4Y16C

Crystal structure of the mcd1d/nc-agc/inktcr ternary complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Lipid and Carbohydrate Modifications of alpha-Galactosylceramide Differently Influence Mouse and Human Type I Natural Killer T Cell Activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 202
sequence length 203
ec nomenclature
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y16C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y16C02
1V3KA 5HHPB 3F6LA 1A22B 1A1NB 1BZ7A 3H0TB 2V5RA 2X4NA 1ERNA 3PIQB 3SDXE 2PNDA 2ADGA 4JM2D 3F7VB 1SM3H 4S1DD 5E0QA 2FX9L 3KPMB 4CMMB 1UENA 4HCRL 4K2UL 1IGCH 5DFVC 3WO3B 2YWZA 5EFIB 3L3IB 4FQPA 3G6DH 3UTSA 1D5ZB 3SDAC 4JO4L 2QL1A 5ADPL 4OZIE 3K4DA 4K94C 1T6VN 4MZ3A 3L9RA 5J06A 2Z31C 4HUUA 4WWKD 5D6DA 2G75B 1X5AA 3DMMB 5DJAB 2I5YH 2IFFL 3SN6N 5ACLA 4YFDB 3U83A 2CGRH 5GIRB 3G08A 3WN5A 3PABB 3U7WH 5F1IB 4S10A 5LBSH 5J4MA 5E9DA 5DJ2A 3ZKSD 3MRFB 3C5JA 3MJ9L 2CXKA 4HWUA 2A6KA 5I8KL 4P2QD 5JPNB 1FZJB 1IAMA 2UYLB 3KPRE 4IS6B 1YMMB 1FYHB 5KG9A 3RDTB 5ID0A 2AJZB 3CFKB 5HVWA 2BVUA 5FGRA 5F3BB 1DSFL 4MHHG 2CSPA 1IAKA 2V17L 5E00A 4HXBL 5D2LF 2AJ3A 3QEGH 5FUCE 1I1YA 3D0VA 2PYEE 4BSVB 3TH2T 4KZEH 1NL0L 4M6MH 5I1AA 4R96B 3DVIA 3OJMB 4P9MH 4PB0L 3L1OH 1MAJA 4P3CH 1NGQL 5HVHB 4Y2DA 2OJZH 3U30C 3AY4A 4P46A 1G9NC 4LARL 4X4ZA 2CLVA 2DIAA 4X7FC 2DWDA 1RY7B 4IMLB 4GG6B 3M1BB 3CSPA 3OAUH 3ZKXC 2HT4D 3CC5B 3DETC 4IRZH 3D39D 4MXQD 4YFLF 2ARJQ 1O5DT 1A7PL 3V8CA 4MD4B 3TNMA 2YR3A 4CNIA 2LV4A 3O41A 2DI7A 3HE7A 1TVBB 4NM8H 4HUXA 3QP3A 1FVEB 3U1SL 2R15A 2N7BA 4JQIH 2DRUA 5EWIL 5K59E 1IZJA 3NCEB 1FNGB 2ZSVB 4KTYA 3GIVA 4ISVB 3FAWA 3OL2A 3F58H 5C0EB 4YDVB 3T3PE 3CH8A 4WDIB 4HC1L 2VLJE 2AJVL 3K0WA 2BXYA 2YN3A 3C6SB 4ONGH 4RAUA 4L4VE 2ADJB 1JZ4A 1DJSA 4UT9L 1RIHL 2CR3A 3V7AE 4WWKA 2PYFB 1H3XA 4MJIE 4U6HA 1WEJL 3BKCH 3T77B 4XCNB 1P4IH 1CTNA 4I48B 5CEZD 4YPGA 1H3GA 4UT6H 3GJEA 2GSIB 4L8SB 2R0ZL 3FONB 2MCPL 3GSXA 1AHWA 32C2A 1K8DA 1IZKA 3E2HC 2I9LA 4NN7B 5I0DA 4HXAL 4QHMA 3VXPB 1WCBB 5JORB 5KZCD 1DFBH 3SDYL 4NRYA 3PG2A 4P2QA 3VGGA 1EGJA 4LGPB 5DD3L 3O3BA 3HCVB 4DTGL 4JPVH 2F8OA 2BK8A 4OGYL 1BVLA 1JRHI 5KVEH 1HHIB 3HZVA 3PE9A 3FQUA 3QIBD 3RWDA 3FOLB 3J8F7 5DC0A 4NC1E 3WKMH 2OSLB 2BJML 2X42A 5GRZA 1KNOA 1JI2A 1QFUH 5GZNC 3OB0K 5ESQB 1R5VB 3F62A 1AIFA 3DI3B 1J1PH 1LK2A 3J7HA 4NO0D 3WFDH 4TVPH 3N85H 1YQ2A 2YC1A 1F90H 2GSGB 4OCYL 4G8EB 4R8WH 3RRQA 1Q94B 3DO7A 1UH4A 5KAQF 1MSPA 3D39A 4JB9H 3HC0A 5CHNB 5IMLB 4WW2A 3V6OA 1YNKL 4NQCE 3DV4B 2EDOA 1FYTD 4OKVB 4MQXD 2AEQL 5BXFA 5MENE 4PRIE 1NC2A 3AMKA 5I2IA 2X4QA 5JOEA 2XZCL 1T1YB 1LWRA 2NY6B 3NTCL 4N9GA 1FGVL 2R69H 3DXAB 5E8OA 1WFOA 1DE4B 1RK0A 1AP2A 1EHNA 2QQQA 4TUOA 5C0FB 3L5IA 4PGBB 1LD9A 1R0AL 4NBXB 4NDMA 4Z95H 2EE2A 4FOMA 4L3AA 4NRXA 3DSFL 1U8MB 4MNQA 2WP3T 3OJDB 1ZANH 3QO1B 3S96B 3BGFB 1W8NA 3NH7L 4XI5D 1LEGB 2AQ3A 2WBJB 2XKNA 2DJSA 1S8DA 3ULVD 1FE8L 5HHNA 3CCHA 5IIEA 5CS7A 1RURH 3GMOB 4WW1A 3HC3H 2C1OB 3OB0H 1KPUA 1GPOL 2YKLL 1G7JA 1WC7A 3D2UD 4FZ8H 4YHPA 1IVLA 1S7RB 3LCYA 3C2AL 4MAYC 5CFHA 5T5NG 5F7DA 2X9YA 5KVFL 4Z77A 3L3KB 3MRRB 5FM4A 4APQC 3ZMRA 4V1DD 1MCFA 3UMTA 1W72A 1MHPL 2WBKA 3L7EA 1S78D 1XMWA 5J1TC 2X70A 1OTSD 3P0VH 3SE8H 2E7HA 1L6ZA 2HRLA 4NC0B 3WHXA 4TSBL 1QLRA 1A7NL 1I9IH 4JFZL 5IMMB 3VRLE 5HHXL 2ENSA 3RWFA 3BRFA 1WIPA 1FAIL 1TNNA 2FIKA 3O8XC 1BEYL 2VISB 4YDLC 1BMGA 1ONQB 2DF3A 3MV9B 4EQ3A 4NO0A 1Q9LB 2AEPH 1UWEH 2KZ1B 2J8OA 2VXSL 1IC7H 4FQIH 2A77L 5LGKA 3SE4C 4GAJL 3VXNA 2BERA 1L0YA 4NNXB 3WS6C 5I18L 1DQJB 5BS0B 2QHRH 2NXZC 3CSGA 2XTJC 4DZBA 4D3CH 1ZWIB 2Q86B 1MLBB 3MREB 4P9HC 2G5RA 2KBGA 3KWWA 4PUBL 4GW5A 4G7YL 3DYOA 5DD6A 3KR3L 4XCCH 3A6BL 4LHUD 3QQ9C 1I8LC 5IHUL 3VH8A 3P4MB 2VDQH 1U3JA 1Z9LA 2VSDA 5T3ZL 3QDGD 3GO1L 4BSWB 4MA1B 4I77H 4L9LC 2BSSB 1ZHLB 1MUJA 4WV1C 1ADQA 3HB3C 4JR9H 4RISL 2Y07L 1QSED 5D5ME 2F53B 2ZUWA 3NZHH 4Y5YA 1S9WA 2ZG1A 2VITB 5TDPA 1G0DA 5DQ9A 1X4ZA 5GGVL 4FXGA 4JHWH 4HIIA 5GHWH 3X3FH 1S7UB 3CXHK 5JQHC 5TF1H 3CDFA 3RPKA 5IFAL 2VDKH 3D3VB 4HF5H 5EU6E 4W70A 3EYOB 1T22B 2EO1A 2P5EB 3D2UA 1FZKB 1J10A 4GAGH 4IOIB 4J23A 1F02I 1UJTA 4LIQH 2DQUH 3MJ9A 5C08E 4BFBD 4BK5A 1DBKH 3MNZA 3QNYA 2ARJA 4V1DA 1V7NH 4UV7H 2FR4A 5TQ2L 1AO7E 1K4CB 4PG9A 1MQ8A 4HHAB 3MOQA 5E2WH 1JPST 1VFAA 3P4OB 4F15B 3LEVL 3RZWA 4ZUUA 5E2TL 5IOPA 3L3GA 4TULH 3VWKC 5ABDE 3T2OA 4M7LL 4NWUH 3GI8H 2C3XA 1RJCA 4J7RA 4ESKA 1Z9SA 3WSQH 1RUML 5GGTA 4W68A 1EEUA 3RVTC 2JJTA 2HAZA 3ZO0A 4XX1E 2FEDD 4UT7H 4L4TD 2X9WA 3QXTA 1JN6A 5HYIA 3MLWH 3NCYP 4PD4J 1CR9H 5DC9B 3VXUE 2IGFL 4NJAH 4OLXH 4JAMB 3W11D 3HE6D 2XPGB 4KQ4L 1KFAH 1BOYA 3GSOB 4K3DH 5D7JC 1UM4L 4JO1H 3UYPA 3QB7C 5L2KB 4WO4C 5IFJA 5EOTB 4UTAL 1LEKB 1NEUA 4KK6C 4XNXL 1CDUA 4DJMA 5GSVB 2QQKH 3EFFB 5DRZB 1S7WB 2GITB 1YPZA 4JFOB 1RJYA 3NFSH 1QEWB 3MOBH 5F70A 4WU5A 1OP9A 4DEPC 4O2EB 2N56A 1HH9B 3HLAB 2I07B 2J3SA 5T3XE 1CT8B 1XGTB 3HUJB 3I84A 1G6VK 4HC1A 1WBYB 4WI2A 3ZDZF 5C0AE 2FLRT 4QCIA 2AJUL 2Y6SC 4KK5C 5DJXB 4RAVA 2MQCA 1TZHA 1OM3H 4EEEA 3O9WA 5DGRA 1KCKA 4FQHA 1UA6H 4Z7VE 2MPAL 1MRFL 1RD6A 5EN2B 5GS3A 