4YSQA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 8.38 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
total genus 96
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysqA00
3DTUB 3WG7B 2J55A 2XVBA 1KBWA 1NTDA 3ASNB 1PY0A 4L0PB 3NP4A 4YL4A 5IY5B 2HLEB 3EH5B 3G5WA 7PAZA 4BWTA 2HRHA 1PLAA 4E9WA 4P5SA 5E9NA 3MBWB 2FNWA 1AIZA 3SBRA 4E9YA 1ZDSA 2GHZA 3PAVA 1QLEB 3X2QB 4YSCA 4G70B 5FC9A 1IUZA 2VMJA 2MTAA 1E30A 3ZBMA 2YARA 1WA0X 4Q89A 1ETJA 3PLYA 4X4KA 8PAZA 4UAHA 5I5IA 1ILUA 1BXAA 3H4FA 2TSAA 5PCYA 1PMYA 1JVOA 2P80A 2GIMA 5B7FA 3X1NA 4DP9X 2BP8A 5B1KA 1OOWA 3IE9A 2BP0A 5AFAA 1L9TA 4HHGA 3AG2B 4AKQA 1NWPA 1KGYE 4UF7C 1L9PA 3T6ZA 2A3TA 3IBOA 2I7SA 3NJJA 3BQVA 3ABMB 3UGEA 1V54B 2GI0A 1A8ZA 1NIAA 1PZBA 2XV0A 3S8FB 2AVFA 2GB2A 3PXLA 1KBVA 1J5CA 1SF5A 3MX0B 5B1AB 4A68A 4G7SB 1QNIA 3FPYA 1FFTB 2FT7A 2PPDA 4F2FA 2YXVA 3PPSA 3OQRA 3H4HA 1PZCA 4HAKA 2YQBA 2LLNA 2DY2A 2PPCA 4M3HA 3PCYA 3FPXA 2WO2B 1ZV2A 3CG8A 3S3BB 2UX6A 3WKPA 3GXUB 2VM4A 2XLLA 1MZYA 3GDCA 4M4RB 3ASOB 3T6XA 1ET8A 1M57B 3T6WA 3IN2A 1VLXA 1NICA 2YAMA 4E9XA 4BDVA 4JHUA 1AZCA 3H56A 4G7RB 1ET7A 3X1BA 3D12B 1JZJA 4DP7X 1GR7A 1JZFA 1J9SA 5B7EA 4A2GA 2YAHA 2YAFA 2B08A 2DYSB 1M9WA 1OCZB 1OE1A 3FS9A 4DP1X 3TBBA 3QJQB 1PLCA 5I6NA 2J56A 2QT6A 2XXFA 2FT6A 1ASQA 1RZQA 1JERA 3QJSB 4HALA 3NJMA 2IH8A 4YSOA 1F56A 1NPNA 4PAZA 6PCYA 1WAEA 1ZDQA 1XMEB 2BW5A 3CVDA 4GP8B 2I85A 3NYKA 2NRDA 2TSBA 1DYZA 5A7EA 1PZAA 5TK4A 3SBQA 2YAOA 4A67A 2BZ7A 5B1JC 2GC7C 1BEXA 1AS8A 2H3XC 4AKPA 1X9UA 2Y1AA 3S8GB 1ZIBA 4DP2X 3ZIYA 1TEGA 3TA4D 4E9RA 2XYBA 4CSZA 3PAUA 2N0MA 1ASPA 4G71B 2R7EB 3UAEA 2IWKA 2QPDB 2H5UA 3BVDB 3HB3B 2JFCA 1E5ZA 4YSDA 2QDWA 4W9ZA 4YSEA 3QJRB 2WSDA 2PPFA 4G72B 1GY1A 1URIA 2ZWNA 4GP4B 2XUWA 1BYPA 5B1BB 5I6OA 4FAAB 3UAAA 1PLBA 1UATA 2HX7A 1SF3A 3PAZA 2PP9A 5I6LA 4BXVA 2XWZA 1CUOA 3WKQA 1KCBA 2XX1A 2H47C 3IN0A 5F7BA 4A2DA 4NAJA 1GYCA 2CAKA 3V9EA 1KDJA 3FQYA 2FQFA 1A4CA 2VSMB 2VM3A 1IBZA 1JZHA 1SFHA 3ZX1A 1E5YA 1NWOA 3CDZB 1MDAA 2XX0A 1GS7A 1W8EA 3QPKA 2W8CA 5B7MA 1M56B 1KV7A 5EHFA 1AS6A 1E67A 3FSAA 2BWDA 1NIFA 2Q9OA 3NSYA 2X87A 2E86A 3OMNB 1J9TA 2GC4C 9PCYA 4GXFA 1ZIAA 2J57A 3AG3B 1AZUA 4AI7A 3AZUA 3FU8A 2EINB 2PCFA 3FQ1A 1AANA 3WNJA 4CSPA 2I7OA 4WKXA 1JVLA 4YSRA 1OE3A 1V55B 2BW4A 2OJ1A 5ANHA 3QJTB 4NB7A 4HCGA 1JZGA 1NIEA 1NINA 4DPBX 3KW8A 2IAAC 4BXSV 1PNDA 3FU7B 1OCRB 1ZPUA 1EZLA 2YAEA 4PCYA 1IKOP 1NZRA 3T71A 1BXVA 2BZCA 1AZRA 5F7AA 2CALA 1A4BA 4JKNA 3NJKA 5I5JA 2DWSA 1AG6A 2GSMB 1ET5A 1A65A 3SQRA 1WS7A 4ENZA 1W6LA 1E65A 1RKRA 1L9RA 4DP4X 1PCSA 1MG3C 4AKOA 2YAQA 3AY2A 5D4IA 2P80D 3IEAA 2VSKB 4KO9A 4EF3A 5B3SB 3AG1B 4DP0X 3TU6A 2WO3B 3U25A 2AANA 2VW7A 5I28A 3ERXA 3UABA 3ZDWA 1J9RA 2Q5BA 1ID2A 5I5MA 3HEIB 5D4JA 2IDQA 2AFNA 2IH9A 1OF0A 2AZUA 2PP7A 4YVUA 1AZNA 1L9OA 3DIVA 1KDIA 4KOBA 3KW7A 1MG2C 3FSVA 3N2JA 4JHVA 1SDDB 2EIMB 1KCWA 1MZZA 1XB8A 1PAZA 2VW6A 2XU9A 5I26A 2VN3A 1W6WA 2YXWA 2UXGA 1GS8A 3OMIB 4A2HA 1AR1B 1NDTA 2XV3A 3X1FA 4HCIA 4KO6A 4YSAA 2FQEA 4DP6X 1B3IA 1JZEA 3TBCA 3JT2A 4DPAX 2CCWA 2EILB 2HX8A 2IDFA 3FSWA 4YSUA 3ABKB 1RCYA 4K9JA 4ZK8A 4HIPA 2ZONA 1YLBB 5I6PA 1X9RA 2GBAA 2PP8A 2AZAA 1EHKB 2UXVA 4KNUA 3T9WA 2XXGA 3QJVB 2R7EA 4F7KA 3NJHA 1AAJA 1NPJA 4GY4A 4NERA 2FWLB 2CUAA 4QKTA 3EF4A 1CURA 1AG0A 1FWXA 4UANA 3EHBB 1DZ0A 3AG4B 1OCOB 1AQ8A 2IWFA 3NJIA 2UXFA 4E9TA 2XV2A 1WA1X 1AOZA 4HCFA 4FA7B 3QQXA 2DYRB 3EH4B 3JTBA 2IDTA 2PCYA 1SHXA 1A3ZA 1QHQA 2ZXWB 3FU9A 4W1TA 3NJGA 4A66A 1AS7A 2HRGA 2J5WA 4YSPA 1SNRA 3UADA 1ADWA 1BQKA 1GY2A 3GYRA 4HHWA 3CDZA 5B1JA 1TU2A 1L9SA 3ABLB 3CVCA 2OCCB 1A4AA 1WA2X 2IWEA 4KO5A 2QDVA 2BO0A 4KNSA 3NSDA 4A2FA 4AX3A 3NSFA 2BP8B 3CZUB 2BP0B 2BHFA 1ILSA 4BK5C 3FYEB 4E9VA 2Y69B 4YSSA 2CJ3A 2B3IA 3WNIA 4MFHA 4TXVB 1GS6X 1OCCB 1JXDA 1BQRA 2PPAA 2ZOOA 3WIAA 1TKWA 4KNTA 2PLTA 3NJLA 4E9SA 4YVNA 1GSKA 1KYAA 3CVBA 3ABGA 3N55A 3NJNA 3FU7A 5D4HA 4DPCX 2FQGA 1GW0A 2DWTA 2HZHA 4YSQA 1AACA 2HXAA 2YAPA 2EIKB 3OM3B 2UX7A 3NP3A 4AZUA 2RACA 5LDUA 3FYIB 4P5RA 1ASOA 2PPEA 1PF3A 3V9CA 1J9QA 1L9QA 4Q8BA 4KO7A 2IDUA 1BAWA 1IC0A 1XB3A 1OV8A 1CYWA 3C75A 3NSCA 1SJMA 2FJSA 3AW5A 1I53A 1IBYA 1OE2A 1T5KA 1HFUA 3SBPA 3WI9A 2CBPA 2W88A 3S3DB 4E9QA 1RZPA 1TEFA 1SFDA 4DP5X 1BYOA 2MRYA 4BDVB 2JXMA 5I6MA 2FQDA 2IDSA 1JXFA 3UACA 2FT8A 5TK2A 2VW4A 1R1CA 4BWUA 2UXTA 2X88A 4N8UA 3NJFA 1SDDA 6PAZA 5PAZA 2HX9A 5I6KA 1BXUA 1V10A 5AZUA 3OMAB 5AKRA 3DKHA 4A2EA 1JZIA 3TASA 4GP5B 4YSTA 2QPEB 1AZBA 4F2EA 1CYXA 4QLWA 3QJUB 3S3CB 1JXGA 1JOIA 4N4YB 1WS8A 1XB6A 1HAUA 4GYBA 1HAWA 1N68A 4G7QB 1NIBA 3RYMA 2OV0A 4HZ1A 1PNCA 4KOCA 3EH3B 4BWWA 3FT0A 3NT0A 1BQ5A 3OD3A 3L45A 4RH4A 3FQ2A 1CC3A 2FTAA 2JKWA 3X1EA 3X1GA 1N70A 2BWIA 3T6VA 1NIDA 2DV6A 4DP8X 7PCYA 1J5DA 4WTQA 1SHWA 3FSZA 2EIJB 1FA4A
chains in the Genus database with same CATH superfamily
