4Y16C

Crystal structure of the mcd1d/nc-agc/inktcr ternary complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
202
Chain Sequence
b'TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Lipid and Carbohydrate Modifications of alpha-Galactosylceramide Differently Influence Mouse and Human Type I Natural Killer T Cell Activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 202
sequence length 203
ec nomenclature
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y16C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y16C02
3KPRE 3D39B 4GQ9H 1O7VA 4PTUA 3QHZL 2A0LD 3QUMH 2IQAB 2D03L 2VLRE 4XZUB 2NCMA 2OSLB 3UZVB 2YN3A 3EO0B 5D2LB 2XV6B 1LK2A 4ISVB 4JFYB 1E28A 3G08B 1MIML 3STLA 5EC1B 1WZ1H 3ULVH 4OLWL 4XVSL 3SKMB 5F9WB 4NWUH 1BBDH 5CHNA 2X70A 1OTUC 1B88A 2VDNH 1SM3H 4X5XA 5HYJD 3RIAK 1OGAB 1Z6JT 5AAWA 1A0QH 3I02A 4YDJB 4TNWF 3N85H 4NYLB 5DRXA 2DQTH 4D0DA 5I30L 4XBEH 1EHNA 4GT7A 5GGVY 3X11A 1AKJB 4KROC 4UT7L 3FQXA 1I85A 1NDMB 4GBXC 3TO4A 2X6MA 2I9TB 1EGJL 3RGVA 2MKLC 4FFYH 3V4PL 3WFDH 2XG5A 1FJ1A 3BE1L 1E4XH 4M9PA 4Z7OE 2V9QA 2ESVE 2GAZB 4OB5L 1I9IL 5JR1H 2F54E 5TQ2L 2HH0L 5H2BB 5JA8B 2XWJB 1QQDB 3L3OA 1FO0A 5GGVH 4WI4A 2DTSA 2HFGL 2Q6WB 4OCRH 3RDTB 5K9KA 2XRAH 4Y1AA 4OCSL 1QOKA 3QEQE 4NC1C 4XPHL 3A6CH 5C0JB 3RJQB 2UVEA 4YR6B 5JW4Q 4JG1L 1YMMB 5DJCB 2AEPH 3VFMA 5E2VH 4E41D 4HG4J 4BH7A 1NFDF 1P5UA 3VD9A 1JVKA 1Z0NA 4YPJA 4KK9D 4X4MA 5E8EA 4BKLB 3O6LH 2YD6A 3IFOB 3PJSB 3RRQA 1A6UL 5HHVL 4H8WL 3LS4H 1Q38A 5T1DH 4JKWA 1FFOA 5EA0L 4X6FB 3VWJB 1N59A 1EHAA 4LEOA 1LILA 2WANA 4KRPB 2YD9A 3TF7C 1NCNA 1I8IA 1R5IB 4U1JB 5F9WC 3TBWB 4L4TD 4XPBL 5HVWA 5HHXH 1QLFA 3SPVA 4XP4L 3P9LB 4DGVL 3L6FB 2EE6A 3LRSA 4QKXB 5JLZB 2DQFB 3K8LA 1FNGB 4PYHA 4Z18A 4CL7A 4EZMA 2KZ1B 4JRYD 2FHCA 3IU3A 1TLKA 2CR3A 3HPJA 3AS1A 3KPSA 3MV8A 4HWBA 4EI6B 5DS8B 3KYNA 3EYFB 4OBSA 2V2TB 1MRFH 2G9HA 4N0YL 1TTUA 4HW6A 1UJ3A 1Z0MA 5D71L 3QRGH 4PY8J 4UNUA 2ITDB 3H9SA 1ZHNA 4C55A 1ACYL 4DUXA 2OXHA 3JSSA 3DROA 4FQHA 3ARFA 2MQCA 3PQYB 4NM8L 4G5ZL 5D1XA 1AGFB 4LLVB 3N1QC 5J1TC 3RDTC 1NGWB 1QBML 1EBPA 1IEHA 4U1MA 1V5JA 3T2OA 4DK6A 4TUKH 2W9EL 3X3FH 3SCMB 5DFWH 2ZKHL 2BVYA 4HV8A 3MRPB 3LQAC 3VGAB 4RRPA 3C5SB 1CT8B 4WO4D 3IJYA 1Y6MR 5JXEC 1YZZA 4ZXBA 4PJIF 5DMJB 3GI9L 4M6OL 2W92A 4I5BB 5ICXA 4POYA 2AQ3A 1BECA 2ZG3A 1NEZA 1Q8MA 3ZTJH 1LEKA 3DVIA 1VADA 5C09A 5CJOL 1JFQL 3QWOB 1KJVA 4AH2B 3MLVL 1HOCA 3RWFB 2A74B 3SE8H 1A7OH 5TQ0H 5DT1L 2AK4A 5EOTB 3AM8C 3QH3B 2BOCA 2PTTB 1ZT1B 4JZNB 4Y1AE 2YUZA 3QHFL 3V79C 1NGYB 4R4ND 2EDRA 4CUCA 3DWTA 1W72L 1AD9B 2O5YL 5DK0B 3VFVA 2JIXB 2X44D 3MA7A 1ODAA 5IIEA 1ZEAL 1RZKC 5F7EL 4ELMF 3AGVA 5DJXA 4X4ME 2GJ6B 4ONHA 5HD8D 2XN9A 3SQOL 4LLMB 2FH6A 5F72S 4NO0A 4I4WB 2IADA 1MRCL 5TDNB 4PJGB 1CDBA 2PYED 1ZA3A 3ZHLA 1N0XL 4JO4H 3KLAB 2CDGA 1MCEA 3MRJA 3V6FA 3WSQL 4PPTA 3HAEB 4PRPB 3N06B 4U6TA 2HTKD 1NAMB 2V9RA 4NQSB 1MI5B 3ZTNH 1BD2A 3QA3A 4NKDA 3SCMC 1XF4A 1JRHI 2YBRA 4GXUM 1YPZF 1JGUL 3L3IA 3LOWA 3QXAA 4P2YA 2P5WD 5L7XL 3VGAC 2A6KA 4P49A 3KPSE 3MV8E 4L5FL 4D0CB 3M17B 4Y19D 3ZMRA 3ARXA 1QSFE 1LEGB 2H8PB 3QG6B 4ETQA 4XVJL 4N0FA 3STZB 5LCVL 1A6AA 2AJZB 4PLJD 2B1AL 3H9SE 1L6XA 4OFPA 1IBGL 3CVHA 4Q6IA 2AKRA 3MRRB 1SYSA 1ONQB 1A7BA 2AJVH 2IPUK 3C8DA 2JB5L 2JKXA 2CMRH 1QLEH 4L9LB 1GGCL 3Q1SL 2J8HA 1WTLA 4QRTA 1H3GA 1KN2H 5F7YC 3MLXH 4PJ9A 4HXAL 3SDAB 4G42A 1NDGA 1JGDB 4NQCA 5BVPH 1YY9D 3U0PB 2YK1L 1S5HA 3RNKA 4GO6B 1WZLA 1J1XL 43C9A 5D96B 4HLJA 3UBXG 3ZYOA 4RX4A 1NSNH 1AD0B 3GMLA 4ZUWA 1KLGB 3WIIL 5CUSH 5FKPB 3O9WB 4YHLL 3Q6GL 3DRTA 4UT6L 1FDLH 2WUCL 1BFVL 4FXKA 1A7QH 1WVZA 4G3YL 1TJGL 2CO7B 4HFWA 4J4PD 3MFFA 4ZUTA 1KB5H 3DETD 5C09E 4X4YA 3H6JA 5C0RL 4GW5B 4G8FA 4PP2B 1IAOB 3QUMB 3NABL 4BA8A 1UWXH 4HUWB 4RBPH 1CVRA 3MGOB 4GMTH 1JWMB 4EN3D 1CGSL 4K23H 3RWHA 3MLUL 5EUOA 7FABL 2WWMC 5F3BA 1R3JB 1XGUB 1ZK9A 1WBZA 4G43B 4MAYD 4X6BB 2DQEH 4OF0A 3MROB 1OGTA 3VH8A 1H15A 4QNPE 3K4ZA 3GMNB 2DWDA 2EECA 3GSVB 2DQUL 4PB9H 2EKJA 5DJ8A 4MD0A 4U6XB 4I9WE 4GKOA 4M62L 2XN9E 5FGSA 1SY6L 1MWAL 5A43C 4K9EH 4FTVB 2ARJA 3EYQC 3WJLC 3VXSA 3STBA 4FQQB 3RUGB 4W4NA 1MCNA 1JGVL 4J3OC 1OM3H 3UMTA 1YMHB 2VZUA 3WEXA 4DW2L 1FCGA 1U92A 3RWGA 1N6UA 5IBTH 3T3ME 4GMSL 3LS5L 1BD2E 5I76A 1MNUL 5DJDA 4OCWL 4UIKH 4JFFB 3ZSSA 1N4XH 3HC3H 3NIGE 5D96C 4ZPVA 1CZ8H 2DBLL 1FLTX 4KZDH 3CD4A 4IMLB 3WNNA 4X5WA 2PKDA 3OAYK 4PRAB 3O9WC 3C6LA 3U9UA 1T2JA 3C5JA 4XMPL 3U46B 5DRWB 2P8PB 3IXTB 1MCLA 4OGZA 1W0VA 3S35X 4O9HL 1WEJL 4QHLA 2FLRT 1IGML 1I7UA 3NZHL 1DN0B 1DCLA 1UM4L 4LLAA 1JYVA 5JHLL 2Y23A 1DQJB 4C56A 5J9PB 3ZSTA 1YYLL 3WS3B 2BNRD 1JV5B 1CVSC 3V9FA 5D6DC 4HZLB 4WFGD 4I48B 5IHZB 1IT9L 4PRHE 4HCRA 2Z92B 4F7PA 4YDLB 3VDCA 5DD5H 3MRCB 4QT5A 3ULVC 1RAMA 5ABDE 2HRLA 3I6LD 2OTUB 5DDHB 3OAZH 1KPUB 5TDPB 4I3SL 3WNOA 3HS0B 1JPST 4LOUC 3QQ4A 5T3XE 4HUVB 4K8RH 2C1PB 2XXMB 1FAKT 4JLRA 5IWLC 5KS9F 2DAVA 4LL9A 4UT7H 5GXBB 5I1GH 5KSBA 1DQQB 5DUMH 2XACC 1CK0H 2F5BL 1MREL 2V7HA 4J3VA 4RAUA 5HTSA 1QPXA 1RK0A 4JRWA 2JK5B 4E0RB 4OCXL 5HYJA 3BOVA 3P77B 5HVHB 3WUZA 4GOSA 3EHBC 3GNML 4WFFD 4XNXH 4YZFF 1U3HB 4J3XA 