB 2COQA 4PY7A 3VGEA 2H8PB 4UDTA 1IM9A 4YDKH 2PW2A 4XVSL 1DQML 4JZNB 4ONHB 4LVOB 5EUKA 4AEIL 3LQAC 4Y0GA 3CDGB 3RP1A 1HILA 1IL1B 2FEEI 2P5EA 2XKNB 4PJDB 4MB5A 3VH8A 1PG7L 1WAAA 8FABB 3CLEH 2GT9A 3ARRA 1OM3L 2HT2D 4POZC 2XWTA 3RBSA 1SEQH 1JGVH 1OGTB 5HDQH 5BVPL 1AGDB 1BQLL 5FO7B 2HT3C 3DXAE 5CEZL 3TVMD 5IHBA 4TQEH 2H6PA 4CVZA 1FRGL 1YEEH 5HD8D 5C0DA 4KH2A 3MRFA 5F70A 1I1RA 3RDTD 1CDYA 5C0CD 1HI6B 4WEBH 2QSVA 3WUWG 5ESAB 5I1CH 1JK8A 1BFTA 2VXTH 3CFBA 3QG6A 4LVNC 3DGGA 1RPQA 1QO3A 2F54A 3CLFH 1I1YB 2CLVB 2OJZH 1JHLL 3GK8L 3MV11 1PY4A 3BP7A 3RPIA 4U05A 3F5WA 5JQHC 3JWDH 4PY7B 1RZ7L 1IM9B 3WJLC 5EUKB 2IQ9H 3B3IA 2YPKA 2ORBH 1HQRA 2J5LB 2QJDA 4GQ9H 3VH8B 5KG9A 5IVOA 3A6CH 4OZHA 1IGFL 5KZCD 3D48R 3WFDH 1H3VA 1JPFB 3FQWA 4G5ZH 4C54A 4JVPA 1SY6A 3QFJB 3RZWA 1BX2A 2H6PB 2AJ3B 4F33B 4CVZB 5C09E 1AR1C 2X4OB 1Q9LA 3QIWA 5TFSH 3SDDC 4OJFL 1A7BA 4XCCL 4UAOB 5GS2H 2QV2A 3IFNH 2A9ML 4RAUA 3QP3A 3Q5OA 3GUTA 5DZLA 5DK3A 2FATL 2P7TA 2ZOKB 3GJFK 2VLJD 3ZZ1A 2CRIA 2YSSB 4M6ML 4EXKA 35C8L 3GRWL 5H94A 2W65A 5IWLA 1UCBL 3BP7B 4L3EE 1RJYB 4R4NC 4YPJA 3IJYA 4EJ1C 4Q6IC 2EDEA 1CGUA 3CXDH 2M8XA 2W9LA 4R97B 1IGIL 3U7WH 3MRLB 1ONQB 2JJWA 1HQRB 3F8UB 5CJQL 1JBJA 2FSEA 2Y23A 1XCTA 3CFKA 2AEQL 3LQMA 3G5XA 1OTSC 1X5KA 4R2GD 4NC0B 2B8OT 4GMTH 2R0LL 5D2LA 3SEPA 5E8OA 2VXSH 3REVB 3FQWB 1KFAL 1X4ZA 4CMMA 1NSNL 3FOLA 4ZNCD 1JRHL 1BX2B 2XY2A 2EH8L 1T4KA 1FYHB 1NCAH 1QSFE 3MJ9L 1NEZB 4PJ5D 1J10A 1VKXB 5E5MB 3NZ8A 4LDOB 4OM1H 4TNVF 4U1HA 2FJFA 3WEXA 1XT5A 4FFVD 1YZZA 5F1IA 4RAUB 5KSAC 4WU7B 2Y5EA 4UBDC 2EEDA 4IRSD 4G6KL 4KK5C 5JPNB 2XRAL 3LSOB 4IOIA 4PJCA 1U95A 2KQMA 3UTPE 2R4SH 2OP4H 1G7IB 5CZKA 3WXWL 2E6PA 1MWAL 3FB8A 4WCYH 1XH3A 1PX3A 7CGTA 2D4DA 5I1LB 5F7KC 3ECBB 5JXEC 2CLRA 5C2BH 3KDMA 2XZQL 2B39A 5FUOH 1NMBH 2HFGL 1CE6A 2V6HA 4LLQB 5GS0D 2QQQA 4NM4H 2P42B 4KPHL 4TVPE 5I17B 5D2LB 2EEAA 5ICZA 4JFDD 4FP8H 4CMMB 3DLQR 3ZTJH 3FOLB 4OD2A 3SHSA 3VG0H 4P4RA 1NAKL 4Y88A 1KTKE 4M6OL 5SWZE 4NBYB 5CHNA 2A0LC 5FM4A 4M03A 1DBJL 5GRXG 3KVQA 1F3DJ 1HQ4A 1HOCA 2XQYK 2FJFB 1AJ7H 3SGKA 1NBZA 3D0LB 3DVFA 1BM3L 1U42A 2MKWA 4K94L 4TSCH 3QEGL 1CICA 4N0CD 2NY6B 1I9EA 1QFHA 4L4VA 1DP0A 4IOFC 4PJCB 1U95B 3IFLL 3S37L 5KW9H 3V4UH 4PG2A 3JSSA 4G8EA 2GSGA 1XH3B 1Q9OB 3FN0L 1A7RL 2ICWJ 2CLRB 3JUYA 1BOGA 2IG2H 4DK3A 1EK3A 3AM8C 1U0QA 4WFGE 2Z93A 3U7YL 4NQVB 1CZ8L 5C6WH 3FHQA 2R39A 4UV4H 3M8OL 4MZ2A 4MVBC 1VEMA 1ZVSA 4NO0B 2D3VA 3RL1A 1F90L 4RNRB 4LEOA 3RWHA 3NABH 5T1LD 3OG6B 1DDHB 4OD2B 4NC1E 4P4RB 4QRPA 1GC1C 1MJUL 5FUZH 2GY7B 2G2RA 2Q86A 2VITB 4JFHE 1BD2E 3S4SG 4M43L 4PS4L 3ARGB 5T5FH 4KZEH 1FGVL 2DLHA 1HOCB 2J8HA 2IH3B 3K1KC 4M48L 5JQ6L 3KJ6L 3GGWA 1PLGL 