2OMZB

Crystal structure of inla y369a/hec1 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin-A
publication title Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omzB00
4OY9A 2A4EA 3Q2WA 2OMUB 4AQAB 4AQAA 4ZMZA 4AK1A 2V37A 4ZT1A 3K6FA 2OMVB 4AQ8C 2OMWB 3FF7A 4XXWA 4XXWC 1FF5A 5JYMA 3LNEA 3PPEA 5KJ4A 1L3WA 2WCPA 2EE0A 2WHVA 4ZTEA 1WYJA 3UBHA 2WBXA 1SUHA 4ZMQA 5JYLA 3UBFA 2YQGA 3LNHA 3UBGA 2A4CA 1NCJA 3LNGA 4AQ8A 3K5RA 2OMYB 3Q2VA 1EDHA 3LNIA 4QD2E 4ZMVA 2QVIA 3K5SA 3LNDA 3LNFA 1OP4A 5DZVA 1NCHA 4ZMPA 1NCIA 4NUPA 4ZMXA 4NUMA 2WD0A 5CZRA 4AQEB 3QRBA 4AQEA 1NCGA 4AXWB 4AXWA 1WUZA 1Q1PA 3MVSA 4APXB 3Q2LA 4APXA 2OMZB 2X2UA 4ZMTA 4ZMLA 3FF8A 2YSTA 5CO1A 2OMXB 1ZVNA 4NUQA 1ZXKA 1O6SB 4NQQA 3K6IA 2QVFB 4ZMNA 2O72A 2OMTB 3Q2NA 4ZMWA 4ZMYA 4ZMOA 4ZI8A 3K6DA
chains in the Genus database with same CATH superfamily
5F8RC 4F24A 3FQUB 3L4XA 4TUJA 4Z77B 2DQUL 2NTSP 3VFWA 1E65A 1ZVYA 4WO4D 1K5NB 1MI5D 3UDWC 3ZTJH 4YBLB 4LHUD 1E28A 4U1IB 3MV7A 3QZMA 3RQ3A 4NKOB 4GQ9H 4OB5H 2FHBA 3EH3B 1NBZA 5JPNA 5I30L 4HZLB 1HQRA 2A83B 3O3AA 4YDLC 3AY4C 1SJMA 2ADGA 1FJ1B 1T22B 5T1DL 1VLXA 2HFEB 4ODSL 2CBQA 3MOQA 3C9NA 4HW6A 3WU1A 1GHFH 1DP0A 1A5FH 2E56A 4L3EE 4HIHB 3C60C 4R2GC 1YEHL 3T08A 1YY9D 2IAMD 4HFWB 3OF6D 1A7OL 4Z9KB 3MPCA 3MREB 4HK0B 2EDNA 2QPDB 4J8RA 3CC5B 3D51A 1V54B 4PG9A 1RIUL 3J2PA 2ZCKH 3GWJA 1F4YH 3QIWA 3U30B 3O3BB 3C2AL 4XBPA 2CNZA 2MQGA 3MLZL 3FTVA 4RMTA 3CHXA 4MAUL 2BIMA 2D4DA 5TE4L 1TU2A 4LSSH 4PP2A 3GMNB 2EKSB 3QORD 3AWEA 1MN4A 1WS7A 2CDFB 4HBCH 5E56A 3FO9A 1GSMA 4H20L 2EC8A 2NY3B 3IJHA 3IGFA 5BJTB 2F8XC 4KDVA 2IGTA 1ULVA 4PB9L 4XX1G 4LZKA 4A7GF 4OCLC 1F4AA 2FGWL 1WIPA 1VDGA 5LAXB 5IW3A 2HFGH 4PVNA 5GGSA 1QOKA 3QXTA 5TDNB 3OB8A 2VLJB 4JO1H 5I17A 3EHBD 4MNQD 3UERA 1IQDB 1JNLH 3BT2H 3L6FA 1VCBC 2DWDB 3K6NA 1MDAA 4U1SB 3D9AL 2VO8A 1KJ2L 5DHVB 3DX4A 2GJPA 3CX2A 2Z93A 2VDQH 1AO7A 3L3OB 4JDVB 4HD9A 2OW7A 1AGDA 1YEEH 3R19A 5EORL 2BHUA 4KROB 3P54A 5CXPA 5I8CA 2F68X 1G7LB 3DJTA 3VXUB 5DRWB 5F9DC 1S7QB 1YG9A 3FQYA 4ZMTA 3SO3B 4GIAA 5D7LB 1XL4A 1JYVA 2RH0A 4KKPA 4DFIA 4CDHA 1DVQA 3KPSA 4UI2A 1J8SA 1N26A 3KJ6H 1QBAA 4X5WB 4NI3A 4JY6A 3DETD 5TE7H 1JGDB 3CZEA 1NGXB 2YK1H 1VKXA 3I02B 2W92A 2YQ2A 2P44B 4BZ1A 4Q6YA 1FVEA 3FTXA 3OX8A 1U8OB 3K1KC 1OCCB 5EIVA 5IB5B 2VLRE 2JFCA 2WUCH 1KXVC 4EI5A 3DIVA 2NX5E 1SYVB 3FAWA 4EN3C 1N8OE 4WW1A 4ZT1A 3FH8A 1OARL 2R8SL 5KYNA 5DYOA 3LZOA 4K5LA 1PG7W 2J2ZB 1FNGA 1FNEA 4PSRA 1SHMA 5KG9A 2QQNL 1E7VA 5CMAA 2R0WL 4FULA 2BPBA 4LMQI 2K3TA 1FVDB 2FK9A 2VDOH 1JF5A 2YZ8A 4GSDH 5LBSH 3QAZB 3HUJF 3HVDA 4LGPB 2FD6H 4NRYB 3IMWA 3QZNA 3IGAA 2WWKT 1IX2A 2WLMA 3MRMA 4DKFL 3Q8BA 1MFBL 2FTAA 1MZYA 1G9MC 3P3TA 4JDZA 4MD5B 5KVMC 3GGWA 3V55A 1GS6X 2QVTA 1UJTA 4QRBA 3CFMA 2ZP0T 3LRLA 3C8KA 4MTMA 5MI0C 3E0GA 3S5LB 3T8XB 4LQ1A 4JJ5B 3AACA 3ARGC 4GKZB 2GG1A 2FSDA 4BZ1H 1QSEB 1MCDA 4YDLB 5EO0B 2AJUH 1FBIH 3TH2T 2XNAA 2QLYA 2R56L 1HXMA 2LVEA 2WB1A 1F4HA 3EYSL 4LAQL 5E2UL 2EABA 2R1XA 5J12B 1GSKA 2C4FT 2JKWA 4FDWA 4HIEA 4YE0A 3C60B 4R2GB 5J6HB 1OE1A 3BYYA 4M7KL 1HH9B 3KGRA 4M5ZH 5JR1H 2JI3A 1UTDA 3PAZA 2QMJA 4WDIA 3R06A 1PX4A 3TPUB 3RZCB 2C9XA 4OR1A 2WMPA 1BAFL 5C2BH 5CZVH 5T3XH 4L0PB 3O6FA 4UT9A 2BP3A 3ZHFA 3BP7B 2OSLA 4MMZC 5F9JA 5IB1A 1NAKH 4QMEA 3IFNH 3DUSB 2BZ7A 3V0IA 3ROLB 5CZXC 1RXLA 1P7KB 3VXSB 2VCOA 3OLIA 4XNDA 3GZPA 3TO2B 3BMWA 2O5ZL 1KLGA 3L9BA 3U9UA 2PR4H 3NTCL 1WQVT 1PCSA 3ZGIA 1E4JA 3I75B 4FNQA 5AVTB 5I0ZA 2FIKB 4MRCA 4JM2F 3HZKB 4PY8I 3QG6A 5AYTA 5IQLA 1M53A 1NBQA 1XF3B 3WFDH 3WLBA 4RWHA 4ZAKD 2NY2C 2BSSB 3MHZA 3TYFB 5C09D 2LGNA 2M26A 2GIMA 3BKJH 4G42A 1XD1A 1TEGA 1CQKA 4XVOA 2BDNH 3N55A 3DNKA 4HIJB 4RRPA 2A74A 3H4HA 2G30A 3PNWB 4GKOA 2DIEA 5AZUA 4Z8FL 4IOIB 4XPBH 1YQVH 2NYZA 1FFTB 2EDEA 4JFXA 1QLEL 4OQTA 1R5IA 2BY1A 1A65A 4RDQG 5BV7H 5KVFE 3VM5A 3LKNA 5DEJA 3MZTA 2VRAA 4J4PC 3OPZH 4RBPH 5I75C 5E5UB 3UO8B 5KUKA 2ESVE 1MFDH 3LV3A 4JHZA 4J1UA 1OTUD 1A7PL 1KTLB 1YLBB 3OXSA 4HIIB 4YHIA 3CFDB 5LGHH 4U4BA 3MLRL 4QRRB 3L7EA 3TJEL 4M6MH 4GO9A 3W9DA 1UKSA 1Q0XL 5DSCB 3OZ9H 5GZOD 1S5HB 3KS0H 1ILSA 3K0WA 1D7FA 4XP4L 4EN3B 5DHXB 4NM4H 2ITDB 4DO4A 1MF2L 1QP1A 4RDBA 2EIBA 2Z8RA 3RRQA 1V3MA 3L4TA 2F7IA 3LXUX 4X83A 1OAXL 3FUJA 1SJXA 4N2EA 3V4VL 1MLBA 1A2YB 4TULL 4ZW7A 1WH0A 2PO6C 2X4UA 3JWDC 3F5WB 3MRBA 1EAQA 4N6RB 3VVVA 4I3RL 4CKQA 5KSAC 5EULV 3TPKA 1HL5A 3VWKA 3PFQA 3II2A 4KZEH 3EG9A 4M8RA 4I9WE 1HNYA 4F3FB 3AC0A 4XMXA 5HGBA 1MHPL 3EJZD 5MI0B 1A4AA 2YD2A 3IDIB 1PMYA 4JFDE 3T6WA 5C70A 4FFWD 43C9A 1IVTA 3BZFA 1MFVA 4LCWA 2GC7C 3BVXA 4KJYA 4DGUA 1X3DA 2ZSVB 1DVFB 3FB6B 3CSFA 4G7QB 4DUWA 5LNGA 4LVEA 1HZLA 2EYTB 1JPTL 2NQDA 3CSYB 4MXQD 4Z3EA 1AR2A 1X7TA 3OHXC 2A99A 3K3QA 2DMBA 2HG5B 3WKMH 5DMYA 3A23A 4XO9A 3MJ9H 3UABA 4FMFA 1T0PB 1WZKA 1P84K 1PQZA 3RWFA 4GBXC 5I8KH 4V2BA 3OLDA 2KS0A 5A16A 4MMXC 3UTTD 4UM9A 3RDJA 4P2RD 1AHWA 2DQFB 1UD3A 4KK8D 3BSZA 4IS6A 4UOW0 5K33A 3B37A 4I0PA 5CN2A 2NXYC 1OAJA 4BSWB 4MMZB 2QZ5A 1BJ1J 4UV4H 3T04D 3FQXB 4QWWD 1P1ZB 2HXAA 3GMQB 4DGIH 3D4CA 3ZBMA 25C8H 3SCMA 5IB2A 4MHHG 3Q2WA 