2OMZB

Crystal structure of inla y369a/hec1 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion/cell adhesion
molecule keywords Internalin-A
publication title Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omzB00
3Q2WA 4AQEA 2O72A 4XXWC 3Q2NA 1SUHA 4ZTEA 4ZMPA 4ZMYA 2X2UA 4NUMA 1O6SB 3K6FA 3LNIA 5CZRA 4ZMWA 4ZMTA 4ZMVA 4ZMXA 3Q2LA 2WBXA 4AQ8C 4AK1A 1EDHA 4ZMLA 1NCJA 3UBHA 3K6DA 2YQGA 4QD2E 4ZMZA 3LNFA 4AQAB 3LNEA 1NCIA 3QRBA 5JYLA 4ZMQA 5DZVA 1NCGA 3PPEA 2A4EA 2QVIA 4AXWA 4ZMNA 2OMWB 2OMZB 4OY9A 1ZXKA 2OMUB 5KJ4A 1L3WA 4NUPA 3LNGA 1FF5A 4APXB 3K5SA 2OMTB 3LNHA 4XXWA 2WCPA 2A4CA 3UBGA 3K6IA 2V37A 2WD0A 4AQEB 1WUZA 3Q2VA 1OP4A 3FF7A 3MVSA 2QVFB 3UBFA 2WHVA 4ZI8A 1Q1PA 4ZMOA 2OMVB 5CO1A 2OMYB 4AQ8A 4NUQA 1NCHA 4APXA 5JYMA 1WYJA 4ZT1A 2YSTA 3K5RA 4AXWB 3LNDA 1ZVNA 4AQAA 3FF8A 4NQQA 2OMXB 2EE0A
chains in the Genus database with same CATH superfamily
2Y36H 3LH2H 3MRRB 2Q3AA 1U2YA 3S37L 4X6DA 1FJ1A 1DUZB 3S35X 2BM3A 3UYRL 1G7PB 1YEIH 2WZAA 4U4BA 4YPGB 4DUXA 4HWEL 4LQ1A 4OFKA 4ZXBD 4AIXA 4LLUA 2X3BA 4U7KA 3SHSA 4FFYA 2OCFD 2YBRA 2O93L 3WFDH 1KIPA 3I74A 2VDNH 4BZ2H 4WWKD 4EJ1C 1V8HA 4X98A 1CU4L 5E1GA 4JZJC 1I1FB 3MLUH 5C07B 2EDBA 1V5JA 2PN5A 5JO5B 1EXUA 3DVNA 3MRPB 1EJOL 1UXSA 2HB0A 3BVTA 3S5LB 2AJUL 3EJZC 3B2DC 2Z1KA 4M5SA 2F0CA 3P30L 3IFPA 1PVHA 1PQZA 4KQ3H 2ENJA 3QUMH 4LEEA 2PTVA 1MJ7H 4G80A 1VADB 2DQGL 3I02A 4CADA 4JFDD 5I0WA 5L88L 1QNIA 3ZTEA 1KEGL 1KGCE 4MXWL 1FNSH 2V5SA 5C09B 3W3BA 1YQVH 1AS8A 3NFPB 4MQXD 3WFBL 4Z3EA 3WUWG 1TNMA 4KITB 1WWBX 4UV4H 2XUWA 3P02A 3PWVB 2PMZA 4K55A 1M05B 3VCLA 1OP3K 4R0LA 1MLCA 5BS0A 3WTXA 3MLSL 1QAWA 3NRQA 5EZOL 1VFMA 2WXPA 3C6SB 2VAAA 2ICWB 1R3LA 3QI9C 4P2OB 3KLQA 2CSPA 3ES6B 3NQIA 3KLLA 4M1CD 4FABH 3LS5L 3A0OA 5DGQA 1G43A 1V3KA 2MTPA 5D72H 3B34A 2ED9A 2J8UE 4XC1H 3VQ1C 3SJVB 2EQDA 2HX7A 3MFFB 4K9JA 1OTTD 2DQEL 3ZQ9A 1YAIA 1IBBA 2X2YA 1CXKA 3NCXA 5F9OH 3UTZB 5IBUB 3D39E 3LTVA 5F7FA 4IBZA 1K9TA 1AR1B 5L2JB 3MRCA 1GRWA 3MBWA 3MV9D 2YXVA 2WQVA 1JAEA 3F83A 1E27B 3C09B 1EZVX 3FO1A 2J20A 3TL5A 1ZHLA 5E2UH 5ECJE 1U4FA 4G9FD 5IB3A 4WK2B 3T3PF 2BW4A 4RGMC 2FNWA 3DIFB 3KG5A 2AEQH 3CFDB 4FFZL 2Q20A 5HYQB 5TJWK 1NC4A 4ZW5A 2DYRB 1BSIA 1F3RB 3K71A 4CSZA 4QMEA 5HPMA 5I1IL 2XCMC 4M5ZL 2A74A 3FBQA 5I26A 3VGBA 4KKBD 1ET8A 2HJKB 4NRYB 3DYMA 3WO4B 3RZCA 5D1QB 4AIZB 2WZPD 5HYIA 1HTYA 5FYJE 3WL9B 1X9UA 4PRPB 3GWJA 1NCBL 1S3KL 2ODHA 3LRHA 3Q48A 1K6QL 3CZNA 1MCWM 1MUJA 4RGND 3T0EA 3QG7L 3X3FL 4PY8I 1AD9B 1H6FA 3BVNB 1SF5A 3OV6A 5CZRA 4XMKL 3I50L 3LRGA 3HI1A 1I8LC 3M1OA 2KPNA 4ODBD 4J3OH 4CJ0A 3SO3C 1SLWA 3DROB 3KVDD 5HDQH 3QCVH 4L1SA 4ZMLA 2BNQB 1WITA 3VXUE 1WZ1L 3BAKA 1A7RL 2Y06L 2VDLH 3CXDH 4MHHI 1TQBC 4XP6H 4L3EA 4R9HA 4PJ9B 5H2BB 4NQCA 3AMKA 4JM2A 4AITA 3G5VA 4M5YL 1J9RA 5C0CE 3VXSA 4I9XA 3HE7D 1TFHA 4L23A 3MI6A 4PJIB 4PM1A 4MJIB 1YEFH 4W4OA 5F7UA 3TF4A 1QKZL 4N2HA 4OJCA 5TE7H 5IB5A 1INEL 4BWWA 5DFAA 4JZJB 2HLEB 3EO1A 1KENL 2G4EA 3BIBX 3O2DH 4LBEA 4N20A 1QOKA 5LNDA 3DX6A 4A7GF 1CFNB 5KANI 1KB5B 1I9RH 3SEPA 3MJ7A 4ZUTB 3CIQA 1J5OL 3R06A 1SN0A 3LAFA 5JTWA 2KL6A 3NCYP 2A6DA 5HHXH 1ZLUK 3P2DA 3TBBA 3CZKA 1AQKL 3T0AA 3ZMRA 2O6EA 4ELKB 3L54A 3NJMA 1WT5A 3VVWA 4PY7A 5AFAA 4L8DA 3QIWC 2KZBA 3N1FC 4OFPA 2IWFA 5LKNA 1MNUH 2N4IA 3C08L 1TEYA 4NJ9L 2B5IC 3FB7A 3AFLA 1QVOA 1A4KB 1PLGL 2H6PA 4PJ8A 2FH6A 1XEUA 3F7YA 1UXWB 1YY8B 4K3DL 1QLRB 3W39B 4XVTL 3ZE2B 3CN3A 2C4XA 4WGKA 1NFIA 5E24E 2CPCA 5DJYB 1IAOA 3LXBA 3FAXA 3FO9B 5KBNC 1PIGA 3RVWC 3VFGL 5L0QC 4DGIH 2Y0SA 5TDNA 4X7FC 3B2PA 1KC5L 2J72A 5T33H 1EZVY 4J3OF 2OSLB 5D1XD 4A67A 2WZ0A 1I3RA 4XO8A 1H8SA 1EO8H 5K1JA 2VW6A 3RX9A 2ZOKA 1WAPA 4W9CC 1AY1H 4NCDA 4RDBA 3TONA 3Q13A 1WHPA 5BVJB 1GAFL 3V0VB 4Z78B 1OAZH 4RRPM 2G75A 4NKQB 1ES0A 1G9MH 3NJNA 4GLRH 3G6DH 1CXEA 1VFBB 5BQDA 4I0KA 2NW3B 4P5TC 4AM0Q 3HC2A 3MV7E 1RUPL 1O5PA 4JFED 4F7PB 1KMGA 2XXMB 2Z35B 3HA0A 3WS6C 4RGMB 3VFMB 5AD0A 3NCMA 3QPXH 2BWQA 4MCZA 1TQSA 5K9JL 1M53A 1MHHA 3EOAA 4TUJB 3WEXA 3F05A 4JLRB 4N2LA 5C8JB 3WLWC 3UTSA 5JHBA 3ARFC 2X70A 3E0GA 2OYPA 5BZDA 1DQML 1NMCC 3L7EA 3E6FB 1A65A 1KTBA 3FFCE 1KPVB 4HDIB 3ZRCC 1PLBA 1OAKL 4W4NA 5C07E 2FHCA 3V6ZA 1PX4A 3SN6N 2Z7ZA 4DSYA 3HN8A 2WNGA 4HLJA 4MDJB 4X6FA 4FQXD 4HV8A 2C8NA 4YBQC 1SEBA 4P5KA 3EH5B 4F91B 4NQVA 1UZ8B 3FAWA 2BSRA 3PWPA 4KX8A 4XNDA 1YUHB 1BG9A 3SO3B 3MOQA 4JUSA 3IE4A 4Z23A 4HGWB 1AIZA 4PU2A 4WJ5A 5DLML 2O61B 2APXA 2P43B 3BPCB 4WTZA 1G6RL 5JHLL 1A4BA 4HH9B 2E27L 2OTWB 2VRQA 2V2TA 4MLIA 3E1ZA 5EOQL 3OAYK 2KLTA 2K6ZA 4G7VL 3ILQC 1FE8H 3Q8CA 3GRWL 3L4ZA 3SOBH 3TJHC 3KS0J 4M02A 5CGYC 5IK3A 4H2AA 1QASA 3O6FA 2MNUA 1GTNA 2FVNA 1QUNB 2IV8A 2JH2A 3QC5X 2B0SL 3OAUH 2X3CA 4F8OA 4GXFA 1IBHA 2VXTH 5KOMC 1ZEAL 4Q0XH 3C87A 2R1YA 1W6LA 3IEAA 3KLAB 2F54B 1CT8B 4G7RB 1OCZB 1S7TB 2K6YA 3U9WA 3IKKA 3BPOC 1B4LA 4ZO6A 3BESR 4AYDC 1P5VA 1BJ1H 3EJRA 1QPPA 4E41E 4LK4A 3SE3C 3LEXA 5C0RL 3T8VA 1M7DA 4IMLA 5IUCA 1ASOA 1BZ8A 2IFGA 1RJCA 2BVQB 4FTVE 4L4JA 4AYID 1KTLA 3S37H 2DLEA 2G60L 3IWVA 3O4LB 3CN4A 5IQ9A 3WTYA 4KZEH 3BFWA 2J57A 4QRRD 3F2LA 3QIWB 