3OR6A 3T0VA 4OFVA 1DZBA 5I71B 3FQTA 1QACA 2DQJH 1BF8A 3F58H 1CICB 2BNUA 4OIIL 4F57L 4H26A 1CU4L 1IKFH 1YN6B 5TPWH 3N1MC 4OZFH 4LKXB 4TUKL 5IFJA 2GSIB 4L3CA 1C7TA 3FFCA 3RL2B 1LO3L 2VQTA 1RHFA 1OT2A 5ISZA 1ZT7B 1LQSR 4RWHA 3KR3H 1DVFB 2KPNA 4ONGH 1UJ3B 4MA8H 1QKZH 1NDGB 5F89B 4M7LH 3RL1B 1BQHA 1EA9C 1TETL 3IGAB 4WWKC 4Y4HA 3SKJL 2DMCA 4MCZB 2L0DA 4XI5C 4LEOB 4KRPC 1DQJB 3C6LA 4BUGA 4ODTL 3GKZA 3AMLA 3RX5A 2Q86B 5EBGA 5D70L 1IM9D 1F6LL 3UAJD 3GSNL 2NPLX 1HIMH 1CBVH 5EBLA 1GVIA 4M7ZC 3GGWB 3RKDC 4TOYH 1LK2A 1BVLA 2H1PL 4X7DC 3FQTB 4LSRL 3ZTNH 4IHOB 4ZFFA 4AMKH 3B9DA 2BNUB 4BELD 3AS1A 2NX5A 2WLYA 1HNGA 3SE3C 5KSUA 4LNVA 5IMOA 1G6RH 3QFJD 5I1KL 2H3NB 3T4AB 5CMAA 4XXCA 4ZODA 4PBWD 1UM6L 4L3CB 1DBKH 3C5ZA 3U0TA 3FFCB 5KVEL 3GMRA 1J1XH 5E6ZA 3UTSA 4W6YB 4HUXA 3V4VL 2Q8BL 4AL8L 4PB0L 4CMHC 4Y16A 1CLYL 4B7IA 4EQ3A 5KOMC 3HNSH 5FYJH 1VESA 4JAMA 4JQXC 3BGFB 1P4BH 5DRNB 1Q0YL 4CADA 1JWUB 4MNQB 1EUTA 4RGOH 2RQ8A 5JW4M 5BS0E 5ALCH 3HPJA 5F3BA 2NY0B 2XTJC 4WV1A 2ADIA 1R3IL 4XT1C 5I6XC 4GAJH 4NO2A 1TLKA 2WUBL 3DHMA 4K55A 3BDXA 4GKOA 4FZ8H 4ZFFB 1DLFL 2P5WA 3WNOA 3SE9H 1UEYA 5CSGA 1L0YA 2EDQA 3OJVC 4NKDA 5DJ6A 2MPAL 4Z0XA 2FJHB 1NCWL 2VH5L 2J6EH 2V2XB 2Q6WA 5CBAB 5K9QI 3VFTB 4PJFA 3ULUD 3DSNA 4ZD3L 4JVUA 1N6QH 1T1ZA 3SDXB 1KEML 2XN9E 3C5ZB 3U0TB 1ZWIB 1QLFB 3GMRB 1FCGA 4PJ9C 3I50L 1ZHBB 4IMLA 4GRLC 2WWKO 4DKFL 4MCYB 2FNBA 3X3GL 3MZTA 3LV3A 4JAMB 4Z7NE 2R2BB 1SMAA 2AJUL 4IMKC 3UPCA 4CADB 3TBSB 3FRPG 1NEUA 3HPJB 3IS0X 5FB8A 2IWGA 3SKNB 2ADIB 2BVEA 4OTXH 2C7UB 1J7VR 3B83A 2V5RA 4ZDHB 2B4CH 3O6FA 2VLRB 3GIZH 4XC1H 1YNKH 4NN5B 5CP3H 3H3KA 4TULL 1NC2A 4OV5B 3I9GL 5FOJA 1SHMA 2P5WB 4WWID 3DUUB 4XMLH 3QRGH 2O5XL 4M7JH 6FABL 1I3GL 5E6IB 5IOPB 1JTOA 1GGIH 3NTCH 3HC3L 2BNQA 1T1ZB 5GIRA 4ZUSB 2LE9A 4WTXA 3TF7C 4WO4A 4JDZA 4IMLB 4BJLA 5EC1B 4AT6A 1MI5A 4JFFA 3HI1A 5DMIL 5I1GH 4PP1D 4ODVH 5IESH 1VSCA 3BW9A 4DGVL 3LV3B 3TBVB 3O2WL 5KANI 5HYJA 2XZAL 5IQ7L 1NMAH 5TH2A 4M8QA 4EDWH 2NY6D 3UBXB 2B1HH 4HCRH 5MI0C 1RI8A 4Z95H 3KPMA 2EDTA 3VFSA 4S1DD 3LS5L 4H1LG 1A4JB 1ULVA 5ACZA 2ZUSA 1AHWB 5F1NB 2XT1B 1OP5K 1B4RA 1D9KB 1MOEA 2FBOJ 3DTXA 5FB8B 4NJAH 1A4KB 4E0RA 3MBEB 3QB7C 5JW4R 1W2KT 1SM3H 3O6FB 4FQ2H 4WFHD 3V6FA 3HC4L 1TCRB 1D5ZA 3MGTA 4PGJA 4Y8AA 4KFZC 5I1JH 4RDQF 3CK0H 3TIDA 4KXZH 4AY0A 4NO0D 3WXVL 3QA3A 2AI0L 1FNSH 2FR4B 4NRXB 3QCUL 1VEPA 2AS5M 1RIVL 1CL7H 2BNQB 5E9DE 2EZ0C 5DVOA 1YEDB 3ARGD 4PV8A 4PJ7B 2AJXL 3TFKD 1FBIL 1IJ9A 3K2UH 1FCCA 4JDZB 4CN4A 1A3RH 1RMFL 3QXVA 4FQXC 4JRWA 2BCKA 1V05A 3WIFB 4KDVA 5ALBH 4XB8A 1IQDA 1A6TB 3G5ZB 2Z8VC 4IS6A 5IV2A 3BW9B 1JF6A 1ACYL 4HDIA 4O02L 1CICD 2D9QB 2X42A 4JLRA 3NA9H 4M8QB 3HB3C 