5JDSA 5J7CC 2RQ8A 3C08H 3IDGA 2Y6SD 5EUOE 5LGJA 3BEWA 2LVCA 3PP3H 2NXZB 4UT9H 4S11A 3SKNB 4DCQA 3MLSL 1DDHA 3NIDF 4LVNB 2MKWA 1S7VA 3ZDZE 2VWEC 2QTEA 3OWEA 4BYHA 3RKPA 4JHAH 1HI6A 3BP7A 4CNIB 2HLAA 5MERB 4JY5L 5B8CB 5KN5B 1GAFL 3UZEA 2G5BA 1J88A 2HWZH 5EZJA 4K71B 1FCCA 1MCCA 4P9MH 1FH5L 1QFWH 1BEYH 3VXSE 1D7FA 4JM4L 4KGLA 4JGMA 2YZ1A 4C83B 1DFBL 4HHAA 2JJSA 3KPRB 1QR1B 1K5NB 3ZE0F 2XZQH 3EYVB 2VLRB 3IDJB 4NNYB 4YDLC 5FKAA 4U7MA 2FIKA 4U6VH 5I8EA 2A77L 2O93L 3VFRA 4QCIA 3H42L 1FPTL 4EOWH 2Z91A 5ILTL 3FQUB 1ZVHA 4LVEA 4RZCA 2A2QT 1MVUB 3K74B 1RIUL 1FL6A 3D9AH 5E6IB 3TC9A 1FV1B 4HJGA 1FL3A 4ORGA 2DQGL 1YEKL 4L4TA 3TWCH 1CYGA 1MAKA 5DWUH 5HI5C 1YEFL 4X6DE 1IILE 5HVHC 1OARL 5JO5A 1DE4A 5HY9B 4C56E 3BO8B 3FRPG 2MSPA 3OF6D 5C0NC 4JAMB 3IB4A 4CN6A 5GZOC 1L7TL 1R3IL 3JV6A 4TTGA 4J6RL 4PR5B 2FJFB 2ESVB 5HYQA 5D6CA 2F54B 3HN3A 1J11A 3U4AA 2X9WA 3CZJA 4NUGH 1IFHL 2VR5A 4LCUB 3S98A 1C5CL 3VXOB 3SE3A 2FX9L 3B5GA 4O2FA 4OZFA 1K4CB 1ZA6A 2BY3A 3L7EB 2FHBA 3RL2A 3BP6B 3MJ7A 1U8OA 4K71C 1F6LL 2V2XB 3NCJL 4M6OH 5HYJE 4OZ4B 4OF3A 5AAMA 1TVHA 3QI9C 5IM7B 1NQBA 4IHOA 4XP5H 2GYSA 3BI9X 2JJTA 4FQLH 1P6AB 2WUBL 5BZWB 2KBGA 4WO4A 2HP4A 3TBYB 4G9DA 2VE6A 4XPAL 1FNLA 1KN4H 3MOBL 5DTFB 4XPFL 5HVGB 5E6IC 1AGEA 1U3YA 3DYPA 1W72H 1ZGLB 5B3NA 5E8DH 2B4CL 3KDMA 5KTEH 3IU4L 5T3XH 4MJIA 2KKQA 4PP1D 4P5TB 5IEKB 1XF5B 5EZOH 5J6GB 4FABL 5EOQH 1NJ9B 1HYRC 1YNKL 5F96L 1DANT 4U1NB 1FNAA 1CDCA 2H2SD 1CL7L 1GVIA 4UOJA 3EGSA 2HAZA 2Z93A 1RJCA 4PTUB 3B2VH 4E41E 2B8OT 1CICB 1MCPH 3RAJH 2X1PA 2Y36H 3P4NA 1E27A 3VFGL 4H1LG 5IB1A 3CZFB 1CDGA 1LK2B 3W0WD 1SJVA 1JP5A 4NC0B 2FRGP 1QFUH 3QUKA 3WD5H 2PYEA 4L5FH 3ULSA 4D8PA 4X5XB 5D1ZB 4JO3L 1CU4L 3I02B 1N2RA 1MH5A 4XBPB 1X4YA 4L4TE 1MIEL 4YBLB 5DRXB 3U4BL 4D0DB 2ZUWA 5E99H 3BAEL 3X11B 3ELAT 4M7KH 4O58H 4BUHA 4KDVA 1TVBB 3FQXB 3TO4B 3QUXC 4JRYE 2P5WA 3RGVB 4KQ3L 3D3VA 3Q6FA 2EEDA 1I9EA 3FFDA 4HIEA 5CJQL 2YRZA 4ZFGL 1X3DA 4Y19A 4EXPX 4HD9A 4OUOA 1SJXA 4WNQA 1IM9B 2W9DL 1QZ1A 3BN9D 4TNVF 4Z7WA 2YK1H 4JFPA 1MFDH 3G5XA 3L3OB 3OJDA 4PTTA 1D5BA 3OKLA 5K9KB 1KOAA 4G8EA 4Y1AB 2YUXA 1CFTA 3UTTD 4P5TC 4KHTH 1TZHB 4QRPE 3TIEB 2PTVA 3SGJA 4KV5F 4Y4HC 5I18H 1G6RH 3TCLA 4PB0H 4WW2A 3VFMB 4XMKL 5HI4D 4BH7B 4YXHH 4UUJA 5MEQA 4WFHD 4OCYH 3LAFA 2BVPA 2ADJA 1BPVA 5E8EB 3GMRA 1KXTB 1CICC 3CXDH 4QOKD 3MYZA 1W8OA 3F12A 5J0BA 1FFOB 1P4BH 4LEOB 1UWGL 2NY0B 4LDLB 5IR1A 2AJSH 1MLCA 1PAMA 3P4OA 3OQ3B 4CU8A 1QLFB 3SPVB 5D7IA 5DVKA 3BPNB 3EOTH 1PY9A 4OFIA 4G7VL 5C2BL 5D1ZC 3PWPD 4J4PA 1A3RL 4OKVA 1BM3H 1JI1A 4YBLC 5CWSB 4B5EA 1V3KA 2FNBA 3IU3B 1RD6A 1K3IA 3HPJB 4EN3A 3KPSB 3MV8B 1MWAH 4QXGH 2RB8A 2NY3D 3QSKB 5HGBA 1J05A 3RX7A 3U30B 1A3LH 3KYNB 3TO4C 1QSFB 2KQNA 2Q8BL 4K9EC 3RGVC 4MAYA 1ZLSH 2G9HB 3QFJA 5I8OL 1UJ3B 3C2AH 3QNYB 1ZWIB 3H9SB 1ZHNB 2QQNL 2OZ4L 4EUPH 4FQ2H 3DROB 3ARFB 1QKZH 2VABA 1GHFL 4GMSH 5C9KA 5D1XB 3BZDA 4OCWH 5FM8A 5HGDA 1QFPA 5B3JE 4GKSB 1P84J 3T4AA 4XAWL 4U1MB 3TYFA 5ADOH 2Q3ZA 5K59E 2FX7H 5J12B 1F8TL 3FT4B 3B6SA 4UDUA 5I16A 3U9PL 5M95B 4NBXB 5FHBL 4ZXBB 2P5WE 4Z95H 3WDJA 2EDOA 1JZ7A 5ICXB 1NEZB 3QG7H 1NMBH 4MAUL 4Y19E 3G6JF 1VADB 5C09B 2NY0C 3RVUD 3BGAA 3GSXA 1DBMH 3CMGA 3OJVC 4RMSA 1KJVB 4WHTA 3O45A 1NCWL 4Z7WE 1HOCB 1PSKL 4S1SL 5DFTA 2AK4B 4LDOB 4NZTL 5FYKL 5EU6D 1HWGB 2BOCB 1FZKB 2OCFD 3VXUD 2BNRA 5A2LH 4HJ0D 4MA8L 1I8LA 4MXWH 4U2YA 1YEIL 1LK3L 3VFVB 3MA7B 5IIEB 5TE6H 5DJXB 4QHNA 4S1QH 3HC4L 2XN9B 2ZUQB 1Z9OA 1ED3A 4C59B 4JKPH 4LLDA 4R97C 3ZDXE 4NN6B 4NO0B 4YWGL 4PRID 1BZQK 2IADB 1ZA3B 5D1XC 1FC2D 4Y5XB 2CDGB 3V6FB 1B4RA 3GJFH 2VDKH 5I19H 4MNQD 4L3CA 5HI3C 3U0WH 3RY6C 5D7IE 4JQIL 3IDYB 1AI1L 5JZ7C 1AGCA 4XCCH 3VRLF 1BD2B 3QA3B 4NKDB 1XF4B 2YBRB 1M7IA 2AV1B 4P3CH 5F71A 3DURA 3IKCA 2YRPA 1MJ8L 3PGDA 2A6KB 1DEDA 1F90H 2J1KA 2YPVL 5B38A 4DUVA 4OZIA 4N1CA 1QA9B 1JL8A 2FX8H 2P8LA 4ZXBC 1LDPH 2I26N 1KBGH 2F19H 3V5KB 4XVTL 5F7NC 4ETQB 2J88L 3G04A 2X4OA 1A6AB 3CVHB 4L4VD 4Q6IB 2AKRB 5TF1H 5FO8A 1SYSB 3TJEL 4H26B 3U7YL 2IPKA 1T66D 3VA2C 1S9KC 1ZVSB 2HRPL 4YO0B 1UKSA 1T7YA 1FPTH 5ILTH 3KJ4B 1OWRM 3WIHL 5B4MD 2XNAA 4PRHB 3AVEA 5EH1A 1EXUA 3NTCH 1NDGB 4WFED 4S1RL 1ADQL 2BSRA 3RNKB 3VXRD 43C9B 4DGIL 5JXAL 3TZVD 4G8IA 2AGJH 2YR3A 4H1LH 3GMLB 3ARSA 2BMKA 5ACLA 4IJ3B 2ZUQC 4LBEA 5F3HA 4NN6C 3CDFA 5ITFA 2R2EA 4LPUA 3JV5A 3HZYA 4AZ8A 4DVRL 4FXKB 4S0TD 3KLSA 4Y5XC 1F58L 1FIGL 4HFWB 4ZUTB 1T0MA 3LH2L 4X4YB 4M48H 1FVCA 4D9LL 4NFBA 1I1RA 3P9WB 3SDXA 3CDGA 2DI9A 3RWHB 1BGXH 5EUOB 5F89A 3WO4C 1WBZB 5GISH 1EX0A 4GG6A 2BNRE 1OT2A 3RY4A 2OBGA 3QJHA 3MPCA 1OGTB 4N8CL 4LSPH 3VH8B 1H15B 4WFGE 1IZJA 1FFNB 4Z78B 3E2HB 2DWDB 5C8JA 3VD5A 4JHZA 2VH5H 4MD0B 3I6LE 2DMCA 4NP4L 1K6QL 2J5LB 3ARTA 5EN2A 5H37G 1C5BL 4JQVA 4FZ8L 2CK2A 1F4WH 2ARJB 5DZOA 1TQCB 4RGOL 3VXSB 1CIDA 4HBCL 4Q6YA 4TRPH 4OZGF 1NC4D 4NKOA 4LSSH 2GSIA 5DO2C 3C5ZD 3KJ4C 3RKDC 3WEXB 4MA1C 3TM6A 3X14B 4IRJB 1U92B 3RWGB 5C7XH 2V5YA 4PGDA 5I76B 5DJDB 1KCKA 4XRCB 4JRXA 4M61B 3BPLC 3IU4H 3JWOH 4WFFE 3MJ9L 2X89A 4GSDH 3LPWA 2BSED 4BZYA 5C0BD 4X5WB 2ZCKL 4OIIL 1A7PL 4JR9L 4IJ3C 2H1PL 3C6LB 4R4FH 3U9UB 4LASH 4XNYH 