1ETZB

The three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
228
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGEGLEWLADIWWNDKKYYNPSLKSRLTVSKDTSSNQVFLKITSVDTSDTATYHCARRTFSYYYGSSFYYFDNWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB NC10.14 - LIGHT CHAIN
publication title The three-dimensional structure of a complex of a murine Fab (NC10. 14) with a potent sweetener (NC174): an illustration of structural diversity in antigen recognition by immunoglobulins.
pubmed doi rcsb
total genus 40
structure length 228
sequence length 228
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1etzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1etzB01
4WGWB 5CLWA 2DB8A 3EOAB 1F4WH 1F3DH 4NM4H 1N5AB 3ARED 4U3HA 4D0DB 3EOAA 4ZXBD 2VTFA 3FJTA 4PIRF 3SCMD 1FYTE 1N5AA 1ZT1B 3FB6B 5MERB 3ARSA 1B90A 3OBAA 1K9TA 3A6CL 1J10A 1KCSH 4D0BB 1B2WH 3FB6A 5TQ2H 5MERA 5JTWA 2QL1A 1JF6A 4KQ3L 4D0BA 4UINH 1RIHL 4NJAL 5L0QC 5L88L 3RP1A 2F19H 1H8OA 1J0ZA 4I8DA 4M02A 5F70A 2FO4B 1R5IB 2MMXA 3I50H 5JOFB 3S5LG 2D0HA 5IB1B 2DWDA 3FL7A 2EH7H 3HZVB 2FO4A 1R5IA 4RBPH 4ZYKB 5TGBB 5JOFA 4QRPE 3WCYA 2BNRD 3FTGB 1LEIB 4FNLH 3V52H 4OFYA 5TGBA 4ZYKA 3FTGA 1ZEAL 2MWCA 3OJVC 1LEIA 3ZLQC 1F13A 3TZVC 5LKNA 4MCYB 1ZTXH 1FZOB 3DX9B 3TNMB 5GS0C 3ZE0E 1BFTA 1FZOA 5I74C 3TNMA 5K9QI 1PG7H 4K7PL 3GI9H 4Y0GA 3STBA 3BJ91 4N0UB 1RUKH 2V6HA 3MRQB 3WUWB 3PWLA 1MFEL 3ARBC 4KZDH 4KK8D 1MEXH 1JGUH 4N0UA 3DV4B 3MRQA 1YJDC 25C8L 4TNVK 3SBWC 3WUWA 4F57H 1QZ1A 3MJ7B 3DV4A 4WJ5B 1QR1B 3MJ9H 2PR4L 3MJ7A 2C3VB 4WJ5A 1QR1A 3VFPB 4Y88A 2GCYB 5EO0B 2BSTB 2C3VA 1XFPA 3MLTB 2YEZB 3VFPA 4LGRB 2GCYA 5EO0A 1S7TB 2BSTA 3PWPB 5FV1L 3T1FB 3ZE2F 2YEZA 1EFXD 3Q2CA 1QRKA 4PJ9D 3IDIB 1BECA 2H3NB 1AR1C 1A14H 3PWPA 4YDLC 2CMRL 3T1FA 5B38B 5HHOB 4IRJB 5EUKB 4F7MB 3IDIA 5ISZD 2BJML 2OJZH 1O7SA 5B38A 3MCKB 1U8QB 4IRJA 1EBPA 5EUKA 4F7MA 3PXHA 2VSDA 5C0NC 1DANT 3TIEB 4P5TD 1U8QA 3HI1B 3TIEA 3OKOB 3QG6A 1EO8H 4HJJL 5IT2H 4WW2F 3HI1A 4JEGB 2J8UE 2VO5A 5IBLC 3K80A 1WZ1L 3MLYL 3SKMB 4OLXL 2X4SB 5FK9B 3OB0H 4X4YA 4F9LA 3SKMA 4PRAB 2X4SA 1ITBB 1HXMB 5FK9A 4LHJB 1CE6B 3NCEB 3R8QA 3D3VB 4PGJA 5ITFA 1HXMA 1YZZA 4CBPA 1CE6A 1Z2KA 4PGBB 1KJMB 5IBUG 2WBWB 3HRZB 3LQMA 3QIUB 4YDJB 4PGBA 4M4PA 1KJMA 3SOBL 4EI5B 3HRZA 4YDJA 2L4OA 4JQIL 4H8WH 4NNPL 4EI5A 1OB1B 5BZWB 5E5RB 1OP3H 1A6TB 5GRUH 3C9NB 1DLHB 5ESAB 4I0PC 4EBQL 1OB1A 1DQTA 4PJEB 5BZWA 1A6TA 4QTHA 3C9NA 1DLHA 5ESAA 3M8OL 4PJEA 5D2NC 4YWGL 5BS0E 5T3ZH 5C2BH 4B7LA 3CMOH 2ZOKA 1RFDL 4H0IA 1G6RH 3IVKB 5DUML 3MNVB 1IAMA 1P69B 1Y6MR 4ZOBA 1NCWH 4RQQB 3IVKA 4LHUD 3SEPA 3MNVA 5DLMH 3FQUB 3QRGH 1F58L 4XC1L 2XXCB 4P3CH 1V3MA 4RQQA 1UM6H 2WUBH 3D85D 5F8QC 3FQUA 4XP6L 1F4XH 3WEXB 1A4JB 3MC0A 1MELA 4GO6B 5JXAL 3K46A 3WEXA 1A4JA 1FAIH 3BSZH 4EN3B 1CGSL 4DOHE 3CU1A 2QSVA 1K6QH 3K81A 1W72B 2A77L 1UWEL 1DTUA 3RQ3A 1W72A 3DNKA 1NCTA 5F7KC 4NCDA 1I4FB 1U95B 3DXAD 5I1DB 5CD3B 4HPOH 4JB9H 2Z9TA 1I4FA 1U95A 5I1DA 1FBIH 1G9NL 5CD3A 3H9SE 4HLZH 1AQKL 3O2VH 4QY8B 4XH2B 4PUBL 4Q2ZB 5D6CA 1C5BL 5KVEL 2FRGP 3T3MF 4QY8A 1P84J 1PJ9A 2LQRA 4XH2A 3S7GA 4Q2ZA 1TZHB 3MRKB 5GZNC 4K7PX 1I3UA 3GBNH 4LBEB 1O7VA 1QBLH 1T66D 4LVHC 1OHQA 1I9IH 1TZHA 3MRKA 4CGTA 3WIIH 4ORZC 4LBEA 4KXZH 1T6WA 5DR5H 4XMPL 5IFAL 1X5KA 5E4EC 1QKZL 3V5HB 3CMGA 4NFCA 1YEFL 4PRBB 2WP3O 5IHBA 3VDCA 3MFFB 5D7SH 3BZ4B 1A0QL 2NY0D 4PRBA 4QHLB 4LVNC 3MFFA 2F5AH 1F2QA 3BZ4A 4N5EC 5A16B 1LP9F 3NN8B 4QHLA 1Q9LB 1YEIL 5A16A 4G8GB 3NN8A 4X7TA 5CEZD 2DIAA 2Y25A 4TOYL 1Q9LA 2VQUA 4NC1E 4O2FB 4G8GA 1CDJA 1C12B 5JXEA 4FTVE 1IKFL 4GRWF 1ZLSL 4MJ6B 3O81A 3B9DA 4O2FA 1C12A 1BJ8A 4MJ6A 2E8ZA 2VR5A 1ULVA 2AV1B 4F7TB 2EYTB 2DQJH 5DWUH 2KH2B 3KYNB 4PLJC 1T1WB 3NA9H 1OW0A 2D7TH 4F7TA 1QQDA 2AV1A 3M17B 2EYTA 1KJ2A 4OLWL 4NZUL 1T1WA 1XF1A 3L1OH 4KQ4H 2BP3A 3M17A 2VDNL 1IBGL 2R1YB 2CGRH 2YN3A 3VU2A 4TVPE 4NBYB 5I19H 2R1YA 4XNQB 3VRJB 4RRPA 4GMSL 1J18A 1A7PH 1DLFL 2XV6B 4XNQA 3VRJA 4FG6C 4NZTH 4KPHH 2W9DL 2ARJQ 4YPJA 5F71A 2WMPA 5F1NB 2VXVL 3EYQD 2OZ4A 5BO1H 3WUZA 3CX2A 4ZS6C 5AZEL 4FABH 5F1NA 4P4KD 2BX5A 4HS6B 3L3HA 3NFNB 1ES0B 1JYNA 3L6FB 2HAZA 3I3BA 4KHTH 3ULVH 3QPXL 2W9EH 4HS6A 3EO9H 3WFZA 3NFNA 1ES0A 1VFUA 2VN7A 4LDEB 5HGDB 5DUPL 3EAKA 2YD1A 4L4VE 1C08B 5HGDA 4KKCD 2O5ZL 3WS3B 5D93C 4Y16C 5DK2B 4FQHB 1KBGL 4XCFL 1C08A 1TETL 4DQOL 1T1XB 4JM4H 3WS3A 5DK2A 1QRNB 4FQHA 4U6XB 1KN4L 1T1XA 4MAYC 1Z9LA 1QFOA 2F58H 2VLRD 1QRNA 5AYUH 1I9JH 3PV6A 4U6XA 4Y4FD 1ZS8B 3RVWC 5ANME 3HC3H 3RUGF 4X6BB 4P9ML 1ZS8A 3GFUA 4X6BA 5FYKD 2DQHL 3KS0H 4FQLH 4UIKL 3RZWA 2R8SH 5KTEH 3KYMB 4XPFH 1QNZH 5AG9A 1CGVA 1TZIB 3KYMA 1IC4H 4RMSA 3ARGC 5DUBB 5GIRB 4I3RL 3IU3B 5DUBA 1VFMA 5GGVH 1AD0B 4M1DL 4WW2B 1NGWB 5GIRA 1IGJB 1RQ5A 4HKJB 3IU3A 1C5CL 3EJYC 3HFMH 1AD0A 1NGWA 5GZOC 5KJRL 1IGJA 4HKJA 1W0VB 4IOFD 2ZUQB 1W0VA 1KCUL 1E4KA 3L9RB 2NNAB 5A2LH 2HT4D 3WO4B 4PD4K 4GXVH 1OP5H 3L9RA 2NNAA 4BQ8A 4YHLL 4DW2L 4WO4C 5DO2D 4M7ZC 1UYWL 4UQ3B 1JPTL 2Z31C 4MA8L 4OQTL 4TTDD 1R0AL 4WFHD 4MCZA 3VGHA 3FT2B 4B41A 4JFXB 5E2UH 3EJJX 1WCQA 4J8RB 4JE4B 3WJJC 4KAQL 5D70H 3FT2A 3HG1B 4JFXA 5IJKA 5GSVB 