4Y16C

Crystal structure of the mcd1d/nc-agc/inktcr ternary complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Lipid and Carbohydrate Modifications of alpha-Galactosylceramide Differently Influence Mouse and Human Type I Natural Killer T Cell Activation.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 202
sequence length 203
ec nomenclature
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y16C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y16C02
5IB3B 2YXFA 1G7MA 3LKSA 3PWPE 4EUPG 3LH2H 2HVJB 4NZDA 1KIRB 1AO7A 4PB0L 1X44A 2OZ4L 3SBWC 5JORB 3DMMD 2UZIH 2IMNA 2D7PA 1B4JL 5ID1B 1CU4H 4YDIL 5SX5K 2PTTB 2VLRD 4QRTA 5EBLA 4LVNB 2J8UB 3CMOL 5JOPD 1XGQB 2DN7A 2VL4A 3ETBF 4P57A 4WO4B 3BQUB 4K9EC 4WI9A 2DMCA 3OR7B 2PCPA 4RFEA 3A6OA 5EIQA 3MCKA 3C6SB 3ZYZA 1OW0A 5FYLH 3DVFA 5IB1A 4ONGL 4HWZB 2X1PA 1AI1L 1HXMA 1FNHA 4R7DA 4MZ2A 3V0WL 3VRJA 4TQEL 5ILTL 5E5MB 1MFBH 4PJ9A 5BV7C 4YXLH 2VE6B 1JMZA 1S78C 3VFMB 3MA7B 4H1LB 1MVUB 2XA8H 2DD8H 1P69B 1U8JA 1HKFA 35C8L 4HIEA 2FRGP 3BP4A 4BJLA 3L6FB 1IAKB 4JZOA 2DI8A 4XVSL 2XN9D 5HGAB 2BRRH 3BGMA 4JFXB 3BDYH 4QYOB 2R1WA 5SWQB 1A6PA 1HZHL 5DVNA 4PGCB 3RL1B 1T89C 1MCOH 2FEDC 4K9EL 4W68A 5GSRA 2BNQB 4JO2L 3QJFB 2X4NA 1INEH 1DQTA 3TV3H 5DJDB 1KACB 3EYOA 4WFHE 3VD9A 3QRGH 3PJSB 5D2NE 3F5WB 1NEZA 5F1KC 2FWOB 3QFJA 3AGVA 2A2QT 3GBLA 3JBG7 1IFHH 2HP4A 5BV7L 3KPRB 4G6KL 1ZGLP 4GQ9L 3B43A 1S7WB 3I2CL 1YDPA 3P73B 1A6TB 2CKBA 3SN6N 2VLKB 5KN5A 3G5VA 4EUPH 2B2XH 5TE6H 3MV9D 4F7MA 4G6FD 4Q9QL 4FFVD 4JRWA 4FQXB 1BJ1J 1HI6B 1SYVB 4CN4A 4WV1B 4LLWA 1N3NB 3VCLB 5C71A 2CDFA 4P9MH 5DJYB 1JUFB 2DWDB 1MCBA 1RPQA 5JQ6H 2MCPL 1E6JL 3A0OA 4JKKA 5GS0C 1MI5B 1L0YA 5FYJH 1LK3L 4OZIE 4OZHE 3IFPB 1E4WH 5D7LE 4HIJA 3JWDC 3IXAA 3P2TA 5SWSD 2DL9A 3OAUL 5HHOE 1F6AB 5KSAA 2X4QB 3CVHL 2N7BA 3ARFB 1YPZE 1S7VA 5LXGH 3OKLA 3MRLA 3FQXA 3HUJB 3ZDZF 1L0QA 4XH2B 4OZGB 4WEMB 3HZVB 4GRWH 1J0ZA 3PWJB 4JVPA 4NM4L 5IWLC 4ZXBD 3WJJA 1JPTH 1NCWL 4Z76B 2BCKA 2BVOB 3FAWA 5F96L 3ILPB 5EU6D 1BLNB 3PDDA 5E1AA 4EDXB 15C8L 1RU9H 4YDVA 3DRTB 4UTBL 5GS0L 1RZ7L 2HRPL 1MCWM 2E9IA 1P5UA 2ZJSL 2K7QA 3JWDL 1U3HA 1XGTB 2R2BA 1YEIL 3UBXI 3T0AA 3EIFA 2X4TA 4KTDL 4AT6A 5J1SC 3Q3GB 4FQHA 3O45A 1U8NA 3E6HB 1YN7A 5DDHA 3MRBB 4QHUB 3ARDD 4I0CC 3OGOE 2DWEA 3RZCD 3LH2L 1A1MB 3UJJH 1PEWA 1CICB 2UZIL 1KJ2A 1CU4L 5DFWH 2C4FT 4YIQB 3KPPA 3DYOA 4Q9RH 2W07A 2ADIA 3EDDA 2OTPA 4KTEH 2DOCA 4QNPF 2K3TA 3A6CH 4Y1AB 4V2BA 1IEAB 2HTKD 3RY6A 5FOJA 3UTSA 1BJ8A 4L1DA 2GTZB 3IVKB 5FYLL 3HC4L 3FO9B 1NC4A 2HJFB 2QTEA 2PETA 1L0XA 2Z31A 4R2GD 5JOEA 2X44D 3U7YH 1OWWA 4P2RB 4OF7A 3VDAA 2AK4B 1MFBL 2DQFB 4BUHA 4YXLL 4U1NA 4ZFOL 1JGLH 2Z31C 1CDUA 1NCAH 2XA8L 2DD8L 3DBXA 3VJ6B 5FKAA 1QLFB 2XY2A 12E8H 4NQVA 2DQIH 4PRIA 4OI8A 4QXTA 3WHE0 3MV7E 1BQUA 3CC5B 5F1NB 2BRRL 2FJHB 3KYNB 3BDYL 4WFGD 4HWEH 5FFLA 4JFDE 4LL9A 2UYLA 2VDNH 2VQTA 4MDIA 3IDNB 4XHJD 4I18A 1MCOL 3OAZK 5BCAA 4OZFH 1ZLUK 3TV3L 1X6NA 3RNQB 3SJVB 5GRUH 1RUQH 3QRGL 4M5YH 4O4YH 3STLA 5F97E 4XNQA 4YLQT 3TZVD 1JBJA 3UZQA 1U8OA 4ELKB 4JM4H 1M1SA 4AY0A 3FB6A 1DP0A 2XIDA 5DRZB 5ANME 1N5YH 3T1FA 2X9YA 2YD1A 2J5LC 2VIRA 2F53A 4KROB 3QEUA 4H8WH 3OKDB 4GG8A 4I77H 4YHNA 3VXUD 2WZPD 1XZ0A 3N1FC 2VLRA 3EAKA 5DD0H 3IDJB 4Z7WF 5F7YC 1D5IL 4UDTA 2W60B 3ZDZE 1RUPH 4MD0A 1QSEE 4P9ML 3VGFA 1A2YA 4QGYA 4PJ8A 1B88A 3KLAB 4HD9A 2BDNH 4ZFZB 5JQ6L 5J3HD 3AAZA 3Q5TA 3PP3H 3L3GB 3MGOA 4DGIH 5FYJL 4PJ8C 1IVLA 1T5WB 3GSXA 5GZOD 4XCEB 4NFDA 5FYLE 3CSYB 3U9UA 4S2SB 5DT1H 4D0CB 5TJWK 1DN2A 4PGEB 5LXGL 4ODHH 1H8SA 1EO5A 3VRIA 4EN3D 2Y5TA 1HXYA 4CNIA 5FB8B 1CFVH 1OPGH 2P24B 2UY7A 4NKOA 4QF1A 1U9KA 4JPWL 3RX7A 4R0LC 5KS9A 4LCCC 1FN4A 5C6PB 4PLJC 3BYYA 5DSCA 1G1YA 2XN9A 1JPTL 2NTFB 2R1XA 5KVDL 4R6UA 1AKJA 5B21A 1IM3B 2HLAA 3DI2B 5IEHB 1AGDA 1BVLB 3WD5H 1RU9L 1KIUA 4NO0D 1KIPA 1EXUB 2AV7B 2ZZUT 4L3ED 3LEVL 5HHPB 4ETQB 3HAEB 3FO0H 3QUXC 2YD9A 4QNPE 2OTUB 4PTUB 3LN4B 3BIAX 4ZFFA 4FZEL 4MXQD 4ZODA 3TA3B 3S9DB 3BPOC 3TBYA 4PREA 4QRRB 3S97C 1ZT4A 3G6JF 1CGTA 2GT9A 5DJ0A 1F4WL 4NN5C 2ED9A 5I17A 3KPOB 1FVEA 4UNVA 3UJJL 5C0GA 5HGDB 3T0EB 2FO4B 3GIZH 1Q1JH 1JRHI 2BMKB 3BAEH 3R0MA 3MV9A 1ZVYA 5E6ZA 3T0DA 1H3XA 3H9SD 5EIVA 1J0HA 4I3GA 5CJQH 4U6HA 4MB5A 4Q9RL 1ND0B 4YPJA 1S7SA 3W9DA 4KTEL 2GQHA 4HS3B 4LF3A 5SWZA 4LGRB 3U79A 5A40E 1QSFD 4M61A 5HHVH 1JWUA 3BPNC 3QXDA 3WNMA 2XTJD 3C60C 1FFPB 4JPKH 5KANI 4XT1C 4JFPA 5TDPA 5IB4B 4HAGA 3VXMA 5DWUH 4RGMC 4X9BA 4D0BB 3GSWA 4MAYA 2L7JA 3OKNA 2NY6C 2X4UA 3V6OA 1TFHA 1JGLL 1PJ9A 5AZEL 2XWTA 4PJGA 1Q38A 4GAYA 3ZTNH 4E41A 4CKVX 1I9IL 4QRPE 1S9WB 1NCAL 1UKTA 2GHWB 2WM0A 2QQNH 1NKRA 4MAYC 4TPRL 2PO6A 3ZYIA 2PYEA 12E8L 2DQIL 4PJEB 3C87A 4Y4FB 3JUYA 5HY9A 2OSLB 3VG9B 4X9HA 1NFIB 4ZXBA 3VD7A 2PO6C 1CDJA 4HWEL 3EW3B 3GEWB 2VDNL 4JQXA 3U4EA 5EU6A 3G08B 4RNRB 1TTFA 4Y89A 5KJRH 5AD0A 4X4YA 1TCRA 2EYTA 3INUH 3V0VA 1IGCH 5D8JH 4JQXC 4JREC 4YFEA 3HG1B 4Z7WE 5JHDE 4Z5RB 2P5ED 2PNDA 2BXZA 1KYOK 3CDGA 4M5YL 1FBIH 4O4YL 5E2VH 2J6EL 5BS0D 5TH2A 3H3PH 3ARXA 1CGYA 1PZ5B 3VU2A 5FA3A 3PWNB 1FZJB 2FGZA 3DX7B 4X5WA 3NACH 4JG1L 4JDZB 