1G6RB 3C5JB 3BPCA 1X5XA 2WWKT 1I9JH 2QEJA 1AFVL 2A6JA 4OSUL 4QHLB 2XKNA 1IGTA 1I7UB 3QCTH 5BMFL 4X6DB 3H2WA 3MLZL 5CP3A 3TV3H 4JDTH 1K4DA 2CK0H 3FB7A 1L0XA 4C56B 1RUPL 1X6NA 4Y16A 5FYJU 5FECA 3IFPA 4OUUA 1NBZB 3TVMC 5E03A 2VLJD 4QLRA 4F7PB 1MPAL 5LGHL 5L88H 4QT5B 3MUGA 2IBZX 1JNLL 2LU4A 2I07A 5D7LD 5DJZA 2HT2D 2B2XL 3O81A 5BZDA 1KIPA 3E2HC 2OYPA 3G5VA 2VNCA 1CFBA 1FHGA 3EO9L 3MYJA 2QQKL 3W0WA 2J5LC 4JLRB 3HR6A 3CCHA 5EFIA 2RCSL 2EO9A 5KSAC 5ENWA 3VFOB 4PY7A 1QACA 1TQCC 3C6SA 3MLPA 4HF5H 3ARQA 5DGRA 1MOEA 4MZ3A 4H0GA 3MCLL 5ACMA 1G7IA 1MEXH 5HYJB 3DNKA 4LLUA 2X10A 3FTGA 4LSRH 4NJAH 1CGTA 4OFDA 4OI9A 1IGFL 4EUPB 5IMKB 1VACB 4IRJC 3IDGB 5FO9A 3SDXE 3B8YA 2B5IB 3GHEL 4P4KD 2ZCHL 4U3CA 3UTZA 3BEWB 1EJOH 2Q7YA 2YN5A 5KW9L 4GG6E 1KLUB 2VXQL 4QO1A 1S7VB 4ODVH 1IE5A 2R0WH 4HS6A 4OLXH 5GSVA 5IMOB 2FJGA 1CDHA 1HI6B 2HLAB 3WE6A 2ZNXA 4NOBA 1D5IL 2VLMD 4R7DA 5FFLA 2G5BB 1FFPB 3VG9B 1I1YA 4M1DH 3GMMA 5EZJB 3P0YH 3GSOA 5GPRA 1ZSDA 1MCSA 2Y07H 5I0DA 5E2UL 2NQCA 1G9MC 4FFWD 3UTTA 1WIPA 4HIHA 2GFBA 2FL5A 4HHAB 2GI7A 3QNXB 1U95A 1X5HA 4ZTPL 4F3FA 4U7KA 3RVWC 4NZRL 1HE7A 1TPXB 4NO2A 4YIQB 4E41B 4MGXA 1V7MH 2G5RA 4L1DA 3BZ4A 4HPOH 5FKAB 4R8WH 4XP1H 2MJWA 3QPXL 2HJFA 3ULUL 3IDIA 1A3RH 4RMVA 5CLTA 2NYYD 1CGVA 4QOKA 3KPLA 1CE1L 5I1LA 5DUPH 1FL6B 4KTDL 4HJGB 1KYOJ 2IAND 2Q8BH 3MV9D 3VXNA 4N8VG 3JVGC 4L4TB 3GSNH 5I8OH 1A5FH 4MB5A 4WU5A 3NH7H 4ODHL 3PWPA 1I3RA 5IFHH 3EYSL 1A4JA 4KAQL 1DE4B 5GGSB 4YE4L 4JRYB 4F7CA 1Q72L 2WBKA 3N50A 3BRDA 1GOGA 3MLWH 4FQCH 2B5IC 4M00A 4OF8A 4OGAD 3R8QA 3MV7D 4K07A 4KGJA 4XAWH 1YQ2A 5IROA 5HYQB 1OAKL 1CDIA 4Y2DC 2D7OA 4FXGA 5D6CB 3PGFH 2MTPA 2D31A 3K2MC 4O2FB 4OZFB 1S3KH 1EHLL 3W0WE 2HKHL 3M07A 2YKLH 1U8OB 3VG9C 3U9PH 1JCKA 4K7FA 4HH9A 2E27L 1EGJA 3FAXA 3VG0L 4L8BA 4UB0L 2JJSC 2WZPD 4WIQA 3ZKND 3IJSA 4XC3L 4LU5L 1TVHB 3LV3B 1P4LA 4IHOB 4B7IA 2LU3A 1EVTC 5E4IA 1D6VH 2XYCA 2OL3L 4P9HL 3CAFA 2IJ0C 1R24A 4QRSA 4S1SH 1J0YA 3FKUS 2X4NB 4WO4B 2F53D 4G9DB 3UO1L 5I15L 2VE6B 3N0PB 2PO6A 1U58A 4ESKA 2BVOB 3O0RL 1LK3H 4U1SA 4QHMA 3LN5A 3KDMB 4AEHL 5FA4B 3K80A 5FB8B 1MFBL 2AI0L 5GSRA 1G9NH 2VZ3A 4YFLI 25C8H 4S1DD 5EU6A 1SJHB 2ZZUT 3UTTE 2APTA 3VXUA 3KYKH 3EOBA 1FBIL 2Z93B 1HDMA 5DHVH 3RHWF 2VZ1A 2DMKA 2DQCH 3P4NB 1E27B 4WFHE 2YC1A 4L8CB 4XMLL 3RU8H 4LQFL 1DZBA 3GSUB 1F42A 8FABA 4X5LA 3O6FD 3GBML 4X7DC 3S36H 1FNHA 4QOKE 1DSFL 2CIIA 4GXVL 1UQSA 4PRIA 1TNMA 2ADFH 1QLRA 5TDOB 5D2NA 2HT3D 5E8NA 2WM0A 1BBJA 1MJJA 4MNQA 2VXTL 1NFKA 3FN3A 1HZHH 4H88H 4OD3H 5GQBA 1D9KC 4FZEL 3IETA 4FS0A 2IBBA 5T5FH 2P5WB 5F6HI 3ARYA 4IRSD 2IAMD 1A6VH 2HRPH 4ENED 1E4KC 2W59A 1VDGA 3FFDB 4WO4C 1JNJA 3MRFA 4Y19B 2V17H 1BOGA 5I9QB 5ECJE 4WNQB 5D1QC 1CDUA 1A9BA 4Z7WB 4JFPB 4PTTB 4L4VA 1TJHL 1D5BB 3OKLB 2DM3A 3MX0A 1JTPA 4NQED 4G8EB 1XF3A 1CFTB 3QXDA 2NPLX 4NBYB 3OR6A 3IGAA 3TCLB 3HMXH 4WW2B 1NANI 5C6WH 1T20A 3QQ9C 4UUJB 5TE7H 4Y4KD 1IC7H 2N4IA 4WENB 1GZPA 5ICZA 2ADJB 5FCUL 3VXRA 4RFOH 5CJXA 3GMRB 3T77A 3TZVA 2QSCL 3G5YA 3LMJL 1OWWA 5JIHA 3F12B 1A6TA 4QHKI 4LCIH 3DI3B 4IIQA 1GIGH 5HD8C 1C1EH 5AYUL 3L95A 5DMGD 1CD0A 2DBJA 5IR1B 1MLCB 4BFEA 5KSVA 3RA7L 2QBWA 5D7IB 3V95A 3S37L 2DQJH 3FQTB 4W4OA 1RU9L 1DVFD 4U05A 1I1AA 4OKVB 1BQSA 3P0VL 1JZ6A 5FYJL 5L8JB 5IT2H 1AXIB 2BC4A 2HTKC 3KXFD 4FQXC 5B39G 3BQUD 4EN3B 1C5BH 1XFPA 5M94B 2XQYK 5EU6E 5HGBB 1J05B 2P49B 4QRRD 1C5DB 5T3ZL 4G80B 5MI0C 3VXUE 1J9CT 3O3BA 3D85D 2R69L 4KPHH 4P99A 4MAYB 4KKLD 3KPMA 4KI5D 5LQBL 1X44A 5I1JL 1BQHG 5I9QC 2Q87A 1KFAH 5ALBL 2VABB 1K85A 1HXMA 1J86A 4I2XA 1YY8A 2VN7A 2ZG1A 1LP9F 5HGDB 1H0DB 1J7VR 3J8F7 3T4AB 5I8CB 4YHNA 2R4SH 1I7TA 3JWOC 4MB3A 4LAJH 5DHYA 1I3UA 3FQRA 5D2NE 3TYFB 5BOPA 3D69A 1FAIH 2YUVA 1NL0L 3C5ZA 4Y89A 3QDGD 4MNQE 2A6IA 4UDUB 5HYIA 2EC9U 1YY9C 5I16B 5DJAB 4OM0H 1F4XH 2PXYD 5BMFH 4UILL 4ERSH 4MJ6B 3R06A 1JJUA 2FHFA 2GT9A 4JFED 5C0CE 3VE0A 4TQEH 5GRJL 1OAQH 4H20H 5D7KD 5C0BA 2ZUUA 3GSXB 1VEOA 3NCYS 2VKWA 2VO5A 3DUSA 5JQ6L 5E2WL 5C1MB 2JCCF 1L7IL 2BXYA 1EZVY 1IKFL 4OFVA 3ARUA 3MR9A 4WY7L 4L4VE 1S7SA 4PJXF 3LSOA 3HRZB 3DETC 1N5YL 4HFUH 2H32A 5HDQL 3RVXD 1P7QD 4NZDA 4C57C 2BNRB 1DQDL 3OKMB 4EN3C 1KCSL 1EA9C 1WSST 4UTAL 3GFUA 2VLJA 1B2WL 4JPWH 4MAYC 3BD4A 3BHBA 2YD4A 3VXRE 1G0YR 5C9JA 5D7LA 2I60H 2EDQA 5ITBH 5HDOA 4LLDB 4Y5YA 3EIFA 3VMNA 1A2YA 2Q1EA 4FQJL 1MFEL 1TENA 5EIIB 1YEGL 1IGJA 2OJZH 3B9KD 4L3CB 3S4SA 4DUWA 3K4AA 1WWBX 1IAIL 3BT2L 5K9JH 2NY7L 1AGCB 4XTRD 2Z8WC 1PZ5A 4P3WA 4HS8H 3PWUA 3CH1A 3IRZA 1M7IB 5D2LF 3DURB 3IKCB 2DLHA 3PGDB 4P23D 3UTOA 4X98A 1BF2A 12E8L 5I74B 1SY6A 2CH8A 1MY7A 3MCKA 5B38B 4P4KA 3DV4A 2P8LB 1HHHA 3PL6D 4F57H 5SV3A 1U8IA 4DGYL 3CU7A 2JTDA 3G04B 2X4OB 2IGFH 5DR5L 4P2OC 1OTSD 5F6HJ 3V8CA 1KENH 1RQ5A 4LRNH 4AIZA 3RX5A 2GJZB 3LKRA 1TDQA 2FATL 4BFIB 2IPKB 3DHMA 4I2XE 3G6JE 1TMCB 4XHJD 5DA4A 2L0DA 1CR9H 1SMOA 5FUZH 3O3EB 5IW1B 4K3HA 3MRBA 1E4WL 2XNAB 4NZUL 1EXUB 5T1LB 3T0BA 3FHQA 1HHJA 4JPVL 6CGTA 1AHWC 5H8DA 1I8LC 1RZFH 4N5UA 4UTBL 3FFCD 1PVHA 3AB0B 3SO5A 3LQZB 1M6OA 1BJ8A 1A3QA 4G8IB 3QCVH 1E6JH 2JELL 5FYKD 2BMKB 4LBEB 4FNLL 5DRZA 5F3HB 4OCLC 4YE4H 5ITFB 