3R1GL 4M3KB 1RVFH 5IJVA 5L2KE 1CF8L 3PV6A 3KNBA 1R3HB 3KPMB 3QUZB 1NGZB 3VFSB 4JREC 3W11C 4NGHL 1N0XL 2I25N 4APQB 2L7UA 1PZ5B 3RA7L 4OCSL 1JNNL 1RUAL 4I77L 5T1MA 2XV6B 2CR3A 1QFPA 1GPOL 2HVKB 2VUYA 4M4RA 2CK0L 3MUZ1 3V6FB 5GISL 1JGUH 4XNUL 3Q6GH 1OTUC 3WLWC 4KTDL 1YY9D 1DVFD 3TIDB 4N0UB 2CDFB 3IDIA 1QFWH 1YYLL 5EOCH 1G7JB 1UKQA 3BZFA 2OL3L 3VGDA 4WTZA 3CPLB 5C9JA 5IMLA 5M7QA 1A1NB 3TZVA 2AABH 1A3LH 2EE2A 4HZAA 1MJ7H 3FT4B 4X5XB 4FG6D 1MWAB 4XAKD 2X70A 5LWYL 1NANI 4JB9H 2BCKB 4CW1A 1OAQH 1G1YA 5JW5B 1F3JA 4YEFA 1UJTA 4PLKC 2X41A 1DUYB 4HDIB 3HTLX 3QUYB 3VXTB 3IAPA 4K3DL 3WHXB 1J88A 4UT7L 5HPOA 1ND0B 5IEKA 3PV6B 5D93C 3KPLA 1NGQH 1MCRA 3IAGC 1FPTL 3H2WA 2F53E 4AG4L 2ICCA 1PKQE 5GGTA 5T1MB 4U7KA 3RWFB 1P53A 4M62L 3ZT5A 3PWPA 4EOWL 1JI2A 2EECA 1UZ6F 2OJEB 3UJJL 3FB6B 3HC0A 2QQLH 3BDBA 5D96B 3P9LB 1SMOA 1F4XL 2VXUL 1KJ2A 3BZFB 4JG1H 4N0FB 4UV7L 5C9JB 1L4IA 5H37G 5C2UB 5IMLB 3WSQL 3TZVB 4MNQD 4I3RH 2A1WH 5FDYA 1A6ZB 4WVRA 1INQA 5I30L 2VDML 4HV8A 2NY0D 2X70B 4LQFL 4E5XA 3MRHA 5CSBA 5ICXA 1HHJA 3WO4C 4QNPE 2CJUH 3DMMA 2CIKB 5KJRL 2XYCA 3DXAA 4XH2A 1UG9A 3WIHL 3MNZA 4XWGH 5TE6L 2VZTA 4ZSOA 2X40A 2PO6A 2O61A 1T83C 3KPLB 1JGLL 4O5LL 4U1MB 1A6VH 1UYWL 1BGXH 2GUOA 3NFPB 4UIKH 4MJ4A 5LGKA 3ZO0A 4ZYKB 4FQCL 3C2AH 4KK8C 2WM0A 4M6NH 3BIKB 3K4DA 4OLWL 25C8H 4DCQA 5FCSH 4XNMA 43C9A 4U1GC 1VFOA 2DWDA 3C5ZD 5LQBH 2X4PA 4HMCA 5I74B 1WEJL 3HC0B 1ORQA 2VLLA 3O2DA 1MCPL 1JPST 4PJIE 4ZOEA 4AEFA 2FLBT 3PIQA 4Y5VB 3IDYC 2ZCKH 2APBA 3AC0A 4JPWH 4MLIA 1QBBA 1T7VA 4PJ8C 5FO8A 1JVKA 2EC8A 1P7KB 3PL6B 4NNPL 2MSPA 3VWJC 1ZAGA 1A7OL 4DK6A 2J1KA 4FFYL 2V5SA 5CEZD 3BPOC 2X10A 3C9NA 1INQB 2BOCA 4A6YA 5LXGL 1OT1A 3LEVH 4I3SL 1M1SA 2AVGA 2V17L 1QYGH 2WBKA 1T21A 5T3XE 1K8DA 3PGDB 1K4DA 1UM5L 5ICXB 2VLRD 2CUMA 3DMMB 2EDBA 4PB9L 5EB9A 2R23B 5T1KA 4N0RA 3DXAB 1AGEA 1CGTA 4NWUH 1KULA 4WIQA 3D5OF 4J3UA 1L7TL 2P5WD 4LRNL 2PO6B 4M7KH 4GJTB 1PX4A 3PWJA 4F8QA 1JHTA 3BN3B 5C09A 1RIHH 2GUOB 2A73A 5E6ID 4PTUA 4PRBB 1WWAX 3GBNL 3OZ9H 4G8FA 3AUVA 4KDTA 1M4KA 4YDVA 2Q76A 1W8NA 3BVNB 4DCQB 2IH1B 4QCIB 2WIMA 5D7KD 5ID1A 4XNMB 3MJ7A 3GSNB 43C9B 5FHAL 4PRAA 5BO1L 1FDLL 1LP9A 2DWDB 3BGMA 2X4PB 5I1HL 4WI4A 3TT1H 4OF7A 1ORQB 1EHLL 3GSVA 2VLLB 2NW2B 1VENA 4XP5L 4XNZB 3O3DA 1N5YH 4L3EA 2GITB 3NGBB 1UT9A 4K9EH 3PIQB 4FFWC 4JFZL 3SGDI 4HMEA 3MRJB 4HQQL 4I4WA 4I9WE 4O4YH 1RJCA 2M1KA 2VTFA 4WUKL 1BBJB 2N4IA 3BHBB 4OIAA 3RGVA 1F3RB 5DS8B 3OB8A 1ZLSH 1GH7A 4RCAA 1A7QH 4A6YB 1JCKA 4HJGA 5EZJA 4Y2DB 1D9KD 1MCSA 1A7PL 2YZ8A 1YY8A 3MBED 2VIRA 1T21B 3UYPA 1K8DB 3GMMA 2CSPA 3O6FD 4PLOB 2XFXA 5IG7A 5F7EL 5EU7E 3QWQB 1FNFA 5L88L 1RZJC 4LPWA 4NZTL 1AGEB 2H9GA 5ABDE 