2F8IA 2OPCA 1GPOH 4FKEA 4BGLA 2FCBA 1UB5B 2ZCKL 3K72B 1PY0A 4Q6IC 2JJUA 2ZG2A 2J2ZA 5HYIA 3TVMA 5KS9A 3NQKA 2QLYA 4KKAC 4XBEH 1BLIA 4MJ4A 1FV1A 3L7FA 4MNQA 5JNYB 2BS8A 5LG6A 1DLFL 1TQSA 3QJFB 3IFOB 2AEQL 2AQ3A 4PGEB 5E8DH 2DQHL 3U2SB 2EP6A 3G5ZA 1S3KL 1U8JA 3RZCD 4MQ7B 1XO8A 2D3LA 1GZQA 2BH0A 3TBYA 1E30A 3ZBMA 2VZSA 2WBJD 2DYPD 2ZKWA 4LASH 4B5EA 8FABA 5I74C 1BEYL 2ITCA 2AV1A 1FNGA 1U2HA 5CEZL 3MRMA 3X1NA 4DP9X 1RHHB 5B1KA 1OOWA 2BP0A 2ZJSH 5AFAA 4HA1A 1U8HA 3EG9B 3GF8A 4ZFGL 4ZXBC 3AADB 3FFDB 3WXWH 2A5UA 2FWOA 4RMBA 1ZLVK 2F6AA 4UT7L 1A5FL 2VR8A 3B5HA 4JPVH 4ZNEA 1BQHB 2JKTM 2HKAA 3LNDA 3RUGA 3KXFA 4H13C 3VTAA 5HI3C 1VF5C 2Q76A 3ARRA 4FXKB 1NC2A 3C5SB 1P4IH 4QXGL 4J5VA 2BINA 1GGBL 2X7LB 2CPCA 1WE5A 1KPVA 1LP9F 1UJ3B 1YDPB 3JWNG 4YDLB 5C0EA 2LV4A 4HFUL 4X6FA 4I9WE 5L8JB 3H4HA 3NCEB 4HAKA 5L6YH 2YEQA 4IIZA 4P46D 4G8GE 3DDGA 1FVDA 2B59B 4ERSH 3ZE1B 2ZUXA 4ODTH 4BELD 4ZQTA 3AUVA 1UADC 3E6HA 4WKZA 4WW1B 3NRFA 4KBPA 4ZMQA 1XGUA 2F5AL 5L7XH 5D96B 3RX9A 3BZFA 4JJ5B 2F53E 2DIAA 2B8OT 1FNFA 3HCVA 3PP4H 4W6WB 3W0WA 3IKKA 3T77A 5KAQG 2VM4A 3WY1A 3LHAA 4K23H 3IDMB 1B0RB 1VLXA 3MUGB 1MFCL 3S88L 5LWYH 4IBVA 1ADQH 3WUZA 5KVMC 3DJRA 2AGJH 3PV6B 5T8IA 3SKMA 3BJ91 3BZ4B 3UAJC 3WXVL 2FGZA 1JFHA 5IW1A 4XXDA 2OMYA 3TX4A 1KXHA 2CLVA 2G2RA 3UCRA 3QJQB 3H9SA 2YKLH 4Z7UE 1BVKA 3TPUB 4ODSH 4YDJA 1QSEE 4NSKA 5KBMA 4F20A 1RFDL 1USZA 3WE1A 1U8QB 1AGFB 2XXFA 2EXYC 4KZEH 4MHHG 4FKHA 3GXDA 3ZHNA 3D39A 2CRIA 3ESUF 4PRPD 2RQ8A 4YSOA 4XE5B 1WTLA 4UBDD 2AJYH 1WFTA 1BAFL 5D1ZC 1L6PA 4A39A 4QAMB 2O5XL 1DYZA 5IKCB 1EO8L 5F9OH 3O6LH 1M05A 3BXNB 3TN0B 1R3IH 3LS4L 2GC7C 3MRLB 2NY3C 4HGMA 1I1FB 4Y4HD 3ULVL 1KIRB 4TMPA 5HHNB 2MOGA 1A4KA 4E41D 3DYOA 1BDYA 4JQXA 3F84A 2EH8L 1TEGA 5FPIA 4Z7WA 4ZO9A 4PGBA 5EZLA 2D4DA 5I1KL 3C5ZB 5FA4B 4WV1C 3LZNA 5HYSA 3QEUA 5ICYB 2IWKA 2JB5L 4M1GH 1KELL 2GUOA 3AMKA 4JGNA 3VWJB 3WN5C 2Z7WA 2UZXB 3QUGA 5EO9A 3ZYJA 1WYJA 3MRPA 3UTSD 3O3DA 2QSVA 4FZ8H 4TF4A 5AOJA 2G5UA 4FQXB 4HWZA 1JXKA 3BAYA 4TKWA 3FUMA 3QZBA 2IBGA 3VTTA 3NPSB 1RUML 2I60H 1A6TA 1MI5A 4XPHH 2FHCA 1UQSB 4YHKL 3NAAL 2C7UB 4IBLT 4IEFA 1JNLH 2WXLA 3EF7A 4WW2B 1O6TA 1L4IA 1YMHB 4LGPB 1HL4A 2P5ED 1BP3B 4ZOEA 1U91A 2B1AH 2VAAA 1W72B 5CHNB 1QFUL 2VM3A 5E8NA 3UC0H 3ZL4H 1JZHA 2D7TL 2NY2D 5KVDL 5JQ6L 1O9WA 1C8QA 4M5ZH 1OT1A 1GVIA 1VFBA 3V6BR 2R0KH 1C9SA 2GJ6E 2W8CA 2CHNA 2YPLA 4QWWC 5E2TL 1M56B 3MRQA 4GUPB 3H1ZA 1AS6A 1U93A 3FSAA 3GWJA 3NOIA 2P9RA 1IB5A 2Q9OA 3MLZL 4UV4H 3EHBD 1J05B 3WFEL 2E7LC 3WFHB 3IWUA 3KMDA 2F0CA 3U46A 1LD9B 1QLFB 1GGTA 4N2DA 3MLRL 4YSRA 5BZXA 2BFGA 3OXSA 4K5NA 2H0FA 3ZIMA 4X7SH 3ZHLA 2VLKA 4HCGA 1NIEA 2YD6A 3CK0H 4OI9A 5A2CA 4KTDL 2EE2A 1HXMB 3AB0C 1GIGL 4HLEA 3T0EA 4QY8B 2O72A 1HYRC 1M2VA 4R0LA 4W9DC 1JV5B 2L4OA 3BDYH 4UQAA 3SO3B 1QBMH 2Z7ZA 1ET5A 3AMLA 5B3JF 2Z35A 1WS7A 2BSED 2Y23A 3CHQA 2NY4C 3IF1A 5EU6B 1T1ZB 2ZAIA 3BWAB 2X4QA 1YQ2A 1PEWA 3HBPA 4ZO8A 1PG7L 1YEKL 2H6OA 5AD0A 4YHYB 4K5PA 4OLYH 2M1KA 1KZQA 1Z5HA 1G0XA 4CADA 1J12A 4FNTA 2WP3O 3VQ1C 2R0ZL 5MP6H 4UOW1 4EDXB 3H0TA 1E40A 4A37A 1HL8A 5AVZB 1T1XB 5D7HA 4H25A 1HTYA 3B7TA 4WAFA 5F44A 1RZ8B 2PYEE 1GMEA 3KW7A 4JVWA 4FI6A 4FQJH 4UMSA 5D1XD 5AZ2H 3VYNA 3K46A 2H1XA 2DMBA 1RSFA 1ZPLA 5IQNA 2XICA 3BPNB 3UBXI 4WHDA 4NN6B 5F0PB 3U48A 1GPOL 1XVSA 2B7DT 3QIUD 4PRNA 4BK8A 2XV3A 2V2XB 4HCRH 3CPUA 4YIQA 4MCMA 1HI6B 3QHZH 2AV7B 2Q0ZX 4HJUA 1NANI 3JT2A 4G8GA 1GZHC 1XGYH 4PRHB 2R51A 5E8DL 1PGRB 3QUMA 4IMLB 2XZQH 4BZ2H 3EUUA 5DRXB 2CR0A 3ZKXB 5CLXA 4LASL 4EIGB 3I6LD 4G9DB 4AEEA 2LU5A 2PR4H 3VJ6B 2ZXCA 2OR8A 3FCUB 3NDYE 1Z7JA 4C54A 1DEDA 3K5SA 3CC5A 1EEYB 3HA0A 5DRZA 1SN2A 3MA7A 2ZJSL 1W16A 5FGCE 2WVVA 1YY9C 3L3KA 3WXWL 2FJFB 2XTJD 1T03H 4JHAL 1B2YA 3F12A 3LRSA 2IWFA 4JPVL 4DKAA 2EUZA 3GXPA 3BVWA 3QUXC 5KJRH 1GXEA 5DUBB 3QJXA 3HZ3A 5F7EH 2HFTA 3SGKA 3HE7D 1P4IL 5HJBA 4LE8A 1JHLH 4UIKH 1XCQB 4V1DB 3HE6D 4LLQB 1CBJA 1R3JB 4X0KB 2VDKH 4X5QA 3P0VH 3H3BC 5IJVA 3HC4H 4YSPA 2HKFH 3VXQB 4CJ0A 4GLRI 4QRPB 2EO7A 5L6YL 2V2WA 2GBVA 2XWTB 4OIIH 3IJHB 2IH3B 2XQ0A 3VXUE 4ERSL 1XF5A 4ODTL 1HKFA 3DRQA 4WEBH 4FOMA 4ZFFB 4KNSA 1F4XH 1RP8A 1TXKA 3AJ7A 3C6LB 4GW5B 5DEZA 1VERA 1QI5A 5IM7B 1G1OA 1SLVA 1TO5A 2VZ3A 2YOAA 3PP4L 5A2IH 4HWBA 1KJ2B 4ZW8A 2C1OB 4ELKA 3WS6A 5CN3A 4K23L 3S97C 2Y6SC 3L54A 2V9TA 3QFJE 4OZIE 2BVEA 2IALA 1ORQA 3C6SA 4PGDA 5IG7A 4U6YA 4ENED 2ZOOA 5LWYL 1ADQL 3IMVA 3KGTA 2J72A 1Y6NR 3HVNA 2QZQA 3LVTA 2AGJL 1BG1A 1WBYB 5M95B 3KLSA 3QZOA 5D4HA 2ED7A 4XCYA 4PJGB 1B0GA 5B8CA 2IAMC 4IOFD 4AK2A 4PTUB 1I1CA 3P0GB 2AXGA 1EUUA 1RUAH 3RDJA 4ORGB 3CXHK 2YKLL 4OV5B 4ODSL 2WTRB 4NPJA 4GIPD 5ICXA 3ZTCC 2L7QA 4GW1B 4KZEL 4R96A 2Z64C 4LL9A 5JORB 4Q8BA 1A0QH 4BZYA 3D2UD 4WWOA 1QFOA 1OV8A 3NSCA 5EWIH 1SJMA 2Y0SA 5KSVA 4JHZA 2HVJB 3BWZA 3VGAB 2AJYL 2H2SC 1CFSA 5EOTB 4XWOD 1ITCA 5D7LD 1MN4A 2CBPA 3G9VA 3NZSA 4QHNA 5HD8C 5F9OL 3O6LL 4Y5YB 5C08D 1MWAB 1R3IL 5C0AE 1FO0H 1IEBB 1L0QA 1IEAA 3K4ZA 3K91A 5D8JH 3PWLB 1FAKT 1NGWB 1UT9A 5IREA 2NNRA 4UINH 4Y8AA 3TH4T 4G9FB 1A22B 5DLMH 5T1LB 2VXQH 3LHPH 1FYTD 5E00B 4D94A 4B60A 1NH6A 3LIZH 5KBKA 4JFDB 4W9LC 3W5NA 4ZAKA 5AZUA 3A4EA 4M1GL 1EAPB 3CPLB 4GAYA 1MRFH 4RMWA 5B1CA 1XH3A 1KV3A 3G6JB 2L04A 1AZBA 3FO9A 4FZ8L 2QKIB 4PPTA 3EJRA 1JOIA 2ZX6A 4PSPA 1L0XA 2I60L 1WCQA 3FUIA 4AIEA 1HJCA 4XPHL 