4YSQA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 8.38 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 96
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysqA00
1WA0X 3EHBB 4UF7C 3ERXA 1QLEB 4G70B 3SQRA 3QJSB 1IC0A 5A7EA 4AKPA 4GYBA 1BXUA 1JZHA 1JZIA 3C75A 1AG6A 3S3BB 4GXFA 3UACA 3X1BA 1JZFA 3NJMA 3T6VA 4G71B 2QPEB 3T6XA 4A2EA 2HX7A 2HX9A 1RZPA 5PAZA 1AQ8A 2PPEA 1AZNA 2YARA 1L9RA 5I6MA 2UX7A 2YAFA 3NT0A 1SHXA 2PPFA 2FTAA 3H4FA 1JXGA 2XX1A 2ZOOA 1UATA 2QT6A 1TKWA 3EH4B 1ILSA 2P80A 2QDWA 3PLYA 3ABGA 5IY5B 1NIBA 2AZUA 2I7SA 1NPJA 4Q89A 4YSPA 4Q8BA 4GP8B 3MX0B 4G7QB 1W6WA 2GB2A 2BW5A 2TSBA 1BQRA 1ZIBA 2B08A 3N55A 3FU8A 1VLXA 4P5SA 4DP0X 2P80D 3OMNB 1JVOA 1J9RA 2FNWA 2AFNA 2IH9A 3EF4A 5I6OA 3JTBA 4DP6X 1AS8A 1V10A 1L9OA 4AKOA 4FAAB 5FC9A 1EHKB 3WKPA 3WI9A 1MZZA 1ET8A 2BP0A 3EH3B 2YAQA 2VN3A 2FWLB 3BVDB 1TEFA 2BWIA 2IDSA 3FSWA 3NP4A 2I7OA 2YAHA 4KNSA 2PLTA 2EINB 1CYXA 1TU2A 3S8GB 3TBBA 2XV0A 2Y69B 2Q5BA 3AZUA 4BWWA 1KCWA 3AG3B 5B7FA 4A66A 2GSMB 3NJLA 6PCYA 4BWTA 2UX6A 4WKXA 1SHWA 4CSPA 1XMEB 2RACA 6PAZA 2W88A 5I5JA 1DYZA 2JKWA 1PZBA 4JHVA 3ZBMA 1GS6X 1GYCA 1YLBB 2CBPA 4YSEA 1J5DA 1NIEA 4UAHA 2FQDA 1CYWA 2EIMB 4NERA 2XXGA 4E9SA 2FQGA 1E5YA 1KBWA 2HRHA 1AG0A 2A3TA 3X1FA 3U25A 2I85A 1M56B 1XB8A 1NWPA 4RH4A 1AZUA 2PPAA 1A65A 1GS7A 1MDAA 2EIJB 1JOIA 1SDDA 3N2JA 2ZWNA 2BP0B 3AG4B 1KDJA 1RKRA 3WNIA 2IH8A 2JFCA 2CALA 3S3CB 3OMAB 2CAKA 1KV7A 3X1NA 1HAWA 2HLEB 1KBVA 1AZRA 2XLLA 1GY2A 1ETJA 5I6PA 4A68A 5B1JA 4HHGA 1A4CA 1XB3A 2OJ1A 3ABKB 3X2QB 1V55B 3NJGA 4G72B 1GW0A 2DYRB 3FS9A 1JVLA 2Q9OA 3FYEB 2VSMB 1PZCA 4TXVB 1JZEA 3EH5B 3NJNA 3PAVA 2AZAA 1TEGA 4YSQA 2GC7C 2EIKB 4L0PB 4BXSV 4JHUA 3D12B 4HCFA 2VW4A 2XV2A 1RZQA 1A4AA 1PNCA 2DWSA 3IN2A 3H56A 5TK4A 2VW7A 3NJIA 1PZAA 2E86A 3OMIB 4A67A 3ZX1A 2XYBA 1NZRA 2YAEA 5D4HA 1HAUA 4KO9A 5AKRA 1SDDB 1V54B 2BWDA 4EF3A 1HFUA 1SF5A 1AR1B 2CCWA 2W8CA 2XVBA 3OQRA 3NSCA 3NSDA 2J5WA 2H3XC 2IDTA 2CJ3A 2IWEA 1FFTB 4F7KA 2R7EA 3NJHA 3QJRB 3X1EA 1AZCA 1BQ5A 3ASOB 1KYAA 3FPYA 3KW8A 4MFHA 4X4KA 3AW5A 1ASPA 4HZ1A 1FWXA 3WG7B 3NJFA 3NSFA 3T71A 1AS7A 1ET7A 3UGEA 4WTQA 4KNTA 2PP8A 3CDZB 2UXFA 1CURA 4DPCX 2PCFA 4E9VA 7PAZA 1IKOP 1ILUA 3IEAA 1BXAA 1W6LA 2OCCB 3AG2B 4G7SB 3IBOA 4KO5A 1MG2C 2PPDA 1X9UA 4HALA 1OV8A 1ASOA 1RCYA 4YSAA 2IAAC 5B7MA 1ZV2A 1QNIA 4KOCA 2HXAA 3QJVB 4PAZA 2XU9A 1PY0A 3OD3A 4NAJA 1L9SA 4W1TA 1AOZA 2X87A 1BEXA 5I6NA 2ZONA 2MRYA 3GDCA 1ID2A 1KGYE 4A2HA 3NJJA 5I28A 2ZXWB 3QJQB 3UADA 1FA4A 4HAKA 3S3DB 2IWKA 1M57B 3RYMA 3UAAA 5B1AB 4M3HA 3PPSA 1A3ZA 3FPXA 4DP9X 2J57A 4AX3A 3TASA 2R7EB 1OF0A 2FT6A 3CZUB 2IDUA 4YSRA 5E9NA 1R1CA 4CSZA 4K9JA 5I6KA 3GXUB 4DP2X 1EZLA 2VM3A 1ZDQA 1BYOA 4BWUA 3G5WA 4DP4X 1BQKA 2FJSA 4A2FA 2N0MA 3UAEA 1PCSA 1M9WA 2OV0A 1NIFA 3S8FB 4HCIA 1IBZA 3JT2A 2FQEA 3CVCA 1IBYA 4JKNA 1A4BA 1L9TA 1N68A 3ZIYA 2YAPA 2TSAA 2VMJA 3T9WA 4YSUA 1NDTA 2WO3B 3FT0A 4DP7X 1OE1A 3X1GA 1XB6A 2X88A 3TU6A 4YSSA 2Y1AA 3FQ1A 4E9WA 3CDZA 4KO7A 3OM3B 4ENZA 4YSCA 3FYIB 5EHFA 3V9EA 1JZJA 1BXVA 1NICA 1NPNA 3AG1B 3H4HA 3MBWB 2VSKB 3QQXA 4KOBA 1PLAA 4HIPA 1OCOB 4E9XA 3FSVA 1ZPUA 3NJKA 5B7EA 1JZGA 2YAOA 3FSAA 1OE2A 2GI0A 2AANA 3NP3A 5B1JC 2VM4A 2BW4A 3CVDA 3FU7A 4KO6A 1N70A 1AS6A 2LLNA 1SFHA 3ABMB 3HB3B 4E9TA 2JXMA 5AZUA 1J5CA 1OCCB 4HCGA 2BZCA 3ZDWA 2J56A 1L9QA 4ZK8A 4UANA 4YSDA 2YXVA 2FQFA 4YL4A 1L9PA 2PP9A 4P5RA 1A8ZA 3FQ2A 3T6WA 2BHFA 2XWZA 4YVUA 5I26A 3AY2A 4BDVA 1PAZA 3KW7A 4N8UA 1SNRA 5D4IA 1IUZA 4DP8X 4M4RB 4AI7A 3DTUB 2BO0A 4A2DA 1NINA 2CUAA 5I6LA 5F7BA 3T6ZA 1W8EA 4A2GA 2J55A 4DP5X 4W9ZA 2PCYA 2IDFA 2AVFA 1MG3C 2H5UA 1I53A 2UXTA 3PXLA 2H47C 3TBCA 1MZYA 5LDUA 1GR7A 3HEIB 1PF3A 2VW6A 1J9SA 3GYRA 1NTDA 2DWTA 3NSYA 1GY1A 3IN0A 4QLWA 2BP8A 2XUWA 2EILB 5I5IA 1SF3A 5D4JA 3FU7B 1JERA 1GSKA 1AIZA 3SBQA 2IWFA 4F2EA 5I5MA 5B1KA 4F2FA 1AZBA 4GP5B 1AAJA 3ABLB 4KNUA 2PP7A 2XX0A 4E9QA 1BYPA 1CC3A 2UXGA 4HHWA 1PNDA 8PAZA 1KDIA 3IE9A 1CUOA 2YAMA 5B3SB 3FQYA 2FT7A 4YSTA 4BDVB 1PLBA 4PCYA 4BXVA 1URIA 4DPAX 2FT8A 1OOWA 2B3IA 5TK2A 1ZDSA 4QKTA 2XV3A 3PCYA 4BK5C 1AACA 2NRDA 2YQBA 2MTAA 3QPKA 3ASNB 1F56A 2XXFA 7PCYA 3QJTB 2IDQA 1E67A 3PAZA 3QJUB 3CVBA 1PLCA 1B3IA 1PMYA 1WA2X 3WKQA 4GY4A 1WS7A 1QHQA 2GC4C 1ASQA 5B1BB 3PAUA 2DYSB 2HZHA 3TA4D 1BAWA 1X9RA 5ANHA 2BP8B 2GIMA 4DP1X 2YXWA 1AANA 1SJMA 1NIDA 1DZ0A 3UABA 1OCRB 1J9TA 4E9YA 1T5KA 1J9QA 5AFAA 3WNJA 1ZIAA 3SBPA 2GHZA 2HX8A 1ET5A 1E30A 1WAEA 4N4YB 1WS8A 4NB7A 1SFDA 1E5ZA 1ADWA 4YVNA 2QPDB 1GS8A 3FSZA 4YSOA 2BZ7A 2QDVA 1JXDA 5F7AA 3SBRA 2DY2A 3DIVA 4GP4B 3BQVA 2GBAA 3CG8A 3DKHA 5PCYA 3L45A 4DPBX 4FA7B 4AKQA 1NIAA 2DV6A 2WSDA 3WIAA 1OCZB 1E65A 3FU9A 2PPCA 4G7RB 1JXFA 4E9RA 4AZUA 1OE3A 2UXVA 9PCYA 2WO2B 1NWOA 3NYKA 1KCBA 2HRGA 3V9CA 1WA1X
chains in the Genus database with same CATH superfamily