4E41A 5FYKU 4KJYB 4QNPF 1JV5B 2OR9H 2EDLA 2JCCA 3MOAH 4H5SB 4O58L 5C09B 5GS0H 3D69A 3SE4A 2J2ZA 5IFHL 3FO0L 4PTUB 2HLFD 4P23B 3UTZA 4YDIL 1OWRM 2BNQD 5ID1B 2DKUA 4LF3B 2DI7A 4Q0XL 3KYKL 1KELH 3BGMB 4JFXA 1I9JH 3VXPA 3GSVB 3S4SB 4WEMB 5HHPB 1W72L 2P8LB 4L3EB 2QSTA 3H9SA 2NYYC 5C0RH 2IC2A 2Y36H 5A2KH 4PJIF 3NCJL 5HYJD 2V2TA 2X05A 1AKJB 2EDHA 3E3QE 4YXKH 4MHHI 3BKJL 4RRPG 3QUZD 3QIWC 4XP1L 3RGVB 5J3HC 3OSKA 4APQD 1NANH 3QO0A 4HJGB 5EZJB 1Q72L 3VXSA 2VSCA 1KTLB 2YS4A 3GMMB 1M6OB 3KS0H 3E2HB 4WI5A 1MUJB 2XFXB 5IG7B 1IGJB 1FG2A 3QPXL 2XQBH 3VXTA 3Q5TA 5HYJB 2CQVA 3GMLA 2R56L 3QDJA 4E41B 1Z2KA 5D2NE 4R0LB 2JCCB 2CLZB 5SWZA 3MROA 1X5ZA 5DUBA 3D69B 5ILTH 1QFOA 5DK2A 2JB6A 3P11L 4JZJB 5F21B 3RVVC 3M17A 1IC4L 3QUML 7FABL 4YO0A 2XNAB 3KYAA 4HX1B 1RURL 3DVNB 4D9QE 4X4YA 2E27H 5DVMA 1MJJA 3IETA 4M4PA 5J9PA 3CVIH 3LN5A 4TSBL 1R3LA 3UTQA 3NAAH 1BFSA 1TCMA 3BT2L 3LPFA 3QUYD 5IMKA 5FGBC 4N68A 2LTQB 3BH8A 1YJDC 3V79C 4LCYB 4Y5XA 4ZS6D 1KLUB 1P84J 3VXSB 4IDJL 1G7QA 4UQ3A 3HUJE 2PUQT 4BSJA 1PD6A 3RWJA 3MA9L 4ODHH 2ZKHL 3I6KB 3FB7B 1Z5LB 5EFIB 3VCLA 4DZBA 1MCIA 4OAWA 2CDGB 4ODBD 3QNXA 4H8WC 3NBNA 5SWZB 4LARH 4OUUB 4L4TA 4PGDA 4ODSH 2VR5A 5AZ2L 1KYOJ 5DK2B 1SJEA 2RGSA 4G80B 4HKJA 1I8KA 3TZVD 3G6DL 4UT6H 1N4XH 3DX7B 4YK4B 5DD1H 5KSVA 4WI6A 1CFTB 4L5FH 5IR1A 4TPRL 3GMOA 1QFUH 1TXKA 3PHOB 4XPBH 3QJHA 5EOQL 3V0AC 4X4YB 5MHSD 5CIPB 4D0BA 2YK1L 4P4KB 5TJWK 3EJYD 2YWZA 3W81A 4NCDA 3CUPA 2A6JA 3MJGX 3OKEB 3QDMA 1QQDB 2OX5A 3FO2A 4KKAD 1IFHL 1BZ7B 1OL0A 3BH8B 4NNXA 2Q8AL 3J7HA 3I02A 5DHVB 3MLRH 5FOBB 3MLZH 2V2WA 4Y5XB 2X4TB 1IEAA 2DQEH 3VFUA 4ZFGL 2D7TL 1N59A 4V1DE 4XWOD 4NO5B 5I19H 4LHJB 1WWWX 1NCBH 1OPGL 2ZSVA 1LE5A 3UDWA 1E6JL 4D9RE 4TTDD 2CPCA 2GK2A 2IFGA 3X3FH 1L0XA 5HI3D 1A6AA 4U4BA 3A67H 3G04A 2X1PA 2DLIA 4DZBB 1Q0XH 2E8YA 1G1CA 4P5TB 1BD2B 4PG2C 4PGDB 2D7OA 5TE7H 1ZGLP 5GZOD 3PL6D 3MLUH 5FUCE 5IBLC 1A1MA 1F8TL 5KSVB 3PG2A 5IR1B 3TESA 3MV9E 4M5YH 1KBGL 4XVJH 4OQTA 3PE9A 1T03L 2R0WH 3QBTB 5IB3B 1NUNB 3DMMD 1YUHB 5DK0A 2DM2A 3DXAD 3QQNA 3QDMB 2CKBA 5HYFA 3FO2B 5DHXB 4NSKA 2PO6D 4M61A 4ONFH 4N1HB 3I02B 2D0HA 2OL3B 3JWOL 5T3XL 2DQIH 4I2XE 3THML 3VFUB 4IDLA 1S7VA 5C71A 5D5MF 4JHWH 4G9FA 3LDBC 1NJ9A 2ZSVB 1SY6H 2VXVH 3LOWA 5HVGB 3ULUH 1ZS8B 5JHDE 1A6AB 1KN2H 3HI5L 3HUJF 3F7QA 4MMZC 4Q2ZA 1U3HC 3G04B 1KG0A 1XF5B 2DQUH 3PWLB 1UA6H 1U6AH 4U1LB 2VC2L 2WIIA 1CLCA 3B9KA 1GIGL 2FDBP 3WIHA 5BS0A 5J89A 2FH6A 4X9IA 4KVNL 1E4JA 1E28A 1TENA 1BFOB 2Y7QB 1KC5H 1QSEE 3K81A 4PTTB 3V0WH 1G9EA 4U1SA 4XBPA 5MEOA 4Y2DD 1QOKA 4P2QA 2JLLA 3H9HB 1LE9B 1T5WB 2RIKA 2DQDH 4DVRL 4Y4HC 1F11B 4H88L 3O6LH 5BV7C 3C6LC 3TNMA 3I6GB 1QR4A 4WGWB 3ZLQC 