3PS6A 5TPWL 1G6RA 3SKJH 2G75B 2NW3A 4QT5A 4S1RL 3UJJL 5I1IL 3GKWH 1IL1A 4XXWA 2ZTBA 3B4NA 4M1GL 1FCCA 4UOQA 3QEQA 3U4AA 3DO3A 4JGUA 1DUYB 1F3JB 3A3YB 3QQ3B 4F80A 2XA8H 3U82B 2G9HA 3LOWA 2NY2B 4TSBH 1RI8A 3UFIA 2BOLA 1QFHA 4XOEA 4Y8DC 3EO9H 2YPLB 3QBTB 3DX3A 4OF3A 4BE5A 4QOKD 3GXNA 1KGJA 1R3HA 3GHEL 4GH7B 1X9UA 3QFJA 4NS0A 5DUPL 2BSTB 4ZMQA 5JQ6H 1NCAL 3JUYA 1MH5B 4MJ6B 5TK2A 1XSJA 1VSCA 2V5SA 1KLFA 4HETA 4YXHH 3HI1B 4APQC 5MEPB 1GIGL 4JCLA 3CQPA 3OKMA 4IGBD 1E67A 3QJHB 1FRGL 3KXFD 1NCUA 4ZPVA 3N91A 3ARBD 4NC1E 5CWSB 5TH2A 4XZUA 3SJVA 4XMPH 5IG7B 5I75B 4JFFB 5I1HH 5JOPE 3ZX1A 1HL9A 4GKSA 3ZHNA 4XCNA 4X6EA 1QZNA 4Y5YB 4M6NL 2IVFC 1G6RH 5AUMA 5BQDA 5FGSA 2I9LA 5D1QD 4HULB 2J5WA 1JMZA 3UYPB 5F97E 4UAOC 4Y4FD 3GMMA 1KEML 2H2PC 3LRMA 4JVWA 3L54A 3CXDL 3O6LL 4I1RA 4GRLC 3GK8H 4KJPD 1J0JA 4U31A 3OJMB 1A7NH 1S3RA 2FNWA 1DUZB 4V1DD 4L23A 3T6XA 1AANA 3VWJD 2K9UA 5F7FA 3CFBA 2CHNA 1AQHA 4PP1D 2J88H 3ARFC 3QRBA 3RUGE 3O9WD 5ACMA 1NTDA 1Z9SB 4CSPA 4Q6KA 4U6HA 5LGYA 3GS4A 3HI6L 4A67A 4WU5B 1U41A 2PO6B 1EO8L 4YSRA 3CHPA 3UG3A 3GFUA 3LYRA 4NQCA 4BGDA 4LP4A 4FQQA 1JPGA 3GPEA 4KVNL 3HE6D 3UAJD 3UGEA 1R19A 4G7YL 4BXSV 4I48B 4NXKA 2CKBB 2IADA 1HQ4B 1HWWA 2BC4B 3FB7A 3PHAA 4X8JA 4PD4K 5E8PB 4ZW6A 4PPTA 1Q9OB 1NEZG 2H6OA 1E8XA 2VC2H 2W07A 5ISZE 2ZPKL 1PYWB 1U3YA 1F90H 2UVFA 2EXYD 3ULVE 1SF5A 2XKNA 2YGQA 2JIXA 4HPYH 4OFVA 3WXWL 3FCGA 1OCWL 3CFUA 3U25A 4UOW1 3MNDA 1YJDL 2I5YH 3FQRA 1NFDA 4PJFA 3OHXB 3KPMB 2OAAA 1YEJH 3NSDA 1HHGA 5DJ0A 5L4FA 3BEVB 4YZFF 1BIIB 5BRZB 4GW1B 1ACCA 2WBJA 1D6VH 3ILDA 1DQLH 2RR3A 4YDJB 4Z7UB 3WGUB 4GBXB 4FXGC 1NC4D 3EZJB 1IJNA 5HJ3B 1NBYB 5GRUH 4MMXB 1JUFA 2CJUH 4X2UA 3V0EA 3K1DA 3ZL1A 5T3XE 4Q9RL 4HJEA 4BV1A 1GS7A 3SQOH 2NXYB 4MB1A 4LPVA 4AIOA 2CRZA 3O2DL 1ADQH 1K6QL 4DETA 2VDRH 1J8HB 4FNLL 4G9FB 3P9WB 3DXAB 1P7QD 5I71C 1T0NB 4N0YL 5EU5A 2XBDA 1Q4NX 4EBQH 5JIPA 1A6VH 5F7KC 2R0LH 2XXFA 1LE9B 5IJKA 5F7EL 1I3VA 3PQYD 1RUML 1RZGA 4YDKH 2X9ZA 3ILQD 4HT1L 4ODXA 3NZHL 5I5JA 2DQEH 1UA7A 3VD4A 2EUVA 2J57A 4JKPH 4IIQC 1JRHL 3T6VA 1H3WM 1PX3A 1MFAH 4G1EB 2DBLH 1KBPA 3S3JA 3CIAA 2UY6B 4QAWA 4NNXA 3DBXB 2AW2A 3TLRA 2BOBA 1A3ZA 1JXDA 4YNYA 5I18L 5IREA 2J1KA 5J1SC 3FRPB 3EAKA 3VXNA 1P2CB 3DARA 4HXBL 5ANMB 4H0GA 2X3AA 3FQTB 3MXWH 3L3HA 2VB5A 2PW2B 4NO0B 2VITA 4FI8A 1K5WA 5A6LA 5KVGH 5BRQA 4PREA 5FYJE 1SOSA 3FU6A 1WBXA 4N3UA 5I1EH 4GAJL 4FQIH 3EDEA 1ZJBA 3CE1A 2HJLA 3P2TA 4XNQB 5ALCL 3GSNB 4BFIB 3X3GH 5E2TH 1PKQE 3PABB 3UTSA 1DQKA 2OTWB 3G6JE 4LBEB 4RA3A 1G9HA 4UAOB 3FSAA 4Y19E 4QRPE 2VN4A 5D1ZD 3VI4B 4DEPC 4GRLB 2TAAA 3S35X 1YEWA 4MSWA 5AW3B 2A9MH 4K0OA 3KPLA 2B1HH 5L4MA 4W4NA 4HS3B 2YSSB 5DT1H 4G5ZH 3B1TA 1FYHB 1U2YA 3HB3D 3EYOA 4ZUTA 3ARFB 1S9XB 2WVUA 2B15A 3D0AA 1OF2B 4DGYH 4HWUA 1LO0L 1U8NA 2VJ8A 2V9QA 3OXRB 5HSFA 4WUUA 4B95C 3C08L 4YLQT 2YEVB 1KGCD 2X70B 1RP8A 1VHPA 2VQTA 2Z4TA 4O2FB 4GXVH 4NP4L 1T7YA 4YSEA 5GIRB 1RKRA 3LMJH 1XT5A 1OLZA 1J0IA 2EC9U 1RU9H 3MRKA 4OTXL 2WO4A 3WFCL 5G4NA 2DQDL 5G5DA 1R1CA 1LEIB 3LD8C 3HC2A 3SE6A 1RCYA 3ABGA 3ZKSD 1UB6B 1U8MA 3PPEA 3DV6A 2DQGL 3QDJD 3RIFF 2D3VA 1I8MA 5A2JH 3FQNA 3VD0A 1A4BA 3JV6B 2OXGB 2YPVA 2EE9A 1T7VA 3AQDA 4L8SC 3BJ91 4HWEL 1CBVH 4MGXA 3THMH 5C0CB 5IB3A 5E08L 2GK2A 3U4EB 1CFBA 1CLZH 5HYQB 2F53B 2ITEA 3BE1H 3MOAH 4FZ8L 4JANA 2CCVA 4QNPF 1INQB 4FXGB 1UB5A 3VGGA 4TVUA 4HOXA 2YKLH 5GISL 2XUWA 1FFNA 2OULB 5FGCB 3RX7A 3OWRA 1UT2A 1XFPA 2A9BA 2XVLA 3L5HA 4G70B 4FQXC 2SEBB 2UWEB 4F20A 4XMKH 2VZSA 3ARWA 5J6GB 1N8ZB 1QEXA 2VZ1A 3MR9A 4JAMB 3W39B 1RZJL 4YEFA 1JDDA 4GIPD 1KXTA 2P8LA 5I71B 4G8IA 4BFBD 4ZMPA 2F74A 2YA2A 1YRKA 2AZAA 4H5SB 4N8VA 2FEDD 2YEQA 2DIAA 4UQ3A 3QXDB 4WK4B 4MB3A 5ES4B 5KVDH 2E7CA 1J86A 1ND0B 1UWXK 1FG2A 5AKTA 4XNBA 4ENEC 4U6XA 2ZX5A 3ARXA 2YPVH 5J3HD 1IEAB 1VPOH 2X4PB 4IIQB 1DE4B 4POZC 1JWMA 2ZXWB 1K8DA 3EIFA 1BPLB 4PRNB 3T3ME 4LIQH 2ENSA 4WWKC 1WT5A 3QJZA 4KKBD 5HYJD 4A2MA 2AVFA 1ROCA 4X42A 1AH1A 5AEAA 1JV2B 4OIBA 1QRNE 4MKTA 3EOAB 3ATFA 1BD2B 3WIHH 1XHHA 3H9HB 3V6FB 3SODB 3GTTA 4UM8A 3I9GH 4U2ZA 1PLGL 3Q3GB 5C08A 3L8QA 1FORH 3VI3E 3DV4B 4W9JC 4YDIL 1JNHA 1FFOA 5E4AA 1I1AD 4OUUB 2WXFA 1R17A 1K4DA 1UA3A 4GSXA 4ZOCA 2C3XA 4YHKL 4Y5VA 4YHOH 4D9QD 4CU7A 4RAHA 2EIMB 3G5WA 3QQDB 2ADJB 2GY7B 4X6CE 2BNQD 3MRQA 4HFUH 2NR6D 4KY2A 3BDBA 4GG6B 4PLKC 4NLHA 4DEPB 3QDGE 2GBUA 2B2XH 1QFUH 3P4MB 1FZKB 1X5ZA 2YQ3A 3KVQA 3T8VA 2EH8L 5LHDA 1JI2A 1PZUB 4B5EA 4XPGL 2OMVA 5CP7A 4JB9L 1CR9L 4I87A 15C8H 3QJUB 4JHVA 4FQJH 2DLTA 4OFKA 1UXWA 3EO0B 4J6RL 4GAAA 1XTLA 2HPOA 3NIGF 1L9RA 2B4CH 4NWTL 5TDOB 1TTRA 3TA3C 2AV1A 4P2OA 1ML0A 5CR1A 2WCGA 4E68A 3I50L 1JTPA 2C3GA 4XC1H 5E9DD 3S35L 5CHNA 2RB8A 1T6VN 3H7LA 1MRFL 3CZLA 2RALA 1C5BH 5B7FA 1YPZA 3AREA 4ZFFB 5SWSA 1W72A 2XACC 4QHUA 4GFXA 5D7KE 3F12A 5D7IA 1OGTB 3VFMB 4D2NA 1TUPA 1ZTXL 1WFTA 3ZO0A 3LD8B 5JDSB 5E8NA 1VADB 1KCSL 2A4ZA 5BZXA 2DD8L 2XWJB 4QY8B 4UU9A 5EEXA 3LKOA 1ED3B 3P0VL 4R7XA 3GD1C 2ARJA 5DTFA 3S88L 2IPTH 5DLML 3FFOA 1E6JL 3LNDA 4OFYA 2VMFA 3NCJH 4L8SB 1I1FA 4OSUH 2OJEB 1MRCH 3L5IA 2YMXL 2BP8B 5E70A 1YY8B 