1DVTA 3JV0A 4PD4J 5KVEH 4HWEH 1WSST 4IOIB 2XDHA 1ZKAA 1CLYL 2B5IB 1DHKA 2WMPA 4ZMPA 2UXFA 4GKSB 3J07A 1CB4A 1SJEA 5PAZA 5B38A 3EO9L 4LIQL 1UYWL 3ARBD 3UH8A 3VE0B 2FCBA 2Y22A 3CFUA 1ZLWH 3U2IA 4PV8A 2RGSA 1CU4H 1L6ZA 2BERA 3HC4L 3BH9B 1E9QB 2E46A 3AU0A 5D1QE 2MOVA 4ZQKA 4FQLL 5F96L 4EZMA 1X5KA 2ZF8A 3FCBA 1CF8L 1TKWA 3C9NA 1S3RA 4PRPE 3P30H 1KIUB 1KT2B 5AAMC 3UGXA 1FZKA 2OX5B 4TTDD 3TEUA 5KUKA 4WHTB 1A2YB 1JN6A 3REWB 4PGEB 1U58A 2DQGH 5JW5A 5L88H 4FS0A 4N68A 1AC6A 1JXGA 1XZ0B 1CDHA 1XVSA 3LEVL 1P53A 3F5WB 3PGCA 3Q5YA 2BZ7A 1BQRA 4HPYL 4QIRA 1CJYA 4MCNA 4V1DD 4OCMC 1OM3L 1INDL 4PJ5B 3W5MA 4YHOH 3BUTA 2AQ3A 3HPJB 1BXVA 4N5ED 5I18L 5D7JD 3Q9QA 4TUKH 4WTZG 1TMQA 1QFWM 4AXWA 1K2DB 4P5TB 4B5EA 4GG6B 4YSDA 2IV9A 4NKIL 3MCLL 1CYXA 1BF8A 2PCPA 3IF1A 4PVLA 3FU8A 5D7LE 3OTTA 3TZVD 3MRHA 4HIEA 5TF1L 5EZOH 1ITBB 3ULVE 3KZ8A 2EDHA 4LBAA 1E3XA 3ARPA 3DXAE 5KAQG 3FT4B 5CJXC 1IL1A 1NDGA 1MG2C 3OWEA 3C60C 4OCWH 4WNSA 1VEOA 4PJIE 1JZFA 3DOIA 5ILTL 3KYMB 3D4ZA 2DI9A 3N06B 4PRHD 3ARFB 5FCUL 3OR6B 2ENPA 2ZX7A 2X88A 2E7CA 1NMCB 2Z1PA 3X17A 4KK8C 4PJFF 5H94B 4JCWA 2YEZB 4UDTB 1NKOA 2DQEH 4MYPA 5KSAD 1U30A 1RVFL 1TEFA 4GPVA 3GXFA 1N8ZA 1TO4A 2VLJB 4XNUL 1XGYL 1S7XB 3DRQB 1JNHB 1P6WA 4DZ8B 5SWZB 1UOLA 3MNWA 2CIIA 3U2SA 2HYMA 2X05A 4IKJA 1BFVH 1B0GB 1Y18B 1HSAA 1CGVA 4OF5A 1MRDH 2ERJB 2YQBA 4P4RA 4EI5A 5I1IH 2OMXB 2EYTB 3KEDA 4N5UA 3B7YA 3LIZA 4BH8B 3T8XA 3CSYB 2HMID 3TV3L 4HX1A 4U6VL 2UUDH 5B38G 4PJFA 3M1BA 3H85A 4ZDHA 3CU7A 5ITFA 3ZE2E 5TDOA 2NYZA 4CSTA 1ZGLM 4ATWA 4UTAL 2H2PC 1S3KH 3BW9A 5DUJA 4I1PA 2V33A 1F3JB 1LMIA 2XZAL 1K6QH 4PHZA 1X44A 2H32B 3QG7H 3X3FH 1CDYA 5E7BA 1CIDA 1IB5A 3QJQB 1L9OA 4PBVC 4XMKH 3I50H 3VXPA 3BPOB 2UVEA 1XF5A 2LOEA 3AY2A 4FLRA 3AQDA 3VJ6B 1HZLA 4UT9H 4F8PA 3SD5A 4W9IC 4HKBB 4U7SA 3QH3B 4G71B 3FH7A 4XVUC 1SXCA 4P46D 4AK1A 1WZ1H 4OFYA 1A7RH 2Y06H 3BPLC 3FUDA 1JUFB 3OB0H 1MRCL 1SMAA 3MMEB 3OVUB 3P4OB 5CILL 3G6AA 5DURB 2A5UA 1WIUA 2CD0A 4QO1B 4M5YH 3VXOB 2RHEA 4C56D 2EUWA 4GQZA 1E67A 4F27A 4UQ2B 2DYPD 1U91A 4MD4B 4HJUA 1K4DB 5IB2A 1XWVA 4EKXA 2YZ1A 5FM5M 3TVMC 4L4TD 4H20L 2VYRE 1MCFA 1UXLA 2YUXA 1MZZA 4KQ0A 2XBDA 1Z66A 1QKZH 4Y4KD 3Q7JA 4QXGH 3GJFA 1INEH 2OKMA 5CIPH 2DBLL 5I0ZA 4Y89A 5CHNB 1GZHC 3SDXF 3V7AE 4H0LC 1PIFA 1J5OH 3BRDA 5FECB 1J1OL 2Y3AA 3MOAH 4AW7A 4IRJC 4K94L 4XP1L 3BAXA 4ZPVA 3O8XA 5E5LA 3MNDA 4Q4EA 3DK2A 1XQ4A 4I4WA 2KH2B 5KJRL 2QADB 5JW4M 1KTJA 2EDYA 5AW8B 3U7WL 5E08L 3FUIA 4IEFA 1TU2B 1YPZA 3C08H 5IBTL 4NJ9H 3Q2VA 5F0JB 5G4OA 1ZK5A 2NDGA 5JXEA 3M17B 3T71A 3BRFA 2XWBA 3TV8A 1F56A 4HC1A 2IMNA 3D0LB 5CLWA 1F11A 4L9LC 3UOAB 3TBVA 5FEBA 3PHOB 5C70A 3QB7C 1UKSA 4HQQL 3F7KA 3FH8A 4Y5XA 4ZG1A 1TTFA 5E9DD 4G5AA 3VFGH 4AC4A 4KK6D 4X4XA 1NKGA 4G43A 3QORD 3TN0C 4O5LL 4N6RB 5DFVD 1E9PA 2WLZA 4FTDA 1KACB 3RDJA 4CC0A 5BV7C 1EA9C 3I6LD 5IFHL 2XI9A 2F54E 2HLFD 4P2QD 5EU5A 3AWFA 5HVWA 2AP2A 4WSGA 2OXGA 2Z92B 1RURL 4G9DB 1HZHL 5J1TC 4WTWA 1ACYL 5HSFA 3PUUA 1DQJB 3B8YA 3BSZA 4HFWA 1RUPH 3I3EA 5ID0B 3O4LE 4HEPA 2YGNA 3K81A 4XPBL 1P5UB 4PGZA 5DQ9A 5LAXB 3TBYA 3BYYA 2WXOA 4DN3L 1P7BA 3QR2A 1V7NH 4EN3A 4I9WD 1TTAA 2B59B 1LEIB 5K9JH 1XSKA 3L3GB 1WEJH 4QTHB 4M3KB 3KL3A 3U0PA 1J87A 5LBSL 1D6EB 1KB3A 2OJZL 3ZQWA 4WEMB 1FC2D 5B1KA 1KV7A 1N5AB 3OL2A 4BSVB 5JQIB 1XGPA 3MRNB 4G82A 1OAKH 3E2HC 4YHPB 2YPKB 3K0WA 3MRFA 2ATPA 1II4E 3VGEA 2SODB 1ZPUA 4P3CL 3AG1B 3LRMA 4O02L 1BQSA 4MLSA 3HR5A 3DVIA 5C0IB 5EF0A 3SZ6A 3FTGA 2UXVA 3LIUA 3QIUB 2PR4L 5C0NC 1XSOA 3FQXB 4U1IA 1S5HA 1R5VA 3GSWB 5DLMH 4ABWA 4HZ1A 5JHLH 1G6RH 3F84A 1IV8A 3IJ8A 4XBGB 3O2VL 4GI8A 4ABQA 3BPLB 2E27H 1CGYA 4JPVH 4PJ5E 2R69A 2EZ0D 3CJJA 1OGAA 3QUYD 5AVRB 2OR7A 1VRSA 4GG6E 3D85D 4G7VH 4TTGA 1N6QL 4PRDB 3A6OA 3D25A 2JKLA 5AOZA 4EOWL 1E8WA 1U8OA 3FK3A 3MXVH 2DMCA 1Y6MR 3TVMB 4A68A 3QWOA 1SJHA 1D9KB 1ZEAH 2Z3FA 4C4UA 3VI3E 4LSQL 1MAML 1XCQB 5ICXA 5ACMA 2Y7NA 5FKPB 4FXLA 2CLRA 4HUCA 4J4PC 4RWYL 2ED7A 2AQNA 1J0ZA 2ZD0A 5DI8A 4Y4HD 3GBMH 3VYNA 1YSOA 1ZT7A 5C0RH 5EBLB 3QZLA 2YGVA 4POZC 3S36L 4KRNA 1BXAA 4JKPH 2C1PA 1DYZA 1T2QH 4NFBA 1AKJB 4QOKD 3WMPA 1X5AA 4O00A 2K0RA 4R0LC 5I15L 2VDOL 3RL1A 1LXMA 1U8NB 4FDWA 2FJHA 1T1ZB 2EE0A 2VLJE 5LNGA 4FXKA 2D7MA 4H25A 4IKNA 3L81A 5IQMA 1MFCL 2A6IB 4PWHA 4X8JB 3ZQXA 4BKSC 5C0JA 3U7AA 1CK0L 4JFUA 4LSTL 4UYPA 1XF2B 1CLYH 2YR3A 4NSKA 3MACH 4B60A 2NYYD 4HEPG 5SWZE 2XPZA 2AEIT 3EO9H 3GRBA 1ETB1 4LIQH 5ID1A 3NCYS 4R2GC 4AE0A 1H5BA 2QTEA 4L9LB 1J9TA 3BQUA 4LKXB 4LZKA 4D94A 3EO0A 1WC7B 5GGRY 1FHNA 1SLXA 5CD5D 2IWGA 2IAMD 1T2JA 2PWFA 2XIBA 4FQLH 2BNRD 3OZLA 4JZNB 4KDTA 2CKBB 4MQ7A 4P5MA 3CFEA 1CF8H 2B1AH 3UTTD 35C8L 3KPRD 3KYNB 2ZYRA 1NKRA 4GIPD 1FO0A 1UACH 2QPEB 3TN0B 1BIIB 1AR2A 4BFGA 5A6MA 3VFTB 4AM0B 1TZHB 3LEVH 4HPYH 2WN2A 2ZUUA 3QZOA 3C5ZD 3H7LA 3WBDA 1PW3A 4F7EB 5K9KA 1QEWA 1ZD6A 25C8L 2BHFA 3PP4L 3TBWA 4HUUB 5CFHA 2A74C 2JE8A 3QEGL 2HJLA 2MNJB 5CJOH 1PDKA 3RZCC 5I18H 4KI5D 1JF1B 1KN2H 2WTRA 2ZP0T 2R7EA 2FSDA 3K8MA 3DHUA 5AAWA 3MCLH 4OCLC 4M8VA 2QVIA 1QSFA 4H2CA 3NESA 3UTQB 4TQEL 4ANXA 3O4OC 2CHWA 1E4KA 1KCUL 3KPSB 4WWPA 