4HJJH

Structure reveals function of the dual variable domain immunoglobulin (dvd-ig) molecule
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
348
structure length
341
Chain Sequence
EVTLRESGPALVKPTQTLTLTCTFSGFSLSKSVMGVSWIRQPPGKALEWLAHIYWDDDKYYNPSLSARLTISKDTSKNQVVLTMTNMDPVDTATYYCARRGIRSAMDYWGQGTTVTVSSASTKGPEVQLVQSGTEVKKPGESLKISCKGSGYTVTSYWIGWVRQMPGKGLEWMGFIYPGDSETRYSPTFQGQVTISADKSFNTAFLQWSSLKASDTAMYYCARVGSGWYPYTFDIWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure reveals function of the dual variable domain immunoglobulin (DVD-Ig[TM]) molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-18
total genus 66
structure length 341
sequence length 348
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hjjH01
2OJZL 1DQTA 2XOTA 3FHQA 4OZIB 1I8IA 5FA4B 1J1XH 5HHNA 3SDAA 1KJ3H 5EZOH 2JB5H 5BS0D 5C9JB 2CDFA 1V7MH 2D7QA 1LO5A 2DLHA 1D5IH 1YNTA 1LE5A 3ORJA 3T2PA 2LVEA 5IBTH 1H8OA 5HHOE 5CEZL 4OAWA 4HIEB 5HDLA 4ZAKD 2VLLB 1MPAL 1VGEH 3NA9H 3FONA 1MCJA 5E95B 4XPTL 2RAMA 1FCGA 4YNYA 4JLRB 5C0CB 4NCDA 1AQDB 1PVHA 3MLSH 2QBWA 1OP5H 1H0DA 2HT2C 2Q1EA 2VKWA 4CN1A 5F1NB 1GGTA 4ODWB 4Z0XB 3VXRE 5C0AD 1S9WA 4YZFE 1RU9H 2FHBA 4H20H 3LEVL 1OTUD 4UDTB 4OT1L 1ED3A 1LEKA 1UB6B 4Y19A 4BFEA 5SWQA 1A7PL 1NAMH 4R7DA 2R1YB 4FQXB 1HYSD 3KPMA 5HGDB 1PKQB 4X6DA 8FABB 5J57B 1HWHB 2VDMH 5E5MB 1G7LA 5SWQB 1OGTB 4YFLF 2NXZB 5IESL 3TBSB 3U4EA 2CLZB 1YNLL 2P5ED 1FFOA 4OJFH 2PW1A 5D7LB 1N4XH 1E6OL 4OD1H 1IEAB 3NCYP 4P2RA 2D4FA 1ZA6B 2PXYA 5CJQL 5D7LE 1TCRA 4RA0C 1MI5D 3VXUA 2XKNB 3QDMA 1FJ1A 1JHLH 1H3PH 4JFOA 2IQ9L 3LKQA 5E8DH 1R5VB 2X4QB 1NANH 3AUVA 1U8HB 4K3JL 4X4YB 2FJHB 3KVQA 3S7GA 1PLGH 4LEOB 3QA3B 5JR1L 4QGTA 3KDMA 4RZCB 3QCUL 2FBOJ 5JW4Q 4WI8A 5CIPB 5GS1B 5ACLA 1KUMA 1UYWL 5KBNC 4WEMB 1A6PA 4OCSH 3TJHD 1YY9C 4NGHL 4U1NB 3VFRB 4HV8B 1G84A 3H9ZA 3MODL 5DRWB 5FGCE 1NPUA 4M1GL 1ZK9A 5IROA 2YUZA 3TVMA 3EO1A 3AU1B 3G9AB 3NTCH 2G5BB 4JFDB 2XA3A 1T5WB 3B2VH 1OPGH 3P11H 2X4TB 3O3BB 4PJBA 5C0NC 3WJLA 3SDDB 2AV7B 3STBA 4G80A 2W0PA 5C3TA 3I3EA 4XMLL 1RIHH 2XY1A 1XZ0A 3UC0H 1P4IH 5BZWA 3QXAA 4KRNA 1JWMA 2V5RA 5CLTA 4JFEB 2LTQB 2KPNA 4OLYH 4P4KC 1DBBL 2R2HB 3QCVH 3ZHLA 3S3JA 1A21A 1JTOA 3CVIH 4OM1L 1E4WL 3BPCA 3UYOD 4Y2DA 4FQHA 4K7PH 1IQWH 4X7EC 2B5IC 1CD1A 1NGWA 2WWKT 4PTUB 2MTPA 3EOBB 2ZNWA 3O6LH 3QEHB 3AC0A 2AKRA 1U8JA 4RWHA 4UNVA 3EYOA 4AQ1B 1DCLA 5AAWA 1LVEA 3G5VB 3UJTH 4HC1L 1QEWB 3MCLH 4JM4H 3SDCC 4GG6A 1DVFC 4MHHG 3VXRD 3OG4B 3GMRB 5IB4B 1YY8A 5E5MA 1S9VB 4APQD 2VISB 4PP2A 4UI2A 3IDNB 1U3HC 2BY3A 3UJIH 2Q20A 3QIWC 1IMHC 4MSWA 4HG4K 3EO0B 1YEGH 4MQXD 1EUTA 5JDJA 3E6HB 4W4OC 2X9YA 4QHUB 1BWWA 1CK0L 4JQVA 4K94C 2DICA 3O45B 3RKDC 1S7UA 3LS4H 2YPLA 3QDMD 4PJAB 4PUBH 3L3JA 4LLWA 5DJ2A 5SX4I 1FAIL 1HI6B 3C6SA 2R56H 4XPHH 1JN6A 5I1JL 2VSDA 2BJML 1JGEB 4UU9A 3TN0D 2MMXA 4P46B 2XN9B 3LHPL 4G3YH 1PG7H 2ITCA 5FV1L 1WWCA 1U2CA 3UJTL 1WAAA 4YDJA 4PTUA 5F72S 4GG6F 1T83C 2AJZB 1KJ2A 3MOAH 5B8CC 3CFJA 2XQYK 1VKXA 2EKSA 5I75C 1L0QA 3IETB 2BP3A 5KOMC 3T4YB 2H1PL 3OAZK 3TBYB 2V17H 4LDOB 3MACL 3W39B 4BH8B 1Q94A 4P5KB 1INQB 1MLBB 5B22A 4H25B 1A1OA 2EH8L 5E8OA 4HH9A 1FN4B 4DZ8A 1QFWH 2FJFB 2DBJA 4LSVL 3WDIA 3WIHL 2DM4A 4XP1H 1HHIA 4UT7L 1B4JH 5F9WC 1BQHG 2AEPL 4HK3N 4PLKC 1U92B 1XIWD 3MLUH 1A4JB 4V2CB 5IVNA 1FG2B 5E2TL 4RGMB 3U6RB 1DUYB 4HJ0C 2B4CC 1P6AB 2GK2A 4ZQKA 4N5ED 5D5MA 1VGKA 5J9PA 3SGJA 4LSVH 1IM3A 3DUUB 2YXMA 3OGCB 1EEYB 1ZS8A 4FQPA 3RWIB 4HWNA 1RZGA 4F7TA 4ESKA 3S34H 1NCCH 3ALXA 3QUZC 1EX0A 4YHPB 4QXTA 5IQ9A 3PL6A 4S0SD 1C16A 1RY7B 4UT9H 3VI4F 4FQCL 3I6KB 4RGOL 4Y4KB 1BOGA 2P8LA 4HS8L 1ORSB 4JHWL 5HD8C 5ADOH 1QR1A 3GSQA 4X6DE 5D7IF 3V8CA 1F6FB 3LHPH 4LARL 5D1ZD 1LEIA 4MAUH 3FFCB 4XPHL 5FGSA 4Q6IA 5J13B 4YK4C 1XZ0B 1EH9A 2BHZA 4FFVD 1YNKH 1ITCA 5I2IB 3CVHL 1ZTXH 4P2RB 1I3RB 1OD9A 1AP2A 4NQDB 2WUCH 5E94B 1XF2A 1KIPA 5FYLE 4Y4HD 2GT9B 1CLYL 2VAJA 2F74B 4G8GE 3O2DA 4HIHA 5JLZA 2DD8L 2J1KA 4CVXA 1QLEL 1JPTH 3T2NL 5L8JB 4YDVB 3IS0X 1AHWB 1OT1A 3WNPA 4APQA 4PJGE 4YH6A 4TSAH 3O0RH 1UQSB 4QTIL 2NY7L 1MFBH 1TJIL 4OV6F 1QOKA 2YUVA 5LCVL 3EOYG 4OLYL 4P9HH 4X4ME 3OGOE 3P4MA 4MD4A 1IBGH 3GBMH 4OCYH 2F15A 2E7MA 4QXUH 4WWKD 4H88L 2EYSA 4PGDB 5I1HH 2HH0H 3QDME 4N9OB 2GJ6E 4LCWB 3S37L 3F8UB 5CEXB 1JVKA 3L3HA 2FNBA 5BOZG 4WJ5A 5F7MC 4TSBL 1LEGA 3QXUA 3TIDB 5MHSD 2VR9A 1FJ1B 2WBJB 3MJ7A 3RRQA 2X4OB 5C70A 4ZTOH 1RIVH 2CLRA 4L8BA 1FH5L 3QQ3A 4H26B 4OAWB 1N0XH 5BZWB 1S7VA 5FYJD 3W2DL 1DZBA 1AP2B 3MRBA 5I66A 2ZSWA 2FO4B 1G6RA 1BECA 5CD5C 4O9HH 2OI9B 4HX1A 3REVB 1KLUB 2FB4L 2V5SA 1CS6A 1U3HB 3QO1A 3MMEA 4TNWK 4ONHB 4JY6A 4F8QA 5GRJH 5IEHA 2YUXA 5ENWB 3DRTB 3LPFA 3DOSA 4L3EB 5EZOL 4WGWB 1CU4H 4HT1L 5I19H 4D2NA 1DBJL 3GDBA 4OCRH 3HE6D 1NDMB 3HMWH 3IGAB 3LSOA 5FXCH 5KANG 3EDFA 3O4OB 4NSKB 3IDIB 2BVPB 1BREA 2YD2A 5IMKA 5TGBB 2ATKA 2ADFH 3TBVA 2A6IA 4UV4H 5D7KE 2J6EL 5IWLC 5DRZB 5FAAA 1IAKB 3QI9C 2XWBA 2G9HB 2MPAH 2DAVA 1Z2KA 1FV1A 1E6OH 2VL5A 1DBJH 4FFWC 4UDUA 4GW4B 1OTSD 4NZTL 1SBSH 5C6TH 1VKXB 4ZFGL 2OK0L 5I18H 5GXBB 1NCWH 1QSEE 2D7MA 2BFVH 4QRRA 1ULVA 1MVFA 3KPNA 4HJ0D 3PQYD 3O4LB 2W9DL 5EOCL 4KKLC 1IGML 