3FFDB 5E9DE 4E42A 3GKZA 3MV7E 1VGEL 2WMPA 5MEPB 3RVUD 2ZCHH 2O5YL 4G6AD 3S37H 4YNYA 3JWOH 1KCSL 1S5HA 4P57A 3WFBL 1QSFD 3FN0L 3DMMD 5KS9F 4RGOL 4PRPE 3D87B 2DQCL 3PGDA 2C4XA 4HIEA 5JOFA 2PTVA 5FK9A 3QIUA 1IGTB 4GQ9L 5E03A 1MJJB 1BFTA 1XGPB 1AE6L 1CDCA 5HD8C 4M7KH 5DFWH 5CEYB 5T1MA 5TJWK 5D72H 1W0WB 3B5HA 3MO1B 4XMLL 4M1GL 4PJCE 1HK6A 1KC5L 4BZ2L 4IDJL 4WFGE 1JL8A 4GKNA 1RUKH 3BE1H 3DHJA 5GRWA 1S9VB 1RULL 2VAAA 3PDGA 4ENEC 5DJDA 4HG4K 1OGTB 4I0PC 5KBNC 3ARXA 3T8XB 1MIEH 1TPXB 1YMMD 1CLZL 3BYYA 1JV5A 1NAMH 4HIXH 1MFDL 3DX9A 4KKNA 3U9PL 5CLWA 3GDBA 1U42A 4X99A 1EJOL 1YNTA 2DWEB 4GLRH 1N59A 1X5GA 2IANA 4IHOB 1ORSB 4PJDA 3GMNB 5IKCB 3EGSA 5GRJL 4L4TA 4YZFF 1PLGL 2EKSB 3RGVB 4HK3N 4IRSB 2MTPA 2NZIA 2ITDA 1IMHC 2HWZH 4MSWB 5CAYB 3UZEA 3OHXB 3GHEL 3PHOA 1RUAH 3QUYC 4R0LB 2BVPA 4UIMA 5D71L 2EDYA 4QHNB 1H15B 2Y25A 3THML 5T1DH 3VG9B 4IMKA 4PLKC 5SWZA 2EYTB 1XR9A 1ZOXA 4X8JA 2OJEA 3DI2B 4F58H 1M7DB 3OKNA 4POZC 1I8MB 3ES6A 4LHJB 3MRQA 1B0RB 3FOMA 4PB9H 3H0TA 4U1IB 1WTGT 3KDMA 3F7VA 3UC0H 2P42B 1XGQA 1LO3H 1FFOB 1AGDB 1JGVL 3KPMA 4ELMF 4PP1C 3ME0A 2XA8H 1MCLA 3MODH 2Y9RT 5HYJE 2AQ1A 4I4WB 1AXSB 5HI5D 5F1NB 5J1SC 5EIIA 4I2XE 2CDFA 3NCCB 1A3QA 1QSFA 3IDNB 5IHZB 2VDLH 4D2NA 4HS8L 4K3GA 5J56B 4E41D 5GIRA 2CXGA 2NY3D 1EFXD 4G6MH 5AEAA 5ALBH 3P9MB 3PABA 3F7RA 3IU3A 5K9QG 2J8UE 4PG2C 3JTTA 4ALAL 1CVSC 2FEEI 3IFNH 2DI9A 1E27B 2DQEH 2GI7A 1FNEA 4A2LA 3IETA 5A2LH 4U49A 4Z7QE 1A2YB 4CMHC 3BD4A 4X4ME 4YHLH 5JPNA 4P5MB 3BMWA 4UB0L 4KI5E 1YMMA 5HYEA 1SQ2N 2W9DH 3I3DA 3FQWB 2HVKB 4P23C 3QIWA 3O6LH 4JZJB 4UQ2A 1TCRB 3ISWA 1SM3L 4Y4FC 1J5OH 5JMOC 1SYSB 2PXYC 1IGCL 2L7UA 4R96A 2YS4A 4TQEH 3G6DL 2ED7A 5C1MB 5EH1A 1YDPA 4QRQA 2RGSA 5FYJE 3O3EB 1CD8A 2IWGA 4Y7MA 3ZKQD 3UAJD 1S5IH 2ZUVA 4A6YH 2YD4A 1IEAB 2VLME 2I5YL 1OW0C 4LAJH 4OLYH 3T1WA 3RPIB 4O9HL 4QO1A 2CGRL 4GFTB 2QSCL 1KGCE 5IVXE 3KYMA 1N0XL 3B6SA 5GS1A 4JJHA 2Q8AH 5JXED 5SV4A 3OB8A 1L7IH 3EIFA 3TJHC 3U7WL 4L8CA 5A2IH 1JGDB 4G9FD 4X6DF 5LBSL 5CD3A 3ULUL 5I8OL 3MZGB 5AG8A 4FFYH 3R1GH 5ISZE 3VWKA 3SGEH 2NY6D 4UNUA 3T0EA 1XT5A 3GRWL 5BQ7B 5BVPL 1K5NB 4JFQB 4OZHB 4JY6B 2O5XL 3ESVF 2H1PH 4WDIA 5J57B 4OTXH 1F13A 1OGAA 3P4LA 3FN3A 1HXMA 3HI6H 3REWA 4KHTH 3OF6D 3QEGL 1BFOB 2PYFA 4KZEL 4H8WC 2BNQE 1RJZB 4ZFOL 3V4PH 3IDMA 5GQBA 1N6UA 2BOCA 2BC4B 1JGEA 2XZZA 4M6ML 1OAXH 3L1OL 1T7XA 4P3CL 4E41A 5FOBB 2HJFB 3CVHB 2OJZL 3KPSB 4S1SH 4Z7WF 1EFXA 4ZFZB 4U7MA 4L8SA 5KANI 1I75A 5A3IC 3N1FC 4M62L 2IBZY 1YEGH 5BV7B 1NGYB 2QLVB 1NCAH 1VEOA 3TYFA 3OAUL 3RX5A 5FO8A 2P8LB 3FT4B 1BJ1J 3ULUC 4GAYB 3KLHC 4WHTB 1ZGLA 3C2SA 3KG5A 2IPTH 2R56H 2A73B 1A9BB 4ZS7L 1R3HB 3PGFH 3AS0A 4NM8L 5I17A 4FQLH 2J88L 3PP4H 3FO1B 3X11B 1HE7A 1GIGH 1KJ2B 1P5VA 4JQIL 4JKKA 4J3TA 5CZXC 2DLEA 3OKKA 3ULSA 1HSBA 6CGTA 2P5WA 4MNHB 2DMKA 3F58L 2IAMC 1ZE3C 2VWEC 2I9TB 2VC2H 1PW3A 2W0KA 1R5VA 2XT1B 3RJQB 2H26B 1DQTA 3MV9D 4ONGL 1JCKA 3HTLX 1UEYA 3MJ8B 3JSSA 3NCFB 3QUMB 2E8ZA 4BH8A 2XI9A 2D7PA 2YWYA 5GGRB 4OZ4A 4PJIE 1IJ9A 1P4IL 4LLDA 3OPZH 3VWJB 1U8HB 4UT6L 1T4KA 2WQRA 3TO4B 3ARSA 4PJFA 3VH8G 1CFQA 3IGAA 4LVNB 3LSOB 4G9FA 1ORQB 2AXGB 5CIPB 3EJZC 3KAAA 3AAZB 1X3DA 2Y36H 3PDOB 4WTZA 4JFFE 4LLWA 2MMXA 1PFCA 4UDUB 5CJ8A 3QDME 3QT2A 5EU4A 2OI9C 1DFBL 4XC1H 4NHCH 3BPNB 4JFEE 5E5UB 3BESR 5LCVH 1BJ8A 4Y1AD 3V52L 3IT8D 1CVRA 4JPVL 3SY0A 1J0YA 5IJVB 3LRHA 3UTPD 1L7TH 5JR1H 5KVEL 5B22A 4JDVB 2X4PB 2HFFA 3S96A 2F53D 3QFJB 1NFIB 1TITA 3RUGF 3GM8A 1WZ1H 1LEGA 4O58H 4AH2B 4HK3J 4QOKB 3BO8B 2WLYA 4KK8D 1G7HA 1T7ZA 3FT2B 5F3HA 3WEXB 4OI7A 2RIKA 4JM2C 5I1CL 3WFDL 1MIMH 3GMLB 1BQHA 4S1DC 4TVPL 4AQ1B 3N85L 4LDOB 2ZNXA 3LZFH 1F90L 1A6AB 1QG3A 3B5TA 4LF3A 4R8WL 2FH6A 2Z35A 4LKCB 4XTRD 2VLLB 3MCKA 1U8PA 4MHHI 4E9LA 1V7MH 1RZIB 4OUUB 1TVHB 3MFGB 1IM9B 2AK4B 5GRXG 5KSBB 5DMYA 3R0NA 5J89A 5IROC 3DGGB 5HHOE 4U2YA 3B2VH 1T89A 1U6AH 4Z7NF 1KN4H 2Y23A 4YJZL 3PL6B 2P7TB 4K8RH 3BDBA 2NTFB 5JPMA 2Y1VA 4RGNC 3T0VA 4KWUA 2R69L 1VACB 5JIKA 1LO5B 3MR9B 2OL3H 2Y72A 3F7QA 1U3HB 1J8HB 2I25N 3SDCA 4WUKL 5CD5C 2R1YB 4MA8L 5GXBB 3F12A 4ETYA 3MV9A 1WIUA 1CGWA 4WFFD 5CKGA 4U1KB 1C08B 5C9JB 5LGHL 2DMCA 4MA3A 2X10A 1UXWB 3P3YA 4ZUSA 1CLYL 2EDBA 3B2UC 3U0TB 4Z8FH 2ZWLT 1INDH 5CJBA 3S37X 1XF5B 1RURL 3CXDH 5L2KD 5K59F 3MRNB 2X89D 2VLRB 3O45A 1V3JA 5C0JA 1SYVA 3LH2H 3CK0H 3I6KA 3LKRB 5HYQA 1U8OB 4FZ8L 5BO1H 5FA4A 2R9HC 1QRNE 2YA2A 4ODUA 2DM7A 3HI1B 4PJGA 4ZXBC 4PJHA 4U6YB 2A6IB 2DDQH 3QDJE 4XPAH 1UQSB 3MUJA 4Y1AA 4HK0B 4MXQC 4ZUWA 4FXKB 5CMAB 3SE8L 2EO9A 2YBRB 3B8YA 3RTQB 3RY5A 3ZYOA 3ZKND 2OK0L 1UXSB 5I1LB 2D4FA 1IQDA 2K7PA 5KSVA 2DLHA 4KKLC 4HWBL 3VFNA 5KJRH 4UU9B 2X9XA 4I3SH 3VI4F 3H9YA 2HG5A 3OGCA 2AEPL 1UWEL 3HZYA 4MNGA 1F4YH 4PGCA 3C6LC 4FQIL 2DQTH 3FB7A 1ZHBB 5EBWA 1T22A 3WS3A 2P8MA 1L0XA 3D69B 1PEZA 3RY6C 3ZT7A 1ZVSA 2ZPKL 3I2CH 5F97E 2WLZA 4UBDC 3UP1A 3ET9F 5AG9A 2QHRL 1CQKA 3HRPA 3GSQA 3ARFB 1UJ3C 1KT2B 1PY4A 1K4CA 4D3CL 5EBMB 5EUOB 3NGBC 1FJ1A 5F7LB 4HHAA 1CD9B 3LKSA 4OLUH 2GYSA 3GSRA 3OXSB 4G8FB 5JOPD 3IKKA 3RWEB 4XCCL 5I66B 1N5AB 2FJGA 4PJAE 2VDQL 4P4RB 1KLGB 5KW9H 4PR5B 4PJ7A 4I77L 