2B1AH

Crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug1033 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
226
structure length
226
Chain Sequence
EIQLEQSGAEVKKSGESLKISCQTSGYSFSDYWIGWVRQMPGKGLEWMGIFYPGDSDSRYSPSFEGQVTMSADRSTNTAHLQWSSLKPSDTALYYCARLGGDYEDSGADAFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 2219, light chain
total genus 37
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aH01
4HEPG 5IG7B 1UM5H 4U1LB 1VFUA 2H45A 4G42B 1MCOH 3W11C 3G5XB 1K8IA 3GMRA 3MNZA 4HPYL 4OZ4A 3TN0D 3LD8C 1FGNH 1G7MA 3LEVL 3ZKXB 1KJ3L 4PJGA 3RVWC 4HF5L 2FBJL 2IQAA 5T3ZH 2NQCA 4PRDA 25C8L 3BZFB 3FMGL 5TF0A 3BZFA 1BREA 4AEHL 1IAKA 1TTGA 1CGSH 4RGNB 3QCTL 5IR1B 5E24E 4JFDE 4QGTA 1Q0YL 2DB8A 4LSSH 5FKAB 1S8DA 4Y4HD 1INQA 2W38A 5B38A 4QRRD 5GZNC 3CLEL 4BA8A 2BFVL 3S96B 1FE8L 1R3LA 3IT8D 5DQDL 1BZQK 3H9SA 3OHXB 3QUYC 4GOSA 3VWJD 4YDKL 5EU3B 3X11B 1CDYA 1SMOA 4Q2ZB 5AWNH 1ZVYA 1MFDH 2V5MA 3F5WB 5D7LA 2NX5D 2FX8L 1WIPA 4GW4B 4NJ9H 4M1CC 4PBXA 5M94B 1HH9A 2P8MA 3OF6D 3LIZH 3V9FA 3ULSB 3LN4A 5EOTB 2OLDA 4XPFH 2PN5A 1CDHA 4PS4L 5D7JB 4N0CC 3TJEH 1VGKB 1CTNA 1HKLH 3GJFB 3JV4B 6CGTA 1AO7A 1YMHB 3ARTA 1NC4B 2AJ3B 3V5HA 4NN7B 4MA3A 1P7QD 3A67H 1I8KB 2AEPH 5GGRB 5HHVH 2K3TA 1D3CA 4GMSH 3MV01 1GZPB 1I1YB 4Z7UE 4YDJA 1A14H 2X4RA 4L29A 5FOBA 4HFWB 3KYOA 4DKEL 2CKBH 2QV2A 5HYSG 4OGZA 4XX1E 3QDMB 5DD0L 1P2CB 3QDJB 5B38B 5CIPA 1KTLA 3OAYK 1A7RH 2R0LH 3ARGA 5BV7C 2HAZA 1JF1A 5DK0A 1EAPB 1JBJA 5JZ7D 5SWZB 4GW5A 3CFEA 3N1FC 1MRFH 1A47A 3C6SA 4LKXA 5EA0L 4WU5B 2CMRL 3GK8L 4YE4H 1Q38A 1AXTH 1TETH 4GQ9H 3OGOE 1BFSA 4QWWC 3BUTA 4NRYB 4PJ5A 3O3DA 2E3VA 2ZZUT 3BGFB 4M4RA 1IEAB 4I3RH 1S7XA 1GAFL 1FN4A 1I8LC 1D9KD 3UZVB 1Q9KB 4PRIA 5FUCE 3VG9C 1UZ8A 4P2QA 1V05A 1JN6A 1HN1A 3SO3C 4Y2DC 4ZUWA 2IAMB 1S78D 4PTUA 2WIIA 2Z93A 5I0ZA 3GK8H 4DJMA 4OZIB 2FEEL 4AQ1B 1PVHA 1FH5H 3IDMA 2OM5A 4PRAB 3PHOB 1F4YL 5E8DH 1ZLUH 1PJ9A 1S7SB 5GRUH 5E7FA 3ZKXC 4KV5F 5ITFA 4HAFA 1ZHLA 4IBLT 5C0ND 4PJ8D 5J6HB 5D70L 1CDBA 1B0RB 4WFED 3T77B 4YFLI 3SY0B 3QCVH 4CU8A 4U1SA 1AIFB 1RUMH 1XGUB 4XP1L 5C0CB 4OSUL 5IVXA 4L8BA 4LSUL 4DOHB 5FYLH 4GMSL 4K3GA 1NL0L 3ZZ1A 1J86A 2I07A 3AAZB 2UYLB 5DDHA 4JHWH 9CGTA 2X4UB 1A1MB 1CF8L 1FNSH 4M48H 3D85D 5ENWB 4GXUN 5DUPH 3IJYA 1KTLB 5T1MB 5E2WH 1A1NA 2YD2A 4ZUTB 1X5AA 3RAJH 5C0BE 3TT1H 3SO3B 4Z77A 1IGFL 1HH6A 1QPPA 4YR6B 3RX7A 4XCYB 1MJ8L 5ID0A 4Z5RA 4HKBA 4WFGD 5HGBB 2NY0C 1LK2A 4KPHL 5IBTL 4ELKA 1M6OA 3UPCA 4M93C 1FFPB 2JCCA 1J8HB 3MRDB 1PG7L 5IMLA 2FH6A 2EDWA 1HYRC 2D7QA 4E5XA 5D5MB 3CXDL 4I3RL 4ZNEA 4IIQA 5CGYD 4CADA 5EZOH 3C87A 2YA1A 2QR0B 1Q0XL 5T3ZD 1U8QA 4D8PB 3HLAA 2ICWJ 4KKBC 4X7FC 3U6RB 4P4KC 2JK5A 8FABA 1IT9H 1H9VA 1NFIA 4MJ5A 4LASH 1NKOA 3ARUA 5D6CA 3W5NA 4NHCH 3T65A 4PRPB 1FFOB 1QEWB 3BX7C 3DMMA 4C83A 3UZEA 1JIBA 4LNVA 5FHBH 4ZXBD 2B39A 1AD0A 5AAMA 5C0JA 4ELMA 1KT2A 1N59A 2D4FA 3E3QC 4JPIA 1W0YT 1MI5D 1EH9A 4J6RH 4OZ4B 1NCDH 4QKXB 2J4WH 5HGAA 5KVFL 4LLUA 2WQRA 4G6KH 4X7CC 3VFWA 4OSUH 1OTUD 4CGTA 5TPWL 5I74B 2R2EB 5C7XL 1PKQB 3BVNA 4BQ8A 3PHQA 4JO2L 4NOBA 2E6JA 4FXKB 1JGLL 4PJCA 1HHIB 1HQ4B 3GNMH 1DQLH 1U8JB 4S2SA 1Q9KA 5J89A 3L5JA 5DUPL 1A3QA 4KKCC 1JPSH 5HHNA 1HILB 3VMOA 3WUWB 1TTFA 3X11A 1BEYL 4L3EA 1Q9LB 1UJ3A 2MPAH 5FK9B 3DGGA 3UP1A 1QLRA 4AENB 4UZGA 3PXJA 1KULA 3GSNH 4JDVB 1LP9B 2VISB 2V2XA 1KLUB 3F7VB 3VD5A 5FA4B 5JA8B 4I9WD 3HPLB 2P5WD 2JELH 4APQA 4R3SB 1K6QL 2BNUB 3G5YA 4LPVA 1CT8A 3VFSB 4MAUL 4I48B 3L7EA 5FIEA 2IANA 1MCWM 2GQHA 3SDCB 1L0QA 5BS0D 5HTSA 1LO5B 2X4UA 4PJEA 4S1QH 3ZSTA 4XP9L 5ITBL 2LU4A 4ZODA 3D2UB 2ITCA 4HIXH 1UWXK 3AMLA 3N1PC 5EU7E 1P5VA 5EOQL 5EU6E 2G9HA 1OB1A 2BY0A 1OGAE 3H7BB 4X4XB 5CHNB 4P23A 4JPVL 3T2PA 3ARYA 3CSYA 3RTQB 1PBYA 5E2JA 4MS8C 4YNYB 3U2SB 3HS0A 3K8LA 1DVFA 3OKOA 5I17B 1QSFE 2FHCA 1WGOA 2ENYA 1Z3GL 3LN4B 2R8SL 4DZBA 4YGVB 2C3VB 3PDDA 3L7FA 4YHKH 3MRQB 1MFAL 2R1YB 1R5IA 3I75A 1RUKH 2VXUL 3QNYA 1VA9A 4G9FE 3JVGC 1UZ6F 1YY9D 4RRPA 2VLRB 1RZ8A 3J7HA 3MLXH 4FXGB 4JQVA 4MWFB 5EOQH 1MI5A 4I5BA 1KJVB 3MRFB 3U30B 5KJRH 1F3JA 2LFGA 4G6ML 1T5WB 1G9NH 3A6BH 4JREC 3QDJD 3DTXB 4NM4L 4OLZL 4YDIL 1WZMA 5CD5D 3CLFL 2NY4C 1Z3GH 3KXFD 4MX7A 1YMMA 2EKSA 4G9FB 1IC7L 3PJSB 4ZD3H 4EN3C 1G9NC 1B0RA 4X7DC 2AEWA 3QUMA 4JFYB 3NAAH 1Y18B 3BIKB 3SDXA 4DGYH 4P2RB 4DUWA 2BY1A 3Q6FB 1G6RL 4MJIA 2P5WA 1ZT1B 3HE7B 1OP3K 1JRHL 3O6KL 4WEBH 1KB9J 4XI5D 7CGTA 3X13A 3ZE2F 3QCUL 1WK0A 5E94B 1NDMA 1DBAH 2R56L 1X7QA 4IRSD 3KLHD 1LO3H 1CLYH 4BKLA 4R4ND 1EMTH 4PRIB 4PGBB 2VITB 3K7UA 3CVIL 5ID1B 1EX0A 3S5LA 5DD1H 1P4BL 3S5LB 4RNRB 3BXNB 4O2EB 2ZUXA 4OF7A 2B1AH 2EDBA 5JA9A 4DKFH 4Q97A 2I9TA 3LMJH 1CGVA 4JFDD 2MJWA 1IAIL 4UOW0 3GZKA 4WI8A 3T0EE 4IHOA 4LFHG 4YH6A 1SJEA 4IOFC 5D7IA 4P99A 2FEDD 4RX4A 4RFEA 4QTIH 1KN4H 3LPGA 5C86A 3FQWA 2VXTL 5JW4M 2GJ6D 1G7JA 4CDGC 5AG9A 1EEQA 1RJLB 2HRLA 3P9LB 2BVPA 