1ETZB

The three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
228
Chain Sequence
b'QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGEGLEWLADIWWNDKKYYNPSLKSRLTVSKDTSSNQVFLKITSVDTSDTATYHCARRTFSYYYGSSFYYFDNWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB NC10.14 - LIGHT CHAIN
publication title The three-dimensional structure of a complex of a murine Fab (NC10. 14) with a potent sweetener (NC174): an illustration of structural diversity in antigen recognition by immunoglobulins.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 228
sequence length 228
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1etzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1etzB01
2OM5A 1KC5L 4I13B 3BI9X 3BDXA 5F1IB 1GGIL 3DX9B 5DJAB 3O3DB 3ARTA 4YIQB 3F12A 1FC1A 4RGNB 5KN5A 2GQHA 1CLOL 2LV4A 5IMMB 1EJ6A 3E3QC 2P5WE 5L7XL 4PJHE 1NMAH 3QEUA 3MR9B 3TCXA 1KYOJ 1T20A 4MNGB 4P0DA 4FMFA 3W2DH 5HYEA 1MFNA 4W6WB 2M26A 5TE6L 3CX5J 1CXKA 1JHTA 4LSUL 3SDYL 3VE0A 3ULUH 1F6AA 1AGBB 1MPAH 4HAFA 4G6FB 4GMTH 1CT8A 5FGBC 5C9JB 3LS4L 2A1WL 4WFEE 3VA2C 3KLSA 1T2QL 3SJVE 1QTYT 1IBGH 25C8L 1T1YB 1FAKT 1G9NL 3PE9A 1FVDB 4X7TB 4JO3H 4TVPL 3DIFA 4ALAL 1HQ4B 5AG9A 4NQEE 2X4UB 5EA0H 3VXRD 1R5VA 4XAWH 2GJ6D 4OF7A 4G6AC 3SQBA 5A3IC 4G43B 1PYWB 2ZUXA 1PX4A 4R4FH 5JIKA 3TA3D 5C0BB 3AS3A 5BV7H 4XNXL 4QOKE 5E6IB 4FQXD 1MHEA 1K4CB 1QLRA 4XP9L 3RIFK 2ED8A 3RGVB 3SGEH 4ZUUB 1GXEA 3D85D 3KWWB 2OTWA 3OZ9H 1HHGB 1G7PA 4U1MB 1IC5H 3IU3B 1MCEA 1FDLH 3IAQA 2R2BA 4NHUA 4LLVB 2BY1A 4S2SB 3VI4E 1MCHA 4UTBH 5IJVA 1R5IA 1IGYA 5C0DA 4KZEL 4OLYL 4CDGC 4JEGB 1KCRH 4GRLD 2D9CA 3O45B 3IDMA 4FQJH 3OR7A 5J12B 5A16B 3CXHK 2HFFB 1HQRA 2OMBA 3U0WH 5HI5C 4XBGB 1NCUA 1QQDA 5FHBL 3B9KB 4AJ0A 4YUEH 3KAAA 1L9MA 1UJ3C 1YPZA 4P46B 1O7VA 3TVMB 3ABZA 3WHE1 3RWEB 4V2BA 4FXKA 1QKZH 1HEZA 4LBEB 4RWYL 5IOPB 2PETA 3Q0HA 3C9NB 3DARA 3GKWL 4JANB 5AZ2H 4FQIH 3QUZC 4G8FB 1XF5A 3WNNA 1CE1H 1TQBB 1EA9C 3GRWH 1Z0MA 5FK9A 5E8NB 3KXFB 4MQXD 4M00A 5H94A 3M17B 1CQYA 5EZJB 4OZ4A 3VXRA 5CIPB 2GJ6A 5HHVH 1IZJA 1HILA 5EIIA 4ZFOA 4CU6A 1KN4H 3WNPA 2VAAA 3IGAB 2A9ML 5GGQL 4MJ4A 4QYOB 3G5VA 4X6DA 2G2RA 5J7CC 3LS5H 3KPSE 4QEGA 1FRGH 3PP3K 3UZVB 1ZOXA 4XTRC 1ZLUK 3D85A 4JO1H 4PP1C 4Z8FH 5ADOH 3X3GH 4K8RC 3KYKH 1N64L 4HWEL 5E03A 2AABL 2HG5A 2VZOA 4BQ6A 3GIVB 3WFEH 1QZ1A 1UWXK 4XAKE 3MLWH 5D7IF 3T4YB 4EI6A 1KIQA 4PJ5E 5I15L 4K3JH 1QRNB 2YEZB 4GRLA 4TSCL 4ZDHB 5E7FA 4RA3A 2AK1H 4FNLL 1RSFA 5CJOL 2AXJA 3UPAA 1CG9A 5DMIH 4NCC1 4OGYL 2XKNB 1MCRA 1VPOL 1LNUA 1R5WA 5ALCL 1A7OL 2VXVL 1B9ZA 4PJ9C 5HDBF 5B4MC 1F4WH 3TLRA 4BH8A 2R2HA 4OFPA 5B39G 1JZ8A 4ZFZA 1EO8L 2X9YA 2RGSA 5DMGC 1JPGA 2BXYA 2AXFA 3SGJC 3ULVD 3RIAK 3HPJB 3IJSB 5JQ6L 1FNAA 4LLUB 3B2VL 4NO2A 1JWUA 1XCTB 3ALXA 5K9QG 4LMQE 2A9NL 2HRPH 2YD4A 4DVRH 2DQIH 4K8RH 4K94C 3TBTB 4QRQA 1S7SB 1AJ7L 1CGVA 3B5TA 1WWCA 3JTSA 4R9HA 2NY4B 2A6KA 4WGWB 3FQNA 1P1ZA 1LP9B 1J11A 1I3RA 3D6GA 3BN9C 4C56D 5HHPB 1T7ZA 4RDQF 3PP3H 3ULSA 2BC4B 2LTQB 5F6HJ 1KJ2L 1ZLUH 4MMZC 5FGRA 3OKLA 4HKJA 3LN5A 5D7JD 1CFNA 5H37H 1KTLB 3RNKB 3HA0A 2ARJA 3DURA 1PJ9A 4HKXB 3LKNA 4LSTL 3BGAA 5CUSL 5FYLD 3A6BH 3MLYL 2P8LA 1UWXH 1XR9B 4OBRA 3BZ4A 2XQYG 1BD2A 4NZUH 4NGHL 5FKAA 1XF4B 4W6XB 3O3BB 1EUTA 2N56A 1FPTH 4PRDB 4XC3H 2FGWL 3P11L 3JVGA 4JCLA 4ODBD 5IFJA 1NFKA 3NCYS 1NUNB 3PJSB 4HS6A 3GJFB 1JNLH 3GI8H 1CD8A 1WC7A 2NCMA 3X14B 3RRQA 1SJHB 3PL6B 2PO6A 2F8OA 2IG2L 3UJJL 5DF0A 2WNGA 4A2MA 4K94H 5D1ZB 4XCFH 1BQLH 1T7XA 1JGUL 4LCYA 5GS1C 2HKFL 3HMXL 3OL2A 1Q0YH 4NP4H 1DZBA 2Q7NA 2OI9B 3GBLA 3O6FD 4XNZB 5DFVC 2WP3O 4K71C 5EDXA 5D2LA 4K07A 2JK5A 2ZNXA 4J1UB 3RWGB 3DVNB 4V1DE 5CEXA 4LLWA 2X40A 1E28A 2D9QB 5J6HB 5TPWL 2VWEC 1P84K 3H3BC 5LAXA 5HJ3A 1XR8B 5BS0B 1BVKB 4KPHL 2BVTA 3RZCD 1NL0H 3BWAB 3N1FC 5LXGH 2DKUA 3LQAC 4C56A 3MJ7B 2CXGA 2R8SL 5IT2H 3S7GA 1DBKH 3WDHA 3GO1L 3P4NA 4M7ZB 1QR1A 3GSNB 2JJSC 3SDXF 4QT5A 4TULL 3FB5B 5D7JA 2Y9RT 3QH3B 1IAIM 2B1AH 2DQCH 1IEBB 4R90H 5DC9B 2YD6A 4X4MA 2AQ3A 2KUTA 2VXSH 2NR6C 4KXZH 2J6EH 5F88A 2WBKA 1T6VN 5DQDH 2EDQA 3VRIA 1OD7A 2EKJA 1IFHH 1IGCH 1OGAA 4Y1AE 5E4EB 1A4JA 4UDTA 4OD1L 5BO1H 3O3UN 3AROA 4HDIA 4Y5XA 2GSGA 4JKWA 3SKUD 5F9DC 3I02A 1NMAL 3F12B 2P7TA 4X98B 1F4AA 3B2UC 3EIFA 5KAQG 5KN5B 5MEND 4RX4D 5C92A 1YUHA 3VGAC 1BFOA 4OJFH 1BFTA 4TSAL 2Y5EA 1T20B 3HE7C 4QHMB 4ERSH 4HH8A 4HKZB 5D7LE 2NY6D 2APWA 3MOAH 1MPAL 4GMTL 2KL6A 5CILH 2E3VA 3SBWC 4NQCE 1NGWA 1FE8H 3LQAH 3MJ8A 5L0QB 3RFZC 1F6AB 3F7YA 1IBGL 4PGCA 3RPIB 4GG6A 3VH8G 2X2YA 5HVHC 5F1KC 1RJYA 5EA0L 3CFKB 1I8MB 3T65B 2J8UA 3O81A 1VFBB 3EFFA 3SKJH 3MRNA 1HOCB 2AVGA 2VLJE 1R5VB 4E5XA 4E41A 4CGTA 3RZCA 4K55A 1YN7A 3F7PC 4XPBL 2HVJA 1D5XA 4G9FE 1YEEL 5C0IA 1VSCA 3TCLA 4PY7A 3WL9A 1A7QH 1T21B 1D5IL 1MVUA 2WMPA 4B5EA 3ZKXB 1CFQA 1MHEB 2GUOB 2RBLA 4PLKC 2CH8A 1CDIA 4NKDA 2QADB 4YC2B 5HHMB 4PGJA 5EOCJ 2HN7A 5LQBH 3L3OA 4UTBL 4NBZB 1DUZA 4JRYE 1NGYA 2D3VA 2AJUH 2R2BB 1B0RA 4XP6H 4NNYA 4ODXA 3E6FA 1KCRL 1MF2H 1I9RL 1IGYB 1TQCC 5C0GB 5C0DB 1HHKA 2Y23A 4WUUE 5DEFB 3U0WL 2UY6A 3ARBA 3OR7B 2XNAB 5SWSE 5IB4A 5EZLA 5KOVC 1SJEA 2BZDA 1CE6A 5MENA 