5SV4A 2YZ1A 4J8RA 4Y4HC 3WFCL 1BD2E 4L5FL 5GSVA 3S37H 2EIZA 4A6YL 1A2YB 4K8RD 1UH3A 3FT4B 2KQMA 1A2YA 1H3VA 4YO0B 3UTSB 3IAQA 3FT4A 2Y5TB 1OAKH 2QR0B 4HGMA 1FNEB 1T2QL 5CIPB 3RTQB 4YO0A 3UTSA 5CILH 1A6VH 2EDDA 3TCLB 3TN0C 5I8OL 1MREH 2Y5TA 2QR0A 1FNEA 5CIPA 4P46B 1P84K 2P1YA 3RTQA 1RVFH 3TCLA 1TPXC 4P46A 4MVBD 1TTUA 1JNHB 1RHFA 1JNHA 2XRAH 2H2PD 4HWUA 5GJTL 4LSVH 2Z93B 2FB4H 2Z93A 3WS6A 5IOPA 2OLDA 4O58H 1NKOA 4AEIH 1BLNA 2FD6L 5HI3C 2J8OA 3UZEA 5B4MD 3BPNC 4KU1A 4O02H 1BVLB 5DEGB 1JNJA 4DGYH 3SY0B 2GHWB 3WXWH 2VB5A 4NGHH 1BVLA 5DEGA 3SY0A 2NY3B 1MJ8L 3RWIB 1ZLUK 4WI4A 3WL9B 5ABDE 1UM4H 4KI5E 5TF0A 5C6WH 3BPOC 2F53D 4OM1H 5TFSH 2OTWB 2VABB 3WL9A 1GZQB 4QHUB 1HQ4B 2OTWA 4ZAKC 4KDWA 1GZQA 3FHQA 4QHUA 4DFIA 4I77H 5FKAA 5HY9B 1HQ4A 1YYML 1AXTL 2B0SH 3RRQA 1Z0MA 5HI5D 1S5IH 3RL1B 1X9QA 5B39G 5HY9A 1IGMH 2BK8A 4J3XA 3ZDXE 2AJVL 3GJFH 2Q8AH 3RL1A 1F8TL 1CIUA 1D9KB 5SWSD 4K3DL 2JLLA 1W0WB 4PLKC 1WFUA 3DVGB 1D9KA 5GHWH 2VDKH 2Z35B 3QCUL 1W0WA 5HYJE 3DVGA 3CFJB 2JB5L 35C8H 2MKLC 2Z35A 5FYLE 3CFJA 1A6WL 1X4XA 2EDWA 4F9PC 5BVPH 1LP9B 5I8KL 1LP9A 1MWAB 4QNPE 4RISL 5CJQH 1YMMB 5EOQL 1QSZA 1UKTA 4DTGL 1MWAA 3N9GL 1WZLA 1YMMA 1JFQH 5F7MC 4GRWB 5I1EL 2FHFA 1HWGB 1I7UB 1W0YT 5HHMD 1H3UA 3W5NA 4F80A 1EGJA 4XNZC 2DQDH 4GUPB 1ROWA 1I7UA 2R29H 3PL6C 4GUPA 4JHZA 1EEYB 4CU8A 4HWBA 5DURD 4M7KL 3VE0B 5CUSH 12E8H 2QSQA 3QHFL 1EEYA 4JGJA 3VE0A 5DD5L 1HIMH 4N9GB 3CZJA 4YC2C 3A6BL 3C08L 3V95A 2J88L 4N9GA 2B1HL 2DQGL 1TDQA 4GT7A 1IE5A 2YUVA 3FCTB 1ZHLB 5D2LE 2BVQB 3CIQA 1KG0B 3B9KC 4LCUA 2DKUA 1RK1B 2Y36H 4KJPC 5GISL 3FCTA 1ZHLA 1AFVL 1AKJB 2BVQA 4MZ3A 5FHAH 3BKML 2N7BA 3HZMB 4F8QA 2WIIB 3P0YL 1AKJA 3HZMA 2WIIA 3V6ZB 3L95B 4HF5L 2HKHL 5DHVH 3HNVH 3QUYB 5HDOA 3L95A 3BQUC 2E7HA 1ZT7B 1MCQA 3QUYA 1XT5A 4R2GC 2HMIC 5DQDL 2D9CA 3ZL4H 1ZT7A 5GS0D 3BDYL 4DZ8B 4CN1A 2EE2A 3O4OC 3O41B 4BELD 5JOPD 3QCVL 3QUMB 1MF2L 4DZ8A 2BNQB 5GGSB 3UTTE 4QTIH 3O41A 4XMLH 3QUMA 2IEPA 2BNQA 5GGSA 1IGYB 4MQXC 3RUGB 5E6IB 3TYFB 1NC2B 1R3IH 4XNYL 1MI5D 1IGYA 5GGRY 4I5BB 3RUGA 5E6IA 1BWMA 3CUPB 3TYGH 3AB0C 3TYFA 3ZE1E 3DGGB 1NC2A 4OZHF 2OL3L 4I5BA 1DVFC 3CUPA 1RPQA 3DGGA 3BMVA 4I13B 1L7TH 4JO1H 3ME0A 4LEXL 1OGTB 1WEJH 3T2NL 4HUXB 2CIKB 1BQLH 1OGTA 3DOSA 4FQ1H 5EU3B 4OB5L 4NQEB 4OD3H 2VKXA 4HUXA 5SWZE 2CIKA 4YE4L 5EU3A 1UENA 3RVXC 5JW5B 1NUNB 4PJCF 2FX9L 3HLAA 4W4NA 3ZO0A 1S7VB 5JW5A 4JN2B 4LGSB 1FVEB 2VR9A 1V7NH 1S7VA 4M6ML 4JN2A 4P2QD 4Q0XL 1FVEA 3S34H 4NCC1 2NY6C 5CJ5A 4HUMB 4TSCH 5EFIB 3CNKA 1RZKH 5EIIB 2FNBA 1J1PH 5EFIA 4N8CL 2OM5A 5KVFH 2CKBH 3O2DA 3ZDZF 5EIIA 1YEKL 5ETUB 4IRSB 5GGSY 3BGFB 3V7AG 4P2RE 5ETUA 3LMJL 4L9LB 1TCMA 4RNRB 1GYAA 4L9LA 4Y7MA 1VFBB 4RNRA 2AEPH 2ED8A 5C09D 4V1DB 4F58H 3O6MH 2UYLB 3MLUL 1VFBA 3PWUB 4ZXBB 4C4KT 1TNNA 1VGKB 5GJSH 3OKLB 1KIRB 3K2UH 4FZEL 4V1DA 2DF3A 2UYLA 3PWUA 4O9HH 4ZXBA 1FFOB 4I0PD 1VGKA 1MY7A 3T65B 1LDPH 1KIRA 3OKLA 5CJOH 4FQJL 1FFOA 1X5AA 3T65A 1OAUH 4KRPC 3U7YL 2I5YL 1LK3H 4XTRD 2R69H 4XAKE 2UZXB 5FGBA 3TVMD 3VXUE 1CL7H 4XPGL 3BYYA 4HZAA 3SO3C 4U1MB 2FECI 2YD4A 3VG9C 2C4FT 2PW2B 5I1JH 5EOCH 2GSIB 4LL9A 3B2VL 2WAHA 4U1MA 5HGBB 2PW2A 1KB5B 3G5VB 1SEQL 3NH7H 2GSIA 1I7TB 1L6ZA 5LGKA 2B5IB 5HGBA 4X9GA 4XP9L 3WLWD 1KB5A 3G5VA 5B8CC 4CMHB 1I7TA 5C0CE 4HFWB 2ITDB 3KPTA 3QEGH 1HKLL 4K3HA 4B53A 2OI9B 5SV3A 3NPSC 4HFWA 2ITDA 3UX9B 4DUWA 4KI5C 5DMIL 2IPTH 4YZFE 1DL7H 1O0VA 4YHOL 1PLGH 3BRFA 4ZUTB 3SE9H 3T4AB 1MRDH 2EXYD 4CU7A 3F5WB 4KKLD 3U30C 5HGGS 4ZUTA 5ITBL 1QFHA 3T4AA 2NY1C 2DQFB 1RV6X 4HULB 1JZ3A 3F5WA 4H20H 4BH8A 4X7EC 4K3GA 2DQFA 3ZZ1A 4YEEA 3RIFF 2VLKE 2GQHA 3QJHB 4QOKE 3SE4A 1F45A 5JHDD 3QJHA 1IAIH 5IFHH 4UT9L 3INUH 1EFXB 3BPLC 4U7KA 4PJ9B 3RNQB 3I6GB 3FFCE 3I3EA 4PG9B 2FECL 5I30L 4GKNB 5GZND 1QR4A 4PJ9A 3RNQA 5ISZB 2YRLA 3I6GA 3B9EA 1GGYA 4J7RA 4IJ3C 4GKNA 2BFVL 2VXSL 4X6DF 4ZPTB 2YPLD 3IETB 5ISZA 1L7IH 2MHAB 1F6AA 1WBYB 3WKML 4P5TB 2Y5EA 3CFCH 4ZPTA 4PJ5E 1U2HA 3DLQR 2MHAA 3RDTD 1Z6JT 4P5TA 2FH6A 2XWBB 5A3ID 4F33B 2AQ3A 2PYED 3RPKA 3C6SB 1UVQB 4F33A 1KXVC 2EDHA 4GS7C 4WFGD 2VXTH 1JPFB 1SMAA 1RD6A 3C6SA 1DDHB 4X7SH 2IFFH 3AU1B 1DSFH 4N5ED 1JPFA 1QSED 4ETQB 4LRNL 2VZVA 1DDHA 5DVMA 3AU1A 1KCRL 3OAYK 1A3RH 1OLLA 4ETQA 1DQML 1X6LA 5EH1A 1CGUA 3LQAH 1E4WH 1EMTL 3U4AA 1U42A 2VISB 3EFDH 1HCFX 1KENL 1BQUA 1RUPH 3QFJE 4S1SL 5C2UB 5GS1C 2VISA 1UWXH 2QHLA 2YXFA 5E99H 4UTBH 4PLJD 5DD1L 3X17A 1TJGL 1JZ5A 1SQ2N 4D3CH 3B43A 3QUZC 4NWUH 4TVPH 1MLBA 4HZLB 5H35B 3MJGX 2V2TB 1CVRA 5CP3H 3OPZL 3OF6A 5A2IH 3UJIH 4HZLA 5H35A 4QRPD 2V2TA 3UXFA 4XP1L 2DBLL 1PG7W 3TO4B 5DFTA 5TPWH 4FMFA 4FG6D 4QRQB 3TO4A 3RJQB 3QUXC 4JHAH 3O9WC 2O5YH 5DFVD 4E0RB 3IDGB 3D85B 3O3AA 4ZS6D 2NW2B 1EO7A 5KW9L 5EA0L 3IDGA 1G7QB 2VDMH 2EXWD 4AL8H 3D85A 1OARL 2HRLA 5DFWH 2NW2A 2H41A 5KAQG 1G7QA 2GTZB 7FABH 4JPVL 5GRZA 4LOUC 4YHPB 2MTPA 2R0ZL 2UVEA 1QFPA 2GTZA 3NOIA 1EK3A 3U4BL 1MFCH 3EHBC 4YHPA 4FFZH 4Y16D 4NUGH 4PJFE 1Z0NA 1OAXH 4OZHB 1YYLL 3MCG1 3V5DB 2YK1L 4ZUVA 1K5NB 3KPSD 3DXAB 4OZHA 2VNCA 4YFDB 3V5DA 1K5NA 4KJWD 3DXAA 4NRXB 2XFXB 3MACL 1MFDH 3VWJC 5IMOB 4TVSa 3K7UA 4X4ZA 3RBSA 3RY4A 4X8XA 4NRXA 3RHWF 