3IDIB 1J0IA 4TRPH 3U4BH 3NZ8A 1T1XB 4N8CH 3QEQE 2R0KH 2X5PA 4Y16C 4B5EA 1OPGH 4Q9QH 3FQTA 5FYLH 4BYHA 2EXWD 1GJIA 4Y5XB 3RGVD 3FCTA 4IRSD 2X44D 4HGWB 3NZHL 4YBLC 5DGQA 1A7OH 4NNYB 1YUHB 5B38A 4KHXH 5HYFA 4JHWL 1UZ6E 1F4XH 4X7EC 5GHWL 3UO1H 4WI7A 1TQCB 2XPGA 5CWSB 4N1HB 2QKIB 3X3FL 1WWAX 4J8RA 1OAZH 5TF1L 5L2KA 1X5HA 2X89A 2CIIB 4OM0H 3I6LD 4XAWH 5L9DH 3HG1A 3U7YH 1C5BH 4GAGL 2EDHA 4XCEB 1VFBB 2GITA 4LIQL 1B3JA 4KTDL 3QXVA 1R5WB 4PBXA 1V7NL 2JCCB 2MOVA 4GRMB 4UV7L 2HJKA 4WFHE 5EOQH 1QEWA 3O6FB 3W9EA 1BVKA 5D2NB 1MF2L 3RNQB 4PREB 4MDIA 3E0GA 2HLAA 2I07A 5E2WL 1MCPH 5MP6H 2UWEA 3CIQA 1XGTA 3HUJA 4FFVD 4TULL 4NWUL 3VMOA 3GI8L 2FNBA 2WSKA 2XTJE 4QNPF 2IAMA 5DUBB 5HGHA 3VA2C 3HMXL 4MQXC 1RU9H 2RAMA 1P69B 4ZFOA 3QEUA 3WSQL 2M1KA 4MJ2A 4YHOH 4QRRD 3LEXB 2YRPA 4Y89A 4HBCH 2D0GA 5DEFA 4PGEB 5FGCE 3C9NB 2Q1EA 1YJDH 1A7QH 5C0IA 2BVTA 4MLSA 4MD0A 4LNVA 5FCSH 5DK2B 3H3BC 5JXAH 4NJAL 1QZ1A 1RHHB 3IAPA 3BH8A 3SQOH 1MJJA 4OLXL 1XGPA 1FVCB 1TZGH 1A6TA 3VGHA 4MJ5A 2R2EB 2FZ3B 4F7MA 4EUPB 4HZLA 5DD0H 4PJ8B 2E5EA 2NXYB 2JELH 4Q58C 2UY6A 2ZUSA 3MRDB 3I02A 1XCQB 4MJ6B 3O4OC 4G80A 4PJBF 3A6CH 5E24E 1IL1B 1YQVH 3H9SB 5IK3A 3NFSL 1KIPA 1ETZA 3BIBX 5J7CC 1MWAH 1I3VA 3ARDC 5L8JB 3KLDA 4NYLB 1NCBH 2HLFD 3NIFE 3LRSB 3SPVB 3RNKB 4MQTB 1C5DB 4NCC1 1A9EA 4HMDA 3T3ME 1I7TB 2CRMA 3OX8B 4G5ZH 5IKCA 1OM3L 1LNUA 3S97C 4KROB 3BZFB 2EKSA 1I3UA 3IRZA 2CH8A 1UA6L 4GW1A 3OKMB 2W60A 5EG6C 1S78C 3BXNB 1KN2H 5KSBF 2V9RA 4KMQA 1Y18A 1ZAGA 2ZCHL 4JLRB 3S37L 4NO5B 5EZJA 4N8VA 4JZOA 5CEXA 4GW4B 5BZWB 3ARGB 4I18A 2DQJH 6FABH 1P4LB 4E0RB 3M17A 3I9GH 2XXMB 3FFCB 4D0CB 1OP3K 3LRGA 4M7KL 5B4MC 4Y8AA 1OGAE 3TVMA 5F6IC 3GMRA 3TGXA 4HKBA 1M7DA 4FG6D 2EE3A 3SJVA 2K9UA 3TBVB 5D72L 4XNZB 5FDWA 3ZDXE 3ZZ1A 1T1WB 3O4LA 1B0RA 3X3GH 1FSKC 4M3JA 4GKSA 3D5OF 3IAQA 1PKQA 1RUKL 2IADA 3BE1L 4JFDD 1D9KA 2B4CC 4QRPE 4U7KA 3RWIB 1MIEL 1BIIA 3JV4A 3BAEH 1PVHA 2ZKHH 1PD6A 3I85A 4L3EE 4ODXB 4I4WA 4OLVH 5GS0H 5JMRA 1FCGA 1KB5B 2YEZA 4QRRA 2DLIA 1FL5A 1NMCC 3PWVA 3IDNA 3GSUB 4K7PX 4KMLB 2FSEB 4LLAA 3GMQA 2ZOLA 4YO0B 4OQ1A 3LS5H 4NKIH 1FFNB 1EPFA 1T83C 2HWZL 1R24A 3KPSD 2NY5H 3IDYB 3MRMB 3X12A 2G5BB 1RUAL 1K2DB 2IEPA 3G6JB 5DS8A 4LFHD 4B0MM 3O3AB 5D1ZB 1S7QA 2EDEA 3MRCA 3PWUB 5FUOH 3UTTE 2VXTH 2ZP0T 5T1DL 1KB9J 1CFTB 2GTWB 1T04B 4P3DB 5K9OA 2IPUK 1CGSH 2FGWH 1A2YA 2XWTB 2OXGA 4F58L 4JRXE 4JANA 1R3LA 1OP3H 3K2UH 3CFCH 3SKUD 1XIWB 4FS0A 3TP4A 4D9RD 2HVKA 4WU7A 4PB9L 1IM3B 5D4QA 35C8H 1FLTX 2FX8L 5E7BA 4OBRA 5DURB 1SYSA 1PG7W 5HJ3A 1L4IA 1RZGA 2XA8L 1LP9B 3MODL 5INCA 5C6WH 1YYML 4N1EA 1H3UA 3QDAA 4FP8H 2WUCH 3JTSB 2DBLH 3O3EA 2ICEB 4Y5VB 3MFFB 1CU4H 2VDLL 5KSUA 3QQNA 1GGYA 1M71A 4YXLH 4WTZG 1CLCA 3VWJD 3FT3A 4BKLB 1EFQA 3DRTB 5DHVB 2QQLH 2Q8BH 4G6ML 5EO1B 3TO4D 4G8IA 3H7LA 5ALBL 2VSCA 5AAWA 1F58H 4ZODA 3ZE0E 3WIFA 2FEDC 1WZKA 4PJXB 1L6XA 5ILTH 4MAUL 5HHME 3IFNL 2BOBA 1U8NB 2X7LB 1BF2A 1FFQA 4H0GA 2DQEL 3QI9B 2NYYC 43C9B 3MYJB 4JHAL 3HE6C 4JFDA 5C7XH 4HSQA 2FL5B 1NCDH 1WSST 1PX4A 3TIEB 3MV8B 4K23H 5IG7B 3RHWF 3K8LA 1U58B 5FKPA 3NFPA 5FV2A 43CAA 1G7MA 4C83B 4Y4KB 2H6PB 1E6OH 3O6LL 4GKZA 2ADFH 3MBEB 1BQHG 2H32B 2VDRL 4RZCA 5C09E 1T20B 1J5OL 4GUPA 3QJHB 4GSDH 4GOSA 3WFHA 2JCCF 4QOKD 4M1CD 1MVUB 3SDDB 4YXKH 3MX0A 3KPSA 1Q8MA 5JLZA 4YC2C 1S5IL 3MC0A 4A6YL 4HH8A 4GH7B 4F9PA 2WWKO 5DQDH 3VGFA 2FX7H 4NM4H 2CRZA 4LCCA 4NCC2 1HHJA 1XF1A 1IFHH 4A2MA 4S0TD 3UDWA 4LLUA 3ZKMD 4WHTA 2Q8AL 3SKJH 3DMMC 3IDGB 1SEBB 2AK4D 2X4RB 4UILL 2BSTB 2A74B 1G9MH 4XPTH 1YY9D 3FO1A 1C7SA 4FFYL 3QUXB 3R1GL 4CJ1A 3PL6D 3FJTA 1H8SA 5TH2B 4X5LA 4PRBB 4HS6A 2H3NA 1EEZA 2BHZA 4MNHA 4I5BB 4CU6A 2QR0A 2AV1A 3AXLB 1Q38A 1U3HD 1CGYA 1UM6H 3UTZA 4RQQB 4OTXL 2H26A 4GRWB 3C8KB 4JQVA 3WKNA 4NQDB 2DKMA 1S7XB 2FBJH 3HI6L 4KHTL 2PW2A 1HHGA 4PJHE 3RDTC 3V4PL 4B50A 2F74A 1OAXL 5D7KE 4Q9CA 1EAPA 3RZCC 1DQMH 4N0CD 2V2XB 3BEWB 4S1SL 2ZCLH 3DYPA 4YR6B 5FO9B 4FTVE 2A2QT 1YEGL 2VLRD 2VQ1A 3LSOA 1NCAL 1ORQA 1AR1C 3NN8A 4TTDD 1FO0H 4H1LH 3U9UB 3RBSA 4AEIH 2HH0H 4UDUA 4Y19E 4RWYL 4QT5B 2IPTL 3EO1A 1MHCA 2KPNA 2R56L 4N9OB 2D4DA 3MOAL 4LK4A 2XNAA 3PGFL 2J6EH 4TSCH 1YEHH 3PQYB 1OAYH 3PP4L 4G42B 4AG4H 2NX5B 1JWSA 3RTQD 4JDVA 3EHBD 3P9LA 2A83B 2X4PA 5EA0L 1BD2B 4L8DB 4K7PL 5K9QI 2XA3A 3HS0B 4XRCB 1KENH 4N5EC 4NQSB 5SX4I 4QOKA 2VC2L 1H3VA 2BCKA 5CSZB 5ACZB 3BO8A 4UQ3B 1AR2A 1MELA 3LOWA 5L6YL 5B39B 4KVNH 2GJ6A 3KXFB 2OTWB 4HPOH 4LPCA 5HI5C 3HPJA 4ZTPL 2CO7B 1O7SA 3MNWB 1PEWA 2HN7A 3GSNH 1ZA6B 2XG4A 3MNVB 5DUML 3ARFD 2V5MA 1G7LA 2OTUA 3V0WH 5KSAD 5CJQL 1CXFA 4UINH 1NDGA 2P7TA 1I7RA 1YY8A 2R29H 4M6NH 1H5BA 4JZNB 3TNNA 3ARBB 3NIGE 4XC1L 4NHCL 3G6JF 5LCVL 4KPHH 1LO5A 3DVFA 3QRGH 4HUWB 1EVTC 4NN7C 3F7YB 4NQEE 4Q6IB 4XH2B 2R1YA 1RMFH 5B38G 4X6EB 3ULUE 4WUUE 2Z4QA 1DTUA 1NMBH 3FMGH 5D7LE 5JR1L 5C9JA 3F7PC 3IDUA 4EKXA 2BY1A 3WLBA 1T83A 1WZ1L 3KPNA 4O58L 2RHEA 4QXUH 4HKJA 1KCLA 4JRYB 4R3SA 2ATKB 2NY1C 1Y6MR 1E28B 2EDXA 4XZUB 1MIML 1IBGH 1BHGA 4H88H 3LZFL 3MRNA 4X6CE 1JP5A 4S11A 4FN0A 2VWEE 3LKRA 4PJEA 4J1UB 5TDNA 5H35A 2EZ0C 5M95B 1ZHNA 4YE4H 1D5MB 2JIXB 5FCUL 3UAJC 1BQUA 