1O0VA 4RX4A 4YUEL 1CZ8L 1F2QA 1CICD 1OL0A 2EDRA 4L3CB 4P9HC 3I6KB 4LEXL 3MRMA 1IKFH 1FFOA 2AV7A 2EEBA 4KV5E 2AS5M 5CKGA 1OCWL 1S5HB 2EDKA 1CE1L 3GRWL 1FLRL 3DGGB 1N59B 4HMCA 3STBA 1U2HA 4EUPH 3VH8B 3MV9D 1GZPA 4RIRB 1DLFL 5DD0H 3QPXH 3VXMD 4H88H 5H94B 4TUKH 5HHVL 2V7HA 4OZFG 4XP5L 4RRPA 4OZ4B 1W0VB 5FCSH 3VXRB 5DRWA 1LWRA 4G6MH 4XCNA 3BUYA 3FT2B 3HZKA 5EIIB 2FEDC 3IB4A 3UJIH 1LO0H 1J0HA 1UH4A 4D0CA 3K1KC 2VAAB 4WI6A 4DVBB 4H8WL 4GXVL 4HT1H 4P2OC 1IC1A 3TA3B 4GQ9H 4L8SC 1IARB 3ARGD 4CVXA 1HSAB 3G5VB 5KW9H 3MUZ1 2EH8L 4FQXB 2ADJA 4WNQB 3X3GL 3O3AB 2FJFB 4YHKL 3EJZC 3KYKL 2P42B 3RWCB 4QRUB 3ZSTA 4M4PA 3WFEL 2EH7L 3PWPD 4NO0D 4HIJB 1E6OL 4G9DB 4WO4C 5EC1A 5IROC 2ZOKA 1FZJA 4QGYA 4JFFD 4M6OH 4P9HH 2VC2H 1INDH 1TZGH 3ZE1E 3ZKND 1KV3A 4GRLB 5F7EL 2IADB 3NPZB 5DMIL 3ZTJH 2VUYA 2DTMH 2OX5A 4F9PC 3TPUB 1R24A 1Y6MR 5JOPE 4PRAB 3KS0H 1AC0A 1CICA 1LNUB 1WITA 1R5WB 1QACA 2I24N 2ARJQ 2HT3C 3HFML 1F4WL 4PJAB 2P8PB 4KJPD 4AEIH 15C8L 1NJ9A 3GB7A 4BH8B 2O5YL 4UNVA 4PJCB 3FFCE 4ZFZB 4MXQC 3IYLW 4A6YH 4XMLH 3V52H 1EHXA 3MV9A 1XGPA 4PJIF 3HAEA 3SQOH 2VUOA 4TUOB 2H2SC 3VXMA 4YDLC 1WJ3A 3F5WA 3VFNB 1PG7X 1UXWB 4JFED 1HHHB 4BELD 4DVRL 4K8RL 3SDDD 4BYHA 3PWUA 3QXTA 1RVFL 4HV8A 2NY2C 3C6LA 4QRRE 1CDHA 2COQA 1GGBH 2BNQA 3S3PA 5KVEH 1BBJB 3ARGA 4PJDE 1P1ZB 1WZLA 5CZVH 1MH5B 1I3RB 4U1NA 4LKXA 3BPOB 5GGRY 4Q2ZB 2NW3B 4U0RC 4CN4A 1ZHKB 2C3GA 2R4SH 3MRHA 4S1QL 4HJJH 3LN5B 2V7NA 3PWPA 4NO0A 3A6BL 1A47A 4R26H 2ARJB 4IRZL 2G60L 3CXDH 4BSWA 3GMRA 4PD4K 2DYPB 1CU4H 3UPRA 4MHHG 4JFFA 3IXAB 2YS4A 2FO1A 3UP1A 1GL4B 1U41A 4HXBL 1KB5A 1FPTL 1WT5C 4XC3L 1BIIA 3G6DL 3D25B 4JQIH 1K9TA 3G6JF 4EOWH 3GI8L 1I9JL 2IAMD 1G7JA 1XGYH 4NNPL 5J3HC 3WS3B 1YNLH 3ARED 4K94L 4Z7UA 1AI1L 3X17A 1E4KA 1Q0YL 2M8XA 5E1HB 2Y6SD 4OQTH 1I9EA 4LCYB 4LRIA 5KVDH 2VLKA 3NTCH 1RIUL 5E2WH 4EVNA 5J1AA 3CUPA 1UA6L 4BUGA 2CIKA 2F54A 1CS6A 3VXUE 5D1XC 3SDDA 2JK5B 3IDIB 1RJLB 1X4ZA 2ZCKH 2Z8SA 3S34L 1E28B 5DHVB 1S8DB 2BOBA 4ODTH 1TENA 5HJ3B 3JWDC 5GRVK 3RTQB 1FGVH 4RISL 5HHQA 4ELMA 4CRPA 5JW4Q 4OLXL 3QUXD 4F3FA 4XGZB 3C6SA 1QR1B 3DLQR 3QEHA 1KTKE 3P0VH 3FHAA 5H2BA 4ZSOE 1CQKA 3QDHA 4UQ3B 3HG1D 3OXSA 4Y4FD 4IIQA 4KTDH 5HBBA 3MZGB 1YEIH 1UXSA 2XKUA 3HZMA 4WENB 2GIYA 4ZO9A 5D8JH 2P43B 1IFHL 4Y16C 1LEIB 3EOBA 2A77H 3UX9B 1NMCB 1JHKL 1T6WA 2Q7YA 1FYTD 4NWTL 4PJFA 5E9DE 5BMFH 3EHBD 3T0EB 2MCG1 5GJTH 2ITCB 3VXSE 1H8OA 1MCIA 3AREA 3I02B 2ADGB 3C5ZD 2L7JA 3IDYC 2A83B 1ZAGA 2E7MA 4JFQA 4UUJA 2I07A 1BFOB 1G7LA 3HLAA 4NYLB 2DL9A 3NFSH 5DRNA 1MCSA 3MRDA 3ROOB 1KTRL 3JWDH 3BMVA 1DQQA 1FE8L 3WXWL 2J4WH 4J8RB 3O6FB 5I73C 4Y5YC 3MJ8B 2FJHB 4QHKJ 4HUWA 1MQKH 5T3ZE 1C16A 4FG6D 4NOBA 4M1DL 3SKJL 3RVUC 1UZ8B 5I16B 2J8UB 3EFFB 2DLEA 1PZ5A 1JPTH 3Q1SH 2YUZA 4Y4HB 3U46A 5KS9A 2FBJL 2VN7A 5KSVA 3P40A 1MCOL 2H1PL 3ZT7A 1NAMA 1X5ZA 3KJ4C 5DJYA 2XFXA 2VLLB 4GRWE 3QUXA 5C0IB 1VKXA 1A7QL 1UB6B 2ICWI 1ZHBB 5EBGA 1CDGA 4GQPH 3TCLB 3KYMA 3AB0B 3PQYD 2EDLA 4RFEA 4PTUA 3TBSA 1CFQB 5JW5A 3BIBX 3HG1A 1IGJA 4Y4FA 4PJEF 3DETD 5LQBL 1QFHA 1NCAH 2KKQA 3V9FA 2G75B 3HB3D 5I1CH 5L9DH 4OZHE 3CLEL 1B0RB 4PGEB 4NUGH 4NNYB 1QLEL 4E0RA 1FO0A 3QR2A 1A6AB 4ODXB 1I3GL 3P0GB 4ZUWA 1FYTA 5J56B 3BYTA 1HHKB 4HUXB 4WU7A 4Q58C 2FR4B 3AS1A 4NQXA 4GS7B 1A1NA 3C5ZA 4N0RA 1SJEB 3JSSA 4MWFA 4CAGA 4LCCA 4YHIB 1WK0A 1UJTA 3PDDA 5C2BH 5ISZE 3EYOA 3NCMA 3QDJD 3ZKMD 1IKFL 4NKIL 3RWIA 4LSQH 1ORQA 1FIGL 1RUKH 3WLWC 1OGTB 5JW4R 4Z7VE 4JFDA 1NBVH 3SE9H 4NRZA 5GQBA 5E2VH 4XPGH 3Q6GL 1C5DA 4F7TA 3QPXL 4Z78A 4H88L 3QXDB 3DSFH 4MNQD 3WIHA 3R8QA 1DE4A 5HYJE 3BP5B 4JR9H 4G6ML 4S1RH 3ARZA 1EEUA 4PV8B 3KLHD 1FFQA 2X9WA 4NM4H 4APQC 3N9GH 1I85C 2F15A 2EEAA 3TJHC 1KN2H 4V2CB 4KI5F 4HT1L 2WIIA 4L9LC 5DMKA 2RAMA 1KNOA 4LCUA 4WCYH 4X6BA 3QEQE 1MLBB 1YY8B 2CGRL 5FA3B 5H35A 1QSVA 3PQYA 3SE4C 5D7IA 3RQ3A 1PDKA 2VZVA 5EWIH 4YK4C 1I1AB 3G6AA 3P4LA 2ADJB 1W72B 5F97E 1UVQB 3IETB 4HG4K 4DN3H 1A1OA 2JJWA 1LMKA 1P69B 1A9BA 5I1KH 5BQ7B 4M6OL 5EC1B 2VC2L 1AO7E 1KIUA 3WO4C 5HI4C 2CDFB 3RY6C 3RVTC 2YPLE 5F72S 3RDTC 2DTML 4JQXA 4RGMB 5TDOB 5GS2H 4P2YA 3CAFA 4FZ8L 2VISA 4JFZL 5JO5A 5K93A 1BJ1H 3AGVA 1CICB 5EUKA 3IT8D 1SYVA 2NMSA 1RIVH 5A2IH 1NGZA 4JQVC 3CZFA 4UTAH 4HC1H 1U3HB 5HY9B 3BQUD 5KZCD 5IMOA 4A6YL 4D8PA 4ODSH 2C3XA 1GGYA 2FD6H 4IS6B 3MV9B 4MNQA 2J6EA 1OM3H 2XT1B 1FVCB 1TLKA 2WWMC 3F5WB 3QXVA 4DK3A 1NBYA 1SY6A 5EU3A 3AY4A 1FZOA 1MJUL 2CKBL 4O2FA 3FB6A 4P4KB 5L8JB 3BPNC 1YEDA 1V3JA 5L88H 1JWSA 2FECL 3MNZB 5GGTA 2MKLC 2V5MA 4Q7DA 2W92A 2QBWA 1CFSA 2V2WB 4U1JA 3ARGB 1SM3H 3U36B 3CZJA 3RWJA 5B38A 1DFBL 4DWHA 4HCRA 4JKPH 4HEME 1N0XL 4HJJL 4M8QA 3QWRD 3NCJH 4LSPL 4KHTL 1Z9SA 3CXDL 3PWPB 4OM0H 4ZODA 1QSEA 2YD7A 5T3ZH 4EDXB 4PRNA 1T2XA 1U8JA 3MUGA 1JYVA 1Z9OA 5F89A 1BZ7A 4R7DA 5A43C 4Z7OE 1N8ZB 4NN6C 1KB5B 1RULL 1VADB 3ME0A 2RCSL 4H0HB 4EOWL 4IHOA 2K9UA 3VFSA 2BNRD 1D5BB 2AJSH 5I8OL 2UVEA 1WBYB 5HHNA 4GRWH 2EDDA 3VW3L 2P48B 4JG1L 4QY8B 5INCB 1G7JB 4E9LA 1LO3H 5CP7B 1IC7H 4F7CB 5F3BA 2FATH 2NW2A 3GSVB 5E94A 1MWAL 2D7OA 3NTCL 3WFBH 2R0LL 3DUSA 1IT9H 4AZ8A 3R8BB 3OKKA 4PJXB 5LJYH 1HI6A 1PQZA 3V0VA 4KKLC 4YO0B 4XT1C 3SE3C 