4YE4H 5EMYA 5FUOL 2ZX6A 1W8EA 3T0EC 2ITDB 3KHQA 4EUPA 1LQBC 1OAQL 2EIZB 5ILTH 4JFFA 4KJYA 4X7CC 1T0NA 5DJCA 1T5XB 2AAAA 5E1QA 4JG1L 5KSBA 2DBJA 4ODUB 3N9GL 3IAPA 3BZ4B 5TF0A 3LSOA 3V8CA 5BRZB 4LEXL 2Q86B 3N1QC 3E2HB 3MCG1 4N9GA 5I71C 4QTFA 3WI9A 3H0TB 2IPKA 3S34L 4N2OA 2JK5A 1RVFH 4R7NA 1FJ1B 4X6DB 4W9EC 3T09A 5IEKB 3EJQA 1DVFA 1GSMA 4XNUH 2C5DC 4PW4A 4Z76B 2H0FA 1IGMH 2C4FU 4QY8A 5LQBL 4Z7VA 4LLUB 4TXVB 4GMSL 3HNTL 1HSBA 4ADIA 4CMMB 3DARA 1KIPB 3MGOA 2R8SH 2VDQB 4W4OC 1MHPL 3IB4A 4OH2A 2CNZA 1OZUA 5IGXL 5H37A 3S37X 43CAA 4JMXA 5DMIH 5EOCL 4HOMA 1BMWA 5DYOA 1G7QA 1LO4L 3FF8A 5FKAB 3TV3H 1EXUB 4GKLA 4U6VH 4OCNC 1UXSB 4OZFA 1N26A 1W9XA 1QNZL 2WXJA 3MJ8B 4H13C 3AREC 4EBQL 2J1ZA 2CLVA 3ZSSA 4UTAH 3H3PL 5T1KB 4R96A 4PLKC 3HG3A 1UA6L 3FFDA 4P3DB 3H9SD 1ZOXA 4WHDA 3LH9A 1NGZA 4H8WC 4D0CA 3IDGA 5LG6A 1SMDA 2KBGA 1WT5C 1U8PB 1HWGB 4FE9A 4HIHA 5L4FA 4F93B 1F5WA 5C0AE 4LPVA 2EKSB 3QG6A 5JZ7C 1N6UA 4ZMTA 4PJ8C 5I17A 4GH7B 4GO8A 1A14L 1XH0A 3QYCA 1LVEA 4DW2L 3VCLB 4A1RA 1DCLA 1ZA3A 3DETD 4R0LB 1MLCB 5FV1L 5BS0B 4JFOA 3VD4A 1Q4NX 4XMXA 4KC3B 1Z9NA 3JVGA 2FJUB 5FAAA 2X6UA 2VAAB 1IU1A 3N40P 4Y1AB 1WCBB 1R3LB 1BVOA 2GKIA 4HG4J 1FYTA 2XYBA 2ZG3A 3IYLW 5GRJH 4H20H 3VXRD 5GJSL 4R2GB 4GKNA 3NSDA 2HT3D 3CG8A 2HWZH 2K4AA 7PAZA 3HVNA 4EUPG 1ADWA 3ZVVA 2DBLH 4U31A 1DSYA 5DD5L 4HK3N 4K7PL 3GC3A 4XNMB 3QDGD 2Y72A 4Z7WF 3MBWB 1P4LA 2XN9B 2Y23A 4K94H 4XP1H 2XV2A 2NTSP 2LAAA 1P1VA 3FO1B 1OGSA 1MHCA 5IB3B 1HINL 2GTQA 5KJRH 4H1LH 4Q58C 5F8QC 2NUPB 3T0XA 1NC4B 3V79C 3K71B 5IBTH 5HPMB 3EOBA 2V8LA 4POUB 5F3BA 3ATAA 3HBZA 3MKGA 2QLYA 4FGMA 1IE5A 2E8ZA 1TPXB 1KXTA 2E6JA 5H37G 4HSAC 3MCYA 4AKPA 4ZZFA 2AQRA 4UU9A 4HQQH 4L1HA 3T0EB 1OAUL 3BVXA 4NM4L 4OZFG 1S2EA 1S78C 4JG0L 5KZCD 1SGKA 3HI1B 2VUOA 4HP5A 4O5LH 1EFQA 2AK4D 2CIKB 5J6GB 4PPTA 3T3PB 5IFHH 1ID5I 2VDNB 3GTTA 3FQNB 5IHLB 4PLNC 1EHKB 3D5OF 2W9EL 5HVGB 4KTEL 3MRJA 2W95A 3R19A 1RURH 1HZHH 1OTUD 1CVSC 4NQCB 2I9TA 1ACYH 3NYKA 4N1HB 2A9AA 3RI5K 3Q1SL 3FT9A 4PRAA 3VB8A 4KZEL 4KKLC 5FOBB 4MA8H 1E4JA 3O6FC 1H9VA 2JCCA 4XPBH 5EEXA 1QACA 2P3YA 3IRCA 1HNYA 1W8NA 2AJSL 4A7UA 3NP3A 1AJ7H 1YEEH 4ZXBA 4UQ3A 3X14A 4ZMVA 4OZ4A 4XPTL 2EIJB 5IB5B 5EF2A 5IW6A 3EO1B 4MNGA 4JKNA 3MLXH 5LBSH 3DX6B 3THMH 1OGPA 4GW1A 3MJ7B 4QJ3B 3EOYG 4B27A 3AREB 4WWKA 5F6HI 2C9UA 4HKJA 5IVOA 3CXFA 4E9TA 3NJJA 4XN4A 1NIAA 3A4DA 4QRQB 1A9EA 2A6DB 5A2CA 4JCLA 4KO6A 4P3CH 2ADFL 3GMQA 4O02H 3BJLA 3C5SA 3VRIA 1W0VA 3IDNA 1I1AA 2WLKA 2P5EB 2DB8A 3RVXD 5KW9L 1U36A 1IUZA 1OWWA 1BLIA 4BHUA 4G6KH 3SE6A 4YHKL 2AJ3A 1PLCA 2JB5L 2BFVH 2EDRA 3FO0L 1Z9SB 2H6PB 3CFJA 3MBXL 3F7YB 4JGUA 4LCCC 2MPAH 4KXZH 3DBXA 4Y2OA 3O2VH 2WKOA 4WFHD 3DJRA 3Q0HA 4CBPA 1RJZB 4WUUA 5J8OA 5LLIC 3V4VH 1GOGA 1NFIB 4AL8L 2HTLD 1CD1A 1IAOB 1A7BA 2WWMC 4RESB 1HK6A 2CJSA 1LE5A 2WO4A 2Z0BA 3JWDL 2CM5A 4Q9CA 1CD0A 1FL6B 5I28A 1MNNA 2B3IA 1QATA 3KGUA 3IDJB 4EOWH 2A3TA 1JHTB 3KPSE 1ZA6A 5INCB 3GSVA 4MZRA 5A2JH 4OV6F 1I3RB 4F1ZA 1CGSL 2GSGA 3QK0A 5SWSD 1DL7L 2ZOKB 4IKKA 3QQDB 4D0BA 4LSQH 5T3XE 1MAMH 1T4WA 1Z2KA 3OX8B 3A21A 1E28B 4UTBH 5AVQB 3RTQD 2B4CC 3V0GA 2L7JA 1M2VA 5BRZE 1T5KA 1B9KA 3WMSA 2O30A 2G75B 1VA9A 3S36H 1ES0B 3UX9B 1CR9L 2ZX5A 1UZ6F 2ZXDA 3ATFA 3FCUB 4IS6B 1UD3A 4X4ME 1VESA 3CPLB 4X6DE 1GYUA 2DWDA 2A83A 3M07A 4KGJA 3TWCL 3SYPA 3IMRA 3VUAA 3MV9A 1MFCH 5E70A 4MCZB 1MHHB 2O6CA 3EOAB 3E8UL 5J12B 3WEXB 2VLLA 4RMVA 4G9FA 4OLUL 4XXCA 4JQVC 2X70B 4ZX6A 1FUNA 4D2NA 2A4ZA 2OR9L 4ZMYA 2OYLA 1AZZC 2Y6SD 3KXFD 3QCTL 2VITB 4X6FB 1U92A 4HV8B 1SEBB 4PJBA 3ROOA 4P5KB 4NQVB 2VQ4A 2QPSA 35C8H 1VCBC 1P7QB 2EXSA 4HGMA 4BHUI 2BSRB 4Q9QL 2VSKB 3X13A 4Y5VC 3TH2T 3BYTA 2A0LD 3PG2A 4LOUC 1ZTXE 3UEQA 1AO7D 2X4RA 3VAEA 4JRWA 4IRZA 2F5BL 1RZKL 1GCYA 4LF3A 4O2CB 5FO9B 2V2TB 2X6MA 25C8H 4L1TA 4EI5C 3PCYA 1RCYA 1Y0LA 3BGMA 3ECWA 3QEGH 2F1BA 2L3BA 5IKCA 3DV4A 1XAKA 3PWJA 4LCUA 4M1GL 3NZSA 3SQOH 5IK3B 3O6FB 1IMHC 3DOSA 4TQEH 2DMGA 5DRXA 1IKNA 1V10A 5BUGA 3NJLA 4IU3A 2MNWA 2X5PA 4JO3L 1KCUH 4YDLC 4R26L 4J2QA 4NFDA 5IVZA 1UB5B 4L4VD 4Y1AE 2CM6A 3ZRSA 4C4KO 3O2WH 2R1YB 1TTGA 4LNRA 4KO5A 4JG1H 3L4WA 1BXUA 1BV8A 4M7JH 1I1CA 5LCVH 3II3A 4NO0D 3PUCA 3LEXB 5ENWA 4JQIA 1M7DB 4IMLB 4TULL 1N12A 4PLJD 2OP4L 1Q0XH 4G6MH 2DYSB 2W9DH 4HCIA 1OSYA 3MDJA 1BBDL 1KTLB 3S34H 3MLWH 3V10A 1KULA 2VIRA 1XGTA 1CD9B 1DSFL 2NY2C 2XN9E 1KJ2A 3FQYA 4JRXB 2YWZA 2X2IA 5FK9A 5DEGA 1FV1A 3LN9A 4X7TB 5GS1B 3S2CA 3PWUA 5LQBH 1RZFL 3QFJA 3BKML 3LZFH 1QO3A 3HNTH 3V0AC 2WMPB 1QA9A 1GJUA 3K3QA 1SYVA 1SJEB 4LCCB 5B38B 5CO1A 5JLZA 2XQYK 5L6YL 4LSRL 1MHPH 5IGXH 3NPSC 4PV8B 2VB5A 4U1LB 3ULUC 5EOCH 4YZWA 1ZXQA 1TJIL 4L8CB 4UT6A 1ZLUH 5AZEL 4BRVA 1Q38A 4ZQKB 3A6BH 1T89A 1ECZA 1QNZH 3C9NB 1XR9A 4EBQH 4PCKA 2DWSA 4GEIA 4Z7OF 32C2B 3OKYA 2W92A 3DX9A 1JN6B 2A99A 3O8XC 1ET5A 4PN6A 4QWWC 4ZO8A 1U58B 1UA6H 3EYQC 4Z0BL 5JW5B 5TD4A 1H3PL 2OZNA 3IJHB 5C3LD 5J89A 4AW4A 2AXHA 3PGCB 1NCAL 5HBBA 4RBPH 2FUQA 3V4PA 4H8VA 5D1XA 2XJKA 4GW5A 2H47C 2DM7A 3OAWA 4P5RA 5JXEC 1REIA 4FXGC 2BS9A 3T1WA 1N5YH 2DJMA 1UWGL 5FFGA 1A14H 3E38A 3MRMA 3EADA 4ZMWA 