4JM4L 2MNUA 1OSZB 4G9DA 1UB5B 3WXVH 4ZS7H 4N0UA 3GHBL 2ADGB 3ARDA 3OG6B 1N5YL 1T21A 3MRRA 3RZCA 5CD3B 1YEHH 4GBXD 4Z0BH 4H8WL 3T2QA 1WITA 3D3VB 4I77L 4UIMA 5F7HA 6CGTA 2NY7H 4PRAB 3GM0A 2IANE 2VTFA 4Y2DB 1A21A 4HGWA 4PRHE 1FORL 1RUPL 2GY5A 3ZKND 4K07A 1WT5A 1ZGLB 2BDNL 1SY6A 4Z77B 5F89A 5IKCA 3V7MA 2EC9T 4IIQB 4UQ2A 4XXDB 3LN5B 1OQOA 1U92A 4XNUH 4H0IA 1B0GB 3JZ7A 1UJ3B 1I1RA 4PJ5E 3MNVB 4XTRC 2ICCA 3QUZD 5HBBA 1GGIH 3MBEA 5DT1L 2CIIA 1RUMH 4RMUA 1OP9A 5HDBF 2XOTA 4ODHL 5FUCE 3MBEC 3CMGA 3QRFM 4K8RD 1IM9B 5ESVA 1K8DA 1P7KB 2NX5A 1B90A 1CFVL 1OPGL 3QISA 3KPSE 1MQKL 1KCRH 2Y4SA 3QA3B 4X9IA 4LNRB 1OP3K 4MNQD 3QDME 3G6JE 1MOEA 4EKXA 1AJ7L 2D7QA 5TQ2H 1XF4A 4U7KA 4WUUE 3T8XB 1HWHB 3UJIH 3WD5L 1HHKA 2MFNA 3QJHB 2HT4D 2OI9C 4X6DA 2XZQH 5SX5H 5F7LB 3ZMRA 4OKDA 1WWCA 1F3DJ 4FQQA 4RA3A 3FO0L 4ZUTA 3SEPA 2BXYA 3QIBD 5F72S 1SHMA 1YMMD 4OQTA 4Q0XH 2R2CA 4XP4L 2OXHA 4AEFA 5TDOA 4YAQA 1I1YA 4FMFA 2GI7A 2VAJA 5E00A 1NGZA 4K55A 5T1KD 4L29A 1LK2B 2CXKA 3GIZL 1Q1JL 2SEBA 3RDTC 3BAEL 4OV5B 3QEGH 2BNUB 5CJQL 5EZIH 3VXUA 4MLIA 4CGTA 1QSVA 3WNKA 2MTPA 3LKPA 2IFFL 1YUHA 2DI9A 2ARWA 4HC1A 2DIAA 1RHHB 1YNLH 2GEEA 5HHVL 3V6FB 3VWKB 4PFEA 1IAMA 4JPKL 3VXQA 5JXEC 1CXLA 3ZT6A 1HQRA 2R69L 3NPSC 1DEEB 3E3QE 1JN6A 4M6MH 4FABL 4F37K 1HH9A 3G9VA 3MLPA 2VXTH 1HNFA 3ZTNL 4HCRH 1C16B 2QQNL 4IRJB 4EN3A 2G2RB 2QSCL 4OCRH 4HUMB 5E9DD 4CAGA 2VDOH 3KLHC 2WBJB 3QCTH 1ZV5A 3MV8B 1EX0A 2ICWJ 5IVXF 3WFCL 5DA0B 2IC2A 5E56A 3P4OA 5IGXL 3VW3L 5ISZE 5KJRL 3VXNB 2DTSA 1KXVC 3RY5A 4N8VB 5L0QC 2AV1A 1QACA 3INUL 1EEZA 1IGCL 4I9WD 4PBVC 4UBDD 5D8JL 3PWPD 2FCBA 4GKNB 3THMH 2ZSVA 4L3EA 4BZYA 1J0IA 1A9BB 1J1OH 4HK0B 1FBIL 4ISVB 2ID5A 5E2VL 1L7IH 3OKYA 2JELH 1D5BB 2XG5A 3H3PL 1TZHA 1I3VA 4DN3H 2FECI 3B4NA 4ODWA 1Q9LA 3HN3A 4YGVA 3NACL 2YSSA 3VDCA 5H2BB 4GRMB 3PABA 3OKOA 3O2DA 4RMTA 3KXFB 3WXVL 1KLFA 3NCBB 4JFFA 3VGAC 1XT5A 3GMMA 1SBSH 4G42A 4JPVH 3L3KA 4I3RH 2Z91B 2HT2D 4FQIH 5JPNB 4GXVH 3UP1A 5HDBE 3DVIA 4XGZA 5I74C 2NY7L 1EEYB 2AW2A 4M1GL 3H9ZA 1CDCA 4L8DA 2CJUH 4KKNA 4N9GB 3HI1B 1XGPA 2VMFA 4LLUA 4OKVB 5IQ9B 3DXAB 1N8ZA 1JPFA 4LKCA 4PG9B 4XNUL 1RK1A 2VZSA 1LO5A 4WTWA 5C0DA 5EO0B 1GGIL 3ARPA 3EOBA 1R3KB 1RUML 3ALXA 4ZYKA 2C9AA 3BMVA 3U7WH 4HLZH 2VKXA 4LVOC 1KPRB 1N0LA 3FOMA 3QXAB 4RGNB 4OCSH 2ATPB 3N1QC 3W0WE 3RVWD 2DMBA 4WFHD 3ZYOA 1KCRL 1BVKB 1MLCB 3MUJA 2JB5H 1NCUA 1JNLL 4YH6A 3BVNB 2VZTA 1V7MH 4V1DB 3VG0H 3CCHB 3STBA 3UJIL 1Y18A 5JIHA 1H15B 2AJYH 4JO1H 3Q5OA 3QDAA 2OP4H 5D7KE 4ZDHA 5J11C 3VFRB 1T6VN 3EYSH 5F7MC 5KVGL 1AR2A 2YC1B 3NFNB 2P5EA 4ZO8A 1MHHB 4NHUB 4JM2D 1R3LB 3QIWD 4JJ5B 4QHKI 4Y5VC 2P8PA 1K2DB 4RDQF 5DVMA 4Q0XL 4TUOB 5HVHC 1WFTA 4YNYB 3VA6A 1XH3B 4QCIA 1P4LB 4L8CA 4PJ7A 3S37H 1YQVL 1MWAA 1DN0A 2JJTA 3BH9B 3KWWB 3L3IB 1MRFH 1MCIA 2MHAA 1DL7H 1HILA 3QEGL 4GBXA 4NC0B 1DLFH 2XQYK 3SO5A 3JV0A 5EZIL 2JJTC 5D7LD 3F7PC 4OCWH 1HYRC 1NBZA 1TIUA 4UU9A 4IJ3C 2X05A 3G6DH 5HHOD 1YNLL 3LKRA 3WL9B 1P4BH 4OBRA 2LFGA 5L8LB 3OKMA 1YEDA 1FL6B 3WFHA 1QRND 2XACC 5IVXE 2E6JA 3NPZB 1T3FB 1IZKA 4MVBC 2W65B 3OAZH 1CE6B 4M6ML 3CU7A 3QUZA 1BVZA 1ZLUH 3NCJH 1PBYA 1LNUB 3OB0K 1ETZB 3GSRA 1OB1B 2VXTL 3TH4T 4HCRL 1MLBB 4OLUH 1HH6A 5EOTA 3HPJA 3WIHA 4LBEA 4XPFH 5E8PA 1U58A 4QGTA 1KB9J 5ACLA 4N0RA 2OMNA 4NKMB 4OCRL 1QKZH 1F6LL 3VXRA 3D85D 3LS5H 3LSOB 3X12A 4JFQB 2VDOL 1X5XA 4MNQA 3QCTL 5F3BA 4WHCA 5HHNA 3CUPA 3SGEH 2ZOKA 2C1OB 1IAOA 3BEVA 2GSGA 5EIIA 3QHTC 1F42A 1VADA 2V7HB 2VQ1B 3THML 2P5WB 3S35H 1DUZA 3IDMA 1J1OL 5MI0C 4MB3A 5T1LD 2YUWA 5E2UH 3RPIA 1L7IL 3RI5F 2JELL 1R5WA 4ZUSB 4DN3L 1ZSDB 2BHZA 3QIBA 5KSUA 3I85A 2VOTA 4WW2B 1H8OA 4DKAA 4E0RB 5DI8A 4D9RE 3GMNB 1OY3B 1SBSL 3MLXH 5KSBF 4I3RL 4JFZH 2EYRA 3O6FB 2FB4L 4FQIL 3HRZA 4GXVL 3WFZA 2FEDD 5GRXG 1J5OH 3GIVA 2C1PB 3CFDA 3SY0B 1QFWM 1Q9KA 1CQYA 1KN4H 1V8HA 3ZKMC 2CJUL 3B6SB 4BFEA 1WAAF 3KLSA 2D2OA 5F7UA 1CDGA 4XXCC 4R4ND 3T08A 3MODL 4BH7A 3QWQB 5F6HI 3UPRA 3IDIB 5DJ2B 2VLJB 2GYSA 3MV7D 1JGVH 3O9WC 3MRGA 3WEXA 1CGVA 4F7CB 1EVUA 4D9QE 4RMRA 3BH8A 4JFDD 3PGCB 3U7WL 4K3HA 3LRSB 3TJHC 5IB5B 4G8FA 4JZJB 2WIIA 3LEYH 5EDXA 5F7DB 5I0DA 1C5DA 3U30C 2C3HA 4OCSL 4TUJA 1BD2E 3MLRH 4F33A 1EGJH 2JB5L 5E9DA 1CFBA 3U36B 1S7QA 4OSUH 1V05A 2GSIA 5EO1B 3SKNA 1V7ML 4U1LB 3D39B 3VG0L 43C9B 1ZT1B 3MGAA 1ZHKB 3BHBA 5EOCJ 4JVUA 4EI5C 4C58B 5I1AB 2AJYL 3C9NB 4JO1L 1N5AB 3O2WH 4DGVH 3Q1SH 1X6LA 2OP4L 3PGDA 3PWPA 2C7UB 4B5EA 4FS0A 2UVFA 2RFXA 1AH1A 1QOKA 4J3OC 1HEZA 3RWEB 1E27A 3K4ZA 5GGRY 1QSED 4IHOA 1JPGB 5C0IA 5E1HB 5BVPL 3N1GC 4XPAH 3O3BA 1P1ZB 4NPYA 3MRDA 2DL2A 1DL7L 5CIPB 1DLFL 2D4DA 1G9MH 5LCVH 2YPLB 2D31B 4RIRA 1K3IA 2KPNA 2AP2A 3BN9C 3QEQE 4OCWL 4QOKB 5FYLD 3QWOB 3MGTB 3L95B 3G6DL 3O41A 3BD5A 3EDEA 3LRGA 1P4BL 3C5ZB 4M03A 3QAZB 1XF3A 4S0SD 4F7TB 3JV4A 5J8OA 1OAXH 5I18H 5FM4A 1H8NA 4HWUA 4RGOH 1AY1H 2VR5A 5DQJB 5TPWH 4LCIL 1YA5A 1KLUB 4H1LG 1D9KD 2H6PB 1CFNA 3MYJA 1UZ8A 4WWKB 2NTSP 1RJZA 4OLUL 2MCG1 1KCUH 1OHQA 3ARBD 4XPFL 3JWOC 1P7QD 2XZCH 3LHPH 1MFCH 4X98B 3CJJA 1QKZL 4H88H 3LQZA 5K9OB 3LS5L 1UH2A 5D2NA 1EVTC 1FGNH 5E4EB 3P0VH 3FQTB 3CSPA 2WANA 5KSBE 