4JFEB 3D2UA 5T5FH 3OPZH 3D39B 2LU7A 1EBPA 3F65A 5I76A 5HPMA 1JYNA 3SDXA 4GAGL 3P77A 1PSKH 1KLUA 2JCCB 3HC0B 4XNYH 1JI2A 2QQQA 1U95B 3HZYB 3CC5A 3TFKD 4MNHA 1WZKA 3A67H 4POYA 5HHQB 3LV3B 4P2CG 1DCLA 2W65B 4ELMB 2WLYA 3P4MA 3RWDB 3QWRA 4CJ1A 4HGKC 4KQ3H 2IANB 2SEBA 1GGCH 5BRZA 4LP4A 3C6SB 4LLDB 4P5KA 4DEPC 3QEHB 5C0JB 2Z93A 2EKSB 1RIHH 3VRLF 1QFWL 4OD2A 4UILL 4QHUA 4MDIA 2DMKA 5IR1B 2JELL 1EERB 3B8SA 3U6RA 4EDWH 5ADPH 3F7RA 1XGQB 3QIUC 1ZHNA 4OT1L 4LVNC 4XPFL 1U8MA 4GBXB 5I17A 3HI5H 3O2DA 2FHBA 4Y4KD 1NFIA 3T3PE 4H1LA 3LD8B 4BM7A 4OZGF 2BNRA 2W59A 1QSFD 2UZYB 3R0NA 3QBTB 5GJTL 3RGHA 2AK4A 1JWMA 2Y4SA 4GLRI 4XNQB 4H5SA 1W0YT 1WUNT 2IAMB 4MA1B 1BX2A 3AREB 4ZNEA 3KYNB 3W9DA 3MNVA 4J4PD 4MD4A 3HR6A 3JWDL 1RHHA 3DMMB 4YH6A 3VFMA 2PF6A 2NY7L 3HLAB 3CSGA 4M62L 4CKVX 1OF2B 3MRDB 3QNXA 1H3XA 3BDYL 3W39B 2YD5A 3IAGC 1DQQB 5JLZB 1U92B 3B43A 4EI5D 3VWJC 3MFFA 5DQJA 3E6HB 3LKPB 1UB5A 3NN8B 4ZO8A 1TZHB 2RJMA 1M05B 1A7BA 1C16B 4PB0H 2FNBA 5DC0A 3U9UA 3PWLA 2J1KA 5JOFB 2JJTA 4L5FL 4L1DA 3MROA 3Q1SL 3EJYC 5GRVL 2AEPL 3FT4A 1Q1JL 4XPHL 2E9JA 4WI9A 3RKDD 2F8XC 5IFAH 1ZHLB 2OSLA 1GGTA 1TJIH 2H41A 4CU7A 2XFXB 5M7QA 1WFUA 5AEAA 2Q76A 3QUXB 1HSBB 1MQ8A 5D1QD 1VERA 1XZ0A 3KYMB 5JTWA 4OSUL 3TN0D 2XG4A 4MDJB 4NQSB 5CD5D 1E6JH 1VFOA 1KCSL 4PTUB 2ZPKH 4RFEB 5FO7A 2EE9A 3THMH 1NPUA 1IGJB 3S37H 3Q2CA 5FDWA 3VGHA 5I8CB 1K4DA 2EXYD 3GMLA 1LK3H 1H0DA 4PJ7E 3DUHA 2O93L 1Q9WA 1FG2B 4R2GC 1MRDL 3P9MA 4Y4KA 5IEKA 4UU9A 1TVDA 3UJTH 2IFGA 2GW5A 3ARQA 5EU4A 2F74B 4EEEA 3MLUH 2ADFH 5ETUB 2FSEA 1BVLB 5F7UA 5C8JA 4MAYB 1KT2A 1WFNA 3C5ZB 3CGTA 3WIFB 4HS8L 4ZFGH 4J4PA 2F19H 2MJWA 2OXHA 1YJDL 3QDGE 4WV1A 4MCZA 4LSQL 1HKFA 2Y1VA 2GT9B 4MVBC 4FFWC 4JJ5B 3EYOB 3CCHA 2QHRH 4GW1B 2YUXA 1U93B 1ORQB 3O6LH 1SYSA 4RNRB 4EI5A 4HXAL 4NRZB 2CR6A 4PUBL 3RUGE 2FDBP 1XCQB 4HK3J 2R0KH 1RJZA 4NWUH 4TSBH 4Z0BH 1J5OL 4OTXH 2VXUH 4PGDB 4JFPB 4NM4L 1C5CH 4G7YH 1K8IA 4CNIB 1KN2L 3H7BA 5AAWA 2E6QA 3X13B 1F6FB 4I9WE 2PW2A 5FA4A 3QIBD 3SDCB 2YA0A 4HIXH 5I30H 3DJ9A 2YXMA 2HJKB 1KNOB 4KWUA 2FL5A 2FBOJ 5FYJL 4GXUM 1LO5B 1MCBA 3O41A 2DQUH 1F4XL 4LU5H 5D1QA 5IVZB 3TN0A 5D7IB 5GIRA 1BVZA 2HWZH 5TQ0L 3CFEB 5A40E 1T7YA 3SCMC 3G6AB 4DN3L 3L5WB 2VZSA 3V0WL 3HI1B 4TVPD 3VJ6A 1KENL 3PHQB 4AQOA 1N4XL 3P4OA 1M6OB 4D0DB 2WP3T 4K23L 4ONFL 3T3ME 4J12A 1OAKL 5CSZB 3U0TB 1RZGB 4OGZA 5TE7H 5KSBE 1XFPA 1S9KC 4UAOC 1MHHA 4QHKI 4L8DB 2VDOL 3MA7A 4K3GA 3EAKA 4O2EB 1I8KB 4X6EB 1R3LA 1J1XH 2P24A 2X4NA 1KJMA 1G1CA 4Y88A 3P9LA 3RL2B 1WT5A 4D9LL 1OLLA 5EOQH 4Z77A 3LVEA 3QDJB 1SYVB 3MX0A 3EGSB 4UTAL 4LPCA 4XP4H 3NA4A 3UTSD 1KXTB 2EC8A 1BAFL 1DVFD 1L9NA 3MRRB 1YDPA 2FD6L 1J05A 4B50A 3KHQA 5IMOB 3NABH 3EDEA 4MXVE 3TGXA 2HRLA 4K3EL 4NN5B 2Q1EA 4MNQB 3BFOA 3QNZA 1KPRB 5I1LB 4NPYA 2G5BB 3SN6N 3MRQB 4IJ3C 4R4BA 4U6VH 4OV5A 3K74B 1RFDH 4B0MM 4YDIH 5D5MA 5IW6A 4JFOA 4XCYA 1JWSB 3QUYC 4MX7B 1CFSB 3GJEB 3P0YH 1S5IH 4FXGA 3LY6A 5B38B 3LKRB 1ZA3B 2VJXA 2BSSA 3QQ9C 4KJWD 3WNMA 4YJZL 2J5LB 4URTB 4YWGL 3SPVA 3H42H 1ZA6A 4HMEA 3KPQB 2M2DA 2H6PA 5LGJA 1B90A 1YZZA 5E7BA 4G6KH 3RVVC 4OM0L 5DZLA 3JV4B 5JUEL 2GTWA 3VFWB 3QAZB 3G6JA 3ZTNL 2IPUK 2PXYB 1YY9D 3MO1B 2XA3A 3C09C 3U82B 4MJIB 3WIIL 1MCJA 2P5ED 2F58L 3H0TA 3ILQC 3ARUA 5M95B 4LCWA 4YX2L 3U4EB 4M5YH 2AJSL 3BMWA 5D72L 4FFZH 4IHOB 5GZNC 4HIHB 3ORJA 3VFSB 5B22A 1WF5A 5FKPB 3B9DA 1LO3L 5HHNB 1IC7L 3NZHL 4LASH 2P8MB 4Y16A 3QI9D 4GW5A 4M6AA 2R1WA 3LB6D 2XN9E 5DUPH 4YXKH 4AIZB 4Q9QH 2NW2B 1DVFA 4GSDH 2EDTA 2WBJC 3BQUB 5KZCB 1V3LA 5JMOC 4PR5B 4TQEL 4XWGL 2L7UA 4OF8A 2NTSP 1U91B 4JFHD 5J9PA 1AP2A 1PQZB 3LKOA 5FV1L 4X8XA 1CVSC 4HKBB 5T5NF 2DTSA 5DD6B 3HE6B 3HTLX 5I76B 4XNYL 3A67L 1A5FL 4JM2C 3D87B 4NKOA 2GCYA 5HD8C 3T04D 4MYWB 4M43H 3BEWA 5HXMA 3D1MC 1NUDA 2AJZA 4KQ3L 1Z5LB 1GGCL 2HJLB 3QIWB 4DZBB 1MFAL 4LLQA 4PRHD 2GEEA 5ADPL 5DURD 2Z93B 4HW6A 4Z76B 4I18B 5IW3A 1HHJB 1F3JA 3U6RB 3AM8C 2I27N 1LGVA 3ISWA 4TPRL 3Q5OA 1AQKH 4TOYH 4P9MH 5DVNA 3UBXI 5KVFL 5E8PA 3SDAB 1CFVL 4KK9C 3CMOH 4ODUB 4X99B 3CSYA 4TRPL 4H1LB 1ZV5A 3CX2A 4ZFFA 2VDNH 1TCMA 1DSFL 2HJFA 4JGUA 3ARDD 1CFTB 2VR5A 5EU6D 5JXED 1OTSC 1YC7A 2YD3A 1UM4L 4M7LL 4HWBL 1N2RA 5J13B 4RWHA 1RHHB 2R0WH 5DGRA 32C2A 3D3VA 1MRCH 3WMSA 1H15A 2FB4L 5JIIA 3C60C 2ESVE 4WFHE 2CXKA 3V8OA 4JPIB 4Z5RA 4KI5D 4YXLL 4PB0L 3MFFB 1QYGL 3PXJA 4M7LT 1S7VA 5MHSD 3O9WC 2VXQH 2A74B 3FO1B 4D9QD 2G9HA 3U9UB 3PWLB 1X5LA 4G80A 1RZFH 2VZTA 2J88H 4NO5A 4H0GA 1BWMA 2B5IC 3EYUH 3OKDA 1N5YH 3FT4B 5IB3A 4PJEA 1XEDA 4O4YH 1BQHA 5ICXA 1IGIL 2MTPA 5IJKA 3MGTB 4KKCD 1LD9A 4X9IA 3LH2H 4R0LB 3T08A 5D93B 2YR3A 5LKNA 1JHLL 1E6JL 3L7EA 4GLRH 5FECB 2YSSB 1U42A 4DUVA 4HWUA 4PRHA 4JHBA 5F7YC 2XWJB 4FQ2L 4N0CC 3SKMA 1LK3L 1H3VA 2Q8AH 3F6LA 5HHXL 5FDWB 5HYQA 1K4DB 4QHNB 2XWBA 5L6YL 1GAFH 3RU8L 1TVHA 4YFEA 1KPUB 1UACH 2DD8H 5GGSY 3UJTL 2EIZB 4ZTOL 1N7MH 3GMNB 4Y8DC 2WQRA 4DOHB 3LN4A 5F93C 1X5XA 1QSFB 3W9EA 4P57A 3OJDA 5FGCE 3IFPB 5EU4B 4AG4H 4PB9H 3ARDA 2AERT 2C3WA 5EU6A 4FOMA 2R29H 1JZ7A 1XIWB 4L4TA 1KT2B 1UM5L 3DVGA 1NAKL 5FM5M 5CEYA 5EZOH 2KBGA 3WUWA 2AKRB 1REIA 1RPQA 4WV1B 3T8XA 1Q8MA 4OAWB 1GIGH 3GSQA 3TWCL 