1ETZB

The three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
228
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGEGLEWLADIWWNDKKYYNPSLKSRLTVSKDTSSNQVFLKITSVDTSDTATYHCARRTFSYYYGSSFYYFDNWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB NC10.14 - LIGHT CHAIN
publication title The three-dimensional structure of a complex of a murine Fab (NC10. 14) with a potent sweetener (NC174): an illustration of structural diversity in antigen recognition by immunoglobulins.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 228
sequence length 228
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1etzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1etzB01
5I6XC 4FFZL 3ZHKA 3P4NB 1JFQL 4Q0XH 3K2UH 1RUPH 2C7UA 2DIBA 5CSZB 3C5ZB 5M7QA 4KK5D 1DQDH 4KXZH 1AI1L 1ZT1B 4F9LC 3GNMH 3ARFA 1L6ZA 4AENB 1A22B 2QADC 3NIFE 1N2RA 1VSCA 1KG0A 4LARL 3SOBL 3B3IB 4Y5VA 3OZ9H 2JCCF 4ERSH 4LCCC 5E8OA 5D7IA 3U82B 4NIKB 2HH0L 4HPYH 3ZKMD 1NJ9B 4LAJH 4BZ2H 4NQXB 2CUHA 1ITBB 5HTSA 3ARSA 3RA7H 3WFZA 4M8QA 1JV5B 3P4OB 3STLA 1RURH 2N1KA 3OHXB 1OP9A 1WWWX 4HUUB 3WIFA 3ZE0E 1KYOJ 3HCVB 1OGAE 4G8EB 1H9VA 3LS4H 3WV0A 3HRZA 2YMXL 3S4SB 4PJFF 4EN3A 1RJZB 2DRUA 4NM8L 1RMFL 4U1MB 1AGDA 4M1DH 5EZJA 3V6ZB 4ZAKC 3WJLC 5CP3A 3CFJA 3VXQB 4JQVA 2ZNXA 4ZO8A 1YNKL 4Z7WB 4HAGA 3PDOA 3PP3H 2HTKC 4M7LH 2NY0C 4NOFA 5DQJA 2R0WH 2G60H 4I8DA 1UT9A 2HFFA 1RIUH 3WSQH 5IB5A 1PGRB 2IBZY 2CLRA 3ARQA 3MO1B 4Z7NE 2AABL 3CVIL 3L7FB 5T3XL 2L0DA 1MAKA 4XPGH 1PSKL 1S7UA 3O6LH 2WUBL 4X6FA 1CDCA 1OGAA 4UMGA 1A5FH 2OK0L 1CFNA 4ODUB 1I7TA 4CRPA 3CXDL 1HHGB 1S7SA 5EO0A 2PYFB 4ODHH 2X09A 2FR4B 2HLAB 1U91B 4S1QL 5D2NC 5IT2L 3NOIA 4JFXA 2X44D 4NQUA 4BH8A 4ZOBA 2GJZB 5JO5A 3B9VA 1XAUA 4D94A 2XY1A 3MRFB 1EDQA 3MV9D 1H3GA 3RGHA 3VFUA 1QHOA 3B2VH 3ZSTA 3UROR 4X4XB 4YXHL 5FCUL 1T83C 4ZFZB 5CGTA 3WE6B 1SM3H 4JREC 3G5VB 3CK0L 2FJGA 2IPTH 1I3GH 2E8ZA 2ZPKL 2JIXD 4G3YL 4JQXC 4ZPTB 4JN2A 3ARBA 2E5EA 4LF3B 3TN0A 5ICZB 1G9ML 3OF6D 1CFVL 5I6XB 1QFHA 4QTIL 1I9IL 3H9SE 4K7PH 1U8KA 3GI9L 4FQLH 4ZNEE 4JANA 4AEIH 1HQ4A 4HJ0C 4YWGL 5HJ3B 3UXFA 4ZTOL 2Q8AL 1DQQA 1VPOL 1YEHH 3HR5B 5J0BA 3V0WH 4JPKL 4X7SH 3M17B 3UTSD 2QADB 1MAML 1N6VA 4HXBL 1LQSR 4JRYD 4NQVB 4FQ2L 3RY5A 1MHHA 1Q9LB 2J7LA 4ZO6A 5C09E 4LCCB 4BQ8A 4KRMB 4KQ4H 5K9KB 1Z9OA 3VU2A 4PJGB 4AY0A 4Q58C 1ETZA 3Q5OA 1FV1A 3V6FA 2RQ8A 3LOWA 1CG9A 1IBGH 2DLEA 3WMSA 5BMFL 5A1AA 1RZFH 3H9SA 4OSUL 1H3UA 1CXFA 2ZSVA 1Q9KA 2D2OA 1KOAA 1YZZA 1S5IL 4JO1H 4O2EA 4P9HC 4ZNEA 1FO0B 3JV0A 4DAGL 5FV2A 1KCSL 4ZAKB 4ELMB 3QYCA 3BI9X 1T66D 4HHAA 4JR9H 1HXMA 1ROWA 5T3XE 4YHNA 5B39G 2EDWA 2A83A 4WFFD 2NY0B 5C0CB 2JF1A 5C09A 3O3DA 1MPAH 3IDMB 3QUXD 4KPHL 4G6KL 1WLHA 2XZCL 1SEQL 2ZG1A 4HF5L 1WZKA 4RMSA 1DBMH 1EA9C 3DX9B 3FTGB 1LO5A 3ARGD 1XR8A 4FXKA 4L4VE 4OCRL 3SDDA 1E4KA 2EEDA 3SDCC 5L6YL 5D5MB 4FG6D 2ICEA 2XOTA 4M8VA 1QBMH 4X7TA 4GMTH 1Q8MA 1P1ZA 3BAEH 2DBJA 4UT7L 5AZEL 3VE0A 4JM2F 1IC4L 4LLUB 1TVBB 1WAAE 3EFDH 5EBLA 3MRDA 1MFCL 1W0VA 4XC1L 4ZTPH 4K3EL 1GIGL 2B7DT 5IQ7L 1AC6A 4L29B 2QQNL 3S36X 2HRLA 2VB5A 2EH8L 1MJ8L 2DI9A 2WAHA 1UENA 4H20L 3RVUD 3NFSH 3BIKA 5CP7B 2J1KA 4J3VA 2W60B 2ADFL 4MZ3A 8CGTA 4AIZA 1NGXB 3LQAH 5KSAD 2R2EA 2HTLD 4JREB 5BO1H 2FZ3B 1GGCL 4L4VA 2NW2A 3O2WH 3FB8A 5ICYA 5B3NA 2XN9B 3DO7A 1K6QH 4EJ1C 3VRIB 3GHBH 4KWUA 5DUBB 2LTQC 2AS5M 4GLRH 5DTFA 1FCGA 2GJ6E 3IFNH 1IAKB 3D3VD 1XCTA 2GFBA 1IGMH 4R90H 3ZLQC 4PJ8C 5IEHB 5F8QC 4HKZB 3DYPA 3LKPB 4MA7H 1WAAA 3MRJA 4LLQA 4YXLH 4JY6B 4XMLL 1BVKA 3EOTH 4C57C 2IG2L 1SHMA 4P4KD 1EO5A 4O9HH 5MEQB 2AQ2A 2IQAB 4DFHA 4RGNC 2ZWLT 4Y1AD 2QKIB 5E6IC 4QYOB 3KGRA 3MJGX 3ULUH 3G08A 4IMLA 3REWB 3QEQD 1V7NH 2WQ8A 4I0CC 2ITCA 3B8YA 3D6GA 3O9WC 1M7IA 3TO4D 4P9ML 2GJ6A 3QIWC 4P46D 5FYKH 1CXHA 4JFDE 5DURD 3MJ9A 4YFLI 4L9LA 2D7TH 5CBEB 2Q76B 4PJ7E 1NBYA 3PHSA 4MLSA 2VDRH 4BSVA 2IC2A 5IQ9A 4R4NC 4H1LH 1AJ7H 4RNRA 3A6BH 5I1HH 5L88L 1WQVT 1ZGLP 1I85A 4R4FL 4TNWF 3NPSC 5I1LB 1MCJA 3BMVA 3HAEG 4N8CL 5I2IA 1CWVA 3B5HA 2X4QA 4OGAD 4RWYH 1T2QL 1MJUL 3D0LB 1K4CA 5KSVA 3MLXL 3O3AA 1RUAL 1QSZA 4KGLA 1I3GL 5FUOL 5DD0L 3QJHA 4ZO7A 12E8H 1HZHH 2JJSA 2W0FB 4ZMAT 4QRRE 5T1KA 3QBTB 4HBQA 3SDCB 1KJ2L 4JFDA 4PJ7A 1TJGL 2R29L 3JWNC 5D72H 1IZKA 4C56E 3W11D 5ILTH 1ZANL 2Q6WB 3P0VH 3D39B 4G6JH 3UPRB 4GW1B 1CD9B 2DQFA 2AK1H 5AYQA 3HPJA 1YEIL 3IF1B 5E9DE 4Y2DA 3UBXB 1WWCA 2Q7YB 4LVHC 4XPHL 4M61A 4L8DB 5E99L 1LGVA 4P3CH 1WBYB 5HHQA 2YD2A 4PGEA 1XZ0B 2NXYD 3KPSD 2DDQH 2PW2A 4M93B 4F7CB 3LN4B 3ULSA 3BD3A 4GRWB 2DJSA 2JK5B 2VL5B 3O45A 5BXFB 4U6TA 3QT2A 2X4OB 4QRRA 3TVMA 1LEIB 5DJ6B 4UDTA 4XCYB 3X13A 1DN0A 3HNSH 1HHHB 3QIBA 1KV3A 1ERNA 4C56A 1E28A 4JDZA 4RRPG 4PJ8B 3L5WB 3O3EB 2M8XA 4G43A 3F5WB 1HSBA 2C4FT 3EHBD 3PQYB 4LSPH 2YD4A 5JORB 5E9DA 1MCFA 2R4RL 2VQ1A 1X7QA 3LQZB 4JPVH 2DM7A 1I9EA 4RGNB 3ARVA 4U1LA 5E6IB 3QWOA 1N0LA 3SGJA 5DLML 4APQB 3PHOB 1FNSH 2DQTL 1K3IA 5IMLB 2IAMA 3H2WA 5ALBL 1N6QH 4K3JH 2R1WA 4Y5YA 3SE9H 3JBG7 3RWJA 1MF2L 1VKXA 3O9WB 4OFYA 2FX8H 3F12B 2BOBA 5F9JB 1NGPH 1JHLH 5HGHA 3QPQC 5ACZA 3KPPA 4LLWA 3O6ML 2Y9RT 4RA0C 1WICA 4M7JL 5MP6L 1PLGH 1BOYA 1K5NB 