1QSFD 1N5YL 1GGYA 3CDGB 5C1MB 2YD7A 1N0XL 3LHPH 2R1WB 3AREC 4PGEB 4ZSOE 4U1KA 2ITCB 1D5MB 5T3ZE 5KJRL 3MLUL 3GIZL 2D03H 5FM5O 5I18H 4LLDA 1P7QB 1QVOA 2BSRA 2W9EL 1JF1B 4FABH 1AC6A 4MGXA 1HHJA 2EO9A 1UH2A 4HWUA 3LKPB 5DQ9B 3SKMA 1MCBA 4YNYA 3U2SA 2DAVA 3VGHA 4OZFH 4NQTA 1ZK9A 1KPRA 4LIQH 2DQFA 3QUYB 2HA1A 3FL7A 1VGKA 4N8CL 3LN5B 5J3HD 1FVCA 4LRNH 4PIRF 1T83A 2BSED 4I3GA 3I6GA 1KN2L 3AS1A 5F7FA 3VWKB 2MCPH 2VLLA 3MOQA 5ISZA 5E2UL 1GPOH 2LAAA 1V8HA 1DQQA 2MQCA 2E6PA 3AMKA 2VKXA 5HVWA 1T4KA 2X1PA 3TVMB 2ADIB 5I8CA 1DBKH 4G80B 1E4JA 5H37H 3V6BR 2BNQD 2X9YA 4F7TA 1WEJL 4XP6L 4ISVB 1NGXA 2XXMB 4JRXB 3HE6C 4JQVC 1QVOB 1PG7W 3D85A 5HHQB 5DJXA 3QWOA 4GW5B 3LMJL 3JBG7 5TFSH 4OLXH 2V2XB 1U36A 4NRZA 1NGPL 3GJEB 5F7DA 4KRPB 1JUFB 1QFWI 1MH5B 3MRRA 4ZXBB 2BNRD 1MWAA 4UIMB 3BN3B 5C09D 3TJEL 1GPOL 4E0RB 1UENA 5DHVB 5SV4A 4X5WA 3SGKC 1CXHA 3ZTJH 4DGVH 1T66D 2LV4A 4LCWA 1SJVA 4TRPH 2YSSA 1P4IL 4PRDB 1SM3H 1FZOB 1PZ5B 5EORL 4U1IB 4LKCB 4JREB 2YMXL 1M71B 1T4KB 3LHPL 4ODHH 2R4SL 5DHYA 5D2LA 3T4AA 1I1AC 1I85C 1RURH 2EDEA 4FRWA 4QWWD 1GC1L 3BESR 1RUQH 4PJHA 2AJUH 4KVNL 3V6FB 2W9EH 4CU7A 4LSUH 4AT6B 3OXSA 4YDLC 1OW0A 4UOJA 1IC4H 2NW2A 3LS5L 5JZ7C 3F5WA 4CUCA 4K2UH 4X4YA 2Z8SA 5EU6A 2COQA 3OKLB 5JW4R 1UFUA 5DC0A 1BVLB 2BVUA 3WO3B 2DBJA 1ZAGA 2QKIB 1YC8A 1F4WH 1XCTB 4X6DA 3QIWC 5AAWA 5C0DB 1ORSB 1JI1A 3E2HC 5JXED 3WHE1 2F15A 3QZWA 4NSKB 3HZMB 4HUMB 2IANE 3NH7H 4YPGA 3LQMA 4TSCL 4M9OA 5T1KD 1BPVA 1AGBA 4UDUB 1DBKL 3CDGA 2AQ1A 1AGBB 5JW4Q 1NC2D 4KROC 1OM3L 4YIQA 1ZGLP 1RPQA 3F6LA 5ESAA 1B3JA 1AP2B 2IWGA 4MJ5B 2MMXA 4DKEH 1SEBA 2CGRH 4AH2B 2FLBT 1KCRH 3SDDB 4JN1L 5LBSL 4O2EA 4Z7UA 1DZBA 5DD0H 2G5RA 4WI5A 4NCC1 2OR9L 3ZKND 4JPWL 2VZSA 1S5IL 3J8F7 5DXWA 2P5WE 3PWPE 2W59A 5J0BA 2Y36L 3WFZA 1PKOA 3AS2A 5IESL 1D5ZA 4ZSOA 1G84A 4RMSA 2QADC 3ILQC 1JWSB 2DWDA 1LE9A 3U9PL 2Y6SD 5IVZB 1YEKL 1NCCH 4APQD 3OB8A 3VFVA 5LVEA 4DVRH 3QJFA 5B8CB 3C2AH 1N4XL 1EIBA 1X7QB 1T03H 4RQQA 1T3FB 4MAUH 1NDGB 3HZYA 1HZHL 2VL5A 2X10A 2B5IB 3VFNB 3QDJE 1KB5L 3O9WB 2GSIB 4JRYB 5KANI 1VERA 4S1DD 1IGYB 2HT4C 1FPTL 4K3EH 4UBDC 5F1KC 1SEQH 5CP7B 2Y36H 2FX7H 1KCUL 2H32H 1MFEH 5JOEA 1S7VB 3PHOA 1I8IB 1KEGL 4IDJH 3GJEA 3FAWA 4UT7L 1SJEB 5GSRB 1HEZA 4I0PB 3L3GA 1I4FB 3O8XD 2XN9D 4L8CA 4WU5A 1UCBL 1C5BL 4A6YB 1QSFA 3RGHA 3L7EB 3OX8A 4QHNB 4JDTH 1H0DB 2Q6WA 4LLMB 4JKWA 4ZNEE 1JPGB 3IF1A 3C9NB 4PJ7A 3RVXC 1F90H 3L95A 4XPAH 3RL2B 1E28B 5EZOL 3IU4L 1RUML 4MXQD 4QY8B 5DJCA 4IRJB 4IRSA 5H37G 2KDGA 1OAYL 5DZOA 5DHYB 1HHHB 2VWEE 3DX6A 4XH2A 3WXVH 1T20B 1CQKA 4JO3L 3ARBB 4JKKA 3WUWA 1KEGH 4L4VE 5FUCC 1IFHL 2ZSVA 4NO5A 4R0LB 2ITDB 1N8ZB 1AE6H 2AJXH 4NO5B 1YEIL 1CXLA 2W9DH 2Z31C 5JLZB 2LVEA 3CUPA 3X3FL 3MRIA 1QLFB 3TYFB 4MXWL 1I9IH 3AXLB 5D71H 1NMAL 4HUWA 4NC0B 3JV4A 2QBWA 4Y1AD 3V4UH 1XF2B 3QO1B 4LMQI 4PJXA 1YQVH 4G6KL 2X1QA 3FRPG 3R06B 3BGFC 4FQJH 4JPVH 2IANB 4DVRL 3C9NA 2K7QA 2XPGA 1E4XL 4PGJA 4PJDA 1UXSA 4ZS6C 3MLWH 4PBVC 4JM2D 4N5ED 1NAKL 3FO9B 3H9HA 3CX5K 3UPRB 1S8DB 5EU7C 1TLKA 5B39A 3KXFA 2A9NL 1BEYH 4IOIA 2OCFD 5BVPL 1BZ7A 4L3CB 4KU1A 2MHAA 2X4SA 5ICZA 1XGRA 4P9HC 1WC7B 3IDIB 5EN2A 5ISZE 1CDCA 4IDJL 4K3JL 4EZMA 1DVFD 1JF6A 1X4ZA 3BKMH 5F6HJ 2WINB 3AXLA 4WTWA 1UCBH 4PJIF 3RUGE 1DP0A 1AO7B 3SBWC 4WI2A 1A3RH 4WHCA 4X9IA 2Z92A 3PGFL 3GKWL 3VFVB 1IC1A 5E8OA 3FFCB 3GMNA 4JEGB 3GMLA 3W0WB 4KQ4L 1TZGH 3DVGB 4LCWE 1B0GA 4TTDD 4S1RH 3WMSA 3SDDD 1EXUB 4K07A 4Z7WF 3SCMD 2XWJA 1CFQB 1QSVA 2ATPA 2NW3A 4UNUA 2XA8L 1RV6X 1TZHA 2HG5A 3U1SH 1KCVH 4I4WB 1QD0A 3JWDL 3QIUD 43C9B 3MA7B 4OQ1A 3QXAA 4DAGH 5BMFL 2B20A 5D1ZC 4MD5A 2UUDH 4HZLB 2JJSA 1XGTA 2KZWA 3MV7A 1T1YB 3BHBB 2HRPH 3BDYL 2DYPD 4CNIA 5IFAH 3TVMC 4POZD 2EKSB 6FABH 4APQB 2A77H 5D7IB 3L3GB 1JP5A 4NUGL 5FB8B 1CDGA 3IRZA 4P48A 2HJFB 3MV9B 3FRPA 4PJXB 3L3KA 3VMPA 5F1SA 3DUHA 4IRJC 4QYOA 1CGYA 5HYQB 3HG1A 4LCWD 4UBDD 5KSVB 4WVRA 1GSMA 1IM3A 1ZWIB 4K55A 4QY8A 2YPVH 4HUKB 4GXVL 3BJ91 5I16A 3RIFF 4NCDA 1IGIH 3S35L 3PNWB 5HHOB 2P42B 2VQUA 5TDOB 4F3FB 5J06A 4Q6YA 5E2UH 1HKLL 4X4ME 5B21A 2AJYL 3P9MA 1RIUH 3S37X 1H3TA 4JFED 3EFFA 1YNTA 4HW6A 1DL7H 1R24A 4YHZL 5JXAH 3GBNL 4PJFF 2ICWA 4F2MB 2NW2B 3D18A 3B9KC 4NUGH 1CDJA 2IBZY 3BRDA 3S34L 2DLGA 2DQJH 3IXAB 1HCFX 3SGEI 2P8PB 4NKDA 3O4LA 3TBSB 5E6IB 5EC1A 5C07A 2ATKB 1P69B 5HY9B 2VQTA 4JFQB 3MLUH 5IEHA 5HYJD 4NKMB 3VGFA 4FABL 2VDMH 1A3RL 2BVOB 3NCFB 2F54D 1C16B 4N8VG 5IVXB 4JVWA 1TZGL 4Y89A 3HNSL 2J1KA 1AD9B 2BVPB 1ONQA 4J3WA 5IIEB 1N6UA 4YEFA 5EO1B 4P2QE 3TJHD 3MGTB 4YE4L 1LWRA 5EORH 3T1WA 4UI2A 1K8DB 4DKDC 2ICES 1J18A 3LIZL 1VHPA 3T0EB 5DHXB 3VRIA 3WE6A 5I6XC 4PJBB 2FBOJ 5T3XE 1K5NB 1A4JA 2AKRA 2GT9A 3BQUB 2CLVA 3UC0H 1MAKA 4KTYA 3QA3A 3FOMB 2X9WA 3OR7B 4NO3A 3BKCL 1ERNA 1CDUA 2YR3A 1OARL 4XC3L 2DLFL 3O9WC 2ZSWA 4ERSH 2VOTA 3I9GL 5D2NE 1OHQA 1EFXA 3MYZA 1PAMA 1LD9A 2VZ3A 3WLBB 