5CWSB 1INQB 3OTTA 3QRGH 3O3EA 1XF2B 4WW2B 2N7AA 1SYSB 4F33B 3FN3A 1AFVH 1UYWH 4EI5B 1MAMH 4Z95H 3V8CA 3FQTA 4NWUL 4Z0BL 5IVXE 3LIZH 4OTXL 4UOW0 5FYKE 3H9YA 1RJZB 4G7YL 4JGMA 4NRYB 4U05A 5JIPA 1MFCH 4OI9A 3JUYA 2VLRE 2UY7A 3TJEH 4XP1H 5E99H 1IGMH 4G6JL 5C0BE 4HUVA 5C09B 1KOAA 1E4WL 1OARL 1MUJA 5CKAA 5E95B 3RL1B 1VGEH 4NHCH 3MLPA 4AT6A 5ECJE 5D1QB 1E4JA 1I1FA 2IGFH 3NAAH 1EFQA 5ESQA 1D9KD 3TN0B 2YD1A 3O8XD 4U0QB 1S7RA 2DKSA 5GIRB 3GSOB 5AYUH 2ERJC 3W11C 3I3DA 2I9TA 4GAYA 3QFJD 1GPOH 1NCBH 3VJ6B 3BJ91 5J11C 3QT2A 1MIEH 4GAJL 4MA7H 4X9HA 3CVHH 1J1OL 3L3KA 5D2NE 4P3WA 3EOAA 3K2UH 4XRCB 3V4UL 5E6ZA 2R4RL 4ZPTA 1JPSL 3BX7C 5TE7L 2QR0A 5MEQB 3KJ6H 5HGHA 2BRRH 2E27H 2K7PA 3BE1H 3DBXA 1MHHB 1Q9KA 1Z6JT 1OQOA 3ZKSD 2BHUA 1F11A 3MPCA 3TZVC 5I1GL 2Q86A 2NZIA 3MLSL 1X6LA 1RK1B 2X4NB 1JPST 3HPLB 2R9HD 4NIKB 4PJIB 4WEMB 3P9LB 5EFIA 1LEKA 4Z77B 4JPKL 3GMOA 2NX5B 1SEBA 4P5TB 3DYMA 5MEPB 3TO4D 2YUVA 1NDMB 1J0ZA 5CP3H 1NGQL 5JW4N 4FQQA 3T0XA 5KG9B 2R69H 5ACZA 4KKAD 4NN7B 4HJ0C 2VL5A 5DD3H 1ZMYA 3QNZB 4PRIE 5TF0A 4R96B 4NPYB 1NFDA 4YHPA 1RFDL 1C8PA 4XH2B 1IMHC 4MSWA 2KPNA 4FFVC 5BOZG 1HIML 3QIBB 3TNNA 4OV5B 2ZG2A 5A3ID 1CLYH 3L3JA 1J8HD 3C5SB 5K59F 4JFOB 2PUQT 2D7TL 2CK0H 3V4VH 4YPGA 3KPMA 1NCWH 1LE5B 2H26A 4NZJA 4FXGB 3O8XA 3D69A 1EEZB 4BH7A 4L3ED 2BSSB 3QZWG 3SPVB 1MCPH 1MI5E 3QFJA 2H6PB 3WN5B 1RMFH 3MYJA 2L0DA 3M8OH 4EZMA 4UV7L 2IQ9L 3OXRA 1WIUA 3QWQB 3GM0A 3NFNB 1QRNE 3ZE1F 4WI8A 2VXTL 5IBTH 5SWZE 4N0YH 3MQIA 3TEUA 4YBLB 4I5BA 3OX8B 3D0LA 1FNFA 5HYIA 5D6CB 1BP3B 5TE4L 5KVGL 3CK0L 5EOCL 5HI5D 4XVJH 4JRXE 5DUPL 4R97B 2YBRB 4GW5B 2V17H 3RVWD 2XTJD 3LPGA 4WHYH 4Q9QL 5DD1H 4ZS6D 4Q74A 4EQ2A 1U8NB 2DJ4A 2B0SH 3UTSB 1YNKL 1M7DA 2F53E 1DVFB 2IBBA 2ARWA 2ENSA 5JA9A 4OCWH 2GITB 2XRAL 5TDNA 2W07A 5J9PB 3LKOB 3STLA 4N5EC 5DC4B 5C3LD 5ITBL 3FRUA 2W1NA 4BZ1L 1IAKB 5LG1A 3FJTA 1KIPA 1GVIA 2EYSA 4NSKB 5ANMB 3DOSA 5FO8B 1RUAL 4BJLA 3P73A 1G9MC 5HDLA 3NIGF 1AHWB 3BO8B 4GG8A 5CCKL 3VWKD 3BRGC 1LO4H 1JF1B 4K7PX 1Q72L 2O5ZH 1ZEAH 2FEEL 2HFEA 3PGFL 2I5YH 2NY0C 3AXLA 4KVNH 2FX7L 3N1GC 4L3EA 4M7KH 5J12C 3H9SA 5DK0B 2FJGB 5C0AD 4ZD3H 4P2RD 2CR3A 2BP3A 5ELIA 1RURH 2ICWA 4ZYKB 4ZAKA 4OZGA 4K8RD 5A1AA 3KPTA 1D6EA 1AQKL 4MD5B 1F3JB 4P5MB 3B9KC 4RAUA 5FYKH 4UBDD 1AXTL 4NC2B 3TVMC 2DS4A 2P5EB 4Q6IA 5JHDE 2X4SB 4G42A 5C0CB 1IVLA 2AXGA 2GTZB 2VDNL 5FM5O 1INEH 3IVKA 2BVQB 4CMHC 4Q9CA 3FQXA 4WVRA 1ZLSH 5MI0C 1IAII 2HVKB 2NXZB 1PKQA 4NDMA 1DQJB 2QSTA 4OZIE 2HJFB 4WFED 3QI9B 5CLTA 3BOVA 3SJVD 4X6CE 2D0FA 5GPRA 5C0FA 1WBZA 1G9MH 1MRCL 4AENA 1TNNA 3MNWB 4PFEA 2DLFH 2VDQH 1J0IA 4N0FA 2Q6WA 5CLWA 2ICCA 1H15B 5HGDA 1CDJA 4Z5RB 5DVLA 3TIDB 3W0WA 1UKTA 5KOMC 4QOKD 1NEZA 1S7VB 4FHBD 1I7ZA 1SBSH 5BS0E 2R0ZH 2G9HB 3VXOB 4PJBE 1N5YL 3VWKA 4G80B 2XZAL 2VITA 4AM0A 2NPLX 2YC1A 3RX8A 5IMLA 4PJEB 2EE2A 5L2KB 3LH2L 2VDMH 4PG2C 1BQHB 1CD1B 3U48A 3FN0H 3T1WA 5GHWL 2FZ3A 1AGEA 4UB0H 4IRJB 1CGSH 4PRBA 4MA3A 4X5WA 1RZ7H 2EDWA 3GDBA 5C0AA 4I0PC 2Z4QA 1JFQH 2FX8H 1TIUA 4KFZC 4PRHB 5L8LB 1UWGH 3NGBB 4P2QE 5A2LH 3SKMB 2PTUA 2H32A 3EO9H 5MEOB 3VXQB 4M93B 4G8GA 5HDQH 2UWEA 4LHUD 4XHJD 4KQ4H 5DDHA 2CDEB 3VCLA 1N7ML 2JB5L 4PV9A 2HFGH 2Y72A 1G7QA 1TVHB 4Q9BA 3HR5B 1YECH 2VOTA 2H9GA 5ILTL 1DLHA 3GHEL 4AG4L 3QXAA 3TV3L 4GH7B 1QLFA 2NNAB 1KJ2B 1MAJA 2VSDA 4N0UA 3CH1A 3DYOA 5ICYA 4P4RA 3VI3E 3PNWB 1JYXA 3DRQA 4JDZB 5E5UB 3VFGH 1MJJA 5EU6B 5EZOL 3MCLL 3DUUB 2AJYL 4WEUD 3IDXL 1MREH 3DPBA 3OKEB 1GIGL 5CEYB 1AY1H 3WUWB 3SY0A 4JFXB 3QRGL 3V2AR 1PD6A 1W0WA 2BSRA 3GSQB 1XF3B 2NY4C 1AFVL 4D0BA 4KJQD 4YGVB 1MAML 4Y89A 2HMID 5JXAL 1W72L 1ZSDB 1T03H 3LIZL 4FN0A 3AAZB 3FQTB 4JAMB 4KMLB 2D4DA 4JY5H 1FAIH 5F9OH 4ZXBC 2OL3L 4NQVB 1GJIA 4AL8H 4JVWA 4XP1L 4GKNA 4LVHB 4XVTL 3NMEA 1BFVL 1I1YB 3GZKA 4PGBB 4H0IA 1MELA 5IF0A 3DO3A 4IRSD 3FQRA 3LN9A 2MPAH 5B3JE 2OR7A 5FHAH 1QBMH 3DVIA 4F7EB 1FIEA 1ZT7A 4WWKC 4PJ5D 4LAJH 1DR9A 1J18A 5AYUL 2VMFA 3BT2H 3UYRL 2CLRA 1S7RB 2DWDA 1X44A 1F4HA 1H5BC 4J3OC 3UAJC 3UCRA 2DQGL 1HYSD 3QG6B 4MA7L 3CVHL 2WM0A 4BQBA 4OZHF 4PPTA 1QO3B 3TYFB 5IMKA 3K2UL 1PBYA 2HT2D 1YNTB 5D1ZC 1OTUD 2BRRL 1KJ3H 3B83A 2C7UB 1CCZA 2XWTA 5AG8A 2E27L 3OB0K 4DJMA 3G5ZB 3QULB 2IH1B 3L7FA 3OKMA 2OI9C 4HAGA 3IFLH 4XNZC 4ZOBA 2AEWA 2DF3A 3BP7A 3P3YA 3GK8H 4GO6B 2ADIA 3HRPA 2ICEA 1I8IB 3RBSA 1CXEA 4OUUB 1I7TA 1YPZE 5AYQA 1CFBA 2Q86B 3N06B 2P45B 4X0KB 5T3XL 4OF0A 3HE7D 3OGOE 3T1FA 3BSZH 3GMOB 3K81A 4Z7VF 3DECA 4CMMA 4LFHD 2AXHA 2BVYA 2R69L 5F1NB 4U1KB 3DYPA 2XZQL 5JPNB 2BCKB 3PG2A 5I1JL 1JZ2A 3JV6A 4J6RH 5KSUA 1FZKB 3EYFB 5ACZB 1R3IL 4M7ZC 3VXRE 3ARFD 1NCCL 2XKSA 3L3GA 2GJ6E 2NLJB 1CBVH 1P7QB 1G6RH 3RZWA 3WLBB 3DI3B 5IB2B 1DUYA 3Q48A 4MSWB 3PGCA 4IRSA 4BFIB 4L8CB 5HHOA 2APBA 2CK0L 5I19L 4MHHI 2J8OA 4QF1B 1NCWL 2LE9A 4I1NB 4X6DE 4DKFH 1NGPL 2VIRB 3CVIL 5BW7A 1CXIA 4AEFA 1U36A 3KPMB 1D9KB 2D2OA 1MCPL 3K4DA 3HS0B 4BH7B 3PP4H 4QXTA 4Z0XB 3BZFA 4M5ZH 1RZIA 1JF6A 1ZVHA 4RFOL 2Q8BL 4G8IB 3H9HB 4NM8H 4U1HB 3PIQA 3S5LA 3WSQH 5BZDB 1ORSA 2EZ0C 1FNHA 5TGBA 5IBTL 1D5ZB 4JO2L 3G9VA 3U7YH 3OXRB 1B2WL 1IZKA 2BNUA 3BKJH 3WDJA 3V6OC 5F7DB 1X5FA 2BVPA 1A0QH 4P3DA 