2HTKC 4LOUC 3ULSB 4KC3B 3L3IA 2JJVA 4EDXA 1AQDB 4UNTA 5C09D 4P5KA 4CKVX 4NZRH 1MLBA 1IARB 2NZ9C 1JYXA 1PVHA 4P23D 4DOHB 3OKDA 1S78C 1S7VB 2M2DA 2VABA 1EEQA 4TSAH 2VUOA 1NJ9B 3BEWB 4HIXL 1MAKA 5AUMA 1MEXH 3TBWA 1A0QL 3N50A 4Q2ZB 2PXYB 5DLMH 5C08A 1KG0B 1ZE3C 4PGBA 5JLZA 5LGHL 2JELH 1VGEL 4L3ED 5C3TA 5SWQA 2AKRA 2VJXA 5BS0B 1J8KA 1RK0B 4J7RA 3BESR 3ROOB 4EUPA 3N1PC 1AKJD 1E28B 1XF2A 4XXCC 3EYVA 4FQQA 4JPVL 1XGUA 3RGVD 1QPXA 4D94A 5MEOB 4XBPB 2Z92B 5GS1A 4JPKL 2H2PC 4G7VH 4P2QB 5IBTL 4PFEA 4KJWC 3BKYL 3N85H 3IFOA 4Y16C 4U7MA 4HXBH 2VLKE 4BZ1L 4HWBH 4BZYA 3D18A 1H8SA 3NPSC 2B0SH 4EDXB 4EN3B 1QSFD 4P5KB 2V5YA 2XN9B 1IGTA 4LGRB 1CTNA 3IKCB 4OD3H 5IVZA 2D2OA 3V6OE 4Z7OF 5D71H 4WV1C 5I66B 2VABB 5AUMB 4ZXBB 3Q3GB 1S9KC 1TZGH 3MCLL 1JZ8A 5C08B 5EO1B 2F74B 3ZHLA 4B50A 5JLZB 5KVFL 4GKSB 2ZCHH 4PV9B 3UTPD 5DJ0A 3HE7A 1IZKA 4RBPK 3LHPH 2AKRB 4LLWB 5SWQB 1AIFB 3MLYH 2BVQA 4U0RC 1JWSB 4LASL 2YD3A 4NQSB 2K3TA 1K8IA 1QFWM 1KSRA 3EYVB 1XGUB 2AXFA 5KVDH 4OB5H 2WINB 3IF1B 4BH8B 3TA3C 3P30H 4OZGA 2OTUA 1V3LA 1B0WA 4LAJH 4TVPD 2EYRA 4BM7A 3B8SA 3QCTL 1I9RH 4WJ5A 3QI9B 4XNQA 3P77B 4D3CL 3OAUL 5JR1L 2DQHL 5SWZD 1I7UA 1SJHA 4LU5H 4J4PA 1IGTB 3VJ6B 1CR9L 5C0ND 4MDIA 3RVTD 1P4LA 3PP3H 2BVYA 3DETD 3JBG7 3FOMB 1S5HB 2FHCA 1KN4L 3W39A 5J13C 1HSAA 4OIBA 1XZ0A 3HAEA 4P4KD 1CDJA 4AH2A 2IAMA 3MLVL 1JRHI 4KKLD 5HI4D 2MOVA 3V0VB 2BVQB 3KPPA 4AEHH 4BUHA 1C12A 2B1AH 3F7RA 4X4ZA 1GGTA 2R8SH 4YGVA 4ZOAA 1J11A 4UTBH 3KLSA 3BFOA 4OZGB 1UH2A 2OTPA 2BRRL 4WO4C 2VDNL 4CVXB 1DUZB 1FYTE 1G0YR 4KI5C 4DGIH 5ADOH 3IDXL 4GFTB 2HRLA 2EYRB 5L6YH 5HY9B 1YEFH 2RCSL 4RFOH 3ZL4L 2NY5L 3NACH 1W72B 5B3JE 3QIBA 5F9OL 5AAMA 1F6AA 1XR8B 3LEYH 3LN4B 4JFHD 4P5TD 5E9DB 5F1OB 1SJHB 1BD2D 1OOAA 3RKPA 4UQ2A 3H3PL 4F7PA 4DUWA 4MDIB 1DQQA 1RZKH 4X6BB 1K2DA 5DVNA 2OQJA 4OZIE 2DQFA 3QWOA 3W39B 4QEGA 2X4RA 1WBZA 1AXSB 4NP4H 5L2KB 3HAEB 4CJ0A 1IGCL 4X8XA 3QNYB 2IAMB 2G9HB 5AD0A 2K1MA 4CUCA 1TPXC 4M1DH 3B2VH 2NY1B 1KCSH 5I16A 5TGBA 1O0VA 2NY7L 5I2IA 5DQDH 4OF3A 4U6TA 5C0IB 4YXHL 5DJYA 3OKMB 4GBXB 2UZIH 1T5XA 3QUMB 5JIHA 2ESVA 5KBNC 2MHAA 3KXFE 1S9XA 3VDCA 2YEZA 3LB6D 3EYUL 1GAFL 4XVSH 1DQMH 3CDCA 4AEIH 4OCLC 3QEQA 4N0YL 3QDHA 3A6BL 4NWTH 1F6AB 2BSED 1PG7H 2B4CC 4RFEB 4HH9B 4UQ2B 4XPAL 4F7PB 5J4MA 3S9DB 3U1SH 4JDVB 3BAEH 4HWEL 2HFTA 5F7HA 4X7CC 5BVPH 1F2QA 1BQLH 4Z7UE 4GG6E 2ADFL 3HE6C 4JKPL 2DQFB 3ILQC 2X4RB 5CEZH 3P4NB 3PGCB 4PD4K 2VO5A 5HHVL 2P1YA 4U33A 5HPMB 1G9MC 2X6MA 4KJPD 2E3VA 5DDHA 4ZUWA 5I16B 4XBGB 1T1XB 5E8NA 4X6DA 4HHAB 2HMIC 4XX1G 4LSSL 5DJYB 1GOHA 5DO2C 3KPQB 1T5XB 3CFDA 2BRQA 1B6DA 1AFVL 4GH7B 4PRHE 3GK8H 2VYRE 4LAQL 3WIIL 5E2WL 2MHAB 2MQ0A 3U30B 