3FO2A 1AR1D 1AGCB 1GHFH 4MJ6A 1SMAA 4NM4H 3HG1E 1YEEL 3O3EA 1BZ9B 4ZUUA 2Z8WC 4JRYE 2RFXB 5EOTA 3NCBB 2BK8A 3C6SB 2VXVL 5F7FA 3ZT7A 2J6EA 4PBXA 2D4DA 4YHNB 5JXAH 3MA9H 3V7AG 5L2KB 3D25B 1KPVB 1DTUA 4UINL 4LOUC 2VDNL 7FABH 2MQCA 4GH7B 3BYYA 3OBAA 1F6AA 3FOLB 5IB3B 3MRFB 4OFVA 2P48B 2CPCA 2ICCA 1Z9SA 5IIEB 3RWGA 5DR5L 2BC4B 4JPKL 5JOFA 4ZAKA 4ENEC 4HKXA 2UY7A 1CIUA 3EYFA 4KJYB 4LASL 3HC0B 3CXHJ 2W38A 4WTXA 5JZ7C 3JWDC 1QBMH 4D8PB 2JIXA 1A9EB 5E8PB 1MJ8H 4DGYH 2G2RA 4CU8A 3SOBL 3LN4A 5T1DH 2UVFA 2QKIA 4XXDA 4POUB 3SJVB 2V9TA 3IF1A 2QADD 4Y2DB 3ZDYF 1O0VA 2AEQH 1PW3A 4TUJA 5SWZE 3H9SE 4L9LA 5LGJB 3LH2H 3SJVA 3C60D 3RUGE 4MLIA 1HILB 4Q2ZA 3VXOA 5B3JF 5D1QA 3SDAD 1A3QA 2BSRB 1BZ7B 1ZT4B 2BCKB 1GGCH 3REVA 4HS6B 3H0TA 1YEEH 3G6JB 5E6IB 2W9EL 2NNAB 3HPJA 4I3RH 3QWQB 1H0DB 4KI5C 1MCWM 2HLFC 2FEDD 4CMMB 1JWUB 5C0EA 4P2OD 2IJ0C 3P2TA 5JPMB 2WBJA 3CH8A 2DJ4A 1U91A 2IQAA 3GHBL 2XXCB 2VLJE 2VITB 5F96H 2NW3A 3ZTNL 2WANA 1KTLB 2PYEB 4O51B 4PJDB 4U6XA 4PJXE 1XF4B 4JFZL 1FZKA 1VSCA 2I5YH 4S1SL 3IFNH 4NBZB 5DRZA 4GAFB 3JWDL 5DD3L 4PJ9C 4E41A 2GITA 1XGUB 3AMLA 5E8EA 5IK3B 3AS2A 4JQIH 1FVDB 3EFFA 5D7KD 3UTQA 2CSPA 1UXWB 2CK2A 3OKDB 2YD4A 4YFEA 2HJLA 1U8MA 3GSOB 1DLFL 1IE5A 4YFDB 2K9UA 1PG7X 3O9WB 3MC0A 2ZG3A 2APTA 4XB7A 1RULH 2GSIA 5DJAA 3HLAB 4JFOB 3C2SA 1FYHB 3GB7A 4OI9A 1AXSA 5D72H 4GRLD 2VDPL 2EZ0C 3S4SA 5JQ6L 2AJXL 3G6JE 3O11A 3PQYE 4HWEH 3I6LE 3CDCA 1LD9A 2H1PH 2H9GA 1CT8A 3RUGF 1XGYL 3HNVL 3P0GB 4WO4A 2NY1D 3SY0B 3WDJA 3AY4C 1T1WB 1SQ2N 4K9EC 4NDMB 3WN5B 2CLVB 1I7ZB 5GS0L 3ZE1F 4LP5A 4NHUA 2QHLA 3JXAA 1HQ4B 2OSLA 3SKNB 1JPSL 1F90H 1G7LB 4G6AC 1T0NB 3AM8C 2PO6A 1RUML 3X14A 2QQKH 1B0WA 2NY5L 5LGHH 3I75A 4G8FB 1ZT7A 5E6YA 3W5MA 2R4RL 1ZHLA 1G7PB 1CDCA 4MDJB 3B9KD 4MNQA 3VXUB 5I8EA 3TIEA 1OAZH 1J12A 2F58H 4D0CB 1NFDB 2I60L 1MELA 5E8PA 2Q8AL 5B3NA 3KYKH 4FG6C 3MRDB 4AY0A 1KLUA 5DFVC 3D3VD 1X5FA 3NFSL 4Z7WE 1JFQL 3PDGA 3UBXG 4D9RD 2F53A 4I13B 1R3IL 2FIKB 4P3CH 4PJAA 1UEMA 3V4VH 4IS6B 5I1JH 5IHZB 2O61A 3O3UN 4KTYA 5CAYB 1EO7A 4P3CL 2AI0L 4GW5A 5A16A 1G7QA 5CZVH 1P2CB 3VFWA 4TVPE 3UPCA 2FO1A 4XVJH 3V7AE 4L8DB 5CBAA 3G5XA 3VFMB 4NZUL 3EYSL 4OCSL 1FZJB 4PJ5E 2X6MA 3MV9E 4WI4A 2AJXH 3QIBA 5F71A 5DTFA 5KZCD 5DWUH 4L8CB 5IHUH 3ZLQC 4E0RA 1FZMA 3ARDC 2W60B 3BDYL 5I16B 2WBJC 5KAQF 5JPNA 1ES0A 2PCPB 4J23A 1KB5B 4X7CC 1G9MH 3QXDA 4MMZC 2VXQH 3CDYA 3T8XA 1CFBA 5FV2A 3P4NA 1EXUB 2W91A 5HHVH 2DTSA 1OSPL 4QRRD 1VFAA 2PCPA 4OIIH 1TIUA 4YC2C 1UWEL 1N64L 2GW5A 4RMTA 1VESA 1XR9B 4FOMA 4I77H 4L9DA 1A6TA 1ORQB 1RIUL 5C8JA 5C07A 4NM8L 5ICYA 4Q0XL 3T08A 4OM0H 4WU7B 5DD5H 2DQCH 5HI3C 3U46B 4MXQC 5CBAB 3FN3A 4HUXA 3TJEL 1JWSB 1S5IL 4OGYH 1BVLA 3VE0A 5JW5A 5KSAB 5HGBB 3ZSTA 2VXSH 3DARA 3GSQB 4G6JH 3RWFB 2XPGA 5FM5O 1ZVSB 3EO1B 4I0PA 4Y4KA 1QYGH 4Y89A 3Q5TA 1U42A 1D6VL 3I6LD 5DURB 1VFBB 3W39A 1MNUH 5C0DA 5DQ9B 3DBXB 2Z35B 3FQRA 4AL8L 3R0MA 4LLVB 2AXJA 4F7CB 3VXTA 5H37G 1QSEA 4PS4H 4WNQB 1GOFA 3EJYC 1H3PL 3B9KB 2VIRB 2Z8RA 5I74C 4OSUH 1YN6B 5K9OA 3NIGF 5KVFH 1S9YB 4NC2B 1NQBA 5FHAH 3HE7C 4YBHA 1NBYA 5M95B 1PZUB 1ZHLB 3VGAC 3U0PB 4HS3A 3U83A 1IAIL 3VFVA 2X2YA 3QDHA 2J8OA 2QHRH 5SX5K 4LQFH 2Y36H 4YUEL 3MA7B 3SGEI 5AD0A 1GGYA 1UM6H 4NCC1 3QDMB 1AGBA 1CGWA 1LO3H 2NLJA 3O6FA 5IT2H 1T1WA 3BGMB 1KJ2H 3NABL 1F3DJ 5D1XD 4TOYH 1QFUL 3QFJA 3CLEH 3KPSE 3SGKC 2B0SH 1IC4L 5FUCC 4Y4FD 1D9KA 4KPHL 4UIKL 1Q94B 2R0KL 4NRZB 3SKUD 3CLFL 1CDUA 5DD6B 1X5LA 5HI5C 3RUGA 3DPBA 5IB1B 5T5FH 2MQ3A 3LQAC 1SVZA 4L29A 2C4FT 2NY6C 3CSYA 3RIFF 2PN5A 5CEYA 4JVWA 3RA7L 1NGZA 4JFQA 3RNKB 1MCDA 5J0BA 5HGAA 2A1WH 3OKYA 1ONQA 1YMMA 3FFDB 3H3PH 2OMNA 5EBWB 2XG4A 4GRMA 5JHDE 5C0AE 3CLFH 4W70A 3L3OA 1KN2H 1U8QB 3MV9D 4YXLL 4PPTA 5DMYA 4PJHE 1GIGH 5CP3A 1MRFH 2Z9TA 3IRPX 2WQRA 2AXGB 5JOPE 3VFVB 4JO3L 4LEOA 1EEUA 4JFFE 3I02A 3DETC 4XCNB 4KJPD 3G6AB 4P46C 2X5PA 2QHRL 1FFPA 4G9FB 4LVOB 1C16B 4PJBF 1U8NA 1BGXL 5F1KC 3TA3C 5J1SC 2NY6D 4CRPA 3K8LA 3UYRH 2I9TA 1IGMH 3V6OC 1T1ZA 3BKYH 3B83A 2UV3A 3RJDA 1RUPH 1A7BA 1K9TA 2ESVB 3NFNA 4LPXA 3WL9B 2BMKA 4HCRL 4WEBL 3AM8A 3EDDA 2YPKB 5KSBE 4C54A 2ZCHH 3O9WA 2HTKC 4MAYC 4J3WA 1B88A 4PJEB 3O9WD 1ZHBA 4DQOL 1WSST 3S37H 2EECA 3VFOB 4JFED 4Z9KB 2Z92B 4HPOL 5FHBH 3Q5OA 5ICXB 5J4MA 4LKXB 4OZFH 1JNHB 1JNNL 1UYWH 1YC7A 3QXAB 4ODXA 3MRJA 1RZJL 4WDIB 1MH5A 5HSFA 5E00A 5C7XL 3QXTA 4QTIH 4DKFH 4XCCL 2B5IB 2X4RB 2X4QA 1NGXA 3CFJB 4CVWA 2FBJH 5FOJA 1F5WA 3A67L 3MCG1 3MRFA 3MZTA 4FXLA 5JA8B 3S6CA 4HQQH 4G7YL 3KAAA 3UTPD 3STLB 3VH8G 2BNQB 4XMKL 4WHCA 5T3ZL 5T33L 1Z5LA 5DTFB 4QOKA 1G9NL 2BNRE 3LVEA 5HYFA 5I19L 3MRKA 5T1KB 4XBEL 1INEH 1IAIM 5C0JB 3V52L 3QEUB 4TSBH 3BIKB 5DSCA 5ILTL 4EIGB 4W6YB 3K4ZA 4OQ1A 3HI1B 1P9MA 2VZVA 5F6HI 1K2DB 2CK0H 3MV9A 5FO8A 3UTSE 2HRLA 4ZOAA 4R3SA 3NIFF 2X4RA 3DHJA 3VD3A 1IC1A 5GQBA 2R1WA 1H9VA 1Q72H 3LD8B 4AIXA 1R3IH 4X9IA 1IEBA 5INDB 4FXKB 1LO4H 2ATKB 1QO3A 4NBYB 4OLZH 2R15A 3NH7H 4Z78B 4G8FA 5JOPD 4N0YH 5C0FA 3CX5J 4RFNC 3D25A 4OD3H 4JFFD 3X14B 5D7IE 2CKBH 5IV2B 1MFAH 2EH7L 2EYTB 1RZKH 3S9DB 4GRMB 5ISZE 3WL9A 1XT5A 5IMMA 1I1FA 1UEYA 2XWTB 3O6FC 2E6JA 2BSTA 1MCLA 1AGCA 2A73A 4PRPB 2DLFH 