2CIIB 2OCJA 4I18C 5D1ZA 5LCVL 5GGUA 2HJFA 3BLPX 5EUOF 4B41A 4GAGL 1PD1A 1X5LA 3W56A 5MI0C 1G1YA 1D5XA 4YIQA 5ICZA 3C75A 1C5CH 1KPRB 2G5RA 1S9XA 1YECH 5GS1B 2X28A 4NKIH 4W93A 5C6TH 2DOCA 4FJZA 4XPGL 2YD8A 2F54D 1RIVH 1NEZG 1C16A 2WXMA 3QDJB 5F7EL 3V4VL 3OZKA 2P8LA 2PPEA 2YZ8A 3D33A 2YARA 7TAAA 2ROXA 1IQDA 3I85A 2DLEA 4LSVH 4MCYA 1T22A 1ZA3B 4N0CD 4XBGA 2FTAA 4X2UA 3SQBA 4NBXB 2HT3D 3A67L 2V7HA 1X7QB 1WBZB 1TKWA 3CV5A 2AZUA 3UTOA 4EI5C 4ZOBA 1XIWD 4OCSH 4MD0A 4W68A 2F8OA 3ARFB 4M8VA 2VAJA 3L3JA 3N55A 3FU8A 3OKLB 4N24A 4NUJB 4OZHE 4YDVA 1FN4B 4DP0X 1WPCA 1OZTG 1D5RA 5AWNL 2EUZA 1H3VA 3FU6A 4UWQB 5FX3A 3T3PF 3HAEH 3Q6GH 3F7PC 5E8PB 3H53A 2IQAA 2VXSL 4MX7B 5HDOA 5MP6L 2FL5B 1BVZA 3HUJF 4L3CA 5HGAB 4QF1A 3OB8A 2D7TL 1SLUA 6FABL 1VEPA 5TDOB 5KJRH 1RFDL 4PV9A 5LAXB 4ZMWA 2CLRB 1RUQH 1QNZL 2YLKA 2WKLA 4KNSA 3HKZA 4PS3A 1NMAL 5GISH 1VGEH 3SDDD 3SDAC 1ZHKA 2EINB 5CIPA 4P59L 1JDCA 4POUB 1FBIL 4PRNB 5EC2B 5F7UA 2VLLA 4JPWH 2Y69B 3C87A 4G6MH 4PG2C 3DO7A 5GS3A 2EIZA 2AJZA 1B6UA 3L1GA 3MI6A 4RZCA 4GIOA 4M5ZL 4OTXH 4Y4KC 3QDGE 3NEEA 1UXWB 4M43L 1JF1A 3OWRA 4TL5A 2WNWA 3EOYG 5HHQB 3S96A 3PGCB 4LCYA 2NX5D 4PMEA 1G0DA 2C26A 2VLJB 2W9DL 4ZXBC 2FQDA 4H4NA 2AQNA 3O6LH 5ESQA 1UG9A 4NZDA 3LVEA 2BOLA 3QRLA 1OAXL 1K5NB 1MCLA 2ITCA 3D4YA 3OKKA 5AW3B 2Z64C 1KBWA 4AG4H 4JMXA 1NJ9A 3RVVD 4QXWA 1KN2H 4JPKH 1LP9E 3BHBA 3EFOA 3T8XA 3ARRA 5AAMC 4G1EB 1F3DH 2P7TB 3FN0H 4MNQA 4AEHL 2YA0A 3VRIB 1N8OE 2DEXX 3QEGL 1P4UA 4MMYA 3X3GH 5E2VH 4H8UA 5EN2B 4JFED 3ATEA 2F5BL 4JFQA 4C57C 4HDIA 5IMLB 5KG9B 3K6OA 3KYNB 2GSGB 3LRKA 5AW4B 4IRJB 4FFWC 4MS8D 1J0IA 3QGVA 1CDBA 4UCFA 2PUQT 4PLJC 4XNMA 3WLBA 4GOSA 4ZUWA 5D1XA 3MV7A 5DU7A 5F7DB 3RWEB 1KTBA 2FJHB 4OIAA 4ZTEA 1T89A 2I69A 1L6XA 2I9TB 3V6ZA 4NAMA 5CSZA 1KZQA 2BJMH 1N5YH 3U7YH 1FSKC 4JRXB 3MBEC 1QBMH 5ERWB 1F42A 3L5HA 3OGCA 1YMMD 4HIJB 1XF4A 4IRZH 4LCWA 3CZJA 5A2FA 4Y16A 3L4CA 3UTPD 2HKFL 4MDRA 4YHNB 3NIFB 5DHYB 5HTSA 4F93B 3K2KA 4I77L 3BH8B 3LIZA 4X9BA 3NIGE 5JUEL 3G6DH 2NR6A 4PI0A 3RU8L 3VI3B 4F8OA 2KPNA 4GW1A 1PZAA 2VO8A 3OMIB 4IU2A 1AQHA 3DRQB 1SN0A 4LVHC 4UM8A 3W37A 1F6LL 5E8DH 1UZGA 1QSED 1V8HA 4IGBD 5D4HA 3TN0B 1MWAL 4FTVE 4BUHA 2IADA 4WHTA 3X17A 3GZOA 1WEJH 2Y7LA 4ETQB 4PJGF 5GRZA 5I75C 1PEZA 2I26N 4PRHB 4N2LA 1XHHA 3NQKA 4ZUTB 3B7SA 3FB5B 4PREA 4W9GC 2EDFA 3HUJA 1KXQE 1K2DA 3R18A 3DHJA 3C2AH 4MB1A 4RWYL 2QVMA 2LT9A 3VYPA 3GLDA 4G5ZH 5ENWB 5DC9B 5A2BA 1OM3H 1BREA 3KXFB 1PX4A 1INQA 4X4KA 2VDKB 5FAAA 4KUCD 2QR0A 2RB8A 4NEHB 1HOEA 1QG3A 3NJFA 2K6YA 4GUCA 1MFNA 1AHWC 3V4UH 1TETL 5E9DA 3LTVA 4XPHL 5HDBB 3B9AA 3DVNB 3SJVB 1RZIB 5C0FA 3PUUA 1XXDC 1YUHB 2JJTA 3ZTNL 3BGMB 3GSXA 4PG9A 4JFDE 5E00A 1MHHA 4PJFB 2V2WA 5EBLA 2JKSA 3C5JB 3F7KA 1DVFC 2VCOA 4FABH 2AQRA 1WTGT 1ZTXE 4UQCA 5FPIA 3LPFA 2XWDA 4PRIB 2A5UA 4XNUL 1EHNA 3L3OA 1HILB 2HA1A 4KX9A 2R1XA 2WBJB 2XRAH 2OI9C 2PMZA 1AOZA 1MWAB 3FU3A 4Y7OC 3CAFA 3G9AB 4PEEA 3QFJA 1SQMA 2XFGB 4FL4C 2X40A 4N9OB 1NAMA 4KVCL 4WSJA 4Y9CA 5DS8B 3TT3L 3WD5H 1NUDA 4MAYA 4IMLA 3ROOA 1TMCB 1CDGA 5L2KB 3FFCE 5EO9B 1H3UA 1TJGL 3O3EA 4P23A 3PPSA 4AT6A 3PP3K 4YPGB 1QSFA 3JTSB 2DN7A 2P8MB 3D50A 1PD6A 3L2MA 3MCLL 4QHNA 4R8WH 4RMUA 3QXAA 2VLMD 3HE7C 3TASA 1MRCH 1DEEB 2GJJA 5TQ0L 3B8SA 2R8SH 4LBAA 4NZTH 4F2MA 3S88L 1G87A 3VGDA 3NPSB 1MFCL 2COQA 1R1CA 1DBJH 1MF2H 1JPST 2C8NA 2Y2TA 3DPBA 1DSYA 2AVGA 1MFAH 1EZUA 3D39E 3ECBA 3KHQA 4PH8A 1KIUB 3GSNA 4EQ3A 4A2FA 2IAMB 1ZLUK 2W92A 3HS0A 3HIZA 2HFTA 4IOFD 1A1MB 3HNSL 4AH2A 3JWDL 2WVTA 4NBYB 4N2BA 1IGYB 2HG5B 5C0BD 5IREA 4XO5A 4BQ9A 4FZEH 1XH3A 4QNPF 2YC1B 1CT8A 1LDPH 3EGXB 3MLTA 3REVB 1PYWB 4P2RD 3H7BA 3N04A 1PLGH 4PVLA 5GQBA 1IM3D 4I5BB 1A7PL 2BC4A 3UZVB 4OKDA 1JGEB 1NUFA 5L88L 4P4KD 2Z31B 5IT2L 5DK0A 1J05A 1I7RA 3FQ1A 5BRZA 4YHKL 1YNKL 4AYBA 2GAZB 3E1F1 3I2CH 4FFYL 3FYIB 3O2DL 1AD9A 3IJEA 2GCYB 3MBWB 5IEKB 4JJHA 4QPEA 1GJUA 4A7GF 2GUOA 1E43A 4M7JL 3IDIB 2G2NA 2JI3A 3BUQA 1BFTA 2KQNA 4KQ4H 2BMKB 4P04A 1QLFB 2O72A 4WU5A 2O93L 5ILTH 3DURA 4UOJA 2C7FA 1XGPA 4E5XG 3LQAC 1J8RA 4G43A 1IL1B 2WQAA 4CKVX 1MFEH 1KXHA 4YO0B 4GBXC 3DBXA 5FUCE 1CBJA 4M6OL 4G8IA 1S7QA 5GZND 3WJJA 1A8ZA 4RGNB 4DAGH 4LFHD 4OCWH 4R4FH 3SQOH 1NCWH 2LTQB 3MV11 1GPOH 3HFFA 3OKDA 5L2JA 3U82B 2X70B 1SNRA 2DLGA 3T4YB 1I7ZB 4IBUA 4WIQA 1N3NB 3K2MC 4GQRA 3H9HB 2OM5A 5DVLA 2APTA 3DTUB 4OB5L 2FBJL 1JSYA 3OXSB 5B39G 4J3XA 5JHMA 1TO4A 1A6ZA 1IGMH 3WN5A 3C5ZD 5B8CC 4UZUA 1P4LB 3DGCR 2E27L 3F64A 3NH7H 4HIIA 3UPCA 2IG2H 4RMVA 3N44F 4JM4H 1NEZB 4J3OF 3FQNB 3W1ZA 2ZOKB 5I9QB 3MGAA 2EKSB 4LLUA 1JNJA 4WFFE 1FGVH 4GMTL 5G2NA 3L3KB 1YEKL 3I75B 4CGUB 3QIBC 2DWTA 3RNKB 3WNKA 3HAEG 5CCGE 4H0GA 3ZDXE 4LEXH 1G9NH 1MFBH 4FG6D 2B2XL 4LPXA 5EWIH 1XGUB 2VDPB 5FKPA 4PJBE 1DVFD 1H5BB 3K6SA 1OP4A 1YEEL 1COBA 1N4XH 1UB5A 3BAYA 4OJEH 1GGIL 4L4TB 2DZEA 3VQMA 1KXVC 3LEVH 3U7AA 4EAEA 2AKRA 3O4LB 3PWUB 1I8MA 4UOZA 1H9VA 1CCZA 3CHPA 1MCOH 4NFBA 3IPBA 4CN1A 1R3KA 1U8CA 2FIRT 2X9WA 1Z9PA 3MREA 1B0GA 4RAHA 4P9HC 3VSVA 2OS7A 4HULB 3LKPA 1PLBA 1HQ4A 3NUKA 3C8HA 5D2NE 2DM4A 4BIKA 4BXVA 4UQIM 4TSCH 5DJ6B 2XC8A 1T80A 3P4LA 5HY9A 1OOWA 3ATFA 2LLGA 1OVZA 4YHZH 3IAPA 2FX7L 2ZX8A 3DVGB 4R96B 4OBSA 3W3BA 4CDHA 5A6LA 3ARBC 3QHZL 3ASNB 4UT7H 1CXKA 5D5MB 5JHDE 2Y4SA 4R97B 1GGBH 5I18H 3LB6C 2OJEA 3V10A 4OZIB 4AYDC 5FA3B 5FB8B 4M1DH 