2R29L 2ZF8A 3KH3A 4NFCA 1YPZA 2C9PA 1AKJB 3WHXB 1JNLL 3O8XC 4JUSA 1RLWA 3GD1C 5LAPA 1HESA 3UMNA 2QSTA 2B1AL 4B41A 3FQ2A 3ZL4L 4BD4A 1R34A 3UC0L 4JMXA 4TNWF 4BQ6A 3DC0A 4P3CH 2P26A 1UCTA 4M5ZL 4OGXH 2WXIA 4N2KA 2FEEL 1RPUA 2CNZA 2R0KL 3F58H 2H8PB 5GGRB 3P73B 1KTJA 3CFUA 4XB7A 4QRUA 5DJ2A 3TA3A 3DTUB 1HXYB 4UV4L 4X4ME 1SXZA 4LKXA 1MIMH 1GGYA 5E2VH 5IB1A 5ITFB 2O61A 3EH5B 5GHWH 1NC4D 2VMDA 2XWBA 2OULB 4X80H 1UFGA 4FTVD 3MBWB 5GRYA 2W65B 3VFOB 3BQUA 4ETYA 1V7MH 4F8LA 4PSRA 4K3GA 1DQMH 2AAAA 3CK0L 1QLEB 3IDIB 5E5LA 3L9EA 3LZQA 5AOZA 4XGZA 2CBOA 5IZ7A 2LW3A 1MNNA 3ARFD 1E9OB 3MGAA 1KXQA 2QSQA 5I17B 5F9DC 2WOYA 2EDQA 4JFQA 5ETUA 2F08A 2FO4B 4ONHB 3BDYL 4GMTH 1QBML 3CZEA 3B8YA 2ETWA 1XSIA 2BHZA 2AQPA 1QHPA 4L8CA 2WYZA 4PCTA 4MD4A 2OXHA 3T6ZA 5EEVA 3DXAE 4PJ7F 3KS0H 1YECH 2E76C 2KI6A 1C08B 2M26A 5BQ7B 3IGLA 1V54B 3QR2A 4OLYL 2AVFA 5MP6L 2V3DA 3GEFA 2X0WA 3HHMA 3D07A 2AHIA 2EEAA 3CDYA 4Z3HA 1CTNA 1UA6H 2B1OA 3B2MA 5CSZB 3MXVL 4K7FB 3TIDA 4N2LA 2YXVA 1WQVT 2J7LA 3GSOB 3T6QC 1CXFA 4MD0B 1FZKA 2EH7H 2OL3A 4FQJL 5E99H 5AZ2L 1LO2H 4AYFB 3Q8BA 3DECA 3LNEA 3P4OB 1IZJA 4FRWA 4X7TA 1C16B 3LZFH 4OZGA 5HXMA 1I8MA 4JKKA 5BVPH 4G80B 5DFVC 3QRGH 3PDOA 1IC5H 2A73B 4HCRL 9CGTA 1R0AH 2WLLB 2HG5A 2CO7B 4MNHB 5EB9A 4NO5A 4QRQB 3QHZL 1YY8A 3RWIA 1OTSD 1ZJAA 4X7FC 3OJDA 2GJJA 1JYNA 1OHQA 3MOAH 2XETA 4J12A 2DBLH 3JUZA 3KPQB 3NK3A 2VZVA 1XGYL 4KTGA 2MCG1 4U6HA 1WBXB 3TBVB 4E9XA 1U8KB 4JHUA 4QTHB 2I26N 3TJEH 5IQ9B 1HDMA 3GSVB 3FTVA 3Q8AA 2XZQL 1XCTA 5KBDA 2P5WE 4BZ2L 2M83A 4U3XA 3ARDC 1A6AA 5KYYB 5SWSD 2PR4L 2Y7QA 5I8CA 4QT5B 2Q7AA 1LJMA 4XMKH 5JW4R 4ZUTA 1M7DB 1LQSR 1TG8A 4CVZA 1QBBA 2EE6A 2JK5A 1EZVY 4J27A 4DGUA 5I1HH 2QQQA 1ASQA 3BO8B 4MVBC 2IFGA 1NPUA 4PJFE 1EK3A 3FULA 3PIQA 4UTBL 5KJRL 3QUYB 1CICA 5F7EL 1QWUA 1ULVA 2GITA 4J3XA 1JHLL 4UIKL 3FO1B 3W11C 1L0PA 1GMIA 4QHKI 3O6FA 2VDKL 1T5XA 3P0VL 4U1LA 1OP3K 4HWEH 3HC4L 3ZR6A 4FQPA 4ABWA 2HKFL 3Q5YA 3UTQB 4QO1A 3ZDYB 5AYQA 5TQ2H 1FL5B 4EI6B 4U4IA 1EXGA 3BVXA 1TENA 4OIIL 4E42A 3DHMA 1IAOA 3V7MA 4HMEA 2OTPA 4CW1B 4ZOAA 2YA1A 4YBQC 2WUCH 2HH0H 4WEBL 4CJ1A 5BRZD 3HNTH 1KMGA 5IWLA 1F4XL 5BRPA 2ARWA 4FTDA 3BH8A 4RSVA 1OLLA 1I9EA 4RDQF 3RHWF 1KY7A 2OMXA 2ZWNA 3QUKA 1DN0A 3JXAA 4MZ3A 2OYPA 1ORSA 4B9IA 1INDH 3WFBH 2G3MA 5HGHB 2KLSA 2AQSA 3HG1E 1DVFD 2OYMA 2X3AA 2X89D 1T04A 5ID1B 4GUQA 3GJEB 1KJMB 5KYXB 1NCUA 1MFEH 3S3SA 5C07A 1AIFA 3L3DA 2X4NB 4TLKA 4MCZB 4LGRB 4JFEE 2PWEA 3MRJB 4LPXA 3LVEA 4MX7B 3L13A 2VC2H 5I1CH 3UIYA 1HE7A 1OSZA 1XZ0A 4N26A 3S34H 3EOBB 5CJOH 1CLCA 1RUAL 4H8UA 4ESKA 3GBEA 1MDAA 3BVTA 1W8EA 3B43A 3TZVC 2JH2A 1MCWM 3GLAA 3SKNB 3EDFA 2EUVA 1A0QL 3BH9A 5I66A 5EWIL 1CDHA 3QORA 3RWEB 4YUEH 4JFWA 5ABAA 1TDQA 3PXJA 5A40E 3UTTB 2F1AA 5GRJH 1ZIAA 3ISRA 1U42A 1MHCA 4XNZB 1OALA 1JS4A 1LVEA 2IWGA 3SEPA 2PCFA 3FQ1A 3NA4A 1FO0L 1H5BA 1XF3B 1TETH 2JCCB 3M1BB 4WKXA 5D8JL 4DOHB 1O7DE 2VUYA 2BY3A 2Q7NA 4UINL 3GGWA 2K8MA 1UT1A 3LRKA 3ELQA 1TZHA 5DLML 2VXQL 5LGJB 3L8QA 3LHPL 1KLUA 1U3HC 2ZCZA 3I6GB 4LCWD 4Z3FA 3LIZL 4RESB 1JNNH 1QEXA 1EZLA 3SGEI 2JKLA 4PRDB 2EKSA 1IKOP 3NCXA 2X4UB 4JFPB 1MRFL 3SE9H 5DK0B 4PV9A 4ORZC 3SE3C 4KK8C 3SY0A 5F7AA 1DFXA 1A4BA 2H7WA 3BFQG 2P8PB 3MMEB 2J8HA 1RJZA 3L5WB 2N0KA 4I4WB 3R19A 1J0HA 3P30H 2GEEA 1P5UC 3MRIA 1MG3C 2EYRB 3HOGA 4PGZA 2JKIS 2KL6A 1FC2D 3EYOA 4EI5C 3JVGC 3S96A 1XGQA 4MA8H 1OAXH 4PRID 1DANT 5DJDB 1K5NB 4J3OC 3UOAB 1NDMA 2HVKA 3QS2A 1V05A 2BM3A 2R69H 5MENA 3ZK0A 3VD0A 3MBEA 1MLBA 4P3CL 1L9OA 1KDIA 4OGXL 1MAMH 4JHVA 3SE6A 3T0WA 4Y4KC 1COBA 4YDMA 4LIQH 3F58L 3LQAH 3ZE1F 5I26A 1H6FA 2ADGA 5L4JA 4W68A 3JWNH 1JNHA 3B2UD 1FRGH 4JUTA 5DQ9B 2ZYRA 1QEWA 2G3XA 1GS8A 1MLCB 5DMYA 3K71B 3TVMC 1FSKC 1MIML 5ILTH 4ZX5A 1YMMB 5E2VL 1IKNA 4KO6A 1CDGA 3M8OH 4RRPA 1U8PB 3P2DA 3REWB 3T3ME 4IIQA 3VFWB 4X80L 5LO7A 4DP6X 4Z6AT 3ARUA 4CKQA 3IMSA 5KW9H 2BNRE 3TBCA 3BE1H 2EE9A 3EUDA 3UX9B 5DFWH 1I3RA 1V7ML 3AACA 3DYPA 1O0VA 3NPZB 3ZJAA 4BZ1A 2F5BH 1DQML 3APCA 5C0BD 5J56B 2P52A 4M03A 1CO1A 2GVYA 2AZAA 3A47A 1OQXA 2APSA 3ZU8A 1HZHH 1HN1A 2ZG3A 3T9WA 1LXMA 4NRYA 4DCQB 4DEWA 3MLPA 3SZ6A 3VFNB 3MCKA 3DA0A 2HP4A 3DROB 3FQXA 4A6YB 4PVNA 3LAFA 2E7MA 4GMTL 2EDNA 3VM5A 1ZLWH 2CUAA 4QKTA 4D2NA 3P3RA 5HDBB 1FYHB 1DZ0A 4ZW6A 4KKLD 4ZUUA 4P49A 5D2LE 2JELL 4L3EB 4U1JA 2E6JA 5HDQH 4KRPD 2KLRA 1NGYB 3O11B 4BEIA 5GSVA 5KN5A 4KQ4H 4Z78A 4WSJA 1Q0EA 3EH4B 3P9WB 5DZ9A 4APQA 3AT8A 1UA6L 4RAUA 1P7KA 4KKRA 3SDDA 4OKDA 4L3AA 3VH8B 3WAJA 1RK0A 2R0LH 5C09A 2E9BA 1FVEA 5J1SC 5HBBA 3T4YB 5JR1H 2EH7L 4P4KD 1U8OA 2FGWH 4NQEA 5E99L 4N9GA 1LO2L 1B9ZA 4TV3A 3RX5A 1FAIH 4GBXA 1UA3A 3MUHL 4U7MA 2UZYA 3LZFL 4BM7A 5SX5H 2AJZB 3P9MB 3D48R 5BVPL 1E43A 3LMJH 3QRGL 1NMCC 1IC5L 4LLMB 1EBAA 1ACXA 4S2SB 1R0AL 3NSFA 2WVSA 3RL2B 1NAMA 3QZMA 4LLWB 5EC2B 4BQ8A 1HHIA 3STBA 4UM8A 3MOAL 2DBLL 3LN9A 2FO8A 3L81A 4RGND 5E8OA 3TJEL 1NL0H 2CLZB 4DEUA 4FD0A 3ZPDA 5JHDB 4ELMA 3PHQA 1GSKA 3H8NA 1OXYA 1T20B 4OJFH 3NJNA 4M93B 3HUJB 1OM3H 5JQIB 1YCSA 5FHAH 3WFCH 4QHMB 1IJNA 2P43B 4PEEA 1U4FA 4PJBA 4HUWB 4XMKL 3D0AA 1B0IA 