1NAML 4TVSa 5H94B 3OAZK 2EIZB 1ZANL 3FONA 3ZKMD 3EOYG 2L4OA 2F19H 1NKRA 5FECB 1DQDL 2QSCL 3T0AA 5KN5A 4YC2C 4JFZH 1CU4H 4QXTB 1Z9MA 2A9MH 3ILPA 1RK1B 3ZE0F 1Y6NR 1OP5H 2CLZB 3ZE1F 1IZJA 4GLRH 4MD5B 4OCSL 3P2TA 3CPLB 3PWUA 5IM7B 1MCWW 1WFUA 3H7LA 1YPZB 3GSRB 3S34H 2R0KL 5GRZA 4YHIB 1NCBL 1P84K 3O6FD 5C0JB 1N6QL 2IPTH 2XICA 3O2DA 4R7DB 1RUQL 1FYTE 1MFDL 1BQHB 1V7NL 2ADGA 4LRNL 3KPNA 4PYHA 3ZHDA 1MIMH 2NY6B 2XN9B 1QHPA 3W39B 4RGOH 1IC4L 2V9QA 5TGBA 3IGAB 1M4KA 3VH8A 5CEZH 4XNQA 5JOFB 1PGRB 3B9DA 2PO6B 2PTUA 3CX5J 4PJDB 2R2CA 2YK1H 2Q7NA 3PWLA 3WJJA 4F7PA 4HKXA 5I75B 3RNKA 1U8JA 1EUUA 1FO0L 3RNKB 3ZE1E 5JXEC 4NJAH 5F7UA 2AXFA 1MCLA 4JO1H 3R8QA 3WFBL 1IGTA 1U8NB 1ZT7A 4N9GB 1FFQA 4HJGA 3AROA 5GJTH 1U8NA 4U7KA 3DGGB 3KPTA 2YUZA 4H1LA 4ORGB 4LHJB 1RZKL 1QACA 1MEXH 4HCRL 1JZ2A 3G5ZA 1CGSL 1XF4A 1TJGH 5DJ6A 5I8EA 4JHZA 3C60C 3F62A 3TBVA 1SEQL 1PW3A 5F93C 3SE4A 5C08E 1KGCD 1JHKH 2HFEB 4NCC2 1EDQA 5TGBB 4PP2A 4FQXB 4LEXL 1G7MB 5TDNB 2F58H 1A21A 4MNGA 4HIEB 5HDQH 3QIWB 5FF6B 1MRDH 3QQ4A 2OTUA 1BQUA 3CFDB 4J6RL 1ZLVK 1NGXB 4JRXA 1ZEAL 3FTGA 3MBEC 3H42L 3DSFH 3DX8A 1ZTXL 3ARDD 3KPRB 1IAMA 1K3ZA 1MCCA 4N90D 1UM6H 4OBSA 2L7UA 1A14L 5HYJB 4XPTL 1I8IA 2J8HA 1FJ1A 2XWBB 1QQDB 1HZHH 2EE9A 1W72H 3TBSA 4JRYD 3BUYA 3QRGL 3BT2H 4PRBA 4ZDHB 1BGXH 2IALB 2W9DL 2OYPA 5LXGL 4JFDA 1LE9B 1SMAA 4JRWA 3C5JA 1JPGA 3IF1B 1JGVH 3ME0A 1YEJH 2YD6A 1G7PB 2PXYB 4YBQD 4PJGE 2BOBB 5E94A 5F6IC 1CD1A 5DYOB 5GHWH 1R0AH 4F3FA 3ARQA 5FKPB 3DX9A 5LCVH 2M26A 5D8JH 5DO2C 1FCGA 4YXHH 3MR9B 5IB3B 1H3XA 1CFNA 3NGBB 2YA0A 3MLWL 1T0PB 3L5WB 1BFOA 1RURL 4NQEE 4JANA 1KPVA 5DVMA 1ZS8A 2AJSH 2IGFL 3B9KA 1YPZA 2O26U 3TZVA 5L2KB 2W0FA 2YD4A 3RRQA 5I1IH 1HKFA 3I3EA 4QT5A 5J6HA 3UTTB 3U4EA 2VZOA 4KTDL 3MACL 1WF5A 1NH6A 3P0YH 4O58L 1X5ZA 4J4PA 4DW2L 5GGTA 4JAMB 3IFOB 1MHCB 5L2JA 2IG2H 1JPSL 2X70A 1R3KA 3G6AB 3U83A 3FB8A 2EIZA 2E8YA 2PXYA 1G7LB 2XG4A 2MPAL 3HE6D 1TENA 5IJVA 3LAFA 4W68A 4FQLL 3V5DA 1J8HE 4IRJA 1AR1D 5TDOA 3UJIL 2R8SH 1N2RB 4FG6C 5EUOA 4XP1H 5BW7A 2VXVL 3SDDA 2E9JA 3MODL 3DRTA 2VUOA 3UJTH 4HJGB 4M7ZC 2ICWI 3IJSB 1QLRB 4AENA 3A0OA 4YFDB 4KTDH 4RA0C 4EI5D 1OAKL 3DURB 4BSVA 1ROWA 3BT2L 4OCLC 1OTTD 1NBZB 4JPWH 4KJQD 3GI8L 5EBMA 3B9KD 5HJ3B 1IGFH 4U6XB 5A40E 3MRPB 3QHFL 4CU6A 3CK0L 4XMLL 3EYSH 3HTLX 4LAJH 4LHUA 3WS3A 4NC1C 2PYEE 1JHLH 4P5KB 3CLFH 3MROB 1F90L 3BQUC 4MNGB 1EVUA 1MLCA 5C0CE 1B88A 1D5BB 4WO4B 2DLTA 3JSSA 1A9BB 2EDNA 4P5MB 3MV7D 5CJQL 3QXUA 2I9LB 2OTUB 5AYUL 2AV1B 4LQFL 5CCKL 1G0YR 3GMPB 4NQUA 3W0WD 4LGPB 2HFGH 4HLJA 4MVBC 1NUNB 5BCAA 4U1NB 4M6NH 3WXWH 1MFAH 2CKBB 3NN8A 4QRPA 4UINL 1UQSA 1DL7L 1T22B 4YHZH 1MFNA 3QHFH 2PCPA 3OJDA 2P4AB 2XA8H 2GK2A 4KH2A 4W6YB 3MRNA 3MACH 3ULSA 5DJ2A 1K2DB 3HC3L 4BK5A 1T1XB 4NNPH 4PRBB 4ZDHA 1GJIA 3QDAA 1K2DA 4YGVA 4QRTB 4TSBH 1A6AB 4TUOB 4RMUA 3FB6B 4L3ED 4A6YH 1NUFA 4JCLA 4NQDE 1WAAE 1KJ2L 3DXAA 4NM4H 4OLZH 4W6WB 4YDVB 1U8IB 4X0KB 1IBGH 5EO0B 2XZAL 5GS1A 2HLFD 4FFWD 1J5OH 1FFRA 4OGAC 4JDZB 2VLMD 3WO4B 3CFDA 3U0TA 5AG8A 1G6VK 4QRPD 3V0WH 1WBXA 1H3GA 4UINH 5SWZE 4MJ4A 3H0TA 4ZYKA 1OQOA 3N85H 3BPLB 5SWZA 5T3XL 3MRJB 4HC1H 5JHDD 5DEFA 4X83A 4WWID 1GOFA 3P4OB 1KEML 1JTOA 4TVPD 5DD6B 1CT8B 4UIKL 3FN0H 1EHAA 1QRNB 1GC1C 2Q3AA 2W0KA 1T0MB 1AY1L 2RQ8A 4Z78B 3MRCA 3MUZ1 4HAGA 2VDQH 4PJIE 1J10A 4OUUA 4R4FL 1TPXC 2ADJA 2DWEB 3RGVC 1MOEA 3RI5F 4ZUSB 5JMOC 1M7XA 2BVEA 3DXAB 4G43A 3V0WL 5AZEL 5FDWB 2NXZD 4U0QB 5CJQH 1P4LA 1ZANH 4P5TD 1NGQH 5I1JL 3MR9A 4XI5C 3T0BA 4X6CA 2CK2A 5ID1A 4KRPC 4HC1L 5D1ZD 2BNRA 4F9PC 1U2CA 5IMMB 2B4CL 4EI5C 4ZMAT 3SDAC 4PJDE 1LK2B 5I1EL 1MF2H 1I1FB 4AIZB 5IQ7H 2QQNH 1KXTB 1UQSB 2IJ0C 2OL3B 1KPRB 5IFAL 1LEKB 3B6SA 4HIXL 5KZCD 3GSOB 5KBNC 2GSGB 4JFDB 4JO4L 2R0KH 3BDXA 5J1SC 4FG6D 3QFJB 4Q6IC 4R4FH 5DRWA 4KWUA 3BQUD 2D7TL 4LCYB 3T2NH 2DQDH 1TPXB 1J0JA 1AD9A 5TFSL 5AZEH 4QRSB 2P1YA 7FABH 2QR0A 3BKJL 1T7XA 3K2MC 2VTFA 3BP7A 3G6DH 1FE8H 4M4PA 1BAFL 4J8RA 1J5OL 1K8DA 4U7MA 3RWGB 4K7FB 1CFNB 3B8SA 1RUPL 2EICA 2IFFH 3C08H 1CCZA 5D7LD 5EPMA 2FO4B 5L0QC 3FQRA 1UVQB 3DBXB 5EPMB 5JOPE 1JZ5A 2ESVA 4NFBA 1PFCA 4NRXB 3VXNB 4U7SA 5DI8B 1EAPA 2CDFB 4BH7B 1YMMB 3D25A 1E4KA 2HT3C 4DAGL 2MCPL 1J12A 1E4XI 3PV6A 5BMFH 4TNWF 3HAEA 5J1TC 1U91A 4WJ5A 4UIKH 2DQDL 4H8WC 1K4CA 5GRXG 5HHVL 1H3VA 2EDQA 5CP3A 2V2WB 1DANU 3U36B 2APXA 1Z9LA 4G8EB 5IVZA 1WBYB 4K2UL 4G8EA 4OI9A 4K9EC 2C9AA 4OIIH 1DLHB 5IJVB 2BXZA 4G43B 3ECBB 3HFML 3E6FB 3RPKA 2DM2A 2UVFA 5HPMA 3WEXB 2VC2H 3UJJL 5HYSB 4HMEA 4I0PC 1MRFL 3DTXA 4AYFA 3GBML 2PYFA 4G8GB 1RIUL 4O9HL 2NY0B 5EULV 1KJ2B 4RISH 3G08A 3SJVE 2ILLA 5CKGA 5JXAL 3HC4H 4G9FD 1DFBL 3WHXA 4WGWB 2YD9A 3VFUA 1FO0H 4OFYA 3HPJA 5F3BA 2HLFC 1OARH 3D87B 4LSQL 5C6TL 2FJFB 2BNUA 1JVKA 5GJTL 1KCRL 3HZMA 1QRNA 1FC1A 2R0ZH 1VADB 2KKQA 4FQIH 5C3LD 2Q76A 5DJ8B 4U1HA 5IW6B 5TH2B 4XNYL 4IMLA 4QLRA 