4QRSB 4XNZB 4IOSD 1C1EH 3VFTA 4IMLB 4GO6B 1HK6A 4KXZH 1AC6A 1FAKT 1NSNH 2GJ6B 2BVQA 5ELIA 4H25A 5CBEB 1H0DB 1Y0LB 3S6CA 3S35L 1J8HA 1A4JA 2IWGA 4PV8A 1WAAE 5E2UL 3PV6A 4JM2A 2DBJA 1XR8B 4XWOC 3MRIA 3NZHH 5I1HH 1DANT 1FV1A 3BW9A 4P9HC 2JJSA 4HIIB 2NR6D 1CD0A 2ZUXA 1CI5A 3IDYC 3MUY1 1E4XH 3SDDD 3JWOL 3MLXL 4B7LA 4K3EH 4JFZL 2NW3B 3MFFB 2N4IA 1YEFH 2Z93A 3CGTA 3MMEB 5CILH 1T04A 1EHLH 5A3ID 3KS0H 1J5OL 2VKWA 5T1MB 4OZIA 4OZHA 3KJ4B 5FCSH 4CADB 1F6FB 1YC8A 1JHTB 3SE4A 1KN4L 1U8HA 2ESVB 5FYJD 4QRPD 1NDGB 1OP3H 2XWBB 2XPGA 3RKDD 3WLWC 1PQZB 3RGHA 1V3MA 4R90H 1BF8A 5CJ8A 4YDKH 3GNMH 3FONA 3BZDA 4XAWH 5DZNA 2O93L 2ICWB 2AXFB 1CFQA 2IAMD 1JGVL 4OUUA 3V5DB 3ZTJG 5IB2A 3PHQB 2ZPKH 3HB3D 4H1LH 5I30H 1ONQB 4P9HL 4E5XB 5LGJB 3LEYL 2UY6A 3PHOA 2JIXD 4TTGA 4G8EA 4PG2A 4XBGB 3OKEB 3FRUA 5IW1B 3MLRL 1EGJL 3D85A 5JHDD 5D6CA 1G9MC 5C86A 4OSUL 2OR8A 4ERSH 1AHWB 3GGWA 3B9KD 4PG2C 1RIHL 1MCSA 1E4KA 3BEWA 4Q6IB 4FG6C 1BAFH 3VWJA 1EMTL 1FYTB 3Q1SL 1QEWA 4NZUH 3L3JB 3EO1A 3EZ8A 2FJFB 3RVTC 3VWJC 5T1LA 4KKBC 1W0VB 1HN1A 1TXKA 2HJLA 2IAND 4AQ1B 4PRHD 2YD6A 2ARJB 4JY4A 3QO1B 4NC1E 3PWVB 1U8LA 2IPTH 3HNSH 3QEHB 4I5BB 4UIKH 4O2CA 3SCMD 4PLJD 1CT8A 3ESVF 4FXGB 4HQQH 4NWUH 4W4OA 5IUSA 4LPXA 3MTRA 1WQVT 3FZUD 5EZJA 2JJUA 4LDEB 4YDJB 1G9ML 2JTDA 5LCVL 4PJ5D 3HZKA 1Q94A 4R7NB 5CGYD 2ZKHH 2IBZY 4OTXL 1AFVH 4Z78B 1QFHA 2EXYC 1P7HL 4YHML 5GJTH 2DLIA 1BIHA 5D1ZC 4RGOL 1AY1L 3KYOA 3KPSD 1NUFA 3EGSA 3NIGF 5TPWL 4YUEH 4UQ3A 1QLRA 2WQRA 2CXGA 3QDMD 3MV7A 1NC2B 4APQB 4ALAH 3BGFC 4WUUD 4XHQA 2B39A 5FO9B 4WDIA 4NYLA 1FLTX 3L5WA 1KCUL 4JFDA 1AXIB 3GSOB 5DK0B 3BKCH 2R4RH 2DQHH 4P5MB 3X13A 4KHTH 4DN4L 1I3GH 3QQ3B 4JG0H 2XZCL 3LHPL 3F7YB 5FM5M 1MFCL 1U6AH 2J8UF 4H88L 4ZPTB 3ROLB 3F12B 4LVNC 5EC1A 1IGJB 4PY7B 4KTYA 3TN0D 1EUUA 2HMIC 4WO4C 1IGTB 4L4VB 3QG7H 4M6OH 4GJTB 1J10A 4J3WA 4FN0A 1KTDB 3KPMB 1FFNB 1NSNL 1QVOB 4Z0XB 4LLAA 3D87B 4NQDE 5ANMA 4ELMB 1J05B 3H8NA 2YKLH 1XF5B 2EIDA 3GRWA 1GIGH 4BSVA 2CLZA 1UA6H 4HKXA 1RZKH 3V5KA 2ILLA 2QQKH 4KMTH 3NZHL 5FEBA 3HS0B 5I1HL 3MRQA 3OHXA 4R97B 4XP9H 2QADC 2KQNA 1E4XL 5AZ2H 1LEKA 4K3EL 3SGKA 4DOHB 5FGCB 1VPOH 1YEFL 4U6YA 2XICA 3VFUA 3W39A 4C56A 2XXMB 4HFWA 5CILL 5AUMB 5F9OH 5D7IB 5IBLC 1QBLH 1RY7B 4CW1A 3QQ9C 2FH6A 4M4RA 1FAIH 4WI3A 3ULUH 3PDOA 5I16A 3HLAA 1CGXA 4R90L 4Y19B 3RWCB 2BHYA 4U1JA 4YDKL 3GNML 1LHZA 1CLYH 1W8OA 1RI8A 2PTVA 4HH9A 3QO0B 4JANA 4NRZB 4AYFA 5MENE 2NXZB 1D9KA 2EDNA 5KAQG 5I30L 1SJHB 2MQCA 4UZGA 2C26A 1KBGL 2C3VB 4Z8FH 2AGJH 2NNAB 3WUWG 3W9EB 5ISZD 3BP7A 3ARBA 3P40A 1P7QA 4KJYA 4F37F 1Y6MR 4WI7A 5IG7B 4PV9B 4Y8AA 4FQXC 2LABA 5IVZA 2OX5A 4MQXC 4WV1C 1PG7H 5I8CB 3EJZC 1S8DA 3BN3B 5IEKB 3W5MA 3O0RH 4ERSL 2GK2A 1G6RB 4F2MA 4H0HB 4LOUD 4P5TB 2YD8A 4MDJA 3DIFA 3PF2A 3VFPA 3ARGA 4NZUL 3MA9H 4TRPL 3RWFA 2RAMA 3AREB 1QRKA 5DFTA 5DHVB 5INCA 4LEOB 1SYSB 4I0PD 4LCWE 3ARGC 3UBXG 1MHCB 3S36X 3A67L 2XKSA 5DMYA 1CYGA 1I1AB 1UKQA 2K7PA 3TO4A 2BSRA 4EQ2A 5IK3A 3HUJF 5M95B 4R3SA 5CZVH 4MJIE 2IPTL 3HNSL 3SDDA 3NIGE 4UIKL 4HQQL 4NWUL 1IAII 3WXWH 3AXLB 5E2WH 1LD9A 1BOGB 4XBPA 3OB0H 4G6AC 3HC0A 4NO3B 1UWGH 1HKLH 5JIPA 3TBWB 3CFKB 3DX9B 4ODUB 2G5BB 3RWDB 1AFVL 3BUYB 1EZVX 4WHTA 1ORQB 2H9GB 1D6EA 2J8UE 4XPBH 1E6OH 4FMKA 5GJTL 4AEEA 4U1SB 1OT1A 2Q6WA 1Q9WB 3RGVB 3QG6A 1W2KT 5L9DH 3BFOA 3W0WD 3CFIC 4ZPVA 4FQ2H 4YUEL 1PD6A 1JGEA 4LIQH 2P45B 5KVEL 1T66C 4ALAL 1FHGA 4EVNA 4I48B 2AERT 4PY8J 3RDTD 1MEXH 2EKSB 3BKCL 2R4RL 1NQBA 2DQHL 4LMQI 4KHTL 1I3GL 4JG0L 2A83B 1U6AL 2JIXA 1I3UA 3K2MC 2W9DH 5D7KD 1INDL 3QI9B 4Z7WA 4RCAA 4X4XB 2VDPL 5DD6A 3RWIB 4OIIH 5DEZA 3B9KA 3QG7L 4M6OL 3P4MA 3TF7C 2MQ3A 1R24A 3ULUC 2EYSA 1SM3L 1WBZA 5ICXB 2BNQE 1NCNA 3VFOA 5F93C 2YKLL 1PKQE 4U6XA 3CAFA 3CFJA 3PQYE 1EHXA 4BSJA 5L2JB 1GIGL 4Y7MA 1UA6L 1RZKL 5D7JD 4KK5D 3SPVA 2QQKL 4KMTL 3IETA 2IANA 3FT2B 5CCKH 3JTSA 4XP9L 5L7XL 4PRHA 1MCJA 3KPRE 5DFVC 1VACB 5AZ2L 1LE5B 5I8OH 3SDAB 4GG6B 1YNTA 3IJYA 3SCMA 3MRCA 1RURL 1G7LB 1VPOL 1A1OB 3OG4B 4FTVA 3MRFB 5FO8B 4S11A 2ZSWB 4PP2A 4ZNCD 5F9OL 3LAFA 4Y16B 2VLKE 4QHNB 3LS4H 5CZXD 5HYQA 1KOAA 1QBLL 1I4FB 4PJ5A 1UXSA 1FAIL 1XCTA 2Y5EA 4JCMA 5ESAA 3SE3C 3ULUL 3V7AG 4GMSH 1CD1A 1JMXA 1DEDA 3UTZA 4Y4HD 5DXWA 1T0MB 3O3EB 2PW1A 1RJYA 4RAHA 4NRYA 5ETUA 1CLYL 1FNEA 1QFWL 5D1QB 2D0FA 3CSGA 3LVEA 1MI5E 3UTOA 4Z7OF 2QHLA 5LBSH 5DMGC 1TQBC 3E6FB 1JZ8A 2CLVB 3DV6B 4MNGA 4Z8FL 4PJFF 3HE7B 2NQCA 4KGLA 4NO5B 4X8JA 4ZUUB 3T0WA 4KROC 4GAFB 1ZAGA 3CFEB 1IAIH 1ZS8B 1A9EA 1RSFA 3HUJE 2WQ8A 1PG7L 1PY4A 1I7RA 5EORH 2NY1C 3O0RL 3G5XA 5E08L 4PUBH 1B9ZA 2NY0D 1NCCL 3DROB 4MWFA 5FGRA 1U95A 1MAJA 3NTCH 4P23A 2CDGB 3ALPA 3WO4C 1FVCA 4JVWA 1T83C 3FKUS 4YQXH 1U93A 4UTAH 4D9RD 4POZC 4WVRA 2W9EH 3WLBB 5IMOA 2BVPB 4ONOA 1CDIA 3LKQB 3HMXH 3E0GA 3MA9L 4ZQKA 3WE6B 3DVGB 3QIUB 1MHPL 4P3DA 1HNGA 1T7YA 5ACMA 4QRUB 2IH3A 4JCLA 4F7EA 1ZK9A 4MJ6B 4MCYB 3TVMA 3BOVA 4OF0A 1U8KA 4M62H 3GKWH 4Y4KB 5EU5A 5F7EH 3MR9A 5CZVL 2WP3O 3D69A 1G84A 5ADPH 1K4DA 5K93A 3GSNA 3WXWL 4PGDB 1IEBB 5E2WL 1QA9B 2AI0L 1LO2H 3C2AL 4DUVA 3REVA 3CZFB 3J8F7 1UWGL 4JLRB 1DDHA 1HKLL 2VXUH 5B39B 1NLBL 