2XFXA 4ERSH 5FCUL 3HMWH 1ZVSB 2E8YA 4XVUC 3S35L 4CL7A 2B39A 2JCCF 4R97C 3UAJC 4RIRB 2DJSA 4AG4L 3BZEA 1ZVSA 2DM2A 4PJCB 3L3OB 3NIDF 4RIRA 1NCAH 3KPOB 4UT7L 2B2XL 3U7WL 5KANI 4M93B 4PJCA 3L3OA 1ZV5A 4Y89A 3ARGD 3KPOA 1WCBB 3FB8B 3C5SB 3N85H 1OT1A 1Y0LB 1T0PB 1QSFD 4YBHA 3NBNA 1WCBA 3C5SA 5TE6H 3CSYB 4BZ1H 4EDWH 1Q9OB 3HI6H 1HILB 3CSYA 5FV2A 3IDNB 3MLPA 1Q9OA 4LCWD 1BVKB 1HILA 1FDLH 3IDNA 3GMPB 3QAZB 3QWRD 1BVKA 2IANB 4HS3B 3GMPA 3P0VH 3PGDB 2W1NA 5DC9B 3UTQB 2IANA 4JY6B 4O4YH 2Z8RA 2B1AH 4YK4B 3BYTA 1NL0L 4HS3A 5KVDH 2Z31D 3UTQA 2ILLA 4JY6A 1JTTA 4P23C 3S88H 4RX4A 1I8MB 2AGJH 2BVEA 1A7NH 3MA7A 2WW8A 1TJIL 1I8MA 1NBVL 2X9YA 2XZAL 3FQRB 3HAEG 4WUUE 5JW4N 3MUGB 2BXZA 2FX8L 3GKWL 4M4RA 1R6VA 3BD3A 3FQRA 3OG6B 3RI5K 3GSQB 4UZGA 3FKUS 4XP5L 2VZSA 4G3YL 1DFBL 5JZ7D 3GSQA 4JREC 4FQQB 1WWAX 4FQCH 1YEHH 5HHQA 4FQQA 3MNWB 3PWPE 4ZODA 5D7LB 2X42A 3MNWA 5ADPH 1WWBX 4PGCB 5HHOE 4X9FA 5D7LA 1FRGL 2D7OA 1SM3H 4PGCA 3D9AL 3L3JB 3DARA 3OJ2C 4RMVA 1W8OA 4LLDB 2PTTB 3L3JA 3VDAA 1AC6A 2AXHA 1YNLH 4LLDA 2PTTA 4QRRD 1UCTA 4CAGA 1F4WL 4PV9B 2X1WL 4NM4L 2Y6SC 1UKQA 5H2BB 4JFZL 1WVZA 4PV9A 3W11C 3UBXG 1RJZB 2JJTA 1WK0A 5H2BA 3LPFA 4RMTA 1KCSL 1B2WL 2PW1B 5TQ2L 1RJZA 3D3VE 5JQHC 5LVEA 5GGTH 5LJYH 4UINL 2PW1A 2VLRB 2FZ3B 2F19L 2OQJB 3FO1B 4Y4FB 4PLOB 3I50L 1UXSB 4GG6F 2VLRA 2UZIH 2FZ3A 1ETZB 2OQJA 3FO1A 2EH7L 4Y4FA 3WHXA 1UXSA 1OVZA 1ETZA 4FNLL 4ZAKD 3V52L 3P4LA 4IOIB 3R0NA 2A73B 3DHJA 3VFSB 5BV7H 2X9WA 3HKFA 1KCVL 1VEOA 4IOIA 2A73A 1ZTXL 3VFSA 1OTUC 4X6DB 3WDIA 2LABA 1OLZA 4C56D 1XF4B 1U9KA 4X6DA 1X5ZA 1XF4A 3S3PA 1NGYB 1XCTB 1GGIH 1PG7L 2N4IA 1YUHB 3Q6FB 5D72H 3GI9L 3G5XB 4KTEH 3LEYH 4QRSB 1FFNB 3BEWB 1NGYA 2D7PA 1RUKL 1IZJA 1YUHA 2HT2C 3Q6FA 1HINH 1RUAH 4KZDL 3G5XA 4LKCB 4QRSA 2Q8BH 4ZTPH 1FFNA 3BEWA 3ZKMC 1JGUL 2EIBA 5DQJB 4PRPD 4ELMF 4KJQC 1I85A 3CVHL 1Q1JH 4LKCA 4HQQL 2NY2C 5DQJA 4LCCC 5MEOB 3A6OA 3MJ9L 3S35X 4AZ8A 3VH8G 4PJXF 1CXEA 3QQNA 4GOSA 5F7NC 4M48L 5MEOA 1MCWW 2BSSB 3K74B 4JRYD 4XCEB 3X13B 1JK8B 5KS9F 5FYJH 2FBJH 2O5XH 1T2JA 1WFOA 4XCEA 4YHKH 5IB5B 4OLEA 1JK8A 5IMKB 1A14L 1A6PA 3GSRB 3FQWB 5IB5A 4NC0B 5EZLB 4Q9RH 2OJZL 5IMKA 3PL6D 1WAAF 4JFFD 1OAQH 3GSRA 3BESR 3FQWA 5L8LB 3V7AE 1CR9H 2X1XR 2UUDK 5GS2D 3SJVD 3PDGA 3DRTB 4JPKH 1EO8L 3DRTA 2P4AB 4JZOB 5HYSG 1T21B 4JZOA 2NY4B 4XNUL 3OHXB 3MJ8A 1T21A 4GXUN 1D5IH 4HV8B 3OHXA 3H9HB 3IAGC 2WWMC 1H3XA 2P43B 3N1QC 1TQBC 3WYRA 3O0RH 3MA9H 4R6UA 3SDDB 1EA9C 3VWKC 1UJTA 3BUTA 2WM0A 3SDDA 4OI7A 1LO4H 2LTQB 4Q6IC 4H8WL 2AAVA 1HE7A 3NACH 4R2GD 5GRUL 2HMID 4UV7H 3VD5A 1NH6A 3TBYB 1UWGH 1P4IH 2FJGA 2W38A 3HNSL 4MDIB 2XZCH 3TBYA 4G8GE 4LCIH 5IBTH 4NZRL 4MDIA 4YXHH 2IQ9H 3DHMA 4LLYB 5T3ZL 5EZIH 5E6ZA 5C2BL 1YNKH 3CMOL 4MQXD 5E5UB 4LLYA 1G6RL 3GKZA 4PV8B 4OZFB 2A38A 3RJDA 2JCCB 4JRXE 4Y19E 4PV8A 2APVA 2KZWA 4OZFA 4OLUH 1NCWL 5LGHH 1I1RA 2JCCA 2XTLA 5DLML 3QDJB 3QRGL 4QHNB 1YEJH 2AS5M 3BD4A 1UM6L 2WUBL 3SQOH 4YH6A 5EG6C 3QDJA 4QHNA 4FZ8H 1F4XL 1PKQB 3PHQB 1TJHL 5CBEB 2J8HA 1PKQA 4KFZC 1D5ZB 1FAIL 4DEPB 1J8HB 5FYKU 1XGTB 2AJ3B 1D5ZA 3IJYB 3RVXD 1J8HA 1K6QL 3BZFB 1XGTA 5E9DA 2AJ3A 3DMMD 3BZFA 3OAZK 1VADB 3BN9D 2CKNA 4GBXB 3AFLA 5EB9A 1B3JA 1VADA 2IH1B 3CK0H 4HPOL 4JB9L 3QNZB 1VSCA 1EX0A 4GBXA 1FBIL 2KPNA 1L9NA 1RUQL 4Y5XB 2IH1A 1OTSC 1NCBH 3QNZA 5ADOH 3HCVB 3TLRA 4IBLT 5J6GB 2GYSA 4J6RH 3QDGD 2CUIA 4JO4H 4MNQD 4XVSL 4Y5XA 5HHMB 4Y5VC 3HCVA 5J6GA 3I6KB 3NFSH 4RSVA 4MLSA 1CS6A 4KRNA 4TRPH 2L0DA 1PG7X 3BH9B 3I6KA 5JW4Q 1QBLL 5DURB 1I9IL 3WIIL 3BH9A 2Z92B 5SWQB 1JNNH 3BOVA 4W81A 1TVDA 4OI8A 2R1WB 2Z92A 5SWQA 3I9GH 1QFUH 5CJBA 4W6WB 3ZE2E 2R1WA 2Z91B 5E70A 4TULH 1KTKE 1EHAA 1YECH 3CGTA 5D7SL 1MCCA 2GJZB 4N5UA 2R4SH 3UMTA 1DCLA 5ICZB 2EDNA 4NN7C 2XKNB 2WV3A 3HNTH 1FNHA 2B8OT 5ICZA 43C9B 5L0QB 4KUCF 1TMCB 2XKNA 5AD0B 4K94H 4JFDA 1H0DB 1GHFL 1WITA 43C9A 5HI4C 5AD0A 2XWTB 1H0DA 4D9LH 1HXYA 2XWTA 1FGNH 1NCDH 3LS4H 3UTOA 5KSBB 3TZVB 1K2DA 3ZE0F 4GAFB 4JCMA 2DQJL 3EDKA 1ED3B 3LPGA 4L8DB 5KSBA 1TZGH 3BRDA 3T0DA 3NA9L 2D7TL 3TZVA 4LSTH 2AK4D 4K55A 3V2AR 4MQ7B 1L0XA 4L8DA 1ZT4B 1ED3A 5I74B 2P5ED 1F11B 5JOEA 4KQ4L 4WCYH 3DX7B 3QIUC 4MQ7A 5FO8B 2CGRL 3CXDL 5D7JC 1F11A 4JDZB 3DX7A 4GG6B 4JFHE 3W39B 4WY7H 5FO8A 4G6KH 5I19L 3SHSA 3ARBB 4JDZA 1EZVX 4GG6A 1A7PL 3W39A 1MI5B 3ARBA 4NZTL 4KPHL 3REWB 3HG1E 1B0GB 1MI5A 2R2BB 3SBWA 2DQTH 3REWA 3O6FC 1B0GA 1NBQA 5BO1L 2R2BA 4R3SB 2GI7A 4FABL 2OTUB 3K8KA 5IHUH 4NRZB 4R3SA 1NBYB 1U36A 3D25B 2YD3A 4KHTL 2OTUA 3ULVL 3BEVB 5J7CC 4LGPB 2W9EL 1WFTA 4NRZA 1NBYA 1WISA 3D25A 3FN0H 4U1JB 1EFQA 4Z8FH 3KDMB 4YDLB 3BEVA 3ARZA 4U1JA 2AXJA 2BY0A 3KDMA 5B22A 4ELMB 1W2KT 4JM4L 4ELMA 3FMGL 4TUKH 1BF8A 3JV4B 1RHHB 4P2QB 3BVNB 3HPLB 4PJXB 1T04B 4APQC 2FBOJ 1IVLA 4UB0H 3D0VB 3WN5C 2F58L 4EN3C 5AYUL 3CSGA 3JV4A 1I9JL 1RHHA 3DVNB 4P2QA 3P4MB 1GC1H 3BVNA 3HPLA 1T04A 4PJXA 3HC3L 3DVNA 5KS9B 1QLFB 5KS9A 4OCMC 1BGXH 1JF1B 4PRHD 4ZOAA 2FEDD 4KHXL 2R8SL 5KTEL 1QLFA 3ARPA 4XPFL 1JF1A 1QNZL 1T1YB 3VFWA 3RX7A 1AI1H 1WAAA 1T1YA 2Q76B 4Z7NF 2ADIB 5T3ZD 4AENA 5FDWB 4LPWA 3QWQB 2Q76A 4UNVA 2ADIA 4XZUB 5C09B 1UZ6F 4FP8H 4OCWL 5FDWA 5GGVL 