3PABA 4P9HH 4P49A 4S1SL 4QXTB 4X6CF 1HH9A 1C5CL 2AJ3A 1A6AA 3CFKB 1G7LB 1Y6KR 5JW5A 2P46B 3MLUL 4D0CB 4P4RB 2BJMH 2D9CA 4XBPB 3CFDB 1JYNA 2KUTA 3HZYB 5LQBH 1YNTB 32C2A 5A2IH 2ED7A 4Z0BL 3QEUA 1TQBC 4YHYC 3CNKA 3BW9B 3M07A 3JTSB 5JXAH 4AH2A 1KACB 3O2VH 1I1CA 4OT1L 3VGBA 1I1AD 5AUMB 4NZDA 4WTZA 3BKCL 2HKFL 4PJIB 1RIHL 5TPWH 1D9KA 1QVOA 2AK4B 1T1YB 1I3VA 4NQEE 4X6DB 3N50A 2DYPB 3BUTA 2XXMB 2WUCL 4FQXC 1MFAH 2E27H 4NN7B 1ND0A 1IM9B 3ES6B 3TP4A 4NKIL 4NQCE 4LBEB 4Z76B 4EOWL 3ULUL 2WBJB 5C3LD 4EIGB 3LRSB 1KJ2A 5J9PB 1DBKL 3QCVL 4JO2H 5D71H 4F7PB 4PGDB 4CNIB 4I2XB 4ODBD 3MRLA 5TDPB 3BT2L 4XX1G 2XG4A 3FQUB 1S8DB 1FBIH 3EO0B 2D7TL 1FG2B 2ZUWA 2OJZH 1PG7W 2IH3B 3UPCA 3E8UH 2F5BL 2P44B 1D6VL 4KTEL 4OCYL 4TPRL 4NQEA 2B5IC 4KTDL 3GMLB 1PZUB 2J8UB 4N5UA 2H2PD 4R96B 2JB6A 5F3BA 2BNRB 4KJQD 1QFWI 2XZZA 3SKMB 1CGSH 3O0RL 4NQCA 1T3FB 3TN0C 1BX2A 2AEQL 1NUDA 5D7SH 3BH9B 4P2OD 1QFWM 2C7UB 1AQDA 1RU9H 1SBSH 4BYHA 5C0BD 3G6AA 2P8PA 5IVOA 4Y5XA 1U41A 1CFBA 4JM4H 3T2QA 4PP1D 5IM7A 5BQ7B 1I8IB 4OI8A 3IJSB 1FORH 4GBXA 3B9DA 4KUCF 1RFDL 5C8JB 1KLUA 5GS2H 1N2RB 3GMNB 4Y5VB 3C6SB 5DO2D 2V7NA 3QQ3A 2JB5L 4GRLD 1NCTA 3EYUL 3UEZA 3RL2B 2H8PB 4PLJD 5IMMA 5DT1H 3P9WB 4TSBL 4CMMB 3FZUD 3STLB 3OKDA 2EKJA 1G7HA 1YMME 2BRQA 2YA0A 1B2WH 2AEIT 3HI6H 4Z7UE 4GRMB 2OM5A 4F57L 1KELL 5K93A 4XNZC 5FO9A 4LRNL 5EBMB 5GGSB 1DBJL 3Q6FB 1T7ZA 2QSCL 3LRGA 3I85A 3ZYZA 5IF0A 1MUJA 3WKML 1WITA 4EN3B 1JCKA 1MHPL 1A3LH 1PG7X 5MHSE 1F4XH 3FRPG 3WJJC 4XPBL 3ROOA 1S9WA 3CFJB 1E4XI 3HC4H 4RISH 5DFWH 1LO2H 2X10A 5DQJB 1TQBB 4YHYB 5HDQL 3IDJA 4LVOC 5AYUH 5IB5B 1CFSA 1UZ6F 1RY7B 3KAAA 5A2FA 5MEPA 2CLRB 1T0PB 1YN6A 4IBLT 4PRAA 1YMMA 5I1DA 4OI9A 4M43L 4UOJA 4IRJD 4Z7UA 3ULUE 4DN4H 1BQLH 1BIHA 3GSOA 5D6CB 2Z0BA 1B0WA 5AEAA 3HE6D 2J6EH 5FDWA 1S7SB 2OMNA 4P5KA 5EO0B 4R7DB 1U0QA 3BEVB 1JZ5A 1XIWA 1A4KB 3TT1H 5FYKE 2JLLA 3VMPA 5DK0A 5FA4A 5FK9B 2JE8A 4BH8B 1F4YH 4YFDB 3Q6GH 1OAZL 3LKRA 5GIRB 5GGRB 4KI5E 4DFIA 3C9NB 1MCPL 4W81A 4PTUA 3VFUB 1JHLL 3EJZC 2OL3H 5FGBC 1OQOA 4GG6B 3LH2H 1B6DA 5I74C 2D7MA 2YRLA 2WWKO 3FQTA 2FX9L 2KQNA 5FO7A 4RQQB 1Q94A 1AGCA 3CFBA 4UIMA 2HLFC 2ED8A 1KPRA 3NAAH 4NO3A 2VAJA 1S9KC 4JVUA 4JN2B 2V17L 3TN0B 3TYFA 2FSEB 5KVEH 3GBMH 3CD4A 2Y07H 3L3HA 1EERB 4TVPH 1S5HB 1BF8A 1HQ4B 1EMTL 3UYRH 3RGVA 3BPLB 3SE8H 4MA8L 3N1FC 1DBBL 5EA0H 4WWKC 5H2BA 2DQCH 1DEEA 3UZQA 5INCA 1TZGH 3Q2CA 4RMTA 5GISL 3CMOL 2WINB 5E1HB 1G9MC 1EX0A 2R1YA 1OWRM 1FV1B 35C8L 5AG8A 1CFTA 5FAAA 5I73B 1CIUA 5I8CB 4QXUH 2VN7A 1IEBB 4O58H 1MHCA 4XNZB 1QR1A 4YAQB 3RTQC 2OR8A 1FZJB 1ORSA 2AXFA 1L7TL 4NJ9L 3ZDXF 5HDBF 3FQNA 3FT2B 1NSNL 2X05A 1NCUA 5DA4A 2EDXA 3FFCD 5DWUL 1M7DA 2Y7QA 2J4WL 5F3HA 3IDGA 4YHNB 5FO8B 2A83B 3VG0H 4R26H 1T1XB 3U4EA 1CK0H 5GRVL 5C09B 3NH7L 4LVOB 1G6RL 3O3DB 2Z35B 1JTTA 2K3TA 4P2QB 4PB0L 3DECA 2KPNA 3UC0L 4XTRC 3WS6C 4HGWB 1FYTE 1LO5B 4U1KA 1XR8B 4FXKB 4LK4A 4PJDF 5GHWL 5HD8C 3HZKA 3B9EA 1WV7T 3S5LA 4AL8L 1AXSB 2PNDA 5DQDH 5C2BL 2VOTA 1YJDL 2OTUB 1P1ZB 3V5DA 4MJID 1UM6L 1IAMA 4G5ZL 4L3CB 5JMRA 3VE0B 5B3JE 5CJBA 5I1KL 1EO8L 1A6UH 1T5WA 4HWBH 4ONFH 4P2RE 3UX9B 3V7MA 1W0VB 2APBA 1ZVHA 1I7RA 4K8RL 5BW7A 4OZIF 1LDPL 5L8LB 1TZHB 3C09B 2Q8BH 4XXCC 1NAML 3HFML 5I74B 4O02H 3DROA 5FYLH 2EXWD 1FYTA 4YE4L 4WI3A 1CLOL 2APFA 1TTGA 2NW2B 3WDHA 5ICYB 2F19H 3MUHL 1NLDL 2CXGA 4JFHE 1X4ZA 5I76A 3MA7A 4KVCL 4LPYA 4P5TA 3W81A 3RY6C 2KBGA 2GFBB 4GAJH 1J1OH 3KR3H 1WSST 5DJ2A 3WFBL 4P2RA 3MRJB 1F58H 1IMHC 4JFZH 4YHPA 2PCPB 3LZFH 1MQKH 1D5ZA 5EBGA 2V5SA 2VJXA 3BWAB 3LPFA 5IFHL 1UYWL 3VDCA 5KTEL 3SBWA 3P0YL 2OQJA 3MRBA 2W65B 1NL0H 1VADA 1KEMH 3G08B 4IMLB 4F3FA 1CLCA 3PIQA 1MJ7H 3T0WA 1FZMB 4W68A 2JCCE 2WZPD 4MSWA 3MROA 4KXZI 1B6UA 4Y5YC 1AHWA 2W1NA 3OJ2C 1WT5C 1M7IB 3J7HA 4X7FC 1A7RH 2CIIB 3QNZA 4HS6A 4U6HB 1EZVX 4ZXBD 4B7LA 2YUVA 1FLRH 3QZWG 4HIHA 4R4BA 1C8PA 3RTQB 4QOKD 4LCIL 5KJRH 1OSPH 4BSVB 4DKFH 2X89A 5EOCL 1F4YL 1U95B 4PJFE 1HHJA 4S1RL 4HEME 5EG6C 5C70A 1IC5H 5I66A 5I2IB 3ZDZF 3K7UA 5C71A 1RUQL 3U0TA 1RZGA 2JCCA 1OTTC 2X9XA 5GRVK 3JV4A 1MFEH 3O3AB 3O3UN 1OAKH 3BP4A 1HSAB 4JRXD 4LGPB 1J8HE 2J8HA 1N5YL 5FF6B 4PJ7B 4PJBB 2AJVH 5CJXC 1A3QA 4QXGH 1M71B 3KNBB 5E2WH 1I1YB 2DBLH 2E6QA 1G6RA 4PJFA 1NGZB 3KJ6H 2H26A 2H9GB 3L9RB 2DQFB 5FYJD 3T3PF 3GM8A 1H3VA 5F8RC 5C9KA 1D5MA 3C8KA 5GZND 4E41B 2NLJA 5HHQB 2CLZB 3F7PC 4PGEB 1P4BH 2VDLL 3MRNA 1YYLL 2PW2B 3T77B 1IM3A 1XGTB 2FIKA 4NKDB 5JIHA 3ULSB 1LE9A 3O45B 4FFYH 1J8HA 5DEFB 3TNMA 3EOYG 4P2YA 4UDTB 5IBUB 3OAZK 2N4IA 4HK0A 4PIRF 4OLWH 3EO9L 5KSUA 1BEYH 1A14H 2HJLA 1DQMH 2DD8H 4O2CB 4JDZB 1NAMA 1P84J 4G43B 5DJ8A 3CPLB 4U6XB 1HSBB 3QDJE 4V1DE 5E9DB 2VQ1B 3W39A 3H42H 1X7QB 1I1FA 3EW3B 5LGKA 1EJ6A 1IQWH 1X5YA 2NY6D 2FB4H 4XBEL 4Y16A 5I8KH 1KSRA 2V2TB 1F6AA 4U1LB 1Y0LA 1IL1A 3QWOB 4Z8FL 4PJ5B 2YSSA 1DUYA 1UQSB 2VZ3A 3H3PL 1BPVA 1QG3A 5E8DH 4HC1H 3GJFH 4NQDD 5GS0C 5C6PB 4PD4K 1QO3A 3BP5A 3MGTA 3C2SA 4Y5YB 4LOUC 3RWJB 4KKBD 2UUDK 2UWEB 3OKKA 2I60L 3VFPA 1IVLA 4DZBB 3Q3GA 2BOBB 1M7XA 1XF3A 1YEJH 5HGHB 4GQ9L 4L1HA 1QSEE 1KIPB 3KPPB 4LLWB 4JY4B 1U8PB 2VDOL 2PTTA 3QDJA 4V1DA 1ORQA 1XGRB 4OLVL 