3MUZ1 2PCPB 4PJDF 2JLLA 1N0LA 4NQCE 1WS8A 3MRHB 2VRAA 1BZ7B 3BAEL 3ME0A 4HBCL 5C92A 2X4PA 1A8JH 4IU2A 3AAZB 2BWIA 2W0LA 4Y5XC 3U0TA 4EZLA 1NDGB 1Z32X 4NRXA 2XPYA 4JFEA 3RY5A 2EXWC 4KXZI 1A1OA 3CZFB 1XTLA 1P69B 4UOW1 2BY1A 3D3VE 2DM4A 2EDDA 4MJ5A 4B3EA 1HIMH 3SQBA 5I73C 2IO5A 2WSDA 4HISA 5IQ7H 1YY9C 3AB0C 2FGWL 5DD5H 4HOWA 3OXRA 4YHZH 1JDCA 4K7PH 4OQTA 5D2LF 1NCOA 3UDWA 3ZLQC 4Z77B 2IGFL 2FEDC 3KVQA 1I9JL 3ZHLA 5C0EB 1CXLA 3F58H 2FEJA 2KPWA 4Y5VB 1XF1A 3HZYB 4NUPA 5F1KC 2EE3A 4WTXA 4FQXA 1G7JB 2WTOA 3VM7A 3CNKA 4NCC1 1HINH 2P5EE 3GMMA 1TZIB 4QKXB 2CIIB 3LNHA 5ICYB 3U2SB 4EN3C 3BVWA 2CO6A 1HSAB 3DX8B 4UBDC 3MR9B 2IQAA 4EI5B 2HJFA 4KTDH 2VE6B 4WGVB 1XBRA 4LEOB 1PX8A 4MNHA 3QEUA 4HD5A 5I8EB 4HX1B 1O6TA 5CEYA 4PJFB 1VHPA 4YVNA 4ZDHB 3KBEA 1LL1A 5TDOB 3TS8A 3DSNB 1S9XA 1XT5A 5ECGA 4YDLB 4ISVA 1XSIA 5D2LA 3BW9B 4J1UA 1UGNA 2VZOA 3PS6A 3QFDB 5E4EC 1YHPA 2OMWA 4ONFL 3L4YA 4RETB 4NZUL 3NA4A 4HUNB 1BIHA 2MMXA 2E4FA 3IBOA 4G83A 1XF5B 3LV3A 3NZHL 1YEJH 3ZE0F 1G9EA 2W9EH 1QD0A 4OLZL 3G3LA 2CDEB 5HYFA 3P4NA 5I1GH 1GCFA 3T1FA 3FU3A 4ZAKD 5CF3A 3B7SA 2NY2B 4O4YL 2LLLA 5HJGA 3HG0A 4IDJL 3QAQA 2N01B 3TYGH 1SBBA 2ZSVB 1U91B 3Q1SH 4XMLL 3LZNA 4X8GA 4FMKA 3VRLF 1GZQA 5FGCB 1RPQA 4Y8DC 5IB2B 4JHZA 1KCLA 2AXGA 2F58H 3BP5A 3GO1L 1UH2A 2X2UA 2ZYHA 1Q9WA 3HG4A 3EZJB 2PO6D 4PGJA 4QRRA 3STZB 4NUMA 5B8CA 3IGLA 3NPSB 3UL4A 2DF3A 5CP3A 4MJJA 4HIQA 3ARBA 4JFQA 1U8LA 4MB5A 4TL5A 4DEPC 1E3ZA 1BA9A 1NCJA 1QSZA 1OSPL 1PLAA 4ZPVB 3O8XB 1ZRUA 3KCWA 2ADFH 1JD7A 4I4WB 1A7QL 5DS8A 4FXKC 5E6IA 5F93C 4GP4B 4YBHA 2KKQA 4M7KL 4IEFB 4K71C 5KW9H 3IVKA 1FA4A 4QGYA 4S1DD 5JA8B 3B3BA 5IVXF 1X9LA 3D2TA 4Q52A 2K7QA 4FXGB 4JUTA 1TJGH 1BVLA 3FO0H 4BEIA 3MBXH 4XHQA 2XWBB 5HGBA 3OZ9L 3FU7A 3OG4B 4F9PA 4TPRL 1H5BC 3OLDA 1HXMA 3BQUC 3TBVB 3C2SA 3FT2B 3REVB 1XH2A 4PAZA 4AYSA 4P3WA 4AL8H 3L3JA 4KKCC 3SDXB 4M7LL 3EH4B 4G11A 1IIKA 4Y5XB 1A4JB 4KDTC 3JWDH 5E1HB 4YX2L 2YD1A 5C2UB 1NCDL 4OR1A 4X4XB 3TZVA 4G43B 1BW8A 1I9IL 3QPQD 3DUSA 4J6RL 2C9QA 4WY7H 1JYNA 2ZCKL 1E9PB 2VXQL 1CGSH 4LLMA 2GSIB 4LMQI 4HUVA 1HT6A 1DL7H 1ZE3H 1DQKA 2V2WA 4Y5YA 2DIBA 4OLXL 3FUKA 4QJ5B 5I73B 2F8VA 3QJRB 2OXGB 3AB0B 5DSCA 4HIJB 4PRHA 4IBSA 4AYMC 1FFPA 1ERNA 2CXGA 4PD4K 2W59A 4DKTA 3VXQA 1Q94A 1SMOA 3ZBMA 3WKQA 1CR9H 3SB3A 5CN1A 3LRSA 2XG4A 5AAWC 3ROLA 3CFMA 4G6AC 3H9ZA 1MHEA 4M61A 5BOPA 2XZQH 3TBYB 5DQ9B 4AQ1A 2JJWA 2YD3A 1E4KC 4JRXE 3U1SL 3HLAA 4EN3B 5B7MA 2QZQA 3DSFH 4JDVB 1L9PA 3BIKA 3QUMA 4I77L 4FL4B 4DCQA 1R75A 4HWZA 2QR0A 1JBJA 3U0PB 5CP7A 4OLUH 1XF4A 4YC2C 2UY6A 4XVJH 1QLFB 3T0WA 1XGPB 1EJ8A 3QRFM 1NDMA 3MRFB 5ANMA 2ATPB 2NW2A 4WUKL 1FZOB 3HUJF 3QCTH 4ALAL 5JPMA 3CN1A 5E4EB 5HJDA 4JM4L 1DVFC 4Q9QH 2YLHA 3WFEH 3FTGB 1I4FB 1K8DB 2A9BA 2NX5B 4DGYL 4U1IB 4QCIA 5AL0A 1R5VB 4X42A 4U1JB 4UTCA 2F5BH 1RZKH 1YNLH 3FCGA 4QT5B 4W9DC 5E95B 5EB9A 5HHQB 3HG1D 3GS4A 2A7BA 4XMUA 3VWKA 3WEOA 1OGAB 2DJ4A 4BFJA 4J12A 4P46A 1PG7H 1X5ZA 4JHAL 2UZYA 5IFAL 4M1GH 4YDVB 3D25B 3CQFA 1U8OB 2IH8A 1PZUB 4MMYA 4AENA 4XVSL 4G6FD 3QWOB 1G7HA 4R26H 1J7VR 1SJHB 5FX3A 3QXWA 4C56A 5KJ7E 2DYPA 3LKNA 4X7EC 5DFTA 3EHBD 5ICXB 1I3GL 3GSNL 5AALA 1NMAH 2CLRB 3VXMD 1JZGA 3US9A 2IAND 1FYHB 4TVPD 4DEPB 4AGQA 4K3JL 4Y4KA 4MA1C 3FUMA 3ZYIA 3ZRFC 1VFUA 2W9LA 5IJVB 2GI0A 3U83A 2NY7H 2C9VA 3CDGB 1NGXB 1BBDH 5DEFA 3RL1B 4KNSA 5KSUB 3LKPB 2FJHB 3DV6A 4L05A 1DSWA 4FXKB 4H25B 3JVGC 2R1XA 3AQZA 4K71B 5AQ0A 1MCWW 1RZFH 4PYHA 2D7NA 3ZHDA 4F8TA 3BKMH 2EO1A 2EDFA 4NSKB 3S36X 4YZFF 4BCYA 3MNVB 3QR0A 4NKDA 4Z0XB 8PAZA 2CH8A 4PIRF 1J0JA 4LSRH 5ID1B 5L6YH 1H5BB 1JZHA 2GK0B 3EBGA 4K2UL 3BQUB 4OFDA 2QHRL 4FFTA 5MERB 3EO0B 4U3HA 4K73A 5G4NA 5EO9B 1TJIH 3ZDYF 2K3TA 5AZEH 3AS2A 4PJFE 4BD4A 4GUCA 4MQ7B 3AY4A 1U93A 4M56A 2Y69B 3CFEB 4K9EL 5D7SL 3BN9D 3CMOL 3GBDA 1HH9B 1MELA 5IB4A 4WNJA 1YLBB 1FO0B 2V6HA 2YK1L 2AJVL 2Q6WA 1U2CA 1T7VA 5E9DA 1MI5E 1H3PH 4HMEA 1ZY9A 3QORA 4DGWC 5I8KH 4D9QD 2FO4A 4QTIL 1BEYH 1QEWB 1RMFL 2XTJD 4GRLA 4OB5H 3F7PC 4HA1A 3V0WH 1QMUA 2HJLB 2JKIS 4Y2DD 1PDKB 4PV1C 2WTRB 2YN3A 3MLZL 4BJLA 3LPOA 1BYPA 4NZ8A 2E59A 3SQRA 3O2DA 1QSFB 3T6WA 3UZQA 1YYCA 2D3LA 1E30A 1RK0A 2MCAA 3LPPA 2AXFA 4OV5A 1GOHA 2IWKA 3N85L 4JE0A 5DMGC 3NJXA 5FGCE 3UABA 4F7MA 3TLRA 3ZDWA 1BD2D 3PHAA 1T0NB 4G3YL 4C59B 2KERA 4WGWB 1FQ9C 2Y24A 3UYPB 1FNLA 3F8UB 3NH7H 4YC2B 5KS9A 1OGTA 5KSVA 3LSOB 1WWWX 2C1OA 4LDLB 3QRGH 2ORBH 3GS7A 4AVIA 2ZUTA 1JTPA 1P4BL 2FSEA 3FU9A 4XB7A 4N9GB 5IHUL 1CURA 1IIIA 3UO1L 2HUEA 3P3RA 2I07A 2JK5B 4AYEC 1E6OL 3H54A 1DVFB 2IGFH 1RZJC 5GS0L 1I9JH 5HD8C 2VLMD 5HYJA 5A2AA 2NXZC 1URLA 4QY8B 4NPKA 1IM9D 4PB9L 1NIFA 5GS2H 1HSBB 3HHRB 2JWYA 2WNWA 3MGOB 1C5BL 2CR0A 3C8DA 1IQDA 3EDDA 3H4HA 4PCSA 1TDQA 4L8BB 3RTLA 2X41A 5FW8A 4ZXBC 43CAB 2IOMA 2RD0A 4MMXA 1AZUA 5I6MA 3I9IA 4OZFB 1X7TA 2PKDA 5D7KE 1MIML 3KWTA 4WWKC 1QR4A 2Q76A 2XLLA 2CLVB 3A24A 4QHUA 4IK7A 3SDXE 5HY9A 4W9GC 3HNSL 4R96B 1OB1A 3D85A 5FF6A 3QUKB 3FW6A 4ZFFA 3FFDB 4BFBD 4PCYA 5CUSL 4ONFH 1NGZB 3IMBA 3HR6A 3RNQB 3ZKMD 1I1AC 4D0CB 4NN7C 4YXLL 3PABA 2F08A 4J3WA 4BE5A 3DVGA 1GYWA 3TBCA 