4L4TA 1Y6NR 4CDHA 5C09A 2MNUA 3T3ME 3HFML 1UEYA 3MGOA 2HFEB 4I0PB 3DVIA 1WIOA 4Y1AE 3SGKA 4P4RB 1HEZB 2NZ9C 4I0PA 3QUZD 5D2NB 5LAXB 4U49A 4R4ND 4P4RA 3RU8H 1HEZA 3RVTC 3WD5H 5JDSB 4WRLA 4GXVL 2A6JB 5D2NA 5LAXA 4YGVB 3TVMB 5JDSA 4OKDA 2EYSB 5EZJB 2A6JA 1URLA 4UNUA 1KPUB 2DIJA 4JHWH 4ODBD 2Y23A 5CINH 4YGVA 5KSUB 2AJUH 2AERT 2EYSA 5EZJA 1KPUA 1WWWX 5KSUA 3TFKC 5E2UL 3QUXD 3ARDC 4K9EH 3H8NA 5D70L 5DT1H 4LSQH 2WINA 4AIZB 4L1DA 5GRWA 5C9JB 4Z6AT 2YRZA 3S37L 5SX4H 1WBZB 3NCFB 1FNSH 4RGNE 3UC0H 5C9JA 1WBZA 3EFFB 1GPOH 4HPYH 2P45B 1OAKL 4GRWE 3EHBD 4LF3B 3TH4T 3MO1B 3EFFA 5CILL 2GAZB 1MREL 4BQ9A 4LF3A 2EE6A 4JFOB 1CLCA 1RVFL 4PBWD 3DRQB 1GZPB 2GAZA 3DETC 4YJZL 5I75B 4Z7VF 4MA1C 4JFOA 2XWJA 1KUMA 3DRQA 1GZPA 3ULUE 1FGVH 1K3ZA 3VWJD 3K4AA 2K9UA 4QXUH 2XRAL 1UA6L 1IFHH 3MV11 5SWZD 3E6HB 3HMXA 3UTZB 3PQYD 4XVUD 1G7JB 4LSVL 4JDVB 5C3TA 4HIHB 2FB4L 3E6HA 3UTZA 4GG8B 4JDVA 4HIHA 4O58L 3CC5B 3CFDB 4U1KB 4GG8A 4LVHB 15C8H 3CC5A 2YPLB 4O02L 2JJWA 3CFDA 2P5WD 5I0DA 4U1KA 3QXTA 4DGYL 2CJUL 4KVCH 3WXWL 3WUWG 4IMKC 3RZCD 2YPLA 3H3BC 4NGHL 3RDTB 3KJ4B 3CH1B 5E4EB 3VGBA 3BHBB 3SDCC 4JKKA 4YGAB 1UM4L 4DUVA 1IEAB 3CH1A 3QA3B 3TBSB 4CVZB 4OM1L 5TFSL 3C60D 3C2AH 2YD9A 1IEAA 3QA3A 3MRBA 3TBSA 4CVZA 4LVNB 1BFVH 4I77L 2B0SL 4XCNB 4WW1B 5IF0B 5DRXB 2KBGA 3MRIB 1U58B 1S5IL 5DVKA 1IGML 4XCNA 4WW1A 5IF0A 5DRXA 3MRIA 2IPUK 1U58A 3BH8B 1BEYH 2WBJC 3K0WA 1JYVA 1J88A 4HMEA 1CBVH 3BH8A 2DKSA 2ADGB 1WT5C 2QV2A 1N64H 3OB8A 5DK3A 5GHWL 1LO2H 2K7QA 2VDKL 2ADGA 1B0RB 35C8L 4OAWB 5FM5M 2CLVB 4Q97A 2BRQA 2XPGB 1B0RA 2YXMA 4OV6F 4OAWA 3RWCB 5DS8B 3M1BB 2APTA 2CLVA 5BVPL 1RMFH 2IF7A 2XPGA 2HLAB 1N8ZA 3RWCA 5DS8A 5JW4M 3KLHD 3MOBH 2BXYA 2HLAA 4QRPB 5CJQL 1H15B 3V5KB 4WW2C 3BDBA 4NQEE 1OCWH 3RWJB 4QRPA 1H15A 1JFQL 3VRLF 3LKOA 1CFSB 3RWJA 5E08H 1EAPB 3RVUC 5EIVA 2AV7B 2DQDL 1PX3A 1WBXA 3DX8B 1EHXA 1JTPA 1C16B 1EAPA 4YWGH 3WO4C 5T33H 2R29L 1HYSC 3DX8A 1C16A 1TFHA 5CUSL 12E8L 5IQ7H 3OSKA 3TF7C 3QIWC 4L29B 1MOEA 5J56B 1I1YB 2IWGA 5EULV 1HIML 2Y6SD 4YDKH 1U3HC 1XGRB 4L29A 4TNWF 4X98A 5D1QD 1I1YA 1WQVT 1XGRA 5D93B 3O4LD 4Y16B 1F02I 4I2XE 1CFTB 3HR5B 2DI8A 3VMOA 2VLKD 4YLQT 4Y16A 1MIMH 4ONFH 1CFTA 2Y36L 3HR5A 4P9HC 3KPSB 3V0WH 3GZKA 4MAYB 1MCKA 5FHAL 3WMSA 4A2MA 3KPSA 2H2SC 4U31A 4XI5C 4MAYA 1GGTA 2A77H 2GJ6D 1S7SB 4POZC 1I1AC 3HNVL 6FABH 1P7QD 3S37X 2V2XA 4LP5A 3VXSD 4LU5H 1S7SA 5DJDB 3R1GL 3F7RA 1OTUD 4H88H 5DJDA 2NY5H 3ZL4L 3ARGB 1EIBA 1P1ZB 1KIQB 3ARGA 4HCRA 4QTIL 2JE8A 3KR3H 5JHLH 2IG2H 1KIQA 2BNRE 2V2WB 2AJZB 4QCIB 1R3IL 4LCWB 3MGAA 2V2WA 2AJZA 3TYGL 4QCIA 4G6FB 1X5FA 4LCWA 1T03H 4GSDH 4GKZB 2P8MB 2EKJA 1Q0XH 3QWRA 1L7TL 2NY3C 4GKZA 1UXWB 3IJSB 3LCYA 4WO4B 2P8MA 3ZYJA 4JO1L 4M7ZB 2Z31B 1W72H 1WEJL 4I0KA 1YEFH 1UXWA 3IJSA 3QDMD 4WO4A 4X99B 5EBGA 1BQLL 2Z31A 4FQ1L 4OD3L 1HOCA 1IT9H 4W4OC 1TXKA 5JIKA 2BVUA 1OD9A 4NO0D 1OWRM 2E27L 3MGTB 4EUPB 1N3NB 3WJJA 4Y4HB 4XRCB 3F8UB 3MGTA 5CP7B 4EUPA 2BOBB 1GJIA 1MJ7H 4TOYH 1N3NA 5BS0B 1P6AB 4HAGA 4F7PB 4FQ2H 4PP1D 1T6VN 4XRCA 4Y4HA 1V7NL 3GSUB 2YPVH 5F7LB 2X41A 1D9KC 5CP7A 1OTTC 1CD1B 2BOBA 5BS0A 4RMWA 4F7PA 3G6JF 3GSUA 3S34L 5HVFB 1CD1A 3OQ3B 2RIKA 4YHNB 4TSCL 1ZE3C 1BQHB 3TN0B 1RZKL 4LASH 1KXQE 1KLUB 1V3KA 1WIUA 4J4PC 4HW6A 4YHNA 1J1PL 1YA5A 1BQHA 3TN0A 1TPXB 5KVFL 5ISZE 2CKBL 3EDDA 1ZK9A 5J6HB 5CCKH 3BDXA 2WNGA 2E7BA 4PBVC 4HBQA 4HS8H 5D1ZD 5J6HA 1SY6A 4RGNC 2NX5D 2E3VA 2P24B 2VZ3A 4BH7B 4DOHB 3VWKD 1MHEB 2P24A 4WI6A 4F58L 2COQA 3O6ML 4BH7A 3ROOB 3ZKXC 5E2WH 1MHEA 4X6FB 3BT2H 1DBKH 4GAJH 5GJSL 1A64A 3K2UL 5ELIA 3ROOA 4O9HL 4KMQA 1N5YL 4O00A 4X6FA 2QHRH 3BPNB 3GSOB 1LDPL 5CJOL 4OFVA 4Z7VB 1X5XA 4BUHA 2VDPH 3RGHA 3GSOA 6CGTA 1OAUL 3ULUC 5E1AB 3H9SB 4JPWH 1H8NA 1ZWIB 1IGCH 1LK3L 4KI5F 4Z7VA 4S1QH 3KHQA 1IAII 2R69L 1IC7H 5E1AA 1JYXA 3H9SA 3BPOB 1ZWIA 3SE8H 1CL7L 2W60B 1KJ2H 4RFNB 2JJVA 1G0DA 1T1ZB 4QRTB 5I1JL 4UI2A 5EOCL 4XCFH 4ZAKB 4CMMA 2RAMA 3TC9A 1T1ZA 4QRTA 4PBXA 1NMBL 4UTAH 1GCFA 3NH7L 4LMQE 4ZAKA 1KN4H 3T2QA 5DXWA 1EO5A 3O3EB 1AO7D 3OG4B 4UQ2B 4C56B 3NGBC 3QEGL 2ZNWA 3O3EA 4UQ2A 1J0KA 3DV6B 4C56A 3MV7D 3E8UH 5D7IF 3WIHA 2IPTL 2OZ4H 1DL7L 3DV6A 2E7MA 1PLGL 5ESVB 4XNMA 1BP3B 3SE9L 3THMH 1MRDL 5ESVA 4AH2B 4NOFA 4AEHL 4PRPB 1VGEL 1ZOXA 1HHKB 1T22B 1XCQB 2Y7QB 3MRMB 3IB4A 4H20L 4AH2A 3S8WA 1T89C 4PRPA 1HHKA 1T22A 1XCQA 2Y7QA 3MRMA 4F9PA 4XMKH 5D71H 4MXWL 4N1CA 2H26B 4R0LC 4FTVB 4PRDB 2B4CC 2H26A 1M4KA 5BXFB 1CFBA 1JHTB 1IAIL 3VMNA 4FTVA 5IFHL 3INUL 4PRDA 3GBMH 3BI9X 5BXFA 2ZCLH 1JHTA 3BW9B 3HE6C 3IDJB 3F62A 1O5DT 2BHZA 4OZHE 1MLCB 4RFEB 1J5OH 3PL6B 3BW9A 4JFFB 1QG3A 5T5FH 1U8LA 1KB9J 3IDJA 4PYGA 4WEBL 3DXAE 4RFEA 1MLCA 3PL6A 2LV4A 4G9FD 4OQTH 2V7NB 3CFCL 3UO1H 4PREB 3PUCA 3DYMA 4MXVE 2PTVA 2I60H 2V7NA 1INEH 4PREA 4IDLA 2PF6A 1PY4A 4LSDA 5D2LF 3U7AA 4G6AC 2J6EA 1A6AA 3B9KB 3D69B 4LRIC 4R7NA 4X7SL 2IFFL 1DSFL 3UYPA 1Z9SA 3B9KA 3IDMB 3MBXH 3TESA 4TSBH 2BVYA 5I16B 2CR6A 5CSBA 1A3RL 4ESKA 3NVQA 3IDMA 3LN9A 4KUZH 5I16A 2CO7B 4EIZC 3ARTA 3ILQC 3LQAL 2Q20A 4YNYB 3EFDL 2X89D 2XNAB 3DIFB 1ZGLP 4ZO6A 4YNYA 3FRPG 2XNAA 4IRSC 3DIFA 3ZDZE 5ICYA 5E99L 4R2GB 4UTBL 