3LPOA 5AAWA 1D9KC 4N1EA 4JPKL 1H8LA 1WHOA 5E2VL 2NLJA 5ACZB 5LBVA 4L3EB 2Z64C 3F83A 1MCKA 4XOBA 4HKXA 5FM5O 1JGEB 1KN4L 5T5NF 2WIIB 5HY9B 1XX9C 4FABL 1GY2A 3DVNA 4AQEA 3G5XA 3T1FB 3BPLC 2DWXA 2NY0C 2IBBA 1PDKB 3HI5H 3KZ8A 2WK2A 5DRXB 2F58H 4KMTL 2R2HA 4OH2A 4YIQA 5KYWA 1GMIA 1W72H 4WTZA 4TYUA 1KV3A 2F19L 5SWQA 3BQVA 2W65A 1NEUA 3WNLA 4MA7H 1AD0B 2Y5TB 5DQDH 3IAGC 4XXCA 3DVIA 4P46C 1JN6B 3C12A 4IRZH 1PD0A 4AEIL 1ZDQA 1FYTA 3U6XA 4F9LA 2NY3D 4PGEB 3GSOB 5ITBH 5D7SL 1JOIA 1TQWA 1NFDE 3QUZA 2I60L 3MC0A 4PJFE 3WHXB 4QYOA 4HEME 4ZW3A 3IK2A 2VDPH 2WQSA 4ODHL 4XPHH 5FHAL 3KH4A 4XBEH 3TX4A 1IGFL 1TQTA 2VDKB 5I15H 3QWNA 3PAVA 2X0UA 1CL7H 4M4RA 4NAMA 2VLJD 4RQQB 4M00A 1J5OH 1G6VK 4NQVB 4H8QA 4FLSA 4DKDC 5FV1L 1FWXA 1ID2A 4W9GC 2HRPL 4NQEA 3WKPA 3KWUA 4FGMA 1NBVL 2FE0A 3CBJB 4LLAA 4WUKL 4KROD 4Y88A 2FLBT 5FKPA 1CXLA 3E2HC 5IW1B 3VXUD 3SBPA 1B0WA 4DPCX 3S97C 3O3UN 1Z3GL 3MNZA 1R5WB 1GCFA 1PW3A 4UT6A 5D7LD 2V7HA 2YD9A 5JO5B 1EO5A 1PY4A 4JO2L 4MBRA 2Y6SD 4HUWA 4OZFB 3BVNA 3L9YA 3BDYL 1MRDL 3TBTB 4AZ8A 4G43B 4MZRA 1I8IB 1OIOA 4JFOA 5GS0H 1HDMA 4I1NB 1RVFL 2CBTA 4IBTA 5C3TA 3U6XS 2VLRB 2IGFH 5IOKA 2NX5B 2ENJA 3WOVA 4GAYA 3SD5A 2BIIA 1SJHB 1KY7A 3DX2A 2EDJA 3LNIA 3L3JB 1N10A 3EOTL 4TS6A 5EN3A 5A2AA 1SEQL 4J23A 3PY9A 3V5HA 2KH2B 4XN1A 4XB8A 2DWEB 4JG9A 4OFIA 3TA3B 3I85A 1TQVA 5LNEA 1U42A 4O02A 4QYAA 3STBA 5BCAA 2Y7LA 2D3LA 5LAPA 3IFOB 1NAMB 3IVKA 3VD2A 2GQHA 4AH2A 1PBYA 3A5VA 5BOJA 4ZD3H 3SHSA 1MCLA 1BZEA 5ABZA 1Q38A 2OTUA 3NMEA 2JCCF 4OV6F 2PYFB 2V4LA 1GGCH 3WE6A 3WHE0 3ZXAC 5FS5A 5KBKA 2QSTA 3WS6A 1A21A 1NEPA 4O2EA 3NSYA 2YFOA 3MCLL 5KS9E 4XP1L 4P59L 4HG4K 4LF3B 3TEYA 1VEMA 4XE5B 1IKNC 3LRSA 4KX7A 1JGLH 4H0HB 1DEDA 3ISWA 1QSED 4NCC1 1D9KB 1L9OA 1OAZH 1YNLH 4ZG1A 5FX3A 3LEXA 3X13B 5DJDB 1ZS2A 1AGBB 3PHOA 4Y2NA 4IBVA 4NQQA 4L4TA 3RBSA 1MWAB 1YPZF 5D6DC 3SYQA 3C60D 1RUKH 4R2GD 2DQHH 4XBGB 1T03L 4NKDB 5D7IF 2NY0B 1B4JH 4OI8A 4F1SA 3W81A 4L1DA 1NJ9A 2HTKC 1FCGA 5DC4B 4K8RD 1VFOA 3UZEC 3RZCD 4YAQB 4HOWA 3TIDB 5LXGH 1HX0A 1MSPA 5HGHA 5F1SA 1FGNL 2B7DT 1EEYB 4OKVB 4WCYH 3US1A 5H94B 2RA1A 2E74C 5IP4A 1T80A 5KVDE 4P46B 5F9OL 3CBRA 4EXPX 1FZMA 4PSPA 3KBEA 3FTGB 5H4YA 4JFYA 1DLFH 1F56A 1RJZB 1WA2X 3V7AG 4NO5B 2LQRA 3KPRE 4MB5A 4D9LL 1MFMA 5CJXC 1SUHA 3CFKB 4W1TA 2MCMA 1AY1L 2I32A 4WI6A 1A64A 1BVLB 2MOVA 4QTHA 3AABA 3GINA 5D71L 3O8XA 2OZ4A 1UG9A 4KBPA 5MENE 3MN8A 3HC3H 3OAUL 1JXFA 2G4GA 2PKDA 4RGND 3ARDA 4JN2B 3S98A 1VESA 5I1JH 2JI1A 5AYUH 2EXTA 3QDMB 4PWEA 3E2HB 2BINA 4ANXA 3IDXH 3HMXH 4ESKA 2EIKB 5HHQB 4NC1C 1XCQA 3IEAA 1DZ0A 4YHLL 4KZCA 5G4OA 2ESVB 2JQMA 4LEEA 1ZLSH 2ZUQB 2CR0A 4HWBL 4CILA 2Q8AH 1T89C 2CPUA 3HN3A 2VMEA 3Q13A 3SY6A 3VM7A 3DYPA 5D2NA 1OAKH 1AI1L 1T1YB 4MX7B 4KC3B 4QRRD 2EIDA 5IMOA 4LSUL 1JPSL 2WYIA 5IOPB 4XNAA 1FVCA 2EDDA 4FMVA 4OM1L 4OCSL 4FHKA 3AXHA 3BAEH 3SPJA 1OLLA 3NP3A 4QRSB 3QA3A 4EN3D 2NOYA 4C83A 4QKXB 4AXWA 4U1HB 5EN2B 4QXWA 2OZ4H 3QUKA 3MNMA 4APXB 2MMXA 5C08E 1DSWA 3BQUA 2NSQA 4LCUA 4XCFH 1IM9B 2X9XA 4YLBA 4N90E 4XBMA 1VA9A 5CEZH 3RDTA 2L7QA 1H0DB 2Q5BA 3HMWL 4GQRA 4ACTA 1CT8B 2V9UA 5H4ZA 4JGMA 4OD3L 3T5WA 1OAUH 4NUQA 4HIXH 1NPJA 1OCRB 4ZS7L 3JT0A 3V0GA 4WV1B 2ZJSL 1NGQL 3R0NA 1N3NB 4HUXA 1TITA 4Y8AA 2AEQH 1TXKA 1T04A 4MD0B 4D0BB 2G3XA 4JFDB 1IFHL 1P69B 4PMEA 3N9GL 4OT1L 4ICWA 4NT6B 4RMQA 3ULVC 2A6JB 1DDHA 3HG4A 1F8TL 2HLAA 3D06A 5FYKH 4YXLL 6PCYA 4L29A 1FA4A 1X5IA 1ZDSA 3V52H 2VLKE 4RFEB 1MG2C 4UDTA 1DVFD 1MJUL 4HXAL 4CC4A 4WSJA 5E5LA 1P5UC 4A7SA 4OZHB 4GS7C 4HA1A 5IV2B 4JFVA 1QHQA 1UM4H 3QO1A 3OWEA 4LOVA 1CGXA 5IVOA 1NOFA 2DQUH 2LOEA 2CDGA 3H55A 4DFHA 2ERJC 3ALWA 3FFCE 2CJ3A 4PS4L 5C0AD 5I1AA 2HJKB 4UQDA 4G6KH 1MZZA 3LIZA 2W81C 3G9AB 4OGAC 1KDJA 3EUUA 2CHWA 2PN5A 1RD6A 5I30H 5IQOA 2RIKA 4S1SL 4TUJB 3LNHA 4ODSH 4KI1A 2IOOA 1E28B 2WLYA 1UCTA 4NLAA 3DOHA 4LEOA 1YEHH 3DTXA 1AFVL 1NBZB 3C09C 5CZXD 1A7OH 1DJYA 2BH0A 3BN9C 4FL4C 3O3AB 1RIUH 2ADGB 3FULA 4MDRA 4MJIE 1OY3B 3C2AH 1CLOL 3MLZH 4RBPK 4BDVB 4HAKA 4MAUH 5TE4H 2HLFC 3FK3A 3B8YA 4CGUB 4FG2A 4PRIE 1C8QA 1JZ4A 4NUPA 5K1NA 3D05A 3EBGA 2CLZA 4H20H 3KPPA 4PG9B 5IIEB 1YMME 32C2B 1N59B 2YPLD 5CCKL 3DOSA 3U2JA 4XBPB 2F2HA 3EJRA 2R51A 2XVKA 4PB9H 3X12A 2FGWH 3ZGHA 5BV7C 4OCWH 4F7PA 1XEUA 4OLXL 3PAUA 2Y2YA 4KFZC 4R8WL 5AVQB 4YSAA 2VW7A 4NCDA 1B6UA 3FH7A 4NB7A 4D3CL 4OI7A 4BGLA 2P5EA 4XNMA 4QPEA 4J4PD 3D9AH 1FN4A 3O2WL 1KJ2H 3V0HA 2YOAA 2FT6A 4JFFD 3ZJAA 3R1GL 1MELA 2FJHA 4X7TA 2CLVA 3KJ4B 1W15A 4K3EL 5GGSB 1VAHA 3WNIA 5EORH 4ERSH 1XF1A 2ATPB 2XX1A 2VUYA 4LK4A 4TNGA 1AYOA 4TLTA 5F1NB 3DECA 3AGVA 3T4YB 3TO4C 4MMYA 2Z93B 4H8WC 1AZCA 3W3BA 3IMBA 3O6KL 3V79C 1YO4A 1AGDB 2XZCH 4JJHA 1AC0A 1U8CA 3RUGB 5IF0A 3AM8C 5I8CB 1J9TA 1VGEH 4N6QA 4WGKA 3SKMB 2LE9A 2VDOB 4Q6IA 1BQLL 2HFTA 1NGZB 5T1KA 3MFFA 3JTSB 3AG4B 3RX8A 1FF5A 1C5DB 2PO6D 3KPSB 3G6AA 5E95B 1S6NA 1WC7A 2GJ6E 1OSZA 4JY6B 2EIZA 2C9QA 1A4JA 3HN8A 5F70A 3PDOA 1OARH 3X11A 5I82A 2BNUB 5ISZB 4H1LA 4RSVA 2AABL 1ZT4A 2HVJA 3KAAA 3K8LA 3OMZA 4E9VA 1FVEB 1GYUA 5KSUB 2QQNH 3VDBA 1VACA 2A7BA 2R0WH 5EPMB 