4Z95H 3HMWH 1VFOA 3PJNA 4Z78B 2YD5A 2XWCA 3ARQA 5T1DL 1VJSA 5INDB 1B88A 3RWHA 4XGZA 3T0AA 5J8OA 5CCHE 3RWGA 4GEJA 4A7GA 4PRDB 3WE1A 2EVHA 3OC8A 5GZOD 1ITCA 1I9EA 4K7FB 1FIEA 5D6CB 1VEMA 3F04A 4RESB 3CDCA 3GZKA 4MZ3A 2WYTA 2N7BA 1ZWIB 1WS8A 4ORGA 1BD2D 4R5TA 1A7NH 3D5OF 4C58B 2H2SD 1JXDA 2QHRH 4FMKA 3MV8D 5F7AA 3PL6A 5C08B 4JPVH 3SYAA 4MRBA 4N0UB 4Y5VA 4MJJA 3EBAA 5CMAA 2PYFA 1K5WA 4OSUH 1KNOA 3KYKH 1UD8A 5SWZA 4WGVB 3P73A 5DS2A 3WIAA 2HWZH 5MEND 1A6AA 5I6XB 2PPCA 4O00A 3V9CA 4GAYA 2XBTA 1BLNA 5FGSA 2HJKB 4UF7C 1VESA 1MQ8A 4FTDA 5EOCL 4AEIH 1CDJA 5JIQA 5JQIB 4GKZA 4ZSOE 3VQ2C 1OHQA 2D2OA 5A7EA 1VERA 2BSTB 3DXAE 3T0EC 3EOBA 1F4WH 4B7LA 1CFTB 5KVEL 1E42A 3X1BA 2DI7A 2WW8A 1E4HA 1UB6A 3BSGA 2FE0A 3P0YL 2GJRA 3CZNA 4JFUA 1J1OL 3AXHA 5JNYB 3UAJA 2O6CA 2QFRA 4GRWF 1ND0A 3EH1A 2KERA 1CQYA 3WNOA 5C9JB 1F3JB 1AQ8A 4Q9QL 4C4KT 4HPYL 4Y5YC 4CC4A 4KI5D 3U6RB 3NT0A 2P42B 5FO9A 2PPFA 1P6WA 1H8OA 3U30C 4UNIA 4PJCA 3QAQA 1MOEA 2OMWB 3IJSA 4QXTB 4S0HA 2ED7A 5HHME 4Q8BA 1E8XA 1FYTD 2F0CA 3GB7A 3B2VH 1MVYA 2DJUA 4IK6A 3X12B 4ANWA 5EEXA 1P53A 1S9YB 2NY0B 4NCDA 2P80D 2DMGA 4ZW5A 2ZCLL 2HLFC 4KTEH 3E3QE 3ATDA 2DQEH 4N0FA 4FAAB 5DQDL 4N2OA 1ZLSL 4N90E 3QXTA 3FQTA 4MQXC 5TF1H 4FKKA 3G9VA 2F18A 5FYKL 3APFA 5C3TA 3LEYH 4NWTL 2P8PA 4Q4IA 3GRGA 1K4CB 3UYRL 4AL8L 2FIKB 4YHML 3ARGD 5IQ7H 2EKJA 5CZXC 1QI4A 3IXAA 2F19L 2IBZX 5IB3B 1KYOJ 2H32B 3OL2A 3E8UH 1FCGA 2GPZA 5EOTB 3IMWA 5J4MA 1F18A 5ICYB 3N85H 4HWUA 4Y1AB 3AZUA 4QHKJ 1LD9B 3U4EB 3UOAB 3UMNA 5AVWB 3VGAC 3VO0A 4M61A 3T1FA 3FRUB 4ZOAA 3S5LA 4KJWD 1RJCA 3HLAA 4YLQT 1NKGA 2BSCA 2W88A 4XXWC 4ZFFB 1DYZA 1Z9NA 4JRWA 4V2BA 5EZOL 4Z9KB 3PABB 4LU5L 3BE1H 3QYCA 3JQOB 1OP3K 5KVFL 4HMDA 3L6FB 1S3KL 2LVEA 3MU3A 2WXRA 4A04A 4Z3GA 3LRGA 4PJ8A 2EC9U 2NY2D 1AKPA 3RZCB 4N87A 1E27B 2VO5A 4F33B 2VXQL 3EYFA 3X1FA 4ZX4A 1THAA 1RZJC 3GLZA 3QAZC 1I1AC 4GI8A 4X6FA 2EDJA 5I1IL 2BS8A 4N5UA 1JWUA 4U1HA 5KYUB 4HC1L 4UDTA 1AOHA 1DVSA 2CMRH 4ODVH 4KBPA 2LABA 2CG9X 4U3SA 3MRJB 3CMGA 4G3YH 2OMUA 4YC2C 2A9NL 3MLRL 3N91A 1U41A 3B9KB 3DROB 3MRBB 3SYPA 3V0FA 3C09B 1FAKT 4P46C 3GKZA 1LEIA 1I31A 4HJIA 3O2VH 5K1NA 1PQZA 1A7RL 3QULB 4HWZB 1D2PA 3ZMRA 3P0VH 1YECL 5D7LE 5H35A 2NNAB 4LEOA 4OF0A 4NKIL 1TVHA 1DQDH 2C3VB 4PJXB 5CFHA 1L6PA 2CGZA 3K2IA 5MEOB 5DFVC 3WHE1 2GJ6E 4UQ2B 4QI3A 3CFBB 5B38A 1SGKA 3EOAA 3Q2NA 1ZV5A 3PXHA 3HZVA 4QT5B 4UT9A 1W0WA 1EANA 2EDXA 4Z7VB 3T0ED 2WKGA 3EGDB 2YAEA 4L3AA 3IRCA 2HTLC 4KO9A 1YNTF 1GYUA 3QRGH 2EYRA 4TLUA 2BWDA 4BFIB 5CAYB 4EF3A 3ESUF 4JCLA 4G8GD 4XPBL 4DETA 1DBMH 5F9JA 1QRKA 3Q06A 4N86A 1MFUA 2A6KB 3FO9A 4FQIH 8FABB 3QEQA 3MRLB 2Y1ZA 1JPGA 2AI0H 3EFDL 3Q6GL 1B9ZA 4PTTA 4Q6IB 1WV7T 2IJ0C 3NN8B 2R2HA 3IS0X 4K3JH 4E5XB 4NYLB 2VZTA 1KJVB 1KT2B 2X4TB 3X1EA 4FC3E 4ODSH 1HEZA 4TSBH 5HI4C 3GHEL 2VXTH 4LLDB 4XBEL 5KJRL 2DQJL 2WWMD 3V7MA 1RUQL 4AJYV 1JJUA 3HR6A 3OV6A 1VGEL 3INOA 5BXFA 2CH8A 4MLIA 4ICXA 4PHXA 2PCFA 1XF5B 1KCKA 4HEMA 4LGRB 1EZSA 2LFGA 1JBJA 3QSKB 5HD8C 4OTXL 3FKUS 4KO5A 1HWHB 1XCTA 5B39B 1X9UA 4HU8A 2P24B 4G6JL 2EXWC 1V5JA 4OCYH 3SDXE 1U4FA 2QV4A 1QA9B 5KYYB 2HXAA 3M45A 1MVUA 4BFRA 4L3FA 5I6NA 2ZONA 4ANXA 4X50A 3WHE0 5MHSE 4O58L 5IB5A 5DUJA 3VA2C 2C1PA 3NJJA 4NSKA 1KN2L 3CJJA 4X4MA 3HAEB 3FT3A 2F7PA 1IIKA 4Z76A 2Y72A 1UM6H 1E8ZA 1S46A 2GITB 3K8MA 4MVBD 2EDOA 2WIIA 1TJHL 3Q8BA 1M9SA 2BK8A 4LB8A 3MUJA 3O3BA 5A2JH 1C1EH 2IDUA 4YGVA 5DZAA 3ZL1A 4JFHE 1G9MH 4HIHB 4LHUD 2H6PA 4N1EA 2FAUA 5KSAD 1KYFA 3BZ4B 3PIQB 4HJSA 2DLTA 4Q7DA 3OLGA 1FI8C 3RQ3A 4P2CG 5HHXH 3UTZB 3GHBL 3WS3A 3DC0A 4OZFA 2RALA 4UINL 2NSMA 3VXUB 4OCXL 2A6DA 3M7FB 3GMPB 4AQ1C 4YHIA 1R3JA 2BNQA 2R0LH 5IB1A 1QBML 5KN5B 2VSDA 2AXFA 3ZIYA 4IRZL 3GNMH 2JIXB 5F21B 2Z3FA 5IMOB 3NZSA 3UX9B 1QLEH 2E6PA 3BEWB 1MRFH 5DJ2B 3TONA 4DP7X 3IRZA 3QC5X 5DZNA 4PJ5B 4HWBL 5CZKA 3AREC 3BWSA 3QG7L 4PWJA 3Q6FA 2G60H 5D1XD 4CN6A 3CDZA 5KVEE 3LDBB 4WUKH 5GIRB 1TIUA 4MXQC 1YSOA 3V55A 1AVAA 2EECA 5T5FH 1DN2A 3F7VA 4XVUC 2ENYA 4PLKC 2CO1A 3PWVB 1YNTA 1E5CA 4G6FD 1P4IH 2A73A 4P9MH 2G0KA 4YR6B 4AGNA 1GIGH 4FZ8L 1ZHNA 1NBYB 2AJYH 4KI1A 4CW1B 1N64L 2ENPA 5EO1B 3D34A 4AENB 3VXMA 1YAIA 4Y16D 3OLDA 4KQ3H 3H9SB 1W0YT 1RMFL 1DR9A 2XQBL 2L7QA 2OLDA 4I8DA 4KC3B 3WTXA 3NABL 1KEML 3RAJH 2NY4D 4HJGB 1DANU 4PYGA 4G5AA 4J6RH 5IMKA 3CPUA 1EEZA 3MC0A 1NBZB 2E4TA 5K9JH 1NFIB 5CGYD 5C0EB 4GG6F 2YGNA 3ISYA 3IDJA 2MTPA 4ILDA 1WZAA 1E0OB 4R7XA 3FL7A 3DARA 1T7XA 1HT6A 1ERNA 3V4UL 3DV4A 1KFAL 4GRWH 3VTTA 1PAZA 5FGBC 3KW7A 5J3HC 4K9EC 5J12B 4L8BB 4M7LH 5DDHA 5JW4Q 1X5XA 4I85A 2V5SA 5E5LA 1EMTL 3P11H 4ERSH 5FDWA 1Z9LA 4R0LB 1XR8B 1AO7B 1FNGB 4JG1H 3TNNA 4A2DA 4HGWA 3WNPA 4OM1L 4YDKH 4XO8A 3ZZSA 5I1KH 4QDGA 4UDUB 2J55A 5IOPA 1YN6A 2DB8A 4F3FB 4XBMA 4JBSA 5TDNA 2PCYA 3D52A 4BSVA 1KB9J 2H5UA 3CFCH 2EYSA 2OJZH 2CKBA 3N5AA 4WVRA 1TFHA 2WOBA 1J9SA 4O9HL 3SDAA 4XX1G 1WAAE 1DLFL 2COVD 3HPJA 3DX6B 2EO7A 4B9JA 1JHLL 1I1RA 5HPMA 4PG2A 4JKKA 4X5XB 2UY7B 1WP6A 3SPCA 2WBWB 1XV8A 2MQ0A 4V1DB 1YYLL 4L0YA 5D7IE 2IWFA 3UJIH 2C3XA 3UROR 4JB9L 1MRCL 3GXIA 1DVXA 1J1PH 1U8NB 1UQSA 