4FXGB 5HVWA 5L6YH 4D3CL 3O4OB 4FXGA 2RGSA 4NWUL 4TVPL 2E7CA 5CEZE 3FB5B 1F6FB 4E9LA 3UJIL 3AREC 3P11H 3FB5A 3SCMC 5KN5B 2FD6H 1CQYA 5TPWL 3V6FB 3QZWG 3MRRB 3DVFA 5KN5A 1J0YA 3X3FH 4OCRH 1FC1A 3MRJB 4W68A 5AEAA 4GKSB 1DVFB 4JHAL 3V6FA 3MRRA 1B6DA 2O5YL 5IESH 5T3XH 1RIVH 3MRJA 3WNOA 2VLLA 1DVFA 1QYGH 2O93L 3F7YB 5H94B 4HMCA 5MI0C 2VDML 4AL8L 1JGLL 5TE4H 3F7YA 3NABH 5H94A 5AYQA 7FABL 2ZUTA 4GKOA 4LHQB 5IIEB 1MFCL 1J0HA 2OCFD 3CLFH 4FFZL 2EIDA 4OI9A 1I9RH 3DMMB 4NUJB 4NUGL 5DGQA 4CMHC 5JR1H 1OAXL 1ONQB 3TA3D 4YDVB 4PY7B 4HLJA 3DMMA 4NUJA 1NAKH 1QUNA 2DM7A 2CDGB 4NO3B 5FO9B 1ONQA 3VD3A 4YDVA 4PY7A 2CDGA 2XOTA 3R0MA 4NO3A 3W5MA 5FO9A 1MFDL 2NY6B 3QSKB 5DD0L 3S4SB 4KK8C 4LFHG 4ERSL 3HMWL 2X4QB 4JHBA 1JGDB 4MNQB 4KKBC 3L3IB 1NFDE 3S4SA 2C3WA 4CN6A 2X4QA 5E24E 1JGDA 4MNQA 4JGMA 3L3IA 1WV7T 1BD2B 4M61A 4H1LB 1J8KA 1CZ8H 1NCAL 1LO5B 3HE7D 1VACB 1BD2A 4RISH 4H1LA 5EOQH 1LO5A 1VACA 2VLRE 2RB8A 3N85L 4DVRH 4OD2B 2NPLX 2VDLH 4X83A 3G6JB 2W92A 5TE6L 4BZ1L 4EDWL 4PJ9C 3G6JA 3NMEA 3HI6L 4YAQB 4IMLB 4Y2DD 1NDMB 5FYKE 5A43C 4K3EH 4YAQA 1FDLL 4IMLA 1JL8A 2NZ9D 1NDMA 1QEWB 4MLIA 1F97A 3SDYH 2RJMA 4P5TC 4X6DE 4KRPB 2A83B 2KUTA 5IMMB 2QADD 4JPIB 5FHBH 3RVTD 1QEWA 2P7TA 3P0VL 5IROC 4L8SC 1AHWC 2A83A 4HIJB 5IMMA 4JPIA 2B1AL 4KRMB 3OWEA 4OT1L 3S5LB 5KVDL 4HIJA 3VG9B 4X4XB 4Z9KB 1A7OH 3S88L 2AGJL 2APBA 3RVVD 1A7NL 4NOBA 4X4XA 2ICWI 5GISH 1S3KH 3ARFD 3BKMH 5B8CB 1MWAH 4CVUA 2DD8L 3LHPL 2X4TB 4JANB 4HFUH 1JUFB 4HGKC 5B8CA 2P5EB 4UMGA 3NPSB 4QHKI 3UJJH 2X4TA 5E8DH 3RKDD 1JUFA 2P5EA 1FE8L 1HQRB 2D2OA 4FQCL 4WFHE 3IYLW 1YEHL 4YXKH 1I7RB 5DJZB 3VD7A 4HWBH 4NKIH 1HQRA 4LCYB 4OLZH 3KPPB 3U30B 3EDFA 5GGQH 1I7RA 5IW6B 5LGJB 3UBXI 5T1KD 5ADPL 2NY1B 4LCYA 3KPPA 2LU7A 4PGZA 5IW6A 5LGJA 4HKXB 3TWCH 1U91B 3NAAH 1SM3L 3QCVH 1QA9B 2QSTA 5HDQH 1KB9K 5CGYD 5DDHB 3DX6B 2A0LD 4HKXA 4XBPB 5J3HD 1U91A 4DKEL 3W0WD 5DDHA 4P59H 3DX6A 4XBPA 2X44D 5D7IB 1YNLL 2FEEI 4XNYH 3QQ4B 5FGRA 1LNUB 5HYJB 1I3VA 3BPLB 1LE9B 2ZPKH 3QQ4A 5HYJA 3NCMA 1LE9A 1BHGA 1M7XA 1QVOB 5CZXC 3V7MA 4IJ3B 5DI8B 2HTKC 1QVOA 3E6FB 4B50A 3ARRA 4MXQD 4IS6B 5DI8A 3VXQB 4HGWB 3E6FA 4AYFA 2Y4SA 2N56A 4IS6A 3VXQA 4HGWA 3T1WA 2OR9H 1U3ZA 4YE4H 4MNHB 4HK0B 1DR9A 2UZIL 1KLGB 1REIA 3U0TB 1FYHB 4ALAH 2DQCH 1LO3H 4GS7B 4MNHA 1K8IB 4HK0A 4P3WA 1YC7A 1NJ9B 1KLGA 3U0TA 3GDBA 4JO2H 5M94B 4PRHB 1Z3GH 1K8IA 3QUMH 1FP5A 1NJ9A 5BV7L 2DLEA 3WBDA 4EZMA 3MBED 4YDIH 4IIQC 2VC2L 4ENED 3GSVB 1XGPB 1ND0B 4Z0XB 1RZJH 2FSEB 1NANH 3GSVA 1EERB 1CDYA 1XGPA 5IBUB 3U1SH 1ND0A 1GGIL 4Z0XA 2FSEA 2F53E 5D72L 4KTEL 5GS1B 3LEYL 3B9VA 2FEEL 3CDGB 3MV9D 5D2LB 1HINL 5GS1A 2AKRB 5J1SC 2Q8BL 4NHUB 4ZTPL 1CCZA 3CDGA 1T66C 1BWWA 3NIDE 5D2LA 5ALBH 5GXBB 1Q1JL 2AKRA 1R3KB 5J11B 2F8VA 4NHUA 4OZGE 4UAOC 4CUCA 1G84A 3QUZB 5DD6A 1PEZA 1R3KA 3QI9C 1PKQE 1MUJB 3MSPA 3QUZA 5SWSE 1D5XB 2ZOLB 1MUJA 3AAZA 2CK2A 4L9DA 1D5XA 5DJ8B 1XIWD 2ZOLA 5FYJL 3SGDH 2O5XL 1X5HA 2W0KA 3WNKA 1KPRB 2NY0C 3RVUD 2KDGA 4MJID 2XA3A 5CD5D 3QUXB 3PP3H 5DJ8A 3QAZC 3O9WB 3T77B 2GUOA 1KPRA 5F1OB 2I5YH 4Q9RL 3QUXA 1HYSD 2EDQA 1RUMH 3O9WA 1NSNH 1OAQL 3T77A 1RURH 4HK3N 4OM0L 5EBMB 5IR1B 3AS0A 1CR9L 3O2DH 1U3YA 5EBMA 4NKOB 2QEJA 1UG9A 3UTTA 5IR1A 4UIMB 4JPKL 1U3HD 4NKOA 2E9BA 4UIMA 3Q5OA 5HHME 3ESVF 3LY6A 3WE6B 4D9RD 2VJXA 3GIZL 1D5IL 2IGFH 3WE6A 3VXNB 4XAWH 4WTZG 5A2KH 5HSFA 1J0JA 4U3XA 3VXNA 3OAZH 2I26N 4OCXH 2GJJA 3VWJB 3O0RL 4PS4H 3JV6B 3MA9L 1CD8A 2PNDA 3FZUC 5B3NA 3CFIC 2EC9T 4ORGB 5SWZB 2QQLL 3PQYB 3VWJA 2CRMA 3GGWB 5DSCB 4POZD 3UROR 1KTLB 4R97B 1G7IB 4ORGA 2APXA 5SWZA 3PQYA 3WO3B 4Y5YC 1LO4L 5DSCA 5HHXH 4ZUWB 1KTLA 3H42H 1V8HA 1G7IA 3O3DB 4ZFOB 1ERNA 4RZCB 4UV7L 3MNZB 1CICD 4MNGE 1UWGL 3O3DA 1SVCP 2P5WB 1P4IL 4P4KC 4ZFOA 3TIDB 2XIDA 4RZCA 3MNZA 3QCTH 2XZCL 1YQVH 1OT2A 4JFED 4LCIL 5IBTL 2P5WA 3DUUB 2HH0H 3TIDA 1XZ0B 4YXHL 2DKMA 2IQ9L 4OF3A 4XNXH 4NHCH 1KB5H 5EZIL 1FORH 4J23A 1BJMA 1XZ0A 1YNKL 2FIRT 4KTYA 4Z0BH 3JTTB 4MJ4A 2ENYA 2NXZD 4Z7WF 1PFCA 3JTTA 5IB3B 4OLUL 4JZJB 5LGHL 1Q38A 2E9IA 3IDYC 1JMXA 5L2KD 3VFUB 5IB3A 3ZT5A 1YEJL 2DL2A 1HCVA 3SQOL 4O51B 2MFNA 5JOPE 3KJ6H 4DVBB 3VFUA 4FZ8L 1IM9D 3QH3A 4U1IB 4O51A 4P23B 1UKSA 1ZA6A 3IGAB 4GG6E 5K59F 4U1IA 4EXPX 1ZHBA 4P23A 3IGAA 4ZTOH 5F9OH 3T09A 4EXKA 3Q3GB 1F3DJ 3P9LB 2OXHA 4Y1AD 5I1HH 5J0BA 3Q3GA 3P9LA 2JB6B 4WI3A 5J13C 3GM0A 2JB6A 2C9AA 2AEQH 3GMMB 5TF1H 3VXUB 2XN9D 1KENH 2NLJB 3CK0L 4AEEA 3DBXB 2NXYD 3VXUA 3T4YB 2NLJA 5C0FA 4HUUB 3DBXA 1NCBL 1I85C 5ADOL 4EIGB 3J8F7 4J6RL 4Z7QF 1ZLWK 1RK0B 4J4PD 3BPCB 4JO4L 3T4YA 3EYOB 4QGYA 4HUUA 4MSWB 1KLFA 4IOFC 1DUYA 1II4E 1V05A 1RK0A 3BPCA 3NFSL 2Q1EA 3K4ZA 3EYOA 3QISA 5C0CB 3RY6C 3NZHH 4MSWA 2HT4C 4TRPL 3ZKQD 4WHDA 4I4WA 2QSCH 3OPZH 5C0CA 4JG0L 4P2QE 3JWOH 5DO2C 4PJXE 1JNNL 4OIIH 4TTDC 1EJOH 3WJLC 2HFGH 5CEYB 3PGFH 3OJMB 1PZUB 3GO1H 1FJ1A 3I9GL 1QFUL 3BIBX 5KS9E 1P4LB 2A74B 4TULL 1YECL 8FABB 4NYLB 1P4LA 3GRWA 2QTEA 2R4SL 2A74A 2VLKB 2J2ZA 4OUUB 4DK6A 5FGCE 4NYLA 8FABA 4HMDA 4QOKB 4GAYB 3KPRD 3HNTL 3LS5H 3ULUD 1J0IA 1G9NC 4OJFH 2VLKA 4OUUA 2BMKB 4QOKA 3P30H 4GAYA 4K94L 1F4HA 1ZVHA 3MUHL 4EKXA 5ID0B 2AP2A 5C09E 1JZ8A 