2R2EB 3S96A 5C0BE 3HE6A 1T1YA 5CINL 3N1GC 1T0MB 1VFOA 3JWDL 1INDL 4JKMA 3MV9A 2UY7A 3V7AG 1NUDA 1U8QB 4UV4L 5DZNA 3SDXB 4JFHD 3HNVL 5F89B 1GCFA 3SE4A 3T2NL 2CIKA 4GG6B 1DP0A 2BCKA 4P4RA 4AENA 5I74C 5F6IC 3QJHB 3FB5A 2Y6SC 3NPZB 3PDGA 4RA0C 3F7RA 3MV7A 4GFTB 4PJHA 5C8JB 2B39A 1LO3H 3HG1D 3MBXL 2R4RL 2LU7A 5D7LE 2VDQH 5GGQH 5EN2B 3RGHA 5E8PA 2MPAL 1BWWA 1H3XA 3NFSH 1EEYA 3OB0H 2OL3H 5D5ME 3W9EA 1RVFL 4NKOB 1NFIA 2ZOLB 2GSIB 3L5IA 2O26U 2X1WL 3SBWC 4BZ2H 4JJHA 2VQTA 3DVFA 4HKBB 4XCFH 4QHUB 1U36A 1AJ7L 2R0KH 5IJVA 2GKIA 3PABB 4PGDB 4PJBA 4X6CA 3AB0C 1OD7A 1PFCA 1WAAF 4GKNA 1YYML 5CGMA 3O2WL 1JYNA 2F53A 3Q48A 4R0LC 4G7YL 1G9NC 4JCMA 1I7RA 4NKQB 1BOYA 3BPCB 4UU9B 1JWUA 4RNRA 4ZFOL 1AXTL 3ES6A 5IGXH 1IGTB 5L0QB 5L2JB 3RZCD 2J8UA 1K4DB 1R3KB 2VLME 1D5ZB 4IDJL 2N7BA 4HIXH 5FECB 3IFPB 4WW1A 3LN4B 3MUZ1 5BOZG 3DARA 5AWNL 3MUGB 5IVNA 4MJ5A 3IYLW 4WDIB 2PYFA 2I07B 2W60B 4ORZC 5DJZB 5I17A 1FNSL 4U4BA 5BZDB 5C08D 1T89C 4RDQF 3MTRA 5BQ7A 1RPQA 3MA9H 5ERWA 4PBXA 1GXEA 3B8SA 3MYJB 1T80A 3TH3T 3W0WB 4LP4A 3Q0HA 3FZUD 1S9VB 5EFIB 3O6FA 5D8JH 5I1HL 5ENWB 4PJCE 4PY7B 3C6SB 2VSCA 4JFQA 1HKLH 3ZKSD 3HE7B 3I9GH 2IANE 5JMRA 1QG3A 4LLUB 2E6JA 3K1KC 1X4XA 3FTGB 3MV9E 3G6AB 2DL2A 3A0OA 1YJDH 2NLJB 3UTZB 1JF5A 5EIVA 2N7AA 4D3CL 2Q7YB 1IAMA 3E6HA 4PJGF 1FQ9C 4IRSA 2IAMA 3HLAB 3TESA 1UM5L 4HS6B 35C8L 3MV7E 4GRMA 2VDPH 4PGCA 4YDKH 1CWVA 2VRAA 3WE6B 1HINL 1MFNA 1U6AH 1Z2KA 2J6EL 3QIWC 1I1YB 3GMMB 5C0FB 1EFXD 2CRYA 1ZSDB 3O41B 5L0QC 3LMJH 4NQEA 1KEML 4PP1C 3UTTB 1FL5A 4HIHB 4AL8L 2GFBB 2FL5B 3CFDA 4AYFA 2IMNA 4WTZG 2OTWA 2FO4B 3FO0L 1HSAA 3X17A 1U2HA 1J10A 2W65A 3BZ4B 3OL2A 3H3PL 2H2SC 4Y4KA 1F6FB 1KCRH 3S37H 5C6TL 2AABL 2H32H 4EVNB 2HJFB 3IDIB 4AT6A 3RL1A 3A67L 4HC1H 4AM0A 4QOKB 3NIFE 5FYJH 3BSZL 1HNGA 3OKDB 4K94H 3V0AC 5I1LB 5D70H 3JZ7A 2F53E 3HCVB 5CZVH 2PW1B 3EFFA 4WGVB 3MMEA 4ZO7A 5T3ZH 4FFZH 4K7PL 4R7NA 5IK3B 2R0ZH 3VXNB 4DKDC 1UWEH 3RX8A 5J06A 3MGTB 3BD5A 3L5JA 3HE7C 4WU5B 3CFJB 2IH1A 1FG2B 4M7LT 1INQB 4ONFL 1A4JB 1IAIM 3DGGA 3RIFF 2J8UE 3KXFA 5EO1A 4F7CB 3BQUA 3BEVA 2QHRH 1P7KA 2NY3B 1RUKH 4QRRA 2V5RA 1YNTB 1FP5A 3EFDL 4FG6D 2XA8H 4QXUH 3N1FC 3O2DL 2R1YA 5JW5A 2D31B 2QADD 3VGBA 5I1EL 1CF8L 2IALA 4ZYKA 5CEZL 3V4VL 2AEWA 3QXVA 1EEZA 1KTLA 3O3AB 4KMTL 1S8DA 4K7FB 1FYTD 4HH9B 2QL1A 4MNGA 1RUML 1FGNL 3FOMA 4L8BB 4BQ8A 3JBG7 5TFSL 3DX9A 4GAJL 3P4LA 1W0YT 3O8XC 4X80L 1P4LB 5EZIH 5C07D 5JQ6H 1IM3A 3LEYH 4L29A 1H3PH 4UQ3A 3BKCH 5FUCE 4RISH 1DN2A 1R24B 4HWZA 4QRSB 3H0TA 2R56L 2C3VA 1YUHA 3O6ML 2PXYA 5ID1A 4KDTA 4LK4A 1QUNA 3RUGF 5EOCH 5T5NF 3WKML 3EJZC 5JPMA 2GTZA 1OSPH 1JGEA 3ALXA 4U1SB 4DTGL 4ZMAT 2IPTL 2I5YH 3LN5B 4G6KL 1H5BC 1HSBA 4G6JH 4EJ1C 5GSRB 3I3EA 4CU6A 4V1DD 4I3GA 3ULUD 4GRWE 2C3GA 3MLRH 4ELMA 3QWRD 2WP3T 1TITA 1KG0A 5EU6B 4NQEE 3LIZL 4OTXL 3VXUB 4FXLA 5SWZD 3EOBB 3NACH 3V4UH 4Z7NF 1HDMB 2NY3C 3SEPA 2VSDA 3WUWB 4DFHA 4PD4J 2YC1B 5IROC 4DKAA 5ADPH 2NY7H 2P5ED 4XPTH 1ZS8A 3UJTH 1NAKL 2DKMA 8FABB 2WIIA 4YHYB 4CMMB 1U8PA 4X8XA 4ELKB 5CSBA 5HYSA 2VR9A 1M1SA 1QYGL 2CIIB 2X1XR 3GM8A 3L3DA 5D2NB 5MP6L 5CILL 4BSJA 2C4FU 4DN3L 4Z76A 5E8NB 1BBJB 1MJJB 3B9KA 4MNQB 1T3FA 1UM6L 2C4XA 5C0GB 1M7DA 5DR5H 2XZCL 2FWOA 2OZ4A 4I0PD 1ZXQA 2FATH 3IETB 4M1GH 4DN4H 2FYYA 3KXFE 4JZOA 4LAQH 1MCDA 4P23A 3GSRA 3F6IA 4YHKL 3OKEA 3MXVL 1HH9B 3MGAA 4M3JA 3MRFB 4QRRE 3WN5A 3CH8A 3PL6A 4OQTL 3ZE2F 1CFVL 1LO0L 4JPVH 1A9BB 4KI5E 2VXVL 4L4VB 4I18A 1SMAA 3RVUC 3HNSL 1B0RB 3T65A 3QXDB 4GKZA 1RUAL 3OR6B 3IGAB 1T2XA 2I25N 3BFOA 4X8JB 4MNGE 3E0GA 4AEIH 1T20B 4X7FC 4J1UA 4CRPA 4Z7QE 3QZWA 2V7NB 3GBNL 1GZPB 4HJ0C 5ESVB 3MV11 3VXRB 3FFCA 3QDGE 2OP4L 3T77B 4EBQH 4JY6A 3TZVB 1CXHA 3G5YB 2OK0H 3TN0D 4KKCD 2X2YA 4P0DA 1A6TB 1CLYL 1OP3H 4X9BA 1CGUA 1VKXB 3EYUH 3TYGH 2ICES 4YHYC 1MCBA 4JFEE 3VU2A 1KCUH 3TA3A 1NGXA 2MCPH 1HYSD 1WISA 1FNEA 5D7KE 1XMWA 2EIBA 5TJWK 1HN1A 3OR7A 1OB1A 4M8VA 4KK5C 3UDWA 4YDIH 4JFXA 3ZHKA 1B6UA 3SDDD 4XP6L 4FQIH 4X99A 4YHPA 3VGEA 4FMFA 4WI9A 1E0OB 2DQHL 3O4OB 4M5YL 2CLVA 4CJ0A 3BDXA 2EH7L 5HPMB 3TT3H 2KL6A 4OD2A 3E3QC 2PTUA 3ZL4H 4D94A 1U8MB 2YPKB 2GSGB 2EE3A 4LARL 2DD8L 3HG1A 2R23A 2WBJD 1B0GA 5CMAA 1IEBA 5HHQA 1H3UA 4I2XB 1YY8B 3QO0B 5I1AA 2YWYA 4HPYH 4N90D 2AXFA 5B21A 1IEAA 4YHNB 1KELH 1W0WA 1IAII 1I7TB 2VDLH 3O2WH 5DHYB 2IFFL 3VI4E 5KVFH 3T09A 1NC4B 3E6FA 4BM7A 1YECL 2BJML 1BP3B 1BIIA 3C5ZB 3WHXA 4Z7OF 4E5XA 5B4MC 3V52L 2ERJC 1DLFL 4ACPA 2DDQH 2EH8L 4FN0A 3R1GH 1DBBL 3R06B 3WDIA 1ETZA 5EORL 5F7UA 2WAHA 4IDJH 3QUZD 3VE0B 2GTWA 3V7MA 4ZNCD 4HMEA 5C0BB 2BHUA 5FK9A 3UTPE 4TSCL 1BQUA 5EU5A 3H7LA 3WIHA 4XHQA 3T3PE 2VXUL 3DUSB 1ADQA 1YC7A 3T0DA 3ROOA 2EEBA 4KJWD 4B7LA 3F8UB 3MR9B 4W4OC 4EDXA 1S7SB 1FNSH 4ZOCA 3LQAL 3UYRL 1CXEA 4DEPB 4EDWL 2H32B 4YC2B 4E9LA 3RZCA 5SX4H 1H8NA 4KVCH 5DD0H 1MVFA 3VFPA 4PG2A 4JPKH 3CFKA 3RP1A 5KVEL 5KVGL 3IDNA 4C58B 1BFOA 2HFFA 3DUUA 4XT1C 2CPCA 3BHBB 3SOBH 5C9JB 1JHLL 3F7PC 1IVLA 5D7LB 3FFCE 2YD7A 1KCVH 4P3DA 1RUQH 2YPLD 2E9JA 3HZVA 1A2YB 4L8SA 3VFUB 4F8QA 5D5MB 1OAYL 1QFOA 3ZYZA 1IGJB 1KTRL 1MCOL 3IKKA 1YJDC 4NQVB 3S4SB 2E8YA 3DXAD 1LE5B 1PGRB 