3T65A 1HSAA 4EIZC 2BOCA 4U7SA 5C0AA 2EDBA 3FQNA 4D9QD 1E6OL 3L3HA 1FL5A 2B1HL 1CG9B 4Y1AE 5L9DL 1M7XA 5KANG 3RTQB 1IGFH 3LEXA 2CIKA 4MCZB 3UBXA 1U2CA 1F8TH 3GI9H 2CO6B 1A7RH 3OR6B 1BD2D 4FQ2L 4O02H 5HI3D 4LHUD 4LIQL 5CLWA 2J3SA 2R1YB 4P2RE 4MQTB 2AK4E 2LTQB 1MEXL 5KW9H 1EBAA 5ISZA 2A9MH 2MOVA 3VFVA 4UOW1 1RV6X 3K7UA 1FO0B 3WS6C 2DBLH 3FFDB 4KK6C 5CEYA 4L3AA 1KXTB 2W0FB 2AJXH 5EO9B 5EZLB 3Q48A 4BFGA 3C5JA 4OIIL 4OQ1A 4P4RB 4FQJH 1QLEH 4X83A 5EPMA 4HX1A 4PP1D 5I76A 1MF2H 3BX7C 4GKSA 4YHIA 4UOW0 1BJ1H 2FX8H 1MNUH 1XIWA 5EN2B 1KPVB 3SJVE 5D1XD 1BFOB 4JDVA 5DTFB 4LSSL 1G7MB 2IPUK 3LKSB 5D4QA 4UT7H 1XIWC 4AEIH 1AO7B 4ODSH 1F2QA 3IJSA 5CCKL 3SKMA 3QEQD 4TULH 5JZ7D 3CDYA 2EDKA 4PJEF 3X3FH 5I8OL 4KJPC 4QRTB 5ADOH 4LSRH 5EBLB 1HHHA 1PYWA 4Y4FC 4Z7OE 4ODXA 1D5MB 3FTGA 1G9NC 4FQ1H 3LS4L 4PJFE 5IJKA 2LAAA 2PCPB 4RFEB 3MCKB 1FP5A 5I1CH 3QWRD 3NFSH 5IB1B 3MX0A 5I1GH 3QPQD 4X7DC 4GMSL 43CAB 4R7DB 5IJKC 3MROA 3MBXH 3VRJB 2OM5A 4AJ0A 4PJ9B 4XCNB 4Q2ZB 3RZWA 4XZUA 3HZMA 4GKOA 4RWHA 1MCWW 4FQPA 3W0WA 2XWJA 5LBSL 3UDWC 4HS8H 3QXVA 1U8JB 2ICEA 5F3HA 5HHQB 3L1OH 5GZND 3HFMH 4HIEB 1OTSC 2Q8BH 3BP4B 5DURB 4P2OA 3BZ4A 2DIBA 4OD3H 4LPVA 2BSTB 1VHPA 3BGMB 2R1WB 5D70H 1G9NL 3SHSA 3PG2A 3U0WH 4Y2DC 3RU8H 3GZKA 5EORL 4PUBL 4YFLI 3EYOB 4P46D 5ALBH 3NTCL 1NEZB 2Y7QA 3TIDA 4YQXL 3P0GB 4KK8C 2W9EL 1A4KA 4YBQD 4IIQC 4AG4H 3PGFH 2IADB 5L2KE 2X6MA 1UJ3C 3QUYC 4U31A 2OQJB 3U2SA 2YUZA 4X4ZA 4BH8B 2X4SB 1T4KA 1YDPB 2WUBH 3FCTA 4Z7VF 4DK3A 4ZUWA 4RQQA 4M62L 2CKBB 5D7JA 3DTXB 1NFDF 1GXEA 4UDUA 2W0PA 3P9MA 4F7MB 3BPLC 3O81A 2X41A 2MKLC 4XI5C 3O3AA 5ADPL 5D6DA 2HN7A 4LLWB 3EYQC 3L3OA 3CFBA 1AGEA 2CDFB 4YHZH 2ITDA 1LO2L 5IVXA 3FB7B 3T0EE 1IGMH 1OL0A 3HE6A 1TZIA 4W70A 2YMXH 3I84A 4HIJB 3IXAB 1ZLVK 3HE6C 1IGFL 4WI2A 1F8TL 3GI9L 1A7RL 1S7VB 4LAQH 4O02L 3KJ6H 3OKLB 3MRLB 2VZ1A 3FQXB 3AM8A 4HGKC 5HXMA 1U8MA 1CD8A 3NGBB 3BIKA 3S5LG 3KPLA 1KCVH 2IBBA 1JF1B 5KW9L 2E7HA 2C3WA 5FYKU 4HZLA 3PL6D 3T4YA 2A9ML 4CUCA 5CUSH 3U4AA 4U05A 4PD4K 2DBLL 5E1AB 1CDHA 4JQIH 3V5HA 5C0RL 1DBMH 1MFEH 1AXSA 1JHKH 4PJEE 2AJXL 4YDVB 1FRGH 3MUHL 4MNHA 4MHHI 3GB7B 1X4YA 3MCLH 4ZFOB 3QDJE 4FQJL 4M9PA 1QLEL 2GK0A 1MF2L 3W11D 1U3HB 2R2BB 3F58H 5J9PA 2X4TB 2FX8L 1MNUL 1CCZA 1G1CA 2D4FA 4AT6B 1JZ4A 4FQHB 3O45B 2V7NA 2HT3C 3MUZ1 1LO4H 3IKCA 1MIEH 3GMQA 4X7CC 2DWEB 4UT7L 4AEIL 4HJJL 4ODSL 4M02A 4RMQA 3MPCA 4TULL 4WTZG 1UH4A 1KJ2B 2W59A 5IW6B 1F97A 3X3FL 3C09C 5ADOL 1IL1A 2DKUA 3I75A 3P9LA 4X6EB 5J4MA 5C0JB 2ADIB 4OCXL 5DUBA 5F44A 1MCLA 3Q6FA 4FQ1L 4X6CF 4LQ1A 3VGDA 4Y5XC 3MUGA 1F5WA 3UTSB 4LMQE 4N1CA 2DB8A 4XB8A 5I1CL 5JPMB 3NFSL 3QDGB 1NC4B 5H37H 3D1MC 5I1GL 5CP7A 1IC4H 2Z31B 3RHWF 1I8IA 3MBXL 4LDOB 1X5LA 1RZIA 2P42B 3C2SA 4U1NB 1EO8H 1S9YB 1UQSA 4EUPB 3MRKA 3WKML 4W6XB 3R4DA 1I8KA 2X9XA 3DBXB 2VXVH 4LHUA 4HS8L 4Q74A 5E6ID 1JTTA 5FKAB 3L1OL 4NQVB 4CN6A 3HFML 2Q8BL 4KPHH 1C8PA 5DJ6B 3TCLA 4IRZH 4OD3L 4QXTB 7CGTA 1A5FH 5HGHA 4XC1L 4Z7VE 5M7QA 1RZGA 3K2UH 2UYLB 4NQDD 5D70L 4MDIB 1NFDE 2VAAB 4I18B 2EXWC 4P0DA 2EKJA 3RU8L 5GJSH 2QSQA 2NZIA 3UAJC 2H32A 3O4LA 2VXQL 1M71A 5ALBL 2DQJH 4C83A 3ZDYF 3MLYH 1BGXH 5HHMB 4P3CH 3QR2A 5KG9A 5E8NA 1HHJA 4X7EC 4AG4L 1UYWH 5B4MC 3PGFL 1FCGA 4M7ZC 3FO2B 3D18A 4MA8H 3X14B 3BKMH 1U8OB 4IMKA 2J5LB 1T1WA 1ZOXA 2WUBL 3FB6B 3K1DA 2NY2D 1KPUA 4IMKC 2VIRB 2F53B 3QEQA 1OTTC 3QEUB 3WFDH 4RGNC 4GG8B 1MJUH 4YHNB 5A2JH 1XZ0B 3BYTA 1DSFH 4KMQA 2D9QB 1OLZA 4EJ1C 1CGSH 1F4XL 1EFXD 4AL8H 1OCWH 1VFUA 4UDTB 2X89A 2VABA 1NGQH 4MD0B 5D71H 1A2YB 4PJ8B 1W0WA 2D0GA 2OJZL 3ZKQD 3OF6D 5MEND 1J1XH 3DGGA 1IGML 3AAZB 1OGAA 3MGOB 3QWRA 2I24N 5K59F 1A6ZB 3OV6A 2YMXL 1MCPH 3GSXB 2VWEC 3U4BL 2NY4C 3U9UB 3DVNA 3D2UD 1DFBH 2OXGA 2QQQA 4LSUH 4ZAKC 2BY0A 4LAQL 3VH8G 3KJ6L 1F00I 3KLDA 1S5IH 5F88A 3VRIB 2P43B 1CE1H 4CNIB 5LQBH 4NKOB 1FFOA 1KCVL 4QF1B 2QSTA 4JE4B 5ALCL 1FN4B 3B5TA 5DSCB 4XPGH 4JGMA 2R1XB 4XVTH 5CUSL 1AKJB 2EXYD 1RULH 4JQIL 1A47A 2ZUTA 1DBML 3TJEH 1MFEL 1KIPB 1JHKL 4LCWD 4OJFL 4YFLF 1FRGL 2NXYB 4P46A 4NCC1 5D1ZD 5C0FA 3MCLL 2ZP0T 4CJ1A 3WHXA 3BPOB 3SGDI 4TOYL 3W81A 4X6CE 4NNYB 5EC2A 4NN5B 1RD6A 4MJID 3F58L 2ICWI 1G7JB 3D25A 1FZOA 3SKOA 3TBYB 1JVKA 1T0NA 1LO4L 4HBQA 4PREB 4Z7UA 5LWYH 3S5LA 1ZT4B 1MIEL 2GT9B 5DJ0B 5IJVA 5I17B 1ZA6A 4OGYL 4AH2B 1FVEB 1TJIH 4MB4A 3N85H 5F21B 3DETC 3MV9B 4MSWB 4G6FB 3FFCA 4U6HB 3KXFE 3S4SG 3BPNB 1S7SB 3BQUD 3C60B 3FN9A 4LF3B 5SWZB 1QUNA 4KH2A 5DQ9A 2APXA 1IQWL 4RGMB 3QXDB 2OJEA 4KDVA 2WAHA 1DBKH 1FZMA 2UWEA 2F15A 4JFPB 1MQ8A 1OGTB 3F7VB 4PLKD 3VXMB 4M00A 3E2HC 5F9DC 3GSWB 4MAYB 1X5ZA 3OKNB 4OLWH 2X4UB 1EO8L 3PE9A 3UTQA 4E41B 2XWTB 2OS7A 4GAYB 4PJGB 2APWA 4XNMA 2PF6A 3DXAE 3ZDYE 4WW2F 4JRYA 2VXVL 3I6KA 3SE8H 4WW2C 5C0CE 5MEQA 4WHYG 2PO6B 2PYEB 2JKXA 2F8VA 4ODBD 4M3JA 4H26A 1W72A 4KPHL 4ZFGH 1F3DH 4IRZL 2DTMH 1ED3B 4XMLH 4ZXBB 3O6FC 2AABH 3PL6A 2Z0BA 3OPZH 3QQ9D 3KHQA 3U82B 3K2UL 4N5ED 3KGRA 4J6RH 2BNQD 5EU6B 4YC2C 5GJSL 3PQYD 1EERB 2HG5A 5AD0B 1TCRB 2EYTB 3V0VB 5ECJE 3EKCA 5GRVK 5JOFA 2GW5A 3MLYL 4CJ0A 2W9LA 1BGXL 4P3CL 4KQ4L 3CDGB 3M45A 4D2NA 3KPRD 1UYWL 5TH2B 