4X80L 5EIIB 1OAYH 5D7SL 2KBGA 4LRIC 3KPNB 3WV0A 5I73B 3MRPB 5HYJE 3FHAA 5A40E 3RI5F 3FCTA 3PQYB 1HH9A 4UT9L 4H26A 1RJYA 1ZANH 4JO1L 4D9QD 4TSCH 2R69H 1N5YH 3F7QA 4J3TA 3E3QC 2GSIB 3FONB 1UFUA 3SKJL 2KL6A 3CUPA 5I6XB 3MGOB 5CP3H 1CFTB 1TQCC 1E6JL 1TETH 4S1QL 2GK0A 1BEYH 2ZOLA 4N8CL 3VA2C 4RWYH 2WIIB 1NGPL 2OR7A 1WZKA 4J3UA 1BD2B 4BJLA 5F96L 3ZTNH 3TBWA 3V4PL 3KYAA 1LP9E 4P23B 1Y0LB 5DQDL 1A64A 4JO1H 3MLZL 3IJSA 3AROA 1G7JA 2XYCA 4DAGL 2GY5A 3QUMH 2YA2A 1F6LL 3NAAH 5TDNA 4CNIB 4Y88A 4U31A 4NQSB 3BD4A 2NY1C 4FQJH 4Y19D 4J4PD 4X99A 4UT7H 3WFEL 4RWYL 5HY9A 3N1FC 5JPMA 4K9EL 4G43A 1YYLL 4YX2L 4DTGL 1RZKL 2EZ0D 5HYQA 5C0DB 3G5YB 3UEZA 2Y9RT 4NQDD 1QNZL 3UROR 5ACZB 5EZJB 4LVEA 2EO9A 4AH2B 5E94A 4FG6D 4Q7DA 1A4KA 2I60H 2R1XA 3VGAB 4L8BB 2ZUXA 5D1QB 1CCZA 5LAXA 3QEQE 4H20L 4GKNA 4K2UL 5CZVL 3B9KC 1UH2A 3O6MH 4CL7A 3KS0H 3BQUA 5FECB 5F9WB 3D0LB 2LAAA 4OCXH 2A6KB 2X4PA 3M1BA 5KVGH 1UB6A 3L5XL 4M03A 2ZUQC 2IPTH 3HZMA 1ZA3A 5IB5B 2BOCA 1MAKA 1SVCP 1OW0A 2ZKHH 1GJIA 1ADQL 4LIQE 3G5ZA 3TPUA 4WEUD 4P2OC 1G6VK 3QUYC 2CMRL 2YPLE 2CO7B 3UX9B 1WBYB 1T0PB 4ZO9A 1N3NA 1VFBA 4DVRL 4PRNB 1NAKH 3SKMA 1FBIL 1CZ8H 3CSYB 2ZUSA 4X4XB 4BQ9A 4JB9L 4HW6A 5IVXB 2DQEH 2BDNH 2E6QA 1UACH 1FG2A 4MNGB 2FDBP 2VLJA 3V79C 5DVOA 4I5BA 3PWVA 3HE6A 5DRNB 5GSVB 4MS8D 2KUTA 4NQDA 4AEHH 1EO8H 4QHLB 2UZYB 5EA0H 5C09E 4GLRI 1OY3B 3FAXA 2BSTB 3QCTH 1E28B 2IBGA 4GJTB 5J13C 1G0DA 4PJ9D 1A6TB 1XMWA 3D18B 1H5BA 2VDPH 3B4NA 1R6VA 4I3GA 2J5LC 5JW4M 3NTCL 2F5AL 1U8PB 1T1XB 1TZIA 3N1PC 4KZEH 1S7QA 4K7FB 3T3MF 4DOHE 1M7IA 2ICES 4Y5XA 3I6KA 4O4YH 5E8DL 1T89C 4MJID 4N0FB 5D2LF 1NC2D 1NDGA 3KPLB 3V5DA 5FYKL 2XN9D 3C6LA 4QRQA 1M7IB 3DXAA 1NEZB 3W11D 3QZWG 4PGJA 4OB5H 5IVZB 2OQJA 2UWEF 2G75A 3SO5A 3EAKA 1YN7B 3JV4A 4XVSL 1TZHA 3O8XA 1HXMB 1BQHB 1YPZE 2XWBB 3GK8H 1K4CB 2OP4H 3UPRB 5A2KH 3LEYL 4OI8A 1W2KT 4M43H 1J8HA 4ORGA 3AS1A 3WJJC 3ARFC 4JM2A 4PJEA 3HI1A 4NBXB 5BQ7B 4LBEA 3S4SG 1CFSB 3QWOA 4QEGA 3B2UC 3KLDA 4DQOH 2W0FA 1S9XB 5BXFB 3SE3A 1DQQA 2P46B 1X5AA 1TMCB 1PFCA 4C58B 2YK1H 2A6DA 1FE8H 4MGXA 1DN2A 1E27A 5FGRA 3MGAA 4IOIB 5LBSL 3DO7A 5JTWA 1KCUH 5DC4B 1WCBA 1QPPA 4CADB 2C5DC 4K71C 3EYUH 4P2OA 4HWBA 2CGRH 4R8WH 1A7OL 3MLYH 4M9PA 2XN9A 1XF3B 3ZE2F 4HKZB 5LGKA 1KPUB 1BBJB 2DL2A 3QJHB 1KYOJ 3UXFA 3WO3B 5E2WH 4L8CA 5AAMA 4RRPA 4JRYD 2DM7A 4F3FB 2P5WA 3DURB 3S3PA 4RAUB 2GYSA 1EAPA 1JNHA 3GKZA 4ZDHA 4PJHF 5EC1A 2NY4B 4XXCC 4YZFF 4LSQH 1CDYA 3MRCB 3UZEA 4DKDC 4HD9A 4GRWB 5IW1A 4KRMB 4MWFA 1BFVH 4KUCF 4O02H 1AR1C 1NCAL 3BUTA 3NN8B 1BFVL 4NPYB 5HYQB 1HHJA 3S4SB 1V5JA 1N0LA 4EUPG 5D2NB 2O61B 4PJGB 1MFBL 1JZ7A 4QKXB 1GGBH 1U3YA 5C6TL 4KKBC 4HIIA 4QT5B 4EZMA 3ULUD 5L6YL 3DJ9A 3CX2A 1GPOL 4N0CD 3LRHA 4H0GA 4F7MA 1GZPB 2QR0A 3BP7B 2UY6A 5BV7C 3OJ2C 3CCHA 1I8LA 1KJVA 4JFPA 4FQCH 2ZUUA 4O2EB 5ITBL 1ZAGA 2DJSA 3HUJB 4PJHA 3QUYB 4WWKC 5DJ6B 4EQ3A 2PYEA 2I07B 4QRTB 1T66D 4O58L 3HE6C 3SJVD 5JO5B 1QR1B 5F8RC 1RUQL 1MLCA 2X4UB 4MA7H 2VITA 4DKFL 1ODAA 3WBDA 3QZWA 2J2ZA 1VA9A 4RQQB 1KJMA 5E2WL 1I7ZA 4UT6L 5EWIL 2B2XL 4H8WH 3MV8A 2AK1H 3OKNB 4HS8H 4D94A 2VLRA 4ODSH 1CIDA 3BZFB 5JMOC 3KLHD 4PJCF 2VXSL 5DD0H 3LKRB 2BNUA 5E4IA 3PE9A 5ETUB 3H3BC 3H42H 1EEYA 3RIFK 1F3RB 2RBLA 4QT5A 1D7FA 4W81A 1MNUL 4Y5VB 2YMXH 3ZHDA 4I77L 3PABA 2EC9T 4ZNEE 5KZCB 5HVWA 2DTMH 3WNLA 3LKPA 2VXUH 3MACH 3S36H 4B7LA 1U36A 4F7PA 2ZOKB 3ZZ1A 3VFSB 3WHE1 5JA9A 2NPLX 4KK8C 2YXFA 2HYMA 5EDXA 4G8IB 4EUPH 4OTXL 2W59A 2R9HC 1EJ6A 2JCCA 3K0WA 3F6IA 4ZTOL 1TJIH 3IXAA 4WHDA 2VQUA 3VRJB 1XCQA 3QIUD 4R90H 3ZKND 5EO1A 2BJMH 5JDSA 1EDQA 4RGND 3WS3B 2DOCA 4YXKH 5CSGA 4PR5A 1FVCA 4ETYA 5K33A 3Q0HA 1GZQB 4MD5A 3MPCA 4B53A 2J6EH 4N5EC 4PP1D 4NYLB 1X6NA 4YXLH 4P2YA 1WFTA 1S3KL 5FKPB 4LLVA 2GJZA 2NX5D 1Q8MA 5D93C 5EC2B 4PLKD 4P9HL 4KDTA 1CR9H 5BMFH 2I27N 4NRYA 3HAEB 1FNSL 2HVJB 3X12A 5E2VL 2B20A 1JI2A 1ZSDB 3LQZA 4YO0A 4ONHA 4J12A 4WW1A 4BSJA 1X9QA 3A6BL 1YYML 5F3HA 4KROB 3QUZD 4B41A 4OKVB 1N0XL 2BOBB 3CGTA 5DJZB 5E9DD 1AY1L 4C56D 3TNNB 2ZPKL 3D3VE 3L5IA 1S7VB 2X89A 4U6YB 4YC2B 5JW3H 2ILLA 1UA6H 5DFTA 3VI3E 1FBIH 3HZKA 1ND0A 4KK6C 1NCDL 3NCJH 4HK3J 4ODVL 1RUKL 2VLLA 1DBKH 2DQIL 1BVZA 1YUHB 4UOJA 4RGOH 1G7PA 1CBVH 4C4KT 2RCSH 1V3JA 4RFOH 3R1GL 4NJAH 2QJDA 3SE3C 1S7QB 3JTSB 4QRPA 4U0QB 1IGTA 2AVGA 5D71L 4X83A 3RVWD 2Y5EA 3NCCB 1MHHA 2A0LC 3SGDH 5BVPH 3L5XH 3DRQA 3FB7B 4U1MA 4NFBA 3MRIB 1FYTE 4KHXL 1WEJH 3I3DA 5CZKA 3OSKA 2RFXA 5EOTB 2AK4B 1E4WH 1U3HD 5EB9A 2XTLA 3HNSH 2ZUWA 3KPSA 3SCMB 3TYFA 1AI1H 5DJXA 3WIIL 3MGTA 1P7QD 3ARPA 2UZXB 3DSNA 3V6OA 4G8GA 3ZHKA 1N59B 2E3VA 4Y1AA 3L3GA 4FTVD 1CLCA 4N8PA 4G9FA 4WFHD 2XWJA 1A5FL 5HI4C 1AQKH 2XZAH 4JREC 3WUWG 4UV7L 5F1IB 1JZ8A 1F4WL 4MYWB 4DN4H 1QTYT 4PJ8C 1ZEAL 1FORH 3TN0C 3P0YL 3K8MA 3E1F1 1FO0H 2QSCL 3IVKA 4R4BA 3ZTJG 1HDMB 3C60B 3JVGA 3QQ4A 3HE7B 4P4KD 4P5TA 5T1MB 4BSVA 1B2WH 2QADB 4PJ7F 5E5RB 4NO2A 3IDJB 2IAMC 3QIWA 1ETZB 2Z8VC 1CFVL 3PXHA 4ODBD 3FO9A 1MCOH 3TWCL 4ONGL 3BQUB 5FECA 3PJSA 1QP1A 1U8HA 4R2GD 2LVCA 1FG9C 5C0ND 5JR1H 2C7UB 1MHCA 4F7TB 5EUOB 4JDTL 4DCQB 5CBEA 4IOFD 4F8TA 5BZDA 1F97A 3VD9A 4U1LA 1AH1A 2L7UA 1A7NH 4WO4B 4CVZB 