2NYKA 5LDUA 3AQXA 3FYIB 1CGUA 5I1HL 4ODVH 4MS8C 2F61A 5KZCD 3LEXB 3KPNA 3IJEA 2XBZA 1QTSA 5L2JA 3QARA 3BAXA 3NH7H 4BHUI 1X5HA 1AR2A 2C4XA 4JFEA 3N40F 3N50A 5A2KH 4PFEA 2HAZA 3TWCH 4TVSa 1QLRA 1R33A 4N90D 3DBXB 4Y2LA 3R06A 4NQDA 5IB3A 2GI7A 2VGLM 2W88A 1I8AA 3C87A 3IU4H 3S3DB 3S36X 1SFDA 3V55A 4JQXC 1CDBA 4XB8A 5JXEA 2WXFA 4HWEL 2FQDA 2IDSA 4AM0A 1JXFA 2AJXH 5DEGA 4P0DA 5TQ2L 4BWUA 2IQ9H 2D7PA 4KXBA 2YJLA 4P5TA 1PFCA 5FM5M 3RWHA 4XCEB 2CPUA 4TVPH 1PIFA 2WUCL 2HH0L 2ENSA 3HNTL 1PJWA 1KXTB 3KEDA 3P3TA 3OPUA 1EGJA 3AU0A 5E4AA 4YSTA 4L8DA 3OKYA 5KSUB 2ZYSA 4J3SA 5IJKA 3MRFA 1M1XA 1H6TA 1WS8A 3SDAD 1S78C 2BZDA 3AREB 5DTFB 2B9BA 4JFSA 1MFEL 1ZANH 1AGCB 1LQBC 3ZOAA 1F3RB 4R8WH 3NT0A 5F89A 3T8MA 5DHVB 1HCFX 1WF5A 5SWZB 3TO4B 3QVAA 5I1CL 2VC2L 5CBEA 3QUMH 3RFZB 1NLDH 2NMSA 3S34L 5F1SA 5CJOL 1FG2B 2FTAA 4PJIF 3PWNB 5H2BB 3X1EA 5J89A 1ACCA 1XWVA 2VXSH 2A83B 4JZOB 1MW1A 5JPNB 2OTWA 3MRHA 3VG9C 3D09A 4RBPK 1I85A 3KDMA 4HJEA 1MCIA 4YUEL 3AS0A 1WICA 2K7PA 2ARJQ 2V5TA 2ARJA 1NTDA 5GRJL 4DH2A 3NP4A 1D5MB 5GRXG 3U9PL 5FFGA 3ATFA 5BZWB 5CGTA 1TETL 3UBXB 3WELA 4AENB 4L3CA 1XF2B 2NXZB 3FQNB 2XN9D 3L17A 3MRCA 1QW9A 5F7DB 4TM9A 4IW4C 2AS5M 2IADB 1OOAA 1Y7VA 5E4IA 4KRMB 3SBRA 3WE6A 3PAVA 4YO0B 2Z4TA 1V5JA 3CDFA 2VR7A 4X9YA 4AVKA 4R0LC 5EO0A 1WA0X 2YN5A 4M29A 1A64A 1TTGA 3P11H 5DSCA 3SE9L 2W0LA 1TTCA 2QKSA 2X5PA 4NQXB 5F8QC 2GCYB 2RA1A 4HU8A 1VGKB 1I8LA 5D7SH 3U0PA 1MJ7H 4NRXB 3P30L 2YPKB 1NCWH 4WWKB 1OGAB 4AV5A 3BT0A 3ALPA 1MCRA 4PW4A 1V27A 2QR0A 5CMAA 5JW5B 3UBFA 4HWBH 1FFOB 4MA8L 1OAXL 2DQ6A 4D9RE 2Z6FA 4X83A 1SF5A 3W3BA 3SBWA 3G6AA 1EJOH 4M48H 4NUPA 1K3IA 2YSTA 3P0YH 4XNMB 1PQZA 5D2LA 1CLYH 1MAML 1N8ZB 4LARH 4LIQL 3LQAL 4ANWA 1R5WB 3V0VA 2E6PA 5CGYC 2DY2A 2X12A 1M1SA 4FNPA 3ULUD 3WTTA 1FRGL 3ISYA 1OT2A 3QI9B 3V0IA 3B2XA 4F5CE 1P4BH 4LVHB 1OB1B 3KLAA 3MLVH 1E4XH 1N67A 3QO1B 4IU3B 4RDBA 5FB8A 3M8OL 2HTKC 1J8HB 1HSBB 3DHJA 4PWFA 4S1RH 3UJIH 1S9VA 3WKPA 3WEMA 4AGMA 5KW9L 1BZQK 3GDCA 3IMRA 3KGUA 5EBLA 4H26B 3BE1L 1D7FA 3DGGB 2R2HA 3GMOB 4PGCB 3RWJA 4JJHA 2X6MA 4PV8A 2F5BL 4DVBB 3LRHA 1N3NA 3QAZC 2WBXA 4JKWA 3FT4A 1A8JH 3D25B 3OB0K 4PJGF 1D6EB 2AVGA 3MV8D 1KY6A 4DP7X 1IM9A 1HZHL 1WV7T 4J3BA 4ABVA 1A9BB 2YGPA 1CN4A 3GDBA 2IC2A 3B9EA 4RMUA 5D6CA 3L3JA 2D9CA 4LCUB 3QDJA 4HKXB 1JI2A 1MXGA 4HUNB 1PTZA 4QTIH 3FOLA 1YRKA 3VXOA 5HDQL 3U4KA 4PI0A 2BNQD 3CH1B 3FNKA 3UGUA 1FBIH 2PO6D 1FZMB 5EIIB 3TFBA 4KQ4L 4ES8A 4XO8A 3HZYB 1JWMA 2JJSC 2BERA 4AIZA 3JV0A 2R0LL 1MCLA 1IGMH 5E6IB 4W9FC 5BO1H 1KIUB 4JY6B 5JR1L 2FGWL 4E9RA 2G9HA 1FAIL 2V6HA 4NUJB 3QWNA 4AITA 2YN3A 2X3CA 2XWXA 3MJ7B 4Y16A 5E5MB 1MRCH 3LMJL 4OU3A 3BEWB 4AVHA 2GT9B 2VLLB 3WS6C 4CKVX 1GY1A 2MQGA 5F6IC 3K72A 4JN1H 5JO5A 5C0CD 1UT2A 4IKIA 3M1OA 1NL0L 2Q20A 3DV6B 5JNYA 4MXWH 2F15A 2NZ9C 5B8CC 2LGNA 4BH8B 3IFOA 4PGEA 4JB9H 4AUYA 3U2SA 5DHMC 5I0VA 4MQ7A 1OM3L 3BLPX 5FHAL 1GOGA 3T1FB 3WFCL 4C4KO 3DTXB 5CJ8A 5CKGA 1QMUA 2B77A 3ZX1A 4HU2A 1XQ4A 5AALA 1E5YA 5J0BA 5INDB 4ODVL 3DJ9A 3NIFF 2JJVA 2EVIA 1KB5B 1UZ6E 1RHHA 2ZOLB 4ONOA 3QPKA 4GSQA 4Z7NB 1AO7E 3NH7L 4BBWA 3RDTC 1VEOA 1HEHC 5BZZA 3P1VA 3RPBA 2ERJB 3CFKB 3TWCL 2DBJA 3W5MA 1P5VA 2YFOA 2NDFA 1BQHA 3O2WH 1PDKB 9PCYA 3FT9A 3IU4L 4FXKA 4XOAA 3NIGF 4GI9A 2F53D 1L9NA 5E9DE 2JI2A 1BD2E 4HLJA 2AJXL 2IV9A 2X7LA 1W0YT 4G83A 1GH7A 2ROYA 1UJ3A 1YDPA 1NINA 4ZAKC 4JVUA 2HPOA 5FV2A 1NKGA 3Q3GB 4TVPL 1S9YA 3GXIA 4QOKE 3D06A 3PFUA 2QADC 2OL3H 3EOAB 4I1PA 4GKSB 1BXVA 2KZWA 2DQCH 5FYJE 1CGSL 5C92A 1UXWA 2YWZA 4WK0B 5IQMA 4TQIA 2AJVH 4JJ5A 4PHZA 4JVPA 1BIIB 5LBVA 3QC5X 4NNYB 4P2QB 1B0RA 3MUGA 4NHCH 3PWPE 5H8DA 4DP0X 3B34A 4PJ5D 1ZANL 3D4ZA 4R8WL 2B20A 3PV6A 4YHOH 4KRLB 4PS4H 3BZ4A 2XPGB 2MWCA 5DEJA 3QUML 1WBZB 1NLDL 4M43H 3BVNB 1FP5A 3A3YB 3L3GB 4TUJB 2NOYA 3K0YA 2L3BA 1ZV5A 1AC6A 1B4JH 2I9TB 2VXSL 3L1OH 2EVHA 1WZLA 4IDLA 1LEKA 3TPUA 4YN3A 2VN3A 2NY7H 2ZUTA 2X4RB 4XN4A 1U8QA 2YXWA 3TJHD 3C9NA 4A7GF 4AUJA 5T3XH 3RWGB 1UFUA 3C60D 5D70H 3MV9E 2AKRB 3RGVC 3Q2WA 1ZLUH 5CEZD 4CVUA 5KSAB 4YMPA 5B38A 3ECQA 4YFEA 2DYPB 3B3BA 2HX8A 3BXNA 3BD5A 5A7BA 1N6UA 3Q1SH 3MRLA 1I1FA 4M7LH 1QSFD 1KIRA 3Q5OA 3A4FA 5HHNA 1QYGH 2B5IB 3VXMB 4F5CA 5KBLA 3DMMD 4OZHB 3V0DA 5FAAA 1MCDA 3GXFA 3MROA 3P11L 2FL5B 3IPBA 4KQ0A 5D9SB 5FA4A 3I6KB 1FN4B 5ICYA 3EW3B 4MDIB 2ZIDA 1NBZA 4ZTPH 3SODB 1SYSA 1T83A 4NHUA 4L4VB 1I7TB 1AG0A 2UZXA 2P7TB 3A23A 3CHOA 5D7SL 4XNYH 1MJ7L 1YNLH 3OKNB 4FQCH 3LKRB 5CINH 5FA3A 1NCWL 4HAFA 4FQXA 1S5HB 2NTSP 1SJXA 1CXEA 5LN4A 2GJ6D 2ICWI 4HWBL 3L4UA 4UQCA 1UQSA 3TM6A 3DX6B 3VACA 5SV4A 2C7UA 2NYYD 1F42A 3QQXA 1F4AA 2DYRB 1SXBA 4WW2A 3DUUA 4P46B 5CP3A 1LDPH 1YMHA 3DX8A 4PJEF 1EJOL 4M48L 3D3VD 5D7IE 1I31A 5CHNA 3P0YL 4PJXE 4Q9QH 4ELDA 1RPQA 1CLYL 2KT6A 4YNYB 3ZSSA 4LARL 1A6ZA 5B1JA 4KJPD 1JGDA 1TQBC 4HS6A 5DC2A 4CSTA 4I3SH 4MCYA 4RFNC 1ACZA 1SVZA 5GIRB 2XIIA 4HIQA 3NIDE 1P4BL 5I1JH 2Q3ZA 2BFVH 3MLVL 1E4XL 1UWXH 3BN9D 3SDCD 3GSXB 3COOA 4S1RL 3UJIL 1J05A 1YEEH 3WFHA 4L1HA 5HVHB 1LD9A 1DSYA 1TNNA 1QLFA 3US0A 2BP3A 1KJVB 3MNVB 2X4PB 1QRNB 1BREA 4KNTA 2DLHA 