1X3DA 2P4AB 1CZ8H 5FA3B 5ENWB 4MA8L 2V2XA 5K9KA 3BKML 2BY3A 3ZT7A 4G9DB 5K59E 4D0DA 3AS2A 5IMLB 2VLKD 4HXBH 3ARDB 4ZNEE 4NQXA 1WFUA 1T21B 1LE9A 1LVEA 1W0YT 3A6BH 2ZUQB 3PP4L 3WFDL 1ZVSA 1MJUL 4UIMB 3LKOA 5JDSA 1DSFL 3EJZD 1CGSL 4AL8L 1OCWL 4HGWB 1JV5A 4BSWA 5BW7C 1NGQL 1KC5H 5D71L 4RZCA 3AY4A 2A9NL 5F89B 2KL6A 1J1XL 1MI5D 2VZUA 5IKCB 4XP6H 4FA8A 1NMBH 5C6TH 3RIAK 4BQ8A 4UQ2B 2P7TA 1P5VA 1U8PB 1HE7A 1U92B 3ILQD 1MCPL 1H3TA 4O2EA 3AY4C 3MJ6A 3U0TA 1TDQA 4NT6A 3MBEB 4MS8C 2CIIB 3ARFD 1DFBL 4LSUL 1CXIA 1S5IL 1CGUA 1TMCB 5E6IA 5ESVB 1K8DB 3DOSA 1X5HA 2NX5B 3MRJA 1AP2A 4MQ7A 4O9HH 5LQBL 4LLDA 3QXTA 1S9XA 1U8QA 4DKDC 2R0WH 4AQOA 4XPGL 3FJTA 2OI9B 1XF4B 3IS1X 3N50A 4Q6YA 3R8BB 1RULL 2P44B 1KB5A 4M1CD 3RL2A 1HHKB 1I7TA 4X6DB 4LGSB 3O3DA 1F45A 5C0ND 3G5ZA 4FQQB 3V4UH 3C5ZC 2Y07H 1KGCE 3GJEA 4X4MA 4N1HB 4ZUTB 1M6OB 4YWGH 1UXWB 1EEUA 1HYSD 1LQSR 4WFEE 2VNCA 4F8QA 4U1IA 2X2YA 1GYAA 5MP6H 1XGUA 2C4XA 5DJXB 5LWYL 4K7FB 3LQAH 4KVNH 5TDOB 4EQ3A 4YAQB 2P5WE 2J1KA 3JWNC 4NN6C 4WWKC 1TJIL 1J86A 1CICD 5E00B 1NGZB 3N85L 1S5HB 4L29B 4FFZH 2XZZA 4PGZA 4RRPG 3BPCA 1T20A 3TEUA 4KKAD 3NABL 1CFSA 2V17H 4PBXA 5FGBA 3RWJB 1AR1D 5C8JA 3VXUB 1FNSH 5DF0A 2VDKL 4C54A 2E6QA 1EFXA 1S9VA 2ZUWA 5F7NC 5HVFB 5ICZA 3LKPB 4Y1AD 5GGQH 5E4EC 5FGBC 4XNZC 3ROOA 4S1SH 4MJ5B 3NPSB 1T22A 1KCSH 5F6IB 1DBKL 1A3QA 4P2RD 1EDQA 2AK4D 5DRWA 1JN6B 1KTLA 3GMOA 4NZJA 5KZCB 1EO7A 4OLWL 3D2UA 2VZOA 1H3VA 5DFVD 2D7TH 1YY9C 4MD4A 3EDKA 4PR5A 2Z92A 2DTML 4XMLL 1PKOA 4HWBH 1I7ZB 3OPZL 3FT4A 1J7VR 2COQA 3P4OB 2J12B 3W82A 3KJ4C 4ENED 3C6LA 3SJVD 2VDQH 4ZSOA 1YMHA 3J7HA 4YPGA 2AV1B 3RIFF 1EEZB 4HIHA 2ZSVB 2DLGA 5DLMH 4HDIA 5B38G 4KGJA 3C6LC 4KJQD 2BJMH 2Z35A 1F02I 5CBAA 3BRGC 1CZ8L 4MJIA 4ODWB 4OZ4A 4YGVB 2YSSB 3RWHA 3FL7A 3OKOB 3PABB 5SX4H 4JFFB 4HXBL 5HGBA 5IVOA 5I74B 4JFEA 3L3KB 1ZLVH 3V9FA 4I8DA 2CK0H 3R8QA 1BF2A 4XPTH 4XGZB 1KFAH 4F7PA 1OP5K 1ES0A 5MHSE 1QYGL 1QBAA 4AM0A 1Z6JT 1KYOJ 1KC5L 3BQUA 4L8DB 5D5MB 1QR4A 1QBBA 2G9HA 5EFIA 1XGPB 1AHWC 2PXYD 1T7VA 4RMSA 4LLUB 4NUJA 3SQOL 4JRXA 4XP6L 1NMBL 1N8ZB 4ODVH 5C6TL 4Q6IC 1RK1B 4NDMB 1LO5B 4QOKE 5E5MA 4YZFF 4LK4A 5JTWA 1J9CT 5D2LA 2CRZA 3FMGH 4ZOBA 3GUTA 1FCCA 3FHQA 2HVKB 3KPNA 3MA7A 4ZYKB 5AG9A 1KJ3H 3QZWA 3LQAC 1CR9H 5DEFB 4MXWH 3OSKA 3GBNH 3FOMB 1I9EA 2GY7B 2Y36H 4IRSC 2R0WL 1MVFA 5GPRA 3IT8D 4IOFC 3RL1A 5L2KD 1Y18B 3MJ9H 2Q76A 5TE7H 3WFEL 5GS1C 5DHYA 5DJDA 1BQSA 1PKQA 3OJMB 1U42A 1JI1A 3PQYA 3EOAA 1J0YA 1G6RH 2IH1A 4AIZA 1QNZL 4Y5VB 3V4UL 2Y07L 3H42H 1WWWX 4MJ2A 5CAYB 4QHLA 2P5EB 4OFIA 25C8H 2FR4A 1A7OL 5JIIA 3TA3D 2P8PB 5DHVH 5T3ZH 1OTUD 5EG6C 5MP6L 3WO3B 4QCIB 2GJ6E 3LQAL 4KVNL 4PJ7B 4L8CB 2EDQA 1ADQH 2WINA 1MWAB 3T0ED 1S3KH 2LVEA 2OLDA 5I1IL 4YXKH 4FFZL 2HLFD 3B8YA 3RQ3A 2MHAB 1Q0YH 1PG7W 2E7LC 3FQWA 1HILB 4KFZC 4GBXB 1WIOA 1O7SA 2A77H 2V17L 2YRZA 4KK6D 1ZXQA 1A6AA 1SYVA 1FNSL 4UU9B 3RVUC 5DJYA 5GGQL 1NAMA 5A2FA 5DUPH 2PYFA 3VGBA 3LKRB 2GUOB 4S1SL 3OKMB 1YEDB 3WFHB 1KCSL 5HHXH 1UC6A 2O26U 1DANU 3H2WA 1R3HB 3OGCA 3RAJH 3CIQA 3QUZB 1F6AA 2ZUSA 5GGRB 3GSRB 1BZ7A 5C07E 2DIJA 1HH6B 3SDXA 5EOTB 5JR1H 3HPJB 5EOCH 2D7TL 1RMFH 4LBEB 5E8PB 4J3TA 4KV5F 4R97C 3WJLA 4B50A 1G0XA 3EFFB 1DQDH 2E9WA 1NGWA 2HFFA 3VXRB 1BBJB 4NO2A 3X12B 3MJ7A 5CEZE 3SOBH 4MNQB 1L9MA 1OAYH 3O8XC 3QDJD 5F3BB 5HHNB 2NMSA 4L4TE 4HWBL 2VYRE 3CUPB 1PLGH 2ZOKB 1BLNA 1CXFA 2BHUA 4S10A 5MEOA 1IAOB 3BEVB 2GSGB 3DRTA 2VDQL 4OFYD 3S34H 1NBVH 4LNVA 1RZ8A 3GJFA 4PJXA 1VADB 5DLML 1DUZB 3IDMB 4RFNC 5JO5B 2BJML 4ZD3H 1R5WB 4POYA 1OF2A 1OT2A 3K0WA 3QIBB 5KSUB 3PWLA 2BFVH 3MRBA 1FYTE 4M7LT 5E99H 3H9HA 4TNWK 3U6RA 1M4KA 3QUMA 1HDMA 3DWTA 3GM8A 4NOBA 1A1MA 4YZFE 2EYRB 2M1KA 1F4YH 2CK0L 3D3VD 3HRZB 5DO2C 5CWSA 2XI9A 4XPTL 4YIQA 2RJMA 4CN1A 3GIVB 3CFDB 4TN9A 5J12C 1Q9KB 5C70A 2X10A 3LD8C 2GTZA 5B38A 5LAXA 5C9JA 4ODVL 5EA0H 1IILE 2YXMA 3KDMB 4MA3B 2F5AH 4NZTH 4P5TC 3S98A 5K9QG 3UPRB 4P2RA 1CIDA 3BD3A 3PDGA 2AK4A 3S88H 4MMZC 4Q7DA 3AREC 1IRAY 2DJUA 2PTUA 1AXTH 3FMGL 5FO7B 3MRGB 3WEXB 5HD8D 3IDGA 3BH8B 1KJ3L 1IM9D 5DR5H 1I1AC 4Z7QF 5E6YA 3SDCC 4G8FB 3GBNL 2WIIB 4KKCC 1C5DB 1ZA3B 2A0LD 3EYQD 3JTTB 4KRPC 2Y36L 3VD4A 1DBJH 4PRPA 4KDWA 4F33B 1BP3B 5E9DB 2R56H 3B9AA 3MRPA 2DQEH 3SKNB 2IJ0C 3IDNA 1X5FA 3OX8B 2RQ8A 3P3YA 4MX7B 3MJ9L 5TE7L 3BHBB 4XMPH 3VE0A 1G6RL 1I1CA 3I3BA 1XF1A 3PGDB 3H42L 3PWPB 4KU1A 1OLLA 1ZANH 3CXHK 4L4VE 2RFXB 25C8L 4P2QE 2A6IA 4YHLL 5T3ZL 5IQ7H 1HEZB 3O3UN 5EUOB 2LAGB 4N0YH 4IHOB 5DRZA 1V7NH 5C0IB 4KK9C 3S96A 3NOIA 4XB7A 1S3KL 4PJFA 4YXKL 4FNLH 4NPYB 2R39A 5HI5C 2ZCLL 4PLOB 3MRDB 3OKDA 2A77L 5BMFH 1K8IB 4RIRB 4KV5E 1D5ZA 5DUPL 3KLAA 5GISH 4DOHE 3MREA 3NVQA 2Y6SC 3VWKD 2PXYA 2VISA 1XF3B 3VFGH 1X5YA 2A6DB 2AS5M 1SEBA 3JV4B 4XCEA 5SV4A 3B9VA 3CSYA 3RAJL 4I0KA 4WHDA 2GITB 5AG8A 4D0CA 1CFNB 3MYJB 2E7CA 4IRJD 1QFUH 4QWWD 5JR1L 1GSMA 5EOCL 1RMFL 5CSBA 4HJ0D 1C5CH 3NN8A 3FT3A 4TNVF 4GG6F 1CFTA 1DQDL 1JGDA 3BKYH 2P46B 2WBJD 3LQZB 1B6UA 1JFQH 1JPST 3SOBL 5CJ5A 1OAYL 1Z9LA 4R4FH 5HPOA 4A2MA 1FO0H 4YHPB 5HSFA 1PLGL 4Y16C 1AGFA 5L2KA 3VFTB 2LU3A 4TQEH 5ILTH 3JVGA 4YJZL 3S34L 