3FT4B 1AJ7L 3SHSA 4ZYKB 2BERA 4WTWA 5HDOA 2H9GB 4P2RD 5D8JH 5KJRL 1RZ8B 2NX5A 4WU5A 1BZ7A 5IBLC 2DQFB 4X80H 4L4TD 1YY9D 1JWSA 2A9NL 1TXKA 3HNSL 1XIWB 5L6YH 1MJUH 3PDOB 4H5SB 4JPWL 5E1AA 3OF6A 4CU7A 3ZDYE 5D7IA 4D3CL 4XXDB 4CNIA 3WFHA 1HINL 5CJXC 3QYCA 2IH3A 1WTLA 1R3LA 3B9KA 3HN3A 3NH7L 1P1ZB 3GGWA 3UYPA 1N6QH 5L0QB 4NHCL 3OAUL 4RMUA 5F9JA 4PBWD 3LZFH 2DKMA 4WI2A 1JGVL 4WFFE 1T22A 2ZOLB 5DS8B 2IH1A 4XZUB 4CDGC 5HYSB 1IM3B 3DUUA 4PG2A 3FT2B 5ID1B 4AG4L 3O2WL 4NP4H 4OZGA 3IAQA 3RWFA 1MEXL 1MJUL 3ULSA 4XNUL 1T04B 5KSAA 5D5MF 2WINA 1R5IB 3MJ8B 5IFAH 1T7YA 3QUYD 3UDWC 3ZTJH 5J8OA 2R2BA 5M94B 4Y5YA 1OM3L 5JHDD 5IM7A 4AZ8A 1LGVA 4TULH 4M9OA 3S35L 4C83B 4E41E 2YRZA 3RL1A 2XTJC 4WVRA 3RY6A 3IDYB 1KCUL 4AM0B 3BEVB 1OTUC 4JRXB 4NQED 5FCUH 2CD0A 4Z95H 1BBDH 2FR4B 4GXVH 4MMXC 1EHNA 3W0WB 1G7IA 1AXTL 5IW6A 2HT2D 3SE4C 4MNGE 4ERSL 3DGGA 3KNBB 1UKQA 3VD7A 4WFHE 2X9XA 1PX3A 4JN1L 1NBVH 4Y1AE 5ESQA 2LU3A 3B9AA 3QAZC 1GOGA 1S8DA 3C5ZB 1FGNL 3HZKB 3UZQA 4MCYA 5BRZD 3JWDH 3V0AC 3Q6GL 1CXLA 4DVBA 4PG9B 2VZSA 4X6CB 4S1SH 4Z7UB 1ZA3B 1NGYA 1FORL 2CKNA 1PLGL 3G08A 4Z7OE 3C9NA 3M1BB 3NPSB 4WV1C 1HIMH 2BC4A 1DBBH 3FQUB 4EI5D 1JF1A 3FB6B 1J0YA 4JO4L 2EDOA 4U1SA 3IDMA 2DWDB 1IL1A 2XY2A 4BQBA 1NMAH 3K3QA 2FATL 4KXZI 4CJ1A 4AM0A 4FFZL 4X9FA 3SDXF 4B7IA 3QO0B 1JPGA 5DZNA 4C83A 5ICZB 4S1DC 3VGGA 3FB8A 2HFEB 1MLBA 3SDDA 1T5XA 5EU7C 2CRMA 4X7TB 4KRLB 1MCKA 2FD6H 1TITA 2NY2C 5GRZA 1FLTX 3GMNB 1ACYH 5FYLL 3TT3L 4L4VE 3O4LA 2CRIA 1DANU 5EU7E 3JSSA 1EFXD 4L4TE 4LCYA 5I1GL 5TDOA 1AGFA 2VKXA 4ZAKC 3RZWA 3ES6A 3DI2B 2F5BL 3D3VA 4H8WL 4GAJL 2GKIA 2PO6D 4QRPD 3UTPE 4AT6B 4N0UA 4Y4FB 5TFSH 4JFHD 4PJ9B 5MENE 1PYWA 5L2JA 3IFPA 4XVUC 4JPWH 4YR6A 2E9WA 3KDMB 2APBA 5D93B 1NAKL 4PYGA 1PG7W 2EDRA 4JCLA 1KCVL 4ZUTA 2EDLA 2YC1A 2HKHL 3PWNA 5I1DB 5F7KC 4NSKA 1CT8B 4LCIH 1I1AB 4WFFD 1XIWA 4Q74A 3IGAA 4PLOB 4XNXH 5ITFB 4NJ9H 3ROLA 4BELD 4U1KA 5JHLH 4OZGF 3VG0L 4UTAH 4BH7B 3ZYIA 4Z76A 3CAFA 2AV1A 4XWOC 4CVUA 1A3LH 2ADJA 4KXZH 4EIZC 3QDJD 3U1SH 4M61A 5EIIA 1I7TB 2VDRL 5FYKD 2F8XC 2Y36L 2PKDA 2Q7YB 3B43A 3LKSA 3BZ4A 2VO5A 1TVBB 4G5ZL 1QSFE 2AQ2A 3LRGA 2ZSWB 2DD8H 4HWZB 1U3ZA 3U4BH 5MI0C 5DURD 3MRIA 4Z7VE 2D03H 3ULUL 1A6AA 4E41D 1CLYH 1HQRB 5JHDA 4UNTA 1U95A 1U58A 2QEJA 1IC4H 5KVFL 2XTJE 3GJFK 1JGUH 3T4AA 3BPCB 5F7YC 5KVEL 3ZYJA 1YUHA 5FOBB 5IT2L 5DJ8A 3QUXB 3U79A 4G6KL 4KFZC 1D5BA 4NKIL 3V8OA 3GUTA 2AXGA 1MRCL 1FIGL 1O7VA 4L1DA 3LKQB 1LQSR 3CH1B 5J89A 4FZEH 4LARH 3WFDH 3MV11 4NN6C 3B8SA 2P5EE 4LCWA 3BHBA 3MOBH 5MEPB 2D0FA 5MEOB 4P9HC 1MFDL 4XCFL 1B0GA 1YQVH 3EGSA 1S5IH 4OGYL 3RWIA 4GAGL 4WO4D 15C8L 2VLMD 4YWGH 1TQBC 3IDXL 3NIDE 3QDJB 4NNPH 3RWHB 4N8VA 4GW1A 2ADJB 4P46D 2AEIT 4OD2A 5D1QC 3DSFH 3V4UL 3T3PE 5J6HA 3HR5A 1FP5A 3VXMA 1M1SA 1MCCA 3TO4C 4HIXH 1OHQA 3GJEB 4PJ7A 4MJ5B 2OBGA 4X98B 4JRXA 4ODHL 1HKFA 2GJJA 4IMLB 3MROB 3QPXL 3T0EB 4ZFFA 4MB4A 4ODHH 4M48L 5TPWL 3VXUD 1DR9A 3O9WC 3AY4A 4Q9RL 5FKPA 4H0IA 2APVA 2MHAA 4GQ9L 4C4KO 3TH3T 3BQUC 4B0MM 3WLBB 25C8H 4IM8A 2VZTA 4XNZB 3TVMC 5IR1B 1KV3A 4AT6A 4WUKL 5HHPB 5IKCB 3BP6A 2PETA 1EPFA 5CKAA 3QJFB 3IDXH 3RTQC 3DX9B 4TUOB 1TZHB 3CC5A 3O8XB 4PGCA 2CK0L 1XEDA 3LRSB 5I1GH 1MWAH 3QWRA 1IAOA 4YIQB 2BOBA 3Q3GA 1NUNB 1RZGB 5MEND 2Z31A 4BZ2H 1AD9A 2IBBA 5C0BE 3WFDL 2NY7H 4U2YA 1FNGB 1Z6JT 4P3DA 3RHWF 1DBML 4ZSOB 5JW3L 2XIDA 1J8HE 5I8CA 1LNUB 2L4OA 3AXLA 1WIUA 1G9NH 2I26N 1QRKA 2IANA 1EJOL 4HF5H 3FO2B 4HHAB 5CGMA 5I1IL 4QYOA 4KKCC 1VPOL 2AABH 5J12C 4LEXH 1S7SB 3ZE0E 4A6YA 1E28A 1ERNA 5IMLA 3TO4D 1TDQA 3QDJE 3C2AL 2W1NA 5TF1L 5CHNA 4YPGB 5IJKC 4Y0GA 1CG9B 2N56A 4DVBB 1JHTA 4PGBA 3MUGB 2D31B 4WUUB 2I9LB 1SBSL 5C0CA 1T4KA 4L3AA 4MAUL 3A6CL 4KH2A 4PJIA 5E9DB 1B0RB 2CIKB 3AB0B 3DXAB 3OXSB 4ZFOB 3QEHA 1MCHA 4GAJH 2HAZA 5HI5D 2D0GA 3BP4A 1AIFA 4XMKH 2A77H 1KTDB 1XF5B 3L3HB 1DEDA 3ARFA 2E27L 4Y4FC 4I1NB 5E99H 3HNVH 1FVEB 1CLOH 1J0HA 3QP3A 2FSEA 3GSRB 1OW0C 4KJWC 4P0DA 3GNML 1FL6A 4NUJA 1KOAA 3FRUA 4OCRL 4XP9L 2WV3A 4WI6A 2BZDA 5TQ0L 3GSUB 3FFDA 2CO6B 4JG1H 5D1XA 3TH4T 3QH3B 3JV5A 4LPUA 3WO4B 1I1YA 3D2UA 3TYGL 2Q76B 3X13A 1FPTL 3BXNB 3WUWB 3VXMB 5E5UB 2Q6WB 1F3JA 5FGBC 1KIQA 4PRDB 2YPVL 4I2XB 2HG5A 3PIQA 4I8DA 4LRNH 4TVSa 3T1WA 2F8OA 4V1DA 4PRBB 5LAXB 5FEBA 4BZ1L 4IIQA 4KZDH 4NRXA 5EO9B 2EDDA 1X5JA 5J06A 4WW2C 4XNUH 1WIPA 4YAQA 4P9ML 4RGNB 1AKJA 4AEIL 5ID0B 5L88H 5CP7A 3P3YA 3LKOA 5LQBL 4W68A 3RWJB 2CKBB 5JUEH 2UUDK 1DFBL 3GIZL 4BSWB 1Q9KA 4HDIB 4CMHC 3GHBH 3P9MA 5JXED 3UDWA 5LWYL 3VXUE 3P4OA 4OLVH 1FNAA 2WUBL 1A0QL 2HH0L 4J7RA 1A22B 3T77A 3L3DA 2AJYL 4I18C 5GRYA 4QXTB 4YHIB 5HI3D 4F57L 4H5SA 1HINH 1H3VA 2ICWB 3GMMA 4Z7VB 5T3ZD 3H6JA 1QPXA 4KQ4L 4ZNCD 1Q9LB 2JELL 3EYVB 4KMQA 1SBBA 5I1EH 4RDQF 1VGKB 5F1IA 2YA1A 3FOMA 3GBNH 3BIBX 3VXQB 1T21A 1A7PH 2R29L 4G6FD 2NY2B 1BX2B 3TC9A 4ETQA 3LMJH 4JCMA 1A7NL 5BQ7A 4M4PA 1TVHA 5CD3A 4ZUSA 1DLHB 3FKUS 4LLUB 4PFEA 3TYFB 5DC0A 1BBDL 3ARDD 3X12B 1R3KB 2ED7A 4XTRD 2EDFA 1CZ8L 3MSPA 4WI3A 5D7JA 2X9WA 2ICWJ 3EIFA 3RPIB 2E7LA 5C07B 3MUZ1 2GFBA 3NFPB 1MCOL 3BWAB 1DBAL 4HV8A 2AJYH 5L2JB 3OB0H 4LAQH 6CGTA 5HDQL 2OQJB 1RQ5A 1RZIA 3ZE2E 2AERT 4LMQI 