4PS4H 4I5BA 3PABB 1ZGLA 4RGMC 2DTSA 1UB6B 4TQEH 2CGRH 3RZCC 1XH3A 2LQRA 1HH9B 4CGTA 4MD4A 1JL8A 4IHOA 2AJ3B 3QUZD 5JW5B 4J4PA 3TA3A 1F90H 1NAKL 4D8PA 1F4AA 4TVPE 5KN5B 5C0GA 1NC4A 2FEDD 5CHNB 3SO3C 3THMH 1B0GA 1S7TA 1T7WA 3QEUB 2YXMA 3QH3A 5C7XL 5D1XD 3MNZA 1JRHL 3OXSB 1YNLH 4X98A 1OP5K 2R23A 4JY5H 1ZWIA 1QSEA 2VC2L 2OL3A 5EPMA 1NDGB 1TXKA 5D1ZA 1QVOB 2I5YH 1UXWA 4Y4HC 4HUMB 4LSTL 3BH8A 4GOSA 3KJ4C 3GB7A 3MV7D 1ND0B 4NZJA 4YHOH 3FB6B 5JMOC 4HK3N 1ZLSL 3ZDYF 2DQUL 3A67L 2GT9A 2VABB 5GPRA 4CDGC 5CZVL 4JDTH 2ZUQC 1IKFH 1KJ2B 3BE1L 3DWTA 4N90E 2VXQH 5D7LB 1FVDB 1ONQB 1UVQB 1KENL 3U0WH 4WW2C 2FJHB 2CUMA 4EI6B 1BECA 2BOCA 3QP3A 2NXZC 1FIEA 3L3OA 2V2XB 3IFOA 3ARFD 3VXRD 1A1NA 1GPOL 4NQEB 3WLBA 1J0ZA 3BZ4B 2EE6A 2JB6B 4JM2A 3C60D 4LPVA 4IDJH 3RX8A 5EC1A 2PXYC 1FAIH 1CS6A 2I07A 1QPXA 4GLRI 3WUWG 3G6AB 5E2VL 4Z6AT 3IXAA 3MLWH 4XP9L 5DK2A 2P1YA 4GBXB 3E3QE 4OIBA 4CVXB 3CJJA 5CEXA 1GZQA 1JTOA 4YHMH 1CFQA 1P9MA 1G1CA 4OTXH 2V7NB 3QQ3B 3VGDA 4O4YL 1I75A 4HT1H 5IR1A 1IGCL 1NLBH 2MCPH 3S35L 1ZT7B 4OJFH 4H25A 4XMKH 2NY3D 2BDNH 5FO9B 4NDMB 4RGMB 5I8EA 1NCBL 3RZCB 4HX1B 5IMKA 4MD0B 4HGMA 1VDGA 5I1GL 1QBLL 5ITFA 2F53B 5CBAA 2EO1A 2X5PA 1IGJB 3UAJD 5I1AB 3U2SA 4NN6C 3SO3B 1HIML 4MNQE 1RHFA 2J88H 3L3IA 2GTZA 4TNWK 5MEPB 3KS0J 4FA8A 2CDGA 5B21A 1MIEH 1UM5H 5I1DB 4DGIL 4Y4HB 1H3PL 1WEJH 4Z7UB 4YPGB 5SWQB 1IC1A 4RGOL 4WFEE 4XVSL 1F45A 1Q9WA 4X9GA 3VA6A 4ELKA 1MHEA 5CIPB 5FDWB 3IFLH 1BZ7A 3U7AA 4RIRA 3VG9C 2ZUQB 2R0LL 1RZKL 3VFTA 1NKOA 3ARBD 5DK0B 4ISVA 4HWEH 4UTAH 5L2KD 2OSLA 4MNQA 3LKRB 2AJXL 2CDEB 2W92A 1IKNA 4PTUB 1S3KH 4XBGA 1VESA 3QULB 3O6FA 3T2OA 3LD8C 2NXZB 1RJYA 3FQTB 3I6LE 5GS1A 1RK0B 2CUIA 1NGYB 1NMAL 4UV7L 3PV6A 5FO7B 1Q94B 1U6AL 1MCBA 1AGCB 3CFBB 1RUKL 1WZ1H 4UIMB 4ZFOL 5T5FL 3BKYH 4G9FB 5C0JA 5JHDE 3DXAE 1JNNH 1MSPA 4UZGA 2GCYA 1LO4H 1KGCE 1YEDA 2XRAH 4OFIA 4XNYL 3FO9A 5EOTB 3NA9H 1CLZL 3BJLA 3C2AH 1EEYA 5DSCA 4HJGA 3RGVB 3H9SD 3K8LA 43C9B 1FFOB 2VLKE 5B39B 1DN2A 1FAKT 4UINL 1OAYH 1QLEH 5TE7H 4FP8L 1WTLA 2D7QA 1AFVL 5HHME 4F33A 5GS0H 4UILH 5HY9A 1BOGB 2PTVA 4KK9C 3F6LA 1BD2D 2FX7H 4F7TB 3TNNA 4FABL 3FT3B 1LILA 3QXWA 1CFTB 2HA1A 1AHWC 5IGXL 3QUYC 2HG5A 5JHDA 1BP3B 3DXAA 2R69H 3I6GB 3U46B 3HHRB 3IXTA 3V4PL 5IBTH 3QEGL 5IEKA 1DUZA 1ORSB 2AXFB 3LSOB 4NWTL 3RWCA 5HHNB 1UXSB 5J56B 3G5ZA 4N5ED 4R7NA 4X6CE 4OM1L 4E5XB 2VLJE 4XRCA 4LMQI 4R3SB 2VLKA 5BJTB 2Y7QB 1T04A 5F3HB 1FVCB 4NN6B 4JHWL 1H3TA 4KI1A 4MXWL 3U48A 3EYFA 3U4EB 5DEGB 2B2XH 3MRMB 1K3ZA 1MLCB 3L3GA 3N85H 1ULVA 1O5DT 1YEFH 3BYYA 2IQ9L 3A0OA 1HEZA 3HTLX 5DJAA 1OP3H 3TFKD 3HZKB 1XGYH 5HGBB 1LP9B 3S5LB 3TZVA 1YDPB 3TPKA 4LIQH 1WVZA 2OP4H 3QQNA 4L4VD 5EO1A 3B5TA 3V5DB 3PL6C 2KDGA 4MAUL 5IROC 4PLKC 2HFGH 4X6CA 2VLJA 1Q72L 3DLQR 5CIPH 5EU6D 3QDHA 3VG9B 3WHXA 3K74B 4LU5L 4U1SA 5I18H 1T5WB 4W6YB 4YZFF 3GO1L 2YKLH 1I7RB 4HDIA 1Z5LA 2K9UA 2YC1A 2Z4QB 5LGHL 3X11A 3LMJH 1ACZA 5J6GA 1A6ZA 3NVQA 3LD8B 3SJVA 4Y19E 4NZUH 1NLBL 1JZ2A 1YJDC 4K94L 2HVJB 1R24A 4JG1L 5FHBH 4JFFD 4MNHA 3VXMD 3KPNA 2DWDA 3BKMH 2B1HL 5C0AB 4M62H 1BFOA 3VFSA 2Z93A 3E0GA 3I2CH 3I50H 4K8RC 5KS9B 4U6YB 4MZ2A 2RIKA 4ETQA 4YGAB 5C0DB 2F5AL 4OFPA 2GJ6D 1S7VB 3CSPA 1X5ZA 4XPTH 2EDYA 3DURB 1K8DA 5E4EB 1UC6A 1QSFB 5HHOB 4ZFOA 3INUL 4Y19A 1C1EH 1VHPA 3MRBB 1JPSL 2P7TA 1VADB 3UYPA 1NC2A 2W0LA 2KZ1B 4NNPH 4WEUD 3PIQB 1BF2A 4FZ8H 5C6TL 5I16B 3MROB 3QG7L 3F7VB 1FNLA 1AHWB 2AGJH 1A6PA 3TJHD 4DKEL 4D0DB 2UYLA 1BLNB 4LLDA 1AIFA 1UJTA 2BVOA 3IFLL 3RDTC 3H6JA 3QNZB 4HS6B 2R0ZL 4P5MA 3S36L 1INEH 4HIHB 1FZOA 3V79C 1DANT 4N8VB 3D0VB 4YUEL 3EJJX 3X3GL 5T1KD 3PHQB 3BXNB 1J5OH 1RIVL 4U2YA 4JFDD 3AY4A 5JDJA 1HHJB 4HFWA 5ADPL 3G04A 4TUOA 5GXBB 4NBZB 4NSKA 2A9MH 5ALCH 3WFDL 3FO2B 4P23A 8FABA 1OAQH 2EZ0C 3U0TB 3U7WH 4ONGL 2JCCB 3TA3C 4Y2DD 1UZ6E 4HKXB 2WV3A 5F97E 2H3NA 3C08L 3MOAL 2EXYD 2H32A 4LCUA 4TSCH 3BP4B 1L0YA 5SWZD 4AEHL 4Q9BA 4XP5L 2BY1A 1GGBL 5IG7A 2CKBL 5EORL 2LU7A 3UJIL 3PWUA 1HKLH 4NZTL 3NCJH 4FQHA 4PJCF 1YEKL 2IMMA 4QRRD 3PL6B 5D1ZC 4P59H 4PYGA 1YY8A 4G8FB 4PJFB 5F1IA 3WFHA 5ENWA 2H26B 1FNHA 1WIPA 4IRZL 3EIFA 1GGUA 3OPZL 5JQHC 2DKUA 5FIEA 3QIBD 3MV8B 1EEZB 2EDTA 3ARXA 4C56D 3G9AB 3T4YA 1ZGLM 1AP2B 1ZA3A 3V5KA 3C8KB 4WO4D 1Z3GH 2AV7B 3UZVB 5I1IH 5ETUB 2BSTA 4ZUUA 2NLJB 4PBWD 3MRNB 4U3CA 1WIUA 4OQ1A 4RMVA 1IM3B 2FIKB 4UQ2A 1J8HB 3RX5A 1IAIL 5J8OA 4G6AC 4G7YH 3L6FA 5E7BA 3U83A 2ZJSH 3VFMB 5E8EB 3MFGB 3T0AA 3WN5C 4HK0B 4IOIA 2IAMD 1KBGH 5TJWK 1JI1A 4MDIB 5KSUB 3QIUA 4PD4J 2HJLB 4DOHE 2JJTA 1MNUH 3F7YA 5DRWA 2AJSH 4BUGA 1NAMB 4OF8A 5DJ8B 2X6MA 5K9OA 4UDUA 2F54D 2X41A 4G9DB 3KPQA 1T4KA 1CGVA 1JJUA 3W39B 2K7PA 1I1FB 2VAAA 5F7FA 1NFKA 4WRLA 3VMNA 1A7OL 2R4SH 5JIPA 1F6AB 3HAEH 4EXPX 2VITB 3CCHA 1AR1C 4NCDA 4YHZL 2ZUSA 3QCUH 2YSSB 3RBSA 1RZJL 3O4LE 3IVKA 1KJ3L 3VXPA 4NWUL 5L7XL 5JOPE 2AKRA 5FYKU 3MGTB 3BP5B 2H41A 3RWHB 4J2XA 1P9MC 2Y72A 3OKKB 2W91A 4WTWA 3VFPB 1FGVL 3ZTJH 5A2LH 3Q3GB 1GXEA 1UB5A 1JBJA 1XF3B 5JIIA 1NFIA 4MS8D 1CF8H 1PEWA 1UKQA 1XFPA 2VDKH 3GK8L 1L9MA 1U8JA 1YYML 2PTTB 3DTXA 5IJVA 4KJYB 1BZ9B 1U8IA 3VXUE 2RGSA 1ORQB 1M6OB 3VXSB 1G7MA 4EVNB 4I5BB 4H0GA 