4H25B 5HHPA 4X0KA 4PJBF 3HAEA 3BESR 3UROR 1J8HB 1A4JB 4PV8B 3LN4A 3C8DA 1CS6A 4R96A 4ZD3L 1KLGB 3PV6B 3IDYB 5D1QC 5EBWB 3TA3A 3IFLH 3MRIB 3KXFD 2BFVL 3BW9B 4KUZL 1UEMA 1S9KC 5E99L 3NZ8A 1Z2KA 3QP3A 3ULVF 2H2PD 3KPOA 2AQ3A 1HZHH 2FO4A 1F4YL 3HE7C 2Z93B 2YN3A 3ZE2F 3C8KB 1T04B 2H2SC 4JO2H 3OB8A 3LPGA 3O2VL 3BRFA 2DI7A 4LPYA 3UAJD 5F8RC 1ND0A 2WLYA 4NSKA 4Z7QE 4PB9H 1HHGA 4HS3A 4HAFA 4MAUH 4LEXH 4J4PA 4M4PA 2Q20A 4U7MA 1TQCC 3OMZA 3DXAD 3ZKSD 4L9LC 4G6KH 1N64H 1FFPA 4BUGA 1A1NA 1RVFH 4GQ9H 5C0CD 2F5AL 4NZTL 3FONB 4AZ8A 5LGKA 4GAJH 3LV3A 4GW5A 4D0BA 2V5RA 1T2QH 3S88L 3QIUC 3V6ZA 4LRIC 4OUUB 1AXTL 1MJ7H 5IB2B 4HUVA 4NGHL 1S9WA 4X7TB 5B8CA 1WGOA 4OD1H 5DR5L 1C12A 5DRXB 1J88A 4Y4KC 2BZDA 3DJ9A 5CD5D 1KJVA 3DO7A 4G8EB 5B8CC 2OSLA 3ZL4L 1DBJL 3FRUB 3K74B 2H26A 3D85B 5D6CB 2R56L 3QDJA 2DQEL 3U0PA 4PY8I 1BIIA 1FZKA 2M26A 1KELH 4HK3N 3G08A 4PJDF 4XMPL 3BEWB 3VWJB 4AIXA 4OFYA 1QEWB 2ERJC 3EO1B 2CDEA 4P4KC 3S36H 1ZANL 4LHQB 3AVEA 4TSCH 5T1LB 4OCNC 1PZ5A 3CX5K 3RTQC 4LSQH 1FZJA 1WJ3A 3P4NB 3GK8H 5IQ7L 3EBAA 1MCEA 2ED8A 2CKBH 1MAMH 2ADGA 4JY4B 1V7NL 1E28B 1U8LB 2OMBA 4TTDC 4O2CB 3AFLA 5JA9A 2R4SL 2VC2H 4XP1H 1P2CA 5B3JF 3FOLA 5EZJB 3IF1A 4BK5A 1TETH 1JK8A 2P8MA 3HZKB 1Q94B 1X5JA 5GS0H 1UKSA 1ZGLA 2BOBB 4W6YB 5GISL 4GG6E 1WWBX 4FZ8H 4WJ5A 4U49A 1YEIH 9CGTA 3VFGL 2AEWA 3PXJA 4LSTL 2H1PH 3BGFB 2AXGA 3KYOB 5DMKA 2KQMA 3EGSB 2KUTA 4UQ3B 1QLRB 4OCMC 4LLVB 3MV7B 3RIAF 4OBSA 2YD7A 4Z7VA 4PJBE 2GJZA 3DETD 3L5WB 1QFUL 4NYLB 4WDIB 5GRVL 4JFDB 1UVQB 2X9WA 1NFDA 3QNXA 4HMEA 5GSVA 1P7KA 1C5CL 3NIFF 5FUOH 1JL8A 3BKYL 3QA3A 1JZ6A 1U41A 5BRZA 1KGCD 1JFQL 3HC4H 3MOBL 4R4FL 3ULVE 1FO0L 1XEDA 1QHPA 4WFED 2LQRA 3ZE2E 1SMOA 1OW0C 5FKPA 4YDLC 3L7EA 3TC9A 1XR9A 1OP5H 2P5WD 1T80A 5ANMB 2YD2A 1CXKA 2B1AH 4JFHE 1YEEL 2H45A 4PJ9C 2QADB 4KI5C 2EDWA 2NYYD 4U1GC 4BSVB 5DZLA 4HKXB 2OCFD 3IFLL 4UMGA 4QKXB 3LPFA 3OHXB 3SO3C 3OJDA 4WEUD 3V95A 2R2EA 1LEKB 5E8EA 3TH3T 3O6FD 1O7VA 2WWKT 3EJYD 1LK2A 2J88H 4LLQA 3IDXH 1KJ2H 3IS0X 4U6YB 4OV5A 4NQEA 3VFUB 4HSQA 4C56B 4HFWB 2AEIT 2YEZA 1LEIA 4CW1B 4PB9L 4MAUL 5T1DH 4LEXL 1JF5A 2E3VA 1BZQK 3VD5A 4R26H 3L5JA 3PDOB 3VWKA 5I16B 1F2XK 1N64L 3HLAB 3HRPA 3WIIH 1UCBL 1RVFL 4RX4D 2IQAA 5C0EA 5IF0B 2FJGA 4U1JB 2O61A 2RCSH 4GAJL 5EU7C 4PJDE 5KSVA 4HH9B 1T2QL 1W8NA 1RJLA 1MJ7L 4X8XA 2RIKA 5FECA 4OD1L 2EDTA 4IRJA 2QKIA 3GO1H 1ULVA 3BP7B 2ZG3A 3ARBB 1CTNA 3B9EA 1D5IH 2E9BA 4KJYB 2CKNA 5DC9B 4GOSA 5IVZB 3CH1A 1O5DT 1F3JA 3WN5A 3H6JA 2X40A 4OGZA 4NHCL 2WSKA 1S8DB 5CEXA 4X6CA 3QUKA 1KELL 4F2MB 1DBBH 1RZJH 3VXNA 2V5YA 4YHYB 5B3JE 4MDJB 1PZUB 1TJHH 3OXRB 3ARGB 4F3FA 2QR0A 4HK0A 3RWFB 3S36L 3H3BC 4GRLD 4A2LA 4TSCL 1QRNE 1P6FA 4X5XB 4Q97A 4LSQL 5KSAC 3GK8L 4G7VH 1DTUA 5MHSD 4C4KT 3KXFA 4JPWH 3TO4B 2BSRB 5IK3B 1TNMA 2WIMA 1Z9MA 2CKBL 2DQUH 1L7TH 1MAML 3CNKA 3NGBC 4LARL 1R6VA 3RVXD 5KVDH 3SDDB 3UYRH 5DD5H 4AIOA 5JPNA 3B83A 3QH3B 2VC2L 4XP1L 1FDLH 2FSEA 3WJJC 1LD9B 4XBPB 1EEYA 2YD5A 3VI4F 1S7TA 3HC0B 1TETL 4QOKD 2V2TA 3RX8A 1Y6KR 3MNWA 1YYLH 3LEVH 3NIFE 2DMKA 1JYVA 4J3SA 4N9GA 5DS8A 3C5ZD 4FZ8L 1D6EB 4UV7H 2HWZH 4FZEH 2CRIA 4G6MH 3DXAA 3QG6B 2H1PL 4PG9A 5C0CA 1LEGA 1ZVHA 1U3HC 4NQUA 4ZPVB 1F4WH 1RK0A 2EE9A 5EO0A 4PJIA 5SV3A 2EDHA 1YEGH 2OL3A 4YR6A 4WWKD 1MJJA 4EVNB 3EYVA 1JWMA 2YA0A 4L8BA 3UO1H 3I02B 3NBNA 3QXAA 4KKLD 5FUOL 3QFDA 1WBYA 4RWYH 1BVKA 4PJAB 1P53A 5GQBA 3T77A 1H5BA 5DD6B 3UYOD 3B9KB 2BC4A 2FD6H 3P4MB 1H5BC 3RY6C 2M2DA 3EOTH 3KYMB 1R24B 4HKZA 4ZG1A 2GJ6D 1UGNA 2EYSB 5C2BH 1WBZB 2VN7A 5AZEH 2BSSA 8CGTA 3VFOB 1I9IH 3O6KH 5A43C 2B1AL 3CFJB 1UH3A 4JJ5A 4KAQL 4TPRH 5ERWA 4QHMA 5EOQH 3RJDA 3SPVB 1LP9F 2GCYB 4N0CC 2KBGA 2E8YA 2IANB 3DGCR 2X4OB 3JTSB 3IYLW 1I3RB 4PRHB 3DUSA 1MCNA 4ESKA 1YNTB 4N9OB 3IJYB 5GGUA 2J88L 3MRCB 3IDXL 4FTVB 1KJ2L 1T5XA 2X70A 5I1DA 4RAVA 4PP2B 5FK9A 4OGAC 2BNRE 5BO1L 4D3CL 5E0QA 5HYQB 4G80A 1VFOA 1N26A 4I18C 5T1DL 1FE8L 1UXSB 1KT2A 4X5LA 1RZJC 4NNXA 2NY3C 4R26L 2CD0A 5ESAB 4H0GA 2J6EH 5C07D 5LKNA 1CD1B 3IAGC 1KG0B 5DK3A 4NKIH 3WIIL 2PW1B 4JGJA 4JG1H 2QSVA 1TQBB 4NRYB 5ETUB 1FNEB 1T3FA 2RCSL 3DYPA 3GHBH 4U4BA 5CEZD 3BZFA 4GRWF 1BHGA 1LNUA 4HUNB 4L4TD 1A3LH 1MLBA 3DMMA 1A7PH 2EECA 4MNGB 2OTWA 3TIEA 3GO1L 5D7SL 3TESA 4NKMA 2ADJA 1NANI 1MCHA 2IF7A 1FORH 2NY1B 4PRBA 3P77A 1FNFA 5C09E 4JN2A 4WI5A 3BP5A 4JFQA 1ZHLB 2YK1H 3WO4B 5C3LD 1UT9A 2ZUVA 4OLYH 5I1LB 3G5XB 2EDJA 4QTHA 1Q9OB 1U95B 4P23B 1DBBL 1RZJL 1FVCB 3W5NA 1FYTD 1U93B 1IT9H 1U91A 3VI4E 1TJHL 5IMOB 2V7HA 3M1BA 2P5WA 5TQ0H 4QY8A 4ZQKB 4P3DB 1NJ9A 4FRWA 4OM1H 5I6XC 2IH3B 4ZUSA 4G7VL 3TVMB 1NMAH 3WUWB 1MQKH 4LCUA 2EDFA 3L9RA 2XKNA 3FQUA 2DQUL 1L7TL 5I1EH 4PJHF 3NCYP 1AJ7H 5KOMC 3D69B 3UYRL 5DD5L 2BVTA 4GS7B 1K4DB 4UAOB 3TBVA 1FDLL 3GSNB 3MNZA 2HKHH 5TF1H 1FG9C 4TNWF 4DZ8A 3REVB 5JHLH 1DDHB 3SY0A 1SJEA 1MPAH 1YYLL 3T65B 1HHIA 5DYOB 3WYRA 2X7LA 2EDOA 4ZS6D 2BOCB 1YEKL 1SY6H 5C0AB 1KEML 4KDTA 4UV7L 2HWZL 2O5ZH 2NXYC 4G6ML 5HPMA 4K3JH 4LHJB 1FL5B 5KVFH 4RX4A 4XP4H 3LEXB 3UBXB 1HCVA 2CIKB 2DLTA 5DJ2A 5TF0A 3QDGE 1YEGL 1NC2D 2V9RA 4APQD 3RY4A 4XCCL 2R8SH 3LCYA 3G04A 3GI8H 