4W70A 5I18H 4U1GC 3OB0H 3QO0B 4XX1E 3E2HC 2VAJA 4KU1A 5EO1A 1MFBL 5L0QC 2X70A 3FZUC 4MS8C 3GSNH 5EORL 3NCEB 4M3JA 5LBSL 1IGTA 4OGXH 2CRYA 3DV6A 4NKQB 3BRFA 2B0SL 1U8QB 2AI0L 1LEGB 3FONA 4V1DD 5FCUH 2GSIA 5ITFA 4LQFH 3TO4B 4WDIA 2DKMA 2JKXA 2CMRH 5DWUH 4XCEB 1M7DB 1C1EH 4OCWL 6CGTA 5ID0A 2QEJA 3E1F1 1MHPH 2GAZB 2C5DC 4KK8C 1U8PA 1EGJL 3U4BH 4PJGA 3SOBL 3ARFA 2ZJSL 5AD0A 3ZKXC 3STLB 4GUPA 1UG9A 3FRUB 1KULA 2PCPA 5H8DA 5EBLB 2X44D 5HI3C 2QADC 1IGFH 3QQ4B 1OB1A 3I50L 4GG8B 1J8HB 1WBXA 3EYQC 2O5ZL 4AH2A 1DQTA 4O5LL 4UIKH 1AIFA 4KVNL 4ETQA 43C9A 3V4PL 4U49A 4WW1A 4L29B 4BK5A 3KPLB 1GHFH 2EEDA 3GBNL 1A7NH 5E2UL 3BKYH 4NZDA 1QA9A 3MLZH 1FNGA 1MCKA 5TH2B 3ZDXE 4WO4D 1P6AB 3L5IA 4RA0C 1BD2E 4ORZC 1ZLVK 3CFBB 1X5HA 1NLBL 4ZTPH 2PR4H 3GGWA 4G42B 4U2ZA 2AXGB 3IXTA 4HHAA 1ONQA 2AGJH 1D5MB 4NQCD 4CADA 3O11B 2Z91A 1CF8H 1W8OA 3TBVA 5CJXA 5H37G 3UC0L 1L7IL 3Q3GA 4V1DA 4W4OA 1UJ3B 4ISVB 5DJ0A 1G9ML 3IKKA 4DCQB 4WEBH 4M7JH 2IFFL 1XGRB 3JWOL 1CGUA 1WBZB 2DLFL 5I1IH 1MNUL 3BHBA 4MXQD 3TA3C 2YZ1A 1ZWIA 4G9FD 5IK3B 1ZT4A 3HNTL 4PJCF 5D2LE 1A4KA 4LRNL 4NKMA 4MB5A 1X5JA 3FOMA 1Y18A 2W60B 4YEFA 1B4RA 1TVBB 2NY1C 4WTZA 1ETZA 2VQ1B 2R0ZL 3LSOB 4HIIA 1N26A 4GRMA 1I7ZB 5FYKU 2FHCA 1NGXA 3KG5A 1VACA 3VWKB 2VDML 2Z92A 4Y19B 4KRLB 4ODWB 3KPRA 4JM4H 4C56E 2YPVH 5IQ9A 1CGSL 4P49A 4ZUSA 3OAUL 5SWQA 2FX8L 1ZANL 4GRLC 4OM1L 4PRBB 4X5WB 1YEHH 5C0AB 1IAIH 4P2RB 3MV8D 4OCRL 3ZDZE 4X6FA 4WUUD 2NY3D 3KPNA 2CKBA 4DGIH 4KQ4L 3FRPA 4AY0A 2H32B 2WIMA 3ZMRA 5DJ6A 2ZSWB 3CIQA 5TQ2H 1ZLVH 5I1AA 2P5WB 1RZJC 4JZJA 4LHUG 3GSWB 1HZHH 1BQUA 4PV9B 3T3PF 1MRFL 2PTTB 2OBGA 1OGAE 2DJUA 4ESKA 1WIPA 2R39A 2UYLB 4HPOL 1HKLH 2DQHH 4RGND 3QXAB 3QA3B 4OD3H 3D0VA 4N0UB 4MQXC 5EO9B 4GXUN 1ADQA 3DRQB 4LLYB 4L9DA 3SJVB 4PJ9B 4HUKB 5T33H 5CAYB 5JW3H 1AY1L 4KDVA 3QCUL 2PTVA 2XQBH 4NQEB 1DQLH 1CLZL 4G6FD 2YPKA 1W0WB 3CSPA 4KTEH 3PWNB 1UWEL 2ZCHL 1BM3L 1NCDL 3WJJA 4GG6E 1FAIL 4AEHL 1JGEB 5EOTA 4QOKB 4U6HA 4PLJC 4AL8L 3VXTA 4O58L 1QBLH 4E41E 4H25B 1MWAA 3GIZL 5DSCA 5E8OB 3OQ3B 1A7RH 1BOYA 1RZJH 3RAJH 1T0MA 3FTGB 5E6ID 3C8DA 1H3PH 3AMKA 4K7FA 1LK2B 5JZ7D 1OAYL 3BT2L 3KS0J 4XNMA 3RBGA 3MV8A 2P4AB 4S1SH 2YN5A 4WUUA 5HGGS 3JVGC 2DWDB 4HJGA 3WFHB 4PJ7F 4N68A 2DQTL 4DGVH 4K7PY 4S1DC 5JOPD 4LHUB 4QTHA 2PO6C 4DFIA 4LEOB 1YYLL 5DHYB 4J3SA 3WFCH 4RMSA 4G8EB 5I75C 5T1MB 3D18B 5DJAA 4YIQA 2XWTB 3IFLL 5IHZB 5IMMA 3IJHB 3OKMB 3GK8L 4O02H 3ULVC 3KR3H 4MNGA 3RHWK 5MENE 4I2XE 1VFUA 4KHXL 3QB7C 2EDOA 3W5MA 3AS2A 2HTKD 3MOBH 3BSZL 1P2CA 4LARL 4MA8H 3ZHLA 3P30L 4FP8H 1AGBA 3E8UH 3SE8H 3CFCL 5GS1B 5C9JA 4JY4B 2VYRE 3IKCB 3NCCB 4MLSA 1ULVA 4QRRD 3RUGF 1T1YA 4OFKA 3KXFD 1FVDA 4I3SH 4PLNC 4J6RL 3G04B 3MRFB 5D71L 1HQ4A 2WINB 2XG5A 2X4UA 3LEYH 5KSUB 1CBVL 3ZYZA 3WFZA 5I1HH 1G6RL 3KPSB 4G43A 2FRGP 1PYWA 1KCVH 5D7JC 3MRPA 1S7TB 3VG0L 4XMKL 2OTUB 2VABB 1JVKA 4YDVB 2E7LA 3PGCB 5E6IA 3B6SA 1K4CA 4QXUH 3RGVA 1B4JH 1P9MA 2PKDA 3WXVL 3KWWA 4PJ5B 5DR5H 1HHGA 2XICA 1CDBA 4EUPG 4U1MA 2OP4H 3IU3A 5CGMA 1DJSA 4R8WL 3ULVH 4P23D 4FA8A 4S2SA 4RMVA 2CRZA 4Y5XC 2X4OB 3HNSH 5DJDB 3TYGH 4M6MH 3PIQB 5ERWA 3R1GH 3U7YL 3QNYB 1CVRA 1UEMA 4CUCA 1ORSB 1UENA 3FT3A 3O45A 3JUZA 4YXHL 2BNUB 5D9SA 1FL5B 1I1CA 5KSBF 4HFWB 2QLVB 2HFFA 2AEQL 4BUHA 5FYJD 3QO1B 2BVPB 3TO2B 5HVWA 4P3DB 5GRWA 1JBJA 4G7VL 3IU4H 4XBGA 1H3WM 1RK0B 4P46A 4H26A 1DN0B 4FXLA 5FF6B 4XWOD 4QRTB 1FGNL 3RWEA 4HEPG 4D3CH 5FCUL 1LE9B 3VXUD 3VGAB 5IOPA 3HE7B 1PVHA 3C9NA 4JANA 3DV6B 4G8FA 3T2OA 3HI6L 2DQDL 5ITFB 5EBMA 3RZCC 5E8NA 3KXFA 1YQVH 5GS2D 3M17A 5J6GA 3MV9E 5EZJA 3LRHA 2Y25A 3U4BL 3QPQC 5CIPA 3ZTJG 3VXME 4MLIA 4XPAH 1S78D 3IGAA 4PD4J 2K3TA 1ACZA 3IS1X 2BNQE 3TJHD 2YRPA 5IBUG 5JORA 1L7TL 4AH2B 3HUJF 4MCYB 3D9AH 4WWID 2N4IA 1T04B 4EUPB 1B3JA 1F8TH 1KCUL 3ESUF 2JIXD 1GHFL 2CIIA 4P23A 4X8JB 4WW1B 4KDWA 3PWPE 4KAQH 3ARBC 3ULUE 3O6MH 3T4YA 3TH3T 5E9DD 4AYFA 4M48L 2YEZA 1QA9B 2H3NB 3VXSD 1K3IA 1SHMA 4JFFE 5FO9A 2J12B 1M7IB 3VD3A 1FBIL 4KVCH 4OLUH 3G08B 2PR4L 1A22B 2NY6C 1FNEB 3RVTD 2JB6B 2P44B 1S3KH 3MTRA 4OCXH 1P5VA 1EV2E 3UTZA 3VMPA 1A6WH 2DJSA 2HH0H 3PWVB 2CDGB 3IXTB 4J3TA 3VGFA 5D70L 3HCVB 2EDJA 1YEJL 3WJLA 2FIKB 3VXUA 1PLGH 2C4FT 3RWHA 3BIKB 4Z7UE 2O26U 3Q3GB 4V1DB 1EFXB 5MP6L 1Z3GH 5DJ0B 1K2DA 4FQCH 3HPJA 3IJSA 3WFDL 2VLKE 2J3SA 4OV6F 4LLUA 3WCYA 3EDFA 1XCTA 3BHBB 5DT1H 5F9AC 2CLVB 2F54E 3GNMH 2QQKL 3NIFE 3TBTA 4QCIB 2WWMD 1KELL 5E08L 4X7FC 3ARXA 3N50A 4GFTB 4GRMB 1LP9A 1LDPL 4WUKL 5FB8B 5IBUB 4OQ1A 1QFWM 2D31B 2MHAB 5DJ2A 2O61B 3L3DA 1C7SA 2DLTA 1EMTH 5DJ8A 2YPVL 5HHPA 1Q94A 2BC4A 3CU7A 4YHOL 1S7XB 4A6YB 4ELME 2ZUSA 5GS3A 2JIXA 4NZRH 2VERN 1YEHL 1BLNB 4ELKA 5SWQB 1A3RL 3RNKA 4HKXA 4C83B 1NC4D 5E8DL 1JNHB 1CTNA 5DLMH 3DX7B 2VDPL 1Q38A 4JB9H 3SO5A 4NC1E 3VXSA 3KPNB 1BFSA 4KUCF 5GISL 1CICC 3L5XL 4WO4B 1J0JA 1XF4A 2EE6A 4XNUH 1HZHL 3O3BA 4D9RD 5EB9A 2HKHL 3P2TA 4PRDA 4ZFOL 1JN6B 2B2XH 5I1AB 4F2MB 3EYSL 5ALBL 4F58H 1H9VA 3EFDH 5TJWK 4FFYH 5ISZD 3PJSA 3GJFA 5INDB 3OF6A 3X14A 4MQSB 2R15A 1RUQL 1SJHA 3PL6A 3ZL4H 4PJFE 1G7HA 3B9AA 2LU4A 4JN1L 3MBXL 5B39A 4NQCB 2BXZA 2ZUUA 3RJDA 4PJ8D 1RZKC 3D0VB 5T1LB 4UV4H 