1VEPA 3TPKA 3O6FD 1LE9B 4U1LA 4KXZH 1QSVA 4NZDA 1E4KA 3B2VL 4FXKA 1NAMA 1U6AL 3WHE0 1KN4L 5CMAA 5FO7B 4HH9B 1GSMA 3NAAH 2GFBB 1R3KB 4HUMB 4K8RL 1KPVB 2BVOB 4KI1A 3IJHB 3B43A 3S4SB 1HEZB 2P48B 4PJXF 4ETQA 3CX5K 3G04A 2OL3L 4MDJA 1SJEB 3K1KC 1BAFH 2NY6C 2AV7A 3PWJA 1KCVH 4U6TA 1RZ8A 4ZQKA 2YD3A 5DK0B 4U3XA 2D7OA 2X6MA 1IAOA 4Z8FL 4P4KA 1JNHA 1IGJB 5E99H 3SDXB 2VDOH 3D0LA 3FO9A 1INDL 5ICZB 1G7PB 1FZMA 1NCNA 4K3HA 4G43A 3BGFC 3CXDL 5BRZB 1ZLUK 5DZOA 3ARFA 2X4UA 2HTLD 1UM5H 4BK4A 2ZZUT 5C07B 3WE6B 4QY8A 1IGIH 3CK0L 5IF0A 2R23B 2WBJC 2XXCB 4OZIB 5KSAA 5D1XB 4OV5B 3PGCB 3GEWB 3E1F1 1BP3B 1KLGA 1NQBA 2DDQL 3KPOB 1TJIH 2MQ0A 4XPAL 5DHXB 2Y7QA 5EZOH 1T1XA 2DJ4A 5CILH 4X6FA 4XAKD 2MKWA 4O5LH 3Q48A 1WT5C 4R7NB 4TN9A 5TPWH 4N8VG 1FG2B 3LKNB 4KROD 3V79C 3SCMB 1DANU 1CL7H 1QO3A 5FM8A 3OKOB 2C3GA 3VD5A 3HAEH 3I75A 3AM8A 4QXWA 1K9TA 1YUHA 1IKFH 4CDHA 4KC3B 2VDNH 2V9QA 2AKRA 4I3SL 3HNVL 3N06B 4Z0BH 3S3PA 4YHZH 2NZ9D 3CPLB 4CAGA 4RGNE 3KPRB 2D31A 4GBXB 1F4YL 3ARGD 3L6FB 5F8RC 1ND0A 4ZSOB 5SWSD 5T3XH 4WENB 1KACB 2H9GB 2IH3B 2ATPA 2HRPH 5HDQH 4FHBD 3MLVH 1DVFD 2NW3A 3I2CL 2W0FA 1VFBA 1Z9MA 4IDLA 4X5XA 4RGMC 3LKPA 5C70A 1GGIH 3BQUD 4YFEA 5F1OB 3ZLQC 4OLZH 1URLA 4X7SH 5DEZA 1FDLH 1PZ5B 2ESVB 3PWPE 5ENWB 4PREA 1HQRB 3SGKC 4OLUL 1F45A 1ZLUH 1EHAA 4ONHA 5FGBC 3WJJC 3BUTA 3BIKB 4FNLH 1S7VB 5KW9L 1Z5LA 2XWJB 5FF6A 4KJWC 4TRPL 3U4BL 1RZFH 4CDGC 4NKOA 2PCPA 2CJUH 4X7TA 2HT2D 2QSTA 4CVXB 2LVCA 4Q9QL 5FYLL 1RZJC 3EOAB 4P5TB 1X6NA 3RZCA 4BUHA 3VCLB 4A6YA 1A7OL 1YN7B 3BP6B 1RHHA 3ZE1F 1I8KB 2YXFA 1Q9OB 4KHXL 1CBVH 1HCVA 4ZUTA 1F4XL 3UO1L 2R2EA 4BFIB 3DTXB 2FZ3A 2V2TB 5D1ZD 1OAZL 3S36X 3OAZK 2Z93A 1T7VA 5DMGC 4OM0L 5BVJB 3U0PA 4AENB 1U92B 3NCMA 4XAWL 5L9DL 1XCTA 4OQTH 1C5BL 2GW5A 4KK8C 5GISH 3MV11 3PUCA 1MHHB 5JW3H 1MCCA 2Z91A 4PRAA 2VXUH 1DQQA 2JJSA 5EOQL 1A4JA 1XIWD 1WIOA 1NUNB 2EDNA 4XTRC 5ITBH 2HFEB 4WGVB 1CE6B 5IVZB 4L29B 1MCPL 4F2MA 1B6DA 3CMOH 4YQXH 5MP6L 1GHFH 3ARZA 3H3KA 5K9KA 3VXMA 3CFEB 5DURD 5F9WB 1IQWH 4QXGH 4F15C 3BXNA 5I15H 3EFDL 5MI0B 4ZDHB 2H8PB 2VABB 5CEZE 3OSKA 4JGUA 1CDBA 4G3YL 4YHOL 1F8TH 3QSKB 1AC6A 5IGXH 1XGRB 4HBCL 3OXRA 4NBZB 1MAML 4EI5B 5D7IB 3CZFA 1YJDL 4NPYB 1A7QL 1RV6X 5SWSA 1C8PA 2ID5A 2OMBA 4LMQI 3SGJC 3QR2A 2DMBA 1DVFA 3SQOL 3DUUA 1KELH 3VW3H 1KCUH 4FQXD 3RWJB 5I16A 1TZGL 3WBDA 1REIA 4UNVA 3RL2A 5EU5B 3BQUA 1LO0H 5DD0L 2JELL 5DI8B 3DX8A 2ZOKA 1FZOB 3VXQB 2BRRH 3OAZH 3I6GA 1KBGH 1I1AB 1NPUA 4TPRH 3A6CL 1T03H 1YQVL 4K8RD 5ICYA 2FWOA 4MZ2A 3MJ6A 2G2RA 3L3DB 1FFPB 1U95B 2YA0A 2EXYC 3VGBA 1NCBL 4Y4KD 4ZS6D 2OYPA 5LWYH 1FP5A 3MBED 4HMCA 2J1KA 4U1GB 3FB6A 3UTQA 4I3GA 4NQCB 4RFEA 2FSEA 4OZGA 5DVLA 4WIQA 1SY6H 1NMAH 1FFNA 5DJ0A 1KN2L 4WHYH 1JJUA 1TTGA 2HT3C 3BN9C 2NMSA 1NGPH 3UJIH 4BJLA 3O3AA 1FYTE 4LRNL 2XOTA 3D18A 2D7TH 3PWUA 4L1HA 1T7WA 2DQJL 6FABL 5C0CB 2BY0A 1I4FA 3VXRE 3I9GL 5MHSE 2OTPA 4QHLA 2GAZA 1A0QH 2JJUA 1A6WL 4H1LB 2XWTA 4ODHH 1G9EA 5AAMA 5D1QA 1XH3A 2XFXB 1S7SA 5FYJH 1XIWA 1IGYA 3C87A 3X3GL 1IM3A 1UB6B 4PRNB 3UEZA 4JCLA 4RDQG 1F3JB 1YN6A 4P59H 4KAQL 4LIQE 1KV3A 3BAEL 2K3TA 3TZVB 2Q7YA 2ZKHL 5KS9A 4BELD 4OLVL 5GS0L 1JMZA 4AIZB 1DUZA 1OTUC 4CVZA 1TPXC 2VO5A 1IAII 4X8XA 3ZHLA 3LS5L 1BX2A 3B5GA 4NKIL 4LCWB 3X14B 1YZZA 1J12A 5D2LE 1CDHA 2NY5L 2COQA 3ARVA 1MCIA 4FQXA 5CINH 4HJGA 1UT9A 2HFGH 1YC8A 3RGVC 4IRSC 3VDAA 3LB6C 1A1OB 1II4E 5FUOL 1A4KB 2VXTL 5KN5B 4QRUA 2EEAA 2XN9A 3QUKB 4R0LC 4GRLD 1CGSL 2FGWL 2FL5A 4YXHH 5C86A 5CLTA 2VNCA 3W0WE 1MVFA 3PWNA 3BPLB 5F9JB 1JHKH 1GC1L 1RJLB 3K8MA 3VG9C 4QTIH 4YIQA 3K2UL 1U58A 2NX5D 3BZEA 1MNUL 1PG7X 2OL3A 3OKYA 4YAQA 4NBYB 4OD2A 3C5ZC 3V5KB 1VGKB 1BD2D 35C8L 5FYLD 4E5XA 1VPOH 3P77B 1U8JA 3QO0B 4PS4L 2F54A 4K94H 4POYA 1JPSH 3T1FB 4XNQB 4FP8L 2WUCL 1CIUA 2DBLL 3BD5A 4FFVC 3DX7B 4PJ5A 5E4IA 2HVJA 1CU4L 3GJFB 4YDIH 3MA7A 4N0UA 3T4YA 1MCJA 4YXLL 5I30H 2C3VB 3REVB 3SKNB 2Q8BL 2QQLL 4ODSH 3PWLB 1CICA 1QFPA 4N8PA 1QPPA 4PRDB 3TBYB 1IRAY 3GMMA 3DUHA 1CZ8H 2WZPD 4ZAKB 3JVGC 3QDGE 5ILTL 4NO2A 1LGVA 2CLZB 1G7IA 3O2VH 2A74A 1CLOH 4ZNEA 2JB6A 5FGBA 4ELMA 3LAFA 1DUYB 1RZKL 3PHQA 4D0DB 3QWRD 5HSFA 1GC1C 7CGTA 1MH5A 1X5JA 5E8EB 3B4NA 5C7XL 1QFWI 4WFED 2NY2B 3BYTA 1QSEE 2VQUA 2FECI 1NCDL 2WBWB 1JPTH 2Z92A 4YH6A 3IYLW 2MHAA 2ZUYA 1B0GA 4HS3B 2M8XA 4S2SB 4XBPA 3U46B 3L3JB 2VLKE 4WHDA 3S5LA 5C08B 1E6OL 5D93B 4PD4K 3LQAL 2FGZA 1P53A 2ADFL 5DUPL 5F7FA 2SEBA 4GSDL 1AGCA 3V5HA 2IFFH 1G9NH 4JRYD 4YXKL 3ZTJH 5DQJA 3BEWA 3ZYIA 4JZJC 5ALCH 4YBHA 4M7ZB 4MMZC 4I9WE 4ODVH 2X4OB 1QYGH 4K71B 4Y4HB 5JO5A 5ANME 5BZDA 2FX7L 3MRBB 4K7FB 3MGOB 5ID1B 3LQMA 2JIXD 4QGYA 3QUZB 1IKNC 1MLCA 4OZFH 3SKJL 4GRLA 1RZKC 2X1WL 2LTQC 1G9ML 4G42A 2NX5A 1CFNA 1LILA 1WQVT 4NNPH 1BZ7B 2X4NB 4WEMB 4EN3D 2A83A 2ADGB 5IMOB 3HS0A 1KTDB 4WI9A 4TUJA 3BPCA 3LQAC 3ARWA 4NQSA 1BFVH 3N0PB 4PB0H 4DW2L 3T65B 1UM6L 4UQ3A 1T0MA 2X1PA 1AKJA 4LARH 3L9RB 2FBJL 5B39A 1U93A 4HUUB 5J6GA 2EEBA 5HY9A 5CZVH 2MQ3A 4U7SA 4X6DA 4XPFH 3MLPA 1DQML 3DJ9A 5JZ7C 3MACH 5C0AB 2ZCLL 3QBTB 1ZA6A 4Z6AT 1OSZA 3MNVA 5MERB 2DBJA 4W6WB 5C07D 4Z7UA 5E9DB 3MV7B 4HULB 3HHRB 