5JW4N 3TT3H 3UO1L 4D9LL 4OAWA 1RUKH 5F7DA 4W81A 5ISZB 2A73A 4F9PA 1NMCC 3VGGA 4RWYL 3VFVB 2IFFH 4UILL 1LP9E 4FFVC 2X09A 5IROA 3WNPA 1K4CA 3MLWH 3U36A 3VXOA 2VLME 4L4VD 4P2QD 3KYAA 1WCBB 1R3IH 1ZT1A 3C5JB 5E95B 2QV2A 4GFTB 4OT1L 2FD6L 3EOTL 2R69H 5EZOH 1N5AA 5SWSA 5EPMB 4HX1B 4R8WH 5C2BL 1GZPA 4FABH 5I76B 1P9MA 2IFGA 1EUTA 2Y25A 2JCCB 4GKSB 5FYJE 4YHIB 3WNLA 2O5YH 1XIWB 3O6KL 4XMKH 1LMKA 4GRLA 3MOAL 4PJGF 4OQTH 3V6OC 4L5FH 1BZ9B 3H0TB 5EOQL 3AC0A 4URTB 3RWEA 2QSCH 1VFMA 1ZEAH 3SKMB 2YRPA 3GMPB 3IB4A 3WFCH 2FIKB 1HHHB 4GRWE 1PYWB 3S37X 3WNNA 4NWTH 1NANH 4I1NB 5IGXH 3VW3H 4ZXBC 3FTGB 5CIPA 2RBLA 3QHZH 5JA8B 5K9JH 2X1XR 2F53E 1F90H 1FLRH 4YO0A 1NGXB 1TTGA 3Q6GH 3HPLB 3MROB 2YA1A 4NKIL 4J3XA 3LIZH 4MD5A 6FABH 4XZUB 3QXWA 1VSCA 2NXZD 1MH5A 2EE6A 4O2FA 1A3LL 2ICEB 1A7PL 5F3HB 3ABZA 2MPAL 2DF3A 2CR6A 3DI3B 3VXPA 3ZE0F 3ARDC 5ITBH 3VFSA 5GGSA 2YD4A 4P2OB 3BZ4B 4OI7A 3RZCC 1BFVL 4M1GH 4LKXB 4FXKA 4ZO9A 2W92A 2ZUQC 1BQHG 1GGUA 1G0YR 3CU1A 3DHJA 3BZEA 2YK1L 3Q5YA 3ARYA 4MGXA 4RBPK 4PJHE 4OLYL 3DURA 4KVCH 1ZLSH 1WT5C 3X17A 4RFOH 3PNWB 5HYJE 5DJZB 2Y7QB 3QUYB 3TIDB 2EICA 1IT9L 2AEPH 1A4KB 2GJ6A 5FAAA 1NKOA 1H0DA 5FDWA 3ARED 5TQ0L 4XRCB 2DJ4A 4R2GC 4KJWD 1JZ5A 1Y6NR 3CD4A 3U2SB 4OM1L 1T4KB 3BPLB 5IHLB 4EBQH 4K3GA 3FCTB 1AQKH 2R2HA 5J6GA 4ZUWB 4RQQB 1NMAL 1C5BH 3O2DH 1SVCP 3FO1A 2MSPA 4UDUB 5HJ3A 3P9MB 4FXLA 5I1EL 4LP5A 5EU3A 1JNLH 3WSQH 4WENB 2CQVA 3MFFA 2HN7B 5GIRB 3L3OB 3CFBB 2HKHL 1AGEB 2WWMD 5TF1L 1NFKA 5M94B 1PY9A 2ITDB 4LAJH 3L7FB 2VB5A 2A6JA 5T1MA 5IVXB 1NCDH 5JHLL 3B2UD 3B5GA 1MPAL 5GGVH 5JLZA 5KVGH 4X6DF 3HE6B 1TZIB 1VKXB 3QCUL 1SY6L 2H3NA 4OIAA 4BQ6A 1H3UA 2APBA 4WNQA 2O5ZL 5C07A 2R9HD 3RGVD 4K3JL 3ARVA 4OLXH 5SWZE 5KVFL 2D03L 2NZ9D 3TZVA 4JN1H 2IBZX 4U6TA 4MA1B 3QQNA 2HA1A 2ICWA 1YQVH 3OBAA 4PGBA 4U33A 1KULA 2R8SL 1U8MB 4P5KA 3PHQA 3GI8L 2OK0H 5I8KH 3BIKB 3VXME 5I71B 5CGMA 5DA4A 4L4TA 3TT3L 3KPLB 5HDLA 4XNYH 1RUKL 4HZLB 4E41E 4PJGE 3T4YB 5JMRA 3ARRA 4GLRH 2CO7B 3QI9D 3LRHA 4XX1G 5I75B 4FOMA 3EHBC 3V5HB 3MLWL 2VLLA 2PYEE 2V6HA 2Y6SD 1GL4B 1AXSB 1UCTA 2ZCKH 3QNYB 4M5ZH 4IDJH 1R3IL 1BX2A 3ULSA 2VUYA 1F4AA 5EZOL 4R8WL 3IU3A 1FYTA 2GK0B 5J3HC 5F6IC 3L3JA 4AK1A 5J9PB 4M9OA 2O5YL 3MXWH 4XMKL 2V7NB 4HHAA 5FV1L 5DJAB 4NZRH 1W0VA 3GMQB 4OQTL 3C09B 4YK4B 4L5FL 1ORSA 1BJMA 2DLFH 1ZEAL 5MEPA 2ARJA 1MWAH 4UB0H 3QEHA 3SDAD 4EN3C 4I5BA 3NMEA 3S3PA 4FXGA 4Y5XB 4A6YA 4XVUD 3ARZA 1IL1B 3I75B 3LPWA 1PW3A 3D6GA 4NWTL 5DUBB 1WICA 3K8LA 3Q6FB 3VXSE 3QHZL 4IS6A 4NO0A 5F71A 3RVVD 3ZE0E 5K9JL 3MUGB 1FNGB 1F90L 3RBSA 1FLRL 4Z78A 2LU7A 1CLOH 4HC1L 2CRYA 5C0BB 3Q6GL 4PPTA 5CP7B 1BBDH 1QPPA 1I8IB 1I85A 2JK5B 1RZIB 3LIZL 3LB6D 1UB6A 4HPYH 6FABL 2Y9RT 4NN7B 3MRKB 4U0QB 2J8HA 1I8KB 4MXQC 2B4CH 4LHUB 1UJTA 4APQA 2FB4H 5HYIA 3AU1B 3ULVD 5FO9A 3HE7D 3WIHH 5CHNA 5AYUH 5DK0A 5ITBL 3H9SA 3TCLB 3SGEI 2Z4QA 3UTTE 4HGMA 5HGHB 1RZGB 5ESQA 4ZPTA 5T5NG 3F12A 5A16A 5LGHH 1QSFA 2FGWH 2NX5E 1P4IH 1YNKH 5D5MF 4JFHD 1YZZA 2EDYA 2H32B 3O4LB 4I2XE 1QHOA 4L4VA 1ZLSL 3DSFH 4KVCL 4X99B 4P2QA 3MODH 1MIMH 4RFOL 1M71B 4DVRH 4R9HA 3TBSA 4M7ZB 4C83B 2AAVA 3KPMA 1AGCB 4OFVA 4CMHB 1HIML 2AEPL 3R06B 4U2YA 5KG9B 5E8NB 1HHJB 4F80A 3K4AA 2HRLA 4MYWB 4C57C 1KJMA 3D18B 4X6DE 3UC0H 1T1WB 3IGAB 4MA7H 4GW4A 4EBQL 1AQKL 4Y4KD 5J7CC 1C5BL 3O2DL 3ZZ1A 5HYSA 3BWAA 1IC7H 4YGAB 1BQHA 4JDTH 3WSQL 5JW5A 4FFWD 1S7UA 3I50H 4JFYA 1A64A 3FB8A 3CLEH 4IDLA 2VABB 4K3DH 1N59A 2FX9H 1W0WB 1NCDL 3ECBA 3OXSA 1VGEH 4NBXB 1M7IA 2NY4B 5GGVL 3DGGB 5GS2H 1OGAB 5A1AA 7FABH 1OOAA 1OAZL 1GGYA 4YEEA 4ZAKB 5BQ7A 5BS0A 4OLXL 3DVNB 4JN1L 3I3EA 3VFWB 1T1YA 4NRZA 3U46A 5BVPH 5F88B 4JJHA 4PJ7F 4TTDD 2AKRA 2OK0L 5I8KL 5FOBB 3HTLX 2C3VA 4U0RB 3JV6A 1FFOB 4XNYL 2HTLD 2CSPA 4LFHD 1OAKH 1IARB 3RUGA 5IG7A 1BPVA 4GBXC 4CU8A 1DVFD 1S7RB 4P48A 1NUGA 3DPBA 2VO5A 2EO9A 2EDDA 1LGVA 2DICA 2ZCKL 4M5ZL 4IDJL 3FB5A 3ZKNC 3H9YA 4H20H 3DHMA 5C0FB 3WHXB 2VSCA 3AMLA 4LCIH 4YBHA 2ORBL 1T7XA 5EC2B 2VDRH 1IGIH 2VUOA 3D25B 1FZOB 1XGRA 5DHVA 3SKOB 3MXWL 1T0NB 3K8MA 4Z7UB 3QUZC 3S5LB 4B7IA 4NZRL 2D0HA 5IJVB 2B4CC 3BO8B 1ZA6B 3GSUA 4PD4J 2DLFL 2IG2H 5FV2A 4GXUN 1MWAL 3MQIA 4UB0L 1YN6A 4K8RC 3MSPA 3FFCB 2EH7L 4JFFE 4KC3B 5GGTA 2F19H 5GGVY 4NO3A 3MLSH 4OCLC 5DQ9B 5FUZH 3EYFA 4ODUA 4TVSa 3RWDA 1QO3A 4M8QA 2E8ZA 3E2HB 1CLOL 2OJEB 1PDKA 1QQDA 2H9GA 2WV3A 4RA0C 1S78D 1FZMB 2UWEB 2HT4C 1BBDL 3L5IA 4JY5H 1EEQA 3RGVA 2EEBA 5D5ME 3V79C 1IBGH 1YMMA 3D0LA 4HPYL 4DGYL 3S7GA 1X7QA 3UTQB 3AB0B 4Y5YA 2W91A 4XNMB 3JWOH 4JRYB 3QIBC 4BELD 1HQ4A 2B4CL 5HVWA 3I6KB 1JWSB 3S3SA 5T1KA 5MEQB 2OR9H 2GAZA 4Y5YC 3WIHL 5AYUL 1W72B 4JKWA 4YC2B 4F9LA 3PL6B 1T2XA 4KXZI 2CUMA 5LGHL 2HFEB 3KYKH 2FGWL 5DK2A 2QJDA 4X4XA 4J1UA 4X80L 3RFZC 1P4IL 1YNKL 3T0XA 2DS4A 4DCQA 1AQDA 2HG5B 3DSFL 1Z0NA 1MIML 4DVRL 5I66A 5JOFB 3DO3A 3KR3H 1EJOH 4KWUA 1J0KA 3OJ2C 4DAGH 2IGFH 5J6HA 3D48R 1V3JA 3V4PH 4P9HH 1E4XI 5K9KB 3UC0L 3TNNB 3JXAA 1F11A 5LJYH 4MA7L 2BNRD 3ES6A 4L8SA 3LQMA 3O4OB 4NQXB 1LE9B 3FT2A 5TDNA 2QQLL 1IC7L 4JDTL 2W0KA 1KENH 1ZVSB 5F9JA 1ZLWK 2CUHA 2WK2A 3LKOB 4U1MA 3I50L 5JDSB 3CLEL 