4J6RH 5HDBE 4GQPH 3ZDXE 3ZTNH 4WWID 1ZSDB 1D9KD 5FB8A 4YH6A 3MNWA 3ZE1F 1XH3B 2EE2A 4AK1A 4UOW1 2Z8SA 5F9WC 2NX5E 1G7QB 3O4LA 4ODVL 4ZS6D 3HE7C 3E3QC 1SYVB 3AMKA 5TFSL 3TA3B 4KHXL 1CLYL 3BRGC 3EZJB 4D8PB 2EC9T 1S7TB 3GIVA 1N59A 2QJDA 1JGUL 1XF4B 5C6WH 1VFMA 4L3ED 4KDWA 5ACMA 4PUBL 4PJDE 5CINL 3TBTA 5EPMB 5E70A 1ZEAH 3LEXA 5D1ZB 3VXUA 4DCQA 1CE1L 1UXWB 2AJZA 1OWWA 1OTSD 1V7ML 5K9QI 2DJUA 4FZEH 4F80A 1CN4A 1KPVA 2GI7A 3GB7B 2ORBH 3D2UA 4KJWD 2MPAL 4PJAF 2YUWA 3MMEA 2NX5A 4KAQL 3IDNA 3TIEA 3HKFA 2E7BA 2CKBA 2ATPA 4OZIE 1ACYH 4NQCD 5JUEH 2HN7A 3BOVA 4JO3H 3BHBA 5ECJE 1S7XA 1YY9C 4HWUA 4ZUWA 4HLZG 4YK4B 2QQKH 2W9DH 1KB5L 2FJFA 2BOCB 4M1CD 4PJDA 3S88L 1J9CT 4XP6H 3RJQB 1MREL 3L3OB 5EU4A 1A1NB 4K23H 3QWRA 4NC0B 3WLBB 1J1XL 1OARL 4XB8A 1SVZA 1MFDH 5ALCL 5EC1B 3QUMH 3MQIA 1BIIA 2EDNA 4GW5A 1U8LA 1SYSB 4HXAH 5ISZB 1A7BA 4OZIA 1TNMA 1YPZF 4WJ5A 1J11A 1T22A 4LIQE 4PG9A 1QYGL 4NPYB 2AJUH 1MVUB 5DK2B 3M8OH 3TJEL 1IAOA 5CEXB 5ERWA 1GZQB 1PX3A 4LFHG 2VDMH 2FATH 2FH6A 4ZS7H 1CFQB 5GRWA 43CAB 1QP1A 4Z5RA 3HPLA 2A6JA 2YD5A 1U3HC 4P59L 4HMDA 4K9EC 3MR9A 4LAQL 5F72S 2HVKA 4NN5C 5TH2A 5IESL 3DUSB 3UTTB 4EI5D 3ARDD 2C3XA 2Q3AA 4KHTL 5FOBA 5GGUA 1X5IA 2XPGB 5DVMA 1RK1B 1OM3L 1YMMD 2A6KB 2Z8WC 5I8EB 1J88A 5CEZH 2XQBL 5L8KB 5T1LB 4RMWA 5D1QC 5IMKB 1PX4A 1R0AL 5F9WB 2NTSP 3PJSB 2OR9L 4XVUC 1UH3A 3ARED 3HE7B 3ZDZE 3QHFH 1UJ3C 1VERA 2OTPA 4N1HB 3S4SG 1WBZA 1G0YR 1YECL 3P3YA 3DUUB 4YHLH 5GJSL 2O61A 3T0EC 5E56A 1XIWD 4QHMB 3GEWB 1BJ1J 2X4UA 5LXGL 5DDHB 2GTZB 2AJSL 3VWKC 2FGWH 4KV5F 4H8WL 4CVZA 1P7QA 5AWNL 1YN7A 4K3DH 3FOMA 4LNRA 4LDOB 1CDBA 3QQ9D 1CDHA 5C07E 3U9UB 1EFXB 1HK6A 4KTYA 4QTHB 2EYSA 1BZ7B 2E7MA 1NPUA 3GDBA 3ULUD 4YR6B 3T3PE 3OB0H 4KMTH 4LSDA 2Q86B 4MAYC 3BDXA 3I3DA 5DK3A 5E2JA 1YEEH 2VLLA 2ATKB 3C5JA 4GS7C 1YC8A 4NZRL 5FYKD 4LQ1A 4IS6B 1GHFL 4JRYE 1DVFC 4XBGB 2XT1B 1WC7A 4R2GB 2X70B 4LHUB 3EYOA 1HHIB 4HH8A 4LVEA 5F9OH 2EDRA 2HT3C 4KI5D 1JGVH 5GGQL 2VXVL 2HRPL 3L3KA 5IVXF 2VDPH 3PV6B 1PG7L 1JZ3A 3RP1A 1JZ6A 4Z77A 1JNJA 2JIXA 3G6DH 5F1OB 4W4OC 4YBQC 5C07A 5MERA 3IT8D 1CU4H 2GCYB 1YEDB 4QHLB 4FQIL 1VACB 1JPST 1LK3L 1LK2A 5C0EB 2HTKD 4YXKH 2R56H 2BZDA 1KB5A 4X5XA 2EIDA 3ECBB 4WTXA 3FO9B 5CLTA 1LEGA 1EEYB 1F00I 2FEEI 3QCTH 4HCRL 5DSCB 1F02I 3C6LC 5TDOB 5LGJA 2VZUA 3BPCA 4LRIA 1F4WL 1FZKA 4WFFE 4JRYA 1KIUA 5TQ0L 2P43B 5EUKA 1CBVL 2O5XH 2IANB 1B0RA 1ES0B 1HHKB 4FQ1L 3KLSA 5HY9B 1ZMYA 3BKJH 3CLEH 1ZXQA 4PGZA 3IRZA 1OAUL 1U3HB 3TNNB 3B6SB 4TN9A 4Y8AA 1A1OB 4ZD3H 1X4XA 5DMIL 4NN5B 3WIIH 4UBDD 2FBOJ 2VE6B 5JHDB 4Z78A 4RX4A 5GGVH 5DD5H 5F1SA 4DGVL 3RVXC 4AJ0A 1OCWH 4N0YL 5D1QB 2DAVA 4GMSH 5DUMH 1RUMH 4P0DA 4KKAC 3G5ZB 4KRLB 2VR9A 4O5LL 4DN3H 1U8OA 2VLKB 3L5IA 3REVB 5EUOF 2O5ZH 25C8H 2RCSL 2AEWA 3KHOA 3QUXA 4P23C 3U9PL 3EYFB 4MNGE 1TJIH 3LN5A 1VB9A 3VD5A 5C0IA 3S3PA 1IFHL 2OTWB 3LQMA 4LLVA 2E6JA 4NCC1 4PV9A 1HEZB 1RZIA 2KQMA 1U8QB 4UTBH 3R06A 4J23A 4PR5B 1ZLUH 4OZFB 3OL2A 1FYTD 2B39A 5HPMB 3IGAA 3VI3F 4M6ML 5FKPB 4M5ZL 4J7RA 2LAGB 1KTLB 3ZDYE 4Z7QF 3O11A 5HI3C 2WLZA 2FATL 1KLGB 2VLRD 4GS7B 2G75B 3WYRA 2NZ9C 3DX6A 1NUNB 3MOBL 1UH2A 4MNGA 4NKMA 5KBNC 2DQJL 3X11B 4WNQA 3GUTA 5HHXH 4P2RD 4BKLA 2ZUXA 3SJVB 1MEXL 4K7PX 3TH3T 1PY9A 2I9LA 3UO1L 2R0KH 4OIIL 5J7CC 4ZOCA 4U1GC 4JPWH 3NACH 4OCXH 1DLFH 1BJ1H 2OXHA 5LAXB 5I1JH 1F3JA 3TBVB 5BV7L 2QBWA 4R97C 1BFOB 3QNXA 2Z93B 1EEQA 5E8PA 4YX2L 5BOZG 3O3BA 3R1GL 3IETA 5DUPH 4N9GA 4JFHD 2ICWJ 3OR7A 4ETQB 1Q1JH 4DEPC 1J1PH 1RULH 1UCBL 3RIFK 4UV4L 4P4KA 3J8F7 1OB1A 2BC4A 3TF7C 3C6LB 4Z0XA 1JYWA 5HVWA 1K8DB 2WANA 3MBEA 4NJAL 1EAPB 1MJJB 2AJYL 3BMWA 5H94A 4ZFOB 1QOKA 3E1F1 4Y19B 5DRXA 3G6JF 4MDJA 1LHZA 1T89C 1T21A 3T0DA 5ID0A 5T1MB 4K9EH 5I17A 3TO4A 4KKCC 4P46A 4LLDB 5T3ZH 4HCRA 1AIFB 2BVOB 4ZUTB 4UT9H 4OZHF 1BHGA 1N3NB 5E5MB 2FHFA 4HQQL 4URTB 5FV1L 4MJ4A 3BVNA 4LSRL 3RVTC 3OKEA 3IJYA 4HFWB 5B8CA 3AAZB 4WI7A 4NSKB 1MRFH 4N0FA 4RRPA 4ZUVA 5KW9L 4P23B 3NFNA 4LQFL 3PWJA 8FABB 5DD1L 4XPFL 2X4TA 2QQQA 3KPSE 4Y4FC 3W5NA 3JUZA 3CGTA 4GXUM 4XP1L 4MB4A 5DJCA 5IP4A 4JFOB 2H3NB 1FN4A 3ROLA 1L7IL 2H32B 1MIMH 4LCUB 2C3HA 1XF5B 2MJWA 3BZFB 3FOLB 3ETBF 3FFDA 3L5XH 5BOPA 5DI8B 4ZFGL 3LCYA 1OGTB 3T2NL 4FN0A 3N0PB 4M5YL 2F8VA 1QLFA 1I7UB 4RGND 3BUYB 3NFPA 3EYQD 3MODL 4OZFH 5GZOC 1YY8B 2FLBT 5F1IB 3WFHB 1CL7H 4M6OH 3PWPE 5EZOH 5GS2D 2QEJA 4NHUA 2HJKB 5DYOA 3M1BB 5DVOA 1AXTH 9CGTA 1EVUA 4XPAH 4U1IB 4LLMB 3T65B 3L7EA 4M1GH 3ZKND 3QUMA 2PYEE 1H5BA 2YUZA 3O9WD 3KYOB 3WLWD 3KPSA 1FYHB 5JHLL 3QIWD 2UV3A 3UBXG 3VD7A 4PGJA 3PXJA 5EIIB 4UQ2B 1EJOH 1N6UA 2W9EL 1MFNA 5TDNA 1NCCH 1U92A 4U1GB 4Y16D 5FFLA 4R4ND 3L6FB 1KTDB 1IGFH 1II4E 1T5XB 4P99A 4R97B 1LWRA 2VWEC 3QIUB 1S9XA 4D3CH 4HWNA 3PWPA 4DEPB 1T2JA 4XX1E 1WISA 4UDUB 4RFOH 4WI8A 4AG4L 2OBGA 4FRWA 2PYEA 3GHEL 3LEVH 4NYLA 1H3WM 4WCYL 5B22A 4V1DD 3MRGB 2X4SA 4MJ5A 3CCHB 5MENE 4F8QA 1W72L 4OLZL 2GEEA 4TSAL 5SWSB 2QHRL 1FRGH 3CFEA 1T20A 2GTWA 3HRPA 2D0GA 5IBLC 5F88A 3TT3H 5E00A 3HG1E 3ZKMC 4J4PD 2ARWA 3H9ZA 4J12A 2CR3A 5EN2B 3EYSL 1NC4D 3GSWA 1AE6L 3N1QC 4WUKL 2FH8A 1INDH 4JFYA 4EBQL 1WUNT 3MJ7A 1TQCB 1U8IB 3MGOA 4Z95H 