4OQ1A 4DQOH 4M7LL 3DMMA 1RZKL 3PWUB 3CH1B 3GUTA 3C5ZC 2UUDK 4LPWA 4U0RB 3QXUA 4XNQA 1F45A 3CX5J 1EO8L 5FO7A 4JFHE 3MCKB 3WL9A 2DICA 5K9OA 4P4KB 2VAAA 1X9QA 1CXFA 4M4PA 1LHZA 1I9RL 1U8IB 3O3DB 3VGHA 5BV7H 5CCKH 4XI5D 3LEVH 4AIZB 1ZLVK 1SBSL 4RMUA 3Q3GA 3WLBA 5AD0A 4NO5B 3LKRB 5I1IL 2CKBH 3HG1E 1WFUA 3ESUF 1LD9A 1N3NB 3ABZA 3P3YA 1EFXA 3LPGA 3MRBB 3U1SL 4LRIA 6FABL 4YC2C 4HJJL 1NGPH 2A9NL 4JM2D 5TE4L 1HHJB 1OLLA 3RVTD 1EMTH 2HVKA 4K94C 2QQLL 1JPFB 5I8KL 1TIUA 4LSTH 1M6OB 5DRNA 3ZDYE 5JW3H 4MA7L 1JNNH 1GOFA 5SWSD 4ZPTA 3C60C 2HT2C 4JHWH 5DRZB 1T1WA 4PJCB 4KHXH 4F2MA 4U1LA 4RMRA 4UOW0 2MQ3A 1A9EA 3S96B 1T1YB 1EH9A 1IC5L 1AE6L 2IANB 4QTIH 1R0AH 3T0ED 5FXCH 3MV9B 4ZUVA 2AXGA 1MCWW 4XXCA 3WHE1 1BQLH 5EC2A 1WQVT 5E94A 4R3SA 3W2DH 32C2B 2J3SA 4UZGA 2CIKB 4HIJA 2O5XL 4K3DL 2FB4L 2B0SL 2BCKB 4AENB 1PG7H 3FB5B 1BIHA 1YEHH 3I50H 4P4KC 1PZUB 2F8XC 3JUZA 3MV7B 4LDEB 2ZUTA 5DQDH 3AXLA 4G6FD 1JPSH 4R4BA 5SX4I 1OTTD 2VLKA 1I3GL 3NA9H 2Q8AH 5E8PB 5IG7A 2E6PA 5C08E 1FRGH 3MUJA 3L3HA 1Q0XH 1U41A 1A7NH 4ODSH 2AQ1A 4PJFA 1ZOXA 4NBZB 3W9EB 4F7MB 3O6MH 1NFIB 1XGYL 5T1MA 2DLTA 5KJRH 2UZIH 4HAGA 4FFWC 5LXGL 1XF2A 5IJVB 1FE8L 1EO7A 3S34H 4P57A 2D7TL 4XPGH 4H0IA 4P2RD 2NY5L 5C07A 3LRGA 3GRWL 1MAML 1MELA 1YN7B 1ND0A 2P47B 2H2PD 5CEXA 2F53B 4PFEA 4M6MH 4NKIH 2NYYC 1NLBH 1I7RB 3K2UH 2HMID 1JWUB 1A14L 3MO1A 2WMPA 5DMIH 3ES6B 3HA0A 5HGHA 4ODTL 2BSSB 4Z0BL 4YEEA 3NCMA 2J8UB 1WCBA 1YNLL 4RDQG 3WBDA 5FYLL 1BZ9A 3EDDA 3G6DH 3WNMA 4TOYH 4V1DA 2AJUH 3SDCA 2VLLA 4JDZB 4TN9A 4WW1B 3QWRA 3RIAF 1V3MA 3S35L 5SWZA 1GPOL 3H3KA 1A8JH 3FJTA 5JW4N 1I1FA 4OGAC 5MP6H 3AU1A 1WZMA 5I17B 4A6YL 3ZO0A 1DUZA 3HNTH 3BP4A 5BQ7B 2EKSA 1T6WA 4RSVA 1WBYA 2P5EA 4GQ9L 2VISB 4MJ2A 3QUML 1JN6A 4P59H 4JFOA 1JK8A 1MHHA 2GITA 3O6FB 5CS7A 3BH8B 3W11C 4F37K 1S7TA 3VFTB 4L8DA 3G9VA 2IBGA 2B1HH 4M6NL 4BJLA 3ULVL 2FGZA 4QNPF 2NY1D 2EDWA 1L9MA 4EKXA 1RFDL 3HAEG 1BBDL 4NWUL 3UCRA 2VDNL 4ZFZA 1HEZB 3B5HA 1CLZH 1YEDA 4I0PA 1IRAY 1U93B 3CSYA 3N85L 5A2KH 2RFXA 4LQ1A 3FN0H 1JHTA 4IRSB 2IAMB 3ECBA 1NPUA 2X1OA 1TZGH 4PJ8D 4GRMB 1D5XA 4OGYH 4HWEL 5IQ9A 4PGCB 3LHPH 4FFYL 2AK1H 3WFDL 3QDJA 3T3MF 1E4XL 1EJ6A 2DM4A 4X7TA 3RY5A 2XT1B 4GRWB 4R9HA 1JPGA 3NIGF 5JR1L 4NQEB 4PJFE 1FL5B 3CFDB 4XX1E 5HHPA 3SGDI 2R8SL 3CFCL 2OTWB 2EYSA 5GGVL 1HNFA 1FYTE 1X5JA 3OPZH 1HSAB 4JANB 4OCRL 4S1DC 2XRAL 4MD5A 2W65B 3C8HA 4G6MH 5AG8A 4Y4KB 3A6CL 3MRNA 2JB6A 3EDEA 2AEPL 5E2VL 2EYTA 4AT6B 1EEUA 5C07E 2M8XA 3RL1B 4AM0B 4RAVA 4K2UH 1P4IH 2ICWI 2XTJD 2YUWA 4NZJA 3O6LL 4O5LH 3WKNA 3EFFB 3LS4L 4RCAA 2IH1B 1VFAA 4KKBD 1LO2H 1DVFB 4J3TA 3DGGB 3SDDA 1T83C 5HHXL 5DC4B 3KXFB 5EO1B 3TFKC 3BQUB 5FUCC 3ULUE 3BEVB 5E00A 1KJ2H 1KLFA 1P7KB 3ZT7A 2F9BT 4QRRB 3I6KA 5SWZE 3D85B 5EIQA 4IRSC 2IAMC 3ZE1E 2Z8SA 1UACH 2NR6C 2R1YB 5JW5B 5CJ5A 1KULA 3AY4A 5F9OH 4GQPH 1MRFL 5TPWH 2WBJA 2P5EE 4ZYKB 2EH8H 3QRGL 3RI5K 1EEZB 1YEJH 2XG4A 5EUOF 1OAZH 1S8DB 3OAUH 4DAGH 4RQQB 4MNGB 3QAZB 5A1AA 1MI5E 3FOMB 5CZXC 3NCYP 3DRQB 5T5NG 3ZDZF 3LKQA 1T1ZA 3DX9B 1KNOA 1UKTA 3QDGB 1VESA 1NCTA 5J11B 3QUYC 1IM3B 4Y4KC 4L29B 1J12A 4UQ3B 2EIDA 1UA6H 2FGWH 4HWZB 3H0TB 4TUKL 3X3FL 2A9MH 3LQAH 1YUHB 2PXYB 3QEHB 5ID1B 1NUNB 5DMKB 2AJ3A 4ZOAA 5EO9A 4JFEB 1XR9A 1ZGLP 3CC5A 3QUZA 2BNUA 3P30H 3RWEA 4NRZA 2GTZB 4J8RA 2EXWD 1JGEB 4OV5A 1N64H 5DMGC 1ORQA 4MQXD 4BELD 3QIBC 4TUOA 1UYWH 3U36B 3CVIH 2UZYB 2LABA 1DVFC 1OHQA 1KG0B 4NSKA 3EUUA 4DJMA 1CFNB 4PRBA 4PRNA 3SE8L 1P7QB 2VOTA 1A7OL 5ICYB 5TQ0L 4EXKA 1TJIL 4PREA 1KIUA 3L5HA 2DJ4A 1CE6A 2E5EA 1T1XA 1ZS8B 5AG9A 1I8KA 1JZ4A 4KI5C 5SX5H 3RBGA 1H3TA 2WIIB 5F7MC 1U8PB 4X6DF 3JTTA 5HYSB 2DLFL 4Q9RH 1D5MA 3L3DB 4O02H 4CADA 3CLEH 5B22A 2EDJA 4Z76B 1T6VN 4EQ2A 1RY7B 3ARBD 5DD1H 3B9KB 5GGTH 3QAZC 1T3FB 3W81A 1KB9J 3DXAA 4L9DA 3BUTA 3WS6A 4JO4L 2FWOB 3WDHA 4LHUD 5GGUB 5BV7C 1TTGA 3MLYH 5GIRA 5J11C 2FYYB 2KH2B 4P23B 5F7HA 4KC3B 3NCFB 1G0XA 3ZTNL 1GYAA 3OKEB 3H9HA 3ARPA 2IF7A 3WN5B 3PL6B 5HSFA 5DJ6A 5F7DA 3TBSA 4CDGC 3BXNA 2XPGB 4NQXA 4XNUL 3R8BB 4PJ9D 1ZT4B 4NQCD 2W91A 3T65B 3TJHD 2D4FA 2QV2A 2X4RA 2R15A 2EXYD 4GKZB 5GJSH 1NCUA 3SHSA 2HT4C 3NFPA 3JUYA 2K7PA 5LBSH 1JYXA 1JWSA 4N90E 4RMWA 5J13B 2AJVL 4RFNC 4J1UB 5IJKA 3S88L 3QZWB 2CMRL 1QLEL 4JM2A 1F3RB 4JFFE 1KN2L 3F6LA 3MLXL 2COQA 4CGTA 3FFCB 2D7MA 5J3HC 1T7XA 5E56A 4PLKD 4JY6B 2CGRH 5BVPL 2QSQA 4LCYB 3VRIA 2MHAA 3RPKA 2R29H 5SWSA 5ESAB 5GGRB 3MOAH 15C8H 1UZ6E 1TZIA 1NGXB 1NSNL 2O5XH 3LCYA 3W5MA 2H26A 1FNEB 4KUCD 4UDTB 2ED8A 3OR7B 5CUSL 2Y25A 1OB1B 4Z77A 4W6XB 4JFXB 4PY8I 3T0EA 3B9KC 4X7SH 3CXHK 1FDLL 4X99B 4YHPB 3RNQB 3AUVA 1A7QL 1I3GH 3PWNA 1PG7X 1KB5L 1CI5A 1NAMH 2GJJA 4TVPH 2J2ZA 4PGJA 3IS0X 4YDVA 2CLVB 1EIBA 1RZIA 1PQZA 4P23C 4GMTL 1UEYA 2BZDA 2EO1A 4K23L 4M7ZC 4O2EA 3IDUA 1RI8A 1J8HA 1RZ7H 3HG1B 2DQEL 1RZ8A 1B0GB 4P5MA 4ZS7H 1RURH 5CMAB 4Z6AT 1IEBB 5HYFA 1OTSC 1X5LA 4PBWD 1CLOH 1Q9KA 2XZZA 4JZJC 5I1AB 2YPLE 3DBXB 3SGKC 4PB9L 2PUQT 3V0WH 1IEAB 1W0WB 2OMNA 2O5ZH 1P69B 3KPPA 1VPOH 1Y18B 4K9EL 5IHUL 5J13C 4J3WA 1BIIB 1WT5A 3WHXB 1DUYA 1WFOA 4E5XB 3DXAE 1S7RA 3AS3A 1RIVH 2R1WA 3QULB 3SN6N 5F8RC 