4OLEA 4F3FB 3Q6GH 5SX4H 1KB3A 3TH2T 1HXMA 5LCVA 5HJDA 4MAYC 4Z7QE 2Y3AA 2NY1C 3FDWA 1A9EB 4QY8A 4YE4H 2PR9A 3ZE2E 3HFFA 4OTXH 4OFDA 4QTIL 5IB5B 3UO8B 3Q44A 3BESR 2PYED 4GRWB 2HJKB 2WB7A 4OCLC 1T1ZA 3BWAA 1C5DB 1CICC 4KO7A 5CIPB 1I75A 3PREA 3EH1A 3O6MH 1CDUA 1FBIL 4XH2B 3ZTDC 3WMPA 4WFGE 3O6FC 5I74B 2R4RH 4P05A 5H4YA 4EDXA 4DO6A 3GZPA 3DOSB 3U7AA 1T1XA 3PL6D 1IGML 4PP2A 1IEHA 2X2YA 3NESA 5BO1L 4XNXH 3SIKA 4OLVH 1SMAA 1MXDA 3TPKA 1RZ8A 4ZXBB 1MUJB 3F3HA 2YIHA 2TAAA 3OZKA 3OHXB 4NO0B 5IWLC 2YUZA 1W0WB 5A16B 1I82A 2YR3A 1MRCL 2VDPB 4EUPB 2EIDA 4L18A 1BD2A 2Z7YA 1EFXD 2RJMA 2V2XA 3CX2A 3LH2H 2DQUH 4JN1L 3LH9A 3SQBB 4ZZFA 1VKXB 2D4FA 4WU7B 5EG6C 4JO2L 4ZMAT 1HI6A 3OKEB 2AV7A 1QFWL 4DNLA 4J23A 3BWSA 4MXWL 2NY2B 4IGBD 4KK9C 5HGDB 4JB9L 1UJTA 2ZAHA 3EH3B 4EXPX 1KCLA 1JYVA 1E8ZA 2XZCH 5DRXA 3X17A 4BZ1H 2R56H 1FE8H 5GS0H 3RFRA 3WLWD 3FUDA 2NY0C 4ZO7A 4Q6KA 4BUQA 4G1MB 3RG1C 3X1GA 1H8SA 4N85A 4EEEA 2HMIC 3PWPA 2W9EH 3B6SB 3QORC 4NENB 2FJFA 2MKLC 4IKKA 3VXUD 2PTTA 3CU7A 1UWYA 5EF0A 1L6XA 1XIWD 2J55A 5E0FA 4P9MH 3O2WL 1S7VB 3ASNB 5EN3A 4OGYH 4QRSB 4DSYA 5DUBA 3OLIA 1EAOA 4JO1H 3RB7A 4P2OD 5ECJE 1TJIH 4V1DA 1XCQA 4BH7B 4LLQA 3TONA 1LDSA 2G75B 4OSUH 2B1HH 1LE5B 1VEPA 2K78A 3BUBA 5EZJB 1N10A 1VACA 4BKSC 3VXQA 3MSPA 4HV8B 3AM8A 3F85A 1NKOA 4KK6D 4OUUB 2XWTA 5K59F 3IJHA 4B5ZA 3T8XB 1C12B 1ZGLP 4P2RB 1I3VA 1F86A 8PAZA 2OL3L 4N8VB 2FR4B 4GIAA 1NKRA 2DQCL 3OAZK 4IRSA 3GS0A 3C6LA 1FFQA 4B9GA 2AJVL 1HNYA 3CWGA 2NY3B 2BSBA 2BVYA 2C1OA 2VR5A 1CDCA 1UWEH 2NY5H 4JE4B 1NAMH 2ODHA 4L9LB 4NHCL 3ABMB 5E23A 1QASA 4DK6A 4E0RB 5IROA 4WV1B 5HVWA 4HIJB 3SDXB 1WBYA 3MBEC 4P2CG 4MNGE 5D1XB 2X6CA 4PS4L 2BIHA 1VZIA 1ZLSH 3WN5B 4AMKH 4M43L 3LPPA 5C0NC 1NOAA 3DPBA 4G6KL 1SXNA 4RWYH 4PTUA 3QIUB 1B4JL 1HCZA 5C0AD 4ZMLA 4M61B 3L1OL 1ZSDA 3SKOB 3O41A 4ORGA 4YDZA 4OV5A 3BD4A 4KJYB 1GOFA 4AJ0A 2NY7L 4UOJA 4WI9A 5FO7B 4GW1A 1OIOA 5JORA 1IKNC 3V8OA 4GPVA 3GMQB 5T3XL 4IIQC 3TP4A 3S3BB 5D70L 2LFEA 4R7DB 2HVJA 5JDJA 5EOTA 2CNYA 3D1MC 2V9RA 1ITBB 1KNOB 2ZXEB 4IU2B 4U49A 3ASOB 1K5WA 4WUUE 3MI6A 5GS0C 1JGVH 3P4MB 4Y5YA 1MWAA 1UD5A 1IEBA 3Q1SL 3QC6X 4JFYB 2YAMA 3PWLA 4M56A 5CJXC 4M7LL 3PWUB 1T80A 3CCHA 1QYGL 4G9FA 2ZXDA 5T1LA 1TQTA 5E00A 3X1BA 1LP9E 3QNXB 4JFDA 1XR9B 2XTJB 3G5XA 4KI1A 2ZOWA 1EAPA 3CPLA 4ZTPL 3P3YA 3U9UB 3K6DA 1MCBA 2IEPA 3UYOD 5T1JA 4POYA 3ARGD 4XNYL 4NQCE 1EZVX 3G6JA 3HE7B 3N91A 3NK4A 3N1QC 4FQCL 4MKTA 5CINL 5GXBB 5M94B 1EEZB 1DQQB 1EGJH 1JTTA 1XCWA 1YYLH 3L3IB 4OCMC 4Y2DD 3EFFB 1Q0YH 5I9QB 3WKMH 4APQC 1W91A 1FUNA 3QDGE 2W94A 4NRZB 4YE0A 5LGYA 3GO1H 4NCDA 1QNZH 1JZ3A 3SDDC 1WAEA 3AB0B 1AKJA 3WHXA 5BV7H 5MEPB 2JI1A 2WV3A 5FDWB 1LDPL 3QPQC 4X5XB 3MUZ1 5I6XC 4Q9QL 2YBRB 3GRWA 4ZX6A 1UD3A 1DJGA 5EBGA 5D5MF 4X6DB 2CR6A 4PP1D 4WEMB 2WLZA 5H35B 3MLSH 4G7YH 2H8PA 5GGRA 4I3SL 2DWEB 1BWWA 3P73A 3AQYA 2QPDB 1NFDB 5I1JL 2FHFA 2BFVL 1HXYA 4KKPA 3AGVA 4NQVA 2CQVA 1D5BB 5ITFA 1YEEL 2N01B 4DWHA 4NQQA 5DMKB 4GKOA 4GXUM 2Q3XA 4MQXD 1BVOA 2MNUA 3MBWA 3DURA 2W65A 3L1FA 5DVOA 3JWDH 3V4LA 1ML0A 4BXVA 3DXAD 3ZMNA 4KJQC 2KZ1B 3Q6GL 3IDIA 1QR4A 5HHXH 1JZ6A 4XNAA 3V4VB 3RZWA 5IBLD 4EZKA 4DJMA 1UEMA 2XQBH 3D2UB 4L48A 3VFTB 1E9OA 1AP2B 4YE4L 5I17A 3NCCB 5FYKH 5IR1B 2FO4A 2PUQT 4TRPH 1DDHB 4OTXL 1T6BX 1K4CA 5D7LB 5AKTA 4AQAB 2NNCA 1RMFH 3R1GH 2VDQB 5CNHA 4TTDD 1KV7A 5EHFA 1DO5A 3O6ML 3BAJA 1NIFA 3F7RA 1C08A 3RI5K 5BQ7A 4HS3B 3OR7B 5JXEC 2J57A 5SX5K 2R4RL 3MCLH 3B9AA 4GO9A 1E5UI 3KR3H 3IWVA 3WNJA 4P5TC 5DMGD 2BW4A 5CSZA 5GGTA 4BFNA 4M7LT 4XNXL 4OLVL 1T1YA 1EJ6A 3KW8A 2YUVA 3GSOA 4AL8H 2NX5E 4MD0A 3RQ3A 5I30H 1F58H 3FU7B 2CG9X 2HJFB 3WDJA 1IO4C 4F9PA 4AYFA 1O7DC 3P4OA 1T7VA 4W4NA 3ULUF 1C16A 4KKCC 4R4FH 5IJKC 4KI5C 3RJQB 3E3QC 1KB9J 2VISB 2WW8A 2BIPA 5BV7C 3LH2L 2A73A 2DQUL 3S4SB 2WLLA 4MNHA 2CO7A 4JG0H 3HBGA 3P54A 4QRQA 1ZXKA 1WP6A 2AK4E 2R83A 2D31B 4NS0A 3TBVA 1WBXA 1AGBB 5CEXA 1U8KA 5T3ZH 4K8RH 5IQ9A 4LDOB 3ZDWA 4MD5B 1PZ5B 4N0UE 5DVNA 2H0EA 2XZCL 1TVHA 2KH2B 5DJ6B 3U83A 4BZ1L 1PSKH 2R56L 1FE8L 3N41B 5GS0L 1C7TA 4U1NB 5EPMB 3CH8A 5C0FB 4LEXH 2R1XB 4L1TA 3CN3A 5F7HA 2VLMD 2J71A 1SDDB 4FQHA 5J13C 1DQDH 2EIMB 3QUXD 2J73A 1EZUA 2E7BA 2W9EL 4BQ9A 1I85C 1J1OH 1XB8A 4FX5A 4E5XB 2FD6H 4FTVB 4L4TE 3BO8A 2OYKA 4MNGA 3N04A 5B3JE 3OMIB 2WNXA 2HLFD 2VT0A 3T08A 3KGSA 4P9ML 1PL3A 5HDWA 4OGYL 3VSUA 3QUYA 3D4CA 2IAMB 1URLA 4JO1L 4WI0B 4QRRD 3CXDH 1TJIL 4R5VA 4U1GB 3FO1A 4FABH 4WF7A 2LR4A 3ARFB 1TQCC 3NFNA 1OWWA 1QSVA 2B1HL 4OSUL 4A7UA 3H54A 5JMOC 4ODUB 2C1PB 1IM3B 4B53A 2ZONA 3UTQA 3HKFA 2W95A 5EOCH 3L16A 5MHSE 1FL5A 4EI6A 2BJMH 5IOPB 2WC7A 4DZBB 4CW1A 1I8LC 3KPMB 1JF1B 3FN3A 4F7KA 1NPJA 4WUUA 5DVPA 1U2YA 3LB6C 3UTOA 3VI4B 1FWXA 5T1MA 3WL9B 1WFJA 4QJ4B 1UWEL 4OIAA 3UZEA 2OCJA 5DR5H 2UVEA 2NY5L 4I18A 1R3KB 2Z92A 4LDCA 5ANME 1NAML 3V0GA 1AQ8A 1BFVH 1KCRH 1KCSH 3OLGA 5ID1A 1JPEA 3GJEA 1KJMA 4J8RB 3SBWC 5JIQA 1P53A 1ID5I 3C12A 1Q9KB 3II3A 2WQVA 5JW4N 2OJEA 2X4NA 3U36B 2F18A 4MCZA 4P99A 3VD1A 3TEXA 1VPOH 1A3ZA 1PYWB 3QDAA 1ZLSL 4AMKL 2HN7B 3MRJA 3U1SH 3V0JA 2HRGA 4MX7A 3QEGH 