4HIHB 2CGRH 3ZYJA 2WSPA 2YPLD 4CNIA 5J9PB 2VMEA 3S5YA 4JE4B 1CFBA 2ADGB 4FI6A 4H0IA 1J9SA 3D30A 3NZHH 3QG6B 4MA1B 3ZJAA 1M1SA 2WQSA 4GO6B 4L3AA 3NSXA 4OVUA 5I17B 4JG5A 4KPHH 1RPUA 3NFSL 2HFFB 5DZLA 2FUTA 1AIFB 1ZA3B 2FECL 4Y4HA 1SYSA 4JFOB 4X6BA 4Z3GA 2JQAA 5KBDA 4IDJH 3Q2WA 3W0WD 4FNUA 1I3UA 4JVWA 1B6UA 4QOKA 4X5WA 2W0FA 3BDXA 1U3HA 4TOYL 4HKXA 4HZLA 3GO1H 4CC1A 4NQTA 3TP4A 1MOEA 1F4XL 3W81A 4OW6A 3TO4D 4OJEH 1NBCA 2IWEA 1DTUA 2NSXA 3B2VL 3NSCA 3IKCB 3RE0A 2BFGA 2ZCZA 1F4WL 1P6AB 1MLBA 4EZJA 1HOEA 4KI5F 3EYUH 1HE7A 1E5AA 1WTGT 3H4FA 4IIQA 1P4LB 2RJMA 1OSPH 3ZZLA 1Z6JT 3ISRA 3WNIA 4ANWA 3BVDB 1D6VL 1MHCB 3NT0A 1V55B 2F61A 4X9IA 3GSRA 3GLDA 1A7QH 4FHKA 3UTTA 1DFXA 2ZKYA 4ZUUA 3KPRA 2BSSA 2OLDA 1EXHA 4BFEA 1C5DA 4M7KH 2NX5E 1NMBL 4K7PX 4NCC2 3EGXA 3HBQA 1UM5L 4GKOA 5E1IA 1PBYA 5D5MA 3EOBB 5SX4I 3SCMD 3T2LA 3CX5K 4EMZA 1F42A 4XXCC 4PGDA 5EIIB 3GXPA 5F3BB 3OZ9H 3EOTH 3VD2A 1DFBH 3VMOA 3C5ZA 1OPOA 2MQGA 2QL1A 1XGUA 4UUJA 4ZS6D 3HZMA 1OGAE 1RPKA 5GSVB 5BVPL 4GG8B 4KKBC 2JF1A 4UU9B 5JHDB 3MU3A 4LRNL 5LXGL 2OV0A 2MQCA 4Z7WB 3I75B 2BIHA 4YX2H 1NCDH 2X4UB 1DR9A 1UWXK 1IO4C 1I9IH 4J6RH 2EXTA 3A22A 1DBML 2ZCKH 2VXQH 1ZV2A 4KKAD 4KY1L 1CS6A 1BAFL 4YNYB 4UI2A 3IWUA 3LOWA 3VGDA 3OC8A 4OLXH 1O0VA 2OL3L 3MRJB 2WP3O 3TGXA 4LCWD 1WFMA 3P9MA 3FTSA 4G7QB 1DE4A 4PR5A 4S1RH 2CA4A 2VN5A 4IKIA 4OGYL 4DZBA 3PY9A 4I88A 2GJRA 2CUAA 3QWQB 2NXZB 5CR1A 3PJLA 4FZ8H 1XIWB 2DKSA 3VO0A 2F7IA 3QQNA 4BWUA 3EG9A 3TJPA 1UJTA 1IGTA 4BFNA 5GRZA 4KXDA 1IKNC 3GK8L 5I9QB 1GGCL 4M6ML 5ESQA 5FYJL 1EBAA 3IK2A 3X14B 4I77H 2Z91A 1VCAA 4M3JA 5IW6B 2BVPA 4BQ6A 4EN2A 4N2DA 4XTRD 1P0SE 1A3RL 4DQOL 4HKJB 3WUZA 5ABAA 4QYOB 4J5VA 1S6NA 3OM3B 4NEHB 2CXKA 1TO5A 4WUKH 4UDUA 1JF5A 3GMQB 4AV4A 3VRIB 3C5SB 1EH9A 2XX0A 3FHEA 3SE4A 2EVIA 1J0IA 1I1AB 2NNAB 3MJ9L 2BK8A 4MAYD 4NN7B 3D33A 4B9CA 2NCEA 1XGRA 3L5WA 4U6YA 3H9SA 5KVFH 2V3FA 4FQ2L 2AJ3B 4LCYA 5FYKD 4PWJA 3ZYOA 3CFJB 4Y2OB 3NSYA 3EGSA 2DQHL 1FH5H 3DBXB 3DUHA 4OGXL 1T1YA 1NLDL 1T20A 1OQXA 1IAII 4WUUB 4N87A 1ZHKA 2J1KA 2IBBA 4DKDC 1HNFA 2XV3A 5IFAH 4O2EA 5LG1A 1T89C 3MN8A 5DWUH 4HOZA 1QSFE 3U4BH 5I8CB 3OPZL 2IBZX 4OD1L 4XVSH 3ZO9A 1NC2B 1FNEA 5IW1A 1JNJA 4WF7A 4JANA 2GSGB 1KOAA 4PJAA 2FO1A 3ZW3A 4D0BB 1I3GH 2Y7MA 4K7PY 3MSPA 3VI4F 3FYEB 3VXRA 1COBA 4HEMA 4FEMA 5D1XC 4FLQA 4N0FB 4BV1A 4K3JH 5AKRA 4XNZC 4IBUA 4EE2A 4LCVA 1VGKB 2CKNA 3R8BB 2LGNA 1SLUA 4OKDA 5EO0A 3HMWL 1EERB 4O2FA 3HPLB 4GIAA 2HTKD 2D3VA 2XFGB 2YRPA 5AEAA 3STLA 2DWDB 2O5XL 1WA1X 3QDGA 3APFA 4MNQB 4A37A 4JKLA 3P9WB 5EUKB 4GQPH 4XC3L 3O6LL 5LVEA 2H26A 3SZKC 4E5XA 2VLLB 5C0DA 1QRND 1ZANL 4QJ4B 5I5MA 3LZLA 3K4DA 4GINA 2DMBA 2WLLB 2XZCL 4PS3A 4K2UH 1S8DA 3V0DA 2QHRH 4N3UA 3VI4A 5EU7C 2XJLA 2P52A 1CE1H 1J8HE 3ML8A 4G7YL 5F7NC 5FO7B 4F33A 1W0YT 5I1LA 2YD0A 3ECVA 1R4XA 2ZX8A 3LZOA 3UDWC 1WBZB 2HVBA 3P3SA 1C12B 4K9EH 3LVEA 5D7SH 2NXYD 3CMOH 2VISA 2E86A 3HI5L 3X13B 3WTUA 3SY6A 4X9HA 4UQ9A 2MWCA 4FQXC 4QPEA 4CC4A 2LW3A 4R83A 4WWOA 1LQSR 3EDEA 3KJ4C 4FQHA 1I75A 2AK4A 1WTLA 1YCSA 4QTIH 2X2HA 4LIQE 2HG5B 3SKNA 1XGZA 2QJDA 4XI5D 1EZLA 5FM4A 5T3ZL 4HG4K 5IKCB 3II2A 5CIPA 1HKLH 2BIPA 1RHFA 1Z7JA 3OD3A 2OJ1A 3HRZA 4I3SL 3T77A 3DOSB 5DRXB 2H0PA 4IU3B 5TE4L 1JCKA 1KBKA 4HJGA 4A38A 1MEXL 3N85H 1O75A 5H35A 2R0LL 1YJDL 3KJ6H 1UM4L 1I7RA 2GBTA 1PG7X 3L08A 4PBWD 1QFOA 4HIIB 5J1SC 1X7QB 5I1CL 4PJXA 4FYRA 5ES4B 5CINH 1A6ZA 4KDWA 1OTSD 2DKUA 3ELQA 1AZBA 1P4BH 4NUGH 1HHJA 5IHUH 1H8LA 1CD8A 3JWOL 3UO1H 3BAYA 4ZOEA 2B9AA 1JFQL 2VIRB 1E5BA 1XGTB 3APMA 1KIRA 4NUJA 1KJ2B 5GS0H 4EVNB 4LSDA 5FK9B 2YSSB 5DEGB 1FV1B 2IBZY 3PGFH 5FO8B 3PWUB 4TUUA 2C34A 3QFJB 1QO3B 1A9VA 3BP6A 1BQ5A 1BAWA 3FOLA 2RMNA 2F53E 2AQSA 3NA9L 5ESAA 4P2RD 2D31B 4DK6A 5B8CC 1IVTA 1SDDA 2NY3D 2WZ5A 1S9YA 5F44A 3WD5L 3BXNA 4AV5A 4E5XG 1D7BA 2J2ZB 3FRUB 2X6AA 2DQDL 3NABH 1MXDA 2R4RH 3ARBC 4TLKA 1XR9B 2JI1A 1NAML 4M03A 3W37A 2VDOB 1B88A 2OTUA 1K5NA 3KM2A 5JHDE 4R4FL 3DX9B 4B0MB 2WWNA 3IBEA 4Z7WE 5HJ3A 1HEJC 4L0PB 1ACXA 1VF5C 3U48A 4TUOB 3KLDA 3QYNA 4B9PA 3C75A 5A3ID 2O5YL 5E6IC 3C8KB 4YXLH 3RVVD 2R56L 5I1AA 4TTDC 4RNRA 5ADPL 2DV6A 4HIPA 5C0BD 4FQPA 4GW5B 1VACA 5SWSA 3ZIYA 5E8PA 5LGHH 5D70L 4YO0A 4FQ1L 4RFEB 4XNZB 5TDPA 3V9CA 3DGGB 4M3HA 4WI5A 1MW0A 1IC0A 4TSAL 4OLYL 3QNZA 3RTQA 1UVQB 4E9QA 4XMPL 1QLEH 4F9PC 3HZKA 1N0LB 3QSKB 3H8NA 5C9KA 4I48A 2XTLA 3ME0B 3MRIA 3MROA 2X4PB 5FA3A 2OFQA 4IU2B 3WKML 4DPRA 3JXAA 4XHJC 2AI0L 3LRKA 4NRXB 3KPPA 4LHUB 2FL5A 2NPLX 5GS2D 2FZ3A 4RA0C 1A1OB 4Q14A 3ABZA 4HOXA 1MVFA 5LBGA 1F4XH 2KDGA 2NY0D 2RR3A 2LU7A 5F88A 3RI5F 1AQ8A 3PL6D 4MJ5B 4Y5YC 1UWYA 3S6CA 3SQBB 1WBYA 2G9HA 5JA9A 2EDXA 1QHPA 5AVTB 3OXRB 1F4WH 1ADQL 4R5TA 1AS7A 2E56A 1LP9A 1BFOA 2N59A 2X4TB 1I8KA 4PJDB 3EGDA 3UC2A 3DX1A 4LLYB 1ORSB 2P8PB 1D6VH 3KXFA 3CVCA 1GC1L 1MCCA 1NEUA 1ZLDA 1FGNL 3K1DA 3PV6B 4L3CA 4U49A 5DHMC 1WD9A 3GMMB 2Q0ZX 4AQ1C 1U95A 3KJ4B 2EIEA 2CO6B 3LS4L 4PS4L 3JT0A 2YRZA 1UM5H 2IQAB 5AZ2L 1T2XA 3RWFA 5B3NA 1AO7A 3CH1A 4DP2X 3ARGD 2CO2A 3P3TA 1W8OA 3QEUB 4W9KC 3RPKA 2HCZX 3K8KA 2ZSWB 5D7IF 5F7WC 