4X0KA 1RZ7H 1U36A 1PSKH 4LNRA 2PXYD 1S9WA 1I1AA 1KIQA 4DWHA 4XGZA 4R7NA 3ZYZA 2YWYA 4I48B 5BS0D 5B3JF 4HIIA 4P2OA 2F15A 2IF7A 2QSCL 4HIJA 3BZDA 1KPRB 1HK6A 3CLEL 3C60A 4URTB 4ALAH 4WUUA 5EBMB 2EE9A 3NCYS 5E00A 1A14L 2EIDA 5IB5A 3T1FB 2VN4A 4K3JH 4OZIF 1DEDA 2NTFA 3V9FA 1LEIB 4OJFH 5DDHB 4PJEE 4XCCH 5C9KA 1H3UA 5CLWA 3H8NA 1QR1A 3QZWG 4X6DB 2CUHA 4EN3D 4S0SD 5CJBA 3GO1L 3RI5K 3QO1B 2XN9D 2ID5A 1UVQB 2VXTL 3PP4L 2FATH 4QXWA 2RFXA 4QHLB 2XWJA 4M6MH 1S7XB 1FIGL 4PJIB 4NDMA 1UCBH 1RZIB 4WW2F 4ZXBD 3ILPB 2FGZA 4JR9L 4MGXA 4YPGA 5C08D 4NHUA 3QRFM 1S9WB 1IGIH 1E4WL 1SJVA 5DTFB 1KIQB 1YEHL 4Z7VE 4XGZB 4NNYB 4XVUD 5CJQH 4OGYH 1MCEA 2ZP0T 4GQ9L 4MJ5A 4L8DA 4OGZA 2AEQH 1ODAA 3C60B 2E5EA 2F58L 1D7FA 2R0LH 32C2B 3ZTJG 1GL4B 3IDJA 4N8VA 2GK0A 3U0PA 4DVBA 2VDQH 1NSNH 3UTTE 4Z7UF 4C59B 1JRHH 4GG6F 2EH8H 2YBRA 5F7WC 4LSPH 5EIIA 3QI9D 4MA1C 3MJ9H 1NAML 1BIIA 4YR6B 1DJSA 3MFFA 5DFWH 5J11B 2XRAH 3CSYB 2K7PA 1ZA3A 2CO7B 3BGAA 2O5ZL 3MRMA 3QG7L 4MJIA 4HZLB 1ZXQA 4YPGB 2Y5TA 1MWAH 3OX8B 1DEEA 4N9GA 3SGEI 3GB7B 3WDHA 2FECL 1ZHLA 1CIUA 4GXVL 4KDTC 3O0RL 2XZQH 4L8DB 4OGAC 2EIEA 2VOTA 4JANA 1P5VA 3HZYA 5GGRY 3CSGA 5CJ5A 4HUVA 5DJAA 4D0DB 2IGFH 4KPHH 4M02A 3F7PC 3EAKA 4PGZA 5TDPB 3U0PB 2R69L 5F8RC 5JW4N 1EVTC 3O4OB 4JGMA 1MELA 4YDJA 4OLEA 1NAKH 5J12B 4JE4B 1IC5L 1FFOA 3MXVH 4K7PX 4WW1A 1DBJH 1OB1B 1BIIB 3U6RA 2QADB 3MFFB 1ZLWK 1YEJH 2DL9A 1OP3K 2Z8RA 5E8PA 5E9DD 1BM3H 3BJLA 1Y18A 4K94H 3NZHL 5B22A 3QEGH 1IKNA 5EBWA 1QBLH 4RFNB 5I73B 1ED3A 4MQTB 3HZMB 3S37H 1WQVT 2C3VA 2R4SL 4XCEB 2OP4L 3MR9A 2Y5TB 1MF2L 1T6WA 5DVLA 5GRVK 5L2KD 4HC1A 5FO9A 1DEEB 3FN0H 5JO5A 5CZVL 2Q3ZA 1A7RH 2IAMD 5E8EA 5E0QA 1ZHLB 3SE4C 3PJSB 1G0XA 4LKCA 2ZUVA 2NY1D 5C2BL 2C5DC 4Z7VF 3MRIA 3U7YH 1CZ8H 3MJ6A 4XMKL 4JANB 2PR4H 5FM5O 1PYWB 3M8OH 3T0BA 4HUVB 3KYMB 2UVFA 5DJAB 1DFBL 3ARVA 4NM4L 1OAUL 1F90H 2DBJA 4LLVB 3SGJA 4GBXD 5E2VL 5IVNA 1P2CA 2XY1A 4Z76B 5D2NB 4FP8L 1JGEA 1U8JB 4BH7A 1MJUH 4GLRI 4P48A 1HXMA 2R1YA 1BLNA 4PS4H 3MLTB 1MCWW 4RQQA 1FGVH 5DQJA 4YC2C 4UTAL 5DVKA 4M48H 5JQ6H 4UDUB 3KJ6H 5HHNB 1PLGH 3PXJA 1G0DA 3WUWA 1YMME 1Y18B 1N6VA 2H41A 1FZJB 4GOSA 5EBWB 4OIIH 4F57H 1A9EB 1ED3B 1OGAE 4DKEL 1R0AL 1CU4H 5EUOE 1OSZA 5AG9A 2K9UA 2C3VB 3V4UL 4DGYH 4KU1A 1U8NA 3VXRE 4GT7A 1WJ3A 4TUKH 5EU6E 2FEDD 5JO5B 2FEEL 1NUFA 1KACB 4HUUA 4NQDE 3WN5B 1XGRA 4LKCB 2IG2L 2KL6A 2YC1A 5AWNL 5T1DH 4ESKA 3MRIB 1LO3H 2W0PA 3HUJB 3TJHC 1VGKA 4MDJA 4MA3A 2ITCB 4FXGA 3SKJH 1TETH 5BZDA 2IMNA 2W60A 4U1JA 3S5LA 1P2CB 4ODTH 1DLHB 3NABL 3TO4B 2Z31C 2V7HA 2EDYA 3Q5YA 5D4QA 1HXMB 2R1YB 5D70H 4YHYB 3GSNH 4FMKA 2JJSC 4RQQB 5IB1B 5DJXA 4KZEL 3RU8L 4LCUB 3WYRA 1ZA6B 3O2DH 1MFCH 2C1OA 