1CFVL 4XBGB 4HJJH 3WFDL 1ADQL 3AGVA 2ZUQC 3RU8H 1QO3B 2X4PA 3CVHB 1C08A 4V1DE 4EDWH 3H9SE 4D0BA 1U8MB 3RKDC 1MNUH 2DIJA 1JGEA 4IS6B 1IGTB 4N9GA 3U9PH 2BNRB 3SE3C 1JE6A 1QSEB 4Z7WB 5DUBB 4FNLH 2CDFA 2FRGP 4PG2C 5C08D 3L5XL 5D8JL 4KGJA 3IDIA 3QIWD 3OZ9L 5E08H 4KXZI 4ORZC 3WL9A 3MUGB 3PP4H 2BNRE 3BWAB 1LP9A 5ETUA 3LEVH 3U7YH 3LPFA 5KSAA 2HJKA 3LSOA 3UBXG 3I02B 3QQNA 1FV1A 4L5FL 3KLDA 4BH8A 1NLDL 1UWEL 5JIKA 1F6AA 3RVTC 3O81A 3NPSB 1R3HA 2BVQA 3OG6B 5FYLD 2GCYB 1MCRA 1S9WB 2WUCH 4LCYA 1OT1A 2CDGA 1NFDE 4QRRA 3HZKA 4HUXB 4M48L 3K8MA 4Y4FD 4JQIL 1MCSA 1ZT4A 2ZUWA 1FDLL 4HD9A 4MWFA 3OKDA 4GRMB 1L9MA 5LQBH 5KSBF 3OKNB 5CIPB 3H9HB 3SE3A 4LVHB 1A0QL 5TJWK 4WFFD 1AQDA 1WBXB 3KVQA 3U7YL 4QXUH 4JO1L 3WFBH 4R2GD 1MVUA 4XVUC 2DOCA 4O9HH 3WHE0 5IKCB 1YDPA 3CZFA 1ZVSB 2PTVA 3GSXB 1NLDH 3A67L 2BJML 2J6EH 2VXVH 5FFLA 2X89D 3IDXH 5F3HB 2F74A 3HS0B 4FQ1H 3O41A 1VEMA 5T1KB 1MCNA 3QG6A 4QHKJ 2IC2A 3GJFA 1UADC 5F7LB 4PB9H 1SY6L 4O5LL 3LV3B 3VWKD 4MJID 4OUUB 5TH2A 1NANI 1YEIH 1WBYA 5D1QA 4OD2A 4Y16D 4PLOB 2HLAA 1WWWX 3KWWB 1CVSC 3MBXL 5C2UB 4HJ0D 4U6VH 5INCB 5B4MC 1MFEL 4X80L 2NZIA 4Z7OE 1VACA 2FB4H 3DX6B 3NCJH 2C1OB 4ZUTA 4C4KT 1J1XH 2BC4B 1RJCA 1Y0LB 4EIZC 3IETB 3OB0H 1WZLA 1TETL 4GT7A 2PYFB 1L6XA 3H3KA 3QI9C 4EUPG 2V7NB 1U3ZA 4KDVA 4W81A 2PW2B 5FYJU 4NQCD 1JGDB 3FCTB 5C71A 5EIQA 1N5AA 1GAFH 3V8OA 2FL5A 4P5TA 1MEXL 3GMRB 5TPWH 3MJGX 1EFQA 5HSFA 5C7XH 1F11B 3E1F1 4J3XA 2JF1A 2VDOL 4HWNA 3IFOA 1GCFA 4I0PD 1JZ6A 1JYWA 4HK0A 2X05A 5IFJA 3SDAB 3BZDA 1ULVA 1Z5LB 1SBBA 2AI0H 3PL6D 1QBBA 4OKDA 4D8PA 1FDLH 3LKQA 3QFJE 1ZLWH 1R0AL 1ED3B 1RJZB 1UM4H 3DVIA 4L4VB 5BRZB 4PJCB 1AJ7L 1F4WL 4PREB 4ZFOL 4PJAA 3DUUB 4OUOA 3MRGB 4GRWF 4LLQA 4IS6A 1KLGA 4WUKH 3KPLB 5GRUL 3QRFM 2UWEA 4MAYA 4U2YA 1I9IL 3ULVD 3EFFB 5HVFB 3CFBB 4YHML 3IJSA 1F2XK 4LCUB 5DQ9A 1HQRB 1J0IA 4LCUA 4DVBA 5JR1H 4XPGH 5I1LB 2WBKA 5E5MA 5I17A 4PJ7E 3DMMD 4D9RD 1E4XH 5I75C 2FX7L 2A6DB 3FRUB 2V7HA 1CF8H 1TVBB 2DJUA 3TFKC 2BVOA 1UWGL 1RZIA 4NHUB 1AIFA 2EH7L 4JM2F 1BGXL 3ES6B 4RAVA 4KROD 4WV1A 3VXPB 4Q74A 1JHTA 4C4KO 3DV6A 4QCIA 4NGHH 5FM8A 5J1AB 1KJVA 5FF6A 5HDOA 3QQ3A 2BRQA 2A6JA 4U0RC 5H8DA 1FLTX 3O9WA 1Q72L 4AIOA 3VXQA 3L9RA 3UPRA 3M07A 3LY6A 4KHTH 3QXAB 1P2CA 3QDJA 1NCCL 3K80A 1CXIA 3DX8B 1MJJA 2VAJA 4QRUA 1KPVB 2IAMC 5C8JA 1KUMA 2OR8A 1IGCL 1I7RB 3CXDH 2ZUYA 2XZAH 5IF0B 3JXAA 1LDPH 1WISA 2IAND 1FRGL 2FNBA 1IQDB 4C57C 5FYJD 4ODXB 2AJXL 4GUPA 1TDQA 1EO5A 4RBPK 3MLPA 5FUZL 1YY8A 4RDQF 4K71B 1CGWA 1UXWB 2VE6B 5CD3A 5E70A 1RIVH 2DWEA 3GSNL 2APFA 1U3HD 1FZMA 1OP5K 4JO4H 2OBGA 5HHOA 2EXWC 4IMKA 5I6XB 4S2SB 1HXYA 5T3XD 2XZZA 1A5FL 4DCQB 1P7HL 3JTSB 1HHIA 4MQSB 2EECA 3FN0L 1PEZA 4G8IA 2FATL 3RNQB 4POZC 1ZT7B 4XWOC 3AUVA 3L5HA 2J4WL 3H2WA 5BW7C 4YHPB 3H0TB 2Y5EA 1JGDA 3VJ6A 2YD5A 3SDCD 3MODH 3FFCD 3EYUL 4JZJC 4EXPX 4LCCB 5KG9B 2ZCLL 2XV6B 4KK6C 5F3BB 3UZQA 3LCYA 4YXKL 1FG9C 1T2QH 1RIHH 1UEYA 2EZ0D 2KH2B 3C8HA 4MNGE 2F54E 5JTWA 4WGVB 1YN6A 3VDBA 3IU3B 4QCIB 1D5XB 2APBA 3VXSA 3RGVD 1JNHA 1O0VA 3BD3A 4WFEE 4WU7B 3WN5B 3AB0C 1A1OA 1HQ4A 2DLFH 4KJYA 3MJ7A 2IADA 3JWDC 2C3WA 4GW1A 3RFZC 3UAJC 2AV7B 4KI5F 1R6VA 4RWHA 4U1GB 1ACZA 4P2YA 1MCKA 3LKPA 1LNUB 5E5MB 1CG9A 1LDPL 1DQJB 1DQDH 1EEYB 2QSCH 3JWDH 4WENB 5I1LA 2DKSA 4MA1C 1KCSH 4FQXC 1RIHL 5DK3A 1KEMH 2A9ML 3V5KA 3FQUA 4JY4B 4AM0A 4ZOCA 3IKCA 5KSAC 4K7PL 5EBLA 3LKOA 5DVOA 1AY1H 2CIKA 2HJLA 5E9DB 2BOCB 2HTLC 1AXSA 4NNPL 4FQXA 5ADPH 4LPTA 4P5KA 3VXRA 3S37L 5MERA 2J5LC 4OFKA 2BRRH 5HBBA 4WTZA 1OWWA 3HLAB 5IIEA 3EJYD 3ARRA 5F71A 1I1AB 4AEHH 4C56D 1DDHB 2Q86A 4JRYA 1D5MA 4N9OB 4RMRA 2MKWA 2JCCF 2OJZL 3S98A 4MB5A 4UAOB 1IGIL 1TCMA 1MREL 1Q9OA 3CPLA 4Q7DA 1FFOA 1QEWA 3DMMB 2QSTA 4PTTB 2BFVH 1ZS8B 3I9GH 1EZVY 5A3IC 5EU4A 4CMMB 1RUKL 3VCLA 1DBAL 2R56H 5E99L 5FO9B 3TWCH 3GDBA 1CLYL 5D2LF 5A2FA 4Z76A 2P8MB 2XYCA 3MLVL 5C0GA 3L5XH 4HLZG 3UTSD 5BZDA 3IJHB 1FVCB 2EC8A 1MVFA 2Z4QA 1DE4B 1JWSA 2DWDB 5F21B 4XB7A 1LD9B 4PJ5D 1L4IA 1JPTL 1T1WB 1A8JH 2EXWD 4JY5L 5DEGA 2YRLA 4TN9A 4MA8L 4E41B 1WEJH 3C60A 4XP6H 4MNQD 5F9WB 5J6GB 4OFIA 3HNSH 2CIIB 1JTPA 3TT3L 4ETYA 4RGMB 5MEPA 2CRMA 4XCYA 3U0PA 1MQKH 3LKNA 1MJJB 2QQLH 4NN5C 4XNYH 4Y7MA 2F58L 5AYQA 1GYAA 1H3UA 3MLVH 3MRBA 3C6LC 4LF3B 2OI9B 2ZUSA 1RZJL 2HTKC 3KPOB 3Q2CA 4HV8A 3KPOA 1HSBB 3TGXA 2XIDA 2OL3H 5C0DA 1BIHA 2Q7YA 1JPTH 4U6XA 2BMKA 2CRIA 3FQWB 3EYOA 1MFBH 3SGDH 3QZWB 3V2AR 4YAQA 5F9AC 2MNUA 1AXSB 3OL2A 2E7HA 4QRSA 3QEUA 4XHQA 5HHME 1U6AH 3C2SA 4M61A 2IPKA 1CFTB 3CFJB 4HT1H 5DJDB 1A2YA 1SYVB 3DUSA 2PUQT 5DMIL 3QRGH 5IB2A 3U30C 4J12A 4IRZH 3QXDA 4UV4L 5C07E 3I3BA 1JGVL 4U6VL 1X5IA 2ZUUA 3CFBA 5FK9A 2YPKB 3VGGA 3CSYB 4JFOB 1I1FA 3TWCL 3MUGA 4OGXH 1L0XA 1MFBL 4OCSH 3MV8A 3RWJB 1JTTA 3ARGC 3ULUF 2ZCHH 2RAMA 2C3VA 4X5XA 4R6UA 3E3QE 4QXUL 2BSTA 1A6UL 1U8HA 5HYIA 4ONFH 4F58H 1I7UA 2A73B 4TSCH 5DHVH 