4NZTL 1DUYB 3UTTE 2R8SL 4O02A 2HJFB 5M94B 1WICA 1QRNB 2GYSA 1DUZA 4HOXA 1E7VA 2X89A 3TA3A 1DBJL 1D5XB 4ZXBA 1MF2L 4S0TD 1G4RA 4OLYH 4RMTA 5DYOB 1UZ6E 1T5XB 2DDQH 3IJYA 1MFAL 2OFQA 1ZLVK 3TH2T 4E41B 1TQVA 4JQIA 3KPLB 4BA0A 4IHBA 1C7TA 2XPZA 5AAMA 1KIRA 4UNVA 4QIRA 4HUWA 5TK2A 4CVUA 1IQDB 3LKSA 3MNZB 1T22B 3EBGA 3NA4A 2FCBA 4Y2DA 4BK5C 4JHAL 2V9QA 1IGCL 4KVNL 3AS1A 1F56A 1NBQA 2J21A 5D96C 2BERA 5J6GA 1T21B 4ZUUB 3BX7C 1V3KA 4ZD3L 3Q8AA 1UOKA 3UEZA 3L3IB 2ZKHL 3KVQA 2AEPL 4OUUA 1M42A 4KKLD 4KHTL 4AYGA 4EBQH 3K0WA 1ASQA 2ZCKL 1OGAA 2QVFB 3RDTC 1NH6A 1GYAA 2BIHA 1A1NB 2XZZA 4X6BA 3I2CL 3HG4A 5D4QA 1DEDA 3LKNB 5A3ID 3BRGC 3ZDYB 3V8CA 2EQDA 2ZJSH 1EAQA 1M3JA 2IQAB 3MBEA 4FQPA 1LNUB 3WNJA 4D0CA 3Q44A 4NN7B 1FAIH 4XCFH 4AIZA 5AKTA 4N2KA 4OZGE 4J1UB 4KQ4L 5HGGS 5T3XD 2D0FA 3FOMA 2VE6B 3EH2A 4MKMA 1JV2B 4PP2A 5DTFA 2KL6A 5C86A 1JHKL 2Y23A 1O0VA 3KLSA 2ZKYA 1MAJA 5LGJB 1UURA 3DKHA 2PABA 5SWQB 4GG6A 1IZKA 3HZMB 1K8DA 5GSVA 1MXDA 3TF4A 4G7RB 4OZFH 4RZCB 3GSOA 3NYKA 1GA2A 3L7FB 1B3JA 3Q5TA 4JZOA 3QIUC 3SQOL 4TUOB 1B2WL 2E9BA 5GRJH 1RV6X 3NMEA 1UA3A 3B8YA 5AALA 4U7SA 1JZHA 3DV6B 3S3BB 2L7UA 2OSLB 2ZYSA 3CDGB 2GVYA 3MRCB 4GKNB 2R29L 4HP5A 5C0CE 3QQ4A 4UTAH 3EFOB 3QQ3B 4KY1H 3ZZ1A 3MACH 4Y89A 4BHUA 4C56A 1RZPA 1OAUL 4MNQB 4WAFA 5F89A 5BZZA 4M5YL 1FC2D 2W81C 3NIDF 5ISZB 1T03H 2R56H 3B7TA 5DMYA 1AHWA 2ZOOA 3HG5A 5L7XL 3JZYA 1MFDL 1NC2B 5FWQA 1G9NL 5IGXL 4J3BA 4Q89A 4H1LH 1NFDB 1G6VK 5EWIL 5HHOE 4AVHA 3IXTB 1NANH 4WLCA 3ARSA 3DJSA 4G7QB 4CC1A 2GSIA 1JN6B 4NT6B 4ZUWB 3BFQG 4NENA 4GUPA 2WLNA 2EDNA 1ZHBB 4I0PA 5EUOB 2ZXQA 3D0VA 4JCMA 2PWDA 1GTFA 5EBMA 3LEVL 4OKVA 2FNWA 3PWLB 1R3IH 5I6OA 3T8VA 2WXJA 2DQFA 3OF6A 2HFEB 2NNXA 4JX0A 4QRPA 3SGDI 1KCRL 1X3DA 1MCOL 5IUSA 4XNYH 3HG3A 3HJ0A 3V0VA 4LCWB 3QUHA 2BP0A 4L5FL 1KJ3H 1AP2B 4FNRA 3IS1X 5DJDB 3HN5A 5EU3B 4YHZL 2ATKB 3PQYD 5DEJA 2BVPB 2PLTA 3HE7A 4HOWA 5JQHC 3IU4H 4KFZC 5C07E 1NCBL 1U58A 2XV0A 4X7SH 4PM1A 4BWWA 2V2TA 2VH5H 1XD0A 4NQDE 3EAKA 3LSOA 1EFXA 2KLTA 3LN4B 3BPCB 4NNXB 1RJZA 5E1AA 3SBWC 2CKBH 2ID5A 2IEPA 3BOVA 4WHTB 3UJTL 2XXMB 1AIFB 3ZYJA 1PZBA 2YS4A 2A6JA 4JFOA 4ZO6A 3JUZA 2XQ0A 2GI7A 3HCVB 4JFDA 5F7YC 1T2XA 4EUPA 3O4OB 4XNXH 3GMMB 4ZFOA 5C0IB 3U9UB 4OLWL 1G6RH 4I88A 1KLGA 3SKJH 4IMKA 5CWSA 3UBFA 3V6OE 4KROB 4V2CB 3MZGB 4AMKL 4XPAH 1F1AA 1A7NL 3W0WE 4BINA 1ZXKA 3VX0A 2VN7A 2VZSA 2QHRL 5LBVA 3D3VE 4IBLT 4KZCA 2F68X 4NQEE 5E2WL 3KBPA 4ALAC 4NIYE 4I2XE 4OD2A 1GKEA 1V7ML 3MXVL 1S7RB 3MRIA 4OSUL 3UC0H 2P5EB 4JQIH 4PG9B 4DVBB 3GJFK 1MHHB 4Y4HB 3D4GA 2G9HA 2JFCA 1SLXA 2CQVA 3FTGB 4GIAA 5GJSH 3A0OA 2ALWA 2KMWA 4G7VH 4GSUA 2OK0H 3MLWH 3F5WA 4A68A 4AEIL 1A4CA 2BSEA 4XNDA 1FV1B 3ABKB 4B0MB 5GRUL 1IQWH 3QFJB 5JXED 2JH2A 4TQPA 4Z77A 1OP9A 1XO8A 4F9PA 4PB9H 3ROOB 4NQUA 1M6OA 1E28B 1YYML 4P23B 1QHOA 2QMJA 1I1FA 3L3HA 2DWSA 1MKFA 4OAWA 3N42B 3RFZA 3H56A 4RSYA 3SOBL 1ORQB 1R5VB 4F7PB 2E86A 1UHVA 2AQ3A 3VJ6B 5GSRA 5FM5O 4LP5A 4EOWH 3O2WH 1XH0A 3RY5A 2LLLA 1NZRA 5DLML 3GSVB 1H9DA 2YJLA 3VSUA 4QRRA 1YG9A 4I9XA 5GGTA 1A6TA 5B8CA 1U3HD 1AQDA 1ACCA 3HS0B 2CA3A 2OX5A 4YBQD 3TH4T 3QP3A 3P54A 1KYDA 4MMXC 3HVNA 5FKAA 1RZKL 4F15C 2XTSA 3QIBA 3MDJA 1EGJL 3MLTB 2CDEB 5IQMA 3ASOB 1PG7L 5C0AB 1PX3A 4BRVA 4U05A 5IQ7L 2R27A 5C3LD 3R8BB 2CGRH 4I7ZC 5FUZL 2WXGA 1UUSA 5BRZB 4TKWA 3L9RA 1YUKB 5E4IA 1KXVA 3VFGL 1I7UB 1IBBA 1HHIB 3GUTB 1BVKA 3OXRA 4GNKB 3V0EA 2B1HH 2HKHH 1AD9B 4FXGA 3IJEB 4BQ8A 2MQGA 4ZZFA 4AWJC 1GZPA 1IARB 1DJGA 1A21A 3JYBA 4MSWA 4XVJH 2OSYA 3IBOA 2YPVL 4PJGB 4TVPL 4P3DB 4LEEA 1FVDA 2IAAC 2A74B 3Q9PA 1W72A 3QR0A 3V0HA 2NY7H 3CC5B 1Y1DA 3V0WH 1PY0A 4WU5B 5TH2B 1HHJB 4CADB 2QGEA 4ELMF 2X87A 3DI3B 2RMNA 4G43B 4AGOA 1IC7L 1VCBC 2HTKD 5DFTA 3ARBA 4PJHE 1D6VL 5HGHB 5BO1H 1U8KA 4LO9A 4HAKA 1J87A 3UTSA 2BSRB 3I6LD 3FPXA 2VR8A 1TTFA 2FHFA 3GGWB 4ZMOA 2JI2A 2P5WA 4JQXC 3QORB 2X4UB 4X9HA 2XNAA 3LZPA 4ZMAT 1OPGH 5E03A 1INEL 1JWSA 2CR0A 4N9GB 2FT6A 5ESVA 4Z7OF 2NXZC 4YSRA 2O6EA 2X42A 1TJIH 5DC4B 5G4OA 3TCLA 3IMRA 1Z0MA 4G3YL 1A6ZB 3WN5B 1QI3A 4BFJA 1Z6JT 2X1XR 4PJ8D 5IW6A 2FJSA 4WW2C 1CE1H 4O51A 1FZOA 4GUOA 4PV1C 2N4IA 2PO6C 4GFXA 1OSYA 1KB5L 1MIEH 1U2YA 1WSST 1F11A 1FIGL 3LNEA 4OD1H 4NO0D 4IKLA 1RZGB 3I9AA 3VDCA 2RAMA 4P5MB 3S36L 1OWWA 3BP5A 2FQEA 3LV3A 2R4SH 4NKMA 1Y7VA 5CSBA 5FIEA 2K7PA 2ZOLA 3KPSE 1DQDL 5FECA 2X0VA 1LO5A 1N68A 4H25A 4JK0D 1DL7H 2YAPA 2V37A 2ZWZA 3T9WA 3SHSA 3ZKNC 15C8H 4HOMA 2A9AA 3EG9B 2KC0A 1Q4NX 1NM4A 3QW9A 3QT2A 1TZ8A 2JVUA 1WJ3A 1OE1A 1XR9A 2SEBA 5IJBC 2QPSA 3QUMA 1JK8A 3EKCA 1JMXA 2FO4A 1DJZA 3QNXB 3M8OH 4WHYH 4LLWA 4U1IB 4MJHA 4MQ7A 4P2QA 1ED3A 2OSXA 4Z8FL 4ENZA 2IFFH 3ROLB 2J25A 2G5BA 1NICA 1TZOA 3COOA 4M6NH 5BMFH 1G7MB 4ZW8A 1FHNA 2ZYIA 5IW1A 1R3KB 1U8CB 2YIHA 5DRZA 1XBDA 1ZPUA 5F3BB 4PRPA 4QWWC 2HRPH 3FT4B 1IRAY 1DBML 2G2RB 1S9KC 1DQIA 2MOQA 3CVDA 3M17B 1BOYA 2LLNA 1ZK9A 2AI0L 2V8MA 4N0YL 4Y5YA 5IB2A 3RLSA 5FK9A 4KJQC 4OU3A 4YHPA 4XC3H 3BAIA 1E3XA 5JZ7D 5J1AB 4HYTB 1K85A 1C08B 5TE7H 1R17A 3A23A 3AT8A 1BZ7A 4GRLD 5GGRY 1PKQE 4YL4A 1IIIA 3T6WA 3VFWA 2DMCA 