1LO3L 1G7MB 2I27N 4K07A 1I3RA 5FB8B 5HYSB 3VH8A 3KLHD 1S7WA 3S8WA 3NABH 2HKHH 5HYIA 4BUHA 3MCLH 2DM3A 3I75A 1KCUH 3HLAA 4JPWL 1P7HL 2E3VA 4K2UH 4L8SA 4IDLA 1EZVY 2EH7L 4PB9L 1A2YA 4WW1A 3UDWA 2FD6L 1JK8B 3FONA 3HG1A 3MXWL 2N56A 2IPKA 1G1YA 2YK1H 4TVPD 5GGVY 5TE6L 3GSQA 4KVNH 1KN4H 1RULL 2VXUH 4OLXL 4UQ3A 3VXUB 2AJZB 2D03L 1IC7L 4GAGH 5F96H 3WHE0 2ZOLB 2VZOA 5F7DA 5ESAA 5GGTL 2DQDL 4MVBD 1KPVB 3BO8B 3TWCH 3VXOA 1HOCA 5D7KE 2H6PB 3ZYIA 4M48L 3D9AH 4YZFE 1U58B 1YQVL 3OAYK 1QPPA 3MMEB 2NX5B 4OFKA 1S7RB 5C0BE 3TIEB 2QHLA 3OGCB 2CKBB 2ATPB 3DSFH 4I9WD 4BELD 3UCRA 3QPQD 1WBXA 4FQJL 2EDFA 3V6OC 1FC1A 4HW6A 1S7XB 1UEYA 2XZQH 3V52L 4IMKA 4KFZC 3PWLB 3BPNC 3NPZB 2BNQE 5BS0B 1BBDH 5JQ6H 2Z31D 3V9FA 4FQCL 3UYOD 1RVFH 1X5HA 4LHJB 4JHAH 4X4ME 1U9KA 1G0XA 2EC9U 3OAUL 3QXDB 4DW2H 1T0MA 1W0YT 4P2OA 2BRRH 1BIIB 1ZA6A 6FABL 4ZUSA 3CFIC 3UZEA 3DO3A 5C0BA 1HXYB 2CRYA 3D48R 5IW3A 4OZIB 3E6FA 2AQ3A 2DTMH 3GIZL 4IIQC 3VFOB 4UUJA 4LP5A 3CFCH 2B8OT 2O5YH 4NC1C 3MCG1 1IAOB 3CX2A 4RFNB 2BCKA 4I3RL 2FLRT 4JB9H 4TVSa 2BNQA 3QNYB 3MLZL 2G2RA 4FQXD 1FL6B 1L9NA 5A3IC 4PV8A 5BVPH 3CZFA 3U1SH 2X1WL 2YEZB 3MR9B 4X4MA 2B1AL 2HVKB 2G5BA 3P0GB 1W72A 1BQHA 1U8HB 3I9GH 5H8DA 5FOBB 5F7NC 2DKSA 1KB9K 4WIQA 2ZKHL 4JN1H 2Y36L 5I0DA 4XGZA 4LCYA 2A77H 1J0IA 4JFED 1UWXH 4B53A 4JG0H 2LV4A 1B4JL 1TETH 4WY7L 2EIZB 1AGFB 1AGEA 5CJQH 2UVFA 2UY7A 2LABA 1JWMA 2X4UB 1C16B 4D3CL 3X17A 4IRJA 3LHPH 1JPFA 3ARGC 4MNQD 2BVPA 4N68A 1MCIA 4JPIA 5D7JC 5EIVA 1DQJA 3P40A 3X3FH 5FM8A 2R39A 5HVFB 1YN7B 4FG6C 4PJCE 4QF1A 5J1AA 3K46A 5KZCB 4JZNB 3SO5A 3U36A 2D4DA 5E4IA 5T3ZE 1KCRL 4WFED 3T09A 1NCWL 3V7AG 1GAFH 2AXJA 5T1DH 2VLLB 3ZMRA 4BK5A 4HS8H 4MB3A 2HYMA 5HVHB 5EBWA 5JOEA 3GKZA 4B50A 5JR1L 3MV9B 1MWAL 3MLVL 5JZ7D 2D4FA 3ALXA 4AMKH 3MUGB 5GGTA 1WC7B 3BPNB 4PG2A 5KSAC 3EYOB 3DJ9A 3MZGB 3WFCL 1JHKH 4LCWD 3W0WE 3L3KB 4G42B 2GKIA 3AROA 5F6IB 1FE8L 5GJTH 4PJCA 4Z77B 5J57B 3IDXH 3S37H 1ZHKA 3TV3L 3KYNA 4R6UA 4BSWA 4PJXB 2MQCA 5CWSB 1LK2B 4J3XA 2XNAA 3QO0A 2H1PH 3DXAD 1KGCD 1L0QA 3B9KA 4P2QD 2DLFL 5EOQL 1DSFL 4TULH 4WHDA 4QRQA 3UTSB 1MRDL 4PRHE 4I48A 3SKNA 5IJKA 4JRYB 5IUSA 4JO4L 2FCBA 1B0RB 1KN4L 3CVHB 3GBNL 1ZS8B 1XCQA 2OZ4L 4BQCA 2VUYA 3W0WA 3W2DH 3SGEH 4D2NA 5HHMD 4ZODA 4PTTB 4NC2B 1OF2B 4DVRL 4X7CC 1JGLH 5IVZB 3GSRB 2IBGA 3TO4C 3H9YA 4Z78B 2Z91B 5IMOB 1ZTXH 2RAMA 1CVRA 4PREA 1F13A 3OMZA 3TYGL 3LKQA 2IH1A 3MREA 1HNGA 1RV6X 5GS3A 2VO5A 4NO5A 3CH1B 2BVUA 3QHZH 3EJZD 4KK8D 1T1ZB 2V7HB 5CUSH 2YZ8A 1AY1L 3TZVD 3ZE1E 4PRHA 2WSKA 2WBKA 3MYJA 4U1JA 4OGAC 1M05A 1P7KB 4X7DC 3MCKB 3QUXB 2VLJD 3CC5A 5D8JH 4L8BB 3LN5B 1BGXH 2NY1D 3GRWH 2EDLA 3VFWA 3SGKC 5FYJL 1C7TA 5C0IB 4POYA 1FIGH 3OG4B 3ARGB 4HG4K 2V2WA 4LLVB 5DR5H 2AEPH 1JGDB 1OPGL 3DMMA 2FDBP 4OKVA 2AI0L 1UWGL 3SE4A 1WZLA 2VDNL 1RZIB 3UJTH 1KULA 1XR9A 4UT6L 3R06B 4MWFA 2P24B 3JWOC 4G7VL 5I30H 4WWKD 4UB0L 1AGBA 5IKCA 2R2BA 3MXVH 4RZCA 5K9JL 2YS4A 2CJUH 2IGFL 3BGFC 3P4MB 3W11C 5JW4Q 3EDKA 4QT5A 4PJAE 5DRZB 4Z7WF 3FO0H 3O11B 4G80B 2ED9A 5EFIB 3QZWA 1GZPA 5KVFH 3BWUC 1Q0XH 3V4VL 3DX6B 1R3JB 1PY4A 3HI5L 3O6KL 2NXYC 3GUTB 3OJDB 1TVHB 5KSAB 2A1WH 3O81A 4PRPD 4YDLC 3WEXA 1KFAL 5E2TH 3RIAF 1LD9A 1LO0L 2A0LD 5L9DH 1FH5H 3BDBA 3K8MA 1A47A 4LSSH 4Z7OF 1F3JB 1A7PH 5HYQA 2E7CA 3D3VB 3QNXB 3MGAA 2PW1A 4QOKE 1MWAA 3QXAB 1NGWA 3L5HA 5ID1A 1IGYA 4N9GB 4PJAA 3VW3L 1IT9H 3DGCR 3OR7B 4OB5H 1CT8B 3EHBC 1S7QB 4LASH 1YMHB 3SCMA 4KQ3H 1YPZE 4XWOC 2BHYA 1Q9OB 1AKJD 1EHNA 1JWUA 4LPWA 5JW3L 1VFAB 1T0NB 2VISA 2UZIH 1DQTA 1QZ1A 4PJ9C 4MQXD 4Y1AB 3BPOC 3V95A 5H94B 1AQKH 4TOYL 5HD8D 4NP4L 4F9PC 5BV7C 3U4BL 3PUCA 1E6JH 3PGDA 3QEQB 3QXTA 4YDVA 4MDJB 3OXRA 2IFFL 3CVHH 4KUCD 5C86A 3PGFH 4PRBA 1N4XH 1T21B 3S34H 1E4WH 1PAMA 4JRXE 5ID0B 4F7EA 1N0XL 4DTGH 3TO4B 4P46B 4ZXBA 5DURB 3IRPX 3SDXB 4BQBA 4DQOL 4EDWH 4F2MB 5F9AC 4QOKA 1JTPA 2CMRH 2AXGA 3TIDA 5GRYA 3VWJC 2BSSA 1ED3A 2XWTA 4AZ8A 4J8RA 2HT2D 1YPZA 2OZ4A 3P9MB 2XQYK 1KC5L 3IJYB 5B8CB 3QA3A 3PE9A 4NKOA 2ZOKA 5FYJE 1OW0A 3RBGA 4IRSA 4ZUVB 5JNYB 4LPUA 2YUXA 2R8SL 3D5OF 4PJGF 1JHTB 5BRZD 3DV4A 1P2CA 4DKAA 2DF3A 1JP5A 4ZOEA 2X4TB 3OWEA 4HBCL 5KVGL 1REIA 4JRXA 5DJCB 3SPVB 2D3VA 3UP1A 3PNWA 1FN4B 4X8XA 5LVEA 4YDJB 4KZEL 4A6YH 4DGYH 4JZOA 4M9OA 4KV5E 1I1AC 1G7IA 3T8XB 4B0MM 3G5XA 3LS5H 4NRXB 1UACL 4HFUH 1A1MA 3NZ8A 4UAOC 3ET9F 1NH6A 4OBSA 4D9QE 2DLTA 5IIEB 3BGFB 3F58L 1ZLWH 1FL5A 3CU7A 2ADGB 3QJFB 5FM5O 4PGBA 4PJ5D 5DMGD 5AZ2H 1XGQB 5DYOB 5SX4H 3KXFE 3MLRH 1DL7L 4C4KO 3IKCA 1BAFH 7FABH 3JWDH 4XVJH 4NNYA 2R2HA 3OG6B 2DWEB 2NXYB 1BFVL 1Z0MA 1HQRB 2XTJE 3EKCA 3KPSB 3T04D 4HZLA 3EFFA 1FDLH 4YDLB 1YC7A 4NQDE 5TDNB 5CD3A 4NGHH 3C5ZC 5D5MF 1U92B 1QUNA 4BZ1H 4RBPK 3BP6B 3LKNA 5IVXE 2HP4A 1CZ8L 1EXUA 3NTCL 2VXTH 5T5NF 2XG5A 5DVKA 3UTZB 1K9TA 1A0QH 1I7ZA 1FPTL 1S9XB 3S6CA 4BFBD 5IBUG 2JKXA 3AS3A 2C1OA 3OJVC 2HT4C 1BM3H 1A7QL 2B0SL 4JGJA 3KXFA 1E27A 4HJJH 2JJUA 4LSVH 1WFTA 2X4NB 1DQLH 1OAXL 3BQUC 4E0RA 4PP2A 3BPOB 5EU7C 1AXIB 4NYLB 4YDKL 1EHLL 2DMKA 4PP1C 2CKNA 1QNZH 1R3IH 4WI4A 2YBRB 2X42A 4ETYA 5BV7B 1UZ8A 5LCVL 4WI5A 5F7HA 2XZAH 4NQDA 3N9GH 2ZCLL 4X8JA 2GSGA 2P5WE 5F93C 