2H1PH 4ZUUB 2AEWA 1ZGLM 4LSRH 3QNZA 3P2TA 3S3JA 4U3CA 1T2XA 4JRYA 1Y6KR 1XF3B 4LCCB 1X5IA 3CX5J 3S35X 3B6SA 1U8NB 3X14A 5I1KH 4HWZB 5C0EA 2XTJE 2GHWB 5DJ8A 2C1PA 1UM6H 4HUUB 5DYOA 3IDUA 5KVEH 1MRDL 4V1DB 2BC4A 5INCA 3EBAA 4QRUA 3V4VH 1VGKB 2Q8BH 4AL8H 4MA3B 2F8XC 4FXGB 4PB0H 1CLYH 1QKZL 5JHDA 1TQCB 3Q2CA 4M7LL 2W60B 4XAWH 5AYUL 2DQGL 5B4MD 3S5LB 1LMKA 1KTRL 2MNUA 4Y8DC 3P40A 4ZPTA 1IVLA 1T0MB 5E03A 1Q0YH 4GW5A 2ZCLL 3V8OA 3S6CA 1MY5A 3OKOB 3G9VA 5DFVC 4FQLL 1CFQB 4HIHA 5E4EC 5IHZA 3TIEB 1NC4A 3ALXA 5BOZG 1HIML 3BQUD 3BP4B 1R3IH 2ZPKL 4KDWA 1WT5C 3MV9B 2C1OB 3TCLA 2LVEA 1YPZF 4X7SL 4XZUB 3C60D 4XHJC 3UROR 5T3XD 2ICWA 4HPYL 3UDWC 4F15C 3JV6B 4HS6B 2MPAH 2ZG1A 5IF0B 1NCWH 2VH5H 3B6SB 5FV2A 3SGEH 3X14B 2DM4A 4JHBA 5EUOF 5K93A 4ZD3H 3LD8C 2C1PB 4I2XB 3UJIL 5C7XL 4DN4L 3ELAT 4D8PA 1WWBX 3WKML 3I50H 2RB8A 1NGWA 4PYGA 1J1XL 5INCB 5KOVC 1Z0NA 4KKBD 1F58H 4MSWA 4GAYA 5JHDB 1EHNA 4DKFH 3X3GH 3PWVA 5DSCA 3SJVA 1Z9MA 4YHPB 3O4LA 4Z7WE 1MVFA 1OP9A 4GW5B 1P4BL 2BMKA 4WU5A 1OCWL 4BSVA 3LZFL 2R9HC 1HHKA 4Y4KB 3VW3L 4KK9D 1N2RB 1ZV5A 4I9WD 1R24A 1NC4B 1WF5A 1BFVH 4KUCF 3ZYIA 2HKFL 4YUEL 4TULH 1MVUA 3TCLB 4CDHA 3VFOB 3I9GH 2FX8H 2ICWB 3FZUC 1MFBH 3I75A 2O5XH 1JPTH 3MRDA 3KPRE 3D85A 3SDAB 3B9KC 3HC3H 4UOJA 1SYVB 3BIBX 5IEHA 4TVPH 3AAZA 1KTDA 3V6OA 2QADD 4D8PB 4AYFA 1NGWB 1P69B 4FQJL 3TM6A 4G3YL 3BO8B 3GSRA 2QBWA 3B9VA 1DN2A 4P2RA 5C86A 3SKMA 4J3VA 4DGVH 1IGYA 3O2WH 3PWVB 4LHUA 1J05A 2XZAH 4GLRH 3U2SA 5HDOA 5IQ7H 1AO7E 5EZOL 2BMKB 3TC9A 4J3WA 4R8WL 5DHYA 4PRNA 2IANE 3UYRL 1JMXA 1I3VA 3GHEL 4IIQA 2XWBA 5DZOA 2IQAA 2X4NB 1R24B 2JE8A 5GJSL 2A9NL 4YAQA 1P4IL 5C92A 1Q94A 1U2HA 1T7ZA 5CIPH 5L8LB 1MRCL 1KJMB 3HC4H 2KZWA 4X7TA 4C56E 1GC1L 4XC1L 3QSKB 2WWKT 4PIRF 4EI5A 4MWFA 3WXVH 1I7RB 3INUL 4MA7L 5DHVH 5F7NC 3QFDA 5JPMA 3FFDB 3QCUH 3D85B 1RIVH 1GGIL 1C08A 2Z9TA 5I9QC 1QA9A 4R90L 5EO9A 5IEHB 1I8IB 2WWMD 1KTDB 5T33L 2AJXH 2XA8L 3L7EB 1RK1A 5KS9E 1DE4A 5DC4B 5IM7A 1W8OA 1WFOA 3VU2A 3OKLA 3DSFL 3GSRB 2AEPL 5IVXE 5GS1C 4PJBA 4D9QD 4LHUB 1ACYH 1J05B 4O02H 4JM2A 5ANME 3WJJC 3U2SB 3VFPA 4TNVK 1NMAL 2AXGA 1C16A 1CF8H 4EDWL 5HJ3B 1G7PB 2B1HL 5T5NG 5DHYB 4PRNB 2UY6A 4Z7WF 4IIQB 4U31A 1ZLVK 4NGHH 1QVOB 1N0XH 2XWBB 2IQAB 5C07E 4ZO8A 2R2CA 3EYQD 3RA7H 4AEEA 4OCSH 1JNNH 1RUAH 3O11A 4KTEL 1WUNT 4YAQB 2ZZUT 5CGYD 1GPOH 3BZEA 2Y4SA 1NAMB 4FQ2L 3EJZC 3N9GL 5GISH 4LLMB 5K9QG 3BP5A 4XNUH 4FQPA 4KROC 3CD4A 4KTDH 4QKXB 3V4PH 2SEBA 1YYLH 1NGPL 2H2SD 3RIFK 2JKXA 2OL3H 1E4XI 3PV7A 3TO4D 4HK3J 3QQ9D 3HE7C 2AK4E 5EO9B 3G5YA 4NM8L 4U2ZA 3RNQB 4LDEB 4AZ8A 5E94A 2GCYA 2C9AA 5LWYH 1JL8A 3B5TA 4H0GA 4RZCB 1DE4B 3K2UL 4MX7A 3GNML 4F7EA 3OKLB 4UT9L 