5JW3L 4O9HH 3OAZK 2XQBL 4RAVB 3RA7H 1LHZA 1FJ1B 1NSNH 3C6LC 4KTEL 3S3JA 4D2NA 2FWOB 3B4NA 3S3SA 4J1UA 3RWGA 4CBPA 5I1DB 1JP5A 3DVNA 3O4OC 1YYML 4R7NA 4G9FB 1XH3B 3ARGC 5J6HA 5E6YA 2R56L 4YDLB 3QG7H 3O2WH 1XR8A 4F37F 1BVKA 1YN6A 4HK0B 1QBLL 4P3CH 1BJMA 3BWAA 1F42A 3QDME 3D5OF 4DQOL 3MJ7A 5KS9E 1A7RL 1NBZB 3S35L 2OJZL 4N1HB 3WD5L 1H3PL 1DDHB 3GSNA 4JRYB 3QRFM 3QH3A 1T0MB 1IEBA 3LEXB 2AJXH 2JCCF 5C6TH 3CMGA 2W9LA 3ZKNC 1A14L 4IDJL 4U0RB 4CVWA 1G0YR 2YPLD 4Q6YA 3HG1E 4DGVL 4ZOCA 4WUUB 3SKOB 2NY3B 3BD5A 4LDLB 1GYAA 3HAEH 2CUIA 3L1OL 2EO9A 1RZKH 3MODH 3EYVB 4G3YL 1EHLL 2Z31D 4X4ZA 4KJPC 3WFCL 5GZOD 4YQXH 1SJXA 1BMGA 5ISZA 2A6JA 1U8LB 1E4KC 1FYTE 1OHQA 2BJML 4HF5L 3J8F7 4LSVH 1OAUL 1CL7L 4LRIC 1KACB 5B8CB 3KR3L 4X98A 2P47B 4XCCH 1EAJA 5DA4A 4PJ8A 4QXGL 4QHMA 5GGVL 4WRLA 3O0RH 3OAZH 4WTXA 4HKZA 3V6OA 3LMJH 1X5YA 3FOLA 1D3CA 2F5AH 4HPYL 4I77H 3V5DA 2GKIA 3SDDC 3OKYA 1P2CB 2VDRH 1OSPL 3S36X 1EXUB 2RHEA 3CFJA 4JFDE 1U9KA 1FL3B 1HXMA 1M7XA 3RPIA 3MLTA 5DRXB 3CFKA 1I8MA 3T65A 1VFBA 1BIHA 5M94B 4I0CC 1EJOH 5TDPB 5JDJA 4HG4J 1HOCA 1KB5H 2DBLH 5D1XB 1KCVL 2XV6B 1BQSA 2HLFD 1VHPA 1DEDA 2V5RA 3V5KA 3VFOB 4PBXA 2Z35B 4HWBA 3MRPB 3EW3B 3UDWA 3WHE0 1Q0XL 4IIQC 4QXUL 1IRAY 5DS8A 4NC1C 4IMKA 1T21A 3BUTA 3MREB 3LQZB 3ROLA 2BVOA 2E6PA 3B6SB 2GUOA 5IBLC 2HTLD 5DR5L 5F1SA 3PQYE 5D7IE 1A6TB 3SO3C 5IB1B 5E24E 4CVUA 5ENWB 2AJ3B 2DQFB 5DI8A 3QYCA 3IDNB 5D6DA 3TYGL 2V5TA 1MIMH 1RZ8A 4M6ML 1NUFA 1QNZL 1XMWA 1FZMB 3R1GL 4MA1C 3G9AB 1F13A 1OLZA 3AREC 3UTPE 1TJGL 5C0GA 5ERWB 3MYZA 5E00B 3NA9H 1DL7H 3OJMB 4LSSH 3FT3B 5DEFA 1R0AH 3I6LD 2Y6SC 2XNAA 2OJEB 3EZJB 3LEVH 5D9SB 5IESH 3K3QA 3FFCB 1JGVH 3MACL 3BPLC 4L3CA 1OAXL 1WCQA 4LCIH 1ZLWK 3LQMA 4YHYB 1HDMA 3GKZA 5BZWB 3V7AE 4D3CL 4JG0H 3I6KA 1S9XB 4H26B 3IDYB 4F8TA 1UH3A 1S5HA 2OQJB 2QHLA 2FX9H 1MEXL 5IFHL 1AXSB 3DGGA 3KLAA 1N59A 4XBPA 3S98A 3I85A 3VH8A 4RIRA 5EBMB 4HMDA 4QRRB 5ESAB 1U8KB 5I73B 5J6GB 4MNQE 4HFUL 4Y5YB 3HC3L 3PWJB 1W0VA 4PJDB 3QUXC 1IC4H 3FT2A 2ZUQC 4RZCB 2LFGA 1BJ8A 4QKXB 3CSBA 3U9PL 4DVBA 1DBAH 4FQLH 3TA3A 3QUML 4Y4FC 1JRHL 4U3XA 1NKRA 1HSAA 2DMBA 3L6FB 4XVSH 5JR1L 4FQXA 5DZOA 2YUWA 3KJ4B 4WNQA 2I60L 5JORB 3CD4A 1F8TL 3GMQB 3O3AA 1AE6H 1WZ1H 2NQCA 2FJFA 4GKZB 4X80H 2VWEE 3RWCA 4MJ2A 1VA9A 4QRUA 5DQ9A 12E8H 3M45A 1FH5H 3DWTA 4KJYB 1HH9B 1R3JA 1MCNA 4HIJA 4G9DA 2CIIB 1I3UA 1V3KA 4P23B 3SCMD 3CNKA 3QJHB 4JVPA 4S10A 3DRTB 2DYPD 2ORBH 4M1GH 1QSEE 2WAHA 5HYSG 3C5ZC 3HHRB 5TF1H 5DFWH 1QEWA 4KVCL 5GJSH 1UKQA 4LCCC 2IADA 2OZ4L 2YK1H 4WFGD 5FO9B 3IAPA 3INUH 3FQUB 2PW1B 3TPUA 4UDUA 4PRAA 1A6WL 3QCTH 1MVFA 3S4SG 3S35X 2XACC 1T4KA 2JTDA 4OBSA 3UTZB 1NAMH 3PUCA 3WO3B 1ZLWH 4PJAA 2P8PA 4KDTA 3NPSC 4K9EC 4FG6C 4HZLB 5BVPH 2DIAA 1MHCA 4QNPF 2WQ8A 4PJCA 3VXUB 5T1KD 2KQMA 3RWHB 3QWOB 4U31A 2BX5A 4Z7WE 1K2DB 3MRCB 4TUOA 4DUWA 1IKNA 1F3RB 1UGNA 4OZFA 3VFNA 5DT1L 1UXWA 3IFNL 1HHHA 2G5RA 4KKBD 5J0BA 1UQSA 3GNML 5FM8A 5F9WC 4NJ9H 3UZQA 5I1EH 1FO0H 3LRGA 1KUMA 4QTIL 1AH1A 3RNQA 2IPTL 2E6JA 4F57L 5AWNH 2XPGB 4HBCH 3SDXE 2X1PA 3LOWA 3RTQD 2AEIT 4APQB 1E4XI 1BBJA 2IBZX 1MH5A 4B7LA 4Y5VA 3HB3C 4S0SD 5KJRH 4L9LB 4Q2ZA 2NW3A 5DJ2B 1GOGA 1J12A 3L3DB 5DJ8B 1AGCB 1Q94B 1ZHKA 3BISA 4MB3A 4F15C 2JIXB 4OLWH 5DO2D 5BRZE 4YK4B 4JQXC 4ELKB 3JXAA 1I1RA 4JB9L 2DYPA 5HYSB 3IXAA 1VFAB 2VRAA 4K9EH 1IILE 5E9DB 1P4IH 3VXSB 3WIHH 5A2FA 1UT9A 4F58L 4FMKA 3UTQA 3ZKMC 2ICWJ 1OPGL 5FUOH 4DW2L 2VH5L 3D25A 3WO4B 3S4SB 2Y07H 3H2WA 3O2VL 4LLMA 1EEQA 5C9KA 3ZL4L 2VDLH 2BNRE 2QKIA 3T0ED 5LGHL 1DQDH 2AK4E 1A2YB 3BESR 1UM6H 2FLRT 3EDJA 3WS3A 1SEQH 1G7HB 2I9LA 4O9HL 5B39B 5C7XH 2MQ0A 5T1KA 3QJFB 2WWKO 4ZNEE 3VXNB 5ACMA 4XXCA 5DD5H 3KLHC 5IP4A 2HA1A 4J3XA 1F45A 3AY4C 3VFRB 3HC4H 4OLVH 2ZOLB 5BOPA 5HVFB 3VDAA 2E5EA 1T2JA 4Q0XH 3IDIA 5LWYL 1OAZL 1RJLA 4R7NB 4OIIH 2FGZA 1NDGB 4GRWB 1HXYB 1TJHH 5DHVA 1S8DA 2UUDK 3RTQA 1YN6B 2ITDA 1T0PB 4UT7L 4Y4HD 1UFUA 5C0RL 3BPNB 1A6UH 1K8DB 3MXVH 2MCPL 4J3UA 4OIAA 4YLQT 3BDBA 4XGZA 5C6TL 4GKSB 1OOAA 3DV4B 4OZHB 1HINH 1DANU 4UQ3A 3Q5YA 1MCWW 4OLZH 3Q5TA 1B0WA 4RMTA 3GM8A 1NC4B 1T1XA 4ZQKA 4JKMA 3S6CA 4KUZH 4RFNB 1KEML 1QFUL 4HQQH 3VGBA 3RX7A 2B1HH 4YQXL 1DQMH 4WHTA 1LEIA 5ACLA 1U8HB 2H45A 1IM9D 1SY6H 5CMAB 3U79A 2P49B 4LSVL 3T0EA 2A6JB 5ISZB 1OAQH 2ITCA 2NZ9D 4NN6B 4LPYA 5GGTH 2ADGA 1IEAB 4PP2B 5GRZA 2A83A 4M61B 3TT1H 2H2PD 4Z7VB 3NH7H 4PJ8B 5EH1A 3W2DL 2Y5TB 3OG4B 4NYLA 1I7UB 5BXFB 4HCRH 3ROOA 2VDRL 3FOLB 1Y0LB 3V5DB 5HYJB 2DMCA 3ULUL 1EAPB 5IGXH 3C08H 1X5GA 4J8RA 3O6FA 1Q9OB 1TETH 3BKCH 3RWFA 5T1DH 5EU5A 2FJHA 3QUKA 3CFJB 4NBXB 5GSVB 4JO3L 4I4WB 1HXMB 3MLTB 5IV2B 2DBLL 1UZ8A 5I16A 3QEQB 4XAWL 3PF2A 2OXGA 2UUDH 1JMZA 3I6GB 4Y4HA 1AQDB 4R4FL 3R06A 1J7VR 4LGPB 4LKCB 1WAAE 3V5KB 1N6VA 4NJAH 5BV7L 1P6FA 2VLLA 3GBMH 1UB6A 3JZ7A 4W6YB 4M3KB 1ZHBA 1B0GB 2FYYB 5DJCA 1TFHA 5DS8B 4HD9A 4MMXC 5GRUH 3ROLB 2BVOB 4G5ZH 1I1AD 1JGLH 5I74C 3OZ9L 1EO7A 3H6JA 4L4VE 4YHZH 1AO7B 1WZMA 1QUNA 2MKWA 1IC5L 1MSPA 2YPLB 1FDLL 1NMBH 1A6ZA 4YNYB 5DUMH 2G75A 1TTFA 5DI8B 4N0CD 1RZ8B 4PGEA 1L0QA 2Z31B 5J1TC 1IM9A 1A6AA 3QIUB 2BFVH 3NA9L 4LSSL 1R0AL 4LVNB 1KBGH 1OTTD 1PEZA 