2P8PA 3ETBF 3GMQB 3PWUB 3L9RB 2WIIA 5D9SB 2DIAA 2IGFH 1KJ2B 1O5DT 1T6VN 3CMOH 2YD5A 3W9DA 1DFBH 4HZAA 3DX9A 1U93A 2NW2A 1T20B 4WI7A 4L4VB 3QPQD 2NW3B 2OTPA 4AG4H 2LU4A 5ECJE 1HZHL 4NC1C 2CDEA 4HMDA 1LK2A 4ELKA 4U05A 4Y4KC 1NH6A 2V2WB 3PQYA 3W0WE 3L5HA 2A9NH 3CFBB 3U0TB 5JW4N 3L1OH 4XP4L 1E27B 3MBEB 4R8WL 5BW7C 1JJUA 4LSPH 4PGEA 2FCBA 1CLZL 1MHEB 4NQXA 3BH9A 3MV9B 1K2DA 2DLIA 1G7HA 1ZT4A 4IMLA 3VFPB 3K2UL 2Q87A 5F7DB 3CFDB 1YC8A 1ZSDA 1OB1B 3H9SB 3KXFB 4G9DB 4RDQG 3DRQB 3FB7A 3LEYH 1INDL 1UKTA 3VFWB 5T5NF 4A2LA 1JF1B 1UH3A 2YK1L 3FB6A 3SJVE 4EKXA 1CFQA 3KPMB 5MHSE 3S96A 3X3GH 5EU5B 4GW1B 4Z7UE 5ERWA 5EO0A 3RQ3A 1QO3B 1MRDL 2FEDC 4JAMA 1QEWA 4U0RC 4JPVL 3CU1A 4YIQA 1AJ7H 2H6PB 4Z7WB 3V6FB 4JO4H 3TP4A 3LRSA 2JIXB 2VABB 2CDGB 4GG6E 1A6UH 4GRLC 1CTOA 4Q0XH 3IJYB 1QLRB 1U8LA 4GKZB 3HC0A 4JY5H 4R2GC 4Y7MA 2V7HB 2W65A 1BJ1J 1DUZB 2XFXA 1OAUL 2PF6A 2X4UA 1FSKB 1P7KA 3PNWB 4PUBL 5D70L 1T0NA 4HIEA 2IAMD 1C7SA 4MLSA 4JRXE 4TULL 1N8ZA 2VQTA 4YGVB 4OLVL 1VADB 1CK0H 3KLAA 2VXQL 1UENA 3GMPA 4NRYB 4ERSH 3L7FA 3EDJA 1ZWIB 2XNAB 4UIMB 1MY5A 4PJ8D 5EH1A 3GSVA 3UBXI 1R5IA 3MJ8A 1BZ9A 5CFHA 5GIRA 2HJFA 4DJMA 3FQXA 3HMXL 1RJLA 5HI4D 1ZGLA 2VLKA 3PDDA 1QFHA 4OV5A 3CXDL 2NY5C 3U9UB 1OM3H 2BVYA 1QSED 4KI5D 2V9QA 4AEHL 4KTEL 5CSZB 5IFAL 3F7PC 2OL3A 4IOFC 2I9TB 5MP6L 5EULV 3PWJB 1K5NA 5EG6C 1N2RB 1D5MA 4U49A 3IFOA 3KYNB 4PJDF 3QNZB 1CDBA 4G8IA 1WEJL 4NOBA 4KUCD 3QRGH 2A0LD 5D96C 4UUJB 4NZDA 4MXVF 1GC1H 4I0KA 3D85B 3CUPB 4GXUN 3WFBH 1IC5H 1OARL 3UC0L 2QQQA 4XT1C 3PABB 1V3LA 5IBTL 1JF5A 1I85A 1U58B 1TCRB 2GQHA 2VH5L 3LV3A 3T0DA 4J2XA 2F54D 1BJ1H 5FKAB 5E4EC 1YYLH 1A3RL 3FQXB 5IF0A 3VD5A 4MNHA 4C56E 5JZ7D 2X70B 4WV1A 4BQ6A 2HLAB 4FFWD 4PJIE 3IU4H 5EUOE 2AS5M 4PJ8B 1MIEL 1RPQA 1TTGA 3CFIC 2MCPH 5IV2A 2C9AA 5HY9B 3P9WB 3I9GL 4RISL 3RUGB 5BJTA 1K6QH 1RUAH 3MV7A 1X6LA 4MAYA 4NCC2 3E8UH 1I1AA 4P4RA 5DD3H 1HNGA 3ARDA 1OAUH 2B2XH 1P69B 1G7JB 5GGSB 4WHYG 4UUJA 3V4UH 1CF8L 1F13A 1T1YA 2QLVB 3SE4A 3RNQA 1MHEA 2DQJH 2FX8L 1EFQA 2N7BA 1G9NC 3RP1A 4XGZA 4XCEB 4W4OA 5CD5D 1WZ1L 4YHZH 4M62H 3D3VB 3S97C 4JLRA 3T3PF 5DEGB 3QG7L 2Z8SA 3LN9A 1F42A 5DJCA 4DZBB 5C1MB 1L7IH 4PS4L 5EO9A 3WIIH 2X7LB 3MZGB 5GGTA 3U4BL 3KHQA 4OZFG 4AENB 5D2LA 1Y18B 2JJWA 4RGNC 1D5XB 4YDVA 5EU5A 5C2BL 1B4RA 1G0YR 5I1AA 2EH8H 1RZ7L 3QIUC 3ZKNC 4PJ8A 4P9MH 1KLGA 5FK9A 3PV7A 1EO5A 1U8PA 5GZNC 2R9HD 4JRXD 3ZKSD 5KVEH 4PREB 3QSKB 4Y19B 2MQ0A 4HZLA 1N5YL 3B6SB 1JMZA 1VB9A 3PF2A 2DQUL 3OJVC 2HJKA 3CSBA 3GJFH 5C08A 3UTZA 1FC2D 4JRYB 5DQJA 4LSUH 3T65A 1EBAA 3DURA 4BQ8A 3MX0A 1RU9L 3OV6A 2FYYB 5EWIH 1CXEA 4LLQB 4FZEL 5DK2A 1X4ZA 1C5DB 4MA7L 2CDEB 1KELH 1MJJB 4LVNB 4JO3H 1V7NL 1K4CA 2YS4A 3KPQA 5E4EB 4PV9B 3H42L 2V7NB 2FX9L 4S10A 3IXTB 4PP1C 3TH2T 2E27H 1Q9LA 2BRRH 3NA9L 3KLHC 4Y4HC 1EHXA 5EZLB 5ICXA 1KNOB 1XGRA 1BQUA 4MA8H 1KCKA 3IXTA 4U33A 3G6DL 4JGMA 3BZEA 5D6DC 1RMFL 1UA6L 1U6AH 5HGGS 3QNXB 4HULB 3N85L 3RZCA 2ICWI 4RMVA 4LCUB 4J3VA 5D1ZC 3TO2B 3EDEA 1AFVH 4KK8D 1TPXB 4UNUA 3E8UL 4RMSA 3QNXA 3LPWA 2HMID 3VXPA 2ZCKH 4IDJH 1JPFA 1L0YA 4F9LA 3T0BA 4NQEB 2W9DH 1CL7I 1JHKH 2F54E 3E3QE 5K9JH 4N0CC 3RL2B 4LSQL 4Q6YA 1FNSH 5IBUG 4P5TC 3H7BA 1C12A 3V4VL 3EYVA 4MNGA 2NCMA 1JTPA 1KCSH 3F62A 4DK3A 1MJJA 1NC2B 1ZMYA 5E2UH 4LP4A 3F5WB 4EBQL 4ODTH 1YEKL 3QFDA 3MLVL 2DYPA 3X3FH 4IEFB 3WSQL 3WUWA 1T03L 4WY7H 5KANI 1EMTL 2RR3A 4KY1L 4NQUA 4LLYB 2D2OA 3EJZC 5INCA 3VFUB 1OQXA 2DTML 1NCWL 4ODUB 4FFVC 4JG0H 4JZOB 3P4MB 4MD4B 3ZDZF 2V9RA 1T66C 4GT7A 1N26A 3L3JB 4R90L 3ZE1E 3FT3A 5C86A 1F90L 5H94A 3UBXA 1H15A 5CP7B 4Z6AT 1WT5A 1S7RB 5HD8D 4HKBA 4N90D 5KSBF 2BVQB 4Z7OF 1P7QA 1I9EA 1T4KB 5J1TC 3DTXA 3H7BB 3W2DH 2YPVH 2IBZY 3NCFB 3BGAA 5JQ6H 5EZIH 4KKBD 4E42A 5DLMH 5DXWA 4GRWE 3QEGH 3I50L 4NM8H 2P24A 5DLML 3IFLL 4NO0B 3KPRA 5C0CD 3VH8A 1DQLH 2WBWB 4MJ2A 4TTGA 4XP5L 1U0QA 4OB5L 3B2UD 3MXVH 1E4XI 2YBRB 5GGSA 5KVMC 3RKDD 3TBTA 1MAML 4JQIL 4GG8B 1AD0A 3B9DA 1XGQA 1IKNC 3MLPA 1UXWA 5MENA 3A6OA 5D6DA 3FO0H 4ZUWA 1FL3B 2R2HA 1BD2A 4P4KB 1QUNA 4PJIB 2GFBB 2PR4L 4HJGA 3BP5A 5D5ME 3OKOA 1W72A 4M8VA 3RU8L 4HIIB 1A9BB 1CXKA 3O8XC 5GGQH 5AZEH 3ARGA 5D2NE 1U91B 1KC5L 4L4VD 4V1DD 5IB2B 3OAYK 1GAFL 4NQEA 2FHFA 5J6GB 3T09A 3ZYZA 3PWLA 4AIZB 2YD8A 4QRPE 1BIIB 1P4LA 3UTZB 1RJCA 5I8CB 3UP1A 3GHEH 4CAGA 2XI9A 2JJVA 2QL1A 1LILA 4QOKB 4AEEA 5EOQL 1R24A 3CSPA 1MHHB 2E9JA 4LSPL 1S5HA 3GSNL 3ARFD 4XNMB 4Q9QH 1MIML 5MENB 4EI6B 5DQDH 5SX5H 1KEGL 1EGJL 3V6OE 4AENA 3VW3H 3GSWB 2R4RH 4HMEA 4G6FB 5A1AA 2BDNL 1GGUA 4DKAA 1EA9C 2CIKA 3QEGL 1X4XA 2XZCH 2ARJA 1ZGLB 2NY5H 3MRNA 4DOHB 3ARBB 5EU3A 2EIZB 3TCXA 3WCYA 1GC1C 1FFNA 1I3VA 3FMGH 3VFNB 2R69L 5BO1H 2IEPA 3EYUL 4Z7WA 5F3HB 2APFA 3C5SA 3QNYA 4F7EA 4NC0B 4ZFZA 5HGBA 5F8QC 1EVTC 3QEQA 1RK1B 3ILQC 1EVUA 2DQCL 1OGTA 2QSQA 4JM2B 4JZJC 1RK0B 4OF0A 2Q6WA 5FA3A 1J86A 1S9VA 3BN9C 5SV3A 3OJDB 3M17B 1GAFH 3S5LB 3KGRA 5DHYA 3GSUA 4NIKB 1A0QH 1WCQA 2DMKA 4GOSA 4X5XA 1PZ5A 5FKAA 3C5ZA 2YD9A 3AFLA 1HIML 4O00A 1VEOA 3JV6B 1A47A 5C0CE 2F5AH 1KTDA 4I4WA 5DO2D 4NKMA 5HXMA 3VDBA 3MLRL 3OR6A 3HI5L 3OAZH 2VWEC 2CQVA 4U1GC 4F57H 3GSNA 1GH7A 1T1XA 4J4PC 4R97B 