5DJ2B 2B0SH 3JXAA 1FO0L 3C5JB 1ZLWK 2HH0L 2RB8A 2VE6B 5LVEA 1Q1JH 5BV7C 1OTTC 4I3RH 2A6KB 1ZXQA 3SO5A 2B5IB 5L2JB 1D5IH 5IM7B 2J6EL 4TSCL 1YEHL 3KPLA 5KG9B 4XH2A 5ID0B 3KPQB 2AJVH 3GBNH 4LAQH 4ZOEA 1IAKB 5E00B 5FEBA 3SCMD 1RIHH 1TMCB 2AJ3B 1N26A 1I1YB 3D0VB 3OBAA 1KENL 1T66D 4KKAD 4PJCB 5I8CB 4G9DB 5I1AB 1S9KC 4JRYA 1MY7A 4Y2DB 4P49A 4P46B 5A16A 2CLVB 2APXA 3BN3B 3KPRD 4GBXD 4IOFC 2ICES 5T5NF 2DWDB 3SQBA 4KVNL 4HPOL 2B7DT 2NR6C 5DFTA 4J1UA 1NJ9A 1HYRC 3DVNB 3O3UN 4LSUL 3VU2A 4O00A 3GSNL 2PYED 4PLOB 4CNIB 3O41B 2A6JA 3HE7B 2R0WL 1FGNH 2DB8A 3MCLH 3VWJC 3IJSA 3V0WL 1NUGA 1MWAA 3TO4C 1BOGA 4DOHB 2BZDA 1PG7L 3CU7A 2GFBA 4UINL 5IBUG 3MLZH 4LVNC 4M6NL 2R29L 3TV3H 3GIVB 2BVOA 4EN3A 1BGXL 3F5WA 3ZSTA 3KHQA 5D70H 3GUTB 1U8QA 1ZLWH 4KPHL 3QRGL 3O2DA 1SJEA 1RMFL 4U31A 3MJ7A 1NMBL 3FMGL 4G6KH 3BPNC 2EEDA 3CMGA 1Z6JT 4WWKB 1KXTB 3MLUH 4DVBB 2WINA 1YEFH 4OIIH 4U6HB 1IGJA 3DX6A 4CN6A 3ALPA 1MJ8H 3SDXA 5ETUA 3QH3A 1JNLL 4YPGB 5L8KB 4B41A 5ICZA 2APTA 1HDMA 1U36A 1IBGL 4H88L 4RIRB 2Y06H 2WK2A 3TBSB 32C2B 1K8DB 1WBZB 5BOPA 3Q3GB 2ZUTA 4NZJA 4OZIA 2UZIH 2I9LB 4L4VD 4OT1H 4YE4L 2QJDA 4JFHE 4JN1L 3PGCA 3BIAX 5IHBA 5CSBA 5C0DA 4LPXA 1FGVH 4L8BA 1OWWA 5E5MA 1YMHA 4NRYB 5EO9A 4P2QB 5EULV 2DI8A 4C59B 4ZYKA 3INUH 4LPUA 3O3BB 2VIRB 4P2OD 5E6IB 3RUGA 1ACYL 3ZKMC 3NAAL 1MI5A 1KIRA 1XZ0A 3VRJA 4OLWL 1WWWX 1BVLB 3FO0H 3DSFH 1FG2A 3TJEH 3LKNA 1NCUA 3SCMA 3RWDB 5GZOD 1MCRA 2QSVA 2WAHA 1FIEA 1OQXA 1KNOB 3PL6C 1J0HA 4PJ9A 5HI3C 1BAFL 5KOMC 2EIEA 1AGBB 1LK2B 2GHWB 4EI5D 1JZ7A 1N5YL 3KPRA 4GBXA 2YC1B 4XGZA 2AJYH 5I6XB 1U3HC 3CD4A 4AEFA 3EJYD 1JZ2A 3DO7B 4XP6H 5E99L 1CGTA 2FH8A 2VL4A 4P9HH 1DLFL 3CDCA 3MLXL 1UCBH 2PYEA 3VFPA 3HC0B 1QOKA 3QHTC 3KYOA 5CGTA 4WW2B 5T1KD 1GGUA 3QFDA 1YC7A 1F11A 1IGIL 4D9LH 1NC2B 2IQ9L 5I2IB 3UYOD 2X4QB 4J4PC 1I3GH 1YEJH 4U6VH 2H2SD 3K80A 1F4WH 3G5XB 1JHLH 4N9GB 3CH1A 4JM4H 1TJIL 4JFZH 4TTDC 4UMGA 5E8OB 5HHXH 5EZOL 1RK0B 1AP2B 1BEYH 1LD9B 4NDMB 4NQCD 5TPWL 3LV3A 3EOAA 4NRXB 4MNQB 5MEND 1CL7L 4PRID 1INQA 2A77H 5ACMA 3BVNA 2E9BA 4GAJH 3ZDZE 3BP6A 5ISZB 1IKFL 1JBJA 1I8KA 5T5FL 2VDNL 2HTKC 4PTTB 1WWBX 3RTQC 4M5ZL 4QWWD 2XKNB 3L5HA 1S8DB 3EHBC 3TA3A 5HHNB 1CE1H 3CCHB 5IIEB 4Z0BL 4WW1B 4YHZL 2X4SA 1GAFL 5T3XL 1U92A 8CGTA 2HRPL 2VZSA 1KPUB 1DCLA 2VLJA 2MKLC 1G7JB 1WC7B 2FB4H 3FB5A 5KS9E 4L4VA 3KLSA 3KR3H 1SJXA 1FBIH 2YXMA 4Z77B 2PTTB 5IHUH 1GGIL 1J88A 2R8SH 3DXAE 4OLZL 4X7SL 5KZCB 4H0IA 4MJIA 2WANA 5F7NC 3NCBB 1W72B 2BVEA 2ZUXA 2VTFA 3GO1H 1H3WM 1H0DA 3L7EB 1J8KA 4P2OA 2X70B 4ONFH 4ZG1A 5HHQA 5F7WC 5IVOA 3CZJA 1KJVA 1UH3A 1QLRB 5EPMA 2Y07H 4FNLL 2R4RH 2VZ1A 3TZVD 5EUKA 2OXHA 4ZDHA 4M7JL 3RWFB 2V2WA 5AD0B 3RY4A 1RZFL 4DVRH 3V0VB 5SV3A 2CJUL 2FIKB 5L7XH 2CLRA 5I75C 2XN9E 4L4JA 4NO0B 4X0KA 4Z7OF 3T4AB 5IFAH 1L9NA 4LCWD 1N6VA 4LSSH 2UZXB 3P4NA 4NOBA 3E8UH 1CBVL 3EDEA 4YZFE 4KUCD 4DGIH 3ARQA 5I1DA 4RCAA 2A9MH 3ZT5A 4M4RA 1W2KT 4RFOH 5GGSB 2Z8SA 3MRPB 1KSRA 5T1KA 4XWOD 2VZVA 2E3VA 2A6DA 4LSRH 4OQTL 1TLKA 3C60D 3KWWB 1TQCC 4GW5B 5DD6B 3HI5H 1FNHA 5E2TH 3MGTA 3RBGA 1TCMA 3EOBA 1MFBH 3VH8B 1J0KA 3WNOA 3RX7A 4JFPA 1U95A 1U2CA 4N0UE 5ITBL 1T3FA 1Q9KA 3W9DA 1IILE 3CMOL 4NN5B 4YQXL 1GHFL 1MUJB 3PV6A 4WVRA 4Y2OA 4F80A 1HKFA 1IQWL 3F65A 4N0RA 5D2NC 3TIDA 5MENA 1LQSR 4PRIA 4Y5YB 1S9WB 4KDTC 3BSZH 4ZFGH 3U30B 1EXUA 2IGFH 1F8TL 3GKWH 4R4BA 2FO4A 5DQ9B 4I13B 1CFBA 5BS0E 2A38A 2P49B 2YSSA 1NCWH 4HIIB 5GGQH 3B83A 2P4AB 4KQ4H 1PQZA 4PV8A 5A40E 5GRVK 3D6GA 1JYVA 1NBZA 4UTAH 4JM2F 5JDSB 4PBVC 3IFLH 3TFKC 4NUJA 3D2UB 3BKMH 3VW3L 1KCUL 1FO0A 4H1LA 1YEKH 2CUIA 4ZAKD 1DBBL 3MNZB 3QNYB 1DL7L 1DZBA 1LO0L 4V1DB 1C16A 3IJYA 2MFNA 4PG9B 1VB9A 4C4KO 1VFAB 2BRRL 3S5LG 4UTBH 4ZUUB 3CUPA 5IOPB 3BP5B 2NY2D 4PJ8C 1B88A 4TPRL 2NXYC 2F53E 2HTLC 5E6YA 3B8SA 1CGVA 1SJVA 3RL1A 3LN5A 4X9BA 4P2RE 1OB1A 3FQXA 5C08D 5LWYL 1IGMH 1BQSA 2O5YH 4FZEH 1NGZB 3D3VE 4Q97A 1FVDA 4RGOH 2P5EE 1JN6B 3B3IA 1SY6L 1NMAL 2DS4A 1UZ8A 3X14A 3M07A 1NCCH 1IGFH 4GQ9H 4M9PA 1J7VR 3H42L 1I85C 4P5KB 1NGPL 5DWUH 3VD4A 4M93C 5CJXC 1JGUH 2Q76A 3NFNB 4PJBA 3E2HB 2D7TL 1WF5A 5IFJB 4YEEA 4M1GH 1A5FH 3RVVD 3QUZD 3C60A 3NACH 3OG4B 3PNWB 1HYSD 5J9PA 1A0QL 3BDYH 4ODHL 2NZ9C 2VZTA 1FNLA 3ARGC 3MRLA 1YPZB 3SKMB 1AH1A 3IDXH 1RJYB 1FPTL 3P0GB 3VXUD 1EK3A 4XP4H 1CF8H 5FYJL 2JK5B 3U9PH 1NGWA 2J7LA 1EJOH 4X6DE 4PP2A 3AUVA 4GMSH 5B39G 4KU1A 4QCIB 4Z78B 4P59L 4RAVB 1TZHB 5GRJH 4FQJH 1NFDF 3FB8B 3O9WB 4FQHB 1F6AB 4E42B 2VXVH 1X5IA 2CDEA 1Y0LA 4YNYB 1S5HB 3G5YA 4P57B 4WJ5A 3AB0B 4Q7DA 5FKAA 1DBAH 2OS7A 5T3XD 4HIEB 2C3VA 3D1MC 3THMH 5JOFB 5FK9B 3QIUB 4KUZH 4WCYH 4XCYA 5C0AD 3PWLA 2E7LA 5FM5M 1MCWW 3AREC 5CINL 5E08L 1GCFA 3GK8H 3QQ4A 5D5MA 4ZAKA 1JTTA 2HFGL 5T1MB 4HW6A 1S9YB 5E9DD 3MV7D 4JN2A 4Z7WE 3WNMA 3IDYC 4NHUA 5JIIA 1YEDB 4PTUA 3HNTH 5E8EA 4LCUA 2CKBH 5D1ZC 4PRPD 4M4PA 4YXHL 5H2BA 5DJDB 5EU6A 3D25A 1JHKL 1YYLH 1JV5B 3DX9B 3QWQB 1YEEL 3BJLA 1AGEA 3U46A 3L3JA 4X99B 5C08A 5F21B 1YNTB 4OFKA 3VD7A 1R6VA 4LSDA 3JWDL 1N59B 3WJLC 4S1QH 2IANB 1AO7A 4PJDB 3EGSB 4L4TB 2DIJA 3WLWD 4K94L 4HS8H 4X9GA 1GOGA 2ITDB 4OF5A 4Y2DD 3MLYH 