2D03L 1UT9A 4ZUUA 5F9OH 4NPYA 2WQ8A 5FA3B 3OXRB 3VXRB 2D31B 1BJ8A 3PDOB 4LLWA 1ZT4B 5JDSB 2XN9E 4Q9CA 2VDOH 3UTQA 4E9LA 4JN2B 4XPTH 1FYTB 1RZ7H 3CFKA 1U9KA 1ZHNB 4HXAH 1K9TA 4F7TB 4Y19A 1NSNH 5DK0B 3KG5A 1GZQB 3EO0A 4OKVB 5SV3A 1S5IH 4W4OC 4ZYKB 4GG8A 4MXVF 1JNLL 5AD0B 5DEFB 3WJJC 2O61A 3GM0A 5DJ0A 3KDMB 4ONFL 5TDPA 4EQ2A 3RZCA 5DWUH 2BNQA 2QSQA 3EKCA 4OCNC 2WINA 1FSKC 5IB5B 1NLBH 1UWEH 3FO2A 1YEKH 5BZDB 1VPOL 4JY6B 3NIFE 3I6GB 5DTFB 1A7OL 3DLQR 2YPLB 1U3HA 4JVUA 1RZ7L 4WNQA 1MLBA 5F7EL 1U3HB 1LP9F 5HDBE 1DLHA 1I3GH 3GRWH 1KB5H 5FUOL 5IB2B 3LRGA 1DUZB 3SPVA 1T21B 5JQ6L 4LLDB 5FXCH 3C8KA 5L9DL 1VDGA 3MCKA 2M1KA 1ZHNA 3T0VA 1VFAB 5CEZL 5F6HI 3EO1B 3UTSE 2DD8L 1LMKA 4PRHE 4HS8L 1AKJB 3SKMB 2YZ1A 4C55A 2JJUA 4YHPA 2ARWA 5FV2A 3VE0A 4CAGA 1ZTXH 1FNGA 4L8SC 3AB0B 1JWMB 1FV1B 4BH8B 1SBSH 1LEIB 4F57L 3G5YB 2BSTB 2HFEA 4R3SA 1URLA 3MRPA 4I48A 4JFFE 4R97B 4F8QA 5C9KA 4MD0A 1W72L 4YHOL 1BJ1J 2AJUL 5DD3L 1I1YA 3EGSA 3PWVB 1LP9E 2NPLX 2ZG2A 2IH3A 3ZDZF 3S3PA 1S7RB 1II4E 2GEEA 5GRJH 4ZFFB 5DMJB 4KK9D 5HVHC 4LCCC 4HS8H 3QXDB 4I13B 3MV8E 3V95A 5EUOB 2OI9C 1NQBA 5HHNB 4HEME 1A6ZA 1YNTB 1P53A 1QSEA 2MHAB 4Z7WA 3BQUA 2ZSVB 4U0RB 2E27H 2ICWB 5A2KH 1HHKA 4HKBB 4WW1A 1PSKL 2ZNWA 5CGMA 2X5PA 5IFHH 3RIAF 4GBXB 1Q72H 4GRWE 4LFHD 3QFDB 3L7FB 1EHNA 1OAUH 3D2UD 5MI0C 4BSWB 2V2WA 3U36A 4U1JA 4LSTH 4LVOB 3WIIH 4ZFGH 2MTPA 4FZ8H 3FJTA 3I84A 3KPMB 1OVZA 4TVPH 4HZAA 5AYUH 4S1SL 4CDHA 2WBJD 3DV6B 1IMHC 4LLVA 3VFTB 1FNSL 4XXCC 4EXKA 2IH3B 1ZXQA 4KZEH 5C0RH 3RY6A 3VGAB 1JMZA 5J7CC 1YEEH 4HWEL 3QQ3B 2O93L 3B4NA 1I1AA 2LTQB 3TZVD 4A2LA 5K9JL 1RK1A 1AR2A 4JPKH 2R0WH 3MRMB 1TTUA 5T5FL 2GYSA 1PSKH 3VWJC 3MA7A 5DVLA 5CP7A 3MV7B 3B9KB 4HZLA 5JOPD 1DUYB 3PWPD 1KIPB 4S10A 2D2OA 3EO9H 4ZAKC 5EU5A 4LSTL 4ZFGL 1LQSR 5TQ0H 5DVNA 4ZO7A 5DRZB 3REWA 3HAEB 3DV4B 3M45A 1NGQL 3MXVL 5H35B 2D0FA 5I1JH 1RZFL 3MJ9L 1IBGL 4YBQC 4Y4HC 4XX1G 1JPFA 3FN9A 1LDSA 4P2RA 4Z95L 5E0QA 5C70A 2B4CH 5E8NA 5I1EH 1YEEL 4JGUA 4HWEH 1G7PA 3PQYA 2BVTA 3W2DL 3X3FH 1BP3B 4NKIL 4B5EA 3H8NA 4RRPG 4OV5B 3STLB 1M71A 2R0WL 2PR4H 3N9GH 3MJ8A 2ZCLH 5T3XH 3R0MA 2VR5A 2H2SC 3NCYP 3U4AA 1OB1B 1NJ9B 1W8OA 4P2RD 5HI5C 1RVFL 5T1DL 3BDYH 3L6FA 4UUJB 3A6BL 3MRLA 1I7ZB 3GM8A 1G7HA 4DK3A 3RTQA 5HI3C 3RGVB 2R29L 4U31A 3F65A 3OAZH 1DSFH 4ZPVB 5IBUG 2J3SA 4NO0D 4L9DA 4LPXA 3BE1L 3VGBA 1AGFA 1RHFA 2QKIA 3RI5K 1OAUL 2V7HB 3WFHB 2NY1D 3GUTB 3QUZD 3LS4H 1EHLH 4HULB 1PEWA 3EW3B 4JO2H 4F9LA 2FR4A 3W0WA 5GS3A 5F7YC 5MERB 1PLGL 4HIEA 3V7MA 4H1LG 4G80A 5KTEL 3RWEA 2GK0A 4BZ1L 3AC0A 4P5TC 2BK8A 3PGCA 4MXWH 2R23A 3CXHJ 1A6ZB 2IBBA 4AT6A 3PP3K 3IDJB 3Q6GH 3V4UL 4WDIA 1XGRB 2A6KA 4L3CA 1LNUA 4O51A 4UQ3B 4PRHA 4JFOA 1ZA3A 2EDTA 4OCMC 5D93B 5TDPB 1PQZB 3EJYC 1BVZA 4PJIA 1EHLL 1K6QH 3MCLH 4ODUA 3MXVH 2E9BA 5FYJL 2BHZA 5HGAB 4LAQL 5D7JA 1J8HA 2XKSA 1A6AA 3QIBD 1JK8A 1UG9A 2L0DA 2A83A 4JJ5A 1B90A 4M6NL 2EEAA 2XQBL 2EXYC 2OL3L 3QFJD 2CQVA 4CKVX 2G5BA 5FO8B 5CBEB 2W65B 3U79A 5LGKA 6FABL 4GG6E 2A74B 3HC3H 4IOFD 2OX5A 3MGTA 3QG7H 2CLZA 3BKML 5L7XH 3SE9H 1MHPH 1XFPA 1U8KA 4RCAA 3IAPA 4G8GA 1F97A 1W8NA 4X4YB 2VKWA 3FOLB 2GITB 5DJXB 4ZFOA 4YK4C 2ZUVA 3WIHA 2ENSA 4M6ML 1WBZB 4BUGA 2YHGA 1AFVL 3ROOB 3L3OB 4NT6A 3S35H 1Y6KR 1FLRL 2C1PA 2CLRB 4B0MM 3HPJB 4GSDL 1HOCA 2FJGB 5C08A 2IEPA 2VAAB 1CXEA 3T77A 1AGEB 3JWOC 3EJZC 2VSCA 3VXMA 2CDEB 2GUOA 5JHLL 4EN3A 1JMXA 4K7PH 4TUJA 2NX5B 2OMNA 1V3LA 4OLVL 3TA3D 1ZSDB 3S36X 3OZ9H 5C6PB 2V2TB 2DQGL 2FWOA 2ED9A 4CL7A 2LU3A 1C5DB 4NN6C 2BRRL 2FCBA 5L7XL 4LPUA 4OV5A 3DUUA 1OAZL 1G9NL 3FN3A 1UGNA 2C26A 1A1NB 4NBYB 1EHXA 3PWPB 1GVIA 5MEND 4EOWL 1F58L 1UZ6E 4C56E 8CGTA 3BXNA 1N3NB 4OLYL 1WTGT 4U1MA 4LSQH 4MQTB 3O11B 1PZUB 2WUCL 5EU6D 1I7ZA 3FOMA 3O8XC 3GIVB 5DMIH 2PTTA 1IL1A 2X7LB 4M9PA 4ZNCD 4M93B 3WFHA 4IRZL 3B5TA 4OLVH 4NKOB 4YFLF 1DVFC 2Q7YB 1UJTA 1K8IB 5EFIA 4F7CA 1RJLA 2AJYH 1FNHA 2YWYA 5FO7A 4P23C 4QHLB 5E8NB 4N0FB 1ONQB 3L3HA 3PGDB 1SM3L 3DYOA 4NDMA 5H2BB 1C12A 1X9QA 1WICA 1BVKB 4CBPA 1T5XA 3CVIH 1A2YB 3VFNA 1A7PL 4RDQG 5SWQA 5IHLB 3K74B 1AGCB 2R4SH 5SWQB 1U8MA 1HK6A 2R9HC 4LLQB 4DKFL 3HMXH 1AR1C 2RGSA 2VL4A 4QHMB 2KPNA 5DRNB 4HCRH 2EDXA 7FABL 4XWGL 2YXMA 4O2FB 1HHJB 2XTJC 2D9QB 3ARBD 2JJSC 2FSEB 1FLRH 3G5ZB 1FJ1B 4GKSA 1U91B 4KMLB 2WZPD 2E7LA 3MOBL 3TNMA 1KN4L 5H35A 2UY7A 5K9OB 2P8LB 5CEZD 1YECL 5K9QG 1DE4A 5DZLA 4U3CA 5E8PA 1WITA 5FAAA 1U92B 3G9VA 2OTWA 5DURD 3RX8A 4O00A 1I7TA 5F89A 3HC0A 4PJ9D 3OJVC 4PG2A 5KAQF 1MCQA 1I3UA 4JFXA 4JKMA 4F7PB 4OD3H 4ZAKB 3ZL4H 3HMXL 3UAJD 1ZEAH 5F1IA 4PV8A 4Y2DB 4GBXC 5FKPA 5IVNA 3C8DA 3OKDB 5BV7L 4R26H 1V7NH 5MI0B 2WLZA 2UZXB 3RU8L 1L6ZA 2XZCH 4LBEA 1CL7H 4Y8AA 4PR5B 4PJ8B 3QWOB 2AI0L 1M1SA 2PW2A 4E42B 5LKNA 4LIQL 2P8PA 1T1ZA 3B2UD 5DJ6B 1NAMH 3ISWA 3F7VA 2FSEA 1INEL 3E6HA 2G2RA 4M1GH 4QRQB 4JFFD 5HDLA 2ZCHL 2VZTA 3NFPA 4GKZB 4P4RB 