2OXGA 3BT2H 5E00B 4DEPC 1KPRA 2AJVL 3PGDA 1QBBA 3KXFE 3HNTH 5DK2B 3BEWB 3MUGA 3DX6B 4JDVB 1QFOA 3CFDA 1QLFA 3RX5A 1HYSC 4TQEL 1NBVL 4NNXA 3TBVB 2JE8A 1FZJA 4OZIF 5GGRA 4XTRC 3PL6C 3TO4A 4WTZA 4HIJB 1A6AB 5ILTH 2MSPA 3F58H 4MHHI 1UCBH 2BNQD 2BSSB 2NY4C 3O3BA 3U0TA 3VCLB 4ZMAT 4ISVA 5IHUL 3BUYA 4NT6A 3HR5B 5GJSL 1AY1H 2Y4SA 3BAEH 1FAIH 1P53A 3D48R 3NFSH 3W9EB 4LGRB 2V2XA 3AS3A 4X4XA 4QRRB 4CKVX 2R39A 2A74B 3V7MA 2B1AL 2CJUH 3QDAA 2BXZA 1P4BL 2KQNA 4ETQB 5EZLA 3LKRA 2X1OA 2VYRE 1BM3H 5IK3A 5HGHA 4LLMA 3ULVL 2R23A 3F7YA 1EV2E 3OKLA 2BNRD 3QHFL 3CVIL 4GSDH 1DQJB 4ZTPL 2IG2L 4HXBL 1JGVH 3IYLW 3NZHH 4OD3L 2FZ3A 3O2VL 4MB3A 5GGUB 5IKCA 3WKNA 2QQLH 4O2CA 4LLQA 3D39A 3OAUH 3QUYA 2PO6B 5ALCL 4HKZA 5JXEC 3G08B 1J1OL 1FNLA 3L5JA 1PBYA 2DQTH 2O93L 3R4DA 2JK5A 3U2SB 4PY8I 3RAJH 1EFXB 1HHGA 2J88H 4JZNB 5C0GA 3BKJH 1LDPH 2VN4A 3D69B 3L7EA 3NFNB 1Q72L 4F7CA 4WW2B 1SY6A 3KPRB 4ZXBB 3DBXA 2JB6B 1JPTL 3U4EB 4F58L 2FX7L 5I66B 3QULA 3D2UD 5DT1L 2YWYA 4HFWA 4PD4K 2WNGA 4S2SB 3RVVC 4TQEH 4OF3A 5AUMB 3FJTA 4LHUG 2A6JB 2VXTH 3THML 3HUJF 1KIPB 4U1HB 1U8MB 5GJSH 1HHHB 1RHHA 1I3RA 1LO2L 4K7PY 5L8LB 3WHXB 2YZ8A 1JYWA 4B5EA 1NGQL 5BMFL 2FZ3B 4Z0XA 4BSWA 4YBLB 3TWCH 1AXIB 15C8H 3BPOC 5DEFB 4KVNH 3RJQB 4OFDA 2R0WL 2OTUB 1KG0A 2IAMA 2Y25A 2J7LA 3BISA 3VXSA 4KJYA 2ADFL 2EDXA 1WZ1H 4ONFL 3ULSB 3V6FA 4YHZL 5ESAA 4YHLH 4X9BA 4L5FL 5HYJD 1UWGH 2ID5A 5CIPH 1S7TB 1OSZA 1I1CA 4KHTL 4Y16D 1X5ZA 5BJTB 4D9QE 2FBJL 4PG2C 3DVGB 3RX8A 3T8XB 3L6FA 1J18A 1YNTB 2YMXL 1LE5B 1E6JH 2NXYB 4OUUA 3QI9A 4NKIH 4PJCE 25C8L 4EXKA 4FQXC 3D2UB 4KK5C 5EBLB 4JZJB 2AJ3B 5T5FL 1JMXA 1A5FH 4GMTL 5JHLL 4KKCD 2BHYA 4HBCL 4R9HA 4M61B 2BNRB 1QKZL 4PJEF 3ECBA 2NY3B 3L7FB 3PWPB 1MF2H 2LAGB 1A4JA 5F93C 1WWAX 2BNQE 3ARXA 4MAYD 2EDHA 1KJ2L 4G5ZH 4RFEA 3KLSA 2WZPD 1LDPL 1UM6L 3BWUC 4FQ2H 3BP4B 4OCNC 1G7QB 1RZ8A 3CXHK 2IANE 1MI5B 1RJZA 3MNVB 3QAZB 4LIQL 2D7OA 1L6XA 4GAGH 1S7WB 2R23B 5B38G 2H8PB 2ATPB 4HJGB 2Z31B 3L9RA 3PWUA 4KC3B 5I1HL 3CXDH 5DQ9A 3C6LB 5A3ID 2WP3O 3TT3H 5KN5A 4G3YL 1QVOA 4QHNA 2SEBA 4HUKB 4FNLL 1WJ3A 3TVMD 3QEQD 2V2XB 3BQUD 1I8MA 1CE6B 3BMWA 1Z0NA 1ZT7B 3LQAL 3V6BR 3VGDA 1U8KB 5AEAA 3U4AA 1T0MB 3K4DA 4TRPL 2IC2A 3KPPA 1LO0L 2X4NA 3UTOA 1VHPA 2IPKA 5H35B 2D7PA 2O5YL 4OUOA 4BFIB 3M8OL 3L95B 5TE7L 4MNQE 2VDNH 7FABL 2HTKD 3CLEL 5ID0A 4HPYH 2HKHH 3LDBC 3FOMB 4QHLA 1T2JA 3RVUD 5IOPB 4HMCA 2WINB 3LKNB 4EN3A 4PREA 1QHPA 3SGDI 3GSNB 3LS5H 2BY2A 3VG0H 4UTAL 3T0VA 5T33H 1JI1A 5C9KA 2V2TB 4JHWH 2GUOB 4JHBA 2HVKB 1S3KH 4JKKA 4NNYB 2AEWA 3W82A 4NQSA 3TA3D 3JBG7 5LWYH 5BS0B 5D1XC 3LIZH 3VU2A 1U8JB 4KJPC 5MEQB 5CZXD 4ZFGH 3SPVB 1QA9A 5C0AB 5BS0A 4X6EA 4MNQB 5CJ8A 5LXGH 1CFNA 2VC2L 1X3DA 3UJJH 1WBZB 2UZIL 1J0IA 5K9QG 5DJ0B 3E6HA 4RCAA 5I1KL 5C71A 4HUVA 1HNFA 5F3BA 5FB8B 3MMEB 2N4IA 4HBQA 4R4FH 1S78C 2FX7H 5IHZA 1AI1L 4H0HB 5HGHB 4NQXB 3MBXL 5JUEL 3QULB 1ZHKB 4DKEH 2VC2H 4WI9A 3VRLF 1F4AA 3KPSB 4NN7B 1FFNB 4NFDA 4U1GB 1DDHA 5B39A 2GHWB 2XRAH 4GLRH 1RVFH 3GRWH 1X5GA 3H8NA 3WS6C 4JFFB 4P48A 1C1EL 4M1DL 5F7LB 3RBSA 1NAMB 3SDCB 1R3JB 1OQOA 4RFOL 4YBQD 5GS1C 5LVEA 3LN5B 4XPFL 1KENL 1ZT1B 3UJJL 1CICD 3HUJE 4X6EB 5HTSA 1OT2A 1RIVL 1AIFB 3MUY1 1BAFL 3C60A 1J7VR 4UZGA 2IH3B 2M1KA 3O0RL 3I6GB 4O58H 1IKFL 2NY1B 2PTUA 1OCWL 1MQ8A 1YMMB 3RZCC 4U6XB 4X6FA 1KIRB 1YJDH 2EKJA 3OMZA 3DROB 4N0UB 3BD5A 4HH8A 4OZHF 3C09C 5CHNB 3BE1L 1U8IB 2E5EA 1NBZA 1VPOH 1RJYB 4YE4L 2WWMD 1XH3B 2Y7QA 2NY2D 4IIQB 3LS5L 5JW4R 1G9EA 2JELH 1JRHL 2HTLD 1SEQL 3HAEG 2X41A 4G6ML 4TSAL 1GVIA 2GTZB 3DV4B 5T1KD 1DQMH 1MCRA 1J9CT 5GIRB 5AZ2L 2P47B 2AK4A 1IC7H 5L7XH 1SEBA 2ITDB 5TF1H 3MFFB 4ACPA 4MNQD 2DYPD 4LEXL 2NZ9D 4MQSB 4Z0BH 1FL6B 3BN3B 3HTLX 3MRQA 1KLGB 1KPUA 3ELAT 1U41A 3QO0A 3ARWA 1PEWA 3DMMB 2F58L 4RAVA 3CVHH 2OXHA 4PGCB 3ZL4L 1OAQH 3BPNB 4KK9D 5KG9A 3WNOA 3D87B 5DFWH 1XGPA 1WTGT 5EBMB 5BCAA 3I2CL 4YHYB 4HGKC 3QB7C 3VH8B 1NJ9A 5H37H 2XKNA 5FFLA 4XHQA 4IRSA 4X7TA 5DMKB 2EICA 4WFGE 2EDWA 2CMRH 4F9PC 3VJ6A 4ODXB 5IOPA 3KPRE 1ADQH 1URLA 5ANMB 4U4BA 1MAJA 35C8H 4XH2B 1ACZA 4XPGH 5IMLB 2J8UB 4UILL 2DI7A 2QSCH 4YQXH 3LSOB 1LHZA 1BPVA 2YRPA 1AGEA 1CGVA 2DWDA 1U2HA 5DRXB 3TGXA 5L2KD 4EUPA 4PB9H 4ONGH 1JPSH 3K7UA 3EZ8A 4KDTC 4WU7A 3EOTL 4Z77A 3VFGL 1DLFH 5GRVK 1DDHB 2R0WH 3C6LD 1TQBB 5D7SH 3GSRA 1JK8A 4R6UA 3U82B 5KSAC 1IM9A 4R7NB 1PG7L 3I84A 4LHUD 1W0YT 2Z31D 4QTHB 1ZLWK 1NFDE 2GSGB 4G7VL 2BRQA 3DGGB 4DN4L 1IJ9A 5JOFB 2X4OA 5K93A 4NQCB 5HYSG 1VACA 1NLBL 1KEGH 5ABDE 4XPGL 4G8EB 2ERJC 5D6CB 4PGBB 2WUBH 3LOWA 4Q9QL 1A7QH 2COQA 4BK5A 4PJ5B 1LO5B 5ISZA 1BJMA 3RPKA 2VMFA 3X11B 2EYSB 4IRJA 5L7XL 3JUZA 1YNLH 1TETL 3VXPB 1LK3L 3W5NA 3CDGB 1N5AA 2IWGA 3DX8A 3QBTB 4M7ZB 5DRXA 4MXVE 1I1AC 5ENWA 3GO1L 3RBGA 2CXGA 3DI3B 1WF5A 1MHPH 1ZHNB 1RJLB 4LSRL 2HLFD 3KYKL 4NQVB 4BH7A 4BZ1H 3OX8B 4GG6B 1UXSA 2AXHA 4OLXH 3ABZA 3S5LG 3STZA 1JYXA 3L3IB 4M6AA 1B0GB 3QUZB 2NX5E 3QRGL 4OLUL 1KIRA 1NL0L 4KROD 3WIFA 1J1PL 4K3DL 2VDQH 3TIEB 3WNKA 3LAFA 1CQKA 1HH6A 3GMMB 4EI5A 4Z7VA 3T0AA 5DJ0A 4LDLB 1NEUA 3RGVC 2AGJL 2HA1A 2Y23A 5I0DA 4H1LB 4OZFB 5J1AB 4PLJD 2A2QT 4CGTA 1CL7L 4NKMB 3NZHL 1I9RL 1S9YA 1W0WB 