1CGSH 1A8JH 5LJYH 3PRZA 1QFWL 4WHTA 1Y0LA 4ABQA 3BX7C 4M1CC 4XAKE 3BUYB 5FGRA 5H35A 1XAKA 5DYOB 4GS7B 5E5MB 1FNGB 1ACYL 1FNEB 3O45B 3D69A 4QRFA 3MACL 2X12A 2FJFB 2XWDA 3EBAA 3SE4C 1MFBH 4DKFH 5M94B 4PJDE 3QUXA 5CMAB 2CGZA 5CIPH 5F7DB 1QHOA 4LPWA 1T21A 4UILH 3N42B 2H5UA 3C5JA 4EAEA 1G87A 3Q6FA 4HUKB 1R3JA 4GBXD 2VR3A 4KX8A 2CO7A 4MD4A 5DZVA 3IGAB 4GNKB 1BYNA 3MRMB 3OKEB 3TL5A 2EVJA 4JUSA 4PJ6A 1LK3L 3GGWB 1M4KA 1KFGA 2KQMA 5JIIA 2R56H 4F1ZA 5E2UH 2NXYD 4LAQH 3EYSH 4YSQA 3GJEB 1CDIA 5T1LA 4PV9B 3VDCA 1J8HD 4G9FD 3C09B 5GGSY 1I1CA 3DXAD 4FL4B 4M7KH 4LLYB 3NJIA 2ZUXA 5B3SB 1Q8MA 4PJ7E 5FM8A 2XWTB 3CFCL 2R1XB 3NJLA 1BAFH 4PWHA 4PAZA 4HIEB 2KDYA 1EXHA 2PWEA 1J9SA 1NM9A 5KYUB 4L4TE 3VFTA 3INOA 1IC5L 3SE3C 3AMLA 3P3UA 3R06B 1TJHL 3JWOL 3PAYA 1AHWC 5BV7B 3DPBB 2O5ZH 3FT3B 5EZIL 5BUPA 3JYCA 3NTCH 2F5BL 1KBBA 3MRDB 3TWCL 2WXKA 4W9ZA 5F9JB 2BVTA 3JWNG 1NUDA 2DQJL 3LPFA 2E7DA 3D09A 1OKEA 4NO0D 1A6ZA 3GEFA 2M8XA 5E0FA 5C6TH 4MDIB 3GMOA 2J8UE 4QGTA 1I7RB 5L8KB 1PKQB 3NAAL 4JRYA 4JKLA 3DX7B 4J3OF 1IT9H 1RLWA 2QDWA 2ROYA 2Z31A 4XXWC 4QRPB 3B9VA 2P46B 2K7PA 3NJMA 4Z8FH 3WLBB 1S7RA 1N6VA 2A1WL 1M6UA 3UZQB 4O2CB 5AVVB 1QLEH 2XTJE 5KVEL 4MCYB 4G42B 1OD9A 8FABA 2E46A 1UH4A 3IGUA 4N0CD 2P4AB 4ZSOE 2CGYA 3VFUB 3C2SA 1GKOA 3D25B 1A7PH 3BH9B 5CEZE 2QVMA 5E6ZA 3TJEH 1EDYA 1PY9A 5ICYB 3MRJA 4LOEA 4R26L 4TTGA 1VGKB 1NDMB 2Y5EA 1KTJA 3LKNB 3WBDA 4YJZL 1V3KA 4DZBA 3BD5A 4YUEL 1GZHC 1Q0XH 3VXPB 1H5BC 1EQWA 4BFOA 4XP4H 4J1UB 4B60A 2AJ3A 3ESUF 1MF2H 3HJEA 1U91A 2FNBA 2IFGA 2IWGA 1MCBA 3L7EB 3A6OA 3M6DA 1ETJA 1FNLA 1OAXH 5FYKE 5D2NE 4XGZA 2V2XB 4TULH 1IU1A 1I3RA 5M7QA 4JPWL 4I5BB 3D12B 3VSQA 1PS3A 2R23A 4PJ9A 1DN2A 1P9MC 4I3RH 4CVXB 1I7UA 5B1KA 2P28B 5DJYA 5B8CA 3U1PA 2YD0A 1HVXA 5C0CD 1MLBB 4PW4A 3ZE1E 4XODA 1EZVY 1UA6L 1A6PA 2Z7WA 5HHXL 5HGAB 4AJWA 2F53D 3OVUB 2LU7A 3CVIL 1FNHA 2IV9A 1EDQA 5I76A 4HCIA 5B3JF 4EQ3A 1QSFA 3UJTL 2OCFD 2WTPA 3VWKB 2JKNA 1TZGL 4I3GA 4LDCA 3SPVB 5JLZB 1JPTH 1HINL 2GUOB 5JOFA 1RHHA 2K0RA 4KZDH 3NABL 2NNFA 7CGTA 3LEYL 1PAMA 4IMKC 5GRVK 1JPEA 4G6AD 4XI5C 4KJYB 2VLLB 4YDVA 4R4BA 4AC4A 3WY1A 1J0ZA 3GBML 3ZDZE 5IKCA 1WBYA 3KD4A 5AVSB 3EYFA 2NQ3A 3N0AA 3K6DA 5FO8A 2JK5A 4PWGA 4Q58C 3CFJA 4JO3L 3KPNB 1KJMB 3S4SA 1IFRA 2IIJA 3MLTA 2DWYA 5KANI 2OR9L 2ITCB 1JERA 2H1PL 5MEQA 3KBHE 3RWFB 5DUML 3O2VH 5EBLB 3KWWB 4E41A 1QRNB 1QTPA 2W8CA 4WNQB 4XCYA 4UB0H 4UM9B 5TPWH 4ELKA 1AHWB 3QRGL 3TCXA 1RK0B 4L2LA 1VFAA 2OR8A 1UUNA 4IS6B 3QQNA 1BD2D 3UJJH 5K9OA 1A1NB 3VI3B 1KMGA 3EXJA 2B39A 5AL0A 1MJ7L 4WHYG 4M1GH 4ABVA 1A7BA 2BLFA 1DVSA 2QLVB 4L18A 5EOTA 2FAUA 1D7CA 1G6RB 2JV6A 1U2CA 2ZXDA 2HFFB 5GRJL 4W9LC 5E1QA 4X6CB 4QT5B 2WZPA 5C92A 1O9ZA 4EDWL 1AZBA 5I1LB 1IL1B 3GHEH 4PBWD 3QDGB 4F27A 1NCAH 3UXFA 1R9FA 1RK1A 2A6IB 3ZT6A 2E59A 2XXMB 2GI7A 3W9EB 4PJ8C 1GIGH 4HLZG 4ZTPL 1NH6A 4RFOL 3VFOA 1JWUA 3UBXA 5HI3C 4KK9C 1IGTB 1R3HB 2H7WA 4LP8A 5HTSA 3HPJA 3L45A 1TQBC 3R0MA 2PWGA 1ONQA 1COBA 1OT2A 1QR4A 2Z6FA 4HKBA 1AQKL 2GFBA 4M6NH 5DLLA 5BS0E 3U0WL 3QYNA 1E9OA 3P9MA 1KCUL 3OKMB 4AK2A 1OW0A 1E8ZA 1KEMH 4YVUA 3CXDH 5TH2B 3SJVB 2Z3FA 2VXSH 4ABUA 2VXTH 5BNXD 1GZPB 2YUWA 4X98B 2VC2B 2VH5L 3CH1A 5INCA 5C07D 4ONGH 1C7SA 1KELL 5AUMB 3LRKA 5AL8A 4WI4A 5DURB 2ZOLA 3S36L 3LKQA 3MJGX 3AQXA 5J1TC 2IXQB 3Q05A 4KTDH 4OZIA 3GMMB 4GP5B 4UTBL 2GJZA 2A6KA 3RVXC 4W9DC 3IU4L 4WI0B 1EFXB 3HI6H 3NFPB 1G0DA 5D1XA 3GI9L 3CPLB 1E50A 2R29L 1ZGLA 3N06B 4HWZA 5C6PB 4GSRA 3QWRD 4N0UE 1CTOA 2NDGA 3CFBB 4WJ5B 4KVNH 3C8DA 4GLRH 1NUFA 4G7YH 1F0LA 4DP7X 3RP1A 1X4XA 3TBVB 2YPKA 3HOGA 3QR0A 3I6GB 2ZOTA 1MFNA 1F11A 3REVA 4GUPA 1ODAA 3KLDA 4XP6L 3ZHKA 4JO5A 1JBJA 4UQCA 2Y7QA 1UWGH 4L3ED 2ZPKH 3UO1L 2ARWA 4NQCB 4DWHA 2A4EA 4FQQB 1JPGB 5DCCA 3WJLC 5DQJB 3WXWH 1DO5A 1SJEA 1EJ6A 1AZVA 1OCWH 2VXQL 4NHCL 3ZIYA 1YJDH 1JZ2A 3IS1X 3FB7B 2VDRB 4N5EC 1AIFA 1KPVA 2DI8A 3GM8A 4M61A 2J73A 3FF7A 2A0LD 3AU1B 5JXAL 3ULVF 3RLSA 2ILLA 2ICWJ 1LO5B 4AM0Q 2W07B 4H26A 3PXJA 1CZ8L 5IZ7A 1INEL 1ZT1B 3MJ7A 4JREC 1QQDB 2PNDA 2JIXB 1IIKA 1X7QA 5K9KA 2H8PA 1T2QL 4LLWB 3FQRB 2J12B 5KBNC 1NFDB 3D18B 3B1UA 3HRZC 4PJFB 1JF1A 3G04A 4RNRA 1JI1A 1ANUA 4TNFA 4P23C 4LKXB 3F58L 3K80A 4ENED 4Q9RH 5DJ0B 1B9ZA 3SDCA 2CO6A 4JPVL 3K2MC 4MA8L 2WBJB 4GUQA 1IKOP 4BH8A 4N86A 4DGWC 4POZD 3O2DH 1K6QH 2XZQL 4Y7MA 5IT2L 2QPFA 1IGJA 3AQYA 4FNLH 5DK0B 1JUFB 4N0YH 5E0QA 4OLVL 1CFTA 1OEZW 1BVNT 1WGOA 4WENB 5F7EH 1KB5L 4PVMA 1DFBL 1RUMH 3QI9C 5JHDE 1O0VA 5FA3B 3NZHH 3I74A 1IGIL 3EDFA 1XGQA 1FNFA 3T3PF 3FXIC 1FL5B 1WFNA 3HE7C 1JRHH 1B90A 2JLLA 2OCJA 1DQTA 3OL2A 5EU5B 1J1XL 2JJTC 3ZTNL 3B3IB 3VW3H 3SDXA 5C71A 2ZOUA 1M7DA 5CINL 1LJMA 1I8UA 1RZGB 4JFEA 3L3DA 5EBMB 3WN5C 4ODXB 1XH0A 5I18H 3MA7A 3UCQA 3M7OA 1IAKA 5IQ7L 3FU9A 3M8OL 1IILE 4PJ8B 4TLSA 3KLKA 4PBVC 1BBDL 3TFKC 2ZCLL 3H4FA 2B4CC 4G9DA 4YNYB 1A3RL 5EF0A 1MW3A 2NX5D 4GAJH 4JPIB 1KNOA 4BHUA 3APFA 3M46A 3S3SA 3HKZA 4UQIM 3BI9X 4XVUD 1HZHL 2Z91A 4PIBA 4Y9EA 3B43A 5ALCH 4O5LH 5CLTA 3UPCA 3AXLA 4NBXB 4QTFA 4UQBA 3L3HB 4R84A 3ZMRA 3EGXB 3IFPB 2ZXGA 3BWAB 3SDAC 5TQ2L 1YC7A 