1JIBA 4GS7C 2NR6D 3QT2A 4J3OC 4PJBB 1LDPL 3I3EA 3ARZA 2BY3A 4JM2B 4K3DH 4UT7H 3VFPB 2AXGB 5DMKB 5CKAA 4L9LB 3PDOA 1FPTH 4MD0B 4OLUL 3OXSB 3ARFA 5JZ7D 4AG4H 3JXAA 5D1XA 4Q74A 3EDDA 3RWCA 2QHRL 3EYFA 2EYSA 1JHKL 4J4PC 4NQCE 4EOWH 2D0FA 4V1DD 3BP6B 1VB9A 1T66C 3UJJH 5E99L 1FYTB 4LLUA 5JIIA 2PYEE 1HYSC 2SEBB 3LKRA 3KXFA 4D9RD 2VXUH 3MLXH 5L7XL 1TIUA 4OI8A 1EVUA 3VGAC 3K4AA 4XTRD 3WSQH 5HHME 3VXOB 3EO1B 2AABL 5MERA 5JNYA 3G5YB 5I30H 3QQ3B 2VDMH 4N5ED 2B5IC 2AJZA 5KANG 2GCYB 4KZDH 1NCUA 3S3PA 5A43C 1NQBA 3N0PB 1AC0A 2FHBA 3O41A 4XRCA 2BVOB 3MV9D 4OZIB 2X89A 2UWEE 5KS9F 5KJRH 1FVDA 3L5XL 1GGCL 3WIHH 3S8WA 5TE6H 2YD8A 3CFEB 4LRIC 1JGLH 4O5LH 1UYWH 3CVHA 3FRPA 5KN5B 1OAXL 4FQCH 4OKVA 4F3FA 1DN0A 1INDL 3HZKB 1X5AA 3QIBC 3CJJA 2DM7A 3RWCB 1VFAA 2EYSB 4OLWH 2J7LA 5SX4H 2OZ4A 1UH4A 3MA7A 3RWEB 1RZ8A 4CNIA 2Y1VA 3FL7A 4JHAH 3QPQC 1WEJH 1U8KA 4FHBD 4W68A 4LLUB 4U6VH 4PRDB 1T2QL 1MCPH 1Z6JT 4LPTA 3RHWK 3LKRB 3KXFB 3OB0K 1A02N 5JHDD 4KQ3L 3VXME 2PTUA 1UWEH 1QSVA 4NT6B 3MRBA 4NNPH 1CD1A 1K3ZA 1YA5A 4FFYH 4Y4KD 3C6SA 4LVNB 5LXGH 2P5EE 3TPKA 1WAAE 4I3SH 2V17H 1QSED 3KHOA 1UM5H 1UXSB 4Z7UB 2A6DA 4GG6B 5LKNA 2XKSA 4PB9H 2CJUL 2P49B 5DURB 1L9NA 4Q6IA 4AIOA 3WFCH 3V6BR 1L7TH 4LRNH 3J8F7 4NN6C 4F7MB 3SY0B 1OLZA 1A6VL 3CVHB 3ULVC 4H1LA 4PJEA 2UY7A 3SDAD 3OKKA 1MHEA 3LY6A 1P1ZA 1I1FB 4UZGA 2X4QA 5FHAH 5BO1H 1FDLH 2P8MA 3FCTB 4GMSL 4LSQL 4XPHL 1U8KB 2F54E 1EHLH 4PRHB 1M7XA 4XP5H 5FHBL 3CC5A 2X4UA 1IAOB 2HT4D 4JFZH 2VSDA 2D03H 4JY4B 4PJHA 2FCBA 3SDDB 2MMXA 4HQQH 3MRBB 4WHTB 1CD1B 3DUSB 4PLJC 2J8OA 3OHXA 5GGRB 1C5CL 5GSVB 5KSAA 4EBQH 4UU9B 2C4XA 2DIBA 1QLEL 4P5MA 3T2QA 4JVWA 3LEVL 2FIKA 4OZHE 1QYGL 5E08L 2NY2C 3HMWL 3P3YA 5L88H 5IBUG 4DW2L 2BDNL 2AV7A 2I60L 4Q6IB 1CXFA 5CBEA 4NWUL 2Y25A 1CCZA 2UWEF 4V2BA 3W5MA 3GJEA 3DJ9A 4O58H 2VLKD 1JZ2A 3MXWL 1D5MB 3ESVF 1RIHL 1DBAL 1VPOL 2UYLA 5IFHH 5JXEA 1FVEB 4PJEB 1ZLUH 4Y89A 4OSUL 3OKKB 5HVHC 2FYYA 4PP2B 1T89C 4Q0XH 3SPVA 2X4QB 3KYKH 1LEKA 1YDPA 2R4RL 4P2OC 1EEYA 2X4SA 5HYSB 1NFIA 1W72H 1JFQL 5GZND 3CC5B 2DLEA 2X4UB 1XGTA 4O00A 3LRSA 5EU5A 3DARA 3NCJH 3AU1B 4JFQA 3DRTB 1EO8L 4GW1A 4Z7VB 5C0AA 3BKJH 3H6JA 1YEIL 2QLVB 3MRPA 5KSAB 1AH1A 1KLGB 3GIVB 3HG1E 1A6UL 2XPGA 3FMGL 3DV6B 5J1AA 3HAEH 4L3AA 1WAAF 3QPXH 3M07A 5CD5C 2R56H 1A3QA 3STLA 2AV7B 3UTTB 5CBEB 1PQZA 3WNNA 2W92A 1NFKA 1RJZA 4HLZH 1MHCA 5K9KA 3D9AL 3EZ8A 2CXGA 1O5DT 3P11H 1A2YA 5HI5C 4PY8J 1IC4H 3QUMH 2FYYB 2HG5A 7FABH 5DEGA 2HKHL 4OV6F 2EIBA 1LEKB 1RURH 2ZUUA 2EKSA 1KELL 1JMZA 1EEYB 3RX7A 4OD1L 1IZJA 3EDEA 2FL5A 1U8HA 3VH8G 3ES6B 4PJCE 2HP4A 4TSBH 3LRSB 5EU5B 4OCMC 4Z77B 1PAMA 1MIML 5IMMB 1SVCP 4GW1B 1TMCB 4YXKL 3PF2A