4FQ2L 5A2LH 3HI5L 4KGLA 4JFZL 1Q9WA 1RZJH 3TPKA 4CVZA 4L9LA 4OD3L 1JYNA 2H41A 1X5YA 1RHHB 4F58L 4GS7C 5F9JB 2HFTA 2NY3B 4RISL 2BSSA 4PGDB 1BQLL 1RZKH 3ZT7A 5C0IB 1FSKB 5BV7H 2Y5TA 2ADJB 5K33A 3VFPB 1A1OB 4X9FA 4D0BB 5GRVL 3KPSA 3NOIA 3A6CH 1P6AB 3HCVA 5D2LB 5I0DA 3ZKNC 4GW1B 2AXFB 3H9SB 4BZ2H 4JQIH 4HS6B 2W91A 3SCMB 4XVTL 1FNAA 3VRLE 1F00I 2UV3A 3LVEA 3R4DA 3HHRB 4IIQC 5LQBL 4ZS7L 3FB5A 4UT9L 4HKJA 2BY3A 1HXMB 3CH1B 4JPKL 1PDKA 1WLHA 2VABA 4FFVC 4JM2A 1QR1A 3RIFK 3Q5YA 1OTUC 5CGYC 3VFUB 3WNPA 2B5IC 3QWRD 4XC1L 3EOBA 3WN5C 3QO1A 1CLCA 2HJLB 3WS6A 4ELME 2XQYK 5DUMH 5HHPA 3P9LA 4LHUB 4N68A 2N7BA 2OZ4H 3SJVB 4KK8C 2VLRD 3HZKB 5E4IA 3NIFF 3UJIH 1H8SA 4G8GE 2XPGB 2MQ0A 2VLJA 4JN2A 3ARXA 3WD5H 3MQIA 1GC1H 4WU7A 3WN5A 3R8BB 3GMOA 2Y06H 4R26L 5MEQA 4Y5XB 3FT2B 4H26A 4HHAB 3MLTB 4HBCH 5HHOD 2IBGA 3F7YA 3MBEA 1QA9A 4TVPL 4NKIH 1EEUA 3B9EA 3L3DA 3PG2A 2EIEA 1QSED 4HS3B 3WKMH 1OAKH 3ZDZE 2FB4L 4PRHB 2ARJQ 3H7BA 4ETQA 3LPWA 2A6KB 4U1NA 4RAHA 2C1PB 5F9DC 5F3HA 3IXAA 2GW5A 1BX2A 1NBVL 2X4TA 1QBLL 4XC1H 4ZPTA 3SKNB 1EEZB 3EDFA 5LGJB 4PBWD 5DD5H 4KI1A 4YXHL 1XEDA 3UO1H 3QXWA 1ZA6B 2FZ3B 2J5LB 2F53E 2H32B 4ZXBC 5ELIA 1ZT1A 3HE7A 3TV3L 4FS0A 5IMLB 1FVEB 1H5BB 3F58L 1V3MA 1AXIB 1BQLH 1WWCA 5DD3H 3FFDB 1YMME 3IDXL 1NFKA 2CRYA 4G3YH 3REVA 4Z7NF 5CJOH 3UTTD 5CCKH 4PJ8C 3A6CL 4BFIA 3P0YL 2NLJB 4PB9L 4JN1H 5LBSH 1NANH 4Z95H 2GSIA 5KTEH 3P0GB 1AH1A 1NBQA 1KIRA 5FUZH 4HH8A 4PRPA 3U9UA 2E27L 5GZND 3WCYA 2EEBA 3UTTA 4MDIA 3UYPA 1W0VA 4KPHH 1I1CA 3NCCB 4LOUC 3DV4A 1F4XH 2AXHA 3QPQD 1ACYH 5CMAA 4A6YL 4XVUD 4XRCA 5C0CA 2YEZA 1NCNA 3VXRE 4NC1E 4FZ8L 2YEZB 3TIEA 1UC6A 2QLVB 1F45A 3TIEB 3PQYB 3NFNB 3QHTC 1V5JA 4XB8A 3JTTA 5DEZA 1QLEL 2P48B 1KG0B 3V7AE 5DJCB 5GIRA 1B0GB 4M7LT 2A38A 5BRZA 1MCDA 1IM9A 4DK6A 3MXWL 5L88H 4E41A 4JZJB 1NUDA 1J9CT 4HBCL 2AV1A 2KZ1B 4X8JA 3T4AB 1GH7A 3MNVB 2DDQH 3EYUH 3STZA 1JZ4A 4NQED 2BX5A 4S0TD 3U1SL 1DEEB 4PGCA 1KCVL 4UU9B 3CMOH 4YXKH 1R5WA 1TVDA 4FFYH 5C2BH 4PJ5E 2LE9A 1OWRM 2PTTB 5JMRA 1I8MB 1CR9L 5ITFB 3ZYZA 4DUVA 1IGCH 2QEJA 4OM1L 3QP3A 4MA7L 2PXYD 2BZDA 4NHUA 5GGTH 1X6NA 5HGHB 1FRGH 2BOCA 3VWKC 3QI9D 5TDNA 3QH3A 5J3HC 3WNOA 2A6IB 2ZG1A 3P0VH 3UMTA 1CS6A 2XTJB 2G5BB 3DX7B 2DMCA 3W2DH 3F6IA 1OD7A 2N7AA 1DQLL 1N2RA 1KCSL 43C9A 4KZEL 4X4MA 3KPPB 3L3DB 3LKRB 5L2KD 4H20H 2E9IA 2A0LD 3GI8H 3DRQB 1HWGB 3O8XA 4YEEA 4P23B 1NEZG 1KCLA 3CK0H 4XMLH 3CSGA 2D7MA 4ZPTB 5E1AA 1NEZB 3JWOL 2VB5A 4OLYH 3FO1A 3S37H 4PJ9C 4LHUD 2R2BB 4OZGA 3OJDB 5HVHB 3LN5A 2VDRL 1Y18A 1CICB 4X5WB 4Y5YC 1AHWC 2JELL 2P47B 4TUJB 3QAZB 4X9BA 4XP4H 4Y5YA 3LS4L 2FYYB 1NC4A 2AJ3A 1CBVH 3PHQB 5J13B 3HUJF 3VXUE 1QLEH 5KVMC 1P5UA 2OJEA 3T4YA 5BZWB 1H8NA 1TZIB 5HHMD 5HD8D 1I3RB 3OPZL 4MCZB 4YBHA 3WXWL 4BFIB 1QBAA 3CGTA 4DGIH 2GAZB 2ERJC 5IB3A 5I73C 5E2VH 3ARGB 3O11A 2CUHA 5D6CB 3TA3C 1NC2A 4JDVA 2O5ZL 4C83B 2PETA 1L7TH 4JHAL 1QLFA 4HT1L 2PYEB 3OKMA 1S7VA 1CFSB 4KY1H 1VKXB 4R7DA 3T0XA 5IP4A 2OQJA 5EH1A 5LGHL 1NBZA 3BWUC 3Q5OA 4EOWH 3W11D 1WCBB 2X44D 4X8XA 5FYJH 3HAEG 3PGFH 4Z0BL 4X6FB 4ZQKA 4J4PD 4C54A 5J9PB 5GGTL 4K94C 4J3OC 1RHHA 3OF6A 1NFDA 4QRRE 3SJVA 5EZLA 3O3DB 1PKQA 1U8PA 4M7LL 3O6FB 4LKCA 1N0LA 5KS9A 2F19L 2N1KA 2VC2L 5C0EA 15C8H 1LVEA 2XTLA 4GAGL 1O7VA 3ARBA 3TPUB 4GG6F 4TTDC 3B2VH 4XHJD 4XH2B 3RL1B 3ZL4L 1BF2A 4YR6A 1MHPL 2X4OA 3BEWB 3IB4A 1WT5A 3KYNB 3RVWD 5SWSE 3S4SG 4YO0A 5CEXB 5IT2L 2HKHL 1TJIL 4PD4J 3GSVA 4OZGF 3LSOB 3THMH 1R5VB 4GFTB 1CL7L 4WHTB 1I1RA 4HXAL 5A3ID 3JV6B 1A9EA 4WI6A 5TE6L 3SBWA 5GS2D 3B9AA 5EFIB 3UTTE 5E99H 1J87A 3CCHA 1UB5A 4IOSD 1R3HB 2ZNXA 3BPOC 4PJBF 3R06A 2X4QA 1G6RB 5AEAA 2X1WL 5L2KE 1KYOJ 4EDXA 2NY4B 5GGSY 4NQEB 1U8IA 1ZHBB 4MDJA 4QXTA 3ZHLA 4H25B 5EO1A 5IQ7L 3GBNH 5D7JD 4OF3A 4I18B 3CSBA 3LDBC 4XWOD 2YWZA 4MNQA 1NC4D 3D69B 5E08L 4NJAL 4PJ8A 4HWZB 2AERT 4NQXB 3SKJL 4Q2ZA 1X5FA 3QA3B 5D1XB 5DA0B 2YPKA 2B1AL 1RAMA 1A4JB 2AKRB 3VXUB 4DWHA 3CMGA 3GHBH 3T3ME 3BUYB 5JQ6H 4WTZG 2K7PA 3P11L 4ODXA 4NNXA 4LLUB 3AY4C 3MMEA 5SX4I 4XNMB 3UJJH 1TQBB 2XZCL 4Q6IA 4GSDH 3GJFH 2BHUA 5JHDE 5DQJA 1JHKL 3BH8B 3C08L 2WP3T 1BD2A 3V6ZB 1D5IL 1OSPL 4JZOB 3ZHKA 5JHDA 2W1NA 1INEH 5SWZD 1PG7X 2E7CA 3PDOA 4LLWB 2D0GA 4YDLB 3NTCH 1N5YH 5GSVA 3KPRE 5A16B 1I75A 4M7ZB 2OZ4L 4PV8B 4Y2DA 2CIIA 2A6JB 4Y5VA 3QPXL 3EOAA 4H5SB 1J0YA 4OLWH 1YYLL 3U9UB 2NCMA 5BO1L 5FM4A 2Y7QB 4RWYL 2N56A 3KAAA 4MQ7B 1RD6A 4L3EE 3VWJA 5GRJL 4KI5D 1ZV5A 4OAWA 5FB8A 2FH8A 5CFHA 4LPYA 3AS0A 4Z18A 5BJTB 4Y4KA 3W9DB 3NZHL 4NNYB 3SKOA 5FOJA 4XVTH 5FUOH 2Z4QB 3WNNA 4AL8H 5L9DH 4NQCE 2Y25A 3UO1L 1TCRB 3T1FB 3DX7A 3O6FA 3PQYD 3OTTA 3TV3H 4E41D 2JJTA 4YIQB 2HN7B 5C0NC 5IB1A 1IARB 4WUUE 4F33B 1BFVL 1FNEB 5D7KD 3RTQC 1YMMD 1YUHA 4N5EC 1A7QL 2BP3A 4V2BA 5GS1C 1QYGL 3NN8B 4QRPB 5I71B 5GQBA 2R0ZL 3M8OH 4MJIE 2D0HA 5C0RL 1NSNL 2VERN 4TUKH 2BXYA 5I2IA 1A6VL 1QFUH 4PJCE 2FL5B 