5EU6D 4FP8H 3DUSA 3DVNA 4OI7A 2BHUA 1V7ML 1AR2A 4LF3B 5C92A 1MCPL 3CDFA 1D6EA 3QHZH 2OM5A 5B39B 2Q7NA 4WFGD 4BFBD 4R0LC 4IOIA 5GJTL 4K3EH 2ENYA 1WWBX 3KPRD 3OX8A 4MZ3A 2IFFH 1ZLSH 1VENA 4PJFF 5DUBB 1P4IL 3JTTB 3S37X 5C3LD 4I0PB 3PHQA 1PKQA 2AJUL 1S7TA 3MO1B 3NBNA 2EDJA 4Y4HB 3WXWH 3TIDA 1Y6MR 2Y07L 1H5BC 3SDAC 4ZFZB 5KOVC 4BSVB 4I2XA 5CINH 1BQLL 1HHIB 2IPUK 2P5WD 3C60C 1JGDB 2IBZX 4M00A 2Q76A 3PHSA 4XCYB 4DGVH 1LP9B 1UH4A 3WMSA 4KJQD 4M3JA 4IMKC 4QOKE 2VOTA 3HC3H 1HXMA 1BWMA 3QZWB 2K7PA 3K74B 1LEIB 3QUML 4P5KA 1FGNH 4OGAD 5EBLA 4JPVH 2VNCA 5F70A 4LCUA 1R5VA 5CKGA 3V6ZA 5FDWB 4P2QB 4P49A 1K8DB 2DQJL 4RX4A 1RHFA 3CFEB 1F4YH 1N4XL 1Z9MA 5CJOL 1QBLL 2VLJD 5I76A 3TESA 1C08A 5IFHH 3UTSA 2P8PB 1PX4A 2BX5A 4X5XB 4KRPC 4P46A 1A3LL 1IFHH 2NYYD 1TENA 3QI9D 4NWUL 3QQ9C 4WUUA 2QSVA 4PRAB 3UTTB 2FB4H 1K4DB 5D5MB 1A1NB 3QCTL 3FB8B 1EFXA 1MCFA 3I9GH 4AK1A 4NWTH 2EXWC 1DEEA 4LOUD 2YUWA 1KIUA 5T5NG 4ZD3L 1P5UA 4HIXL 1WT5C 1GPOH 3PWLB 4FQXA 2Z93B 1XR8B 3EFDH 1CYGA 3U0WL 4OF5A 5CILL 3SDXA 5IG7B 5D7JC 5IESH 4S2SA 4BM7A 1R0AL 3HCVB 4RAUA 1Q0YH 3OKKB 4RMRA 1U8OA 2YSSB 2QV2A 1I9RH 1U8LB 4GKZA 4XNXL 2JJTA 2VE6A 4OCWL 1OLLA 1IGYB 3G5YA 3ARBC 3GM8A 4IRSB 4AYFA 2DBLH 1WAAF 2B0SL 3QI9B 1YPZA 3MOBL 4XAKD 2AK1L 4J4PA 1P1ZA 3GSXA 1FH5H 1V7NH 1OTSC 1K8DA 3OZ9H 3FN0L 5DMIH 5J9PB 3HI6H 1L7TL 3DMMA 1J88A 2CIIA 3VXME 1SM3L 1KG0B 2IAMB 1R3HB 5F1SA 4GAYA 3FO1A 1KBGH 1N6QL 5ESVA 4NO0A 1JPGB 4KWUA 4DN3L 4UINH 4QXGL 3SGJC 4JDVA 3HA0A 4FFYL 4JZJA 1QFWL 3MRMB 4QHMA 5ACZA 3HHRB 5KSUA 3VD4A 1Q1JL 5J6GA 1GZQA 1J11A 1RIUH 3T4YA 1JTTA 5CILH 2V2WA 3HFMH 2AQ3A 1QLEH 4HFWB 3WFEH 1U8IA 1DVFB 5J3HC 5DJAB 4Y2OA 3BPNC 4LFHG 1A6WH 3ARUA 4YHLL 4WDIA 5FHAL 3BUYB 3CFCL 1JF6A 5IQ7H 4M5YH 5FM8A 5B38B 1NFDA 1UM4L 4UTBH 1TNNA 4LK4A 3RHWK 3G9VA 4IRJB 3LV3B 5HJ3A 3MBEC 2GJ6B 4ODUA 4PJ5D 1V05A 4QOKD 1BEYL 3ZDXE 2ITDA 4GMSH 4BFGA 3IU3A 4QRSA 1NDMA 5HPMB 1CXIA 4M02A 2DM3A 1DQDH 3O3AA 2GK0B 1TQCB 5DI8A 1I75A 1N7ML 5EOCJ 4KQ3L 1HSAA 5FHBL 5DJ6A 1MAMH 4FMKA 4OSUL 4Y1AD 1NCCL 3ULUC 3BGFC 4MQ7B 4G8GB 1W8OA 3C5JB 4PRIB 3QUZA 1MREL 3MUJA 3I85A 3RL2A 2ORBH 3WKMH 2UYLA 1VFOA 4LCCC 2OS7A 2AJ3A 4HCRH 4HK0A 3LKSB 4WEBH 2A74A 2CLRB 4XPBH 2Z91A 3FZUD 3I6GA 4KKNA 2EIBA 1V3MA 1HHGB 1M71B 4KTDL 1UVQB 2KZWA 1WV7T 4N0YL 5JXEA 3TV3L 4PJBE 3DX8B 1LNUA 2H45A 1T22B 4LRNL 5DJDB 4XWGL 3H3KA 4OFYA 2M8XA 5F9JB 5I9QC 1R5WA 3MCKA 4NO2B 5HJ3B 5TJWK 3BDYH 1HSBA 5DUML 1TJHL 1RURH 3IDGB 5JNYB 1PGRB 4E9LA 3T2NH 3HC4L 2APXA 5T3XD 3OKLB 1TJGL 3C5ZC 1IKNA 1MRFL 1XGTA 4JKPL 4H8WC 3ESVF 2GUOA 4XAKE 3VFTB 1OSPH 4OBRA 5I8KH 3A6BH 1OOAA 1FLRH 3P73B 3WS3A 5CGTA 4OCYL 4Y4HA 4Y5XC 4P2OB 4R26L 2R8SL 5IMOB 5DMGC 2J8UF 3VXMD 1IT9L 1YEHL 2A73B 4PRPA 3VMNA 3V0VA 1WBZA 5MERB 2CUIA 2XWTA 5FYKU 5T3XL 4K2UH 1Q0XH 1EAPB 4NZJA 4ZDHB 3LCYA 3C8KA 5F6IB 4WW2A 1OGAB 3MRKB 5T1KA 2IPKB 4XAWL 2BVEA 3MNZB 5HHNB 2MKLC 5C08E 3NAAL 2R29H 4TVPH 4J3OC 2OR9H 4JZOA 1CGSH 2X44D 1OAXL 5GS2H 3F12B 2P7TB 5J11B 5E2VH 4IRSC 4HKJB 1YA5A 3TZVD 2Q8BL 3DECA 4ALAH 1TJGH 1BOYA 5F7UA 4JQXC 1XH3A 2Y7QB 4LVOC 3ZKXC 4KGLA 4YGAB 1WCBB 1XGRB 4JDZB 3BOVA 4HUUA 2NQCA 3W11C 3BIAX 5TQ2L 2M26A 3GMLB 1WVZA 4XWGH 3LKNA 3LZFL 4EN3B 2IALA 3WIFB 3BP5B 4XNQA 4HUUB 1I3UA 3TV3H 3RWGB 3HNTL 3REWA 1FFOB 4L4VA 2XWJB 1T20A 1X7QA 1I7RB 3T0EC 4GBXA 3V2AR 2PUQT 4N8CH 3ARVA 4WWID 3HI5H 4M8QB 3P0YH 1M05A 3ARZA 5LGHL 5D72L 5FA3B 4PGZA 4ZOCA 3QT2A 3QCVL 5IFJB 3LB6C 3ECBB 4WENB 1YMMD 3H9HB 4Q9RH 5E8OB 4KZDL 3V0WL 3OKEB 1G7HB 5A2LH 4MQXC 5BO1L 3S36X 1P4LB 5DHVH 3MLZH 4EQ2A 1U3JA 5FK9B 5DD1H 3ARSA 4HSQA 3LEXA 1M7XA 2VLME 1T6WA 5GSVA 5GS0D 2NY6B 5IUSA 1DVFD 1MSPA 1M4KA 3MRHA 3SDCD 2J8HA 2EH7H 1RJZB 1AO7B 3FQTB 4X6CF 2I07A 4QRTA 5DEFA 5MI0B 2YC1B 2ED8A 1B2WL 2OR9L 5CJQH 3I3BA 4OKVA 2D03L 1RUKH 2A38A 4JFEE 1Q9OB 1FDLL 4PYHA 4XC3L 3EO9H 4QYOB 4EJ1C 5EBWA 1ZEAH 3AGVA 4FABH 5DSCB 1SEQH 2JCCE 1JV5B 3INUL 2DRUA 1OF2B 4OUUB 4X9GA 3ZKXB 4TSCL 5J12B 4NJ9L 1YY8B 2IAND 3MLTA 5E7BA 4HCRA 1A8JH 4Z8FH 3VI3F 1NCAH 2PW2B 5I8KL 2J8UA 1K3ZA 1AGDA 3GBNL 3UCRA 4F33B 2FJGB 3Q6FB 1NC4D 5FGCB 2XICA 3BPLC 4M7KL 4KKAC 5I8OH 2OTUA 3P30L 4CVZA 4RBPK 3G04A 1U8NB 1DBMH 3Q6FA 3MJ9A 2VRAA 3FFCD 4OM1H 3HS0A 3HI6L 2X89D 1JPST 4NN5C 3RIAK 2CKBL 5MP6H 1J8HD 5FO7A 1R3HA 5F9AC 4NJAL 4JJ5A 4KTEH 2PYFA 3CU7A 2X42A 4XMLH 2JCCB 1KB5L 4JY4B 4YHKH 1BOGB 2N7AA 2CLVA 1NCUA 3TF7C 1MWAB 4GSDL 4K7PL 3UTSD 4M6OH 2X1PA 3KWWA 1D5MB 5LG1A 5DA4A 5FDYA 3MNZA 2N1KA 4BUHA 5I1CL 3X17A 3IVKB 3D9AH 2OLDA 1WISA 4KV5F 3EYQD 2Y07H 1NMCC 2PW2A 4M1GH 4GRWH 5J6HB 3P4NB 4ZD3H 4E42B 4KKAD 2F19L 5F89A 3SE9H 3WFZA 3KNBA 2WQ8A 3VXSE 2LFGA 1MPAH 3HZVB 4F9LC 2FATH 2ENSA 3ARED 3W0WA 4CMHB 2DM2A 1AO7E 1CGYA 3AAZB 3U7YH 5ETUA 1GXEA 3BH8B 3QIUB 4MA3B 2HRPH 5LBSH 2XT1B 3MXWH 1J5OL 4MWFB 2V5MA 1Y0LA 1ZWIA 1CXFA 4GFTB 4UBDC 3F58L 1J5OH 1QHOA 5AD0B 1UWEH 1K4DA 3IDGA 2GAZA 5JNYA 3E2HC 4L5FH 3DX6A 4KU1A 5K9QI 3BSZH 3TT1L 3D39D 5DI8B 2IQAB 3ROOA 3V5HB 1NEZA 4NN6B 3JWNC 5HHOA 3C8HA 4YK4B 1W8NA 3GBLA 5KTEH 4ZOBA 4P3DB 3W9DB 4HLZH 4EDWL 4TN9A 5C0IB 3BVNB 2IPUG 2W0LA 1AD9B 3MLRH 2VDQL 1H3UA 5HHOB 4HFUH 1KT2B 5CJOH 