2JCWA 3GLAA 2R2EA 4WUUE 4XR8C 1CC3A 5C97A 2I5YL 5EU6B 1S9XB 4ISVB 3RVUD 3BEWB 5D2LB 3OKDB 2HMIC 5B1AB 1W2KT 5JPMC 4IK6A 4XPFL 3X1GA 5LXGH 2R29L 1UM6H 2YXFA 2OMWB 3D0AA 2PTUA 1EGJA 2C7UA 4KUCD 1KGWA 2VXVH 4LSVH 3TT3L 3UBXA 4L4VA 4PTTB 4KY1H 1T66D 2Y1VA 3ARXA 4PSRA 3P11L 2J4WL 1PU0A 2MOQA 4WQOA 1D7FA 1L9TA 3CHQA 3P4NB 4E9RA 4F5CE 2ZWSA 3NFNA 3T1FB 2WWOA 4NO0A 3VWKC 2Z31D 3ULAB 4EI6A 4AT6B 1EJ6A 4P46C 2VJ8A 2ITCB 4HK3J 3BH4A 1A6TA 2FEEL 4DP0X 4J6IA 4UINL 4N0RA 2YIHA 1AG0A 3BP5B 2AXGB 5DJ6A 4MNQE 5A2FA 4ZYKA 1EHAA 4M6MH 4WCYH 5B8CB 2HX9A 5FYJH 3QDJD 3TOPA 1JPGB 4APQD 1D5XB 2CUHA 2VDPL 3KNBA 1UJ3A 4BA8A 3WHXB 3K6NA 4JFQB 1U8LB 3ZE0B 4Z7NB 4DQOH 1SLVA 4Y4KC 1UA3A 3X1FA 2GYSA 5MEPA 1VPOL 5CWSA 3QJHA 4L29A 2IQ9H 1LK3L 3BKJH 2EE6A 1N2RB 1NBYA 5E8EB 5KOVC 2CO7A 4Q6YA 2ZNWA 4Y9BA 1UZ6E 5DS8B 3G9VA 4IRSD 5BJTA 5E6IB 2LLNA 1TITA 1KN4L 4PBDA 3IVKB 1E6JL 3NIFF 4B6ZA 2EUVA 4OCXL 4FQ2H 4HS3A 2VDKH 1QFWH 2DQHH 5HGBB 4OGXH 3FU7B 1NLDH 1QSED 5F0MB 1HXMB 1W72L 1J0YA 2CA3A 4KVCL 4YHML 1IBGL 1QZ1A 3L3JB 3T3MB 5DHVA 3SYCA 3AY4C 2VLRD 3H9HA 3OPZH 3RFZB 3O3EA 4OD1H 3DUSB 3LHPH 1IGIH 4E9XA 3HS9A 4LLMB 4X8XA 4HUVB 1SHXA 2V2WB 4Y5YB 2CBQA 4BSWB 4L8SB 4KK6C 3QORC 2A9NL 2IEPA 1CF1A 2V3DA 4PRHB 3W9EA 5DFVC 3O81A 5IVXB 1FFPB 3QXAB 4GRLC 3UBXG 4QLWA 3M88A 4IBYA 3IXAA 3QZMA 2CR3A 3K6SA 3VXQB 2HLFC 1YN6A 5FWRA 2OMZB 3LRSB 3HMWH 4IYKA 4DGVL 4LAQH 5EBMB 5B4MD 1CBVL 3BI9X 4AQ1B 2O5XH 1R19A 2I7OA 2R23B 3SE8L 2AC0A 3W11D 1WQVT 1R24A 3SGJA 3V9EA 1M7IA 3QDHA 3QFJE 5ESVA 3JTBA 4R4BA 4DCQB 4FZEL 4HWZB 4XC3H 2QR0B 3O6LH 4WI3A 5CP7B 4PWIA 3P3YA 2DH2A 3IPFA 3T2NH 2FECI 2UY6B 1HJBC 3OKOB 3QIBB 3UBFA 1NDMB 3D69A 3QQ3B 4Z3IA 2NW2B 3CHXA 4ZS7H 4A6YA 4BZ1H 1F3DJ 3RY6A 4DP1X 4EIGB 2PCFA 2XIIA 2OK0L 1AYOA 3D34A 1TCMA 3MAWA 1R17A 1QYGH 4D7PA 3O6ML 1WAAA 4RDQF 1L9MA 4P23D 1NBVL 1W80A 3RNKA 3WDHA 4QCIB 2GIMA 2HRPH 3TWYA 3OLEA 5IM7A 2EDWA 4ACTA 1YNKH 4NQQA 1DDHA 3CN0A 2F15A 4IHOA 1CDCA 2YRLA 1XH1A 2CPUA 3VWKB 4GUQA 4PG9A 4MMXC 4N0UB 3MLRL 1IE4A 4QAWA 1NANH 2UZYB 4M48L 4G7SB 3OSKA 3EJCA 5F1OB 2AV7A 2J6EL 3QHFL 4I3SH 2OTPA 2EZ0C 3MRDA 4ZAKA 3DTXA 4MMYB 5TE4H 4AENB 3HUJB 1G7HB 2QELA 3NDYE 4DEUA 1MEXH 2DYPB 2XQYA 3LKNB 2NQCA 4JDZA 4Z7OE 3LQMA 4YSTA 2CLZA 4NI3A 1UM4H 1E4HA 4QLRA 4R4ND 4KXAA 1EVUA 1NUFA 2PO6A 2ZWNA 1IKFL 5I1CH 3WJJA 3UBHA 3ABKB 5ACLA 1AKPA 1NBZA 3EUUA 4KXCA 3JWOH 3W9DA 1RD6A 4AMXA 5MENE 2C3HA 4MMZA 4HXAL 1QPKA 3A4AA 4PLOB 3JTTB 4Y4HC 1E9OA 5IROD 1JFQH 5C08D 1L9NA 4XGZA 2MIZA 3DV6B 3HCVA 4PJDE 4XP5L 3TTSA 4I3GA 5BW7C 1U3HC 5AW0B 1I31A 1GHFL 3FUEA 4RISH 1AACA 5E6ZA 4NKDB 4RQQB 5EEZA 4K3HA 4NQXA 5BO1L 4D9QE 4GBXD 1D5MA 1XR8A 2GPZA 4PP2A 2NRDA 1L3WA 1JI1A 1JFHA 2DQDH 3COOA 3ESNA 1OF2A 2DICA 3QJSB 3ZMEA 1U93B 1L9SA 2DWTA 3OJDA 1B4JH 5FUZH 2R9HD 3LX9A 2B16A 4IIQC 4LLDA 4WI2A 5EU6E 3R7RA 3EXLA 5CS7A 1KJ3L 3FTVA 4LLQA 4LHQB 2ESVE 4GAJL 5IMKA 2Q6WB 5IHHA 2GB2A 1LO5A 1PKOA 2WVSA 5E9DB 3L9YA 1NM9A 3QORB 2O5YH 3FF7A 2R56H 2FO4B 1S4IA 4XBPA 3FZUD 3RKDD 5ADPH 4G70B 1T7YA 4GRLB 1D2PA 1TF4A 3Q6GL 2X9XA 3BISA 4FQ1H 5DZPA 1RUML 1ZDQA 1KG0A 4EKJA 4LMQE 4TSAH 2UZXA 2BHYA 1C08A 5F7YC 1GGTA 4XMPH 3C5ZC 3JV4A 2V5TA 3U9UA 1L9QA 3ZDYB 4ODTL 1RK0B 5GS0D 2AXFB 3WKMH 4KI5C 3X3GL 3UACA 3BT0A 3CX2A 3V6BR 5AYQA 1F58H 2QVTA 1MREL 2M26A 2J8HA 5KS9B 4MS6A 1OGTB 5KSVB 1HWWA 4FP8L 2C1OB 2OSYA 3NCWA 4KJPD 4XP4L 3UXFA 4ZOBA 2XQYG 2KZ1B 3FRPA 1E8XA 4RDQG 3MLYL 1BZOA 5F97E 3JBG7 1R3JA 2FX7L 2LTQC 2I07B 2V5YA 2EXYD 3ZE0E 5LXVA 2FYVA 1ADQH 1MFMA 1GSKA 3F6LA 3WXVL 2VSDA 3S97C 1PAZA 2IVFC 5HYJB 2VAJA 3V4VA 5J7CC 3IETA 2YMTA 4ELMA 5FO2A 1DQVA 1MCLA 1V54B 1FGNH 3K2UL 2BVEA 3VFVA 4YDNA 1AMXA 2YAMA 4AGMA 4X5XA 3VRLE 4O58L 3TFBA 3PHQA 3ULVH 4KZCA 2FB4H 2J6WA 5JDSA 3TT1L 5F71A 2PTTA 1TIUA 5CMAA 4MMXB 1I82A 5EBGA 1X3DA 2CUIA 4MDRA 3NN8A 1RJYB 3AVEA 4NKMA 3FB8A 4UTBA 1AXSA 1XCTB 2UWEA 4PV9A 3T2QA 2JJVA 2NOYA 1SOSA 2Q76B 4QHUB 2HVKB 1CGXA 5I74C 1DQDH 3QUZB 5EU3A 3RPBA 5IOKA 4PEEA 4I85A 5FF6B 3QEQB 3WKPA 3C6LB 4ZFFB 4XPFH 3L8QA 2P80D 2R29H 1P84J 2PYEB 2YC1A 1OV8A 3QWRD 3T2PA 3SE4C 2BZDA 1AQMA 12E8H 5HI4D 1JWMA 2N0KA 3ERXA 3GHBL 2R0ZL 3LQZA 5I1DB 3F3HA 2WUBL 2K45A 1R3KB 3H6JA 3O45B 3P11H 4AV0A 4B9KC 2DEYX 3FYIB 5D1ZI 4MQSB 5IVXE 1TTBA 2IANA 3MRBB 4Y4HB 1SYSB 1KGCD 3L3IA 4X6BB 3ABLB 4OT1H 1N19A 4XN5A 3T04D 1EMTH 4DWHA 1J5IA 1Q0YL 4X5WB 2EDJA 1NAMA 4Q2ZB 2DLGA 2W0FB 1U3HB 3F7QA 3QQ4A 2VM3A 1A7PL 3DETC 4UINH 3ZHNA 1OD7A 4BQ8A 2NY1D 5A2IH 4HKXB 2OPCA 1ETZA 1MCPL 3KWWB 3P9LA 2YKKA 1RZ8A 5KYYA 3SO5A 1UWEL 1WF5A 4ZT1A 4JDTH 1MLBB 5JPNA 3NTCH 2BP8A 5IZ7A 4IJ3C 4U2YA 1ZVNA 3TIEA 4WZ9A 4IIQB 5DUML 3F12A 3T6XA 3WOVA 4YUEL 4BXSV 3FRPG 1ND0A 3GBNL 1LK3H 2APBA 3WS3A 4CDGC 2EEXA 2K8MA 4KRPD 5DUPL 5F9AC 4ZQTA 3GSRB 3UTTB 2H1PL 4ZUUB 1SOQA 1GKOA 3DUUB 1C5DB 3D39D 3EGXB 3J7HA 5D5MB 1E6JH 1IC1A 3MCKB 1TT6A 3ZTDC 4PGDB 4KTYA 4R84A 2FT6A 2IJ0C 1WFNA 1DJWA 1YEHL 1SJXA 2I60L 4LRIA 2B3RA 2FD6L 1XGUB 4UM9D 4UUJB 3NSJA 1XH3B 3HZMB 4PUBL 3RVTD 4YHMH 3KVPA 1IBGH 4N0UE 4Y2DA 5DQJA 1HH6A 1T7WA 3HS8A 4MGXA 3RGVD 2HKAA 3T4AA 