4LAJH 4RWYH 3BEWA 3VH8G 2O72A 3CLEL 3OTTA 5HYSA 3G6JF 3IJSB 4AIEA 4CVZA 1A4KB 2G9KA 2ZNWA 4H8UA 4L2YA 1DCLA 1D2PA 4NPYA 2OYPA 3MRGA 4KVCL 5C0BE 2EINB 1DQDH 5DWUH 3DUUA 2Y07L 3JUZA 2BVOB 2XWBB 3QJVB 3SE8L 3FQ4A 5KS9B 3BZEA 1TZHA 2WYTA 4NZTL 2GIYA 3GXDA 1LO0H 4NNYA 3VXQA 4NZJA 4RZCB 4QHNA 3UEQA 1JHKL 2ALAA 2P43B 2P45B 2CBPA 1CK0H 3UG4A 4NP4H 1I7TA 3EYOB 4DO6A 4ZUTB 4ZYKA 4OF8A 5I1GL 4FI7A 4OTXH 1L5GA 1D9KD 3WFCH 4XCEA 1ZHKB 4P2OC 4I77H 2DL9A 4WUUB 3DJRA 5K9QG 2V3DA 1JV5B 2Q3XA 4B9ZA 2DQGH 4HIPA 4ZFZB 5IB4A 2FBRA 4U6TA 3A0OA 3TNNB 1KYOJ 4C47A 4HJ0C 3AREC 4K7PY 4A6YL 4DN4H 2V7NA 3GSWA 4NI6A 2NY0D 1U8IA 3BRGC 1U4EA 4HWEH 2FO8A 5G5DB 4OZIF 4TRPL 5E08H 4OZ4B 3FSWA 1EGJA 1IBHA 4ZQKA 1PLAA 2BJML 3FQNB 4FZ8H 3KCPB 1U8KB 1EANA 4X5QA 5D5MA 2X4OB 3MUZ1 4R5XA 1QA9A 3ZRFC 4MJ4A 4QJ5B 3QEGL 1TTGA 1E3ZA 1XIWC 2AXGA 5IB3B 3KPRB 2E0PA 1KOAA 3SZKC 2QMKA 5FCSH 3WEAA 4X4YB 5FB8A 2FH8A 5LQBL 5DJCB 5IVXE 3OKYA 4MNQE 2Y7NA 5EH1A 3E6HB 3AG1B 3M86A 4M48L 3GS0A 5MENB 5DZJA 3P4NA 1QSFE 2AJZA 2YD4A 3QI9B 4XT1C 4B3EA 3WUWB 3KGUA 5CLXA 3OJVC 2XTSA 2IALB 1LQSR 1QPPA 3O4LA 5H37G 3HE7B 3NA9L 1XF5B 3QDMD 4AT6B 4OI9A 4F15B 2OW6A 2Q8BL 4FJ6A 4XXCC 4QAMB 1JWSB 4EI0A 4GAGL 1E0OB 4UQ3B 3KGTA 4DT2A 4G80A 1EGJH 1BZ9A 4Y16A 3WN5B 2WQUA 4FI6A 1G9NH 1PD1A 3C75A 5DZNA 2ESVD 2G3NA 5DJAA 5T33H 3T3MF 2WWOA 4ODUB 2IEPA 1PLGH 5E8DL 4NZ8A 4ZMYA 1JZ7A 3CN4A 3DGGB 2L04A 5AW9B 4N87A 4AL8L 2OKMA 3N1PC 5C0EA 4YDIH 3WXVL 4OY9A 5ESQA 4BWTA 1SXNA 4AQAB 4QXTB 2WNXA 4AK1A 2XVGA 4UM8B 3C6LA 3GNML 2E7LA 5HDBE 1BZ7A 4CSSA 5C08B 2W9DL 2FJGB 3S3CB 1WFMA 4PJGA 3FUFA 4Q14A 2Y72A 3QHZL 1CFSB 4KXBA 2EH8H 2OSXA 1IM9D 1E2VA 3SDXF 1JCKA 2AZUA 4JB9H 3DMMC 3PPSA 4Z3FA 4L3CB 2EDKA 1CR9H 4C55A 3PCYA 4YWGL 3RY5A 3FC8A 2YC1A 4J6RH 3WL9B 5C1MB 4WF7A 3W11C 3RGBA 2RFXA 1TEFA 4NWTH 4I9WD 5F3FA 3PV6B 3DROB 4IBLT 3TJHC 3KWTA 5CP7B 1WG3A 1IBBA 3MRRA 2DYSB 1GCYA 2WXHA 3I50H 2C4FU 2BX5A 3QVAA 3S35H 2VLKB 1OP3H 1MRFH 5EC1B 1UXWB 2R2BA 2ZKYA 3EXLA 2CJSA 1UEMA 2IANA 4FA6A 4P2OB 3IN0A 1UJ3A 1ZTXH 5KSBF 3HAEH 1CD1B 2G5BB 4B97A 3GMRA 1KCSH 3L2LA 2HG0A 3BIAX 4K73A 5CHNB 4JFTA 2VXVL 5KTEH 4I13B 3P0VH 3AREB 5K93A 1RULH 1CIUA 3S88H 1W72B 5DLMH 5AD0B 2QQKH 2VWEE 3PWNB 4QHUB 2HX8A 4NUMA 3MQIA 3QPQD 2H32H 2YMXH 1RFDL 3WS6C 2P3YA 4JPKH 3CDCA 5E2VH 5T8IA 4UU9B 1NPNA 2XVBA 3LKOB 2APXA 1I85A 4EIUA 3MBEA 2V5MA 3IE4A 3G5ZA 4NFDA 1ZANL 2J6EL 5BQ7B 3MX0A 3IRCA 2VDKL 3MV7D 4LRIA 4Z23A 2VDPB 4NP9A 4FABH 3OJDA 1XIWB 4ELME 2YD8A 1HKLL 2ADIB 5D2LA 4MJIB 3EADA 2VL5B 1RUPL 4KMTH 2K6ZA 3UH8A 1K2DA 1NM4A 3QHFL 4PCYA 1MCPL 1UFUA 3LSOB 1DDTA 4KRMB 2F19H 4PRIB 3A6CL 4Z3IA 4ODVL 1P53A 5JTWA 1TVBB 4A2HA 1YMMB 1SDAB 3GZKA 3NDYE 5FKAA 1UQSA 4EI6B 4N20A 4S11A 5DD0L 2ETWA 3IBEA 4UQ2A 1DJZA 2R2HB 3C5ZC 4YIQB 2OCCB 3QIWD 1XGRA 2I60H 3FU3A 5T5NG 4BSJA 3RBGA 4J3VA 1Z1WA 4Z1PA 4ODHH 1E6OL 1JZJA 3QPXL 3N41F 5FHAH 3VX1A 5E6YA 1IGFH 2BVPB 4F2FA 1R0AL 3IDYC 1MVYA 3P73B 4F7KA 1FFRA 3OKLA 3IF1B 5AW1B 3NPZB 3OAYH 2R69A 3CFNA 3DIFA 1OK8A 1EV2E 1FV1B 2C3VB 3MV9E 5CJQL 1IMHC 2HRPH 1KYOK 4NENB 1NBVH 4R96A 1PZDA 3K71A 2CGRL 2EIEA 2ZUUA 4M4RB 4WUKH 5SX5H 5DJXA 5E8EA 1KENL 2XTJC 5E6IC 5JYLA 1BGXL 1F3RB 1NAML 1Z3GH 2D8KA 1OPOA 3UTZA 3TV3L 1OB0A 2Z1PA 5ETUA 4OCMC 1YYMH 1IBYA 3ARDC 4I0KA 5KBPA 1BOYA 4JO2H 3V8CA 4TTDC 3ARVA 3NJHA 2X0VA 1MRDH 3BDYH 3KE0A 4M3HA 1ZA3A 4U1KA 4ZXBA 3OKNB 4YXKL 4M1DL 5FKPB 3MU3A 2DM7A 1Y6KR 5ID0B 2H6PB 2VNCA 3DMMB 2PCYA 3OZLA 2F1BA 5EU3A 2GJ6B 2V7HB 4NGHL 2YBGA 1NDGA 1SN2A 4AOFA 3BVNB 3NIDF 3KPSD 2XPGA 4FTVE 5FO7A 3TEXA 3SYCA 2UZYA 5DEFA 2CHDA 3EOTH 1U30A 3BRFA 5EZJB 1SEQH 2QTVA 3BAIA 2VAJA 4N8VG 4JFOB 5FF6B 1JL8A 3N1FC 3WFHA 3GTVA 4PJCA 1IC7L 4KK6C 4O58H 3IGLA 1KTRL 3RPIB 3SBWA 3FQWA 5ISZD 5DHYB 1T1XB 3NSFA 4Z3GA 4KO9A 3MJ6A 1AG6A 2HB0A 3UIZA 4GAYB 4JDEB 5SWZA 3D4YA 1HOCA 4XC3L 3RVVD 3TBCA 3V5HB 5I5RA 4GW5B 4I9XA 1K4CA 1BQ5A 2YRBA 1WUZA 4IHOA 3IJ7A 2O93L 4PJDB 1ZRUA 4PJGF 5CEYA 2J56A 2Y9RT 3IVKB 3WI9A 4P4RA 5E2JA 5C6WH 1Y6NR 3MCLH 1AKJA 3NACL 4PTUA 4AH2B 3SPHA 5JA8B 4XP1H 5IHHA 4IIZA 4Y0GA 3PHSA 3ZDYF 1M2VA 2OTUB 4XAWL 3WE6B 5T3XD 4NRXA 1EHAA 4PM1A 4CADB 4O51A 2WQXA 1RZKH 2KZKA 4BFNA 4JBSA 5JW5B 5JHBA 3C5XA 43CAA 1HSAB 1J12A 3H9SA 1JSYA 1HZKA 3G5YB 1AZZC 4QJ3B 4M9PA 4Y9GA 4BUHA 2ZF9A 2P5WA 1CGYA 1QTSA 4Z0BH 4XNZB 1Z0MA 5AKVA 3VXTA 1T03H 1WSST 2CLRA 2IPUK 2ALWA 3WDJA 4Z7OE 1WE5A 4PJ7B 5J1AB 2E3VA 2V37A 1SVCP 3JZ7A 3MXVL 4IKNA 4CC4C 3MYJB 1IRAY 4W4OA 4PRHA 1TTFA 4AIZB 3P77A 4L4TB 2AQ2A 3QIUA 1FGNH 3B6SB 4NXSA 4JQXC 3IXTB 1IBZA 3E80A 5F9OH 3B8SA 3IMUA 4HWBA 1F18A 3C5ZB 1NJ9B 3JTTA 1BFTA 5I16A 1RUAL 2AQSA 2W88A 4L8DA 2CIKA 3KLQA 2DN7A 1A9BA 2BW5A 3MCG1 5HDWA 2MQ0A 1FLRL 1TVHB 2PF6A 4Q7DA 3KYMA 4ZODA 3RI5F 4UUJB 4D9LH 2AC0A 2GSMB 5KAQF 1PLBA 3IDYB 1IBGL 1AY1H 1FZMB 1AIZA 2DYRB 2J8UB 3LN4A 2OV0A 4GYBA 4HV8B 5D5ME 3NCEB 4KH2A 5D2LF 2A2QT 4L5FL 4JFYB 5D71H 4AV4A 4IJ3C 1JHTB 2XXCB 3OAUH 3TEUA 3VXRA 4H2CA 1EHLL 3DJSA 2DJSA 3AY2A 5D7JA 2XV0A 1UH2A 1BLNA 2VSDA 1F45A 4LESA 4Z76A 2WN3A 2XTJB 5E6IB 3STLB 1HAUA 2E8ZA 3O8XB 