2IPUG 4RVBA 3ESNA 4RWYL 3LKNA 2FJGA 3QXDA 4QJ5B 4GQPH 2QHLA 1BQKA 1GY2A 1QABA 5FR3A 5BPPA 1P4LB 2IWEA 2KZBA 2CR3A 3SKNA 1T7YA 5FUZH 4Y4FD 3WNOA 5AAPA 1NEPA 4GRLA 1E4XI 3O8XB 4AYID 4PW9A 3OV6A 4K8RC 3RWEA 1ODAA 2BP8B 1I9RH 2E59A 2PWDA 3UTTA 2BHFA 3TFKC 4P2AA 1B4TA 1RY7B 3VI3E 5CCJA 4WFEE 1JGVL 1GS6X 4XP6H 1LK3H 5SWSB 2JCCA 1XF3A 3M1BA 4S0TD 4D8PA 3INUH 2FLBT 4F7MB 5BS0B 5LGJA 4PYGA 2EDBA 3U30C 3FU3A 2YMTA 3I6GA 5EU4A 4CA4A 3MODH 4OF7A 4AJWA 3TNNB 5HI5C 1YUKB 3QH3A 4PRDA 1XSKA 4JFPA 2HUEA 4GJTB 5DK0A 2YBGA 2EDYA 5EN2B 2V7NB 5IFAH 4X6CF 3DIDA 3RVWD 3GSRB 2OTUB 3L5WA 5CU5A 1EGJL 3IKCB 5IVXB 3P69A 2JLLA 1MHPH 1W80A 1ZT1B 1RUKH 1LILA 1YYLL 3D4YA 3OJMB 4FLSA 4MXQD 4KX9A 1Q0YL 3RIFK 3WKML 2L7JA 5EEXA 3WD5H 2IPKA 3Q05A 3GO1L 4IBQA 1QNZL 4Y19D 4HAGA 5BV7L 3MOBH 1HFUA 1F18A 4ODXA 2VSCA 5J5EA 5DJDA 1K5NA 1VFAB 4W81A 4U2ZA 2Z8VC 2C9AA 3QJHB 5DGQA 4UQDA 1JRHH 1QA9B 3S5LA 2BNRD 2VW4A 4OFYD 5I0WA 4LOVA 4Y16C 4N8UA 4MJIE 3HR5B 2E9JA 4U2YA 4R97C 3MLSL 4G7YL 4U1IB 1BXUA 4IBTA 1G1KA 1EFQA 3KJ4B 3U2JA 2ZP8A 4DPRA 2HSIA 4X7CC 2W91A 4NDMA 3K71A 1WAAF 2CD0A 2WINB 4PJCB 4CMHB 3MZTA 1YMMA 2WSKA 3FFCB 3VFWA 3REWA 1QFWI 1U8PA 4TLSA 1YUHB 3LZLA 3QFGA 5FUCE 1XB6A 2Y5TA 3VH8G 1MCFA 4GQZA 3JWDL 4P2YA 3BKYH 5D93C 5F8RC 2DIBA 1V3KA 1CFNB 1I7ZB 3IAGC 1G7MB 4PJ9A 5HHXL 3N5AA 4Q0XH 3L45A 4WK4B 4B9KC 3WMSA 2XQBL 4XHJC 1NEUA 4KZDH 1H0DB 5HDLA 2J4WH 4DCQA 3Q43A 3VFNA 3OKOA 5FYKL 4A6YA 2ZCLH 2JIXA 4L0YA 4TRPL 1WUZA 1Y6KR 3ARBA 1S7XA 2J21A 5L2KB 3SPGA 2WLHA 4GEIA 1RMFL 3R1GL 2MJWA 1Y1UA 1J5DA 2VOTA 4KMLB 3W37A 1VA9A 4HULB 4ADIA 4FFWC 4FXKC 3IU3B 4L3EA 3ARDB 4JZNB 3RL1A 1NGYA 1HK6A 3BUYB 3O11A 1F13A 2IFFH 4KFZC 4RMQA 3MCLL 4LCWB 4B0MB 2BXZA 4Z3GA 4EN2A 3KR3L 1UJ3C 3S35X 3GSQA 1CU4H 2LFGA 4WGWB 5EC1B 5CP3H 3WHE0 4KKQA 5I30L 5GQBA 4AL8L 3T4YA 4OZHF 3LQZA 4NXKA 1F58L 3RPKA 3U9WA 5FC9A 1W72H 2VMJA 2DS4A 3F2LA 2N59A 1RP9A 4R4FL 5D96C 2L8AA 1B3JA 3ZSTA 4JHWH 3DETC 2AJZA 3P9MA 1WT5A 4FQIL 4N2EA 4LLMA 4Q9RL 3ZUNC 2QELA 2GJRA 2WWMD 1DTUA 2G2PA 4MLSA 5CD5C 5EC2A 4JG0L 1LLAA 3GMRA 4M1CC 4UF7C 4X5PA 4HQQH 1PD0A 2ED6A 3VRLE 3NJJA 4RIRB 4I0PD 3V95A 3TESA 1V3LA 2YD9A 3MZGB 3HN8A 4POZD 4XVUC 1A8ZA 1PZBA 5T3ZL 4K8RL 3EGSA 3H9ZA 5K9QI 1TUPA 5JHDA 5ACMA 1T20A 2SODB 4F9LA 1SOKA 4ZOCA 1PSKL 2YRZA 2ICWB 3HUJA 1ZLEA 4U1KA 2Q3AA 4LEXL 4QHMA 2W07B 3D2TA 1UZGA 5LCVH 5DHDA 1FJ1A 3ZGHA 1IJ9A 1DQDL 4WU5B 3ULVF 1G7PA 4XCFH 1J1OL 5D6DA 3ZKND 2A6JB 2FD6L 4A7VA 3LEXA 4WHTB 2DZEA 4KH9A 4XODA 4PJAB 1AQDA 1AGEA 4UNUA 3CG8A 3V4PB 3HC0B 3PDDA 4OCYH 3LEVH 1WZ1H 5C0BB 4GINA 1E5AA 3D85D 3DBXA 3QQ3A 5IB4B 1MFMA 3CXDL 4X7EC 4FABL 1MZYA 3IN2A 2LQRA 5LN8A 4JDEA 5HHOD 4YHMH 2NR6D 2HFEB 2WB1A 5EOCL 3OVUB 2Y7SA 2BJML 1ET7A 4XCEA 2BLFA 1OARH 4WNJA 1T83C 2D73A 4OBSA 4YS4A 2XDHA 3V5KB 2BDNH 3VI3A 3FTWA 4RAVB 3WLBB 4NJAH 3FS9A 1OE1A 4L1BA 4PJHB 3NUKA 3O2DA 5AW2B 1HKLL 4FQXC 4NI3A 4FF9A 3CFMA 2YD8A 1UXLA 5KSUA 4NQSB 1U8MB 4E36A 4GKLA 3EZJB 4CC0A 3UBXG 5DR5L 4Z0XB 1BFVL 1KCSL 1KCRL 3FN9A 3QIBC 5DK2B 3FAXA 4ICWA 2F54E 3RNKB 2WN2A 5ICZB 3OSVA 2QBWA 4P4KB 5DTFA 3VXTB 3LNIA 4PLOB 1AGCA 2X0UA 3PG2A 4NFBA 3NYKA 4O02B 3TZVD 5JIIA 1VPOL 4CBZA 3BLBA 5E6SB 3U1SL 2KHAA 5DHVA 3TO4A 1A14H 2YHGA 7TAAA 2BZ7A 3J07A 5B1JC 3QEGL 1ZLUK 1HL5A 1HHKA 2Y1AA 3L3OC 3WY2A 2DMKA 3PWNA 4UDUB 3IXAB 1ZT4B 2A83A 3STLB 2B4CC 4JZOA 4EI5B 4UMGA 1TLKA 5FUZL 4AQOA 1CE1H 2JFCA 2R0WH 1JCVA 3QJRB 1QTYT 4KQ3H 4ACPA 1R3LA 2IMNA 3NCFB 1QQDA 1I9RL 3L2NA 4Z7OF 4LNRB 2JI3A 1MHHA 3ARZA 2DIJA 3OF6D 4XP6L 1LK3L 5BZWA 3LY6A 3Q9PA 4AENA 3HAEB 4PRAB 4Y4KB 3INUL 4LAQH 1XF2A 3MLWH 5I6LA 2XQYK 3GIZH 3RTQD 4QRBA 4N5ED 5F7DA 2M2DA 2XX1A 2Y7LA 5F7BA 4YO0A 2J2ZB 2FEDC 2XVLA 1F4YH 3SO3C 4OCSH 4MNQB 3PHOB 1HC1A 2GYSA 5IFAL 4JDVB 4IKNA 2ENYA 3RWCA 4NQXA 3TS8A 5IF0A 2GCYA 3OPZH 1VGKA 5AAWC 5ESQB 4IOSA 5DFTA 2CSPA 3QG7H 1MHPL 4O58H 5J1AA 2YPKA 1RUKL 3LXCA 4WWKA 2APBA 3BP7B 4H8WH 3DDFA 3WD5L 4XBGB 3HG3A 5JW5A 4AQ8A 2X87A 3MOBL 2JKRM 1FFOA 1KJ2H 4XPFH 4JFFE 1SM3H 2AV1B 4GXFA 3I6SA 1YO4A 5CM1A 5F0LB 2CCLA 1X9QA 1MVFA 4QF1B 5CBAB 3VWKC 5C8JB 4IQHA 2J8UB 2CLRA 3A67H 1JRHL 1QOKA 4Z7AA 2WKOF 3JTTA 2AQ1A 4NB7A 5B3NA 2YUWA 4XNMA 3GNML 1G9NC 3CFQA 2MCMA 2IAAC 1SUHA 1N8ZA 3LV3B 3KXFB 1PNDA 3MFGB 4L29A 3BPNC 1R5WA 5J3HD 2QGEA 1OB0A 2JTYA 2H2PD 3IRCA 4IYKA 4PCYA 3KS0J 1LWHA 3UPRB 3QI9A 4ZX4A 2IANB 3OAUH 4Q56A 3QULA 3V2AR 2UUDK 4JKNA 2WYTA 1CFVH 1M53A 4X6FB 5EIIG 1OB1A 2DWSA 1W15A 3QO1A 2RTTA 4BQCA 3CSYB 1J8HA 4JRXB 3DGDA 3WYRA 5HSFA 2V5MA 3B3IA 3BAIA 4HSQA 3PRZA 1FVDB 4H26A 4LSPH 3DGGA 3NZ8B 3GUTA 4HC1A 4PGCA 4YHZH 1LGVA 5C70A 3ZKXC 3U25A 4DVBA 1FIEA 1MWAH 3BZFB 4Q0XL 1D6EA 3W0WB 1NMCB 1I3UA 3KPSD 1NBYB 2C3XA 2WUBH 4KZDL 2J4WL 3HEIB 3O3EA 3FOMA 1A9BA 3QZWA 2IDQA 2NY6D 4Z7VF 4AXWB 2ZCLL 3EJZD 4Q14A 2PCPA 5E8PB 5J4MA 1S9KC 3UO1H 1KJ3H 4HKXA 2VDRB 4OY9A 1RXLA 1ZHNB 1YN6B 2BIQA 5IESH 2C3VA 4KUCF 4OVVA 3K3QA 3VXPB 5KSBF 3R0MA 2XN9B 1ROWA 4A2HA 4Y1AB 3CH1A 1PX4A 1FZMA 1Q90A 2IFFL 2QZ5A 4H8VA 3ZKMD 4YSAA 5EIIA 2VZTA 2XN2A 1AE6H 2BSSB 1I1AC 3HZYA 4NSKB 1ZE3H 