1T20B 1U42A 3JTTA 2GTWB 4MYWB 5IVXA 4MHHI 2VTFA 2FBJL 5DO2C 1U2CA 4GRLC 2LFGA 1QFWL 2X4PB 1Q0YH 3PF2A 5E00B 4PLJC 4YIQB 5HBBA 2BXYA 4TTDD 1S9YA 3FN0L 3FZUC 3DUHA 3HMXL 4HH9A 5JOFA 4S2SB 1CDUA 3GSWB 1KXQE 5DMYA 5ITBH 4X99A 1Y6MR 2LVEA 4JFYB 1GGYA 3SKJH 5DHVA 2DICA 3IFPA 3MGOB 4FTVE 1KCVH 5EZIH 4HUVA 5IFJA 15C8H 4KDTA 3MV7E 3MRHB 2OS7A 1HYSD 2HWZH 1CICC 4ZYKA 2ZP0T 2QTEA 3VH8B 1A7NH 4KRPD 4OD2A 5EUOE 1KCKA 4MQSB 3I75B 1QEWB 2P5WA 5GRUH 3D2UD 3H7LA 1TJHH 4XCNB 4OV5A 1D5IL 3OKOA 2P8MB 4L8SB 4WHYG 5D1XA 4WW1B 1U8MB 2JELH 4GKSA 5DGRA 5HYEA 3DVNA 1I1AB 4WHTA 3QUKB 1QKZH 2IPKB 1EH9A 5F7EL 2APXA 1RZ7L 4OLYH 3VXRE 4XCEA 4NQSA 4UAOB 2OYPA 3DARA 5FGCE 4HKJA 3QRGL 2XA8L 3GMQB 4UQ3B 2L4OA 3JWOH 4FTVA 1I8MB 1W0WA 2QR0B 2OCFD 1IEAA 3VI3E 1OLZA 3MV7A 4WTZG 5F7DB 3HE6C 5ESAB 2C1PB 4U31A 3S7GA 5ADOL 2BVTA 1GYAA 1HOCB 3TBYB 1E4XL 4HUKB 4Z7QE 5E6ZA 3MFFA 2I9TA 4OCWL 2F8XC 4LOUD 5EUOA 3ULVH 4G8IA 2B4CL 3CX5K 1J86A 3RHWK 1I9RL 5FM4A 4E42A 3FCTB 2ZUUA 4U6VL 1CR9H 3FKUS 3GSNL 4X9IA 3SEPA 5HSFA 4K7FB 1T1WA 3WS3A 1JVKA 4Z7VB 1SEBA 3VXRA 3QR2A 1VGEL 5LBSH 1OD7A 1OVZA 1CVSC 1VEOA 5DF0A 3KPMB 1UWEH 3C60A 1GC1C 4S10A 3MV01 4UIKH 4P2OB 2GUOA 4OGYH 4ZUSB 1N8ZA 5C0BB 3BQUB 1JNLL 4LEXH 3E6FB 1NBZB 1J0YA 2SEBB 1L6XA 3MNVB 5GSVA 2JJWA 1KB9J 2O26U 2IFGA 3QFJE 3HMWL 3IJHB 4MD5A 5IFAH 1HYRC 2VERN 2RFXA 3G6JE 3I02B 2Y06H 2BCKB 4JFQA 4HIJB 4Y4HD 3U79A 4GRLB 1SJXA 5HI4D 5F7LB 4Q6IA 2YD3A 4XZUA 4OZHE 5EC2A 4G8GD 3P11H 4GKNA 4OD3H 2ADIA 4NHCH 1BQHB 4ZFFA 4JAMA 2YWZA 4MB5A 2E7HA 3HS0B 3LKSB 3GI8H 3HNVL 4CDHA 1CICB 2G5RA 1ZVSA 3ESVF 3L3DA 4NM4L 2ARJQ 4XGZB 4OLEA 5FUCE 4LCYB 1P7QD 4L9DA 4U3XA 1YEGL 1G7JB 4RA3A 4HPOH 3QFJA 4Y0GA 1N7MH 3NGBC 3G6JA 3HMXA 5L2KE 3O2DH 3HNTH 4YO0B 4QY8B 3WFEL 4U4BA 5CD5D 1A6VH 1VFBA 3M45A 4YDIL 2V5YA 5EU3A 4N0RA 4HLZH 2A2QT 1F11B 1A4JA 2PXYD 4FHBD 4R9HA 2IMNA 5TQ2L 3PV7A 5HDOA 3TBWB 4JE4B 5JPMA 4OZHA 1JPFB 1QQDA 2BVPB 3MBXL 4R0LC 4JPIB 5TE4L 1PQZA 5FHAH 3SE4C 1KN2L 3HC3H 5C9JB 4QF1B 3CLFH 3HE6B 3MRRA 3NIGF 3MPCA 3QDMD 3V4UL 4NT6B 4MA3A 5HGDA 3LB6C 3HC0A 1DEDA 5EWIH 4LKXB 2BSRA 1FGNL 4XCFH 1C08A 4JGUA 4OM0H 5C07D 1OSZA 5J6HA 5L2KA 5B38A 5EBWB 1CL7I 2P49B 3E6HB 4HIXL 1CGUA 3BFOA 5TF1L 1KF9B 4PJIF 1JN6A 4RAVB 4BFIA 3MJ9L 3BDYH 4X6DF 1BD2E 5GSRA 3GJEB 3O8XD 1XGPA 1AO7E 3DETC 1DFBH 2XKUA 2VH5L 4Q2ZA 1Z9MA 1ZHKB 4PRNB 1NCAL 2DQEL 3B2UC 2NY5C 4BSWB 3GSNA 1PZ5A 2PR4L 2XNAB 4JJHA 3SDAA 4ALAL 3QO0B 4RX4D 3KPRE 4I13B 1QFUL 4HWZA 4NUGL 3T0XA 4G6MH 2DLHA 4X5WB 4M6NH 3GMOB 3SKNB 3WBDA 3QI9A 3FQWA 1LVEA 2BERA 3AU1B 1MCOL 1BD2A 1C5BL 1UEMA 5ICXA 2X7LA 3RWEA 2HFEA 4AM0B 1AO7A 3LIZL 3CDFA 5KOVC 5IHUH 1U8NA 2C4XA 1KIQB 3IU4H 4JEGB 1MCSA 3NCFB 4OGXL 4R8WH 1OQXA 5J13C 3UTQA 1SY6H 5I1EL 1U93B 3DRQA 4FNLL 5D9SA 1R5IA 4JQIH 4BK4A 3Q1SL 2IH1B 3FRUB 3MREB 3QEHB 4ZNCD 4HMCA 2BK8A 4NO5B 2Y5EA 3KPRA 5EU6E 4Q0XL 4KUZH 2BP3A 3K2UL 1RUPL 1ZHLB 3FFCB 4LPXA 3NGBB 1DQDL 1OW0C 4U1JB 3FO1A 3VFRA 3GNML 3MRPB 3T08A 2YRPA 4YHKH 4XWGH 3U7YH 4XC3H 4Y4KC 2Z9TA 2ICWI 3VFWB 3MLTA 3KLDA 1ZV5A 4X0KA 3OZ9L 4ERSL 1T03H 1HH6A 4X6EA 3DSNA 4R0LB 2HFTA 4HPYL 4BZ2L 4JFFE 4QHNA 1WF5A 4LKCA 4OKVB 3RA7L 4OCSH 3VXME 1J05A 3MRIA 3R8QA 1RURL 3CAFA 1XR9B 3IU3A 4FXGA 4M93C 1V05A 4MWFB 4MJIB 4JVWA 1QSFD 3LS4L 5HHOD 5EU6A 1D5BB 2I24N 3S98A 3S5LG 3FL7A 3WL9A 3ILQC 4KK9D 4L3AA 4Q9QH 4GAFB 2EECA 4M1DL 4U1NB 4QHUA 5CJOH 5GZNC 5E08H 5BZDA 2X4RA 3QUYD 4WU7A 1RHHA 3L1OH 4WI2A 4KY1H 3VFVA 4M7LL 2R0WL 4YHIB 2G60L 3VCLB 3MLYH 1RIUL 2A73A 3WSQL 4S0TD 1GOFA 4JFFA 3MBED 3VXMA 4ODWA 3RI5K 4APQC 1I9JH 4XPGL 2ZCKH 3O6LL 4IOFD 4MXVF 4XP4H 1GC1H 4MGXA 4O2FB 1A5FL 1TCMA 4PRIB 5JA9A 5HHVH 3EOBB 4XAWH 5DFVC 3UJJH 4GG8A 4YNYA 1MRCH 4HPOL 5ID1B 4PJAB 1NFDB 4BQ6A 3HZMA 3KYKH 5IOPB 4ODHL 5J12C 5DZNA 5KAQG 4GG6F 3PP4H 2XWBB 3HZVB 5HHPA 5JLZA 5E1AA 1D6EA 3NZHH 3VRJA 4U1HB 2FWOA 4N8PA 1FO0H 3L5JA 4YDVB 3B2VL 1P53A 4FQQB 3QPXH 3QXVA 3WIHH 1GGTA 5FHAL 3PL6D 3UMTA 3CDCA 1SM3L 5SWZE 1V3LA 2EDQA 4F7EB 2O93L 1CGWA 5J13B 1MCHA 3KPLA 4PY7B 3RX7A 3W9DA 3SKOA 1I8KA 4QOKB 2IPTL 1H8SA 4C55A 3MV8D 4IM8A 3ZTJG 4QRSA 3IDIA 2BSSB 1ED3B 2OJEA 4J8RB 3DBXA 3OKMA 2GITA 4EDXA 4ODTH 1YPZB 4K7PL 3AM8A 4FQLL 4AEIL 2ZOKB 3ARYA 4N8VG 2EEBA 1FCCA 3ARTA 3KDMB 4NBXB 2DMCA 3K81A 1YEHL 3Q5YA 3QUZC 3V0WL 4X7SL 3DV4B 1P2CB 4WVRA 4Y4KB 4NN7C 1RZ8A 1FL3A 1X5GA 5T33H 3ZL4H 3MRCA 3OKNA 3MOQA 4I0PA 4KQ4L 2WBJC 4TNVF 1S9VA 3H0TA 4JRXB 3A6OA 5DJYB 5SWZA 2C3VA 5D1XC 1MLBA 1NBVH 3PNWB 4QRPE 4Q9RH 1K8IA 1QA9A 4JZOB 1DDHB 4D9LH 2LU3A 3UTOA 3G5XB 1NCDH 3JVGC 1CD1A 1IBGL 4TRPH 1A1MB 4NFBA 1NANH 3JV6A 1RZFL 2YN3A 3GBLA 2WIIA 2D0HA 1P4IH 2GQHA 5ESVA 1HE7A 3SQOH 4JO1L 2F54E 2EYTB 3MA9H 4A2MA 2Z8VC 5DC9B 1ZLVH 1HCVA 3LPWA 4WO4A 4NFDA 1ZT4B 3L95A 1QRNE 2MMXA 3PWPD 4JR9L 1TDQA 2R2HB 3VGAB 4XNXH 5FGSA 3RDTD 4HZLB 3FMGH 1IZJA 1MPAL 4OZGF 5F21B 4QRPA 3RUGB 2PYED 3PP3K 5CD3B 5JPNA 1DBML 3LKNB 1GL4B 4CMHB 3VXSD 5A40E 4LSQH 5DJ0A 4MMZC 4H26B 1FNGA 3ARFC 2EICA 1YUHA 1I8LA 1N5AB 3S3JA 1UA6H 3GKWH 1SJEA 3B4NA 5D6DA 2NY5H 2EE3A 2ILLA 1QBML 1XF1A 4Y5VC 5F1NA 4GMTL 3MJ8A 2F54A 3RNQB 1A6WH 1FVEA 2YPVH 4B41A 3BAEL 