5DRNA 5CXPA 2Z7YA 4JY6B 3D9AL 4WEEA 1MCOL 3VG9C 4WWNA 3WIAA 3J27A 1W15A 3HUJE 3QHZL 4IGBD 3LY6A 1T22A 4Y1SA 5FYJD 5CEXA 4CC4C 5K5YA 4WHYH 2ICWI 1BD2A 1HCVA 4S1SH 3Q8EA 5HDBF 3RWEB 3MX0A 3P9MB 2A9NH 5DVOA 3BUQA 1DE4B 4OF0A 1V3MA 2LTQB 4Q9BA 4P57A 2CQVA 4DZBB 3VA2C 4ZFGL 2E4TA 4KOCA 3P2TA 5GGSY 5LWYL 4BH7A 2HT2D 4L48A 4DGVH 3EG9B 4KJWD 2UVFA 3IXTB 1IGTB 3HRZC 3LKSA 1OTUC 3VXUD 1BF5A 1CBVH 3D8MA 2DDQL 3LNGA 4ALAC 5T5FL 2YAPA 2FIRT 5IB1A 1FVCA 3S96A 3V8OA 3T0BA 3LVTA 1WZMA 5T1LB 2D9CA 3EJYD 5CLXA 5ABDE 1SVZA 5C0CD 1AHWA 2ENSA 5I0XA 5DUBA 4Z7QF 1JGIA 2B39A 2QQNL 5E6YA 1K5WA 1HZKA 4QXVA 5I74B 1S7UA 4LVHB 3Q06A 1JPTL 5E1AA 3O11A 5DA4A 4UDUB 1S9WA 1Q1PA 4BKLA 3TASA 3U4EA 1U3NA 4JFHE 3O6MH 1IT9H 2VNCA 4ZD3L 4YQXL 3ZL2A 3NSFA 3GJFK 4U6YB 3CFKA 3LKOA 4NZTL 4ATTA 4LCYB 1JZ3A 2Y7LA 3N1PC 3UCQA 5BMFL 3EGSB 3Q2CA 5CJBA 1KYAA 3RVXC 1T20B 4JMNA 4YZFE 4JGMA 1H3XA 2BINA 2YPLA 3TYFA 1U0QA 1LO0L 4WNQA 5EEVA 5IMLA 1NSNL 2R2HB 4P4KB 3MLRH 3PXLA 4M48H 4O2EB 2A2QT 1F8TL 3BT2L 3KYKH 3ZDYE 2J6EH 5IIEB 1K3ZA 4FQIH 4GKZB 4NQEA 5IW1B 1FNEB 5INDB 2V9QA 2MCG1 3W0WA 3MFGB 1OXYA 4GEJA 4PJAB 4Y9EA 1PZCA 4YSUA 3GQFA 1UD8A 3JV6A 1ROWA 4IBLT 4JRYE 2JTDA 3VYPA 5DO2D 4M62H 4IJ3B 3TO4A 1IKFH 3UJIL 5BV7L 1PJ9A 3U46A 1EAPB 3T5WA 4O2FB 3RTQC 1S5IL 4HXAH 3NK3A 5D1ZD 4JY5H 3STLB 2D73A 1IQWL 5HYJE 3UG4A 3QJTB 3HMXH 4XP5H 5EC1A 1J1PL 1THCA 2H26B 1GHFH 5ETUA 4ZW8A 5C0DB 1JNNL 3HFML 3TNNA 3DMMD 1ZVSA 3EFFB 3MV7D 2ROXA 3N50A 4TNVK 3HEIB 3MV8E 4YHLL 5BO1H 2QQLL 5J4MA 1FORH 3MLVH 1KLFB 3WTSA 3SCMA 4KOBA 3HBPA 5K93A 2V5RA 3CFBB 3VI4B 3GXDA 4F33B 5I1LB 4LXFA 1FBIH 4WU7A 3JSSA 3SD2A 3U79A 1AMYA 2FEEI 4LP4A 5LGYA 4GS7C 1YEGL 4FMFA 3VG9B 1CFTA 1KJ3H 3A47A 3B9EA 2WTPA 3CBKB 3QEQE 3GTVA 2Y6SC 4GAJH 1GPOL 3FFCD 1G0XA 3KWUA 2PYEE 4LFHD 3H7BA 1RH8A 3MOBL 4MQTB 5C07D 1A1NA 1C7SA 3W5NA 5KZCB 4FQHB 4Q89A 3V5KA 2IG2H 4XOBA 3SDAD 5EN3A 3Q6GH 4PRIE 2A0LC 1IEBA 4U6HB 3SKNB 4HJEA 1A8ZA 3I6SA 1NL0L 1RUMH 1OEZW 4FFYL 2XXCB 4OGAD 3GMRA 4LCWA 5GS3A 2OMYB 2G2PA 1ZLSL 1JRHH 4AQ8A 4PMFA 3L3HB 3HRZB 2VDQL 3T77B 1W0WA 1YMME 4YSPA 4HJGB 4JVPA 3PQYA 4KI1A 2KZWA 5L8KB 3GZKA 3S88H 2EEBA 3ABGA 4AJYV 4IQHA 3LNDA 5DVNA 3WJMB 4Y1TA 5KWYC 1VJSA 1I7RB 1DBAL 4ZUVB 3BPNB 2VQTA 5I75C 5HYSA 3OGOE 4PJXB 4XP4H 1M1XA 4UOZA 2H5UA 1A6ZB 5E9AA 4K0OA 3W2DH 5KVMC 3PYCA 3HFFA 3DJ9A 3MLYH 3MHZA 2H32H 4ZX4A 4M9PA 1J8SA 2FX7H 4P2OD 3MJ6A 5GGVH 5FB8A 3EUDA 3WXVH 4NUJB 1ROCA 5GGQH 3H53A 3BE1L 1SBSL 1S7VB 3OZKA 1BJ1J 4QRSA 4PLJC 3L5XL 4E41D 1K8IA 3VRJA 5GZND 3BP6B 2KQMA 3FOLB 3BVVA 3K2UH 3KM1A 2Z6FA 3IRPX 1ODAA 4MAYA 1INQA 5B3SB 4AGNA 5ESAB 4FTVD 3GSNB 1AGCA 1QHOA 1S7QA 1AR1D 3L4VA 1S9YB 5C0BE 2VW7A 2A6KB 3TT1H 1V27A 4LSSL 3BXNB 3BZEA 4GMTH 2XQBL 3QZWA 3WEMA 5BQ7A 1AFVL 2ZKHL 1TTCA 4RFOH 1UJ3C 1WGOA 2TRYA 3ARQA 5D7EA 4JM0A 2J88L 3QXUA 4Y8AA 3PPSA 1NICA 4MD5B 1DVSA 2QPDB 2VXSH 2ZOLA 5DZAA 4BKTC 4FI8A 4GQ9L 4JFPA 2OTUB 3ARWA 1K5NB 2NMSA 2VDMB 5E4OA 1TVDA 5HJ3B 5DVMA 4M6NL 2Q8AL 4URKA 1L3NA 4KKNA 3B9VA 3L17A 5D1QD 4GB9A 1HEZA 5HI3C 3RU8L 5I1AB 3K4AA 4RNRB 3GHBH 2R0ZH 2WPGA 4DPCX 1RIVH 2NZ1A 1XD0A 1VACB 2WUBH 5AB1A 4PRPD 5E8PB 3JUYA 4YO0B 4U6TA 3B83A 5TDPB 5I5RA 3H6AA 3RTQB 4XCNA 2LU3A 3HZKB 2BDNH 4CRPA 2P46B 2WXNA 2WBJD 2DQUL 3Q3GA 4DESA 3MROB 5FA3B 4WI0A 3OKNA 1Q0YH 1H15A 4OZHF 4HWBA 4HPHA 3EXJA 4HETA 3KPPB 1JZ4A 3VNYA 1A7PH 2FL5B 2B9BA 3G6JA 4YMPA 3VD5A 1H3VA 1S7RA 1HU8A 3SKJH 3BGAA 1A7NL 4PJ9D 4P2CG 5D7LD 4F3FA 2K78A 1VDGA 2Z93A 2JKRM 2ZWYA 4I87A 3ULVD 1FZJA 1NAKL 1WBYB 4DKAA 3RJOA 2FJFB 2IGTA 3CHPA 4E36A 3DXAD 3IJYA 4BK5A 4GS7B 5HYSG 4JHBA 1THAA 5JNYB 3N55A 1WA0X 5DUMH 1LP9B 1BFOB 3BEVB 3V9FA 3JWNE 4YUEH 1R3IL 2D03L 3GBNH 1I8KB 2A77L 3EGDB 3GSOB 5GISL 1W6WA 1JV5A 1EV2E 5D4IA 4L3CB 1JIBA 2HAZA 2H1PH 1IC7L 4OZHA 1YZZA 1DQLL 1WIOA 4WI4A 4AQEA 1YEKL 5HDWA 4QXUL 3SGJC 3EJZD 1WGVA 4OUUA 5B1JA 4W93A 1OP5K 3MGAA 2WGNB 3GMNA 2A6JA 3CH1B 1H0DB 2ZXCA 2X89D 5CCKH 2I60H 3RWCA 3SDDB 4HS8H 2H9GA 1O6SB 5F9DC 1MIEL 4PUBH 1DVXA 4EQ2A 1XB8A 4AGPA 3RY6C 4V2CB 4NKOA 5I76B 2BOBA 2QGBA 1YC7A 4FN0A 3HI6L 4N8CL 2GEQA 3D9AH 3Q9PA 3DECA 2Q7NA 4OAWA 5DFWH 1MCOH 4UWQB 3WIFB 1PZSA 2C7UB 1JPEA 3QHZH 4XX1G 4YOKA 5GGSB 4L4VB 5EORH 2BW5A 4HJIA 4N0YL 3F7LA 2YQ2A 3U36A 2L0DA 2C9PA 4H8HA 1NGQL 4HEME 2DQMA 4KDVA 3SGEH 2PWDA 3NFNB 5DHDA 3ZGHA 2GHZA 4LLWB 2WLHA 5JW3L 5J3HD 1FIGH 3SPJA 2R2BA 2CWRA 5LWYH 2VC2B 1FFTB 3OJ2C 3DLQR 3FQ4A 1CQYA 5DJ6B 3FO2A 1UB6A 2WM0A 3DI2B 5J0BA 3IGKA 3QRLA 4KAQH 5IQLA 1IC5L 3CQQA 4P06A 1U21A 2BSBA 3O6KL 5L2KA 1ESOA 5B3JF 4DVRL 3KNBB 4R7DB 3HJEA 3QYMA 3CC1A 2MHAA 3ZMNA 3OSVA 4CBZA 2PO6C 1YEDA 2YD2A 4E9VA 4R8WL 1FVDB 2EP6A 3WJJC 2EDLA 2QQNH 5MEPB 3SPCA 3VI4E 3VFRA 1LD9A 4KV5F 5CWSB 5DJ8B 4DO5A 1A22B 2JELL 4JPKL 4LAJH 5EZIH 1JPTH 1NBYB 4MMZC 2B77A 2DL9A 3L3OB 5F9JA 3LRLA 5BJTB 1JHKL 1JZJA 4FKEA 2XG5A 4ZD3H 4YQXH 3GLEA 4HIXH 2E7DA 5D2NA 1S46A 2XBZA 5DQDL 3H2PA 4HJJH 7CGTA 1PZAA 1RJLB 3DHMA 4ZX3A 4WEBL 1IGCL 2VSCA 2OQJB 4F57H 3M7OA 1KBPA 4S1DC 1NSNH 2J25A 3ARRA 5DHVB 3S98A 3QNXA 3DO7A 4HS6A 4I2XB 4J39A 2ARWA 3ZR6A 