3DHMA 2NXYD 2W0LA 4LCCA 4RGNE 4NKMA 5DMKA 3MC0A 3D0LA 2AABH 3VRLF 5DQJB 1JGUH 3UDWA 1DEDA 4DW2H 4GO6B 1X5GA 3GMQB 3WKNA 4OF0A 4X6CF 5B4MD 1MFCH 4TRPL 3MV11 2IG2L 5BVJA 1WCQA 2DQIH 5TQ0L 1AKJD 1EVTC 2YMXH 4KKNA 4FFWC 3U0WL 2P5EB 3MJ7B 3MLRL 3QUZC 1GRWA 1IM9D 3PP3H 1CLZL 4XBEL 1U58B 4MXQC 3GSXA 3IDJA 3O2WL 2CKNA 3O8XB 5D72H 5IKCA 3FB7A 5E1AB 2PYEA 3OKMB 5KVDL 5DJ0B 5EU4B 4CMMA 5E00B 3RY6C 1HE7A 4UIMA 3KS0J 4LLAA 5D2NA 2ID5A 2VRAA 3NCJL 2F53B 5EBWB 3R1GH 3O3BA 4P4KA 5DMGD 3ABZA 1EJOH 2YS4A 4J1UB 2DJ4A 4X98A 4JY6A 1T1XA 4N5UA 2HP4A 4NO0A 1KENH 2BNQE 2DQIL 2BSSB 4PGDA 2KQMA 1J05B 4G6FB 1F3RB 3BH9B 2DTML 4Y88A 3HAEH 1JHLL 3UCRA 2KBGA 3TN0B 1KFAH 5ESQB 4NZDA 3MFFB 1D5BA 4WY7L 4PJFB 4YDVA 1NLBL 3ULVC 2BJMH 2VNCA 4GRMA 4EJ1C 4HUUB 1FG2A 3ILPB 3QDMA 2IAMD 4Y19B 4ZO6A 1XF5B 1AKJA 3EYQC 3VXSE 1D9KC 5IBLC 3UEZA 4YHIA 2BDNH 2O5XH 2H26B 4OZIF 2HFGL 4P49A 4FA8A 5L2KA 2C4FU 5E6ID 5KVEH 1Z6JT 3ULVF 4KJWC 5E00A 5GSRA 1QHOA 3VGAC 1E4WL 5DD5L 4ODWB 2F53A 5EBWA 2LAGB 4X80H 4HG4K 4KJWD 1NFDB 4ONGH 2B7DT 4TSBL 1QP1A 4KC3B 4IMLB 4N0RA 4I2XE 4K8RD 5T33L 5DJ8A 3B43A 4CW1B 1D5XA 3V5DB 1NDMB 1A9BA 1BM3H 3MA9H 3P9WB 5ECJE 4ZOAA 4I77H 4K8RH 1KJ2H 3DETC 3L9RB 4LAQH 4ZTPH 4PJAB 3UBXI 3CD4A 3HI1B 1UA6L 2VXSL 4ENED 2P49B 2XNAB 1FGVH 3G6JF 3OPZH 5HHOE 4O2FA 5BS0E 2JJTC 2CO6B 1G9MC 4EI5A 2XWBA 2WBJA 1YA5A 3MO1B 3DIFB 1OAQH 2F8VA 2YD1A 3LEYL 4LEOB 5HGBA 4NGHL 4KV5E 4TVPE 3KNBB 4JG0H 2RIKA 4O58H 1ORQB 1UKSA 3BD5A 4HGKC 1Z0MA 5I1KL 2WIMA 1CVRA 4P5TB 4D9RE 2EC9T 5CINL 3I6LD 4M3KB 1MCPH 1T89C 4OLEA 3SE9L 4U33A 4KY1L 3SY0A 1TVBA 2V5TA 3EYOB 4GS7B 5D7IE 3BH8A 4KUZH 5KOVC 2DQHL 4I2XB 4P23D 2A73A 3HN3A 1A6PA 1EJ6A 1CTOA 1SYSA 4KK9C 4P3WA 4FQLH 3QUZB 1JV5B 4WW2C 3ARFC 4OZHA 1NCUA 3BP7B 2VLKB 2UUDK 1BWWA 5K59F 2NY4D 3VFMA 3BP4A 4XCNB 1IEBB 4DFHA 3WJLC 3MRGA 3UJTL 5DFWH 2D7PA 2UWEB 3BW9B 5D7LE 4PP1D 3FO0H 1OF2B 1HQRA 1UWGH 1ZOXA 1JWUB 3B2VL 4KK5D 1FZJA 3PL6C 4X6EA 2J8UA 4A6YA 1OLLA 3C5JB 1XF3B 3EYSL 3I6KA 4KAQH 4U3XA 1CL7I 1CYGA 3MFGB 1KC5L 2J7LA 4HBQA 1L7TL 2Z31A 2ICEB 3AM8A 1S7XB 4DN3L 32C2A 1MUJA 3GJFK 4A2MA 5K59E 4KTEH 1FN4B 1WWAX 2BERA 4OF5A 5A16A 3BKJH 4O4YH 2WAHA 5KVGH 4KKAC 2DS4A 4Y5VB 3WLWC 4J8RB 3TH2T 4YHNB 2F5AH 5DMGC 1NAKH 4IRSC 3EYFB 2NLJA 3MXWH 4PGCB 3V79C 2VDKL 4K23L 4ESKA 1GXEA 3D85B 5HHQA 2V7NA 2FECI 2BVYA 5GRYA 3IDMB 1T1YA 1XH3A 1Z9SA 4NN6B 2PR4L 3C5ZC 4KKLC 1U3YA 3S97C 5ANMA 1IVLA 5I2IB 3BMWA 1AGDA 4GAGH 2QTEA 4Q9RL 2AK4B 4D0CB 5T1KA 4ODWA 1RVFH 1YEDA 5F88A 1U3JA 2VR9A 4KI5C 2EO1A 4RGNC 3LQAC 2F8XC 3EGSB 4JY5H 5J8OA 1F58H 2H3NB 2R29H 5GGQH 2FHFA 5I76A 4YK4B 4S11A 1C12B 4DQOH 3DROB 3RZWA 1LO4H 2Y5TB 4HIHB 1GGTA 1KF9B 4NN5B 4Y5VC 5IMKB 2XQBH 1P7KB 1AP2A 3NFSL 5ICXA 4DGIL 3MBEB 3LKRA 2EYTA 2QQLL 2VIRA 3JZ7A 5E2VL 3W9EA 1F4AA 1WAAF 4X4XA 5CHNA 1U58A 1BBDH 5ADPL 2AQ2A 2RB8A 4NM8H 5EN2B 5C9JA 5MENB 4HIIB 4H20L 4HKJB 4H0HB 1UB6B 3SDDC 2NX5E 1LILA 1NEUA 3BGAA 2VDQL 2Z8WC 1MREH 5GZOC 3ULUD 4NQVB 1G1CA 3GMQA 4Y2OA 1VENA 5SX5K 5EOCH 3O0RL 3IAQA 1BD2D 2IQAB 2Q8BL 1S9WA 3PABA 1S9YB 4ZAKA 3VXPA 1DQQB 4HFWA 3VDCA 3UTQB 4UTBH 2YN3A 2R1WA 3QNXA 3SDYL 5AUMB 4FQ2H 1G7IA 5DSCA 4EDWL 4XHJC 3U0PB 3GHEH 1JGEB 1VFBB 3O45A 2Z9TA 1MF2L 1AI1H 3C09C 2CH8A 2QQNL 1BIIA 3QHZL 3FB7B 1OF2A 4PRAA 3ZSSA 4BQ9A 1INDL 4MA8H 5CZXC 2FLRT 1A7QH 4U6TA 1GGIH 5FGBC 1K4CB 2FJFA 3I6KB 4E0RA 3MRNB 4WJ5B 3O0RH 3TM6A 2ZSWB 5GXBB 5KSAD 5LG1A 3SEPA 3VH8B 1DCLA 2R2EA 4LLYB 3QISA 1E0OB 5IHZA 3QEUB 1GL4B 3D39B 3P3YA 4PJ9A 2P5WB 4TULH 2HTLD 4MHHI 4X5LA 4ZS7H 4LSVH 5I16B 1CLOH 5I1HH 1IAKB 4TNVF 3UTZA 4U05A 1SYVA 1X44A 2D3VA 3DUSB 2MCG1 4HUXA 1J11A 1JGUL 2OSLA 3PDGA 2Q8AH 1O7SA 2Z91B 4KRPD 2ESVD 4MCZA 3V8CA 4NBXB 1BBJB 4JZNA 4R0LC 2QQQA 4KRLB 4FQXD 3X14B 4YHNA 3IAGC 4V1DA 4WWKA 1INDH 4UU9A 3HR5A 5TE7L 3V0VA 1HYSD 1A7PH 3SKJH 4FHBD 4OGYL 1F6FB 3S36L 1QKZH 1IL1B 3B9VA 3F7PC 1HYSC 4EIGB 3LZFH 2I25N 1FO0A 1EK3A 3QIBA 4Z8FL 5ESVB 4HX1B 1A6TA 4XCEB 2VDNL 4OZHE 4U1SB 1A7OH 2IPUG 3MJ9A 4FMKA 3LRSA 1JJUA 4F37K 3F12A 5CGTA 2Q8BH 1VEPA 1D5IH 1HSAA 1OSPH 4UDTA 5D1QB 3SO5A 4OGXL 4OQTA 5MHSD 2ZG3A 3MTRA 4FP8H 4UT9H 3O2DL 4XCCH 4X6BA 3HI1A 2DTMH 4M5ZL 1QFWM 2DD8H 4FN0A 5CSZB 1CU4L 3P9MB 5GPRA 4BUHA 4U3HA 3QXTA 4W4NA 4HWZA 5C8JB 4S1DC 4NYLB 4LP4A 5F9OL 5IROC 3LKNB 4AQOA 5IW1B 3VXRD 1ETZB 4MNHA 2AAVA 5EC2B 1XIWC 5DUML 4G3YL 3GIVA 2J8OA 5IV2A 3BISA 4KZDL 2WSKA 1KELH 5DFVC 4YC2B 3QUXD 5JPNA 3QFJA 5CS7A 1U8OB 3MMEB 3HB3D 2EDJA 3O3EB 3WD5L 1LO2H 1A6WL 1V3JA 5CJ5A 1CFVH 2EEDA 4P2OA 5IWLA 1UB5B 3P11H 2BOBA 5E9DA 1JNLH 4FFZL 2YBRB 4QRRB 4WFHD 2HT4D 3U7WL 2HT2C 4I0CC 3KYOB 2OSLB 2YK1L 1MIEL 1YECH 4W4OA 1LO5A 4LMQE 3SJVD 1DQTA 1LO0L 1TNMA 2GJ6E 3P77A 4HPOL 5JORB 4L8DA 3D3VA 3H6JA 3WDIA 2HFFA 1GGUA 4BFGA 5E03A 2DQTH 2IAMA 4XVJL 1IQWL 3HRZB 2E5EA 3BN9C 3S36H 2DM3A 5HYJA 1I3GL 5BOZG 1WBZA 4BZ2L 