4FQJL 4DKEH 3AU1B 5IESL 4Y8AA 4HUXA 1KXVC 4ZOEA 1GCFA 2FR4A 2XN9D 2D7QA 4UT9H 1JGVL 2C3VB 3R4DA 1A3LH 4YHIA 2MQCA 4JG0L 1FSKB 4AQ1B 4NZTH 1HDMB 1QKZL 2APVA 1OGTA 2JJTC 1U3HD 5AZ2L 4ODHH 4FQIL 5GGUB 4H20H 3DX8B 1DN2A 1HH6A 1Z0NA 3RI5F 3KLAB 5IW1A 2QQNH 4JY6A 3L9RB 4XBPB 3QXDA 3ILPA 3TFKC 5DJZA 3BP5A 4YHNA 2DM7A 4TTGA 3VWJB 5D93C 2BHZA 4PV8A 1ED3B 3HUJA 3O2DH 1KN4L 4WW2F 4H1LH 3BAEH 4P4KD 3TESA 3ZT5A 1S7UB 3S88H 1MLCB 5F6IC 1A7PH 3MRBA 1MY5A 1MLBA 1YY8A 5FA3A 5D5ME 5T3XD 4X6DF 4L8BB 2V9RA 3LS5L 1FRGL 1I1AA 1TZIB 4JO1L 5EUOF 1W72A 3FMGH 3V6FB 2HT4D 1UVQA 3IETA 5ADOL 4Z8FL 4KUCD 3RY5A 1FH5L 4Y4KC 3Q6FB 1CR9H 2Y06H 5DQ9B 2F9BT 1JMXA 4TVPE 1R3JB 1DEEA 4YE4H 2OL3A 3MLWL 5E2TH 5BQ7A 3DXAD 3G6JE 4K3JL 5TF1L 3MCKB 2CDFA 4Z7NE 2AK1L 4J4PC 1OT2A 1QEWB 5TDOA 4R2GB 1H3TA 4WV1C 2FO4B 4EN3D 4LCWE 3VRJA 4UDUB 4RSVA 2J8HA 3W81A 2X4PB 1U58B 4M6NH 2HLAB 1P4LB 1T4KB 4EI5C 1WQVT 5BVPL 3FO2B 1GZQB 3VXPB 2I25N 3DI2B 2ESVD 2YA2A 5TFSH 3JV0A 1HWHB 3FB7A 1MHCB 2FH6A 1U3HA 5HY9A 1Y6NR 4GMSH 3QHFH 2CLZA 2YWZA 3U2SA 4IS6A 1DBMH 5LCVH 4QXWA 4M1CD 5F7WC 1T3FB 1UCBH 1ZGLB 3WDIA 1FVCA 4NJ9L 4OF5A 3C2AH 4OZFB 1D7FA 2HRPL 1UQSB 2DQIL 3BP4B 5D1QC 3D39D 4N8VG 4P4KA 5AWNL 3TN0C 5CD5C 4HBCL 2GFBB 3EZ8A 3RNQB 3I3BA 3MNZA 3MXWH 4JJHA 4YHLH 1WTLA 3IDGB 4NQTA 2V2WA 5ESVB 3U36A 4DGYH 3LDBC 1XGTA 4Y5VB 4JDTH 1J86A 5E0QA 5I2IA 2IAND 3TBWB 2OMNA 2XXMB 4JREC 4M9OA 3ZO0A 4C59B 1N6QH 3SCMB 5JW4M 3DXAA 4K9EL 4EDXA 2XY1A 4NZUL 3T2NH 2WUCH 1FC2D 3ZDXF 1UADC 3WIHL 2WW8A 1CK0H 4NC0B 3H9ZA 4GBXD 3EOTH 3BYYA 2IBGA 1N8ZA 1VADA 2X5PA 5EU7E 4EN3A 4KGJA 2Y07L 5C0EA 3UTQB 3N1PC 1D5BA 1FFNB 2AP2A 4ONHA 1WBYA 3G5XB 1JNLL 4LLMB 3QHZH 3OGCB 3UEZA 4LSRH 4QY8A 2QKIB 4M03A 4UAOB 5INCA 5CP7A 4F7CA 2VB5A 5DJXA 2GK2A 3RVXD 5C7XL 1TPXC 1QFOA 4LGRB 4XCFL 2I9LB 1N6UA 3GSVA 1BQLL 5T1KB 1E4XH 3DMMD 2YOCA 4NP4L 3K0WA 2IPUG 4LOUD 4JPVH 1P7KB 4PJXA 5JA8B 4JN2B 4YO0A 4ONGH 3U30C 3D3VE 3ES6B 4JFHE 2IMMA 4JFEA 2VSCA 5D2LF 1WICA 4N8VB 3D39A 4FQ1H 1R3KB 1EK3A 2EDBA 3QDAA 3BH9B 3WYRA 1ZTXH 2JCCA 5DUBB 3HC0A 3D48R 1G9NC 1UZ6E 3OG6B 1NL0L 4IJ3B 1JI1A 1AC6A 1U95A 3HZYA 5LXGL 2ITDB 3MXVL 3LRSA 5CD3B 3LV3A 2E7HA 4PJEE 5IT2L 1DBKL 2W65A 3MGAA 1YMHB 3RWDA 1E27B 1U8OB 2IANA 2KQNA 4PJ7B 3FFDB 3QUYB 4CDHA 2B1AL 2DQCL 1F3DJ 2IPKB 4LLDA 5C0JA 2EKSA 4N8CH 4OLZL 4X4YB 5IR1A 3QSKB 2NY0D 3MJGX 1JTTA 4PRHE 4R90L 5J8OA 1XGQA 4MJ5B 3ZHDA 3BGFC 3BH8B 1KC5H 2VXSL 2IH3B 1T1XB 2J6EL 4ZQKB 1GGIH 4GBXA 5DQDL 1SY6L 1IGCL 4R97C 1CLOH 4JLRB 2W91A 3SGKA 3C09B 4WHTB 5F44A 3VFVA 5L7XH 3TF7C 1QHOA 5C70A 1ND0B 5BO1L 3QDGB 3IJYB 1MCLA 4M02A 3OR6B 4WGVB 1DVFC 1EEYB 4XNQA 4ZO7A 3V6ZB 2IAMA 3TT1L 5TE6H 1V7MH 3FAWA 2NY5C 3NH7L 4MAYD 1U6AH 3KYNA 4FS0A 4LSUH 4OJFL 5EU6E 1ZK9A 1KIRB 4ERSL 2A1WH 3DMMA 4L4TE 3RUGB 4F7PB 1T2QH 4LIQE 1OF2A 5L8KB 3MOAL 25C8H 5IGXL 1G9NH 3W39A 5CILL 4TVPH 1JCKA 4ALAH 3LQAL 5JLZA 1U92A 2YRLA 4BKLB 2ZZUT 2WBJB 4U6TA 3RWFB 3E6HA 5F3HB 5EU5B 3LKPA 2DI8A 3NN8A 3MMEB 5AUMB 3QUKB 1TZHA 1M05A 4KI5E 1TCRA 5JOFA 1AR1D 4GG6F 2YZ8A 5GGSB 2R2EB 3IDJB 4D9QE 1J0YA 3AVEA 4KJWC 5C07E 3GUTB 4KGLA 4XNXH 2X4RB 1P7HL 3EBAA 5E56A 5C86A 4KK5D 3MJ9A 4NJAL 4XP9H 3B9EA 4A2LA 3SDCD 3GBML 3R06B 4NO3B 1ZHLA 4WFFD 1MI5D 2FLBT 1YY9C 4JM2B 1HSBA 2AQ1A 5DJCB 4G5ZL 2IMNA 5D2NA 4MDJA 4NQSA 5C3TA 5EU7C 1VEOA 2Z8RA 1CGXA 2X89D 2D0HA 4KZEH 4OLYH 4R6UA 5SWZD 2C4XA 1I7RA 4I0PD 4UIMA 5I8CA 2BSED 2NY5H 4BSVB 2AJUL 5KSBB 1A6ZB 1FG2A 4XP6L 5IHLB 1MF2L 3KPPB 4HX1B 1IM9B 3LB6C 4JRXD 2V9QA 2F74A 4UT9L 4YFLF 1OW0A 5ETUA 3VDBA 1EUUA 1BVLA 1JE6A 4MAYA 4RWYH 3WIFA 2F53D 2YMXH 2UZIH 3GKWH 2GT9A 4JJ5A 1SMOA 4GW1A 4WY7H 1U93A 4RNRA 2R2CA 4I48B 1HH6B 3QXUA 1XCQA 4ZOAA 1CTOA 5IW1B 4GOSA 4JY6B 5DD0L 3ILPB 4TUKL 4PGDA 3C60B 4JFPA 2A73B 5IJKC 5DJZB 4YHNB 2P1YA 3BAEL 4CNIA 3UJIL 4ZS7H 3X13A 3HUJB 1LO0L 2EYTB 2B7DT 3SDCA 1NFDE 4ZXBD 4Z7QE 4GQ9L 2HJKA 3CDGB 4HULB 4NQDD 2B5IB 3MRBB 1LO5A 5IVZA 4IOFD 4O00A 5CJ8A 3ZE2F 5BJTB 5IIEB 5KW9L 4HWEH 2ATPB 2PYFB 2AABH 4S11A 1PGRB 3CFEA 2Y06L 3L5WA 5I15H 3HI1A 2R23A 1JZ3A 3PHQA 5K9KB 1IQDB 5JHDD 2HP4A 4N90E 4FNLH 3QFJE 5CJOH 1M6OA 4BFGA 1UC6A 2V5SA 1DEEB 2MOVA 2PXYD 4D0DA 2OL3B 1QFPA 3ARDC 4YDJB 4OGYH 4P9HL 1INDL 1TZGL 1VPOH 4U1IB 4MJID 1KG0B 5CSZA 3L95B 1A7OH 1WCBA 3SKNB 1RZGA 2VXVH 3U0TA 5ID1B 4N9GB 1N5AB 2V2XB 4L8DA 2IC2A 2XN9B 5DVMA 4O2EA 5EN2B 1I8KA 2F53A 4X6EA 3NIDF 3VRJB 3BVNB 3BZEB 1T1ZB 3F62A 3RL2A 4AEIL 4KI5C 5F71A 3CU1A 3QDJA 3EGSA 3VMOA 4YBQD 3ARVA 3HZVB 4XC1H 4R4NC 1RHFA 3B2VH 3CVHB 3FB7B 3MRRA 4OKVB 2A9NH 4XMLL 3V52L 1JUFB 1MFEH 3FO0H 3SQOL 2VZUA 4ZUVA 2CLZB 3U2SB 3FL7A 5I6XC 4KKCC 1KPRA 1JV5B 5I1LA 5F9JA 2G5BA 3MRQA 1N3NB 2YXFA 4BK4A 5EC2B 1FNLA 3HE6D 1DP0A 1G0DA 1GGBL 1S9VB 3MXWL 4HLJA 3DO7A 2OR9H 4NQDA 5CZXD 1FP5A 5F96H 5KVEL 2XA8H 4JCMA 5CZVL 4MX7A 4WHYG 5GSRB 4JGJA 3GJEA 1UEYA 3GSRB 4GT7A 3FCTB 3LKRA 1ZA3A 1XGTB 4PG9A 4LIQH 2R4SL 3QIWD 5L2JB 5FUCE 1PKOA 2EDHA 3KPQA 4U2YA 3K4AA 4F9LA 5I2IB 1N6QL 4L3EE 4NGHH 1YEFH 4KMQA 3JV4A 4R26L 3H9SE 3VFWA 3X3FH 3ULUF 1Z9LA 2PXYA 3MO1A 1CU4L 2ERJB 2XZCH 4HH9B 4OZGE 3P11H 3DXAB 4RGOH 4MJIA 3EOTL 4FZEH 5IWLA 