3SPGA 3EYQC 3GM8A 1XGQB 4JM2B 1P5VB 1HYRC 4NX0A 2NSQA 4UOW1 3PGDA 1DVTA 3HS9A 3CVHA 4L5FE 3AB0B 2JV6A 4M7ZB 4N8VA 5AYUH 1KIQB 1IGJB 2WYIA 4H1LG 1I3RA 1UA6H 4IK7A 3S3JA 1PBYA 4NLAA 1UENA 3S35X 4XCCH 3VFOB 1UWXH 1BJMA 4UB0H 3BD4A 3QIWD 3EJUA 2OMZB 2IF7A 3V0DA 1CFMA 1S9WB 2VUOA 3PL6B 2H9GB 3U0PA 5CMAB 3NA9H 3N0AA 1OSZA 4QEGA 1OT2A 3OKNA 3VE0B 4UQDA 5CJXA 4AE0A 2F58H 5GGSY 3LYRA 3FU7B 4KJPD 3SKOA 5AZEL 3WNNA 2R0KH 4WFGD 1QACA 1UXSA 2FYYB 2BHYA 2JXMB 4XCEB 1WCBA 3IETB 5ICXB 3S6CA 5A2IH 5L9DL 3ABLB 3CLWA 5T3ZE 2VLKE 4PJAB 1C1EL 4JFFB 5DZLA 5HGBA 1CC3A 4LKCA 3TVMC 5C2BL 3T0VA 1GHFH 4G9FE 1KDIA 5HDQL 3NAAH 4NAQA 3N44B 2Y36L 1KELL 1UB6B 1C7SA 2FWOA 3CNKA 2YAMA 4AUYA 1KLUA 5HHXL 3T5WA 5EU6B 3CZSA 3OJMB 2J1ZA 4LXFA 3UPRA 4QRQB 4XXDB 1FL6A 5C7ZA 3RWIA 1ZDSA 3U79A 1I1AA 1D6EA 3L54A 1HDMA 2XV3A 3VXRB 1F86A 2DQ6A 3NTCL 3ZDZE 3TJEL 3O0RH 2XJKA 1VIWA 3VFRA 4GO9A 2YHGA 2H0PA 3WXWH 5JPNB 4WWKD 3DTDA 2BLFA 4P9HH 2WLLB 2YEQA 2CXKA 1N19A 3B2MA 1ZGLM 1LVEA 1QUPA 4XO4A 1MAKA 4GY4A 4Q2ZA 4WO4C 1JPSL 4R7DB 3A6OA 1FLRL 4UOW0 3OKOA 2DM7A 3MCKB 4AM0A 4P46A 3LZLA 3OAZK 3P40A 2A9ML 3WFEL 1DZ0A 2RHEA 5CJOL 4YL9A 3TO2B 1P4IL 4ICWA 4N0FB 4WI9A 3X13A 2VB5A 2H3NA 3WV0A 1BBJA 1GIGL 2GHWB 5CFAA 4LDEB 4UT6H 5D1QC 3HZKA 3K8KA 3ZHLA 5JHLH 4KKRA 4HKXB 3TCTA 1N7MH 3IXAB 3P9LA 4U6HB 2VLRD 4WK0B 4U1GC 4YSOA 3ZXAC 3BO8A 3TJHD 2VDRH 3VXTB 3WO4B 3DIVA 1OT4A 3DYMA 2XA8L 2DMBA 3A47A 1I85C 4FCAA 4UTBL 1OLZA 4A1RA 3KZ8A 1IAOA 5MEPB 1SUHA 3FU9A 1SEBA 2C4FU 1FL3A 2QADD 4M61B 3T1FB 5CNHA 3MKKA 3G5YA 3HLAB 3QDAA 3TIDB 3O45B 1QLEB 4QWWD 3Q48A 1ZA6B 2AK4B 1JZ8A 4RNRA 3KCWA 3QJSB 4IRSC 4X6DF 4H20H 3QVAA 1TZIB 1IC0A 4ERSL 3RWCA 1M7DA 2O4EA 4IHOA 1WD8A 3TBTB 4KGJA 1SOKA 3QUKB 5EH1A 1YEWA 1NGPL 4X0NA 5CJ8A 3KNBA 5KTEH 4B6ZA 1A4JA 1TPXC 2ZUXA 2BIIA 4G71B 2XTJB 4PY7A 3EYFB 4HUUA 4DW2L 4B53A 4BZ2L 4DN3L 4JUSA 1CDCA 3O8XC 4Y7MA 3CFCL 3GSWA 2A77L 2DJMA 3MJ9L 4ANUA 3TZVD 4RZKA 5I6MA 4KGLA 4J3VA 3SKMA 4XHJD 1MPAL 5KOVC 2APXA 4HCRH 1JXGA 4B0MM 4F58H 1T66D 2QT6A 4EIUA 3FF7A 4UDTB 3ZTEA 1P5UA 4TVPE 5C0RH 2QDWA 1CLYL 3JV4B 4QOKD 3F2LA 1A9VA 3ZGHA 4YDJA 1HYSC 3QG6B 2VDNH 1LEKB 2BNRB 1CB4A 1UH3A 4LFHG 4BFEA 2Q2LA 3UJIL 1OTSC 3IFPA 5CJQL 1OB1B 1O7DC 5IVXA 1YDPB 3D09A 3OMNB 1ZHLB 4U1SA 1CU4H 2Z35A 5CCJA 5BS0E 3W39A 1AS8A 1PG7W 4EE2A 4IYKA 1U8LB 4GRWB 2UUDH 5DGRA 2YRLA 3SE8H 2F54B 3MUY1 4BBWA 4TF4A 1TYJA 1MZZA 1ET8A 1Y18B 3BD3A 4YHOL 1SMOA 2BWQA 4NGHH 5FHAH 4LPWA 4OVUA 1U0QA 2P4AB 3FSWA 3ZUCA 5HYEA 4ZS7H 2EP6A 2KDYA 4O2CB 2ZWSA 1TSRA 4QGTA 3BPLC 2VISB 3K4ZA 3TBBA 1G9HA 4H13C 4LCIH 3HZVB 5JR1H 4FXKA 4LHJB 2Y9RT 2WO4A 1U8PA 1XIWB 2JKIS 3GMQB 3TA3D 4WU7A 5DO8A 5E2TH 1LMIA 4LOEA 2UX6A 6PCYA 5E1HB 1QPXA 4FNSA 3S37H 2F7RA 1CG9A 5B3JE 3QJHB 1S7XA 4GXVH 4NQCE 1GS6X 4H8VA 3FMGL 4L48A 3QEQB 4K23H 3TYFA 4HBQA 4ZDHA 3RA7H 4PTTB 5FO7A 5ETUB 2R2HB 1BECA 4OW6A 1RIHL 1YQVL 1I8AA 4Y2DD 3UBXG 3P2BA 1BFOB 4PUBH 1AG0A 1WUNT 1J0KA 1PDKA 3VXQA 3JTTB 3N50A 1F8TL 4PI2A 3KWUA 3LN9A 4JFTA 3RPBA 1M56B 4HJJL 3FUDA 7FABL 3CXDH 3HR5A 3IKCB 1IEBA 4RH4A 3AREA 5BXFB 1HXMA 1AZVA 2EIJB 3SDDB 1JOIA 1ZJAA 4ZAKC 5KS9F 3CN1A 4K5LA 5EZLB 3AG4B 2WUBL 4TQEH 3TXAA 1A7BA 1CGVA 3OX8A 4ETYA 4XMVA 5GS1C 5D7HA 1RZJH 1G7IB 1TEYA 4X6DA 4WY7L 5I71B 4P2OC 4BSJA 1WE5A 5GRJL 3MNWB 3QXDA 1OAYH 5EG6C 1EWHA 4L37A 1ZSHA 4A7TA 5IQ9B 3OMZA 2H8PB 2O5ZH 3X2QB 1LM8V 3OJDA 2UWEB 1JVLA 4KXCA 2BFGA 1VEOA 3KM1A 3HE6C 1HCVA 4EDXB 2C1PB 2Y6TE 3H42L 2LU3A 3N06B 3VI4F 4UTAL 4KY1L 1T20A 1QSZA 1YEIH 3MACL 2MCAA 2VLJE 3AC0A 3I6GB 2VDMH 2OR8A 5GGRA 1UCTA 4HCFA 2VW4A 2DQTH 1T1ZB 1AXTH 3TWCL 2VDOH 4ZMXA 1DDHA 5FYJE 2QKIB 1EA9C 1NLBL 1NM9A 1ORSA 2HLAA 4M56A 1ZVSB 3KMDA 3UZEA 5FGCE 1TXKA 4MJIE 3TBVB 1U21A 4YGVB 4PJ7F 3HHMA 5E5UB 1JNHA 4X83A 2ARJB 4W9IC 1LO3H 4KRNA 3OG6B 3FH7A 3O3DA 5IFHL 3PS6A 4FERA 3O6KH 3CHQA 4GG8A 1L0XA 3HC3H 4MJ5B 1BZEA 2JLPA 2QQLH 3WS3B 2O6DA 4OI8A 2WTRA 3N9GL 4OZFB 1OTUD 3VYNA 1HH9A 5IG7A 2NTSP 2XVBA 1PW3A 4C56D 5EU7E 1G1OA 2WQ8A 1XF3B 3NJXA 4YHIB 4ZMVA 2H3XC 1DLHA 5E0FA 1BM7A 2K1MA 3LKQA 2W59A 3D4ZA 1G7JA 3QJRB 1N59B 5F1IA 4YDLB 2GTQA 1QP1A 1C5BL 1JNNH 1T4WA 1XL6A 3GPEA 2OL3A 3GRWH 3MRQA 4MFHA 4UBDC 5KSUA 5GGSA 5BRQA 4CMMB 1FZKB 3MLVH 3WG7B 3NSFA 3KLDA 5SX4I 1JZ3A 5DK2B 3BKYH 3CDZB 4I18B 35C8L 3IU4L 4HV8B 4DQOH 1T7WA 4RX4A 4X7SL 5HI3C 5T5NF 3NIFE 4PS4H 3KLAB 4TLKA 4M1CD 5EUKA 1IKOP 1DJWA 1E4XI 2ZSVB 1F4XH 4B9YA 4I0KA 1QSEB 3VI3E 4IGBB 1ZHNB 4XAWH 5DRWB 1OV8A 5B7MA 4YSAA 4H1LB 3NEOA 4FTVD 4KJYA 4GI9A 1M1SA 3D30A 4KOCA 4QRBA 1HL8A 1L9SA 3KCPB 1ES0A 4XODA 2AV1A 4XNXL 5DZJA 3KG5A 3LRSB 5AVRB 2ITDB 3MA7B 3MQIA 1NMCB 5IMKB 1JZ2A 4IRJC 3A3YB 5I2IA 3UAAA 4TS6A 3ARWA 1CFNA 3GMLB 4IEFA 5B1AB 4BFOA 3DMMC 4EI5B 1XF2A 4LT7A 4FADA 2DM3A 1VRSA 2XCMC 5KS9A 3HNTL 3T08A 4M5TA 3RDTA 3KXFE 1N10A 3EJRA 4RFNC 4RQQB 4NRYB 4Y19A 1WCQA 2DI9A 5I8KH 3V6BR 1D2OA 4AY0A 5I1AB 1E9OA 4FCHA 1CL7H 4OJAA 4DGYL 1TOXA 5FLVA 4LLAA 5GJSL 4JFDD 1ZDQA 4GSDH 1H15B 4HIXH 3T6QC 1VHPA 2VWEC 3LHAA 5D7IA 3RTQC 4DP4X 3TC9A 3SIKA 3RIFK 1OF2B 5IOPB 2R69H 3UTTA 3Q13A 