1UENA 1OM3L 5HJ3A 4I3RH 4P2RA 1ETZB 3LKOA 1OAXH 5GS1A 3QB7C 5IBTL 4GBXD 2GTWB 2LTQB 4UIKL 1N4XL 3HC3L 5EU5B 4O00A 4MXQC 1CZ8L 4HULB 1PY4A 4E42A 4KZDL 3S35H 1CBVH 3OSKA 4WI6A 4XH2A 3ROOB 2E9IA 1YQVH 4LFHD 4NGHH 4LCWE 3B9DA 1P2CA 1ZLUK 3TNNA 1V7NH 1UZ8A 3RZCB 2ORBL 3FB8A 2F58H 2P8MA 3DYOA 3MBEC 5IFAH 1TETH 5H35B 2Q7NA 3AAZA 3VFPB 3WNPA 3CFKB 5D7JC 3IDNB 1BFOB 2HFFB 3DUUB 8CGTA 4PUBH 4M6NH 5TF0A 1IC4H 3NAAH 1RFDH 2DF3A 4P3DB 2FO1A 5C08B 3HZVB 4WVRA 4FOMA 5DD5L 4R90H 4S2SA 5MEPA 5SWSE 3MSPA 4KJQD 1QNZH 4M6AA 2W0PA 5E0QA 5L6YH 1KJ2B 4O2CB 4HWBL 4JFDD 4B53A 2E9WA 5HDBE 1PBYA 1D6EA 4K8RL 1UH4A 2FH8A 1DBKH 3V2AR 4OLZH 5CD3A 3TEUA 2PR4H 5I1GL 3V6OC 2NY6C 3T0EE 4HWEH 5DUML 3LKSA 3VXQA 1CK0L 1MCJA 3DVGA 4XNQB 4Y4FA 2Q76A 1WZKA 1ZT7B 1OW0C 3S5LA 5LJYH 5FO7B 3MRQA 3HI5H 1F5WA 1ZKAA 3WL9B 5K9OB 4HXBH 2VAAB 3LDBB 5A2JH 2VZSA 4XNXL 5B3JF 3CPLB 2NZIA 3AFLA 3NFNA 3C08L 5E9DE 1IARB 3H7BA 1G84A 4K3JH 3KNBA 3CFCH 2R8SH 3EKCA 4PJ8A 5AD0B 3Q3GB 3WLBB 5DQ9A 5K59F 4UT9L 3WJJA 1SJEA 4YUEH 4WEBH 3NBNA 3WFCH 2EC8A 4L4JA 4AEFA 3RTQD 2D0HA 1LD9B 4NUJA 4JHAL 1EFXB 4JFZH 3RZCC 2XQBH 4PG9A 1VFBA 2OMBA 2HWZL 5I1CH 4HK0A 2HVKB 4P9ML 1QFWL 4JG0H 4ZG1A 1BEYL 4PJEA 2BSTA 4ZSOA 4Z7WF 2R9HD 4AMKH 4ZFOA 3CMOH 1MJ7H 4ZPTB 2XZQL 5E08H 4P2RE 3CUPA 5HBBA 1SYVA 4F2MB 4U6VL 1T04A 2FBOJ 2IQ9H 1E4JA 3FZUC 5GHWH 3QCUH 4WW2F 4EOWL 5IW6A 1RULH 2BOBA 4L3EA 5IB2A 5L2KD 4UNVA 2NTFA 4ZFFA 5GRXG 1YDPA 3O6KH 5EC2B 4LSDA 3D9AL 5EO0A 5E94B 4R3SB 5A2IH 4X0KB 3VFNA 3ZDXF 3TWCL 5DWUL 4HQQH 5BO1H 3ILPA 2UYLA 5F9JA 3LDBC 4JO2H 4NQDD 2VN4A 3M8OH 3UEZA 3WFBH 4RGMB 3AXLB 5D7IF 5AZEH 4R4BB 4NWTH 1AP2A 2BNQD 1I7ZA 5AZ2H 5IG7B 2QADB 4OFKA 3L3HB 3LB6C 3U4EA 4OGXL 4PJFB 2VXSH 2BVEA 3GHBH 4NUGL 5T1MB 1FYTB 4IMKA 4LRIC 3KYMA 4F58H 5F7FA 2H45A 2FSEA 5JTWA 5F7KC 4KY1H 5GS3A 3THMH 4P57B 3GDBA 3PWVB 3WXVL 5C07B 5FHAH 4M5ZL 5J6HA 3VWJC 2J6EA 4Q74A 1QHPA 4NT6A 4RRPG 4KRPC 3KGRA 4MJID 5DVMA 4XP5L 3L5WB 4FQLL 1LNUA 5MENA 4XNZB 1TJIH 3MO1B 3TO2A 3REVA 1E4XI 1NEZG 2SEBA 3OZ9H 1KN4L 4U6YA 4NN5B 1FSKB 1J1OH 4WI3A 4XXCC 4XWGH 1BZ9B 2YA1A 5CGTA 4V1DB 3R0NA 1B3JA 5FV1L 2VLLB 3T8XA 5E8DL 5KTEL 5T3XL 2DLFH 4L1HA 3MACL 4MCYA 5SWZB 5EZOL 2FR4B 4MX7A 4KVNH 4CW1A 5EOQL 5L9DH 3T0VA 3EZJB 1I1FB 5FA3A 1MQKL 3AU1B 4ALAH 5IQ7H 4PJEE 3J7HA 5GRWA 4PV9A 5DA0B 1DUZB 4FG6C 3BP4B 4HEPG 4RGMC 4ZSOE 3HHRB 4TTDD 3MZGB 5IESH 1WBYB 2P5EB 4UI2A 3B2VL 3F7YB 4JFOB 5I1KH 3IFLH 2W9LA 1MCPL 3RAJL 1MHHB 2QADC 2GITB 2Y36L 5F1IA 3OBAA 2XTJE 1QBLH 4L8DB 4F8TA 3BDYH 3I75A 4NJ9H 1QFUL 2ZCLH 4LLWA 1ZHKA 3ARBA 2OTPA 4OBRA 3WD5L 4R96A 3D3VD 3O2DA 2UVFA 4XNUH 1AGDA 1IAKA 2EDKA 3N1MC 4UV7H 5DF0A 4LHUA 3W39A 1YEDB 4I0PB 1XZ0B 4JEGB 2E7CA 3MRIA 3F62A 4JREB 1H8OA 4YHZH 2RFXB 3ARWA 3X12B 2G60H 1JHTB 1PLGL 1XCTB 5E99L 5BJTB 4M7KL 4O58L 1W8NA 1D5XB 5DSCA 5CSGA 3S88H 2BDNH 5IQ9B 4P46D 2J7LA 4XNZC 1PEWA 3O3UN 4X7TB 4U7SA 5HGGS 1EBAA 4M03A 4JO1H 2AV7A 4NN5C 1FSKC 2APXA 5HHPB 2BHYA 1MFDL 3QJFA 5EU4A 2EYSB 3FQNA 1ZE3C 5KOVC 4MD5B 3MRDA 2FJHA 3NGBB 1LEIA 2ICWA 4XAKD 4KHTL 4XB7A 1VB9A 3HR5A 3C87A 3RVVD 3DX8A 2ARJQ 2JB6B 5I18L 1G6RL 4PB0L 3VFWA 2V6HA 4YXHL 2EYTB 4LSVH 2FBJH 4NM4H 4ZQKA 4RAVB 4OCYL 3TN0B 3DO7A 3OX8A 2N1KA 4HGMA 3ARGD 2R39A 4XNMA 4P2CG 1I4FA 3KR3H 4FP8H 3CXDL 1F00I 4HG4K 3QNZB 1MCWM 2EDNA 4WV1B 4F7TA 3O9WD 2AK4E 1NBYA 1Q9WA 1P4BL 2Q86A 3ROLA 3P11H 4ONGH 3HI1A 1VFAB 5IB4A 3V5DA 5F1NB 1K9TA 2BP3A 2CJUL 3VGFA 2AJSL 5JW4M 3SDDB 1OPGH 3QFJD 1AC6A 2Y5TA 4N8PA 3EOTL 1MHEA 5LKNA 5E00B 5KANG 2Z0BA 4I0PC 2UWEA 4LF3A 1KJ3H 2DLEA 1BM3L 4JREC 4YBQD 3I6KB 4KJYA 5IF0A 4YGVB 1GGBH 4HSQA 4MHHI 3FQWA 4QXGL 3ULVD 3GB7A 5IHUH 1A3LL 3VH8G 4ZO6A 2X4QA 5BVJA 4OIBA 2EIZA 1ZTXH 5JNYA 1ZLSL 4L9LC 2WBJB 1HWHB 3C2AL 3SDXF 2BFVH 3BKML 4KKAD 1WF5A 4ZAKB 3SDAC 4FQ2L 2A1WH 1FO0H 1QKZL 5CBAA 4P9HC 4GG6F 4Y5VA 1J1PH 4HKXB 3UPRA 3LKQB 5FUOH 2ZJSH 1KNOB 4OQTA 3NGBC 2PW2A 2XY2A 4WCYH 4F15B 2CRIA 3KPNA 1QFWM 5ADOL 5JDJA 1N8ZA 2FX7L 2AJ3B 5IB3A 3AMLA 4BQCA 2EDYA 1RIHH 3DTXA 3VMPA 1XR9B 2ORBH 1VGKB 4PV8A 3CC5B 3QUZB 3BZFA 3TN0C 2BNUB 5H94B 4GBXA 3TT1H 3ZT6A 4ODXA 4J8RB 4RWYH 1B6DA 1CXLA 1WK0A 2OR9H 3QEUB 4UQ2A 4DKFH 1ORQB 4JN2B 1BVKA 4Z95L 2OXGA 4MVBD 1CCZA 4WV1C 1HYSC 4B50A 1MFAH 1BF8A 4J3SA 1SQ2N 5FDWA 3QG7L 1NMBL 4HKZA 4CVZA 2XFXA 3ZKXB 1N6QH 1INEH 1DBML 4NQCE 1Q94B 2OQJA 2C3HA 4PRNB 3UTSD 2LAAA 3DIFA 2AJYH 3BYYA 4PREB 5DEGA 1GC1H 3HPLA 5JOEA 3SGEH 4HWBH 1CE6B 3B4NA 1G7JB 1CIUA 1XIWD 1T1XB 4LVHB 4DZBA 2IPUG 1RZGA 4MXWL 1I8KB 1HXYA 4I0CC 3T0XA 2JJVA 1T7ZA 3AY4C 2YPLB 3JTTB 2WBJC 2OSLA 5TE6L 1SEBA 2CD0A 1MAJA 4CADB 4S1QL 4I77H 4ZAKC 1CD8A 1CG9A 2D0GA 2P44B 2J4WH 4ISVA 3U48A 3G08A 4JKPL 3IF1B 5EC1A 1XGRA 1JPTH 4OZHA 4JFDA 3N9GH 3DXAB 4FFVD 2HJKA 2GIYA 2D7NA 5GS0H 4Z7UA 2VDKL 5I19L 5HI5D 3IDMA 1A6WH 5GIRB 3MRHA 3U0WL 4F15C 4YDJA 1CGXA 4EUPG 2P1YA 3QHTC 4NNPH 4NYLA 4XCCL 1ROWA 5IVXA 1DBAH 2UWEE 3H9HB 3IDXH 4P3CL 4KWUA 2R2BA 3P0GB 1QVOA 2DTML 4GG8A 5GZOD 5DJ6B 5F7DB 3GMOA 1F90L 4NQXB 4NRYA 1M71B 2FX8L 4UIMB 4LCWB 1LDPL 2LQRA 1JBJA 1KBGL 2F19L 3F7VA 3NCCB 2WINB 4ZO8A 4CVXB 3RTQA 3BP5A 3NFPB 