1ZSDA 2J20A 1L7TH 1PL3A 3GXTA 2CIIA 2DICA 2P80D 5I1KL 3T4AA 2BERA 3ARDB 2VGLM 4ZSOB 3TURA 4KOCA 3IPEA 3HBPA 3MNVB 4LLUB 3ZZSA 4E9LA 2EYRA 4HWBH 5ESVB 1QLRA 4R90L 3O4LE 4PGCB 3B9KC 2X4QB 1W8NA 4IMLA 1RLBA 2WZAA 2XV6B 4WTXA 3U7WL 1AI1H 2W1NA 1BP3B 3DVFA 4LSUH 4OB5L 5LLIC 1CXEA 2A5UA 1GA2A 1S9VB 2CRYA 1MHCA 3DHMA 4KKAC 4WTZG 5EO1B 1KYDA 2JJWA 4OCSH 3ELAT 3N43B 5HHOA 1F86A 5J56B 3CDZB 1U3ZA 3VNZA 5C9JB 2LU4A 1ETZA 3POCA 5D2NB 1AR1D 4FQLH 1IEHA 4F58L 4MDJA 3BCFA 4YQXL 5IMOB 1MG3C 3ARUA 2DWSA 3FUHA 3MJ8B 4YPGA 4R97C 1SXCA 2I9TA 2L4OA 1GJWA 4UINL 3BW9A 2Y36L 3HMWH 4P5TA 3H2WA 2FECL 1QASA 2IBZY 3DX6A 4QRAA 1DR9A 1ZTXE 3S3BB 4OGZA 5BZWA 3SYOA 4OD3H 2X09A 1E9PA 5JIDA 3ZE1B 2ZJSH 1NGQH 3WFBL 2OMUB 4LCUB 1Z0NA 2M2DA 1NMAH 2C9PA 3QJXA 1IFHH 3RX9A 4OJFL 3WIAA 3N9GH 4NBZB 2ADYA 1ZVSB 5IROA 5BVJB 2KYIA 2JELH 1F8TH 2NUPB 5TFSL 1Z6JT 1M2OA 4JFQB 3N44F 3CXFA 3IWVA 1MJUH 4GG8B 4HXAH 3HZVA 2CHXA 4PJCF 3VWKD 1T04B 4ONHA 1EZVX 4PGZA 1TTUA 1SMAA 4YFLF 2NNAB 2VIRB 3AUVA 4PJ5E 1JNLL 1YMHA 4V33A 5J9PB 1LEKB 3ULUF 3NG5A 3B2VH 4PS4H 1LEGB 5DD1L 4HVBA 3CCHA 3ZDZB 2YXVA 1FFQA 4AMXA 3PQYE 1XB8A 3PP3H 2LTQC 1QHPA 2ED9A 4L4VA 2OK0L 1MCRA 1ZA6A 4Z7AA 3T0EA 3D33A 2UXVA 1MCWW 4S1SH 2EO7A 5K9JH 2CDGB 4W9IC 2WXOA 2C9AA 2ENQA 4OD1L 1GR7A 4GQPH 2D7TL 4J39A 2BSEA 2MH4A 5EU7E 3RGVA 5JMRA 5C0FA 4G2AA 3V4PA 2J43A 3D3VA 3DO7B 3S3DB 3BJLA 3B5TA 3KJ6L 3T77A 5HVWA 1PNCA 1AFVH 4X5XA 5FM5M 3TASA 4UM9D 2NY4B 4W9HC 2YK1L 4GIOA 4DW2L 2R9HD 2YARA 1EX0A 2AF2A 1EK3A 4I0PD 2N01B 4X9IA 4IRSC 2C9VA 1CLOH 2AQTA 1NGYB 2BP0A 1KJ2B 4YGVA 5B22A 3TESA 3NSCA 5C0DA 4L8CA 3DTXB 1TTAA 1B0RA 2WLNA 5HHNA 3QULA 4L9LC 2IQ9L 4IJ3B 1WICA 5CN3A 3BFOA 4MASA 1CL7I 1AS8A 5CCKH 1ITCA 3CC1A 4MB4A 3V0AC 3QDGD 4CMHC 3B2MA 4KI5E 4OLXH 4ZMLA 4GSDL 5E8OA 2CLZB 4NJ9L 1X7SA 4R8WH 3APNA 4WTQA 1J0YA 2JQAA 3DOSB 4D3CH 1JYWA 3W38A 3HS0C 3IDNA 4YEEA 3LS5H 3O2WH 3X12B 4PV8A 3DWTA 5BS0B 3R1GH 3GF8A 4KDTC 3WAJA 3RWCB 1ZV2A 1D6EA 4K3EH 1NDTA 4LLMB 5C3LD 5CUSL 1MCOL 4B96A 5TTRA 3GQFA 4F8NA 5IWLA 3OAZH 1KGCE 4HCRL 4XNMB 3VACA 3EJUA 4B9KC 1HHIA 2C34A 5ADOL 3SJVD 1AQ8A 2AJUL 3H8NA 5D7KD 2FJHB 4ANVA 3O6KH 2CLVB 2A9CA 4P4KC 4CNIB 3Q8AA 3TC9A 2N59A 3OG6B 1JTTA 4NN7B 5DURD 3S96A 4LXFA 3I6LE 4R97B 1H3PH 4GRWH 1BQLH 4HMDA 4OGQC 4P3WA 4XX1E 5AW2B 4I88A 4PJXA 5FO9A 5JR1L 3J7HA 4N0UB 1EFXD 4X9HA 3L5XL 1FC2D 4UOJA 3WSQL 2RMNA 4JZJC 5CIPB 5CZVL 4PGBA 1ORQB 4JQVC 3FAXA 2FEEL 4AQ1A 3RTQA 2O6PA 5T1KB 4L0ZA 4BQ6A 4EF3A 1IQWL 2WAHA 1B2WL 2DQ6A 2YGPA 2L3BA 2UZIH 5HVFB 3PWJB 2OBGA 3G6AB 4NQCD 1OSZB 1C1EL 5GS1A 1QR1B 1A4JB 1NCWH 3PDOB 3X11B 1S9YB 5C6TL 1D5RA 2DRUA 1ACYH 3GDBA 2HVJB 3MACH 3QORC 1CDCA 2DQTL 3OLGA 4P9HL 1QWNA 4N9GB 2RBLA 3RWHA 3ALPA 4XI5D 8CGTA 2Y5QA 2JIXD 4Y1TA 4TSAH 4AW7A 3HNTL 1LO4L 1Y0LB 4WFEE 2HA1A 2LTQB 2PR9A 2E86A 1NKRA 3KDMB 4PJ9C 3DURA 1ZKAA 4RAUA 2WD0A 2A77H 2WXJA 3REWB 4AYEC 1GGUA 2AI0H 3GTNA 4LLDB 3QUXB 1LK3H 1D5MA 1RZ8A 5E03A 4RCAA 4G7VL 4B9YA 3VGAC 1T21B 3CN2A 2WBJD 4P07A 4UT9L 1CDHA 1CPUA 3Q8CA 2J72A 1KWKA 3Q6FB 4U1NA 2E9JA 4MD4B 5HHVH 2TRYA 1E27A 4KH9A 1DBBL 5JHDB 3GSQA 4JKMA 3GC3A 3CFEA 1QO3A 2L7EA 2OI9B 1CVSC 5DF0A 5IQNA 5I2IB 4G11A 1JF6A 3DDGA 3MRFA 4IRSB 1WPCA 5T1LB 3OJ2C 2HVBA 3H9SE 4DQAA 1VF5C 4S10A 4EZJA 3L1EA 4L9LB 4D9QE 1TSHA 1IC5H 4K4KA 4NQSA 1KGUA 4FLQA 1ZHLA 4RX4A 3AXIA 2N1TE 3JWOH 3DETC 4U7KA 2CM5A 5EUKA 1HEZA 1QLEB 2BCKA 4CMHB 5EZIH 3OC5A 1CD9B 3TWCH 4YSUA 4R4ND 3VFTB 3DHUA 5FDWA 1PKOA 2DQJH 4PJ8D 4FEIA 1AJ7L 4WGVB 4X4MA 1A8ZA 3ZDXF 1P7HL 4OQTL 2OXHB 3HS0B 4KK9D 5HI3D 2DEYX 4N8CH 4WNJA 3PGDA 5EIIB 3AS0A 4A39A 3NAAH 4ZUSA 3HHSA 4MQTB 2IDUA 3QYCA 3AU0A 2F7OA 2IPUG 4HHWA 4PUBL 4R7VA 4QHMB 5LN4A 5E9DE 3SDDA 3SN6N 1A6ZB 3GIZL 3HHMA 2A1WH 4IBWA 2L7JA 4DPRA 2J25A 4C56A 1PY0A 3U46A 3BMVA 3LHPH 3OR7A 4P06A 4X99A 4HUVA 3A4EA 5KVEH 2BOCB 4B3VA 4P4KB 1TETH 2JTYA 5I73C 3EOBA 2OL3L 3UTSD 1Q9WA 4P57B 5FIEA 4TL5A 4BQ9A 4N2DA 4P04A 4TUUA 2D0GA 1ZHNA 1S7RB 4QD2E 5DMGD 1LE5A 2MHAB 3D0LA 4IK6A 3RVXD 4WW2A 4HCFA 4J2QA 4JUTA 4R26H 4J3OG 4BIKA 2QPEB 5FOJA 4JZJB 4YUEH 8FABB 5DJ6B 2F08A 2C3HA 1IUZA 2XYBA 1LO3L 1R24B 5EWIL 1J88A 3LHAA 7FABL 3U2SA 4F93B 3EJPA 3IU3A 3O6ML 2AXFB 3MRJB 3Q1EA 1M7UA 4DSYA 4WUUD 1YJDC 3VQ2C 5T1MA 1PEZA 1XCXA 5I5IA 3IDMB 2PTVA 2B16A 5AOIA 3SKJL 5JNYA 2VWEC 3FSOA 2J4WH 4ADGA 4YSOA 2PPCA 1N0XL 2AJ3B 3GSXA 4GEIA 2NT0A 2IWEA 4N5ED 3LRHA 2X1WL 1M05A 2R1WA 3O11A 3BP5B 4XGZB 4PJXF 3H54A 3ZU8A 1JK8B 2PCXA 3ASNB 1UA6H 3OQRA 5GGVH 2FYYA 2G3ZA 2HUEA 3KH3A 5HHXH 4K7PX 1Q0EA 3CVIH 1MHHB 2MNWA 5B39B 1TO4A 2R23B 4PJ9B 4O9HL 4PR5B 1NWOA 3UJTH 4J2XA 1MLCA 3OKDA 5CP3A 5LCVL 3W2DL 5DJYB 2DV6A 4S1QL 4XXDA 2HAZA 1TZGH 4P05A 4I2XA 1HINH 3BSZL 5IVXB 5ALBL 5HI4D 3VGAB 4MNQB 3NABH 5JZ7C 3LEYH 5M95B 1Q9LB 4Z7QE 4H44C 5I76B 4JQIA 4XMPL 2EJ1A 1QSFB 2K6YA 2NT1A 3QUML 4OCNC 3QPKA 2Z35A 2VSCA 4LGSB 5I6KA 3FPXA 2QFRA 3QI9D 4YGAB 3UP6A 1TKWB 5J89A 2VN6A 4JO3H 3ZE0F 3CZJA 2ZKHL 3RNQB 3VXUE 2WB7A 3HE7D 2X6AA 2EDLA 2OR9H 3F7YB 1QLFA 4R4BB 5DDHB 3UTQA 4WKZA 1NFAA 3EFOA 5F6HJ 5FYLL 5L2JA 4MJJA 5DUMH 