5IWLC 3CSBA 4BSVB 3MLWL 3OHMB 4PJFE 1TZGL 4AVIA 2XWBA 3JWNH 2CKBB 3L4UA 4U0RC 3ULUL 2DH3A 3P3UA 3VI4A 3KYMB 2WXQA 4PRIE 1BZ8A 4R83A 5HHVL 3L9YA 1GOHA 3B7RL 4TV3A 1L9TA 4PB9L 3RB7A 5FYLE 3K6DA 1FJ1B 3VVVA 3CFKA 1AGCA 1CICD 5D2NC 3AU1B 3FFCD 1G6RB 1URZA 2FGWL 1Z9MA 4Y4KB 1XB6A 3QIUA 5IFAL 1MUJA 4PJ7A 3VH8A 4TUJB 1TG8A 4QYOA 4IDJL 4XB3A 5L2KE 1U3NA 2EE0A 4HLZH 1SOSA 4WSKA 4JGJA 5J7CC 1E4XL 5EHFA 3RJQB 5IBTL 4PU2A 3L13A 1KBKA 1BIIA 4JPIB 2BSED 3O3AB 5T3XH 3WJMB 3RVXD 3FN3A 4TLSA 2DI8A 1T4KA 2F1BA 2XFXB 3B6SB 4P5KB 2WUCH 5HGDB 4TNVK 1H8NA 1KIRB 1XZ0A 2O5YH 4FJYA 3NZUA 4HUWB 2G75B 4FQ1H 1J48A 1NGWB 4FULA 4LDCA 4Q9RH 2J88H 2ESVE 1W0VB 4FQ2H 4MDJA 4WHCA 2B59B 3FO0H 4LAQH 3QFGA 3Q05A 4ZFQA 3E6FB 1HZHL 2YWYA 3M88A 3D4CA 4NP4H 4P2RB 3ZY7A 5AD0A 4POZC 1KEGH 2Q76A 4IDLA 3ETTA 4S1SH 3RVUD 1YMHA 3UP6A 1NLDH 5F3HB 1F0LA 5E2UH 4FQXC 2CGRL 4P4KB 3MR9B 2HCZX 4QRRD 3BAXA 3AY4C 5LBSA 3WLWD 4GKLA 2WBJC 1LQSR 4X6BB 3EADA 3U1PA 3Q01A 2YD4A 1G7HA 4F24A 3ZE2F 4OGXL 4L0ZA 4GSQA 2K7QA 3QWRA 4D0CB 2AW2A 4DP5X 4S11A 2WLIB 3BT2L 2RR3A 1KCLA 4Y2OB 5I16A 2E8YA 2NY7L 2Y2WA 5I0ZA 3DK0A 4A6YA 4BK8A 2DMKA 1V27A 2Y6SC 5LNDA 3MRMA 4QHUA 4Y9BA 3UDWC 1AE6H 1PIGA 1FNEB 5EBGA 1DQVA 4J2XA 3GTTA 3NPSC 4RBPH 1N6UA 5BO1L 5GSVB 4LVHB 5I5IA 5LJYH 5EEUA 5I15H 2FBOJ 3GSOB 4M00A 3WHXB 2CJUL 1OGPA 2R4RL 4OIBA 2Y1YA 1Q9WA 1MHCB 3NCYS 2IAMC 3P4OB 5CR1A 5I75B 2ZCHH 3VFMA 5A2KH 1TJIL 4EI6A 2UXGA 4JFEE 4PLNC 2W38A 4NHUB 1CBVH 2ZG3A 2D03H 1GOGA 1F6AA 3F7YA 3ISRA 3C6SA 4PBXA 1A9EA 1EDYA 2FT7A 1CZ8H 1CE1L 5B3SB 2F7QA 3L95B 4PCYA 1INDH 2L8AA 3DMMD 1M2VB 5F89B 4OD1L 3T77A 1UOLA 2B3IA 4OV5B 5DJAB 2JKRM 3FC8A 1F41A 3PCYA 4JANA 1AHWB 2ZD0A 3GI8L 4JKPL 4Q6KA 4L1TA 4UNUA 5AQ0A 1U8HB 3HW7A 3GI9H 3QRBA 4OIIH 4JZNB 5IHLB 4LAJH 3OB0H 4J6IA 1DVFB 1YMME 2DLHA 4NENB 1P84K 4GUPB 1T0OA 4S10A 5JA8B 2AC0A 4K5OA 2XZQL 2J1YA 3DUSB 4JY4A 3TBSA 2VIRA 2HZHA 3M8OL 4BEIA 4OKVB 4U3XA 5EZJA 2XPGA 5T8IA 3H3BC 4LHUG 2OI9B 2IFFL 4XN7A 2AXJA 4WW2F 1AHMA 3BUBA 5E6ID 5BMFL 4X7TB 5T1KA 4FL4B 4PR5A 5CEZH 2VNCA 4L4TE 3ZN6A 1YY9D 3WGUB 2VDQL 3JWDC 3UBXB 3GJFA 4JRYE 3QNZA 4ZUVA 5D2LE 1F3RB 4PB0H 4LSRH 4GSRA 4QHKI 4RGNC 4L3EA 1VACB 4HD9A 4Z5RA 2CXGA 4GMSH 4XNBA 3U2SB 5JHDD 3LH2H 1DSFH 4K7PY 3V6OA 3A4AA 1BDYA 1RJZB 2UXVA 3ARVA 5E1AB 9PCYA 1KCBA 5K39A 3ZTJH 3KWWB 2RFXA 3V5HA 5JHBA 1IBGH 4OZ4A 1WA0X 1EJOL 3SE9H 1RUMH 1ITBB 1HHHB 2J6EA 1LO2H 2A6JB 2C9QA 3WIFA 5I9QC 3ZLQC 3JBG7 5BQ7A 3BRFA 3HRZC 3CHXA 5HVGB 4BH8A 4MMXA 3IU3A 5CLZA 2Q7NA 4IOSA 3I02A 3T6XA 2FATH 3VB9A 2J44A 4XCCL 1YA5A 1JRHI 2XI9A 3GMOA 1BD2B 3BEVA 4K3DH 5EU5B 4EN3D 4PGCB 3IVKA 3L3GA 4FKHA 5D70H 2EIDA 2A99A 5CJBA 3MGTA 3V5KB 4OD2B 5FOBA 4CL7A 1RI8A 1CD0A 2QZQA 4U1MB 5ACZA 3D6GA 1IAMA 2VSCA 4K5NA 1MJJA 1GGCL 3FTVA 2DIJA 4CDGC 5MENB 3DECA 1RLBA 3H3KA 3NFNA 1JV5B 2X44D 3RL1A 5DJXA 4N0UE 4KXZH 1FG2A 1CK0L 4Z7QE 2EXSA 1A7OL 2EEDA 1AGDA 1Z32X 1BVNT 1QATA 5HSFA 1E2VA 1RHHA 4Z77B 3DXAD 3NAAL 1WIOA 1E6OH 4Z7NF 2VZOA 4R97C 3VMNA 4WK2B 1XD1A 2D7NA 2NUTB 1JPFA 4PJDE 4GBXB 3SPHA 3RE0A 5DK3A 43CAA 4FA6A 4LSTH 1DQJB 3OZ9H 1I1FB 5D1ZI 3L3HB 3TEZA 4JQXA 1T2QH 4OAWB 4PBDA 5T1JA 2OMBA 3O0RL 4AQ8C 1MREH 2VERN 4B9PA 1U8MA 3WXWL 1HSAB 4PGDA 1QVOA 5GSRB 1XGTA 3JT0A 3IM1A 1RIUL 2J73A 5C0BE 2DQCH 3CSTA 5HHMD 1ADQH 1XCWA 1XMEB 2RACA 1MNUH 4BRJA 3ULUE 4QKXB 4MBOA 5CJ5A 3FTYA 1QEWA 2XSKA 3NSJA 1R3LA 2QQNH 4NERA 1ETZB 4ZS6D 5FKAB 4IOIA 3FU0A 2ZUQC 2FQGA 2AJ3A 3D18A 3QIBB 3VXNA 1HOCB 5KW9H 3EO9H 4UT6L 3U9WA 2G5UA 5AENA 3BAJA 3CLEH 5L0QB 4WKZB 1Q0YH 4OLVH 1XMWA 3ARGB 4AGQA 2CIKB 3FT2A 1IGIH 5IHHA 2CO2A 3PFUA 1RP9A 4WRLA 1MDAA 2WV3A 3JWNG 3U9PH 1GZQB 2FX8H 1JUFB 3RVTC 1SLVA 1DQQB 4APQD 5K9KA 3BSZA 2BOCA 3AT9A 2A7BA 4NZRL 7CGTA 2D7OA 1YNLH 1YC8A 3FQRA 4AITA 1HIMH 1FVDB 2Y24A 4O4YH 2XQYK 4ALAH 5KVGL 2CDGB 3O6MH 2H41A 2TRHA 1N2RB 25C8H 4Y9EA 2ZKXA 1V55B 5IVNA 2OZNA 4HLZG 5I1EH 2AV7A 2J4WL 1HL9A 2JJSC 1R4XA 3OC5A 1P4BH 2DBLH 2NY2B 4P5TD 4CJ0A 5ALCL 3UTSB 1TVBB 1UKTA 4KPHH 5DUPL 4KK9D 3DRTB 2OAAA 3NRQA 1U3ZA 2P5WB 3GLAA 3U0WL 3ULVE 5I23A 1OGTA 1H6FA 2EACA 1WG3A 2LVCA 2ZWLT 3B83A 3GEFA 4F58L 2NY0C 2MFNA 3DGGB 3T2PA 5CHNA 5L4MA 2XY1A 1EAPB 2BDNL 2VDRB 2OP4L 4OGQC 1H3GA 1KTRL 4N8CL 5IFJA 4LF3A 4RISH 2QBWA 4X5WB 2EJ1A 3BLBA 3LRLA 5E99H 2DTMH 3WE6A 4L4VB 3QWOA 3SYQA 2CCWA 1RVFH 4ODXA 2ZG1A 3BP5B 5AKSA 5CXPA 4W9HC 1KJ2H 3LHPL 5FECB 2HFFB 1LO5B 1QFUH 4U6YA 3QI9A 4WUUA 1QASA 4XMUA 4RVBA 3AW5A 4X9GA 5E95B 3PWNA 1QQDB 1MLCB 1XR9B 1EIBA 2QLVB 2YKLH 4NUGL 4XCYA 4APXB 5D6DC 4PJXE 2FO4B 2GJ6D 2PP8A 2FEEI 3I3DA 1NEUA 4LCIL 4MQ7B 4NNYA 5FFOA 5HYSA 5I8CB 3WKML 5JR1L 4IBVA 1O9VA 2G5BB 2ILLA 3Q3GB 2CLZA 2DIAA 2OA9A 2X4QA 3DUUA 3O6FD 4OLZH 3T0EB 3OSKA 2C34A 3TVMA 5IW1B 2R1YB 3ME0B 3S7GA 1Q1JL 3GO1L 2GTZA 5TPWH 3RZCC 4X7DC 1RCYA 3S37L 3OPZL 4KK8D 1HHKB 3D7PA 2VDNB 3WYRA 3JYCA 2MHAB 3SDCA 4HGKC 1HL4A 3PFQA 3F8UB 4YHPB 5F7FA 2QPFA 4AL8C 1DSWA 2HPOA 1F4HA 3BQUD 4PUBL 4P2YA 3UTQB 4GIPD 5CP3H 3AROA 2MEJB 1G7LB 2KUTA 2PTTA 4DP9X 4UM9B 2VJ0A 1QKZL 3CXDL 1KWGA 3RI5K 1V7NL 3VFWB 1A4KA 