1UJTA 3VXPA 5TF1L 3ZKXC 5GZND 1JWSB 4KRLB 1HQ4A 4JM2B 4OLUH 1XGPB 4NHCH 1WBXA 4YR6A 4UMGA 3OG6B 1YMMA 3NTCL 3QI9D 3MNVB 2Z8RA 2BXZA 4LVHC 4NFCA 2MHAB 1PD6A 3EBAA 1MCHA 5SWSB 1ITBB 1E6OH 1IQDA 1I75A 1TZIB 4JVUA 2AGJL 1RJZB 4POUB 1J87A 1OY3B 3RWCA 2YEZA 4Z77B 1GGIH 4X6FA 1N7MH 4YXKH 1JGLH 1U3HC 5E6ID 3TPKA 3T0EB 1S9XB 3SJVD 1N6VA 1R5IA 3LEXB 5L2KA 5GRZA 3WS6C 5EBLA 5A40E 3RBSA 4MQSB 3PWNB 3TBVA 2NXZC 4NIKB 4Q97A 4YDVB 5JLZA 5CGYC 2DQFA 3MODH 4M48L 4LVNC 1RZIB 1FNGA 1BFTA 4KK6C 4OGXH 5E9DB 4WUKH 3ILQD 1BGXL 5I0ZA 4LKCA 4P5KA 1NCCH 4O2EB 2DQDH 5GISL 4EI6A 4NQDA 3QR2A 1XCQA 5B8CC 1KC5H 4G6FB 1RZ8B 4P5MB 1FLRH 2MOVA 2V2TA 4XI5C 4LSPL 1Q9KB 5KSBE 2BNQA 1T03H 3WXVH 2ITDA 4M5ZH 3GMPB 3CVHH 2VH5L 4OZFG 3BZEA 3KPPB 4JRXD 4QWWD 3QEQD 3LKNA 5FF6A 1F4WL 2X89D 1F3JA 4YAQB 2G2RA 3L9RB 4OZHE 2V5MA 4JFDE 4LLVA 1MSPA 3H3BC 1S7RB 4ZD3H 4TRPL 4JM2C 1NGWA 3UPAA 4OD1H 2R1WB 4AK1A 4LSSL 3RVTC 4Z7UE 5HJ3B 2AJXH 4P2RB 2CUHA 3LKOB 3SCMA 3EJYC 5GS1B 3TH2T 5C7XL 4O4YL 3QUXD 5IVXE 5DUBB 1RZJH 2H6PA 3JWOL 1CT8A 2IBZY 3MACH 4GSDL 4E42B 4Y16D 1RMFH 4OLVH 4XH2B 1MQKH 1JI2A 1P2CB 4R4FL 3L7FA 3TNNB 4LASL 4XNYL 1NMAH 5F7WC 3T0EC 4Q9QH 1UZ8B 2ZSVA 1VGEH 2XTLA 1C7SA 4N1HB 5JUEH 3IAGC 3FB8B 1I9JL 2P8MB 4MWFA 1B0WA 3QCTL 3RWFA 1QFWI 3TV3L 1HHIA 4JDTL 4Y4HD 4HH8A 1Y0LA 9CGTA 2CK0L 2FIRT 1E28B 3WNLA 5DXWA 2VL4A 3STLB 3MV01 4BQ9A 1NGYA 3OKYA 5ALCH 1KF9B 4QGTA 3DPBA 3KPQA 5CHNB 2X70B 5L88L 2DJUA 3IRPX 3EYOA 4GJTB 5J4MA 1BZ7A 4S2SB 1OTTC 3QISA 5MEPB 1DL7H 2GJ6A 2FEDD 2XWBA 2GK0A 1PLGH 3KPTA 4IEFB 4YJZL 3I3DA 1NCAH 1D6EB 3IJHA 3VW3H 3ARRA 1AO7D 1VEPA 1M05A 3KLAA 4ZTOH 1WT5C 2NY1B 3BUYA 4PJ7A 4HF5L 3LKSB 5L2KE 3VXQB 3DVGB 4ETYA 4LMQE 5KVDH 4PRPA 1NGQL 5GRVK 5F70A 1FJ1B 3S5LB 3MRQB 1Y6KR 1MEXL 2R0LH 3UZQA 4LSRL 1X7QA 4NJAL 3CFIC 4KFZC 5TGBA 3NFNB 5GS1C 1O7SA 3H7BB 3KNBB 1FO0B 4MNHA 2H2PC 1HIMH 4PJAA 4PJ8B 5DQ9B 1EJOL 4NQDE 4D0CA 2CDFA 4P46A 4ODVL 4WWKD 2R0WL 4OLXL 4HWUA 4J2XA 2BNQE 4NUJB 3STZA 4CVWA 4UINH 5C86A 4M8QA 3GRWA 4M3KB 2D4DA 4QY8A 1ZANH 3WJLA 1VFBB 1G9MH 4M1DL 4HK0B 3IFNH 3P0YL 2Y07L 3INUH 4KXZH 4HIIA 4PJEB 5E24E 2BSTB 2YXMA 4ZSOB 1N59B 4HCRH 4ZFOB 1JGDA 3JWDC 5C0DA 1I8IB 5KBNC 1V7ML 1T7VA 2CJUH 4HPOL 3CUPB 1SYVB 1AQKH 1NBVL 4R8WL 5KG9A 3LRSB 4XP1L 3UBXI 2Y06L 2XTJB 2VDRH 3ARGA 2BRRL 4YQXH 5HHOD 4MJIE 3S97C 1KLGA 5IW6B 2BOBB 3TBTA 5DYOA 5FKPA 3O9WA 4PRDA 1MJUH 1YDPB 4LPVA 5HHNA 5DUPL 3ET9F 4XC1H 1I85C 4A6YA 2KUTA 3SE9H 3VFNB 2HA1A 3GSNL 1A5FL 1UT9A 4JKLA 3QUMA 4N0UA 3BKMH 3NH7L 5IFHL 5MHSD 3MGOA 1JWMA 3C09B 4FQHB 5F9JB 1MF2H 4KH2A 1G7MA 2ADGA 4K8RD 4NN7B 3MLWL 4FQCL 5DI8A 3AS0A 1AP2B 3OGOE 1I7ZB 3QDAA 4PJ8C 3QFDA 5L8KB 1A7RH 2PYEE 4CVUA 5KANI 4Y88A 3U4EB 1UG9A 1A1OA 1FIEA 3PGFL 1J5OH 2XKSA 4JN1H 2X4TA 3S3JA 1UC6A 4HV8B 3HC0A 5IWLA 1QSED 3KYMB 5DFVD 1S3KL 1Z5LA 2YKLL 3EDKA 3IJYB 4DOHE 4WTWA 5JZ7D 3RUGA 1AQDA 4PJ7E 2PO6D 1KEGH 3D3VE 5DD3L 3A6OA 1LEKB 4XVUC 1D6VL 1LNUB 5GGSY 3BPNC 2WV3A 2XTJC 3TO2B 3REVB 4PJAE 4U6YB 3KHQA 1EEQA 4I1NB 1GC1C 2AERT 2E8ZA 4NNXA 4KKBC 3U30C 1F3DH 3T8XB 4LGSB 1GJIA 3RWIA 1UJ3C 1DBJH 1OP9A 4MCYB 3VXTA 3CK0H 3UTSA 1DQJA 1G9NL 3OAYH 4ONHB 4CW1B 4DKEH 2CR6A 1PX3A 1M7XA 3DVNA 25C8L 5FA3B 1OCWH 1U3ZA 3ARFC 4GAGH 5BCAA 4PV9B 3KYKL 4XAKE 4HZLA 3TGXA 2ZSWA 3GK8H 1XIWA 4NN7C 1X5GA 4IDLA 4NKMA 3MRJB 3PHSA 1OAUH 3ETBF 2WK2A 4HKJA 1JZ2A 2DQCL 1GL4B 5F1IB 5GS0C 5INDA 2E7HA 3RU8L 4OZFH 4C4KO 5J12C 3I75B 3S36L 3L3IB 4OI7A 1ZV5A 3QDMD 3QXAB 1ZHKB 2DTMH 3ARBB 2ADFL 4MB4A 1NLDH 2EE2A 1CQKA 4WEMB 1BHGA 1IAKB 4LHUB 3W39B 4GLRH 3BH9A 2JK5A 5AYQA 1Q0YH 3VDBA 3QFJE 1F4YL 3VWKD 4N0FB 3LQMA 1ZAGA 3UJIH 1HZHL 1ZVYA 1CDYA 3FMGH 4N0UE 5D5MF 4XXDA 1EO5A 3HMWH 3P40A 4H88L 3F58H 4OD3L 5B38G 1TQBB 5DSCB 5T5FL 4OLYH 4TYUA 1FGVH 1A6VL 3ULVE 4QRTB 4FQ1H 1J18A 3KHOA 1REIA 4PJ9B 2V17L 4HGWA 4MQXC 4LSUH 4G42B 4NQCB 2AV7B 2ICCA 4CNIA 1C12A 4U3HA 1S5HB 3QJFB 1GGYA 5EU4B 3GIZH 3FQNB 3A6BH 3NPSB 3JV4A 3MRDB 2V9TA 1LEIB 2ICWB 5C92A 3ALWA 2Z35A 3RKDD 4ZUWB 4I0KA 1CFSA 3PDOA 2F8VA 2CSPA 3VFWB 3HMXL 2MMXA 2XICA 4HWNA 1WUNT 1K5NA 4HLZG 5TE7L 4ZQKB 3DRTB 3V6ZA 3QI9A 3UJJH 1IC7L 3DO7B 3OX8B 3EYVA 4NNYA 4K7PX 4EEEA 3MFFB 4XNMB 1I4FB 3AROA 4RFOL 1I1AD 5T3XD 4G8FB 4IOIA 1CFQA 4RFEA 3VCLA 1VFMA 1KUMA 1WLHA 3IDYC 4LCIL 4KRNA 1NBYB 1Q9WB 2Q86B 3ROLB 1GIGL 1YEEH 1C1EL 3HI1B 5CSZA 5IB4B 5F3BB 5E6IA 4P48A 3ARBC 5D7SH 5E2TH 2VERN 3SJVA 3BD3A 2NY4B 2Y5TB 4MCZA 2DQJL 4KUZH 2WNGA 1MHEB 3OXRA 2EDFA 2UWEB 4LF3B 3ME0A 4PJCF 3U79A 5DJ8B 5IF0B 5IV2A 5IT2L 3U2SA 3UTSE 2B20A 3TVMD 2YOCA 5T1KD 3QPQD 3FQWB 4Q6IC 3GB7B 3UC0H 3ARDD 2X4QB 2EIZB 4KPHL 5JNYB 4F33A 1L6ZA 1X5AA 2ESVA 5CD5D 4PJ9C 3OKOA 2YMXH 4HT1H 1KFAL 5KSAD 3TJHC 5CBAB 1JZ3A 1FZMA 4O4YH 2EXYC 4Y5VB 3VMOA 4QGYA 1QEWA 4CJ1A 3SDYH 2K9UA 3UPRB 4AG4H 3DOSA 1D3CA 3QEQA 2W07A 3NPSC 4ZPVB 3QEGH 1RZJC 2CXGA 2PW2B 2R4SL 3W5NA 2I9LA 4OZIE 1FAIL 1AY1L 1FORH 3RZWA 1MFCL 5IB3B 2KQMA 4OZ4A 5I1DA 4PLKC 3DTXB 1VA9A 1P84K 1CGWA 4PV8B 1W0VB 1NGZA 4ODXB 3QUXA 4LVOB 4OM0L 1F4XL 4ERSL 2VDMH 5DJYA 1WWAX 2H41A 1BVKB 5I71B 3OAZK 3TBYA 5FEBA 3GI8H 1AXSA 4TQEL 3LZFH 1OAQL 