2BERA 3EO0A 1OSZA 2IG2H 4JRWA 3UJJH 3U4EA 3SDAD 3C5JB 4JQIL 4EN3B 4HIHA 5C0EB 3QHZL 4KXZI 5FKPA 3MLVH 4ONHB 1JGUH 1XGYL 2HKFH 4WU5B 3HMXH 1ZS8B 1YNLL 2P8MA 2EICA 1F00I 1PKQE 4LNRB 2ESVB 5DJXB 4AIZA 2XTJE 5D4QA 5FOBB 4X9BA 4OQTL 4JPVL 3TZVB 3HMWH 3BQUA 5KVDL 4U3CA 3TNMB 4U3HA 4PR5A 5E2WL 3ARRA 5AAMA 4OCYH 1U91A 5K33A 4U1LB 4PS4H 3S8WA 2UZXB 4KPHH 4IDLA 3DHMA 4HKBA 1TITA 3VFTB 2ZCKL 3N85H 5DD6A 1KF9B 4KK8D 3T4AB 3W0WE 3HE6A 2R8SH 4ODTL 4DKAA 3O8XC 3OB8A 1FLTX 1U8IB 4XXDB 2ZSVB 3X12A 1FGVL 3GO1H 2EC9T 2WLZA 2DBJA 4LPXA 1C12B 3MRJB 1NQBA 4K3HA 5ICZB 2VTFA 3LRSB 4OF6A 5FOJA 1Z5LA 2MSPA 2HJLA 3QIWA 4DZBA 2W0KA 5CFHA 4NUJB 4KC3B 3P0VL 4C4KO 2MNUA 5JOEA 1KPVA 4Z76A 4KTDL 1PG7H 4I18A 1G1YA 1HHJA 4OD1H 1YEIL 1IAOA 1CIUA 5FGCB 1HWGB 5D8JL 4G8GE 3U0PB 4ODVH 3KDMB 2UWEE 2A77L 5I9QC 2EDFA 2R9HC 3SDAA 3KPOB 1EX0A 4ODUA 3VDCA 3MRIB 4X99A 3T77B 3VFVB 3UBXG 1L0YA 3KYOB 5BMFL 2IQAB 4QHLB 4TSAH 3L3IB 3TO4C 1V7ML 4PJFF 4LMQI 3W5NA 4WJ5B 1U6AL 1CFTA 4N0UE 1XIWD 4KKAC 3WS6A 3NFSL 3RIFF 4BZ2H 4XB7A 5IVXB 2F8VA 1VENA 2J4WL 4EXPX 1WV7T 4W4NA 4F7MB 4YPJA 4JPIA 1MQKL 3U7WH 2NYYC 2VLRB 2VL4A 2AV1A 2PYEE 3MV11 4XPBH 2D0GA 1YEEH 3FO1A 2A74A 5JNYA 1TCRB 1WVZA 5FUCC 2J2ZA 5GS0D 1JPTL 4IOIB 2NXYC 2NY1D 2W9EH 3DHJA 1D5IH 5EBWB 2LQRA 3ALPA 2EYRA 4O2CB 5KS9F 3WV0A 4ZAKC 5C09D 2W0FA 3MGTA 4OUOA 4XVUC 4R0LA 3VG9C 1U2CA 2ED9A 1NEUA 2J7LA 5FECA 2YSSA 5CSGA 4H8WC 2ICES 5D2NB 2XWJA 4Q6IC 4FQPA 2NY0B 2NY5L 5CBEB 1KTDB 1I9RH 2VR4A 1MCDA 1V8HA 4N1EA 1NCAL 2CO7B 1I7RB 4UIMB 2CPCA 2X09A 4QHNA 5I1CL 5L9DL 1K6QH 3VFUB 1KPUA 2ZG3A 2EIZA 4NUGL 3GMNA 3UBXB 3RVWC 3MV7D 2XTJC 3LAFA 4OI7A 1CZ8H 4ZS6C 1QSFA 3B5HA 1ODAA 3IFPA 4WIQA 1WGOA 4LEXH 2YMXL 2UZIL 4X5LA 4IOSD 4PJHF 1ES0B 1XIWA 1OCWH 4CMHB 1F2XK 4HLZH 5C2BL 2APXA 1FLRH 3CFIC 5MI0B 5KANG 2AKRA 4WY7L 1DLFH 2VKXA 3I2CH 4OAWA 1RUKL 2NX5D 4P5TD 3I9GH 5CWSA 1INQA 4MXWH 4KROC 1NBVL 3SE9L 1XF2A 4WW2A 4XP5H 3ZYOA 5E2VL 4PRIB 4F33A 4XPGL 3VWKC 4XZUB 3DSFL 2BY2A 4JR9L 4S1RL 4H8WH 4GXVH 4NRYA 2C1PA 4ZS7L 5CGYD 1FFRA 3N9GL 4PBWD 5EUOA 5F1OB 2EH8H 4PLJD 4WCYL 1JZ4A 5C09A 4YHKH 4KRPC 1MI5B 1T83A 3CH8A 5HHOE 3RL1A 5DEZA 4HIEB 2EH7H 5EWIL 1E6OH 3GSUB 3HRZB 4UBDC 4JVUA 5SV4A 1GOHA 3GSOA 3GSXA 5IB5B 1CI5A 3VFPB 1BD2D 1QP1A 2FECI 2WWKT 3WKMH 2ZKHH 2X7LB 4BA8A 5SWZB 3MFGB 4PLOB 4I0PB 3MCG1 2R23B 5I1KL 4X5XA 5F7EH 3RIAF 3VI4F 4CJ0A 2EIBA 1ZT1A 3DTXB 4XRCA 3DROB 3MV7A 1H3UA 2AAVA 4MD0B 4S1DD 4YDKH 5MEQA 2A6DB 2PO6D 4JRXB 3HFMH 1WCBB 15C8H 3ZSSA 4C55A 3VU2A 2O5YH 1T1WA 2F53B 1KB9K 3MBED 4OCSH 1RK1A 5FEBA 2WBWB 3HPLA 3SHSA 5HYFA 4PJIA 2BVUA 1A3QA 1RIVL 4XC1L 2NX5A 4P5TA 2ZG1A 1EDQA 4HC1L 4RBPK 5MEPA 4ODSL 1NDMA 1MFEL 3FO0L 1HHIB 1BZ9B 4MJ6A 5KG9A 1RVFH 2H32H 3BW9A 1OM3L 3PHOB 4QO1A 7FABH 5DK2A 4ZUVB 5D96C 8CGTA 1A21A 2EXWD 2K1MA 4QRSA 4Z18A 4PJGE 4R96A 4FTVE 3DX6B 5F9JB 4XH2A 3ELAT 2OR9L 5L88L 1HCFX 3QIBA 5F96L 2XA8L 4ZXBB 3DO7B 3C5SA 4S1QH 4Y2DD 3TIEB 1Q9LB 4NQDB 2GK0A 1SM3L 4POZD 2Z0BA 2I26N 4UT6H 4IBLT 4XHJC 1LE5A 4LIQL 4JKPL 1X7QB 4I3RH 4GAFB 3IF1A 2Z8VC 4IRZH 2G60H 1EEZA 3WEXB 4IM8A 3ESVF 4PG9B 1YEFL 3NCJL 1QHPA 5CHNB 3UMTA 2XTLA 3WN5A 3X3FL 4WWKB 1AD9B 4FABH 5JHDB 4HXBH 1WFTA 2QSCH 2XZCL 1OGAD 2DLHA 3G5YB 1I4FA 5T3ZL 3G6DH 3T0BA 3HN3A 4RGOL 1H5BB 2X10A 1G6RB 5D7KD 1I8LA 1YMMD 3NFNA 2RR3A 4FZEL 4BQ9A 1I9JH 1WFOA 2UV3A 4YZFE 2YD2A 3F7QA 4M8VA 4NNPH 1QFWI 5KSAD 1GRWA 3EO0B 1A1MB 4OZIB 1PY9A 2PNDA 1QVOB 1OSZB 4X6CB 3EDDA 5C0CD 3OX8A 3V0AC 3MLVL 1T66D 1G9EA 1AI1H 5D6CA 2OK0H 1AGDB 2HMIC 4KJQC 2NTFB 3MBEA 2NXZD 4ENEC 4CVZB 1RIUH 2BRQA 2YBRA 3KNBB 2FATL 2GYSA 3K8KA 4QWWC 5HTSA 1BGXH 1UA6H 1U8NA 1WWBX 3BXNA 3HMWL 4RBPH 3UTSA 2CJUH 3WFBL 4Z7WF 1IT9L 1G7MA 4OCYL 2RFXB 3ZYIA 5JDSB 4PS4L 2GITA 1T89A 3S34H 1KCLA 1ACYH 4PJBB 3F7VB 4E41D 4IRSC 4PTTB 4OFDA 3N85L 4RISH 2YA1A 1MFDH 5T5FL 1IAKA 3OPZL 3QPQD 2BMKA 2GJZA 4NSKA 5ANMA 1PSKL 5FO8A 5BW7C 4OLXH 1EHNA 1AHWA 3BO8A 3LHPH 3BEVB 1ZVSB 3X12B 4Y2DA 1QBBA 1JF1A 1HYSC 4LPWA 5L2KD 4PRPD 1WISA 3ECBB 4P2QB 2A6IB 3QZWA 5J57B 3UPCA 3KPRE 4IRJD 1D6VH 2HT2C 1OTUC 5DK0A 2FJGA 1RIHL 1BHGA 1KGCD 1PG7L 3PHSA 3STZA 3WE6B 5E1AB 4ZYKA 4KK6D 4EDWL 1KPVB 4XI5D 1URLA 2JLLA 4MD5A 1YMMA 1JHKH 4P5MA 4YR6A 4ODVL 1IAOB 4NWTH 3V79C 3ARBD 4QRPD 3QUMA 2P5EA 2ZCLH 1NLDH 3HI5L 5KSAA 1CXFA 2X4SA 5AZEH 2A0LD 4X83A 5C0CA 3QEUB 2GTZA 4J3WA 2BVQA 2H8PA 2QQLH 4TTDC 4U1GB 2HVKA 1DQJA 3E2HB 3QI9A 1JHTB 3WXWH 3VE0B 4BZ2L 1CT8B 3IRZA 1VEMA 3ARFC 1LILA 4LPTA 2HAZA 3DIFB 1JPFA 3MNWA 4M1DH 4DTGH 4AIXA 3QEGH 4HSQA 2OZ4A 3U7WL 4P59H 4B41A 2W9DH 5MERA 3TIDA 5C0ND 2FBJH 2AV1B 2D03H 1MCOH 2H1PH 5JNYB 5KVMC 4XB8A 3VXOA 2W9EL 3GMMA 2HYMA 1QLRB 5E2JA 2OTPA 5IFAL 5L2KA 4PRPA 2EYRB 1FORH 1TJIL 1CD1A 2OTWB 1ROWA 1VDGA 1G7PB 2W0FB 4IRJA 4P48A 4NHUB 1IM3A 1CDUA 2CRMA 2DDQH 2ZPKL 5IJVB 2X6MA 3CLEH 1R5IB 3THML 3S37L 1QLEH 3MV8E 5MEOA 3VXQA 1K6QL 1I3GH 3IDMB 4QRPA 2CDEA 1M71A 1HQRB 3MOQA 4XX1G 4I2XA 3HR5A 4XBEH 1T7WA 1QQDB 5CJXC 4W4OC 1YPZB 3MLUL 2NNAA 1KJ2A 2ADFL 4ZNCD 4NKIH 5JMRA 4RGNE 3PNWA 1FIGH 4FXKB 1HEZB 3T0DA 4JDZA 4ZFGL 2F19L 4HWZA 1CYGA 5EO0A 5JXEA 5C08D 1II4E 3DUUA 4MNG