4G6KH 2EYRB 4K8RD 4NKQB 2HKFH 4M93B 3O2DH 4OLUH 5H8DA 2MFNA 3C08H 1C12B 5GS0C 5IQ7L 5TF0A 4RA3A 1T5XB 2PXYD 3HCVA 5DHYB 1B9ZA 5DJ2B 1NUDA 3BW9A 1PQZB 2YD7A 3IKCA 5I71C 5IFJA 3S36L 1MHPL 3DYMA 1FCCA 4M5ZH 3BH8A 4G9DA 3ME0A 4HT1H 3GEWB 4HKJA 4ELMA 1TPXC 1CDIA 1NKRA 3UBXB 3BX7C 5T3ZE 3JTTA 1IAIH 1X5IA 1ORQA 3B5HA 3FT3B 2FIKA 3U7YL 2IALB 3ULUF 2O5YH 4BH8A 1OGAE 1N2RA 2EDBA 4KUZL 1A2YA 5ALCH 1BBJA 5A2JH 3ZKMC 4A2MA 2EIZA 5SX4H 3EYOB 4DW2L 3D69A 2H6PA 2EC9U 1XGPB 1KT2A 2X09A 3SBWA 4LIQH 5KSVA 5IMOA 1F11A 3VWJD 1MWAA 5JORB 3U9UA 4X99B 1Q38A 1RAMA 1G6RH 4JB9H 4WNQA 3U30C 5ESAB 4NN7C 3ZSSA 1G7MB 4OF7A 1RZFL 3GZKA 2C3VA 4EI5B 2DLGA 1VEPA 4P23C 1FYTB 5HDQH 43C9A 3OKKA 3KHOA 2NR6C 2YKLH 2Z92A 1A4KB 3U36A 4YAQB 2YPLD 4PGEB 3BESR 1LO3L 3LKPB 4YX2H 4N9GA 2VLKE 1P2CA 3O4LE 2OP4L 5J11C 3MNWA 1GCFA 2YOCA 1AXSB 3VWKD 5DUBA 2FEEL 3VXNB 4KHTH 5IHLB 3JWOL 3VWJB 1BFOB 2V17L 5D2LB 1L7IL 1A14H 2FWOA 2R0KH 2ESVA 2OX5A 3W0WD 3BPLB 4L3CA 3OKOB 3QWRD 4X6BA 4HBCH 1N5AB 1FSKC 2VZUA 5JMRA 2BFVL 2FLRT 5IVZA 3UAJC 5C09D 2O5XL 5C0GB 2ICEA 4ZXBD 2F54B 3DIFA 3T0WA 5MEOA 4PB0L 4JAMB 4YHMH 5BRZA 5EORL 4LVHB 1NMBL 4MQ7A 3C5ZD 4PJEE 4Q6IC 3MV8B 4E5XB 4NNXB 3RWCA 2XG5A 2ZSVB 4RFNB 1KB5A 2R0LL 1KJMB 4PY7B 1G7IB 3I75B 2QKIB 5IBUB 3TBTB 1CE1L 3SDYL 3D39E 4S1RH 2OR8A 4G6JL 4I48B 3ARDB 1TZGL 3H9SA 1UB5A 4FQQA 4FMFA 4PY7A 4MJIE 3BSZL 1DUZA 4M7ZC 3TT1H 4JFEA 3VFPA 3BRGC 5KS9E 1X4YA 2D31A 2DF3A 4N1HB 2PXYB 5I15H 3MQIA 5JOEA 4AL8H 5GJTH 4H1LG 3E6FA 3I50H 1A7RL 3B6SA 5CSZA 5E56A 1ZOXA 2X70A 4WV1B 3SDDD 2IMNA 5D2LE 3MO1A 2H41A 2NXZC 4M1CC 1BFOA 5I76B 4OIIL 5IVXA 1GGIH 4Z76B 2ED9A 3ARTA 3MOAL 3UO1L 1SJXA 1B4JL 2B4CH 3MRMA 3IS1X 3RVXD 1FPTH 1IGIH 5TQ2H 4TNWF 3L3OB 4ZO7A 4XGZB 2ZP0T 1IVLA 1VADA 2Y1VA 3O6ML 3T0EE 4MDIB 1BLNB 1W0VB 3RAJL 1XAUA 5DF0A 3U48A 5BVPL 4R26H 2R8SH 5EN2B 3WIHA 4JFQB 3RNKA 2FGWH 4JM2D 1CGUA 4NQCA 4MA3A 4HJJL 3C9NB 2DMBA 2FGWL 1NFKA 3UPAA 1GGIL 1AO7A 5SV4A 3JWOC 1F58H 4R2GB 4Z7UA 4K7PX 2OYPA 3JV6A 4PJGF 3BAEL 1KCSL 2JIXD 4OV5B 4L4TA 2P1YA 4ORZC 3V52H 5F9DC 4YDKL 3MGTB 1K3IA 1AC6A 1EIBA 1FNEA 2BSRA 1MY7A 2Q8BH 2NY3C 3NCYS 2B4CL 3KYOA 3ULVC 4TPRL 1ZHNA 4GAYB 3B9EA 5DZLA 3RFZC 4JFXB 2LQRA 4HXAH 4IDJL 3WNNA 4MXQD 3U2SA 3AXLB 1MFEH 1EGJA 1OP3K 3VE0B 2O5ZH 1I7UA 4K94L 5JW5B 4P2CG 3ARFB 3WYRA 2XA8H 2SEBB 3IJSB 3QDJA 5EU6E 5AWNH 4ORGB 4S1QH 3IDYC 2LTQC 2EIDA 1JCKA 1U9KA 4YPJA 5EBGA 2EE9A 2Z4QB 3IJYA 4FQJL 3SCMD 4FXGA 1MWAL 4S0TD 3OKNA 2Q8AH 4G7YH 3VRLE 4ELKB 3QQ3B 4ZS6D 4KVCH 1WGOA 2YD6A 1DUYA 3C8DA 2DI9A 3VFGH 4XHJC 2KKQA 1HSBB 2W9EH 1OAYL 1EERB 2VXUL 2WBJD 4ZNEA 4U3CA 5DMJB 2KDGA 3WHE0 1R5WB 3MCKB 2MOVA 4V1DB 1CICB 5F88A 3SDXE 2P43B 2NNAA 3OF6D 2Y6SC 3ROOB 3V5HA 5DEZA 1KPVA 3F12A 4OTXH 5F6HJ 2DWEA 2ZWLT 4JFXA 2DQDH 3N9GH 2C4XA 4F7MB 3R8BB 2AEQL 5FA4A 4Z77B 3V0WH 4HIJA 2EXWD 5GGTL 3CVHB 3ALWA 4POZD 4JHZA 2P42B 5C0FB 1T80A 3V0VB 3GJFB 3TFKD 3C5JA 4PRIA 5IB1A 4YEEA 3B2VL 3BMVA 1YEJL 1A7RH 4OLWL 5GGVL 4KV5E 1QBML 1RULL 5DJCB 4DZBA 5DFVD 4HUVB 1FVCB 3CMOL 4KAQL 2XV6B 5IEKA 3BKCL 1RUPL 2YZ1A 4BZYA 2R1WB 3DNKA 4FXGB 5I2IA 5DS8A 5EU4B 3WE6B 4JJHA 3WSQH 1BLNA 1W0VA 12E8H 1MQKH 3MA7A 3F6LA 3LEVH 1U8QA 1IBGL 3GBML 1CE1H 3DV6B 4LSTH 3SDYH 4RIRA 2VDOH 4Y2DD 4YO0B 3FTGB 4KJQC 4G6AD 2J3SA 4GBXD 4LNRA 4U1HA 2ZCLH 4FFYH 4RGMC 3SN6N 1HE7A 3MJGX 4LPVA 1JGUL 3HAEA 3MV01 4ZUSB 4U6VH 2J12B 5L2KA 1EHAA 1OAXH 3PG2A 4K55A 3OXSA 1SJEA 3MJ9H 1I7RA 3IDUA 3RWJA 5AZEL 1P5VA 1Z5LB 2LABA 4JQVC 1WBXB 4HK0B 3VG9C 1KSRA 3TA3A 3WJLC 1T1ZB 2R2CA 1I7TA 1ZLUH 3KJ4C 4FQLL 5E6ZA 1I8KA 2VAAB 2EXYD 1U92A 1SY6L 1PJ9A 1MCNA 1LK2B 3OXRA 4HC1H 4XC3H 1T1YB 2OJZH 4H1LA 5IR1A 2HT3C 3DROA 3TZVB 1JBJA 1HKLL 3U0PA 2J4WH 2MHAB 3WFBL 4OT1H 3T4AB 5I0ZA 5CEZH 5D96B 4OZ4B 4CW1B 5I1EL 1KYOK 3OKDA 2FL5A 3PP4L 3RGVD 3DWTA 1DANT 1KXQE 5KW9L 1YEJH 2MNUA 4OLWH 2ZNXA 3MFFA 2CKBA 5E8NB 4YDIL 4PJ5A 1F4YL 5CINL 5DJDA 2ZUVA 3MBXH 4LU5L 4UV7H 4W6XB 2GEEA 4QF1A 1MQKL 4IIQC 1MI5A 2H32H 1B0RA 4OGXH 1D9KC 2IFFL 1ZLSL 3KS0J 5D1ZA 1DQLL 2FYYA 4QTHA 4LCCB 3C08L 3DO3A 5BV7B 2FD6L 3QIBC 1PDKA 4PRID 3TO4B 4HFUL 1EEZA 5E03A 1IGFH 1FYTD 3U0WH 3N1MC 3QH3A 4XP9H 1FN4A 1FGVH 4DZ8B 2BNRA 4ELMF 3QFJD 4OQTA 2QADC 1FYTA 3KPPB 3HE6B 1XF4A 4U3XA 5DRNA 3PWVB 1ROWA 4UV4L 4LLDB 4Y4FA 2BY1A 4N90E 1NMAL 4IMKA 4OZGB 2XFXB 3JTSA 4MJ4A 4QRPB 1GRWA 3GI8L 1FL5A 4IS6A 1F4HA 3MUHL 4O4YL 2HFTA 1QQDB 3F7VB 1NAMA 3SDCA 4JQXA 4Q58C 5HYJB 3EBAA 5B38A 3H0TB 1IEBB 5INDA 3P77B 2Q3AA 4ENED 5I8OL 4WTZG 5KTEL 1BM3L 2HWZH 2CXKA 3CC5B 3PGCA 1DSFL 2K1MA 1CD1B 1NGWB 1WIOA 2C3GA 1YECH 2AV1B 3C6LC 4G9FD 2AGJH 5ICZA 4FTVA 1P84J 3MLVH 3X3GL 2CRYA 2NZIA 5KSUB 5IG7A 1JNJA 3LY6A 1LDSA 2NTSP 1NGQH 1XR8A 3T65B 2OI9C 4JM2F 5EC1B 2FH8A 4M7KH 3K2UH 2VISA 4CJ0A 1Z9OA 4FP8L 2E6PA 2GJ6D 4JKWA 5H2BB 4H25A 4KKLD 2DQTL 3MBEA 5T3XE 3CFBA 4K07A 1XR9A 1K8IB 43CAA 4ZS6C 2G5RA 4JKPH 4LLYA 5HYJA 4OGZA 1VFAB 5EU6A 5KVDH 4LCYB 4LL9A 5ID1A 2R0ZL 5ESQB 1IQWL 3F7VA 5I1CH 2VIRA 4K3DH 2NY0C 2E8ZA 2V2TA 5TE4L 5K9KA 1D6VH 1RMFH 4PJCA 1CFQB 3V6ZB 2P45B 1WFUA 1UCTA 4U1NA 1YJDC 3SE8H 3TFKC 3RIAF 1DJSA 1MOEA 5MEPA 1CDHA 1S7WA 4IDLA 3AB0C