3B9EA 4H20L 5DEZA 4HKZB 4CVZB 2CLRA 5DTFA 3WXWH 3FOLA 5E5MA 3FO2A 2EDHA 2OQJB 2DKSA 3NIFF 4NDMA 5EBMA 4POZD 2NY4C 1F4HA 1Z3GH 5IEKA 1XF5A 2G75A 1EDQA 5T33H 1UGNA 4HFUL 5BS0D 4M4RA 3HPLB 4HS3A 4Y4HA 3RVWD 3QQ4B 4RGND 5I73B 3VI3E 5GRYA 3O2VH 3VXMD 4DZBB 3GO1H 1RZGB 1HXYB 3G5ZA 5KSBB 1WIUA 2XY1A 4JPWL 4RAUB 2V7HB 1CICA 2J8UF 1NGQH 5GJTH 1RK0B 5IBUB 3V6BR 1SEBB 3PP3K 3CZFA 1KB5A 3EW3B 2I60L 1CG9B 4N9GA 5ITBL 5F9DC 5JDSB 1XGRB 1A6ZA 1L4IA 4OZHB 4JFDB 4Y5VC 1RJLA 4YLQT 2HJKB 5LGJB 5DJ0A 2OJZL 1AO7A 1AH1A 4Z7UB 3QO1A 3GSQA 1KIRA 3IDMB 1QSVA 4DCQB 3SJVE 1DDHB 5D1ZA 3MRHB 2XWTA 3MUY1 1LGVA 3RWJA 5K9JL 4XBPA 5DMYA 2GUOA 2NZ9C 5IVXB 4HS8L 3C6LC 3BP7B 2R2BB 2VC2H 3Q5YA 1QVOB 4GG8B 1TVBA 1ZMYA 3GMOB 5E8OA 4X4ZA 5K93A 3D25A 4LVOC 4Y2DD 4NRYB 2V5TA 2BVQA 4F57L 5I71C 2DI7A 2XOTA 3F7VB 1TXKA 4WWKA 2IGFL 5J8OA 4K3EH 3BP5B 1IM9A 3RTQB 1KENL 3MUHL 3VXPB 4LRNL 3BRFA 4IM8A 4M1CC 4OFYD 1IGIH 5DK2A 1NBVH 2FIKB 5I8EB 1HQ4B 2WQRA 2Y06H 4N1EA 2BRRH 4LGPB 2A0LC 4JRXE 4LIQE 3VFRB 4QCIB 1CR9L 1TZHA 5FUZL 3TIEA 1WBXB 2Z91B 3CJJA 1JE6A 4RZCB 5I73C 3HE6D 1JHKH 1MHPH 3BPOB 1RZFL 4YFDB 4GRWF 1FL3B 4ORGB 1IQDB 3VDAA 1HK6A 3MRMA 5ETUA 1R5VA 3QCVL 1E6JL 4I8DA 2MWCA 4KJQC 5HHOA 3RWCB 1ZLWK 2YEZB 5JO5B 1BAFH 4NO3A 5TH2A 1JRHH 1XH3A 5L2KB 4KZEH 5EBLB 4OV6F 4YX2H 1UCBH 2DRUA 3TBVB 3L5XH 3JV6B 4HUUA 3KJ6H 3OGCA 2FEEL 3QWQB 1V8HA 5CWSA 2E9BA 3DGCR 3WFEH 4LKCB 4P5KB 3T2PA 1ZA6B 3PWJA 4NQDB 2VZVA 1XCQB 3RL2B 1QSFA 3MJ7B 3PIQA 3QIUD 5CLWA 1WTGT 5FGCE 2BNQB 1X4ZA 3QNYA 2XZAH 1ZWIA 1CXIA 1LO3L 1F3DJ 5ESQA 2VZOA 5DD3H 3DUHA 4XP9H 2CRZA 3BZEB 2RAMA 3RTQC 2VDQL 5GGQL 1NUGA 1TPXC 3T1WA 5J89A 4QRPD 3LKNB 5FF6B 1F3JB 2G2RB 3NFSL 1QSEA 5C3LD 1XGQA 4KK9C 4GKSA 4ODBD 4KI5F 3RY6A 1AO7E 2X41A 4BZ2L 3UAJD 2APWA 4XCFL 2DL9A 1C16A 2C7UA 4OF7A 3BDBA 2R0KL 4TSAH 3MRKA 1D9KD 4HLZH 4MXVE 3FT4A 1S9YA 2R9HC 1AGEB 3BPOC 2H6PB 1QRND 4M02A 4MJIB 3REWA 4Z7QF 1T5XA 1UFUA 5D1QD 2ZOKA 3QQNA 5DVOA 3L7FB 4NOFA 2ZSVB 3EGSB 2L7JA 1AR1D 3PNWA 4JDVA 4Q2ZA 5IGXL 2DLGA 2PF6A 4MWFB 1HHIB 5IB1B 1Y0LB 4V2BA 4YXLL 1SEQH 1FZKA 4HIXL 3QQ9D 4Q7DA 4WHYH 4YFLF 1H3WM 5E6ZA 3SE3C 2KPNA 3QUKB 3HUJA 3KPQB 3WUWG 2PYEB 5AUMA 1TNNA 3EYOB 1BZ7B 3NVQA 3ULSB 4D8PB 4KQ4H 2YA0A 1DQML 1N2RB 1MH5B 2XWBB 1EUUA 1F4YH 2GK0B 3BWAA 3MA9L 4PJDA 4QEGA 1PG7W 4WGWB 4AY0A 3PWPE 5HHOE 3IJHB 5FAAA 4DOHB 5D8JL 1OF2A 1M05B 4IRZH 4Y5XA 1A21A 3QDMA 3BUYB 2R2HA 2V2WA 2JJTC 4PJ7B 1HKLL 3D3VB 3Q6FB 3S3PA 4HIEB 2ZPKL 4QXWA 3I9GL 4FQXD 1X7QB 2P46B 4CMHB 4XGZA 4JVPA 1UEMA 4LKXA 5TGBB 3VWKA 2AV1A 4LIQH 2EIEA 4KK8D 1QO3A 3G5XB 4HGKC 1YJDL 3OJDB 3VI4F 4MNHB 5MHSE 1Q1JH 4PJAB 4Z7VA 1QA9A 4R26H 1LO4H 2CDFB 2VIRA 4P46B 2A83A 3V5KA 1Q9OA 3ISWA 2VDPL 1T2QL 5MEQB 4YDKL 4M8QB 4MS8D 4QXTA 5IMMA 4YBHA 2DQIH 2BVPB 4QY8B 4H26A 1U6AL 2D3VA 4R4NC 5CP3H 3GKZA 3BMWA 4ZUSA 4OIAA 1ZVSA 4LLYA 4YO0A 1QSEE 3T3PF 4HIIB 3UBXA 5E95B 4M43H 5DGQA 4PRHA 1MRDH 2DMBA 4YHOH 4YHMH 3F7QA 1RV6X 5C0DB 4OM1H 2W0LA 3P4OB 3D1MC 1RHHA 3EDFA 5KG9B 1KCRL 4TTDC 1W72A 5IKCA 3ARGB 1P6FA 1FFQA 1N5AA 4HC1L 3B5TA 3TBTB 5DYOB 4PRDB 1S9WA 4K94L 1IGCH 5HHNB 5D70L 4BSWA 1J0JA 5CZVL 1FC1A 4FFZL 2VDOH 4A6YB 1FNFA 5D9SA 1MY5A 2R0ZL 1UADC 1OL0A 2OS7A 1QSZA 3QFJB 2NMSA 1UWEL 4MD4A 2ID5A 4N0UB 1CD1A 5BW7A 1KYOK 4CMHC 1C8PA 4X9IA 3Q5TA 3O4LD 1G7MB 2ADGB 2DB8A 4D0BA 3CLFH 4PLJC 3TVMA 5DI8B 3VGDA 5T1KA 2QHRL 1RUKL 4UAOB 3QFDB 4PRIE 1BX2A 3HUJE 3ARDA 1UH3A 4H0HB 4OT1H 2XA8L 2EE9A 3K81A 5D72H 3HZKA 4QXUL 1FFNA 5EWIH 4Z78A 2CLZA 3SGJC 4N5ED 5K9QG 4P46C 1A1OB 1AY1H 4JHBA 2X4TB 4WW2C 5JQHC 4RWHA 1MFCH 2NY5C 3B6SB 4Q0XH 2AEIT 2EC9T 3HC0B 4PJDE 5KSAA 3HI6H 1Z5LB 3NN8A 2D7PA 3T08A 1AQDB 2FECL 3QDME 1HQRA 1B4JH 3RVVC 3I2CH 3X14A 2F15A 4IRJA 4WHTB 5EZIL 3O45B 3LEYL 5LWYH 4XRCA 1H3PL 4M61A 3BKCL 1ACZA 1R3LA 4RISL 4GW1A 5GRUH 5JIPA 3ARGC 4J4PC 5F97E 4Z7VE 3FL7A 4P2OD 2C3WA 3FHAA 3QP3A 4R2GD 5EBWA 4GUPA 5EOCL 3ZDYF 1G6RA 1OSPL 4NNXB 4XWOD 2I5YL 3NMEA 3QHZH 4WFEE 2HYMA 2D03H 3RWIB 3AMKA 4G6JL 2WLZA 3VXTB 3GJFK 4X6DA 2GCYA 4QHNB 3UTSB 4FMKA 1ED3B 3MLRL 5DEFA 3DVNB 1MIMH 1P7HL 3BVNA 4YBQC 5BS0A 1HH6A 4OLWH 3SKUD 4XVSH 2ZSWB 4OJFL 1NBZA 1XIWB 3NACL 5I6XB 2ZUXA 3VXMA 3V4UL 4NKMB 3TNMA 4HKJB 1LWRA 4UAOC 3FONA 1JNHA 5ADPL 5INDB 5JHDD 1PKQA 4G9FD 4XPTL 1IMHC 1H9VA 2HFEA 3UJTL 5I30H 4KKAC 2PN5A 3KAAA 5IW3A 3VFOA 4PLOB 3S4SG 3BESR 1MWAA 1EGJH 2EICA 3JVGA 4OZIB 3DI2B 3V4PH 3BH9B 1KPRA 4W6YB 3BE1H 1ES0A 3OG4B 4OB5H 1I9IH 5TQ2H 2HH0H 5IMKA 4R6UA 4EUPA 1VACA 4XXDB 5FO8B 4IOFD 4HDIA 1FVDA 1XGTA 4APQD 4M1GL 4DN4L 2HFGH 4LAQL 1EERB 4OCSH 1KLUA 4XPHH 4Y2DA 4HGWB 4JG1H 4TNWK 4MVBC 5IMOA 5DK3A 2XQYG 3D0VA 2ATPA 1C12B 2BSRB 2IWGA 4OFYA 1FFPA 3JV4B 1A6UH 5HHVH 4H8WH 3X13A 2Z35B 1CFSB 3PDOB 5FYKU 5T1LD 5IMLA 5EA0H 4EI5D 3QNXA 2O61A 4AEIL 3TA3D 2CXKA 3TH4T 3V6ZB 4YIQA 3HZYB 3QI9B 2ICEA 1K8DA 1XIWC 4E41A 5I6XC 1ZHBA 5HHMD 4XPBH 4XP4H 4DGVH 2F5AL 3R4DA 4P2QD 4EBQL 4IOIB 1CFQB 4RFEB 3VCLB 2OK0L 1FVCB 4NRXA 5C0EA 3CDGB 3EYUL 3L3KA 4F80A 3TYGL 2X4PA 5BXFA 1T0NA 5CSZB 1KCUL 3LKPA 5A2FA 2MCPL 3SJVB 3FRPA 3FAWA 2CDEA 4MCZB 5J57B 4FFVC 4N0YH 3OXRB 5