4E36A 4H1LG 4HH9A 4WVRA 1MJ8L 5IKCB 3WNJA 1WBYB 3EYFB 1EERB 4GKLA 1J5IA 2ENPA 3WKQA 2Y69B 1QUNB 3QRGH 4U6YA 1IGML 4Q9QL 5CF3A 1S7UB 1ASOA 2YRPA 1CF1A 3LTVA 3S4SB 3MLTB 2GHWB 3BSGA 3SDCC 3T0EE 3ZVVA 4WFGE 5EUOA 3RFRA 4FKEA 3IJEA 5CP3H 3K2UL 5MEQB 1W0VB 1EPFA 1AZNA 1HESA 1MJ7H 5AKRA 3EGSA 3QFDB 4E41B 2VZTA 5GZOC 2Y24A 4BFGA 3IJYB 3CDGB 4ATWA 3BGFC 2FATL 3A67L 1ASQA 3TFKD 4B9GA 3PXLA 2NXZC 1VFAB 1NMCC 2Y2WA 2CUAA 4WLCA 5HDBB 3EBHA 4N0RA 5K9OB 2ICEC 4EDWH 4WIQA 3VFGL 2PETA 3K8KA 4GOSA 2W80C 4X7CC 5IBTL 3QZBA 4HWNA 3FB5A 4XNYL 5DJ2A 5C08D 1AOZA 4N90D 3OV6A 1ECYA 3SYPA 1H6FA 1PCXA 1MJJB 1HCZA 1KGIA 4ZTPH 5EOCL 2MSPA 4RFOH 5E7BA 2X9WA 4FLRA 1BA9A 1UD4A 3BZ4A 2YOCA 4ZOAA 3UPAA 3U0PB 5I73B 1EEUA 5F3HA 3U0TB 5I6MA 3FSZA 4WO4A 1YNTB 2W0PA 2JNZA 4WWNA 3OKOB 4QO1A 2C1OA 2O61A 5F9AC 3BO8A 1D6VL 3U0WH 4FFWC 1S7XB 3NCYP 5GGUA 3VFOB 1KCUH 3ZZQA 2D7NA 1PF3A 3UBXB 2CCLA 3HPJB 1QFWM 4LGRB 1BDYA 5D55A 5EEYA 4TPRL 2VLKD 1ONQB 5ICXA 4DVBA 5E1AB 1IAMA 2VH5H 2EXSA 1I75A 4HKBB 1TPXC 1V7ML 4IKKA 1LL1A 1QW9A 3S8FB 1BG9A 1KELH 1R3IL 2OMXB 4JE0A 3P9MB 2IBGA 4S0HA 3S36H 1V7NL 4P2OD 4A1RA 4IBZA 2IAMA 1ZT7B 2EO1A 1C5CL 1GAFL 2X38A 4AYFA 3MGOA 2R0LL 3IU4H 3HPLB 1OM9A 4BZ2A 3GI9H 2YAHA 2YUXA 4Y2OB 4LSDA 5KBMA 2R29H 4HJ0D 2DLIA 3ARED 4JS7A 1KJ3L 1Q72L 1IC1A 3D5OF 1CMOA 3ULSA 4KXZH 4OCRH 4JKPL 3ZR6A 4QXUL 3EDKA 5CBEB 4C4KO 2GJZB 5AYQA 4WW2F 2VDNH 1BOGA 1AE6L 3NRPA 3C6SB 5D1XB 4XP6H 3VSVA 4F7CA 3AJ7A 3O81A 3UO1H 4ELMB 5BO0D 4OFYD 1KWGA 5GRVL 3E8UH 1S7VA 1B4LA 3B9EA 4F5CE 1XWVA 2ODHA 2VXQH 4PJEA 1XIWD 3P1VA 1RZJC 2WN2A 4H8VA 2YPKB 1YZZA 2B59A 5DVLA 3REVB 5JXAH 3PV7A 3RJDA 5KVGL 1TQSA 4RSYA 1YYCA 2YUZA 1CZ8H 5IBUG 1INEH 4E9RA 1MAML 5EF1A 3VU1A 5EC2B 3AAZA 5C9KA 4X6DA 4K7PL 3L3GA 1T2QH 5C0ND 5JORB 3VRIA 1YMMD 1J5DA 1AGCA 4WNSA 1SVBA 1AIFB 1TFHA 4B9JA 4M61B 4RGNE 5BZDA 3D52A 2FR4A 2Y25A 2ZAIA 2BMKB 5L4JA 3FU7A 5GHWL 1RZ7H 3F58H 4JFUA 3WCYA 1JZFA 4MQXD 2IOIA 3ZKMC 1QVOA 4JPVH 4MA8H 4HX1A 1EAPA 1F97A 1X7QB 2VJXA 4IGBC 5B1JC 1DJWA 1TCMA 1CFQB 2R15A 4JY4A 3MRIB 1BQHA 2ZT9C 5IT2H 5DT1L 3EO1A 5ICZA 2XQYA 4RNRB 5L7XH 3NDZE 2ZIDA 3MV9B 4OLVH 1IGYB 1NCHA 5E9NA 5GS0D 4DGYL 3MRLB 1KB5H 3SDCB 1DFBH 3CN3A 4F7MA 1XR8A 4Y4FC 2D7QA 3ES6A 4BH8B 1IGIH 4KJPC 1DJGA 1L4IA 3BGMA 4UDUA 1ZHBA 4BSVA 4U6VL 4A2DA 1NOAA 5HI5D 3VWJC 1J1XH 3FRUA 2NXZB 2EEDA 2EDQA 3ZTNH 1RU9L 1BXUA 1ROWA 2B8OT 2UV3A 3HG5A 2ICEB 3LH8A 3BUDA 4NQED 4XVSL 4U1LB 3Q2LA 4NZRL 5D4HA 1XGQB 1OP3K 3F7LA 4DP6X 5J4MA 2HT3D 3PIQA 3QUYA 2DYPB 3CGTA 4MQ7A 2XKUA 5IQ7H 4FNTA 4C58B 3M8OH 2XWZA 1AVAA 5KVEE 3K74B 3HG3A 5CSGA 1WWCA 1Z32X 3HE6C 2C1PB 4PFEA 3UAJC 1MVFA 4FTVB 2WXNA 2KZBA 4M4PA 3BVUA 1SM3L 2AJXL 5F7BA 1XQ4A 2GJ6D 1A3RH 2HJFB 2IQAB 3MA7B 1AS7A 1BEYL 2YWYA 5F6IC 5MERB 2X4NA 3TOPA 2X44D 5EUOF 1IAKB 1KGXA 1HZHH 3W11D 3VXMA 3K46A 2WGXA 3TJHD 2DTML 4F7TB 1CB4A 4A6YA 4KMQA 1NOLA 2B1OA 3ECBA 5AW5B 5TQ2H 1EA9C 3TBYA 3VFVB 4X4ME 3MBWB 2DEXX 4YFEA 5F3BA 3VD1A 1GGBL 3C6LC 4XAKD 4XMZA 4ZX4A 1SDDA 5BXFB 2Z91B 3D2UA 1QG3A 2XN9A 3WEXB 1UFGA 4KVCH 2O4EA 5C0IA 2Y07H 5GRXG 3SE8H 4TOYH 3FUMA 5C0AE 3FTUA 4NZTH 3TF7C 1QNIA 3QISA 4FYQA 1UM6L 5HYSB 2P7TB 5EU6A 4C56E 1JHKH 1XH1A 1U3HA 2YPVL 3CFTA 5D9SB 1KCBA 5I1GH 4U3SA 4UAHA 5L88L 1TZHB 2GK0B 2X87A 3KLAA 4LIQL 4NNYB 3P9LA 3QWQB 3VXQB 2DS4A 4NN6C 1WAEA 2XJLA 3U4BL 1JGVH 1T1ZA 4QHNB 1LTXA 5E7FA 2DL2A 1U93A 4NKMA 1CLYH 1AXSA 1B0GB 3I9GL 4A6YH 3ILQC 3QWOB 3T2NL 3HG0A 4X80H 1AS6A 4FOMA 2W60B 5IHZA 2EKJA 1MCNA 1NIBA 1OGAE 4TRPH 2IDCA 4ZAKA 5EU7C 5IB4B 1YAIA 3FNKA 4L4TD 5DD3L 1I9JH 2BJMH 5C09A 4JZNA 4PGJA 1HJBC 4KO7A 3VTTA 4N2GA 2NNCA 2YPLE 1N2RB 3A24A 2R0KL 4G8EA 4OLUL 5I66A 1BX2A 3C5ZD 5DEZA 3O0RL 5JHAA 2P24A 2B2XL 5BRPA 4KO5A 4NFBA 2WOYA 4IGBB 1QUPA 3DSFL 2VM9A 5LQBH 3KBPA 1DYZA 1CQYA 3MBEC 5D5MB 5GPRA 2V33A 1QA9B 4ETQA 2OSWA 1DJHA 4PJEF 1QSVA 2AXGB 1K3ZA 4M48H 4Z7VE 2C4XA 3EFFA 3L1OL 3MA9L 2E9WA 1F6AA 1RJLA 1UWFA 3AUWB 3WNPA 1IFGA 3SEPA 4KHXH 5IMMA 4PB0L 5D1ZC 3STZB 1OVZA 4I2XE 1DVXA 1TDQA 2EVFA 5J11C 3NA9H 2Y6TE 4KI5C 1P7BA 4W9CC 5IJVA 2Q8BH 3VWJB 3SY0B 2GCYB 4ZMWA 1E2WA 1N64H 4PJHE 5D8JL 5LWYL 2FX8L 2YAEA 3NA4A 5F2FA 3HB3C 3O8XD 3ZN6A 4PJIE 2CBMA 3QNYA 1KDIA 4XN2A 3ARDD 3V5DA 1A22B 4J3SA 5L8LB 3O4LB 4TTDD 3KR3L 1MAKA 1PZ2A 5CEZD 2ZSWB 5E8DH 1ZLWH 2XY2A 5IUCA 1E5YA 4AL8H 3GIVB 4JRXA 4R0LC 3NCJL 2G0LA 1CO1A 2VRQA 4PI2A 3WXVH 2LV4A 1GJIA 1ZJAA 3KL5A 5IEHA 5F6IB 2LLGA 3CSBA 1DQJA 1J8RA 2WCPA 2W9EL 5GGTA 3PL6A 3QZWB 5FAAA 1NMBL 4DZ8A 2X40A 3WDHA 4ES8A 4JFPB 1G4MA 5HJBA 1BJ1H 1BMZA 2W9DH 2X89D 5FYKD 3F7KA 4KK6D 1MQKL 4LQFL 4PVLA 4K23L 1QW8A 3QHZH 5ESQB 2Y4SA 4F8OA 4YHYC 4URKA 2XZAL 3FCTA 1KCLA 4FYTA 3C6LB 2QGEA 3HAEB 2NTFA 3N1QC 1RMFL 2F58L 2EEXA 4IM8A 3PWUA 3BPNC 3CH8A 1UXSB 1T83C 1KG0A 3LZFL 5HGDA 4YHNA 5J6SA 2K45A 5DWPA 4D0CB 2J6EA 4KMLB 4A63A 1XZWA 2P42B 5L9DL 3CSTA 3ERXA 2WVTA 2DMGA 4P5RA 2H32B 3UTTA 4A38A 3RDTD 2IBZX 5BW7A 2ICES 1PZCA 3ZMEA 2YC1B 1QRKA 4ZUVA 5BZZA 2VL4A 4IKIA 1HC1A 4PJAA 2RFXB 4FA7B 2IH1B 4PJ5B 2O1AA 3HR5A 5I15L 1FG9C 3MRRB 3NIFF 5DS1A 1G84A 