2GJ6B 3FFCB 4BA8A 4K07A 5ID0A 1CFVH 1HN1A 1IGIH 5E6YA 4D9LL 3CLEH 3FB7B 1FGNL 1NCDL 2GJ6A 3FFCA 1P7QB 3LS4L 1QPPA 3QUKB 5IB2B 3FB7A 1HHGB 3BO8B 3OV6A 3WKNA 2VL5B 1FCGA 4G9DB 3WNLA 1P7QA 5IB2A 3QUKA 1TZGL 1PY9A 2NQCA 3BO8A 3DGCR 2VL5A 4LSTL 4G9DA 1PQZB 5DC0A 2XQYK 2ZSWB 1EJ6A 3PJSB 1PQZA 2H2PC 3JWDH 4WCYL 5FCUH 2XI9A 3BUYB 2ZSWA 3H2WA 1QLEH 3PJSA 3SDXF 1LK2B 5FYJD 3QO1B 4AG4H 3BUYA 4WY7L 4G6KL 2ED7A 1P5VA 3FO2B 3QO1A 2MSPA 5IM7B 1GOHA 4PJIE 3IDXH 5B4MC 3FO2A 2NY2B 2DMKA 4LCCB 4GQ9H 5IM7A 2VWEE 1LILA 5CHNB 2IMMA 2DQTL 3F7PC 1H5BB 2N1KA 4LCCA 4JLRB 3U0PB 2E6QA 5DJCB 5CHNA 5FUZH 1CXHA 1H5BA 4LSPH 3QFJB 5JMOC 5IHUL 4JLRA 3U0PA 1FG2B 5DJCA 3QDMB 4WI2A 3QFJA 4LARH 3DJ9A 3FN0L 2G60H 3QDMA 1CGXA 4Z8FL 3HE6D 5F89B 5JPMB 4LLQB 3FAXA 1ORQB 3NCJH 4TNWK 5F89A 3MRCB 5JPMA 1ORQA 4WDIB 1LE5B 4TUKL 3MRCA 1JZ6A 4EI6A 5JHDE 4WDIA 4UB0L 1LE5A 4WTXA 1GC1L 5AZ2H 2FCBA 3IT8D 2F54D 4LPUA 4EJ1C 1A6ZB 4JN1H 3VFNB 1BGXL 1A6ZA 3VFNA 4NQUA 2YPLE 1A4KB 5SX4I 2ESVD 3SDAD 5M7QA 1AI1L 4ZO9A 1E4JA 4PTUB 1A4KA 1FIEA 5E2VH 2YR3A 2R56H 1F3JB 1XEDA 3VWKB 2PYEE 1AE6H 2VDOH 4PTUA 3LKNB 1F3JA 4RCAA 2DM3A 3VWKA 4G8FB 4Q6IB 4WFGE 3LKNA 1IKNA 2ED9A 3D9AH 4CADB 1PYWB 4G8FA 4Q6IA 5CEZH 1QSEE 1WLHA 2AABH 1PYWA 4POUB 4CADA 2OJEB 4ZOCA 3C5ZD 3RU8L 4N0CD 2W07A 3WD5L 2OJEA 3D2UD 4QGTA 4JFZH 3B5GA 1OAYH 4FA8A 4JHWL 5CINL 4D0DA 4Q9BA 2AJUL 1ZT1A 4KC3B 3GHEH 3D5OF 1BREA 2HA1A 4K9EL 3B4NA 1FH5H 5DT1L 4LSQL 3T0VA 5B39B 4L3EE 1MCDA 4ZDHB 5B39A 5I2IB 3MV7B 1G9MC 1FNSL 3UC0L 4DKFH 5IB1A 4ZDHA 4U4BA 3HZVA 5LCVH 5I2IA 3MV7A 4NKMB 3ZSTA 1GPOL 2FLBT 4HPYL 2KL6A 3FAWA 3LB6C 1KCVH 2VQ1B 4Z7WB 4NKMA 1E27B 4RBPK 2OX5A 5EBLB 1MFAH 1SEBB 2VQ1A 3L5HA 4Z7WA 4MCYA 2E9WA 1E27A 3RIAK 2EDFA 5EBLA 3DX9A 1SEBA 4LNVA 5FCSH 4O5LH 4LSUH 1KACB 2HLFC 3DPBA 3KPQB 1FGVL 1X5JA 3LKQB 4QXUL 4ZSOE 1IFHL 3KPQA 4KKBD 3LKQA 1I3RB 4U6VH 3CVHH 4WUUB 4Y5VB 5A2FA 2BZDA 4HQQH 1I3RA 5BMFH 4OIAA 4Y5VA 3PDDA 4WUUA 15C8L 3U4EB 4M48H 3KPSE 4OLYH 5JORB 2CXGA 4G9FB 5MHSD 1MPAH 4KVCL 1DP0A 2FATH 1A6UH 2J4WH 3QEQD 3ZT6A 4NQXB 3NTCH 5JORA 4G9FA 3MLTA 5EORH 1GOFA 4JKMA 4Y4KD 1S7TA 4NQXA 4PJAF 4FMKA 2V5YA 4NZJA 1CLOH 3O6KL 3QXWA 2H3NA 3C2AL 5ACLA 1F3RB 1J7VR 5HHOA 2L7JA 4FS0A 4NN7B 1BFVL 2DN7A 2Q86B 4XX1E 5GS3A 3MCKA 1VHPA 2BNUB 4BKLB 4HKZB 4R9HA 4XVJH 3PG2A 2Q86A 2BNUA 4BKLA 4HKZA 5T5NG 5K93A 1BEYL 1QSFE 3OKOA 2O61B 2Z4QB 3T0BA 1DEDA 4XNUH 1CBVL 1VCAA 2O61A 1N64L 2Z4QA 1LO2L 2X89A 2A6IB 4LCWE 1NEZB 3B3IB 2GT9B 2VIRB 2A6IA 3AVEA 4CDGC 4PRAA 1NEZA 3B3IA 2GT9A 2VIRA 3QO0B 2CD0A 3D3VA 2LFGA 1RMFL 3HPJB 3ULSB 5HTSA 3QO0A 3WHE1 1CN4A 4Z7NE 5D7JB 4XT1C 5KAQF 3HPJA 3MOBL 3QIUA 2C4FU 5D7JA 1CDUA 1UZ6E 1OCWL 3CVIH 5I66B 3SGKC 4WUKH 3IS0X 3LN5B 5C7XH 3I6LD 5E08L 3QR2A 5I66A 5EOTB 3HNSH 3MV8D 4K8RH 1ZVYA 3LN5A 3O6FB 1SJXA 3IS1X 3PGCB 4NZRH 5EOTA 5T33L 3KS0J 1YY9D 3Q0HA 3VXTB 3MPCA 2OSLB 3QNXB 4XTRC 4Z7UF 3O6FA 4ODHH 3PGCA 2WWKT 3CH8A 3TVMC 5IQ7L 3VXTA 3QNXA 2OSLA 4U7SA 3SDXB 5E03A 3AM8C 4ACPA 2F5BH 4YDKL 1OD7A 5J12C 5CZXD 5C0BD 5DJAB 5F96H 3J7HA 3WLWC 2HTKD 1CG9B 3EBAA 2VWEC 4HXAL 3FHAA 4PD4J 4ODUB 3TA3B 5DJAA 5KZCD 1TJHH 1CG9A 1MIML 4ONFL 5F93C 1WIPA 5FDYA 4HLZG 1G1YA 4APQB 3V0WL 4ODUA 4PB9L 3WN5B 1S5HB 4LKXB 1A1NB 3BWAB 4PJ7E 3TT1L 4APQA 3MXWH 3IDUA 2Q7NA 1AR2A 1PW3A 4QRRE 3RI5F 3WN5A 1S5HA 4EN3A 4LKXA 1A1NA 3BWAA 2EXYC 4LNRB 4JO3H 4KKLC 1NBZB 1JPST 3VXMD 3T0EE 3FFDB 4LNRA 3MREB 6FABL 2PETA 1NBZA 5TDPB 4LU5L 5I75C 5DQ9B 2OTPA 3MREA 2JELH 3TPUB 4H88L 4Z7VE 1MJUH 5TDPA 2R9HD 2NY5L 1LMKA 5DQ9A 3TPUA 1RUQH 4JAMB 4OZFH 2EECA 2YUZA 3IF1B 5FKPB 1CYGA 3D6GA 4JAMA 4XVSH 2GY7B 3KR3L 3KLSA 5JHLL 2FYYB 2IG2L 3IF1A 5FKPA 1FZJB 5DJYB 2FYYA 3BISA 1EXUB 2DRUA 1FZJA 5DJYA 1RULH 2VXQH 4ZS7H 3N06B 3EYVB 1T03L 1EXUA 2FJFB 1PVHA 4GSDL 4C56E 1R5VB 2BC4B 3QI9D 1P7KB 1Q0XL 2FGZA 3RDTC 4TQEH 3KJ4C 2FJFA 1R5VA 2ZCHH 2BC4A 4XHJD 5A3IC 1P7KA 1W72L 1QBMH 3K1KC 3V5HA 2DLIA 3M07A 2XTJC 1IT9L 5C8JB 3ARDB 5FOBB 4PRPE 5ALCH 1IEHA 5C8JA 3ARDA 5FOBA 1GHFH 4KWUA 1MJ7L 2WIMA 4FQ2L 4OUOA 4XXDB 5C07E 2YPVL 2AXGB 1NLBH 4JRYE 3KAAA 1L0YA 4JY4B 4XXDA 1XF5B 3UZVB 3FONB 4QRUB 4JRXB 4Y19B 1XF5A 3FONA 4LASL 3BP7B 3IRPX 4QRUA 1X5LA 4JRXA 4Y19A 1KGCD 3G5YB 1RAMA 4CU6A 3MLRH 3LD8C 3T0AA 5K9JL 3BP7A 3KYNA 4MA1B 4JFFE 3G5YA 4XBGB 4RWYL 5CCKL 4P2YA 3ULUF 3E0GA 4HS8L 5L7XH 3CXDH 4XBGA 3LKSB 2GSGB 2XQBH 1F6LL 3SGJA 3SJVE 3W0WB 1J1XH 5DA4A 4NN5C 4S0SD 3FZUD 3V8OA 4PG2C 5F9DC 3LKSA 4DN3L 3IFNH 2GSGA 3W0WA 4OFIA 1RZ8B 2IBGA 2VR4A 2W0FB 5F6IC 1JNLH 2VH5H 3H7LA 3U83A 1RZ8A 5E2WL 3VRLE 3BT2L 1DBKL 4GAJL 2W0FA 5DFVC 3PWVB 4KK9C 4PJ8C 2QHRL 4OF5A 5D1XC 4I9WD 1JGEB 1YY8B 3HC4H 2HVKB 3PWVA 2EXWC 1NMCC 1G9EA 2VDPL 3C87A 1HH9B 2XACC 4ZD3H 1JGEA 1YY8A 2HVKA 4JPWL 1IGCL 4S1QL 1D5BB 3L6FA 4IMKA 1HH9A 3SDCB 3V4UH 5TQ0H 1IC7L 5K9OB 3SE8L 2R2EB 5I1CH 1D5BA 1KJ2L 4GJTB 3SDCA 4P5KB 3VJ6B 5K9OA 5GS0H 2DTSA 2PN5A 3VJ6A 4P5KA 2QLVB 3MYJB 1Q72H 4UTAL 1SHMA 2DMBA 3FMGH 1DQQB 5BRZE 3MYJA 5IG7B 3S98A 1DQQA 3RFZC 4KJWC 5JDJA 2VLJD 4WHYG 1EEZB 1IC1A 5IG7A 2WBJB 3PP4H 1U41A 5TE7H 4NO2B 1YJDH 5FECB 5CP3A 4LQ1A 1EEZA 3E8UL 1BZ9B 5I71B 