2PYEA 5IF0B 1YZZA 4Q0XL 3VM7A 4JREB 3US9A 4AYID 1W80A 4K9JA 4KAQH 3JV6A 2WGNB 4Z3EA 4DEUA 4N20A 3CZGA 3BKMH 5E1GA 5M95B 1MLBB 1BYOA 2AQTA 2QKSA 4KKAC 5D1QA 3IGUA 3KPQA 4ELMB 1FLTX 5C0DB 3IDNA 3T1WA 4PJEB 5J0BA 1JGVL 2A38A 3K71B 4LIQH 2LU5A 2O5ZL 3BISA 3HB3D 2K78A 4X4XB 1ZLWH 4AGLA 3H8NA 3U0PB 3CX5K 1DJYA 1ECZA 1I85A 4HK0B 4U3CA 5MHSD 3OKNB 1YEIL 1TTCA 3CIAA 2VDML 4XZ4A 2VT0A 4NO2B 3TFKC 3L1OH 3VGAB 1HWWA 1MJ8H 1W8NA 1D9KD 5F7MC 5FA4A 3VTMA 3SD5A 4RCAA 1AXTL 4YSSA 1H6TA 4QRUB 4E9WA 1HESA 3ISWA 4KFMA 2XBZA 3ALXA 1TJMA 1IEAA 4NDMA 4MNHB 4KI5E 3GPSA 2VSKB 4JFHD 4LHUB 4Q6IC 5KSAB 5EEYA 4LCCB 1OCOB 4E9XA 3MRHA 3O6KL 3WIIH 3UZQA 2XACC 3RHWK 2YAOA 3MLYL 1WC7B 4G80A 2BP5M 1A6WH 2FRGP 3V0JA 3NRFA 3ZTJG 4F80A 1FYTE 4B9ZA 2Q87A 1A14L 3VNYA 3QAZB 1I1AB 2HP4A 5DUBA 1HDMB 3CHOA 1IC5L 3NZHH 3V7AG 3S8WA 2J43A 4XTRC 1OCCB 5J56B 5JW5A 4XOBA 3BDYH 2Z91B 4N2HA 5ELIA 3VXUE 4LLVA 4F7CA 1DTUA 3HG1E 3QR1A 4NQXA 4YC2B 1EHAA 3VH8G 1SYSA 3QDMA 4OFYA 4KK6D 1YJDL 1MJ7H 5TTRA 3BKYL 4AM0B 3SPVA 2PTVA 4KTDL 4PS4L 4DP8X 3MO1B 4M4RB 4YK4C 1SVCP 3K74B 2VDOB 2UYLA 3FRPA 2BO0A 3O11A 2OTWA 1NCHA 1NINA 1JK9A 3C5SB 5CSGA 4NP9A 3T6ZA 2YMOA 1AYOA 4JVWA 3C8DA 1U30A 5L6YH 3UIYA 5TE6H 2WXOA 4GT7A 4J3WA 5GHWH 2DWEA 1I8IA 1SBSL 4HETA 4DERA 1NTDA 4Q56A 4RIRB 2NY4B 3LPGA 3MRPA 4Y5XC 2OQJA 2DM2A 5E94B 4LARH 3EJJX 5E6RB 3MHZA 1IAOB 2YD1A 5SWSB 4URTB 4EZLA 4I3SH 3FFDA 2DKSA 3JVGA 3D87B 5EF1A 3K72B 12E8L 5D9SA 2WBXA 1A9BA 3AM8C 1HCZA 2E7LC 2C1OB 3VW3L 1R0AL 3QUXC 3NK3A 5GGQL 2CHWA 1NAML 2K6WA 3MV9B 4GI6A 1CL7L 3KBEA 2CHXA 3GEWB 4GSDL 3KNBB 4HIXL 4JKMA 1KACB 1KPUB 2UY6B 3VFPA 2CBOA 2IIJA 1PJ9A 2NUPA 2R69L 5HI5C 2FT8A 1KENL 3B2UD 5DQJB 5JORB 3H0TA 2X6VA 1FFPA 1WF5A 4OD3H 1BQLH 2NRDA 2BIQA 2CIIA 2NNRA 2Q8BL 3LDBC 4ZAKA 4G7YH 1B4JH 3HC0B 1HC1A 2I5YL 3HFMH 4QTFA 3BDXA 3GSNL 3KPRE 1D7DA 4FNTA 1KPRA 5GS1A 4WNSA 3IFPB 4U49A 4P2OA 5AVTB 4DGIL 2EDRA 3C60C 4U1SB 3QDJA 1SY6H 3UTTD 4XN1A 3KPOA 4NNPH 4DP1X 3N1PC 3CZEA 4BUQA 1SEQH 1ZA3A 4X9FA 5I0VA 4E0RB 2ZAGA 3HE6A 3OAUL 1MWOA 1X7QA 1WBZA 2WUCL 2DJSA 5TE4H 3LX9A 2WJ5A 4WFHE 2O5YL 4ZRGA 3WIHA 3K0YA 1AY1H 3OR6B 2XG4B 3ARFA 3EUDA 2J88L 2YPKB 3K6FA 3OKLA 2CK0L 5CN2A 4NUJA 4LAQL 5DO2C 5K9QI 3T09A 1M2OA 4BH7B 4NP4L 4EIBA 1KEGL 1U8PB 4R0LC 3ZMNA 4S1SL 4MYPA 1J1XH 1ZCRA 2ZG2A 5E8PA 1QPKA 4TTGA 3DSFL 1W16A 4MX7A 3K8LA 1MY7A 5HYJB 2CM6A 5HGAA 3SQRA 1RPUA 4AV5A 2ZUWA 4XP5H 3B56A 4L8DA 2A83B 1BXUA 1FF5A 2B16A 2OR7A 2XIIA 1BMGA 3CCHB 5GRVL 4AQ1B 5FO7B 1IM9A 1TLKA 2DQIL 2CU9A 1M7XA 4J8RB 5EC2A 1RSYA 4PRNA 3BC9A 3OJVC 4AW4A 4JNXA 3A4EA 4LASH 3ZYOA 4NCC1 2HX7A 3NDYE 2GY5A 4IU3B 1MNNA 5I66A 1TQWA 2IPUG 1UXWA 3IBEA 3D0LA 1H19A 3MLZL 4TOYL 3ILQD 4WEEA 1MAML 3MJ8A 2BX5A 1AE6L 5HHQA 3EH4B 3PGCA 2I7SA 1NPJA 2VLJA 5F6HI 2QGDA 4TNVF 4ADGA 2X4SB 4GP8B 5I15L 4G8AC 1BX2B 4X6DB 4AQEB 4D0BB 2EVGA 1V3JA 2D73A 2ZWKA 3TGXA 1EEUA 4WQOA 2R51A 3A24A 4FQLL 1B90A 4G1EA 3RGVC 4UQ3B 3F12A 1E4KC 2ZCHL 4JO4L 2P7TA 4L23A 2PXYD 4DKTA 1BV8A 1KG0B 5EN2A 3WFZA 5A6IA 4ZPVB 3H1ZA 3GHPA 1HK6A 5IMLA 3WKPA 2EXYD 1BFVL 5KG9A 3KYNA 1CZ8L 2GSGA 2PW1A 5C0CD 4RGOH 4IRJA 1INDL 2YFOA 4KZ0A 3BVDB 1FPTH 1FNFA 1ZS8B 1Z5HA 1NA8A 1M6UA 3LPPA 3RWEA 5F7DA 2FJHA 3CLFH 4ATWA 3G6JF 4A7VA 4OIIL 1GCFA 2I9TA 3NCMA 4MNQE 3DA0A 3RPKA 2D3NA 3CU7A 1I9IH 3FCBA 3L7EB 5KBKA 5HHOD 2HJLB 4JRXA 5IBLC 1HXYB 3GBNH 4NN7C 4PP1C 4HIJA 6PAZA 1A3LL 1MHEB 2KZKA 2WTRB 5IWLA 1BG1A 3RBSA 2ADFH 3ZBMA 4YHNA 1AZZC 2ZZUT 5DHYA 2FYVA 2N56A 1JS4A 3BH8A 3GMRB 2OTPA 5D1XE 3MV7E 4MMZB 4K5PA 3LKQB 1EXHA 5EUOE 2EO1A 3BCFA 2WNGA 3VI3A 3FB8A 4XN5A 3B3IB 5H2BA 1UYWH 4HPOH 3GIZH 1Q9OA 2DEWX 1Z9SA 3DRQA 4RMBA 2DWYA 3NCXA 2QEJA 3MODL 1MI5B 3ARDD 4JO8A 2FEDC 4HH8A 4LSRL 3TN0A 2R0ZL 4BZ1L 1MDTA 5GRXG 3PP3H 1GS7A 4LCWE 3N2JA 4U6VL 3V52H 4UIKL 4PRHA 5C07D 2VGLM 4PD4K 2JCCB 4NQDD 5T1KD 3S34L 2F61A 4NJAH 1ZS2A 1TU2B 2B4CL 5ENWA 1NOLA 4IM8A 3UG5A 1A3RL 3KXFA 2D0GA 1S78C 2YUWA 4HHGA 4HG4K 1AQMA 1ZLUH 4P49A 2ED9A 2XN0A 3C6LC 4PRBA 1WBXB 3ETSA 5GGVH 1GW0A 3C6EA 1OSPL 3FYEB 5C0GB 3Q5YA 3EH5B 3T3PE 3WFDH 3DVNA 4ENEC 3SJVA 1H3TA 1RZIA 2EUXA 5D96B 3PDOB 4DT2A 4NRXB 5I2IB 3HC2A 4L2LA 3ORJA 3BGMA 1Q72L 3F6LA 4ZTOL 4NZUH 4XAKE 4DK3A 3HUJE 3C5JA 4JHUA 1EZVY 4ZFZB 2WGXA 2Y06H 4ONFH 1A1OB 3W0WD 4FQXA 4FQCH 3FT9A 1X5MA 3D3VD 3QUZD 1OO2A 3QCUL 3SCMD 4NQED 1A02N 4Y19B 2QVTA 2WBJA 3US0A 3FTUA 4ZMLA 4GQ9L 4N22A 3KJ6H 3BGFB 2J8UB 1MWAA 3BWAA 2H3KA 1AI1L 4LOUD 3VTAA 1IILE 2PNDA 2NTFB 5E9DE 1MHPH 4X8GA 5DS8A 1KY6A 4JL1A 4AW7A 3QQDA 8CGTA 1SDDB 3KH3A 3MLXL 5I30H 2NY6C 2P5EE 5L2KA 1HFUA 3GM0A 2EH8H 4IOSD 5I1DB 5FWRA 2YRZA 1M7IA 1BHGA 4YPGA 3JTSA 1A7QH 4KUZH 2JELL 3VI4B 4ES8A 4W9DC 4QRAA 3LVTA 2WQRA 3N3EA 5BZXA 1DEEA 4ZODA 5LCVH 3P3TA 3UDWA 4BGLA 3ELQA 4ZUSB 3VXPB 1ROCA 4GAGH 5K59F 4LRNH 3TJPA 3QFJE 2HVJB 2O5NA 1E40A 3CPLB 4LSTL 5DGQA 1PEWA 1G4MA 4ZO8A 4O2EA 3QIUB 1G9NC 4XPGH 1N8ZB 3N43B 4PJ7B 3VH8B 1E9PB 4QYOB 3BVTA 2UXFA 2IAMA 1CFQB 5F7EH 3RGVD 3V4VH 1A1MA 1CVSC 1EO8L 1QSFE 2EE6A 1Q9LB 1ZT4B 4KKBD 3BH4A 3SY6A 3VXSA 5E0QA 1IGYA 2HG5A 