4GLRI 4M29A 4PS8A 4HAFA 2VXVH 2R2BB 3PQYB 2QKIA 1WF5A 2GAZA 3MCKA 4ELDA 4BRJA 4GO8A 4AGLA 5A2IH 2LFEA 4ORGA 4AV5A 4D0DA 1G7PB 4PRBA 5J3HC 4Q2ZB 3KEHA 1BHGA 2VXUL 4V2CB 4ZW5A 2WJ7A 2F61A 1RFDH 3GMRB 4FLHA 4AYBA 1LHZA 1DFXA 1KIPA 5C8JB 1LMKA 4H0LC 1ZANH 2J6EH 3FO2A 3SBQA 2VDKH 1DQIA 1O6SB 4BH7A 3N3EA 3QRLA 1HKLH 2NPLX 2NY4D 3QS3A 4WFHD 1JPFA 1RUPH 5H2BA 2ZONA 3R8QA 1LP9A 3ARBA 1MCPH 3QHFH 5HDLA 3MBEB 3G5ZB 3MUGA 2JKRM 1WEJL 4HJTA 3US9A 3V0JA 3A6CH 3MX0B 4KXAA 4ODVH 3OJDB 1JE6A 1I1YB 5DZOA 2OPCA 3GBLA 3WTWA 1R33A 3CZFB 2H2SC 1UACL 1N9PA 4ZFOA 5DD0H 5D1QA 2NR6C 1JZHA 2AK4A 5D1ZB 1K2DB 3MGAA 1OXYA 3BUTA 4QCIB 5J11B 5AVZB 2K6WA 3QIUC 2BSRB 4V1DA 3B7UX 2VQ4A 3QPXH 3MRHA 5T5FA 5FKAB 3G5VA 1R0AH 4X6DE 2GC4C 5IHUH 4ODTL 1SN0A 4UQ2B 5KYXA 3A4DA 2WP3O 4U33A 1JRHI 3AWFA 4UT6L 1XGRB 3QW9A 3O9WA 2VSKB 5HDQL 4ALAL 1JFQL 2FEJA 3IS0X 2YGOA 2YQGA 5DQ9A 2FLMA 5C2UB 5IEKB 2A6DA 5BS0D 5IW6A 2VLME 3CN0A 4GSQA 4I1PA 1BYOA 3DKHA 1E30A 2CGRH 2CBOA 4ODWA 3BH8A 5F89B 4HGWB 3SE9L 1KENH 2WXLA 3SQBA 4KKAD 1JGLL 2JKSA 5C0RL 1BGXH 3K6OA 4KUZL 4KV5E 1YNLL 1OAZL 3TV3H 5J8OA 1F3DJ 1U95A 4P2QA 3CHSA 2GSIB 5DZAA 5I5MA 3WNKA 4R4FL 5D7JC 1E8WA 2WVVB 5E8EB 4O02L 4YXKH 4M1DH 4UTCA 5D93C 3ZE2E 3V95A 2D4FA 2X4RA 4G8GA 4FMKA 4YHYB 3KPOB 5AZEL 3WELA 4WSGA 2XPYA 4MJ5A 5ETUB 3T0WA 1MVUB 4LVNC 4WHDA 3G08A 1NA8A 4NGHH 3BPNB 3LS4L 3BWUC 3FSVA 3GSUA 1ZA3B 4ZXBB 4O4YL 2FZ3B 5I28A 4LPCA 4C8XA 2Y22A 3PP3K 1IC7H 1NC4A 3TBWA 2XI9A 1V8HA 3QQ9C 5T1KD 2F53E 4YVNA 1WWWX 1OT4A 3QQ4A 1NDGB 2MCPL 1M6OA 3GZQA 2XPGB 4F37F 2UZYB 3BKML 5DEFB 5L0QB 4POUB 4NPKA 3OSVA 3AMKA 4XC3H 1O5DT 2FL5B 1ODUA 1T5WB 4EIZC 4PYHA 3F2LA 3ULAB 1AD9A 2W0FA 3GSVA 2EE2A 2DQIH 1JZ8A 1CG9B 3CX5J 4TV3A 1EH9A 3MO1B 3NACH 3VD7A 2OMTA 3GUFA 3L17A 3UZVA 3TU6A 4E5XA 3FOLA 2B9AA 4P5TC 3DJZA 3CK0L 2CMRL 1FSKC 4IHOB 5LG6A 4N0FA 4BK5C 3AITA 2FUTA 3FOMA 4MNHB 4K7FA 5CEYB 1BVOA 4WKXA 4CW1A 4PIRF 3EYVB 4Z7WE 4PTUB 3QUXD 1KBKA 3TFBA 2IH3A 1C08A 4QF1A 3DI2B 5K59E 2HPTA 1HKFA 1J9QA 2E4TA 5I6OA 4JW3A 3BUBA 3QEUA 3EYUL 5JYMA 1WAAF 2OP4L 2VQ1B 1XF2A 1AQDA 4OZGF 3VD3A 4PJAF 4DTGL 4O51B 4FD0A 4WI5A 1NCOA 3KYNB 3MXVH 1JTOA 1OZTG 1ET7A 1HL8A 1OAKL 4KROC 3H9SB 4FC3E 1AG0A 1WZAA 4IRSD 5K1JA 5DS8A 4KJWD 1DL7L 4B50A 5FUOL 4F8PA 2P5WB 4Z7OF 1KT2A 5T1LD 3D39A 4I8DA 5GZNA 4M56A 3UBFA 3UCRA 3ZDWA 1SXZA 3NFSL 5J57B 4JKNA 1Q94A 1D5IL 2KT6A 3B2UC 1GTNA 1WTLA 2OZ4L 3HUJA 2OMYB 1NLDL 2VM4A 3KYOA 3T0EC 5EDSA 2CG9X 1I4FB 1RUAH 1R6VA 1UC6A 1L6XA 5ESAA 4E42A 3Q2VA 4ZNEA 4GG6E 3QIUB 5LNDA 3UL4A 3L08A 4BZYA 4BFRA 3RGVC 2FGZA 1IBGH 1F13A 3QT2A 2VZ3A 3ZK0A 1BVKB 4U1MB 4DP0X 4EE2A 2EZ0C 4L5FH 3VXOA 1FZOB 2R4RH 4L8DB 2CIKB 3WY3A 5FECA 3WO3B 3JV4B 4N8PA 2Z8SA 4GKNA 4HS8L 5E9DB 1EHLH 3LVEA 5C7XL 1E9QB 1HYSD 3HS9A 3L3KB 3VDAA 1M3JA 4WY7L 4KOBA 1HI6A 5C07E 5C0GA 3VXRB 5I1KH 1O7VA 3PF2A 4DHLA 5KAQG 3AT8A 3VRLF 5D4QA 1UM4L 3D48R 4P4KD 5D7JB 4FQPA 4PJBF 3UIYA 1BLNB 4LSVL 4R90H 4UCFA 5D93B 3RPBA 4G6KL 4G1MB 4AEHL 1IAOA 3U7WH 3V7AE 2OMWA 5KZCB 4LVNB 5AWNL 2CIIB 5FK9A 1ZLDA 3RWDB 2H9GB 4LU5L 4AYMC 3BYTA 1CLVA 1BZOA 4PRDB 3L4ZA 1QLRB 4ILDA 3BUQA 4RMWA 1XR9A 5J12C 4XMUA 3TWYA 4WZ9A 1CUOA 2XBZA 4F58H 3WEOA 5GS2H 1NFIA 4I4WA 4YQXH 5EBWA 5AAMC 1AYRA 4JRXE 4JM2A 2Q6WA 5IQ9A 3U1QA 5JPMC 1MCHA 1Z2KA 3LAFA 5HHOB 4UINH 2Y36H 4M8QB 4K8RC 4NERA 2ZX9A 2QADC 3H42H 4HH8A 1BBJA 3RZCC 4AQ8C 1ETZB 2GW5A 3RU8L 2AV7A 4MDJB 4N24A 3JWNH 2ZXEB 4M5YL 3WFBH 4M7JL 1A47A 4DK5A 1KPRB 5IMKB 1CICA 3CLFL 5F88B 3UX9B 4OJFH 1SDYA 3TCLB 4P5TB 1N5AA 5CSZA 2AEPL 3DX6B 1FSKB 4DQOH 3KLHD 5TFSH 4AM0A 4YOKA 1G7HA 1S46A 1E7UA 3LIZL 4AVHA 4PJ9D 4JPQA 2AMGA 4OAWA 4OCWL 4TUOA 3MV8A 1SNRA 2XKSA 4GI8A 1PEWA 5HYJA 3EH2A 4Z7QB 3DX9A 2H47C 4NHUA 5CD3B 2QV4A 3ZSTA 3MUJA 4LSTL 5I0YA 1THCA 4PLJC 5DD1H 4AMKL 4IK7A 1QSFD 4RGNC 4NO3A 1OL0A 1LGVA 5I24A 3HZVB 1XF4A 3Q8FA 5FGBA 1I9RH 4ERSL 1HYRC 4GT0A 2OK0H 2VDMH 4Y4HA 2I24N 1JXGA 5AW6B 3U4KA 3V6OA 3MCYA 3H2PA 4OD1H 4ZMXA 4J7RA 2D7TH 3KYAA 1UZ8B 3X14B 2BNQA 1UZ6E 2KUTA 1HH6A 2XZCL 3O41B 4L4VB 3P2DA 1ZA6B 4LLVA 3T0EB 4QIRA 1VGEL 3GO1L 4BUQA 2R4SL 4JM4L 4DW2H 2CR6A 3IBOA 3DRQB 2HTLC 4HCRA 1NQBA 1JG9A 1QYGH 4KNTA 3RGVB 3DSNA 3FBKA 4CGTA 4MNGA 3D3VB 1IM3A 3PGCA 3QXUA 4E41D 5IHLB 3A21A 4X5XB 3RKDD 5IVNA 2IQ9H 3CX5K 3FL7A 4JMXA 3FTWA 3L81A 4RIRB 2RAMA 3RFZA 1CE6A 3QS2A 2E76C 2OM5A 5EEWA 2GSGB 4MS6A 4U2YA 2V2TA 3FT2A 5C0DB 1GRWA 2KERA 1LP9E 3K6IA 2I07A 1RL1A 2XG5A 5DC0A 2APTA 1CGSL 5HHNB 1YUHA 3I3BA 3EBIA 4NJ9H 1PGRB 1CWVA 3SQRA 1M7IA 4P3CL 1FIGL 1YN7A 4GRWB 2OZNA 2WZPD 3OMNB 4QHPA 5AOJA 5A7EA 2AK4E 5D1ZI 3TN0A 3U36B 1ZWIB 2BM3A 2W94A 1KACB 3H9ZA 5A1AA 5B4MC 5CJ5A 4KJQC 2XDHA 4UILL 3RY6A 2PTTA 1I8KA 5E8OB 3FO1B 4AKOA 1MUJB 5CUSH 1MCOH 1SOQA 3ESOA 2E9BA 2VR9A 3M1OA 4NKOA 4Y4KC 2QPSA 4NQXA 1X5AA 4HCRH 1DVFC 1V55B 3D8MA 4HZLA 1NGWB 1SY6A 3TONA 5ADOH 5MHSD 4DP1X 1T22A 3GRWA 4LASL 1LNUA 3C8HA 5IR1A 3RY4A 1CGTA 2Y1VA 3CXHK 4Y2DC 5DJZB 3CFIC 4I18A 1QACA 4HFWA 3S48A 2AANA 4YPJA 5JPMB 3VU2A 3MREA 1WIOA 3DYMA 2QGDA 1MCIA 2VISA 4X4ZA 2Q7YB 2QADB 2ZF8A 3L5XH