4JQXC 5JW4Q 3PHOB 3BUYA 3HPLA 4QTHB 2X4OA 4YDIL 2BVPB 4UIMB 2C4FU 1U2HA 3E6HA 3OAYK 3GMPA 2VUOA 4K7FA 1KIUA 2W38A 4F9LA 4C56E 4Y5VC 5JOPE 4ODSL 5SWZB 4IJ3C 1XR9B 4ZOBA 3EW3B 1JZ8A 2WUBL 4EJ1C 2CQVA 5K93A 4X8JB 1CZ8L 2NY4C 2OJEB 3HE7D 4LQFH 4UB0H 2Q20A 4IRJA 3VXUA 5HGAA 1CLOL 3VFRA 3ROLA 1X5YA 2EIBA 3ES6B 3P0YL 1P9MA 5ICXA 3FOMB 3BZDA 4MVBD 2CIKA 3KDMB 3VDBA 5IMOA 1HIMH 3V6ZA 1XGQB 3RVXC 1KTDA 4OFVA 1JPTL 3QI9C 3LVEA 4HBQA 3JWDC 3EO0A 3T65A 3NVQA 3MZTA 3B9DA 3ESUF 4H8WH 4XVUD 5EIIB 2CDFB 1RUQH 1QSFB 1WUNT 1FL6B 2GJZA 2CK0H 3IFOA 5F7EH 5IEHB 3GFUA 1G9NL 4O9HH 4Y4KC 2FBOJ 2QSCH 4RMRA 5ALCL 1N0XH 5C0AA 4N90E 3RUGE 3IU3B 2CD0A 5MERA 3KJ6H 1MI5E 4ODVL 1QYGL 4Z7VA 4UZGA 3JTTB 3ULUH 2BX5A 5FDYA 3SDDC 2XZAH 3MV7A 2FEEL 5KTEH 5I8OH 4UI2A 1FNEB 1D5XA 4AM0A 2CMRH 3IETB 4M43H 2VE6A 3OAYH 3VD9A 4PRPA 3GRWH 5BVPH 4CRPA 3ULVF 3JV0A 5L2JA 4L9LB 5IM7A 2NNAA 5B8CC 4X6BA 1R3JA 2O5XH 2YZ8A 2PO6D 5E6ID 1FQ9C 3UPRB 3KPQA 3P73A 4NNPL 1BLNB 4JGJA 3QIWB 4X9HA 2DLFH 2DTML 1KF9B 1P6AB 4UQ2B 5C0BA 3RJDA 4Z7NE 2KKQA 4GAFB 5AZ2H 2N4IA 4PJCA 5I8CA 1LVEA 1LK3H 1BFVL 3QUXC 4G9DA 1P4BL 2NW2A 3MSPA 1YDPB 3LIZH 4QRQB 4M9OA 2XQBH 3BEVA 4KI5D 5D96B 3DIFA 4M62H 2W91A 4EIZC 2RR3A 5CZVL 4QRSA 4XPFL 1JF5A 3DVNA 3MACL 2IBZX 4OQTA 3KYMB 3B6SB 5GS1B 5HGGS 5HDBE 3LN9A 4L8CB 4RAHA 2IMNA 3ARYA 5MEOA 1EH9A 5DYOA 3LHPH 3GSVA 4CW1A 3KGRA 4ZS7H 5CD3B 1T5WA 2J88H 1NC2D 3QCUL 4HWZA 4RX4D 2B0SL 5DJ6A 3G9AB 3OQ3B 3VWKB 3ZTNH 2IJ0C 1Q1JL 1LE5A 2VLMD 4I3RL 3MRGA 4XB7A 3T0EB 3GUTA 3FTGA 1D5IL 1FIGH 1KGCD 2V5SA 4LCIL 5JNYA 3VRIA 3GBNL 4LAQL 1OGAB 4MNQD 1HXMB 4K3EH 4CJ0A 3REWB 5C2UB 5HPMB 4N0FA 3EYQD 5HI4D 5DT1L 5GRYA 4DVBA 4JPWH 3IDMB 1YPZF 2BOCB 5ISZD 1JGEB 1M6OA 4JKPH 4YBQC 3QNZA 4J3VA 4E41B 3CSYA 1N64H 1CXIA 4ELKA 2NY3B 1EFXB 1KB9K 1KYOK 3V7AG 4HDIA 3S88H 4RIRA 3VFTB 1QKZH 3TC9A 5HYJA 3TBSA 1EMTL 3TYFB 1WBZA 3DARA 3QPQD 3S34H 3VI4E 3Q3GA 5FO8B 2EE9A 1MCBA 4I2XA 2IPUG 4LPYA 4MWFA 2AABH 1QHOA 2Y4SA 1ZGLB 2BNQD 5FYKD 2RQ8A 4O02H 1GZQA 4DEPB 1WAAE 3RWHA 1FGNL 2OM5A 4KKBC 2GTZA 3V52H 3MCLL 5I17B 1WFUA 3A0OA 2VIRA 2PO6A 5E6IA 2J8UA 1P1ZA 3MLZL 3TV3L 3OKKB 1BIHA 2DKSA 1HSBB 3ULSB 5KVMC 2X1OA 2P5WB 1EDQA 5D70L 4P3WA 3SDAD 3T0BA 5L0QC 3I3EA 1SY6A 2D7MA 3OR7A 3IS0X 5DZNA 4XXDA 2ZUQC 1AGBA 1MPAH 3ARBC 2ORBH 4X4MA 5I1CH 4G6KL 1T80A 1E4WH 1QPXA 4JRXB 5JA8B 3WUWA 1EO8H 4F7TA 1B4JL 3MLUL 4GLRI 4BH8B 5IW6A 1YEFL 4OIIL 5CJ5A 4OZ4B 5FA3A 4LLDB 1MJ8L 3AREA 4W4OA 1T4KB 2DD8H 2JE8A 4PJFB 1J05A 1ZGLP 1CFQB 3IGAB 1X9QA 3MXWH 5DJYA 2Y06L 1N3NA 4G9FB 5CKAA 4PJDF 4NP4H 3SBWA 5JQ6H 4NFDA 2UZIL 3JV6B 4RX4A 3DBXA 4LLWB 4JCMA 4OT1L 3V2AR 3G5XA 3HZMB 3OKDA 2FO1A 2ILLA 5EU4B 2NPLX 4F57H 3LKOA 1E6JH 3TN0A 1CFSA 5GS2H 3BHBA 3INUL 1WCQA 3ILQC 5IVXA 2DLTA 4KKCC 4WUKH 3SY0B 2A1WH 4MA8H 2L0DA 1K3IA 3FO0L 3OKEA 3GB7A 4CU8A 5EO0B 3W82A 1ZA3A 3TJEL 5LGHH 3KPTA 4I1NB 2HFFB 4K3JH 3UPCA 2M26A 1CLYH 5ISZA 4LPWA 4H25A 4JQXA 4PTTA 4QNPE 2E7CA 3QDMD 1G7HB 5F3HB 4H1LG 1VHPA 4LEOB 4R97B 1BQHB 2EYRA 1SJHA 3DETD 4LBEB 2AGJL 2NY0C 3VFWA 2AJYL 4LF3B 3Q1SH 4BA8A 2Z35B 5FAAA 4NRZA 4XP6L 2KQNA 5E94A 3MCKB 2E7BA 4P9HL 2PTTA 1UCBL 2EDQA 1U8PB 2BNQA 5CEZH 1INEH 5DVMA 1HQ4A 3D85D 4OGAC 3K74B 1HSAA 1T0PB 4D9LL 1G6RH 4YGVA 4OF7A 5E2UH 5B21A 3T2NL 2ERJC 1I3GL 1YEJL 4U6VL 4WGWB 1F4WL 3QFJE 4GO6B 1Q0YL 1JHLL 5JPMB 1JYXA 1F6LL 2OK0H 4JM4L 3ZHDA 1C12B 1WK0A 2F15A 3L5WA 3V4VH 2QADC 4PJBE 3SDAA 1DDHA 5D1XC 2APBA 2HYMA 4HWBH 3V0VA 5AD0A 4ZO7A 3SDCB 2Z31A 5DTFA 4U1NB 3F12B 4HLZH 5BMFH 3T0WA 2WP3O 1HKLH 4WNQB 4LRIC 4MA3B 1QR1A 3EUUA 5HHOD 3T4AA 4ZUSB 2IBBA 3KLAA 5IWLC 4NUGH 3S98A 4XNMA 2ZPKH 1AQDB 2IALA 1QBMH 5INDA 1AJ7H 1CE1L 2AK4E 3TM6A 5KSBE 1TETH 5GGSA 3MRPA 1AD0A 3ZDYF 3O45B 3S7GA 4AT6A 5C0JB 2DQGL 1SYVB 4NKQB 1B6UA 3Q6FB 3I6KB 1S9XA 5HYQB 1G84A 1RSFA 1A7BA 5FA4B 2FB4L 4ODUB 1BF8A 3FKUS 1FBIL 1CDIA 4CMHB 4QRTB 4NZTH 3RP1A 4LSPL 2YRLA 2R8SL 4PJGB 5B8CA 4PJHB 4JPIB 5DJCA 4BFEA 4PJIA 1J8HE 1FCCA 4LLVA 4GG6F 4Y1AB 4XWGH 2X09A 3ECBA 4HCRA 4HIJA 4ZUWB 2BHUA 5K33A 3QQ3A 4NQTA 4ONFL 4FTVB 1J86A 4HWEH 3P30H 5E7FA 4RFNB 3O9WD 4P99A 5JIPA 2R4RL 5GZND 2EC9T 4GXVH 4JFFA 1QRND 1IQDB 5KSVB 3EDKA 1WZLA 1ZTXH 4FFZH 1A47A 1JFQH 4DVRL 3QXDA 3VFNB 5L7XL 4Y19B 2D0HA 3QDMA 4M8QB 2AVGA 2HG5B 2VLRE 3NA9H 3OGCB 4JFEA 3U4EA 3HZYB 4MNGB 2IPKA 4PGCB 4JPKH 5JDSA 4HV8A 1MOEA 3FB7B 4LSSL 5EBWB 3FHAA 3MRHA 3QIUD 4OCXH 3WS3B 2P8MB 3E8UL 1ZVSB 3MMEA 2CDGA 4K07A 3QJFA 4DGIL 3VMNA 4KTDH 2N1KA 4P5TC 2A9ML 4LLMA 4RFOL 1FL3B 3GSQB 4Y8DC 3ULVH 4H0HB 2V7HA 3PJSA 4K55A 3UZVB 1DBMH 1MCOH 1FJ1B 1MF2H 3ABZA 2B2XL 3D85A 1HN1A 1RPQA 4LSRL 3LKSB 1I1RA 3GSRB 3HI5L 4B53A 3BP5A 2BRQA 1MFBL 2A0LD 4KRPB 2FJGB 3RKDD 2VZ3A 2W9EH 3HMXH 4JVPA 4YHIA 4PJ7B 2P24A 4RA3A 3NZ8B 2DM2A 1NCTA 3C8DA 2IAND 3FQTB 1I7ZA 4F7EB 5CGYC 1NGZA 4F7PA 4OM1H 5HHOA 3FCTB 2VDPL 1DN0A 3BSZL 4ZFGL 3GKWL 4HT1L 3ROOA 5B38B 5J13C 1H9VA 1CWVA 4XX1G 4P5KA 1NCWL 5GGQL 1X5KA 5GGTH 4XHJC 1GGBL 4ERSH 4XXCC 4J8RB 5GZOC 3QXAA 5J8OA 1ZVYA 3NFNA 1OAQL 3IFLL 3ZYJA 4JVUA 3HG1B 5E8NA 5HBBA 3O6MH 5SWZD 3PNWA 1OCWH 3BKML 4APQD 1NAKH 