2ZCHH 1NEUA 2ENSA 2VXSH 5J12B 3EFDL 1QRNA 4HS3B 3SN6N 3BESR 4ZTPL 4E0RB 1V3MA 4PP2B 4K7PY 4RSVA 4NRYA 3P77B 4Y2OA 4OD1H 4RMUA 4BSJA 4EQ3A 1HI6B 4PJHB 3NFSL 2GSIA 5EZLA 3RU8H 4LSUH 4EN3C 4EUPB 1K2DB 3MACH 4MCYB 1JF1A 3LQAL 3G5YA 4JFPA 5BO1L 5MEND 1A3RH 1EK3A 2HJFA 3GMRB 3O2WL 2BHUA 2AERT 4L3EE 2P4AB 3I6KA 4JQVC 4YQXH 1K6QL 2KKQA 2MWCA 2E8YA 4HH9B 4HUXB 3GHBL 2D31A 1J18A 1JWSA 4X99B 4NO2A 3IFNL 5SX5H 3FT4B 3HG1D 3SGEI 2Y25A 4R90L 1IGML 1N64H 1TZIB 1CE6A 2GHWB 4MA7L 2F74A 5IFJB 4YXLL 1DR9A 3EOTL 4GAYA 4G6AD 2K7QA 4ZYKB 3QUZB 1MCDA 4I18A 5F89B 1A9BA 1FFRA 4JDVA 4O9HL 3DX7A 1J0JA 4Q9CA 2NY7H 3UAJC 1AR2A 1AC0A 2XYCA 3OKOB 1G7PB 5D1XB 1V7NL 1V3JA 3CX5J 4L3EA 3RWFA 5D70H 2IALA 3DVNB 3U4AA 4WHTB 1RAMA 1F97A 4FOMA 4JCLA 4MA1B 5CSZA 5ISZD 4NQSB 5FYKL 1WCBB 4GRWH 4HKJB 2Z92A 1ZT1A 1FNEB 4WDIA 2VDRL 4KZDH 1PKQB 1HNFA 1MOEA 4FMKA 3EUUA 3U0PB 1AJ7L 1FFNB 3STZB 3A6BL 4Z7WE 5I1HL 4N0UE 3B3IA 1DBAH 4XMPH 1VFUA 5EUOB 4XNQB 4XNMA 3ARBC 1NJ9A 1CDJA 4NQXA 5D7KD 4CU8A 4I3SH 4RWYL 1JV5A 1G9NC 4WI6A 3OHXA 1OOAA 5J11C 4HUUA 4O51A 4PJBF 1T1WB 4G8EA 3WS3B 3W5MA 3BPLC 4LLYA 12E8L 1HZHL 4JKKA 4JKPH 3ARFB 1UG9A 4ORGA 5FGCB 4Z7OE 4U1MA 4WEBH 1KG0B 4K3HA 3VFGH 3CSBA 5E8OB 2BNQD 1HINH 1TFHA 5D7IB 5D72L 3HE7D 3P9LA 4Z7WA 1MY7A 4F58H 1NMBH 5ILTL 4N0UA 3P0VL 4M8QB 4G6JL 5CILH 2AK1L 4NUJA 5I73C 3MO1A 3VA2C 3WIFB 1KYOK 2BY3A 4M7KH 5GSVB 3E2HC 5FUZH 2BSED 3EDEA 4P3CL 3HRZB 1X5AA 2E7LA 4BFGA 2APWA 2DDQL 1EAJA 4MHHG 4JFQB 1AGDB 5EZJB 1X6LA 4EUPH 4IOSD 3IDYB 3WXVH 1IQDA 3TBSA 3PDOB 3P30H 3HNSL 2HFFB 4EI5A 1F8TH 3ARDA 5CZXD 2NY3B 3SE3A 4XVTH 2QQLH 4ZFFB 1KEGH 3MRFA 4LSPL 1MFBH 3SDDC 1YY9D 1S7UB 1ZVSB 3L3DB 1E4KC 4X6FB 4JPVL 1OGAB 4AIXA 4N5EC 1CFNB 3AREA 1I7TB 2DQGH 4PJGE 1TENA 4TUKH 2R9HC 1CDIA 3G6JB 5E2UH 2UWEF 3KG5A 4BFEA 1FNSL 5C0RH 4ZPTA 1N6QL 1HDMA 1FHGA 3AFLA 4JFXB 4LF3A 1VFBB 4K3JL 5EH1A 5EU3B 3SE9L 5JO5B 3RKDD 3WXWH 3ZHLA 1A4JB 3VD4A 2FX8L 1SMOA 4OF7A 3C09C 4OZHB 5I9QB 1QQDB 1NGPL 4KC3B 2WBWB 1MI5D 3TFKC 2BNUA 4F9LA 5KVDH 3RWDA 3MRRB 3M17A 4M7ZC 1PLGL 2P5ED 3WD5H 3CDYA 4OQTH 4M7LT 4HIIA 4MA3B 5HGDB 4P9HL 4NQVA 5C0CE 3HC0B 2FJGB 4L5FH 4LCCA 2IAND 1L0XA 3ALPA 3MSPA 3DGGA 4PJGA 1ADQH 3ARBB 1ODAA 3A6CH 1OSZB 4H5SA 2FO4A 1U3HD 5L2KB 1RSFA 2I26N 2BJML 5T3ZD 1G6VK 1T6VN 5J11B 5DXWA 1U8KB 5I15H 2YZ1A 5GRJH 4GXVH 3SKUD 5LQBL 4HLJA 4JANB 4P57A 5SX4I 5D5ME 1DQQB 4H1LA 3B9KD 5FYJU 1EBPA 5JXAL 4J3WA 1CTNA 3O2VL 3FHAA 3QISA 2WW8A 1FO0A 4ODSH 2P48B 1MHHB 2NY2D 3IAGC 3VDAA 1E6OH 4W6XB 5TPWL 3WJLA 4LHUG 5D2NE 2FIRT 1ETZB 5DD3H 4CVUA 1MCLA 3W0WD 1U3YA 3V6FB 5IVNA 5C0CA 4L8CA 3GSNB 1MFAL 2E27L 4XAKD 1CG9B 3T0ED 3IDMA 3SDYH 1QACA 3JUYA 5E0QA 4CJ0A 1WFNA 4FFVC 3H9SB 4H88H 1BBJA 3E2HB 4L9LC 2H45A 2ZSVB 1Q9KB 3VWKD 4HWZB 2CO7B 4O2EB 4JO2L 5D71L 2A9NH 1WWAX 1OY3B 1X5LA 4YLQT 2PO6D 5D5MA 3V0AC 3RQ3A 4DJMA 3LEYH 3FQWB 1NGQH 1PYWA 3PDGA 1I85C 1OTUD 4KDVA 3S9DB 1BD2B 4HHAB 4PRHD 1HXMB 5ICXB 2X7LB 1FBIL 5CP3H 3EDJA 2OJZL 1ZHBA 4LLUA 3R8BB 2VDQH 3TCXA 3HR6A 2DQIH 3TJHC 1TVBA 3E8UL 5D2NA 4MAYD 1LMKA 1S78D 4GSDH 2X2YA 5CCKH 4XCCH 1HCFX 1CGSL 3SDDB 4I4WA 2JJSC 1OT2A 3DMMD 5D7SL 1DVFD 1T83A 3NCYS 3RAJH 2ICEB 1RU9L 1SBSL 4X7TB 3BGMA 4JM4L 3MLSH 2VLRE 1FG9C 1FORL 1UM4H 3FO1B 3VFRB 3VRIA 3D85D 4JQXA 5DUBA 4KMLB 5EBLB 3MRDB 1CXEA 4Y2DC 3MLTB 4LMQE 1MH5A 2EDOA 4Z18A 4HKZA 3LKPA 2EXYC 3S96A 1OLLA 5CSBA 3BIKB 3KYMA 5DT1L 4LKCB 2F58H 1J05B 2E9IA 1O7VA 4AIZB 5I1CH 2R2EB 4FXGB 4M7ZB 1B2WL 2P42B 2IQAA 4L4VB 3HI6L 3FB8B 3TVMC 2QKIA 3DO7B 5EU6B 1A6TA 1JPTH 3REWA 2VZVA 4OZFG 3QIBC 5DTFB 3WL9B 1A3LL 2VLRA 1F4XL 1VA9A 1XCTB 4PJEF 3IAPA 1F6LL 1G9NH 4CW1A 2X4RB 4LLQB 3HC4L 4RISL 4WU7B 1BVKB 3SCMD 1LO2L 3VFVB 5CBEA 5DJZA 1B90A 3MRKA 5AYUL 5IB2A 4I77H 1J7VR 2XI9A 4EZMA 4JFFB 2VUOA 4HK3J 2IPUK 4ODWB 4KKAD 3SGJC 2WMPA 2IAMC 4UU9A 5I1LA 3BSZH 4XNUH 2DS4A 4DN4L 1BQLL 2ITCB 4FFZH 5F7MC 1JFQH 2ZUVA 3FN9A 2J6EL 3BD5A 1JNHA 5MEOA 3HZMB 2GJ6B 3FN3A 3BIBX 2BMKA 2FL5A 4L9LB 1AI1H 4G6FD 4WW2F 1XGUA 3TT1L 1NBYB 1SVCP 5J1SC 4WFHD 1F3DJ 2W0FA 5IQ9B 3GMPA 5HHPB 4RNRB 3SDCA 3Q6GL 4CN4A 1D6EB 4LARH 3SOBH 2FWOB 3H9HA 2RR3A 2OL3L 3MUY1 3LH2L 2HH0H 3H8NA 2X4QB 4H0HB 4IRSD 3UPRA 4GW1A 2WIMA 3PQYE 2PUQT 5HI3D 1K4CB 4U49A 5KSVB 2Q7YA 4MS8C 3NAAL 3QHTC 3BN3B 4L8DA 2NZ9D 3QJHB 2F8OA 4QRSB 2YMXH 4RGNE 5T1KB 5KVEL 2OJEB 3GBML 1XZ0A 5HI5C 3DBXB 4JFDB 4NM8H 1RMFH 4WGVB 4F7CA 3LN4A 4EDXB 2Y07L 4TVPL 2CD0A 5BXFA 1D9KC 3VFNA 1BVLA 2PN5A 1JYVA 3UYRL 1YNKH 3SE8L 3ABZA 5EA0L 2J5LB 1HHHA 3DIFA 2DQCL 3HPJB 1A21A 3QG6A 4GH7B 1JYXA 4Y2DB 4KKLC 1TZGL 2WWKT 4PJ8A 3L5WA 3O3EA 2AABH 2NTFA 3CVIH 3OKNB 4M61B 5T3XH 5SWZB 4JCMA 3ZT6A 3PQYA 3RRQA 1PSKH 1K8IB 4FFWD 4GJTB 2WUBH 3LQZA 3LV3A 2OK0H 5DVLA 4QHKJ 3CXDH 1A64A 3SDYL 4QXUL 4QRRB 1R6VA 3TVMB 1FFPA 4XB7A 3ZSSA 4O58L 3DHMA 5E6IA 3X13B 1DN0B 5B4MC 3PHOA 2WIIB 2K1MA 5IMLA 5ESVB 2GIYA 3QIBB 3RY4A 4S1QH 5IT2H 4YFEA 4KJWC 4AQ1B 4D9QD 4C56B 1E28B 3V2AR 5JXED 1GH7A 1WCQA 3O9WA 4WO4B 5I0ZA 5IHZA 1BFTA 3L95B 4KMQA 1J0HA 3F12A 5F9JA 3QIWA 3VG0L 5J4MA 4R26L 5F44A 3VXTA 1CK0L 3KXFD 4CL7A 4YXHH 4PJIE 5FCUH 4OAWA 1LP9F 4X6DE 4Y5XC 