3O3EB 1DEEA 4ZO9A 1NCUA 1VLXA 2NZIA 2XKNB 1GY1A 4AMKH 4EEEA 3DJSA 5TGBA 3R4RA 3TPUA 4BFIA 2WNKA 2HRHA 3GXTA 4G8GE 3UADA 1DUYB 2VLKB 4OD3L 1HHKA 2JI3A 4DP7X 2A73A 4WV1A 2CKBH 3QPQC 4RGOL 1U8HA 1CQKA 4KNUA 5KVGL 4XN1A 4EDXA 1MAJA 2PLTA 1QX1A 4U6XB 4AYBA 3IXAB 3PAUA 3PL6A 3K6SB 5CN3A 2J5WA 4QF1A 4FLSA 3HKFA 5DJ0A 5FV2A 2Q3XA 4ADJA 2YJQA 3B6SB 5I2IA 1P2CA 3LJ3A 1S5IH 2WYHA 4YXKH 2F54D 4BQCA 1IQWH 1BQHG 1KCSH 1R24B 3GSUA 1M7IB 5ESVB 2ZX9A 4Q56A 4U0RC 4R4BB 1GL4B 4PJ7A 3HIZA 4TQIA 4N8PA 3HFMH 4J8RB 4JJOA 1OW0A 4OLVH 3HC0A 4FF9A 1CFQB 4XT1C 4NERA 1B6DA 5LDUA 4YHLH 2OL3B 5F1SA 1RULL 4FQQB 3F62A 1EO7A 2QQLH 3O4LD 1IAIM 3FSOA 3FUFA 2UX6A 4D0DA 3QIWD 3EYVB 3ARGA 1KFAH 1J8RA 4E42B 2OCCB 3HS0A 3KLSA 4ODVL 5T3XH 1ZHNA 4JZOA 5I16A 4CGTA 1OWRM 3BLPX 4KROC 3AT8A 2BH0A 3EBHA 1KBBA 1C1EL 5EULV 2BMKA 2CR6A 1LO3L 4NQDE 4ERSH 3MOBH 4PJHF 4PJGF 2FYYA 5IM7B 2QSCH 1DDHB 1EZUA 4IBWA 4IHOB 3N1GC 2D7TH 1OAYH 2ZCLL 3MGTA 2HLAB 3ISYA 1JZ5A 1EPFA 4PG9B 3L5JA 2F2HA 1NL0H 4ZFOA 1KLGA 4WLCA 4Z7IA 4ZPTA 4QR7A 4J28A 3KCPB 4OF8A 1TVHB 3FQTA 2VDQH 2L7QA 4EAEA 3MRDB 4N2EA 2Z31A 3SGKA 2J56A 4XH2A 1FZMA 4PJ5D 5DMKA 1IGYB 4DH2A 3T6VA 2RTTA 1M56B 3FDWA 2ARJA 3DJTA 1SM3L 5E6UB 1BREA 2IDSA 3NJHA 4IDLA 4P5TD 1X9QA 1MVUA 3QEHB 4JDEA 1UADC 3QDJA 3DPDA 3NJGA 4APQA 4XP9L 5TK4A 1MY7A 3O9WD 1Y1UA 4BGLA 3SY0A 3PP3H 4I3RL 1ZTXH 4F8NA 1Z9OA 1J48A 3QS3A 1E9OB 4XGZB 3HCVB 3A67H 2B4CL 1GS8A 3BE1H 2JV6A 1SBSH 5IG7A 5GRYA 3L5XH 3GXUB 3FT3A 3OR7A 3UPCA 1E2VA 2ENQA 1DBBL 2GIXA 3OKLA 4GRWF 3GKWH 2EABA 4IRSA 5JOEA 1NGYA 2COQA 2E6QA 3SGEI 3TO2B 4NQXB 2NSMA 4YBQD 1SN2A 2Z8VC 2VLJD 4LSSH 4RMRA 2XQBH 2AV1B 2ZKHH 5CAYB 2VZSA 1SY6A 1OF2B 3E7JA 1ZVYA 5JPNC 1Z5YD 2J88H 1MPAH 4OZGA 1QSEA 2CE6A 3UFIA 3BUYB 5IMMA 5SWZD 1WWCA 4LLDB 2YPVA 4TF4A 4DP5X 3HC3L 1OCWH 1HS6A 1LO5B 3WIIL 4M6NH 2VLRA 2Q8AH 1CLVA 3BN9C 3ILQD 4F7CA 2C3VA 5DHYA 3RU8H 5CGYD 4XBPB 4YFLF 5DZJA 4UQBA 3OKMA 4ZMNA 4CILA 1NINA 3ELAT 5LBVA 1B3JA 2UZXB 2QDVA 1C08B 4NWTL 1AYRA 2PETA 4LRIC 5GRUH 3JV4B 2XTJC 4R5VA 1KXHA 1WFUA 2DWEB 5D7IE 5TPWH 4Y2DC 1HAUA 2VJXA 3QNYA 3T4AC 3U6RA 3LIZL 4U0RB 3NCJL 1P7HL 2ALAA 2YAOA 1MW3A 2AMUA 3WEAA 1NFDF 2I9LA 4CKQA 3RY4A 1BVKA 1GC1C 1GJIA 4Z7UA 1TSHA 1ID2A 2WXFA 3BO8B 3HZVB 5ITBL 3B8SA 2J1XA 3JYCA 3KBFA 5DURD 3CSFA 1BDYA 1JGDA 1NAKH 1TVBA 1ORQA 4ZMOA 1FPTL 4S1QL 2JKSA 5KEZA 3B7UX 4NRZA 1C5CL 4LPWA 4Q6IB 1RP8A 4KROB 3KPOA 5EZJA 3FN9A 5FDYA 4YDKL 1R3IH 5CEZL 1CCZA 4OSUL 2A77H 2X87A 5GISH 3T0DA 3IETB 4ELMB 4UIKH 3QJFA 2NY4D 1OHZA 2WINA 4MS8D 4PW3A 5FYLE 3VFVB 3WFCL 4AQAA 5IT2L 3ATDA 3WY1A 3TX4A 1IC7H 1DQLH 4N2BA 1DZBA 3L1FA 4QXUH 2WWKT 1M42A 1Q8MA 1G87A 5F1NB 5ICZA 5JDSB 2YGQA 1NFDA 2VR4A 3IFOA 5CMAB 1X5GA 4RFNB 1HCYA 3NN8B 4NKMB 1AHWC 4JN1L 1AXSB 3QVAA 1XTMA 2UWEB 1M3JA 3ESMA 2QADD 5CKGA 4JFZL 5JIHA 3ULUL 1IC4H 5DD6A 4I2XE 3PHSA 3HI6H 5HHPA 1HFUA 1JHLH 2EDKA 4I0PB 2O6PA 3VM5A 2PCYA 1JWMB 1B2WL 1ITCA 2VLKE 1QBMH 4OM0L 1G84A 4JAMB 4TKWA 3ZKMC 5C2BL 1YG9A 1J0KA 3ZSTA 4HK0A 4FYQA 3NIFE 1RHHA 4H8WH 1BPVA 3HHSA 1NCWL 3L3IB 3D2UD 3P0GB 3TCTA 3B2UC 2I32A 2XNAB 2ZYIA 3TIDA 5JW3H 1NAMB 5JOPE 5C0AD 4PB0H 5IROA 2BSCA 4HC1L 1R5IA 1ETZB 4BWTA 4KVNL 5F1IB 3CSTA 4YFLI 1BEXA 4HH8A 4MVBC 4KX7A 3LN5B 3QO0B 3O6KH 3VD3A 1RZ8B 5KYYB 4DVRH 4YGVA 1F4YL 4TN9A 4FYSA 3MZTA 5JPNB 2DTML 4R8WH 3TO4C 4PH8A 3TIEB 4GBXA 3I9AA 3F12B 1QI3A 1ND0B 5D9SA 3GSXA 2JELH 2WVTA 4JPKH 4UV7L 5CR8A 3RL2B 1JNLL 1BYNA 2DIEA 3IRZA 5FHAL 3UGEA 2AJYH 2KI6A 4NO3A 4N2FA 3WE6A 5I1JL 2Z8WC 4HUKB 5CKAA 4JM2F 2BRRL 2IALA 4PJCF 3NJIA 1RK1B 1RK7A 2D8KA 1CTMA 4K4KA 1UCBL 3BSZL 3TPKA 2N1KA 1BJMA 5CLZA 3ESUF 4M93B 4AVKA 3LB6D 4WEBH 1IGCH 4GUPA 2XTJB 3SCMC 4CVZA 5HP5A 1SDYA 3QIUD 4Y2DB 5DQJB 3T4AB 1L6XA 3AUWB 3T65B 2VR6A 2ZUWA 3N40F 3RBGA 2FWOA 1FSKC 1I7UA 1R5WA 2QPFA 3ZUNC 1F90L 4BIKA 4LPXA 3MYZA 4U1MA 1T22B 1BAGA 5CEXB 5JMOC 3VFWB 3L4UA 2OM5A 3L48A 2DEWX 4OZIF 1OE1A 3MA9H 1MCSA 5GGVY 2DJUA 3MX0B 4PJCA 3X2QB 2DOCA 5DR5L 3ZR5A 3IJEB 3O41A 4KKAC 4HHGA 3TVMD 4J27A 4PJEF 4I89A 1WV7T 2B8OT 1NWOA 3V6OA 5DRZA 5MHSE 1AGFA 1D9KD 2B2XH 2QDWA 4JHWL 3UAJD 1OAJA 4BH7B 2C9XA 4TS6A 4AQ8C 3ZXAC 2F18A 2J1WA 2UYLB 4HAFA 5EF1A 2XOTA 4UCFA 5IB1B 2R69L 1FVCB 3WFHA 3FC8A 4GO9A 4CDHA 4N26A 3NRPA 3AS1A 1JPFA 1LILA 4TNWK 1O7DC 1B0RB 3MRGA 3NCEB 3CTTA 4IM8A 1AHWB 1AGBB 5C7ZA 4R90L 1F6FB 4OZIA 5HDBB 4DQAA 1G1OA 1M71A 4FCAA 3PPEA 1S7UB 4RRPA 1MWAA 2ID5A 2NR6D 5E1AB 5K39A 3TBTA 2ZNXA 3UMNA 2Z64C 3V0JA 6TAAA 1S9WB 3BZDA 1CPUA 3TJEL 4PJEA 1I7TA 3S8WA 1U8CA 4DK5A 2G30A 1JYVA 3ILPA 3CFKB 1G0YR 3KL0A 3LKOB 4NC1C 2M83A 2P80A 3BP4A 4NAJA 2AERT 1ETJA 4ODHL 3QWRA 5E2VL 3VDBA 4D3CL 4MAYC 1JPSH 4ETYA 2IBGA 2QMJA 1ONQB 4ZMAT 2BWDA 2VDPB 2ZCLH 3QI9B 2EH8H 3TYFB 2E9GA 3T6ZA 3QUGA 4WNQB 3ZN6A 3TN0D 2GAZB 4NZRL 1ZE3C 2N7AA 3MUJA 4Z7QB 2GJZA 5ACZB 1KTCA 1EFXD 1NUNB 2XVLA 3F00A 1J11A 2IPTL 5ALCL 4N24A 4NQEB 43C9B 4P04A 3QA3A 3LEYH 3IN2A 3W0WB 1AE6L 3QULA 4G59C 1PZDA 3CFTA 3M6DA 5EOTA 4HF5L 3N3EA 1OF0A 3JV6B 2DD8H 2GJPA 5IESL 3UPRA 3HJ0A 5AYTA 4QRBA 1FO0L 4XP9H 3KPSD 3B7TA 2P24B 3R7QA