1YEKL 5F96L 3SKMA 4LPVA 3W9EB 4H20H 2AJSH 2HJKB 1FNAA 1HHHA 2JK5A 1BVKB 4AQOA 4MDIB 4XNYH 2B4CH 2HLAB 2P8PB 3HAEG 3CVIH 1KCRH 1M05B 2UWEB 4TOYL 4UTBL 4C54A 2IFGA 4OJFL 4DCQA 4Z78A 4X6CB 4J3WA 5HGHB 2IAMB 3BMVA 3FB8A 4PJFF 3SKOA 4ZPVA 3T08A 1IC1A 1F6AA 1QRNA 4XVJH 4ZFOB 3QEUB 1MQKL 1ZVHA 1I1AC 1IGML 5HGDA 2FJHB 3OJVC 1NGXA 2WIIA 4WFHD 3RWGA 4DN4H 5DEFB 3QDJA 4FZEL 3RKPA 5C0IB 5E4EB 1DEDA 4MQSB 2B8OT 2EDFA 4MD0B 1NCCL 4CL7A 4KRMB 1IGFL 4U1GC 5EBLA 4XMPH 3BH8B 1YNLH 2NXZD 1RK1A 5DWUL 1A6TB 3S6CA 4MJ5B 2JCCE 4BUGA 5J3HD 1MFEH 2W9LA 4F7MB 1JGUL 4J3OC 4HZLB 2OCFD 5D2NE 1S9YA 5C0BE 1Q9WA 4ODWA 1W0YT 3I02B 1A5FL 5HHVL 1YEDA 1T5XA 4QWWC 4JG0L 5GRVL 3NACL 4G80B 3BDYL 3BGMA 1QBAA 3WIHL 2GEEA 5IK3B 4EQ2A 3IDXL 3D48R 1KIPB 4UUJA 1ETZB 1CF8L 3BD3A 4XP4L 3BDXA 4JRWA 2BP3A 4QYOA 3HB3D 3QIWD 1EHXA 4EVNA 3Q5YA 2EC8A 1E4XI 4GMSL 4P2CG 2DOCA 1A9EB 1EEYA 3L3OB 5FV1L 4U6XA 4FQJL 1LNUB 3MUY1 5TGBA 4GW1B 4W4NA 2W60B 2KQMA 2ZG3A 5FYKU 3B9KC 4ZMAT 1Y18B 2VXVL 4KJQC 4PJAA 4U1JA 4QTHA 5C0NC 5EZJB 4N8VB 4JZOB 2V9TA 1NKRA 1DBAL 5CEXB 2DQFA 4C57C 4Q0XL 1U41A 4I18B 3N1MC 3V6FA 3QEQA 4MAYA 15C8H 2D9CA 4KUZL 4WCYL 3M17B 1HHKA 4APQA 4MYWB 4QXTA 1N7ML 2KUTA 3H9SE 5D7SH 4M3KB 1TQBC 1MRDH 1RI8A 3GK8L 4IBLT 3TVMB 5C0GA 3L5JA 3GMRB 3G5ZB 4HKBB 3SJVB 5FDWB 5T3ZD 4MGXA 1C1EH 3O4LB 3VWKD 3HNTL 4U0RC 4GKSB 1PKQB 2IADB 4OCMC 2CKBL 2X4TA 2FX8H 4RGNB 3T0ED 1QLFA 1D9KB 1TVDA 4U1SA 4KJPC 1YYLL 4D9QE 2AQ2A 1BIIB 3JV4B 3L7FA 1YYMH 3O8XA 2R1WA 4WTXA 3RVTD 2AS5M 1GGTA 2YEZB 4QRRB 1OGAD 1FL5B 1TJGL 3PWVB 4S1QL 1JNNH 1FL6A 3EYUL 3GBMH 3SE4A 5BW7C 3GMQB 2ZOLB 3MLRH 5IEHA 1IAIH 2O5ZH 3FFCE 3WS6A 1R24B 3MLYL 3X12B 1PY9A 2YD9A 1H8NA 5D7JD 4LDEB 4WO4D 4ZO8A 1BM3H 5DS8B 4IEFB 3D9AL 4Q74A 1L9MA 4MAUH 5DO2C 1EO7A 5DJ8A 4KK6D 1S7QB 4JG1H 2LFGA 3CDGB 3MRCB 4EIGB 4F7CA 3U36A 1NANI 3TYGH 4JHAH 3KNBB 1I8LA 2WWMD 1MJ7H 4ZXBB 5K9OB 3DRQA 4UV4H 5DC4B 3QXWA 2DYPA 4LQFL 4L9LA 1JPGA 5F7KC 3TO2B 1FORL 4JANB 1R3LB 2XTLA 2F58H 3UPRA 3DROA 4WV1A 4WU7B 1BLNA 2Y6SD 4KK5D 4KJYB 4WHYG 2VDRH 2BVQB 1HIML 1NSNH 2P5WD 3WUWG 1K4DA 5HJ3B 5IB3B 1IAIM 1RZGB 2LAGB 5INCB 5CP7A 2CR6A 1KUMA 5CBAA 5FECA 4H8WL 12E8H 3G6JE 3GSWB 2R4SH 4JRXD 4PGZA 1IEBA 5I74B 3C6LB 4WY7H 3UROR 1GOHA 1RUQL 4NOFA 5F7EL 2CK0L 5ERWA 4QHKI 5KSUB 3V7MA 2YPKA 2J2ZA 2GY7B 1M71B 4MCYA 1BFSA 4KK9C 5D93C 3FT3B 4PJ7F 4DZ8A 1G0YR 4G8IB 3B9AA 2VN7A 4GG8A 3KJ6L 3WIFB 1XFPA 1UWGL 3NGBB 1LDSA 4UILH 3FQNA 2BOBB 3IRPX 2XZAL 5KTEL 3RVWC 4LOUC 4ENED 2CMRL 4I0PD 4M43L 4MB5A 4TSAH 4JFDB 4Y4HC 3OTTA 1QFWH 4XBEH 4DAGH 3RX8A 3V9FA 2YPLE 5FKPB 3QUZC 3NFPB 4LHQB 43CAB 1G7MB 1JMXA 2DLFL 4L9DA 4GKZB 3UXFA 4RZCB 5HPMA 5TDOA 3DVGA 4GUPB 4XP9H 5AZ2L 2CRYA 1LK3L 3GGWA 3WFHB 5HVFB 3EOTH 3QUYD 3WO4C 4QF1B 3LIZL 3I50H 2C3WA 2XQBL 4PJXE 1IT9H 4QRPA 4F3FA 5D7JA 5JLZB 4WO4A 2CPCA 3HUJF 2ADIA 3VFTA 5E56A 3M8OH 4L3EA 5I19H 4LCCB 4PLKD 1Z0NA 1HHJB 4ODTH 4ZNCD 4J3SA 4LLUB 5D6DC 1B0WA 3MRKB 2LE9A 4POZD 4RWYH 5CBEB 3MV8E 1J0JA 4BFGA 1QFWM 3LHPL 3MOAH 4XP5H 3BP4A 4KMTH 5IQ9B 4F33A 5BJTA 4JREB 1WZMA 4Y0GA 5IB5A 1BQLH 1F4HA 3WN5C 3WYRA 1ODAA 3ZTNL 3O11B 1AD9A 4JKLA 1U8LA 3P9WB 4OAWA 5EA0H 5DDHA 3GHBH 4HS6B 2H3NB 1EEZB 4K7PH 3UTTA 4H5SA 3L5XH 3WMSA 1K6QH 1FIGL 2QR0B 2AV1B 4ZPTA 1IC5H 3SDCD 3UTZB 3LS4H 2EDKA 1WLHA 5L6YH 4K3EL 2B5IC 4JRXA 5AZEH 4LVEA 4J6RH 2PW2B 1HHGB 4JPWL 5CSGA 4JO2H 2F74B 1EAPB 4JKPL 4DQOH 3SOBH 4ZTPH 1N64L 4PRHA 3GZKA 1J87A 5DUMH 5F1SA 3S88L 2AXFA 5IT2H 3LY6A 3T0DA 2VQ1B 5TQ0H 4X98A 1QKZL 3DV6B 1QNZH 4JHBA 3NN8B 3S34L 3JV6A 1GGCH 4P46C 5CJQH 2OR9H 1PDKA 2AABL 3HZMA 3G6AB 4I0PA 4KDVA 3BH9A 1SBBA 4O02L 3EO1B 1MHCB 5D7KD 2Q87A 2C4FT 2IH1A 1CTOA 2XNAB 4P23D 4GRWE 4RMSA 4FXLA 4NQDE 4FTVD 4Y4FD 3ZTJG 1JWSB 5EO0A 2PXYD 3P9LB 3HE7C 1NBYA 3IFPB 4WHCA 4DGYH 1KPRA 1MFCH 2ICWB 2BCKB 4Q6YA 3GI9H 4Y19D 2E6JA 3QUYA 1MPAL 4B7IA 4MVBC 5JHDA 4OCRL 2ORBL 4JY4B 4LEOA 1E4WL 1S7TB 2BSRA 1A7RH 1EO8L 4LBEA 4CKVX 1NLDH 2GJ6B 5EC1A 3LDBB 3HPJB 4X4XB 4AZ8A 3TJHD 3ZL4L 5ITFA 2DD8L 3DGCR 5C09A 2HN7B 4WWKC 5FCUH 3ZE1E 3PQYE 3MXWL 1CXHA 1G7LB 2OTUB 4NP4L 5JQ6L 3SO3B 3BZ4A 1XF2A 1BD2E 1NDGB 1I7RB 1YY8B 2EDJA 1H5BB 3TH3T 4KRPD 3TNNB 4M8VA 3LD8B 1AHWC 4F57L 4ZD3H 1A6ZA 1C12A 1E6JL 1TZIA 2C1PA 5B3JF 5EZLA 4JJ5B 2XKUA 2A1WL 4U1NA 1GOFA 4LKXB 2Z4QB 4WNQA 2ED8A 3KXFE 3CU1A 3MPCA 3R4DA 4K3JL 5B3NA 3WLBB 1DLHA 2EIZA 3KPNB 3TF7C 5HDBF 4HKJB 1AQKH 4X5WA 4R3SB 4NCDA 4D94A 2RCSH 5LXGH 1AQDA 1A6UH 5DRXA 1ZS8A 4XBGA 2AI0H 4PG2A 1DQLH 1RHFA 1NUFA 3NPZB 1D3CA 1BBJA 3Q1SL 3ULUD 3HG1D 3Q6FA 4WUUD 2VLKB 4PJEB 5TDNB 5D7LD 3MUGA 5H35B 1ZHNB 4IM8A 1OVZA 1VKXA 3JBG7 3W2DH 5IR1B 4FQ2H 4QRTA 2PF6A 5CEZL 5I6XC 1INEL 2CKBA 4JPIA 5IFHH 4U1LB 1SMAA 2HT4C 2W0LA 4P23A 4XHQA 1JVKA 1G6RL 1NAMB 5E2UL 1I9EA 4DKFH 4FTVA 4Y4FA 4WW2C 3V6OC 2PXYA 2IAMD 5D6CA 5EOCJ 5F9OL 2B1AH 5DLMH 3BW9A 4Z18A 3F8UB 3CFJA 5KANG 4ETQB 3G04B 4LGSB 3V4VL 1A02N 1O7VA 4QHUA 3Q0HA 1RZJH 4MDJB 3VXTA 4O2CA 4MB3A 4Y19A 2XG5A 4M8QA 5BMFL 2AV7B 3DURA 4HMEA 3PWJB 3HNVH 1XF3A 2OBGA 5E8PB 5ESVA 1HKLL 2YUWA 1RZ8B 1OW0A 4ZQKB 5LAXB 1IARB 3IF1A 4OFDA 5FHAH 