3CK0H 2XTJD 3RKPA 1K5NA 5JPNB 1SJHA 2IAMB 4QXTA 4GBXC 4WUUD 5EO9A 1X5XA 2ZPKH 1FNGB 4G3YH 1WJ3A 4OUOA 3LVEA 3GZKA 1F42A 1G9MH 2R1WB 3CFKA 1CFVH 4QTIH 1I9IH 1G7LA 3K8KA 1VKXB 4D0CA 1VEMA 5DQDL 3MJ8B 4XBPA 2NR6D 4L4TD 2GK0A 3GI9H 4Y4FD 2DJ4A 4YWGH 2H2SC 5ACZB 1T7YA 4ZTOH 2Q8AH 1VPOH 1A6UL 4HWBL 3BW9A 1KLFA 4ONFL 2F15A 4JPKH 3JTSA 2N7AA 4HXBH 3NCYP 4FQ2H 4PJIA 3QDGD 2Q8BL 4N0CC 1KNOA 2UZYB 1T1YA 2GSIB 4X6DA 4O02L 1A6AB 2J6EA 5FYLL 2NYYD 5GZOD 3G5YB 4JFPB 3LKOA 3ES6A 5KS9F 4M3JA 1BJMA 2F19L 3I6KB 4LBEA 5BMFH 2P5WD 32C2B 4ZOAA 3D18A 4OSUH 3LRSA 3EO1A 3S35X 1WFOA 1S5IH 2BVEA 3ARDC 4AH2B 4PGDA 4CNIA 1CE6B 4GAJL 4DAGH 4X4ZA 1J1OL 3KR3L 1KCSH 1A9EA 5JA8B 1D9KB 1F58L 4JFZL 3FQUA 4V2BA 4GAYB 3LZFL 1MQKL 3EO0A 5GGSY 3RVVC 4FTVD 3AREC 4JDVB 2MTPA 4I9WE 5EU5A 5BS0D 4KPHH 3BZEA 1IJ9A 4G6KH 1TNNA 2ZUTA 5HYSG 2XZCH 2G9HA 1NL0L 1ZVYA 1SEQH 4R96A 1KEML 4HF5H 1XIWC 1MJ7L 1JMZA 3SKMA 4L3EB 4OCRH 3RWFB 1T3FA 2IALB 5A2KH 3Q48A 3BH9A 5L6YH 3MRLB 3H3BC 1A7RL 4K3GA 2Z92B 1FLRL 5BQ7A 1I8IA 4UT7H 5AZEH 3IJSA 2EKSA 3F8UB 4WDIB 1IC4H 1OSPL 1U3ZA 5KJRL 3LAFA 3B5GA 3QQ9C 4DKFL 5C8JA 1P5UA 2BY2A 3WNKA 1MFCH 4XC1H 3ULUC 4K3EH 1GIGH 1PEZA 4MQTB 5IQ7H 4C83A 1QFOA 3GMNA 4KROC 3C6SA 2QQNH 5F3BB 1IC5L 2EH8H 3CIQA 5IBLD 1MJ8H 4KK6D 4H20H 3EJYD 4XNMB 4NQCB 3RL2A 2H8PA 1BX2B 2C5DC 5DJXA 4CMMA 4ZO9A 2ADFH 2VMFA 1AQDB 1GGCH 2P8PB 4Y5XB 4O51B 4GRMA 1MFEL 5IM7B 5GGRY 1OAKL 3RGVC 5GGSA 5EBMA 4LLYB 3V7AE 3Q6FA 4KI5C 2Z31A 4E9LA 1GCFA 1KLUB 4ORGB 2ADJA 1N26A 3VI4F 4MXVE 2AJVL 2AV1A 4QXGL 5E2WL 1J87A 1JE6A 2DBLL 4NQTA 3P9LB 5IMMB 3KJ6L 4XMLH 4N0UB 1GJIA 2IG2H 3OKDB 1G7HB 4NUJB 2ESVD 5FYLE 3WNPA 4GG6E 4JFEE 5IF0B 4UI2A 1MUJB 1P4BL 3EAKA 4PLOB 5D2LF 4POZD 5D6CA 7CGTA 1PW3A 4FS0A 4FQXA 4FFYL 3K1DA 3ROOB 2Y6SC 3QFJD 4WHYH 1S9WB 1IQDB 3TBSB 5KZCD 4P9MH 4R7DA 5IW6A 3BEVA 1DZBA 4HWBA 1A4KA 3VGHA 4OLWL 4UBDC 2YOCA 3IDJB 4EI5B 1BEYL 1A14L 1CFSB 3ARDB 3T2PA 5FK9A 1DQML 1YN6B 2DD8L 4PRAB 2FEEL 5GIRA 5GGRA 1YMMB 5L88H 3C9NA 4R4FH 2ZG3A 3H42L 4GG6A 2PF6A 4N8CH 3GSOB 1IQWL 4JFEA 3AREB 2FB4L 2KL6A 2VLME 1T2QH 4OKDA 1MJUH 5I8KL 4RQQA 4P5KB 3HB3C 3MLXH 1XIWB 1RUAH 4QRUA 4C59B 5FUOH 5DD0H 1CXKA 3H3KA 5E8DL 4HC1L 4W70A 1HDMB 5FA4B 2FSEA 2VIRA 1KJ2H 5BW7C 1TJGH 2MSPA 4LCWE 1S5HA 2R29H 3HUJF 1YEJL 2BNUB 2FHCA 1WK0A 1ZANH 4H0IA 3RWDB 3GFUA 3WUZA 1YEIH 4TNVK 1T80A 4S0SD 3BN9C 4PS4L 4HIIB 5I75C 4KROB 1KPRB 4XPHH 4NO3B 3TO2A 2WINA 4JHBA 4TQEL 2CGRL 5E99H 3DGGB 1NANI 4P5TC 5A3ID 4CN1A 4XHJD 4P2QE 3TYFB 4H5SB 2FO4B 3L3HB 1IGIH 1NMCC 5I8CA 4AT6A 1F90L 4OZGE 1H3XA 4P57B 1BWMA 1IEBA 3SDAD 3THML 5HVGB 4YAQA 3DVGA 4H1LB 1V5JA 1FZJA 4LCWA 5E4EC 5H2BB 2M1KA 4LNVA 2AAVA 1YNLL 4JY5L 1DEEB 5INCB 3FT2A 2YPLD 3SBWC 4D9RE 3WJJA 2Q3ZA 3QI9D 3ISWA 3MZTA 2I5YL 2R1YB 3S97C 2R2CA 2R4RH 3D25A 5FO8A 1P6AB 2OXGA 1AO7D 1T1XA 4L8CB 2I25N 5BCAA 3D69A 2MKWA 2Z35A 4YHOL 3BJ91 4P2QA 3GM0A 1MHCB 1QR1B 2DB8A 4JDTL 5DLMH 1BBJB 4HGWA 1IKFL 2DQTH 4S11A 4LP4A 2OLDA 4KJPC 4OZGA 2VXQL 5D7JD 5ALBH 3FQNB 3KPRD 4Y7MA 1PYWB 2XY2A 1MF2H 1AXSA 3U0WL 1M7DB 2OTUA 1HWHB 2YD1A 1B9ZA 3IDGB 1EBAA 4L3CA 4QKXB 3O6MH 1ZHBB 5D2NB 1TIUA 4M7JH 5MP6H 5ELIA 4CU7A 4MXQC 5HYJD 1TZHA 1Y6NR 4S1SH 4IDJL 4U1KB 5FGBA 4I4WB 5FXCH 1FAIL 3BISA 3QO1A 1C5CH 1P69B 3SGDH 2VKXA 3MLUH 3SY0A 3BGMB 3MLWL 1O0VA 1EUTA 3KHQA 4Z0BH 3WNNA 5DJDA 4YHML 2EDEA 4OT1H 2CSPA 1MH5B 4PRPE 3GJFK 4OTXL 3BKCH 2HKFH 3S96B 1RIHH 1VENA 3QRFM 3KYMB 4HT1L 2KH2B 2PCPA 2NY4D 3UBXI 3DROB 2MCPL 2IF7A 1FYTB 3BWAA 2D7PA 2WUCH 4WWKA 4OJFL 4XMKL 5J89A 2BDNL 5I75B 3EYQC 4NKIH 5K33A 5CJ5A 2W65A 4HC1A 3GJFA 4EOWH 5I76B 1A6TB 4HGKC 4AEEA 3MA7B 3KS0H 4P5TB 1FZMA 1DBKH 3QCVH 2VLRB 4XHQA 2HAZA 3S37X 3ZKNC 1NMCB 3WLWC 5DJ2B 4J1UA 4CW1B 3IAQA 4P2RB 3BT2H 2CIIA 4U6HA 4YHPB 4MQ7A 3EGSA 2GYSA 3F7QA 1D5ZB 4PRPA 3RTQA 5DJZB 3MX0A 1FNFA 4NO0D 4PJBE 3MRKB 5FGRA 3V8CA 3VMOA 5IB2B 1AD9A 2J88L 4CU6A 4TPRH 2F5BH 4OCYH 1D6VH 4KTEH 4Y16C 4KTDH 1U95A 5CKAA 2OQJB 1MIEL 1UM5L 4F3FB 4RAHA 1SQ2N 4UU9B 1WEJL 4MSWB 6CGTA 3O0RH 2ZSWA 3OKYA 2AEQH 2VZTA 1KJVA 1NEZA 4E41E 1JNHB 5MEOB 4LEOA 2BMKB 1AKJA 2FL5B 2IADA 3WS6A 4R4BB 4S1DD 1XGUB 1HSAA 3B43A 1RFDH 3STBA 3GMPB 4HWEL 4UTAL 5BRZE 5FF6A 4PJBA 3H9HB 1M71A 3KNBA 1S3KL 2JB5H 1I1YA 4LDEB 5I66B 3KLAA 3EYUH 4DUWA 1NGZA 2LU4A 4TSBH 3HN3A 2DL9A 2H9GA 1E0OB 3L9RA 1RZGB 2W9LA 4J4PC 5C08D 1U3JA 3JV4B 4F57H 1WZ1L 1KELH 3ULVD 4LRNH 3BKYL 4XXCA 4I0PD 1DBJH 4E41A 2QSCH 1JNNL 3CXHK 2CLZA 1LO4L 3WKMH 2XRAL 1MHPH 2WQRA 3T77A 1XGTA 4NKDA 4PJ5E 4JZJA 1IGIL 3K1KC 2VSCA 4XPBH 3VFNB 3NA9L 5DEFA 1BVLB 3C2AL 3KLHC 5BRZA 1G6RB 1CQKA 5DFTA 2UWEE 3QSKB 4EIZC 1JIBA 5HDQH 2YD6A 2LTQB 3DIFB 2NW3A 1OAYL 1QLEL 5TE7L 3QG6B 3RY6A 1D5XA 4O2CA 5GS0L 1JUFA 4UILL 1D5MB 1EGJH 2NTFB 3CPLA 4U6XA 2ERJC 2FX7L 4M43H 4XI5D 3FAWA 2CRZA 4I3GA 3LV3B 4XWOD 5DZLA 1LE9B 3T3MF 2R69L 5K59F 4QRPD 5EULV 3TNMB 4YK4C 1FFPB 4PJ9D 2V2TA 5IBTL 1YQ2A 3V5HA 4PJ5A 2Y1VA 4MVBC 1UQSA 1J12A 3PGCA 3BD4A 1B4RA 4HIEA 5J1TC 2B20A 1OAZH 1WT5A 2UWEA 5IHZB 1P84K 4JM2C 1MCPH 4DZBA 1G9EA 2W0PA 1IEHA 3QIWB 1KIPA 3VXTB 4QWWC 4JY4A 1U8PA 2B2XL 4IJ3C 4OAWB 1QRND 2FX9H 3N85L