2WXPA 2PXYD 2R4SH 1F3DH 3AM8C 4U7KA 1CU4L 1N2RB 3D39B 2GFBB 1KIUA 2WBKA 4JRWA 2H1PH 5T1DH 1WZMA 1E2VA 1W72L 3JYCA 2RR3A 3GRWH 2YRPA 4IRSC 1M6OB 3C6LC 4DK3A 2IPTH 4OD1H 1KYFA 3TF7C 1M05B 3MJ7A 4JHWL 3FRUB 3ZRSA 3ZE1E 3NRQA 3VM7A 3BEWA 4HG4K 3SE8H 2GT9A 1XEUA 2VLLA 3VFMB 2B3RA 2G2NA 3ATDA 2PF6A 5J6HB 4PGBB 4N2IA 4HQQL 2IG2H 4Q52A 1GGUA 2YGOA 3ZY7A 4CU7A 1OCOB 4PRPE 5CJBA 5IROC 5HYSB 1PAMA 3H9SD 4DGVH 5IJDC 5IK3B 2GUOB 5D7JD 1AO7D 3WHE1 1Q1JL 2VWEE 4H2CA 3ET9F 2AABH 3GINA 4BH8A 1N5AA 2VIRA 1SBBA 5DWPA 4NO2A 1SYVB 1XXDC 4HWZB 2A6DA 4RMVA 3I3DA 2C5DC 3T1FA 4G59C 4F8TA 5ACZA 4E41E 1QLEH 1ZCRA 1MI5B 2WNWA 3DV4A 4X6DF 5GS2H 5LCVL 3ZE0F 5E9DD 4IEFB 4XCFL 3F7VB 1PBYA 2ZOLA 1BF5A 3HZVB 1NFDF 3V5HB 5E8NB 2HVBA 3V0HA 2WLYA 4OCYL 3LEVL 1WZ1L 3FTYA 3UTSE 3CFKA 1CT8B 4KVPA 4RMSA 1PDKA 1XD1A 3MV8B 3MV7E 5FYJD 1SY6A 3BZ5A 1ICTA 2YPLB 1OCCB 3BYYA 5F9WC 3WNLA 4ZTOL 5TDOB 3GXNA 4YHML 4KV5F 3WIAA 3VFGH 4GQRA 4D9QE 3LNGA 4IRZA 2A38A 3CSTA 2P5EE 1AR1C 5GGTH 3EBHA 4EKXA 2HZHA 2BDNL 4DVRH 4NJAL 3OXSB 3MA9H 4NLAA 5IBTH 3EOAA 1JDDA 4DGIH 1YG9A 2VLKB 4P9HH 2AXJA 1R19A 3BOVA 5C0GA 1ZE3C 3P4LA 3V9CA 4HUCA 3SGDH 1BIIA 1J9QA 4LPTA 4NNYA 1BAWA 1BOGB 4P2QA 2FJSA 1M7XA 1OTTC 4U1SA 4MRBA 4W9EC 3SBPA 2DTSA 3JV4B 1TEFA 1D9KA 1XF4B 4JM0A 1A14L 3PE9A 4NKQB 3WTXA 1SDAB 2EDOA 4BDVB 2FO1A 1WBZA 2EE0A 3FQWB 3BVNA 4R6UA 4LPVA 4ANVA 5FV1L 4K73A 4TUJA 2MHAB 2I9TA 5PAZA 3FB7A 1B0WA 1IGFH 4AVIA 2X4RA 2GBUA 1CE1L 3PPEA 2R0WL 1CI5A 5TGBA 4KQ3L 3HJ0A 3RWGA 1YEGH 4U3SA 2AKRA 3HLAB 2DAVA 3T0ED 3P02A 4TNWK 3RZCA 1JXGA 4H4NA 4BFBD 4S1DC 5FYLE 2Z1KA 2WBJA 2DYPA 4F8QA 4LAQL 3MLWL 3GIZL 4RCAA 4Q58C 3ARWA 4PG9B 4PRNB 3U0WH 1IAIH 4YIQB 1KPRB 3VXMA 2HJLB 1IQDB 1YVLA 1F4YL 2FL5A 4OCSL 2J6WA 2X2JA 4OLWH 1VFOA 3I6KA 1FN4A 5D9SA 4G8GB 3W39B 1U3JA 2QVFB 1F02I 2MQ0A 43C9A 2O30A 3OPZL 3T6VA 1I7TA 4EVNB 2P7TA 1T3FA 4TVPD 1PD6A 3OKNA 3QG7L 4L37B 2H0PA 3LKRA 4O58L 5IMKB 3SOTA 1SHWA 2F53B 1S5HA 4R7NB 1IZKA 3QAZB 4H8WL 2BK8A 3VMNA 1EBPA 4KKBD 2H3NB 2ZUQC 2VLJD 4HT1H 2XVKA 5ESAA 1KJ2L 4XPFL 1SM3L 5AB0A 4YWGH 4YL4A 3MA7B 2YJQA 4P46A 4Y88A 4JM2D 3A67L 1KEML 1SLXA 4YAQB 1QWNA 3BP6B 3F12B 3LRSB 1FI8C 5J8OA 4F9PC 4P9HC 3O81A 3MREB 4PI2A 5KBPA 3IE4A 2YUXA 2MTAA 3I6LE 4XBPB 1I1RA 4PJIE 1VHPA 3JVFC 4WI7A 1QSEB 3GJFK 3M6DA 1KGWA 3OAUL 5GIRA 5DHEA 1M71B 4I48B 1CFVL 1C1EH 3ILQD 1ZSHA 1NAKH 4DAGH 2OZNA 4JRFA 1L9PA 2A3TA 1RZFH 3IBOA 1H19A 2J1XA 1XF5B 3MNWB 2LLLA 4LSPL 5E8EA 1WISA 1KJVA 5JIKA 4YHZL 3WIFA 2XWDA 1QRNA 1BVNP 1U2CA 3E8VA 2FECL 1MWAL 2DQFA 4U3HA 4ZFOA 4XZ4A 4WSGA 2OP4H 4WFGD 1A3QA 4WI6A 4H40A 4ELKB 3FW6A 4G7SB 2WUBL 3LXBA 5DS2A 4XO4A 3ZXAC 5J7CC 4LHUB 5I5RA 2QQLH 5F6IB 4LEEA 2C9VA 4XX1E 1A9EA 2XACC 4EUPG 4U6YB 4PRPA 3BKCH 1RPKA 2COQA 1KJ3L 5DZJA 4F57H 4QAWA 3KM2A 5IESL 3OKMB 4WHYH 3FPXA 3QUYC 2HJKA 4XNBA 5B8CB 5K33A 2Z91A 2Y2WA 5CIPA 2A6KA 4X7DC 1MQKH 1IV8A 3PAYA 3L2MA 1NFIB 2XA3A 3VXRE 4KZCA 4XH2A 3V6OE 2OMWB 1AE6L 5ICXB 1S4IA 4P5MB 1HS6A 2FZ3B 2R4SL 4Z77B 2RAMA 4RZCB 4UUJA 1M57B 3T6WA 3WY4A 1XH0A 4HETA 4ABQA 4FZEH 4MJ5A 4LVNC 4KRNA 2H1PL 5T1DL 3RDTB 3QNZA 4FN0A 3GRWL 1X4YA 3UTSA 3OHXA 3IBEA 2IPTL 4YPGB 4OD1L 5FGRA 2WLIB 4GG6F 1IEAB 2YAFA 2GJ6B 4GI8A 1ECYA 3E6FB 5EZPA 5CKAA 1I1YB 2XXMB 3SE8L 4EUPA 3UZEC 2G60H 1EUTA 4I18C 5JHMA 4YDNA 3B9DA 3BUDA 3EJYC 4RWHA 3SQBA 3NZUA 5CLYA 4H7VA 4J3WA 4X6BA 2IG2L 4WU7A 1LE9A 3S0PA 3OKEA 3NJMA 4ZAKB 2P5EA 4DGVL 2J5LB 3DOIA 5ISZD 3KPTA 6PCYA 1BVNT 2AABL 2BIIA 2QADB 5C08E 2NRDA 3FH7A 3H3KA 4PLKC 3T0AA 1U21A 1HCYA 1OPGH 2YAOA 3RHWK 5I1AA 4PWIA 2H26A 4N8VG 4NKMB 1QLEL 5I1DA 2OK0H 4KXZH 1FYTE 1K6QH 1ZIBA 2YD4A 4KXAA 5HYJE 3RLSA 4DP2X 3SDCB 3BH4A 2OMTB 1F1DA 4GRLC 5A2FA 4A6YH 1RURH 1FIGH 3B6SA 4NENA 5F3BB 3T09A 1N8OE 1NFKA 2QDWA 3APFA 3RY4A 3OJ2C 4XO9A 4YBLB 4P59H 3O0RH 4X50A 1S7VA 4QRSA 4D9LH 3N1GC 3L9YA 3THMH 4G8IB 3ML8A 2GY7B 4BH7A 2NNFA 2A77H 2G75A 4JPSA 2ZICA 3OAWA 3P2BA 1LE5A 3VFGL 3WU1A 1KCBA 2F74B 5IB1B 3CFTA 5GGTL 2O61B 4HV8A 1ZK5A 3B2VL 4OUUA 5EU7E 2BSEA 2AMGA 2PYEB 4ZMPA 1ED3A 4WTWA 4DVRL 3T8XA 3RGVB 4GW4B 1OQOA 5DJCB 3MA9L 5IBTL 4ZJ9A 3QQNA 4N8VA 4DGIL 2FR4A 4P9HL 1M7UA 3QPXH 2DL2A 4PD4J 3WJJA 2H0JA 1ZGLB 3AWFA 4D3CH 1SVCP 1J0JA 1C5BH 4R5XA 3ENEA 3CHXA 3FZUD 3KGRA 4Z0BH 1KCWA 2LE9A 1I8KB 4XOCA 4L9LA 5ETUB 3KPOA 1SLWA 1U95A 4JEGB 4DQOH 2KDGA 5D1QE 5IGXH 1ZAGA 5JZ7C 3VNZA 4HIJA 5BUAA 3SDXA 3TA3D 2FVNA 5D1XA 1E8XA 1XGRB 1KN2H 2VLRE 3WN5A 2OJ1A 2NUTA 5KJ7E 2EXTA 2WKLA 3CMOH 5T1KD 4ZW3A 5IBUB 4DPBX 3QIUA 4WI2A 1EFXB 4M61A 3SKOA 4FCHA 4I2XE 4DKEH 3BQUD 3TCLB 3MQIA 3UYPB 1IGFL 3D18B 1ZTXE 4X4ZA 4G6AD 4JPQA 5FO7A 1BM3H 5FGCB 1N18A 1VEMA 1CFQA 3NIFE 3DHPA 4WO4D 3GMQA 3TIDB 2Y06L 5IEHB 1YEGL 4R7DA 4FFVC 4DGWC 1FZKB 3WTSA 3SQRA 3ATBA 4ZI8A 3R8BB 3UDWC 1KNOA 4O51B 3MU3A 4IU2A 4X7TB 4YXKH 4DP4X 4NQCD 3LS5L 3VB9A 3P4MA 4PJ9C 1JGEA 4KO9A 4JFYA 1TITA 4NKOB 3VCLB 3AG1B 1TQBB 3U0WL 1IAIL 3NIGE 2OR7A 1PKQE 4N68A 4XMPH 4YEEA 3LZPA 3UABA 4C4UA 3OBAA 1J9RA 1E90A 4J4PD 4JPWH 1K8IB 3ARBC 3OJDB 2APXA 3VSVA 4OLWL 3MBXH 1XR9A 3CDGB 2HYMA 3S37X 4IBYA 