5EO0A 1NQBA 5KAQG 1S2EA 3A67H 2YC1A 3ZRSA 4F2ME 2PPDA 3VDBA 2VJ8A 1AGEA 3EGXA 3REVA 4QXGL 1O5PA 1PYWA 1U3HB 3PHOA 4GO8A 5HJGA 4KROC 1XZ0B 5D5MF 2VMCA 4I5BA 2EH7L 4ZW3A 2J2ZB 3UZVA 3ZRFC 1JGEA 4QRSA 2QQNL 2Z31A 2C9SA 4ZJ9A 4OZIF 1PZ2A 3NCEB 1XTMA 1XVSA 2Q0ZX 5ANMA 3EO9L 2Q7YB 2A4CA 4Z0XB 3VGFA 3UADA 2GAZA 5AWNH 1BQSA 3V8OA 2QLYA 1SLWA 3KGSA 4Y4HC 1Q0YL 2HT2D 2GCYA 3MBWA 2EDDA 1YMHB 2P48B 5IEKA 3DYOA 3MJWA 3HG2A 4AIXA 3PAYA 2VXSH 3IDIA 5MP6H 1E90A 4NUPA 1USQA 3T2LA 4EVNB 2FX8L 2BMKA 3PPEA 3CZUB 2O61A 2D7TH 6FABH 5BUAA 3V6FB 1QLFA 2F8IA 1QNZH 4JFXB 2RH0A 4WI2A 1IL1A 1YNLL 4IJTA 4KRPD 5BRZE 4JQVC 4P59H 1FBIH 1UOVA 3NESA 4U3HA 1DDTA 3X14A 3UBGA 5F70A 4LK4A 3F7LA 3WTTA 3AUWB 4W9CC 1IBZA 3QZMA 5JXAL 5E1QA 4LQ1A 3U0TB 1JCKA 4M43H 3CVCA 3AQZA 1IBYA 2OKMA 1I1YA 2X0WA 2ZKWA 2DBLL 3ATBA 2F2HA 3BZEB 3FTSA 4PRAA 2CJTA 3FQWA 2FGZA 1N3NA 4GT0A 3H9HA 5I82A 4PGEB 3F3HA 3EJYD 4NKOB 1EZVX 3GMNB 3GWJA 3OXSA 1AYRA 1CLVA 1OZUA 2VXVL 3O2DA 4XZUB 1U91B 1NEZA 4M9PA 4YSCA 3FQNA 5IROC 2ZOKA 1EXGA 4JVPA 4AEHH 4EI6B 2EKSA 2NY3D 4EPSA 3H4HA 2VQ1B 2AABL 3QEGH 3HRZA 3I75A 5FFGA 1ZAGA 2W9LA 1DVQA 1ECYA 4OUOA 3RNKA 4Y4FC 1YAZA 1S7WB 1HNGA 3DX3A 2P44B 3CHSA 2DTSA 1ZY9A 3F7QA 4XP9H 1RURH 3T77B 4Q58C 3W9EB 4NO0B 1DZBA 1TQSA 3CFJB 2IALB 4LVOC 4HX1B 3UYOD 2GIYA 1WFOA 3KPSD 1EK3A 4AC4A 2DEYX 1HKFA 4HXBL 4I1PA 3O4LA 3PWUA 5JIDA 4G9DB 4P5RA 1NCIA 4JO3L 4U4BA 3LCYA 3NFPB 4JY4B 3OKYA 1BW8A 1HJCA 2VIRB 2R59A 4HZLA 4N8UA 1UVQB 2HKFH 2XPGB 4NQSB 5D4IA 4K8RD 1SQ2N 2KKQA 4I77H 3RWDA 3ZE0B 5JUEH 2AITA 3DVGA 2GFBB 4LSPH 3RU8H 2Q10A 5D5MA 3EJPA 1ACYH 4PY8I 4X80H 4TVSa 2NXYD 1XEDA 2BXYA 2XETA 5IQLA 3V79C 3TL5A 4OZIA 5FA3A 1RZKC 5FB8A 2H47C 3RGHA 1GMEA 4AQAB 4HOZA 4Z78A 3GSRA 5C09A 1UD5A 3BVUA 4XP6H 3RNQA 1HINH 4AQ8A 3UJJL 5INDA 1IVLA 4K94L 2XUWA 1HWGB 4QNPE 3SODB 4PRDA 3Q2VA 4IBYA 3RUGF 1IB5A 3SE4A 2H7WA 4GRLB 1KJ2B 3QR2A 4K7FA 1ZOXA 5D6CA 3V4PH 4MQSB 2WB1A 4C55A 4PVBA 2ZX5A 1U36A 2RFXB 3BGAA 1EPFA 2F53A 3QC6X 3HMXA 4GP5B 5EU4A 3ZE2B 3B5TA 4FFZH 3WIFB 3MA9L 3WEOA 3WGVB 4XBPB 4KAQL 2JB5L 3BZFB 4MMXB 3ZPDA 1MCBA 5C08A 3IU3B 1VA9A 4XPHH 4N0UA 2N1TE 3L4VA 3I02B 1CYGA 1JI1A 5LO7A 2A9DA 2KDGA 4HUVB 2WWNA 3L81A 4LOFA 2Y5TB 1TQCC 4XNUH 5FOBB 3QPKA 5CGTA 2HJKA 2IDQA 4U33A 1WTLA 4ODWA 1PLCA 4ZT1A 3QS3A 4PJIF 2XZAL 3ZKQD 5DJXB 2BY0A 4RFOL 1MJ8L 4KVCH 2R2EB 1DBAL 2OSWA 5JNYA 1AGDB 4XH2B 5SWZE 2KI6A 4UQ9A 5C9JA 4JRLA 3MCYA 1F3JA 1QW9A 1KUMA 3KPPB 3T0XA 2VLKD 3UABA 5T3ZD 3QK0A 1P1ZA 3U6RA 1UXLA 3OWEA 2ZAIA 2PR9A 2O26U 2JJSA 4G9FD 4LNRB 4A7SA 3RI5F 3S88H 4BQCA 1MFCH 3DOSB 1E5ZA 1S5IH 3PXJA 1AR1C 4QXTA 1CO1A 2PTUA 4ZO7A 2APWA 3NZHL 4W9JC 4Z7VF 1VFUA 2OXGB 1UCBH 3QHTC 5EU6E 5PCYA 4JM2C 2NXZB 4PGDB 4WWKB 2ICWJ 3HNSH 4AKQA 2DV6A 5CILH 3V5DB 2G3ZA 2NDFA 1OCZB 2OR9L 3JWDH 4LVNB 2ETWA 3T65B 2VRAA 4JO2L 5KANG 3L8QA 4M9OA 4WW2B 3ERXA 4NN6C 4MLSA 1K4CA 2PO6B 2XN9A 2FIKA 1A7PH 1QEWB 5FYKU 4X98B 5IB3A 1H3XA 2H32A 5HVFB 5L88H 5IT2H 5EOTA 1RK0B 5KUKA 4YHKH 1LQBC 5ICYA 3QXWA 1YNKH 1UD4A 4Q9CA 4Y1AA 4FFYH 3O2DH 3RP1A 5TE6L 1LD9A 3U4EA 5HBBA 2VLRB 3GBML 3I9IA 2YZ1A 4M7JH 5ABZA 3FRUA 2BY2A 4OZGF 3MJGX 5DRXB 2MJWA 3WBDA 1WHOA 3RUGA 1PSKL 2O6FA 4ZFFA 1X9QA 1ULVA 2APVA 2P9RA 5IY5B 3PABA 3WTSA 2V2XB 1J0HA 2QADB 5B21A 3I74A 3BKJH 5EF3A 1VLXA 2B14A 1UACL 3P2DA 5TQ2L 3RZCA 1E27A 4F33A 2H1LM 4NQVB 5J5EA 4WJG3 3TBYB 3IT8D 4M6OH 4ZQKB 2D9QB 1MY5A 2B9BA 2E74C 2ICCA 2YPLB 2HT4C 5DEFB 4H5SB 4C83B 4AKOA 5KBMA 4BD4A 2VZUA 1U8JB 4OF8A 4ZW7A 4AOFA 5KYUA 1LTXA 3IMVA 4KX7A 4LSDA 3MOAH 2EO9A 4OB5H 3FB6B 3MVSA 3T2QA 1ZT7A 3SDYH 3VRLF 3MRJA 3R0MA 2WN3A 4O02L 2ZAHA 1BQLL 4Q9BA 1P7QB 3DROA 2O6PA 2E27H 2XTJE 3ALWA 3MRBA 4K5MA 4Z7UF 4YMPA 1BFSA 1U33A 4PJIA 4G7YL 5AVQB 1SJHA 1B6DA 2NCEA 2GSMB 3QULA 4HWZA 3QJFA 5IFJB 1OW0C 2NNAA 4BHUI 2C3VA 1T1XA 4JHVA 1SY6L 5MEOA 4YSEA 1JZ7A 1CF1A 2V17H 2XWJA 3QE5A 1G7QB 3VWJC 1ZJBA 4B9GA 5BS0D 2EIMB 1YEEH 2AEQL 4UQ2A 4QTIH 1GGIH 3CFBA 1PZ5B 2VXQA 4KDTA 2A0LD 4MBRA 4WI5A 5IZ7A 5LG6A 4IJ3B 3T4AC 3SGJC 2CD0A 4QT5A 5IHUL 1P2CA 1O6VA 2MPAL 2I85A 4Z7VA 1HQRB 3EGDA 3VFSB 5KVMC 1BA9A 3F62A 1G43A 1NWPA 1OP5K 2EIEA 4NUQA 4BFIA 4AJWA 5CD5C 4UMSA 1DCEA 2GTWB 1CS6A 3DLQR 2A6KA 4NO5B 8FABA 1RZ7H 3MRLA 1SOQA 1F13A 2FX7H 1J86A 4Q6IA 1NMBH 3NN8A 4O5LL 3QHZH 1DE4A 5KJ4A 4E5XA 1CFVL 1J8SA 1RY7B 2X2JA 1IC1A 1KBVA 1AZRA 1KJVA 3IDUA 3U46B 3VYOA 4OZHB 3FH5A 2E6JA 4X7FC 4HIQA 4LLDA 1JYWA 4JJOA 1XB3A 4NQCD 4M5SA 5DSCA 4G72B 3A22A 3WY4A 2EEXA 4P99A 3ARFD 5J89A 5T1DH 3F7RA 4LPTA 3PAVA 4FG4A 3IDXL 1QI5A 3PRZA 1XF5A 2MWCA 3FUFA 3QEQE 3L4ZA 2AXHA 2DRUA 4F37F 1DBBL 4WO4B 1UJ3C 5FR3A 5TK4A 2P24A 2VW7A 1S7SA 3KH4A 4XN2A 1PPIA 4S1QL 3BIAX 4P3WA 1QA9A 3NCWA 2Q3ZA 4HA1A 4OI9A 3MAWA 4ABQA 4F57L 3B5GA 2YD7A 2ED8A 4R5XA 5D1QB 3FHQA 3QDGB 3QNFA 5KYXA 4JVUA 4HEME 3FCTA 2X12A 1ZXQA 2B0SL 3HAEA 5AYQA 2IO5A 1EDQA 4U1GB 3ZQWA 2GITA 4N0CC 2IDTA 2NZIA 3L48A 4QXVA 2BVOB 3IB4A 5CM1A 4Y5XA 5EOCH 1T2JA 1Y6NR 4QHLB 1LP9B 1XIWC 2FSEB 4JG9A 2VLJD 3GKWH 4HIHA 3VG0H 2OMTB 2X2UA 1FWXA 4G6AD 5E56A 5KVEH 3BZ4A 2UV3A 3PIQA