1ZEAL 4HEME 1IAOB 1OL0A 1JNHB 3QXUA 4P4KB 5E1AA 4NUGL 3WNNA 4OZHF 1U8KA 1WAAF 4JDTH 1T2QH 3D0LB 3FO9B 1GVIA 1LHZA 1QBML 2QHLA 1AJ7L 1FZMB 3ILPA 5IMKB 4G43B 3EJZD 1TETL 3QEHA 1JYNA 1FL3A 2X4UB 3NBNA 1L0QA 2XY1A 4QY8B 5EC2A 4YX2L 5IF0B 5JW4N 1IE5A 3WHE1 5KSAB 1QUNA 3VFMA 2HP4A 4NZTL 4MD5A 2AXHA 3QPQC 2VR5A 1UFUA 4HFWB 3CAFA 4XWGL 2Y7QB 1PX3A 4X6FB 3VE0A 1LO4H 1JUFB 3ZE2F 4OD3H 3TBWA 1U8IA 4HWEL 4F7EA 1EZVY 3P30L 4Z76A 3N1GC 4CN4A 5GSRA 2O61B 5AUMA 5M94B 4OD1L 1QO3B 2P1YA 4GXVL 2PTUA 3I75B 1ZTXL 4FFZL 1JFQL 1FC1A 4U0QB 4KTEH 3PXJA 2AKRB 3HMWH 5BRZE 1S3KH 4YC2B 5FM5O 4NO3A 4RNRA 3NA9L 3QIBC 4XPGH 5C07E 2D31B 4YDKH 3NABH 1ADQL 1ND0B 4JPKL 4NQEA 5DMIH 4L5FH 1I7UA 1EVUA 2ATPB 2BNRE 3HNSH 1T21A 4WUUA 4HJJL 4OCXL 3X13A 3CX5J 5D7LA 1TDQA 5AWNH 2NW3B 2W0FB 4X5XB 3TVMD 2C7UA 3LKPB 3SJVD 2W59A 1N8ZA 3ULVL 3GRWA 4RDQF 1DBML 2F9BT 1MCOL 3O4LD 4OV6F 2P8PA 1P6FA 1OT1A 5GJSH 3MA9L 1M05A 1WICA 4ONHB 1XF4A 4RGND 1ED3A 2IG2L 1D9KD 2Y5TA 1ZHKA 4X6CA 1OP5K 1CGUA 4P2YA 2W9EL 1Z5LB 5CD5D 1HZHL 5I1HH 1UKTA 3EFDH 5FF6B 5BOZG 2XRAL 4G3YH 4OCWL 4NKOB 2PCPB 2Z8RA 2APVA 2FJHA 4X7TB 2GJJA 1ROWA 5IBUB 4ZSOE 1MAMH 3PWPD 4U05A 3B2UD 4OM1L 4TVPD 4G8GA 3EYVA 3RZCB 4D8PA 4A6YB 5J12B 4JO3L 4NN5C 3AU1A 2JKXA 5EU7C 3GIZH 4ZUTB 2X05A 3STLA 5GGTL 4ERSL 4AL8H 2ESVE 4Y5YC 4OIAA 1NLBH 4XI5C 2Z93B 2JB5H 2R9HD 3U0PB 1SHMA 1XCTB 2MNUA 4HFUH 5IB1B 3O6ML 1OCWL 4RMUA 3ULVC 2N7AA 3IDJA 4ZXBD 2XZQH 3IXAA 4YWGH 2YHGA 1NAKL 3KYKH 1CI5A 1OQOA 2A9NL 1ZT7B 3WXWH 2Z91B 3L3HB 4PRAB 4U1MA 1DQQB 3H9HA 4H20L 2AJSL 1J18A 1A4JB 2YUVA 1ES0B 1TXKA 5GS2D 4XNYL 2B4CL 1G1YA 1H3TA 4F2MB 3CVIL 3HR5A 1KCRL 1HCFX 3BP7A 3K7UA 1PJ9A 3VXMB 5K9KB 2R0LH 2RFXA 3L3OA 1NC4B 2EYSA 2CRIA 3VFVA 4LCYA 4NKMA 2LAAA 4KKLD 1QBBA 4P48A 1CFVH 5DSCA 2LU3A 5MEQA 4MB4A 5I1JH 4XVJL 1DQDH 5A1AA 1OP5H 4JM2A 1OTSC 4X9FA 1FC2D 2YMXH 3KJ4B 3C6LD 3IVKB 5DA0B 1JHTA 2YA1A 3OXRB 5F71A 4DN4L 3FN9A 4G7VH 3CZFB 4LRNH 4XC3L 3OR6A 1H3PH 4TNVF 5SWSB 1KLUA 1GXEA 4DGVH 4UBDD 1UACH 4XMPL 1CXEA 4YHYB 1YNLL 1DVFB 3DUUB 2JJTC 5E1HB 3G5VA 5I16B 1A6WH 2FD6H 3RL2B 1MFEL 3BQUB 3G5ZA 5IROA 4WEBH 3VXSE 1AC0A 3TEUA 4LGRB 3DX8B 3TCLA 2ZOKB 2DN7A 3GNMH 2BDNH 4NQXB 5KVDH 3I6GB 4HUVA 4Y88A 4PY8J 1T1ZA 4NN6B 3BPOC 5ICYB 2F5AL 2FWOB 4KAQH 4O2FA 2G2RB 5IW1A 4Y16D 1SVZA 1NBQA 1NEZA 3O0RH 4ORGA 5C6TH 4KXZI 4PJEF 5D7IE 3FB6B 3S3JA 1T0NA 3UTQB 4RFEB 3PWPA 3KHOA 4OZGB 5DR5H 3QHZH 5EU3B 3O3DA 5DK3A 5E2VH 5DJ0B 2NY1B 1WBXB 4GXUN 4NKDA 4Z9KB 1P7KA 3O9WC 3EDJA 3CDGA 3D18B 3G9VA 15C8L 3NCYS 5J1AA 1I4FB 5HYSB 3KNBA 4ZXBA 4QHLB 4GMTH 2GAZB 3AB0C 5D7SL 1MRDL 1F4AA 4QGTA 2F5BH 3OWEA 3DECA 5D1QB 1XH3B 3QA3A 1G7QA 1S7SB 4NC2B 3TO2A 3QZWA 1GC1H 4YK4B 3QIUC 3RWCA 1C1EL 1IGYB 1NFDA 1MNUH 3EDDA 4KJYA 3HA0A 1A8JH 2BVQA 4HX1A 4PRHE 1DEEA 1YN6B 5FB8A 1W8OA 5IB3A 4PS4H 1O0VA 3VXRD 1NDMA 3HZKB 1ZLVK 5MHSD 5KS9B 2Q7YB 5EUOF 1DUZB 1UH2A 2I27N 3GSWA 4CVZB 2HJLA 3MLTA 3C6LA 2A0LC 1JNNL 3RKDC 1U91A 4EZMA 3GBML 4R9HA 3S36H 4LVOB 5EIQA 3MLRL 5C0CE 1IAIL 2IQAB 3RU8H 4IIQC 3RY6A 1BX2B 5DMKA 2O5ZL 4R4ND 1CL7I 3DNKA 4N0YL 5IB4A 4LLQA 4FQXB 1AXIB 1NKOA 1UJ3A 4HJGB 1OF2A 1BM3L 2CK2A 5DA4A 4JG1L 4XNUH 4QRUB 2FYYB 2FHBA 1RZKH 3TYGL 3W11C 2XN9B 4NFBA 1G6RA 1MJ7L 4O4YH 1FV1A 4YHNA 4UV4L 2HMID 3BKYH 5JHDE 3ARDD 2FJFA 1QA9A 3TBTB 3PWNB 2VH5H 1K8IA 4HJ0D 4YIQB 4IMKC 1D5BB 2F58L 4Y16A 3BZEB 5C8JA 3CFBA 2DLGA 2OL3B 4HWBA 3LQAH 4YAQB 1YEIH 4OD2B 3R8BB 2UUDK 5DUPH 5GJTH 1NSNL 5L88H 5F8QC 4E5XB 4LCWE 1U8JB 3W39A 2F54B 1ZV5A 1W0VB 1BZ9A 4ZOAA 4QF1A 1XGYH 2DAVA 2D7NA 3VXOB 12E8L 3QIBA 4GJTB 4PJ5B 4EI6A 3L95A 3W0WD 2D2OA 2R4SL 2HVJB 4WY7L 1ZLVH 3T09A 2GJ6D 2YD1A 3MA7B 4N0UB 3T4YB 3QULA 1M7IA 1UCTA 3H9ZA 2VXQH 3VFUA 4LSVH 4LSTH 1HH6A 3RVUC 2AJXL 5B4MD 1C7TA 3FO2A 4RGMB 5FGSA 1MHEA 4G6AC 4NZUH 3VI3F 1CICB 4NJ9H 3MRKA 3NOIA 3GMMB 1EERB 4NQVA 2Z8VC 5CBEA 3CVHH 4CUCA 3H7BA 4NO2B 1G7IB 5IQ9A 2JB6B 3BKJL 5BV7H 4UAOB 4EXKA 4ELMB 2JF1A 4WI3A 2JJVA 2W1NA 3AROA 3PHQB 3O11A 5HGBA 3TPUA 1MH5B 1U0QA 5J3HC 1FYTA 4TSAL 1P2CA 5DEGA 1GRWA 1QFWL 4XBEL 4DAGL 2Z92B 2FECL 3VXRA 1U3YA 2MHAB 1KJMB 2HA1A 1B0GB 4HAFA 2C26A 4DW2H 4XBPB 3S5LB 3LPGA 4OKDA 4JGMA 1IC4H 1KJ2H 2I60H 3NCJH 1QLEH 2DIBA 3VJ6A 2SEBB 4XP9L 1MCQA 1AGCB 3V5HB 3UYRH 1EAJA 3BWAA 2UUDH 5ESAA 3QIWC 3OG6B 3EOTL 5DQJB 1JF1A 3I50L 1IT9L 4OCLC 4HPYH 3VGAB 1MRCH 2V7NA 2KZWA 2H41A 1F5WA 3DV6A 4P2RB 3M8OL 5JO5B 5BZDB 5I19L 4X7DC 2VLKD 5SWQA 3QUMH 2EDRA 5HVHC 1JE6A 1AGFA 4ODTL 4GQPH 4LVHB 5GGUA 4CGTA 5D96C 3SE9H 3G6AA 1MLCB 4GRLB 1CGXA 4Q9BA 4NSKB 3ARDA 2J4WH 5F9AC 1ZKAA 5IEKA 4XP5L 4M1DL 1GZPB 5D2LA 4KMTL 3HMXA 3EOYG 1CFNB 1BQLL 3QWOA 1QACA 3ARPA 5GS1C 3OZ9H 5CIPH 4PY8I 1A3RH 4I9WD 4R4FH 5GGSY 4TNVK 4MQ7A 4TVSa 2ITCB 3W5MA 3IFPA 4ZOCA 3GHBL 3L5XL 3MLSL 1K6QL 4TUJB 3BPCB 1I3RA 1MCHA 4NWTH 2ICWA 1IC5L 3FRUA 3LS4L 3MBXL 1T0MB 4KZDL 1C5CH 3T0EC 1AKJB 2ZCKH 2GCYA 4JY4A 1UB5A 3W0WA 2CUHA 1HXYA 1S7TA 5AZEL 1U93B 5KVGH 4J6RL 4YDJA 4MXVF 5J6GB 3MRIA 3QG7H 4M61A 5F88A 4DUWA 5HY9B 4JO2L 4AY0A 4P4KD 2C9AA 4X6DB 4X4XA 4DQOL 3SOBL 2R1XA 4LSUH 1OSZB 3KS0J 5IT2L 5F7MC 5DVKA