3VXUB 3D52A 2AZUA 4BFIB 2N1KA 1XIWB 3OG6B 2VR3A 3TURA 1RAMA 3SYQA 3U9UA 3WFDH 1MHEA 5J9PB 1AYOA 1HDMB 5DZPA 2O6EA 1BZEA 3FO2A 1XCTB 3HE7A 1BMZA 2ZX7A 1KZYA 3O2DH 4HPYH 2XJKA 1DQQA 3HE6A 2Y7QB 3E38A 3L3IA 3QEHA 4HT1L 1KTKE 4UT6A 3EFFA 1RZ7H 4NRZA 4MAYB 5DJ8B 3QFJB 4YWGL 1A1OA 4CVZB 4OZIB 4KJWD 2FSEB 2NY1B 2ZZUT 4FQQB 1SJEB 4HJJH 3HIZA 4BHUA 2IDFA 1S9WA 3RVTC 3VX1A 1B6UA 3M17B 2YBRA 1XD0A 2HTLC 3BEVB 4G5ZL 4D7PA 3EFOA 4G1EB 5EUOE 5DHVH 5FF6B 1E27B 4QNPF 5KVFE 4XAKE 1WT5C 4FYSA 2J12B 2GITB 5H35A 3HR6A 1EIBA 3RBSA 3EBGA 3O6FB 4KZ0A 4WTXA 1T5XB 4OD2A 2J43A 4WFFD 4KVCH 4L1LA 1C1EL 4WGKA 4QO1B 1MSPA 1TEYA 4J39A 1NAKL 4DAGL 3WMQA 1S7QA 1D5BA 1OGSA 1RZFL 1JGUH 2I25N 3T5WA 3VD5A 4G6MH 4XP1H 1IAKB 3NJIA 5I0XA 1Y0LA 4F9LC 1IBBA 5T3XD 2BY1A 1YNTB 3EIFA 5C0AB 1CB4A 3BH8B 4B9ZA 4ODBD 1A9VA 1KFGA 1F2QA 1WCBB 3DX7B 2OP4L 2O6FA 3MLYH 1FNAA 3FO0H 3QUKB 4DTGH 1JCKA 4H44C 1JUFB 3NJGA 1O6SB 2QQLL 5CUSH 2BP5M 3D2UA 5D6DC 3VFTA 2BVOB 1AP2A 1CD8A 2TRYA 3RKDD 1NANH 5L8KB 1KYUA 2QVMA 2WNKA 3BKCL 3FQUB 1DDHA 2V5YA 5D7LA 4F57L 2A0LC 3CVCA 4NP9A 1N0LB 3W9DA 5DEFB 1P1ZB 4HBQA 4Y0GA 5BRZE 5C08A 2GIXA 3RJDA 5I19H 4R4NC 4PH8A 1MQKL 4M7KH 1OSZB 1XZ0B 5CEZE 5FECB 3QIWD 2FJHA 4HS3A 1SEBB 3OR7A 1FYTA 1QZ1A 1ILSA 2NY0B 3FBQA 4XE0A 4YSSA 3WNIA 3PQYD 1ZMYA 4MFHA 1UWGH 5F72S 5I66B 2B2XH 3AT0A 1AHKA 4FZEL 1HYSD 3FB8B 3QORB 2AK4D 4E9SA 1MDTA 3NCBB 3PV7A 4PJEE 3ARGB 3CVBA 5KS9F 1B6DA 2BY0A 4E5XG 2K45A 3N55A 4AE1A 3FU7A 4N20A 3FKUS 2WGNB 2PCFB 3W57A 1RV6X 1KF9B 2AXWA 2YAPA 4IKLA 4Y2DB 1A2YB 1DCEA 3GGWB 2G60L 2VISA 2WGXA 3QWOB 2OLDA 4JANB 3S4SA 1Q9WB 4GLRH 1CFTB 5KVGH 2EKSB 5AB9A 4OBRA 2D31A 4GMSH 5DRWB 1XB3A 4L4TD 3MRDB 3KLDA 1T5KA 1AGBA 2OMUB 4D7BA 3FXIC 1URZA 4C58B 1G6VK 1II4E 1RJZB 4HC1H 5C6WH 2F19H 3QXUA 4MD5A 1PZ5A 1OPGL 1FLTX 2AQ2A 4HYTB 2Y7OA 2PABA 5DJ6A 4JPIB 2PETA 2OK0L 2UY6B 4HEPA 4U1NA 1K6QL 2VN7A 5EPMA 3RUGF 1VSCA 4YXLH 3WKNA 1SDDA 2IOIA 2XN0A 4R2GC 1RURL 4RFEB 1FIGL 4A6YL 4E5XA 5C0DB 2EDRA 4FTVA 5MHSD 4A2EA 1S7WB 1QD0A 3G04A 4I85A 1BMWA 4N1EA 3MBEB 1MLBB 3DXAB 4P59L 3O0RL 1NLBH 4M6NH 4QUOA 4D9LL 4QLWA 2ADFH 4LU5H 3CU1A 4WI0A 3THML 4U1MA 2A77L 4I2XA 3ARFA 2WXMA 1NIBA 4ODUA 2JB6B 4PRIE 3B4NA 2C1PA 4M6OH 1H6EA 3KG5A 5JOEA 1BQ5A 1H15A 2DD8H 2F8OA 3JWOH 5FUCC 5IOPA 3EGDB 4QXWA 3RKPA 4DZBA 2W9DH 5LDSA 3KPMA 3AAZB 4OQTA 4EOWH 2DQMA 2JKWA 4FHBD 2QTVA 1N70A 3EYQD 3QPXL 4WWKC 5ENWB 2Y2YA 4D3CL 1NIDA 3VI4A 1C5BL 4AQ8C 4MXVF 4F7EB 1NCOA 2I07A 5KVEE 4Z0BL 3IDNB 1R3KA 3MCKB 3QEQD 4ZPTA 3UG4A 2W92A 3QR1A 2LAAA 1F45A 1KBWA 3QDME 4DQOL 2AQTA 4J8RA 4XOEA 4Y9EA 3OZLA 3S2CA 5IGXL 2P45B 3G5WA 1J8RA 1Q9KA 2E74C 4OGZA 1ZWIA 4DUXA 3U36A 5KYWB 1KN2L 3ZYOA 4D0CB 4ZUUB 3VGBA 1GTNA 2HN7A 3C8HA 2P5WB 2NZ1A 3B9VA 3BHBB 4OAWB 1VAHA 3CMOL 2GW5A 4FJZA 4HS8H 4U1JB 3E2HB 4WRLA 1ZHBB 5E1HB 5BXFB 3ZW3A 5GSVB 3GS4A 5FGSA 3QI9C 5CJ5A 2MNWA 4DKEL 2F8XC 5KAQF 1BZDA 3TL5A 1ES0B 1WLHA 1EVTC 4LVHC 1BM3L 4LP4A 2UVFA 1P4LA 3L2LA 3QA3B 2Z1PA 4Q9CA 5GS0D 4KXCA 2OBGA 3EBAA 1HOEA 3CE1A 1TR7A 1KB5H 3O8XA 3I9AA 4HGWB 1QTPA 4I3RH 2PTVA 3GM8A 3QZPA 4Z7WF 2BP8A 5I6XB 4PJFB 1JPTH 1U8OB 3KDPB 2DWDB 4BJLA 4N9GB 4YXKL 3RVVC 5EUOA 5MEQB 2I7SA 2GIYA 2HLAB 3QK0A 3VFPA 4AMWA 2KBGA 5AKVA 5SWSA 3BQVA 4HD5A 3FHQA 5DHYB 3UTPD 4XI5C 1G84A 2EDJA 3MUJA 4F7MA 2APTA 2JKNA 1J87A 5BS0A 4XMPL 3II2A 3BRGC 5IB2A 5CZVH 2W1NA 1HHIB 2J1KA 4A7GA 1QNIA 5FO9B 1ZD6A 3G5VA 3VRIB 4IRZH 5E8OB 3IRZA 5DLLA 5EN2A 3WFDL 3TBTB 2EVGA 2V7NA 3OZ9H 4ZS6C 4OV6F 3GSRA 2OTUA 2UZPA 3O2DL 4HLZH 3IKCA 1R24B 3POCA 5IVXA 2FLRT 2WO2B 5HI4D 4NQED 1RZ7L 3HG1B 4GBXD 4TPRH 4AJVA 2J25A 5HHPA 1VFAA 1QUNB 3K2IA 5L2JB 1A02N 4RGNE 3W38A 3CMGA 2EKJA 5JIHA 2X38A 3QJHA 1NUDA 3HI6H 5A6MA 4JFEB 3GHEH 1U33A 5GZND 5BRZA 4ZTEA 1AZCA 2DKUA 4XN2A 1G4RA 3HR5A 1HNGA 1JTPA 4U1IA 4ZPVB 1L9MA 2DW5A 5CZXD 1DVFA 3E9UA 2X89A 2DYSB 4KVCL 5IEKA 4AM0B 4B96A 5DEGB 2E3VA 3SYAA 3TO2A 4EN3D 2WXHA 3RA7H 3UBHA 2WINA 3EO1B 4P5TB 4PJCA 2B15A 4ZMZA 5GGSY 4HH8A 1JGUL 1KACB 1DQLH 3A4AA 4XP1L 2AJSH 4N90E 4LVEA 3RPIB 5C97A 1BQSA 1JK9A 2A1WH 3M1CA 1I7ZA 2MTPA 1CTMA 2ZWKA 5JMRA 4L8DB 3MLYL 1G7MA 4F27A 2OSXA 3L9RA 1M1XB 3DJZA 2R23B 1TZIB 5CUSL 4Y4FB 1H0DA 4OJCA 4L1DA 4FYRA 3IJYB 2NQDA 1VZHA 4IJ3B 2OSLB 4OB5H 3ZR5A 5L2KA 1A3RH 3ZGIA 3NRPA 4ES9A 1TNMA 4ZSOE 2ERJC 1AYRA 4G71B 1FFRA 6TAAA 5I19L 2RFXA 5CBEB 4M7KL 1E5ZA 3KLHD 4W9ZA 2G3NA 1H8LA 1JNJA 3CHRA 3IU3A 4JZNA 4YZFE 3QHTC 3BUYA 2IGFH 4LCWA 1BYPA 3SYPA 1UWGL 3UAAA 4B7IA 2B2XL 5EU5A 1NBQA 4BFOA 5J13B 1T7XA 5AAMA 3KDMB 1U8NA 4LCYB 5EC1A 4RX4D 3WKQA 4ETQB 3CDCA 3FN0H 4P23C 2ARJB 5AYTA 1X5YA 5AWNH 3IN0A 3F00A 3OAYK 5F7UA 2YQ2A 3CN1A 3P9LB 3MKGA 1NCHA 5D5ME 3I85A 2VSMB 3DIFB 2LU3A 3SYOA 5EZIH 4AQ1B 1UH3A 4RGOH 1A66A 1NWOA 1WFOA 3WE6B 4PRIA 2EH8H 3BYTA 2WCSA 3R18A 5KVGL 2F8VA 3R7RA 3T3MB 4GMSL 4NN7C 5DSCB 4RIRA 4X9GA 4JO4H 4XMUA 1MW2A 3T3PF 1BGXL 2BNRB 4B95C 1D9KC 1OSPH 1DVQA 1I7UA 2X09A 2CDGA 4N2GA 4HC1L 3FQTB 2F19L 1AANA 5FCUH 4C56E 2VH5H 4JG1L 2X1PA 2ICWA 4UOQA 1OP5K 5CMAB 2QR0B 3VG0H 5HHMD 2QGCA 2W07A 3WNMA 4HW6A 4YXLL