3GMLB 5GS0D 4PJ7E 1MCFA 1RIHH 3X11A 1A6VH 1JV5B 4K3DL 2FX9L 4XWGH 4RZCB 1VGEL 1EMTH 2BX5A 5ITFA 1CVSC 1PX3A 3NFPB 2VL5B 7FABL 2P7TB 1WIUA 3K81A 2JJVA 3U0TB 4PJBA 4NT6B 4UBDC 2XA3A 1IMHC 1X4ZA 4JKPH 5DQDH 1CXHA 5C09D 2X4RA 5EUOF 5DJ8B 4NKDA 5CINH 1HSBB 5EULV 3TNMA 5E6IB 4MQ7B 1S7XA 1AP2B 5FYJU 4LLDB 1S9XB 4ZOAA 4ZUUA 5JXAH 1OAKL 1JP5A 3CDFA 4U1HA 4OTXH 4HG4K 5FDYA 4YHMH 1KB5B 3RL2B 1I7TB 1T1XA 3GSVA 3VXRE 1IQDB 3DROA 3O3DB 3G5ZB 4J7RA 1CF8H 4H20L 3GJEB 1BQLH 2ZCHH 2BVPA 2VDRL 1IGIL 5AYQA 2J2ZA 3DVGA 4NN6B 3VH8B 2C3GA 2FL5B 4U1IB 1ZHNA 3EJJX 1XGUB 3MRHB 5DJCA 3E8UL 4PJCF 4DN4H 4ZTOH 5ABDE 3CLFH 1MHEA 2IG2L 2PUQT 5CP3A 3BPCB 1T20B 4LGPB 2L4OA 1CFSB 2EDRA 5HDOA 2HFGH 4PGDA 2Q86B 1TENA 1EFXB 1QA9A 1S9VB 5D2NC 2F19L 3QHFH 3CZFA 3MLSL 5FUZL 1NBQA 2F8OA 3T0VA 3CSBA 2R23B 1WLHA 5B39A 4PJDA 5J56B 3QDGD 4I13B 5C2UB 1T22B 2Z31D 1CQKA 4CMMA 4JY5L 3VD3A 1VA9A 3QIWA 5DRWB 1MUJA 4RBPH 2FHBA 1IBGL 1KTLB 5AAWA 2FEEL 1T7WA 4DQOH 4N0CD 2OZ4A 1UM6H 2ZUUA 4AMKH 4JM2C 1BOYA 1IEHA 5TGBA 4MD4B 3N06B 2OR9L 2VLMD 1U36A 2JJSC 1FL3A 1MELA 4PR5B 3T2OA 3S4SB 2Z92B 5D7LA 2D7OA 1I9RL 3FT4B 3FFDA 5HHOA 1KUMA 3KYKL 1DVFA 2W0FA 1YPZA 3C6LB 5EO9A 3SE4C 5HYEA 4ZSOB 3IXTB 1YMHB 1QRNA 4HIHB 2GTWA 4P4RA 2PW2B 3KR3L 2YS4A 1EJOL 3DX8A 5JUEH 2VR9A 4O58L 5EB9A 2Z35B 3QCVL 2WUCH 5CBAB 5H94A 4DAGL 4F58H 2IGFL 3ALWA 1KPVA 3V4PL 2E27H 1KV3A 1KBGH 3GRWH 4G9FE 1VB9A 3SBWA 4BFBD 3RWHB 4HH8A 1GC1H 1J8KA 5DTFA 1MCDA 2IALB 5HGBB 5CJBA 3PWUB 3P11H 4JFEB 2F53D 4LRNH 1TVHA 4WU5A 2H8PA 1MCQA 1KENL 3DUUA 5ICYA 5EUOE 4F7PB 2I60H 1ES0B 2VN4A 4BK4A 1QR1B 4AM0B 1D5MA 1A6VL 4PJ8D 1VEMA 2JB6A 4XWGL 2G9HB 4Y88A 5EFIB 5F1IA 2XT1B 2Q3ZA 3HR5A 1QFOA 1QFWI 4JRXB 4NUJB 4HUUA 2PKDA 4TRPH 4DK6A 1E4KC 1A0QH 1SQ2N 1VESA 43CAA 2O5XL 3A67H 4ZO6A 4XCNA 4Q2ZA 4YEFA 5D2LB 3GUTB 3AS0A 4JKPL 5DQDL 1AE6H 3KPNB 5A2KH 1LO0H 5IIEA 3QZWB 4IRSB 4NQSA 1WIPA 2Z8RA 5CINL 2Q8AH 1EAJA 4ORGA 3TYGH 1C08A 1A6WL 5D9SA 1CL7L 1LO3H 4I3SH 5HHQA 4E42A 1DUYA 2WBKA 5HYJD 1T89A 5JXAL 5I9QB 3VRLF 4W4OC 2OR7A 4IBLT 5GS1B 5EUKA 2BSTA 4PJCE 1AKJD 4ETYA 3ZKXC 3QUXD 2Q76B 2WLZA 4Q58C 5DHYB 1PKQB 3PQYB 2NXYD 3EOAB 2IH1B 4AIZB 1CF8L 3CVHA 1BQLL 4QHLB 2ZCHL 2KH2B 4R4NC 5KVEH 5F8QC 4M8VA 2FR4B 2IADA 1FPTH 3DUHA 4JFOA 5IP4A 2EE3A 2VITA 3ZTJH 1VGKA 2OQJA 2V2WB 4BH8A 2X4SA 5DEGA 4ZTOL 2AXJA 1NGYA 2BNRA 3KVQA 1J8HE 2WINB 3DSNA 3DTXA 3CLFL 1T03L 2ZNWA 1INDH 3MRNB 3SKUD 1MFAL 3FQWB 4QT5A 2VDPH 4KUCF 1A6AB 3P4LA 3KHOA 2A6KB 3C60D 2HFGL 5SWZD 1NAMB 3FB7A 3QHFL 1Z5LA 2PYFB 1SM3H 2NY6D 5BJTA 3GSQA 2FYYA 3VXMD 2B7DT 1U8IA 1HINH 4YXHL 4EI6A 4MAYD 4IOIA 3OGCB 4WU7A 5IMMA 4E41D 2HFTA 4DQOL 1UM6L 5L7XH 1BZ7B 1DBAH 1GC1C 1ZKAA 4AMKL 1QSEA 5C09A 1XGYL 3SDXB 5TFSH 1GGBH 5IWLA 5T33H 2CGRH 2PO6D 4ONFH 1RURH 4TSAH 2PYED 3O8XB 5GS3A 1ODAA 1JF1A 1ZHBB 1NGWB 2HFFB 4NO2B 3MJ7B 3SGKC 3WS3B 5JW4Q 4G43A 1VFAA 1XCQA 2I26N 4OZFG 2FBJL 5MEOB 3QULA 4NJ9H 4Y0GA 1R5IA 3RI5K 4RFNB 2F54E 3GB7A 1RZ8B 3GJFB 1U0QA 4PJXB 1QFWH 5J0BA 4ZFOA 3MZTA 4G8GE 5JUEL 3NCYS 5KVMC 4M93B 2DQGH 2WUCL 3CPLA 4F58L 1WEJH 1OF2B 2E27L 3GRWL 3PWLB 2DYPD 3FHAA 1GC1L 3B3IA 1CDBA 3U6RB 3H9HB 1UWEH 3VXSD 3QUMB 1HDMB 1KN2H 1D9KC 3P11L 4UUJB 2VZVA 4LRNL 3BP6B 5J12B 2E6PA 1Q8MA 4P99A 5CWSB 5IW6A 5FCUH 3ARBC 3GBMH 3LD8B 2QL1A 2I60L 1Z9SA 4JKMA 4M7LH 4X6EA 5E08H 5C0JA 1NCCH 2VXSH 2CLRA 4HV8A 3G5YA 4PS4H 4XTRD 1FH5H 3C5SA 3VRLE 4CU7A 5B38B 5LAXB 5CSGA 5C9JB 5JPMA 2XFXB 3QDGA 1MHPH 1DLHA 1B2WH 3QPXH 4YHYC 1A0QL 1KIQA 3STZA 4J2XA 3WHE1 2EH8H 3MBED 3QXUA 4F15C 3RBGA 1WCQA 5C6WH 2P8LA 4I4WA 4JZNA 3SDCB 3UTTD 1S9YA 2NLJA 2AJUH 4EUPA 1AE6L 2FDBP 3IDGB 3I6LE 1I9JH 4OZGF 5LVEA 1LO0L 4KRPB 1LP9A 2NX5D 2Q8AL 3TYGL 3TO4C 4I3SL 1LO3L 3MJGX 2AI0H 2PR4H 5D96B 2NR6C 4P2YA 5DJ6A 4GUPA 3C2AH 3SDDC 4PRPB 4ZOEA 1NLBH 3ZSSA 3MRPB 2YA2A 1J12A 2VAAA 1MFDH 3PHSA 1P6AB 4XPHH 5A3IC 4WWID 2XYCA 4QRPA 4W4NA 1INEL 2B1HH 4XCYA 3VE0B 3K8KA 4AENB 3RKDC 5IOPA 2XZAH 1IFHL 2IAMA 2A6IB 1FPTL 1UZ6F 3FO2A 3HC3H 3X14A 4X9GA 4BKLA 5E5RB 2GIYA 3TT1H 2IAMC 3GDBA 2YZ8A 3K80A 3S96B 3OJVC 2XNAA 5DZOA 4XAKE 3HB3C 4PJFB 4QRQA 1J0JA 2B2XL 5TE6L 5JHDA 3EHBD 5E24E 4PJAF 3RNKA 3F7QA 3GSNH 1ZWIA 1NUDA 1TCMA 2R29H 3ULUF 1D5ZB 5JXED 3MREB 1A8JH 3L3DA 2PXYB 3B9KC 4C56E 2VISB 5B22A 2HYMA 1A6ZA 1SEBB 2VRAA 4F8TA 3MO1A 4LCYA 2GFBB 1E4WL 3CDCA 4J23A 4LSSH 1HINL 4BQBA 5KZCD 1M7DA 3GKZA 1DBAL 3EO9H 4WTXA 3KLHD 5TFSL 1GGBL 1PAMA 4R0LA 4LCCA 2CGRL 5T33L 4ONFL 4TSAL 3NN8B 3FT3B 4PJHA 1UM5H 1CFTB 1JGDB 3FQRA 1WZKA 3ESUF 4ZOCA 4RMWA 3BRDA 5HYJA 3SCMC 4JPIA 4L4JA 2HJKA 4EZMA 3JUZA 3V4VH 3FZUC 2ITCA 1AGFB 2G75B 2QLVB 4NJ9L 5L2KB 3QUXA 3ARSA 3OWEA 2XG4A 3EYUH 5CGYC 1ZLWH 4L9DA 1JPSH 4X0KB 4JO3H 1JTOA 3KPSA 3REWA 2EIZA 4NNYA 5FUCC 2DQGL 4R96B 1G7JA 3QDMA 1WEJL 3G6JA 1MREH 2HAZA 4WUUA 4JAMA 1I8MA 4JFFD 1CTOA 3NZ8B 1UWEL 1KN2L 3WFBH 5I73B 4AH2A 4M48H 3LOWA 5DC0A 1INQA 1K5NA 4M7KH 3PIQB 1G9NH 4MSWA 1G7IB 5FCUL 3GBML 4OZGE 5IBUG 1RHFA 1TQCB 4OZFA 3TN0A 4M7LL 4NSKB 1D7FA 4L9LB 2FO1A 1AIFA 3C60A 2VXSL 1HHGB 3TYFB 5JDJA 3MYZA 1EV2E 3A6CL 5HI4C 4PS4L 3TN0C 3IJHA 1FH5L