2WBJA 2OZ4L 1G7HB 1FSKC 5FECA 2DQEH 4PJAB 1BZ9A 4KHXH 1WT5A 4NNXB 3X3GH 1HHJB 1G7HA 3THML 1YN7B 3VMPA 4AMKH 4PJAA 4NNXA 2F9BT 4PB0H 1HHJA 4AQ1B 4Z5RB 1YN7A 1A3QA 5DD3H 4NO5B 3NIGE 1TZIA 1EAJA 4LPXA 4Z5RA 1RZ7H 3U9PH 1NCCL 4XMKL 5D71L 4WHYH 2FR4B 4NO5A 4OCWH 1YPZE 1ZHNB 1CK0H 2DIBA 2VYRE 5FO7B 4Q9CA 4BJLA 2FR4A 1DQLH 1ZHNA 3LEXB 4WW2A 1XF3B 1XIWB 5BJTB 5FO7A 3B6SB 3GBML 2BSED 2ZCLL 4MJIB 3LEXA 3PNWB 1XF3A 1XIWA 5BJTA 2IAMC 3JV0A 1CDGA 3PNWA 5KSAD 2FH8A 1J5OL 2NY7H 1NFIB 5T5FL 5DMGD 4Z76B 3PWNB 4EI5D 4GH7B 4S0TD 1YQ2A 2YD6A 1NFIA 3QIWB 4HHAB 4Z76A 3PWNA 3UO1L 1S7RB 4UQ3A 5IK3B 2AK1L 1ZANH 2I60L 3QIWA 5F9JB 1U3HB 1INEL 4HHAA 4ZO8A 1OP5K 2D03H 3QDGE 3LQZB 1S7RA 3E3QE 5IK3A 4MNQE 1G7MB 1WSST 2D7NA 5F9JA 1U3HA 3QXVA 4H25B 3LQZA 5HD8D 1G7MA 1GSMA 3HG1A 3G5ZB 4I48B 1PD6A 4H25A 1NGQH 1VPOH 3HHRB 2IFGA 5JZ7C 3MJ6A 3MBXL 4I48A 4TSBL 4UU9B 4ZQKB 3ROLB 4Z7UB 2CK0H 1DBBL 4UU9A 3G6JE 4KUZL 3ROLA 4Z7UA 4UDTB 3RGVC 1A7RH 2VN4A 1ADQA 3B8YA 2X1PA 5IVZB 1I1AB 1RIUH 4BSWB 4I3GA 4PJBF 2QQNH 5IVZA 1I1AA 4BSWA 4HJ0C 4L4JA 1CICB 1K4DB 5L6YL 4KK6D 4MDJB 5E8EB 1AGDB 4JFEB 1UA6H 4KJYB 3LZFH 4UV4H 2YMXH 4MDJA 5E8EA 1AGDA 4KJYA 3P11L 3S3JA 1WZKA 1IEBB 4XPAH 3T0EC 1EEUA 4PJDE 2WP3T 4P48A 2NXZB 5I17B 4HSQA 1IEBA 3GMQB 3X3FL 4OCRL 4G5ZL 5I17A 5DF0A 2CJUH 2FO1A 2CLZB 5L2KB 4F7EB 1GRWA 3MZTA 2AK4E 5IESL 3GMQA 4O2CB 5T3XL 5I1AB 1RIVL 4HEPG 1QYGL 2CLZA 2P5EE 2Q7YB 5L2KA 4F7EA 3KPNB 1IM9B 4O2CA 5I1AA 2Q7YA 4RFNC 2HFFB 3RWIA 2UY6A 5TE4L 3NABL 2FLRT 1RI8A 4XPBH 1YEDB 1IM9A 3KPNA 4JFPB 2XA8H 1EUUA 2VABA 4RGMC 3Q48A 1YEDA 4JFPA 3QHZH 4Y1AB 3VA6A 5DVOA 3CLFL 4W4OA 3HAEB 4DWHA 1I9RL 3HMXH 4GMTH 2D4DA 4Y1AA 5JR1L 3HAEA 1NAKL 3BKJH 4K71C 4NQDE 1CXLA 4FXLA 4PLNC 2NXYB 2KKQA 4X5LA 5D7IE 3F6IA 3AMKA 1T7XA 1TQCC 4YBLC 2P46B 2EH8H 4J4PA 4KTDH 1U8IB 5JXED 1F00I 1DQDH 1MAJA 5DGRA 1CZ8L 2XKUA 1U8IA 4RGNB 4HH8A 5GGTA 1WTLA 4DVRL 2IH3B 4Z77B 2VDLL 5DJ0B 4MS8D 5FFLA 5I1LB 3ZKXB 2IH3A 4Z77A 1CTOA 3RAJH 5DJ0A 4E5XB 5I1LA 3G6AB 3UBXB 5BV7B 4E5XA 4PRHE 4K3EL 2NTSP 3G6AA 1YMHB 3UBXA 1BFSA 2W91A 4ZFZB 3SDYL 1CE1H 4OSUH 1YMHA 5FHBL 5AG8A 5T3ZE 5MEND 3N1FC 4PRNB 5JNYB 1U3JA 3OKYA 1J87A 2R2CA 1A7OL 4C83B 5J4MA 3BGMB 4PGDB 4PRNA 5JNYA 5DVLA 4L3CB 2JIXB 4C83A 3BGMA 3FO0H 4PGDA 3IXTB 2V5SA 2YWYA 3VGAC 1S3KL 4L3CA 1KG0A 2JIXA 1MWAL 3T08A 1RK1A 3IXTA 4WV1C 5E2TH 3NGBB 4K3JH 5BW7C 2BOCB 4HFUL 1EGJL 3UJJL 2BOCA 5E8DL 1NAMB 3CFKB 2AJSH 2EDKA 4K7FB 4YXKL 1BIHA 1GL4B 3V6ZA 1NAMA 3CFKA 4HWBL 3R1GH 4NKIL 3LB6D 2Q6WB 1QRND 3IU4H 4OLZL 2VL4A 5GGQL 2R0KH 4P99A 2Q6WA 1ZGLM 5DZOA 5AAMA 3OR7B 4P3DB 3TWCL 3NAAL 5HDQL 3TO2B 3VH8B 1CDBA 1T89A 4NNYB 4P3DA 1EV2E 2HLFD 2EEBA 4R0LB 1XGYH 4P49A 3TO2A 3VH8A 2EDYA 4P59L 4NNYA 4R0LA 4BK4A 3PIQB 1BIIB 2A6DB 3CDCA 3H9YA 2DAVA 2XG4A 3PIQA 2ZPKL 3HE6B 1BIIA 2A6DA 3QBTB 3U82B 1FZKB 3HE6A 5E7BA 1N7MH 1FZKA 4KKAD 1J11A 4MXVF 3P77B 2IBZY 1BFOB 4WI5A 2F8XC 3WDHA 1SJVA 1E6JH 4NT6B 1BFOA 1MCJA 2RBLA 1HDMB 2OR9L 2F54B 3SGDI 3PQYE 1LO0H 4NQEA 5HYSB 2E27H 4JFYB 4NT6A 1HDMA 3ZKND 4ALAL 1HWHB 2DQCL 1LO3L 2F54A 4P0DA 5F1KC 3DMMC 5HYSA 4JFYA 4KGLA 4HCRH 1FL3B 9CGTA 4JO2L 1ZGLB 2ARJB 1Z3GL 1UH4A 3QUML 4M9OA 1F4AA 3BN9C 4LRIA 1FL3A 3GSNB 4R7DB 2P5WE 2ESVB 4RFOH 2ARJA 4M6NH 4YDIL 2C1OB 5F9WC 1ZGLA 4W70A 4U1GC 2WK2A 3GSNA 2B4CL 4POYA 4R7DA 2ESVA 2C1OA 4YIQB 1RZJL 2ZUUA 5DJXB 4EUPG 5DEFB 3U1SL 3N0PB 4FQPA 4LVOB 3MRNB 4PTTB 3E3QC 4YQXH 1QACA 1MCHA 3S3SA 4YIQA 2HYMA 2D7MA 5DJXA 1CXFA 1S78D 4I2XB 4PTTA 1KJ3H 3MRNA 4LQFH 4WU5B 3LDBC 1YNTB 4I2XA 5JUEH 4IRSA 1I75A 4WU5A 1VKXB 5ALBL 5T3XD 1ACYH 1FO0B 3UTSD 1VKXA 3WFDH 3C5ZB 1FO0A 1J05B 3AREB 4IOSD 2A9MH 3D2UB 4JKPH 4P46D 1IGFH 2NZIA 3SCMB 5IWLC 4EUPH 5E95B 3AREA 1JRHH 3D2UA 4OZ4B 3EDJA 4M6OH 1JI1A 1N5YH 1XAUA 5DA0B 4FQIH 3SCMA 2I9TB 1UQSB 4OZ4A 2I9TA 1ODAA 1UQSA 5CKAA 4LPYA 1RUML 1NSNL 3F6LA 5MI0B 1RURL 4LIQE 1T0NB 4S1DC 3O2DL 1YC8A 1INDH 2BNRB 1T0NA 4RAHA 3OKEB 2HJFB 4ZO7A 1KJVB 2BNRA 1NMBH 4R96B 1BAFH 1SY6H 3OKEA 2JKXA 3LV3B 2HJFA 1KJVA 3QEHB 1QTYT 4N8VB 3LV3A 2UWEE 3ZYZA 5JIIA 4I3SH 3B2UD 3QEHA 1N0XH 2IGFL 2ZZUT 4N8VA 3P40A 4XAWL 4MD4B 2RQ8A 2JF1A 2DTMH 2IADB 4OCXL 3IFLH 4MD4A 1FZMB 2MQ3A 4OD1H 4XB8A 4PS4L 1CGTA 3JUYA 1NFDF 2IADA 5DMYA 1FZMA 4LFHD 4NJ9H 3EIFA 4AEHH 1VGEH 2R1XB 1K85A 4IEFB 3O4LE 3NCYS 5HHXL 4KKNA 2R1XA 1U8PB 3H42L 1S7UB 2VLMD 3TBTB 2EEDA 3HI5L 4MXWH 1MRCH 1U8PA 1S7UA 3TBTA 1SYVB 1KYOJ 1VFOA 3QCTL 2QQQA 1YQVL 1X5YA 2DDQL 3QEQB 1SYVA 4Z18A 2HH0L 3SGEI 4M62L 1MAMH 4XNXL 2FL5B 1KB5L 2GJ6E 4NHCL 3QEQA 4Y4KB 1LWRA 3RWGB 1FORL 3MLSH 4I18C 1EFXA 4Z0BL 2A1WH 3ECBB 2FL5A 4Y4KA 4PG9A 3RWGA 3VXSE 4WEBH 3ECBA 3WIHH 3QIBD 1YMMD 2DS4A 2PYFB 1NKRA 3IETA 1S9VB 4NQSB 1WGOA 3BIKB 3ZHLA 4L8SB 1AHWB 1WBYA 1T4KB 2PYFA 3KJ6L 1S9VA 5IROA 4KZEH 3BIKA 1OWWA 4L8SA 1AHWA 4GRMB 1T4KA 4XWGH 2XWBA 3G9VA 1CF8H 4H8WC 4GRMA 1HSAB 2XTJD 1UVQA 3Q1SH 4ZTOL 5F9OL 3S97C 3G04B 1HSAA 2FEDC 5I1HL 3KPLB 3VXRE 1IM3B 3G04A 3KPLA 4M5ZH 2ICWJ 4H0HB 1IM3A 2AEQL 5TF1L 4WEUD 2HVJB 1CFNB 3QDME 3KWWB 5IVXE 5D6DA 5KSVB 2HVJA 1CFNA 4QHKJ 2LE9A 5DMKB 4RMUA 5KSVA 2HG5B 5DMKA 3D48R 4JDTH 3F7VB 5J11C 3H3PH 5CAYB 5GS2H 5EO1B 3O2WH 2HG5A 3NZHL 4L3ED 4R4NC 4Q6YA 3F7VA 5D7KD 3ARVA 5EO1A 2QSCL 5DVNA 3KGRA 3JWOL 2J6EH 2X7LB 4OIIL 2AJXH 2ATPB 1EJOL 2X7LA 2HFGL 4C58B 1OQXA 3PGFL 5IB4B 3GO1L 2MPAH 1QFWH 1D6VL 4G8IB 4WENB 3KXFD 4LHUB 5IB4A 4GRLC 4QRQA 2G5RA 4G8IA 5E4IA 4LHUA 4KK9D 4PJ8D 3VA2C 4M7LT 2BNQD 3Q5TA 5C71A 5D1XD 4E0RA 2H8PB 2BHUA 5KZCB 3STZB 1JGLH 1KELH 3LS5L 4OJFL 3IAPA 3STZA 4FFYH 4HC1A 2NX5E 3V9FA 3P30L 2DI9A 4PY8I 4KMTH 1IQWH 2V5TA 1OM3H 5J8OA 2GK2A 5I73B 1CFVL 1IGIL 3VXMB 3CLEL 2VRAA 3JTSB 4NQVB 5DMJB 3ZHKA 2GY5A 3VXMA 3QQ9D 4WFFD 1UACH 3JTSA 5IHLB 4IIQB 1PSKH 1N4XL 2DLTA 4XC3H 3IKKA 1X44A 5DD0H 4IIQA 4F15C 4PR5B 1Y18B 1EPFA 4N9OB 3B5HA 4M1GH 4AM0B 1MJJB 3JWDL 4MMXC 3OL2A 5IMOA 5J57B 4JJHA 1IILE 1QLEL 1Y18A 4AJ0A 2I27N 2W59A 4X80L 3QDAA 1JPSH 5KOVC 1I8LC 4OZGF 3DECA 3IDXL 1QO3B 2V9RA 4UAOB 3QB7C 1AO7E 3KYOB 4GQ9L 5GRJH 1QO3A 4P2OD 3RZCC 3QI9B 1IQDB 3GSWB 3KYOA 3FB8A 1XF2B 1NCNA 3MV7E 2YN5A 1IQDA 3QI9A 1E4XH 1Y0LA 4LSPL 5FUZL 2OYPA 3GSWA 5JW3H 3GIVB 1XF2A 3LKRB 1KEMH 4M1CD 4LLVB 4X6CF 3C60C 3REVB 4LARL 5CS7A 1BM3H 3O8XC 2NY0B 3GIVA 2G60L 3LKRA 4JZNB 4LLVA 4Z7WE 4AY0A 2IAMD 3REVA 5JIPA 5EZOL 4JZJC 2LAGB 3VDBA 4JZNA 1A3LL 2IPKB 3NCJL 1N6UA 1ORSB 4HDIB 1SYSB 4V1DD 4OT1H 3PGDA 4I1NB 2IPKA 5BVJB 1ORSA 4HDIA 1SYSA 2ATKB 3O3UN 4HT1L 5T1MB 1ZKAA 5BVJA 5TDNB 5FEBA 4R4FH 4X7CC 2ATKA 5T1MA 5K59E 5AZ2L 4H1LH 3RNKB 5TDNA 4NZDA 3AY4C 5DHXB 2J5LC 3RNKA 3M45A 2DD8H 2DWDB 3EYUL 3LHPH 4JN1L 4NP4H 3MUGA 3I3DA 3ZDYF 1FE8H 4G9FE 3KLHC 3ULVC 4OQ1A 1MVUB 1KYOK 1KNOB 4KMLB 1CU4H 2IMNA 5E2VL 4UBDC 2R56L 3MUZ1 3RGVD 1MVUA 1KNOA 2VDOL 1AE6L 4TSAH 4Z7QE 4Y5YB 4D9QD 2X4PB 1GGBH 4HJ0D 4Y5YA 5DRNB 5EIQA 4UT6H 2X4PA 3C09C 5CEZL 1RJLB 2Q87A 4DKEH 3PWLB 5JO5B 1NPUA 3CXHK 2AABL 4P4KB 5DRNA 5C0RH 4WEMB 3HA0A 1RJLA 2P49B 5JO5A 4QXWA 1U8KB 4P4KA 3NFPB 1CXKA 4J3SA 2LVEA 3GMLB 1U8KA 5D1QC 3NFPA 2NYYD 1NFDB 4FRWA 1OAYL 1RY7B 4TUOB 3T0ED 3GMLA 4K7PY 1NFDA 4TUOA 4H5SB 4QXTB 3GHEL 3P4OB 1WUNT 4Q58C 3IDYB 1JCKA 4H5SA 1FH5L 4QXTA 1CDCA 3P4OA 3O45B 3KYAA 4NN6B 3TGXA 5IGXH 2F15A 2VLJB 3DROB 3O45A 1MHCB 5HYQB 2VLJA 3PDOB 3DROA 3R8BB 4DKFL 3DO3A 1DN2A 1MHCA 5HYQA 5LCVL 3PDOA 2HJLB 3MQIA 5I9QC 3I75B 3DYOA 1FLTX 2HJLA 2VITB 3QG6B 3AXLB 1R3JB 1JHKH 3KYKH 2VC2H 1MFAL 5J13B 3I75A 1UEMA 3OKNB 2VITA 3AXLA 4JM2C 1R3JA 3RWHB 3OKNA 3G08B 4X4YB 4O5LL 4X4MA 2ITCB 1A9BB 4LSUL 3RWHA 1MQKH 2MKWA 3EZJB 5FYLH 3G08A 1XCTA 2ITCA 4J3WA 3SDXE 1A9BA 2X09A 5ITFB 1UH2A 4U6VL 1DBMH 5ECJE 3B83A 5BMFL 1KC5H 2G9HB 4UILH 2IALB 5BZDB 5KSAB 3RKPA 1H5BC 4XWOD 2YD5A 3RY6A 2G9HA 5C07D 4OGAD 2IALA 3DURB 4OLYL 5BZDA 4J1UB 5EWIH 5KSAA 1MPAL 2FATL 1A6UL 3DURA 1TITA 3ZYIA 5LXGH 2BSSA 1G6VK 2J4WL 4HWEH 4J1UA 1WWCA 4WWKD 5EC2B 3NTCL 2D3VA 4DGVL 1OP9A 4QTHB 5EORL 5FYKL 4ZNEE 1HZHH 3X13A 3WJLA 5EC2A 3WFHB 4EQ2A 3OF6D 3EUUA 1CLOL 4OKVB 1J86A 3LRGA 1JHLH 1BPVA 4OM0H 2ZOKB 3WFHA 4OKVA 3UCRA 5EZLA 3N1PC 1BBDH 3A67L 4PP1C 3IRZA 4XVJL 3ORJA 5CKGA 3N1MC 3TO4D 3L7FB 4E42B 3MODL 3MCLL 4FN0A 4E42A 3L7FA 3W2DH 3TEUA 1MFNA 2OBGA 4Y8AA 1DQJB 2CLRB 1VESA 3GIZH 5EDXA 1JWSB 5C6TH 1N0LA 2ZCKH 1DQJA 2CLRA 2ERJC 3R06B 1JWSA 4HV8A 5D1ZC 4X7FC 4DGIL 2YA1A 2QKIB 3H9HA 3S96B 4D2NA 3R06A 1T83C 4FFWD 4HUVB 2BRRH 2QKIA 2QQLH 3S96A 4LEOB 3JBG7 5A40E 1TIUA 2VDRH 4HUVA 1IKNC 4LEOA 2G2RB 4PJIF 2EIEA 3CVIL 3PV7A 4WUKL 2G2RA 3UJTH 2PTUA 5BRZD 5C7XL 4PRID 5ACMA 4LK4A 1UT9A 4MB5A 1XGQB 4MQTB 4K8RL 4FOMA 5D6CB 5EU4B 1FHGA 1MSPA 1ZLVK 1XGQA 3JXAA 3UDWC 1JWUB 1N6VA 5EU4A 4ODHL 1WJ3A 5IHZB 3EYSH 2F53B 1JWUA 4OTXH 3Q6GH 5IHZA 3QULB 1YEGH 2F53A 3W9DB 3BWUC 2F5BL 5KOMC 1CDIA 3QULA 1JWMB 3W9DA 4FHBD 4OZGB 1T7VA 4KXZI 5F96L 1TVHB 5I1GH 1JWMA 4OZGA 1FVDB 4OF0A 1TVHA 5SWSB 1WTGT 4S10A 4QWWD 3PHQA 3W0WE 1FVDA 1I8KB 4OIBA 1LEGB 5CBEA 5SWSA 2DWEB 3MXWL 2ORBH 1U92B 4DAGH 1KCLA 3PHOB 1I8KA 1LEGA 4X6CB 4RAUB 2IAND 5CGMA 2DWEA 4JO3L 3P9MB 4X7TB 1U92A 5D5ME 3PHOA 3IJYA 4Z7OF 3GMNB 2X4UB 1EEQA 4X6CA 4RAUA 3IFPB 3P9MA 2FX7H 4RX4D 1H3TA 1A02N 3V79C 3GMNA 4RWHA 2X4UA 3IFPA 1EHLH 4OGYH 2JELL 1YN6B 4OCSL 1MJUL 2H32B 5DRWB 5AWNH 4NM8H 1SVZA 3C6LC 1YN6A 2X05A 1TCRB 2H32A 5DRWA 1QQDB 1TTFA 1SBSH 1KJ2B 1TCRA 3BKYL 4YFLI 2EDBA 3OAUH 2SEBB 2HWZH 1VEMA 3P4NB 2QQKH 1F42A 2SEBA 4JG0H 1RULL 2VXQL 4HAFA 3P4NA 4ZS7L 3EZ8A 5DZLA 2EC8A 4JR9H 1WC7B 4QXGH 1G0XA 2JJUA 5D7LD 3ZT7A 3UP1A 4ONGH 4TQEL 1WC7A 1FPTH 2A2QT 5MENB 2ZCHL 3GI8H 2PO6D 1QBML 5MENA 1UCBH 3QXAB 5IKCB 4QHMB 4PJAE 4RDQG 3GHBL 2Z91A 3L3HB 3MV9E 2CDEB 3JVGC 3QXAA 4XBEH 5IKCA 4QHMA 4MNGB 4LIQH 2GJZA 4DJMA 2CDEA 5HDBF 1A1OB 5CGTA 5ALCL 2VAJA 4M43L 4OLVH 4MNGA 4PJGF 2R2HB 1A1OA 2IJ0C 4S1DD 1AY1H 2VKWA 1JMZA 2P8PB 4F37K 1KN2H 2R2HA 5C08D 1NLBL 3ARXA 2VZ1A 4X9BA 2P8PA 5GRYA 3BZDA 3SE3A 1X7QB 1UFUA 3O6LH 3PV6B 2FGWL 4MJIE 2Y1VA 4MJ2A 1X7QA 1AGFB 3ES6B 5CZKA 3MLRL 3PF2A 3OX8B 3ES6A 1AGFA 1KEGH 4PJHF 3MV01 4M8VA 4EDXB 1BJ1J 3OX8A 4HKBB 1NC4D 1ZT4A 4LPCA 5L7XL 5DC4B 5FUOH 2XQBL 4EDXA 3GRWH 4HKBA 4OQTA 1J1XL 3OZ9H 3MR9B 3IFNL 4W6XB 1F5WA 4TPRH 1JNLL 3MR9A 2VH5L 3OXSB 1CLYH 5F7UA 2JJSC 4JCLA 3HUJF 4D9RE 1S9XB 2H6PB 3OXSA 1CGYA 4A6YB 3LRSB