3FT3B 3EZJB 1DQJA 1EEYA 4XPGL 1LO2L 3FT3A 2JLLA 1KGCE 4RWYH 3STBA 4J1UA 4JFYA 5DHVA 1W0WB 1FFNB 3FZUD 3VXMB 1UXWA 2VE6A 4JFPA 3UBXB 4GRWB 5JUEH 4NQVA 3BVNB 5C0AB 1K3IA 2ED7A 4R7NA 4ZUVB 1NCAH 4M6OH 4P4KD 2EH7H 1LO0H 3RWFB 4U1IA 4XAKD 3M1BB 1ES0B 5FO8A 5IEKA 5I74C 5ESQA 5K9JH 1C7TA 4X6CE 1UKQA 3REVB 1A0QH 1D6EB 3CVHH 2QQKH 4M5ZH 3PWJB 4OM1H 3WUWG 4BQCA 4PD4K 5A43C 3NCMA 5IOPB 3MGAA 5J4MA 2J8UF 2ZJSL 5E6IC 3H42H 5CSBA 1HWHB 4OKVA 1CE1L 2IQ9H 4LGRB 4EI6A 5GS0C 1CE6A 3Q48A 1IKFH 5IBLD 2OL3A 4TNWK 5KSAB 3RGVA 5L8LB 4ZO8A 3DHJA 3ARZA 1I8MA 3BSZL 3MRIB 4ZTPL 4R96B 4JFFB 4HUNB 3FO0L 4RFNB 1KOAA 1M7DA 3LQAH 1OSZA 3CFIC 4QF1B 2BVQB 5FEBA 3G5XA 3MNZB 4PG9B 4HSQA 4ZG1A 1NBVH 5E95B 3T0DA 1FIGH 3QUML 3RWDB 4XAKE 3Q3GA 1S7TA 1FZKB 2UWEF 1YEJL 3EOTL 1H3PH 2E7MA 5GGSB 3ZDXE 3CVHA 1W2KT 3JWOH 1KFAL 1JCKA 5FKAA 2H2SD 3KLSA 3MLTA 1A22B 3BFOA 4QHKI 4Y1AA 1YZZA 5J11B 3V0AC 3WSQL 1SBSL 4IOIB 3MBED 3P4MA 1MVUB 5ID0B 4R9HA 4NQDA 3BO8A 4WW2F 2NY2D 3FHAA 5EWIH 4OI8A 3I3DA 2YPLE 5IUSA 4LSPL 1MH5A 4ZXBA 2FECL 2NY2C 3TYFA 3V4PH 3BRFA 3ZO0A 1S5HA 2Z35B 3PL6A 1FNFA 1M7IB 5T5FH 2WWMD 3RP1A 5FYKE 3ES6A 3PQYE 4UMGA 4L8BB 2O5ZH 3F7RA 3HG1E 1EJOL 4Y4KD 5JDSA 4OQTH 1F2QA 1S9VA 1QBLH 4RGMC 5J1AA 5I8CB 1CK0H 1NDGA 3HZYB 3WSQH 3OKKA 3WNLA 4P9HH 4HKZB 2QQKL 4I5BB 1DJSA 2VQ1B 3PF2A 4KJPD 1I9JL 5HYSA 5EZJA 1IAOA 4OD1L 3TP4A 4LSPH 3AU1B 2H6PB 4PTUB 1GHFH 2VDRH 5T1LD 3T3PF 1F3DJ 5D1XA 3MCLL 2VZ1A 3WS6C 3TBYB 4OAWB 1PD6A 4X6EB 1E6OL 3OG4B 1T2JA 1HEZB 1WFNA 3OGCB 4I0PA 4ODVL 5CEZE 5IJKC 1ZHLB 2C3GA 2XTJD 1I1AD 4X6DE 1WQVT 3KLAA 5I1KH 4XXCA 3ARVA 2AQ3A 3VJ6B 4ZTOH 4D0DB 2GUOB 3EYVB 1GGCH 2Q6WB 1IEAA 3EFDH 1T1WA 5D2NC 3B83A 3PWVA 1CR9H 3RJQB 3PV7A 1F8TL 4MD4B 3S7GA 4M00A 4OFDA 5FA3A 2MFNA 1FAIL 4L4TE 3QG7L 3PNWA 5T33H 1F4XL 3P0VL 3AS3A 3E0GA 1XR8B 3U6RA 1BM3L 3MA9L 4HUUA 5LGHH 3S3JA 5D93C 4RAUB 4JQXC 2FD6H 4F37F 1RZFH 3KHOA 4UT6L 4JJHA 4DQOL 3V0VB 4PV9B 2OXGA 2C5DC 2MKLC 2NYYD 4XTRC 3BGMA 1FGVL 3NMEA 1V7ML 3KNBA 1RFDH 4UNVA 3ARGD 4MLSA 3MOAH 5JHLH 3QHZH 3HPLA 3MRDA 5IEHB 3DO3A 5IK3A 2PYED 1U41A 3TO2A 5B3JE 1JPFB 3HUJA 3MUY1 5IVXE 4FFYL 1D9KA 1FC2D 4MMXC 1S7TB 1CFTA 3NFNA 4S0SD 4Y16C 4EQ3A 5T1DH 2VLJD 1OAZH 4JQXA 3EDJA 2V17L 3RKPA 4CW1A 5MEQB 3O4OC 1AGCA 1T80A 3FTGB 3THML 1ZVHA 4POUB 1A7NH 4X6CB 4HQQH 4Z7QF 4N1CA 4QTHA 1PKQE 1FYHB 5GGVH 3O6FC 3WFEH 3GSWB 2FJGA 4PJHE 4KQ3H 5D5MF 5EO9B 3VXME 2FIRT 5JNYB 3LN9A 4OGYH 4R96A 4PJEE 1M7IA 3JV6A 2RFXB 5B3JF 2RFXA 3GB7A 2AEIT 2DI7A 4LARL 1PYWB 3ZKMC 2A83B 4JJ5B 1F8TH 1S7UB 3KJ4C 5BZWA 5B8CC 3CU7A 3Q6GL 2X89A 3OXRA 3A6OA 4LSRH 3MX0A 5GGSA 1LO4L 4FXGA 2NMSA 1VACB 2NW3B 2R9HD 3NZHH 2XWJB 1HILA 2D4DA 1J8KA 1VFAA 3ALWA 4HHAA 3MJ6A 5L8JB 4EBQL 1UH3A 1S7QA 4FOMA 3SE8L 3BPCB 4FTVE 4LSVL 4M62H 4RX4D 4CN1A 1AQKH 2AJZB 1RFDL 2GTZA 4JE4B 4PJHF 5D5ME 2B4CC 1JRHI 1FZJB 4NC2B 3MV9D 1PQZA 4M03A 4GUPB 4GKSB 2AK4A 3SGEH 4G6JH 5IT2H 3KPNB 2VAAA 3VMNA 4U6HA 4M1DH 1CIDA 4LCWB 4QRTA 3ZDYE 2FR4B 1P6FA 1TXKA 1FZMB 5I76B 1QYGH 3KJ4B 5KSUB 4J3SA 2PO6A 2ZKHH 4LHQB 43CAA 2ZOLB 4HUVB 4RIRA 1C08B 2D31A 5GISH 1NCWH 2VDPL 5C0BB 5F1IB 4Z0BH 2W60A 3HI6H 4NZRL 4JG1L 1BWMA 4V1DD 2GAZA 1BAFH 1I8LA 4RAUA 4HQQL 2IFFL 3TBWA 3NFSH 5FGCB 1JF5A 3MRBB 5CZVL 1DN0B 1I9RL 3HKFA 3QR2A 3GSWA 1D7FA 5CZXD 3WFEL 2DQFB 3QUYA 4K3DL 2DQGH 2FEDC 15C8L 1HHGB 1J7VR 4KHXH 4NQSB 4J2XA 3KR3L 1GGIL 4HUWB 1XZ0A 4R2GB 5TQ2L 3ULUH 3NFPB 4GKZA 3NABH 4RFEB 1XIWB 3QULA 4PUBL 1MRCL 5BQ7B 5JDJA 1GOGA 4HDIB 4RAVB 4WV1B 1BFVH 4TULL 2H3NA 3BPNB 2XKNB 3JTTB 2G75A 4M61B 1OLZA 1KSRA 2O5YH 1X5KA 5TE6H 2GK0B 4PB0L 4OZHF 3VG0L 4PREA 3T0ED 5LWYH 3KS0H 1OY3B 4WHYG 2EE6A 4EBQH 4WO4C 12E8L 3EJZD 4P46A 3QYCA 5DI8A 4QHMA 5DRNA 5E1HB 2CLVB 3TJHC 4PRNB 3VCLB 4L4JA 4ZAKD 1N59B 3D39E 5EC2A 3BGMB 5DRZA 3LZFL 1MRCH 3HC4L 1OGTA 3VDAA 3Q0HA 3ORJA 3O2VL 3RJDA 3LKSB 1IKNA 3P4NB 2RHEA 2P8LA 4RBPH 4F57H 2CSPA 2IFGA 1NGWA 5KANG 4NSKA 3KPMA 4L9LC 1NGWB 3QJFB 3GSUA 3FFDA 1JHTB 2Y06L 2FGWH 1CLZH 4MSWB 4J3UA 1U8QB 4PJAF 3KHQA 1S9VB 4XBEH 1MI5B 4PJFA 4AL8L 4P3CL 1T6WA 4HJJL 1MCEA 3WFDH 3OAYH 3TA3A 2A74A 4RMTA 4JG1H 3BD4A 1JFQL 4JKPL 3P73A 1F3JB 2UVEA 3BPLC 3MOBH 4HIJB 5DJAB 5C0AD 4AZ8A 2F5BH 1RK0A 1IEHA 2NXYB 1YEHL 4P46B 3O3AA 4Z7UB 5D1XD 2VISA 5MP6L 4ETQB 3NTCL 4OIAA 5ICYA 5GZOD 2ZUQB 5IGXH 1CD9B 3BPOB 2DN7A 3QPXH 2XRAL 1W72B 3O41B 4F80A 1FHGA 4YBLB 2HJFA 1ZA6A 2EXYD 1MI5E 4L5FH 3MRCB 1OL0A 4YX2L 2H1PL 2YSSB 1N7MH 1G7QB 3WIIL 5L2JB 1YN6B 3PXHA 4NOFA 4FQHB 2B8OT 2R2HB 5K9KA 2XA3A 4LRIC 1TJHL 5SWSA 3HNTH 3NVQA 2AXGA 2OP4H 1DBJH 1INQB 1VEOA 2VSDA 2V5SA 5GGUA 4OF6A 1KBGL 2GJZA 4D9LL 4XGZB 3OSKA 5LAXB 4U4BA 2HMIC 4ONHB 3TCLA 3L5WA 1U95A 1SVCP 2QJDA 1XGTB 2XRAH 5C3TA 4NKDB 5DWUL 3SKNA 5FA4A 1LEIA 3GSVB 2Z31D 1JUFA 3GSOA 1MHEA 3EO9L 1VPOH 3O2WH 3EIFA 2C7UB 1XF2A 3D0VB 4GRLC 2AK4E 4XPHL 2J8UE 3QIBC 4KZDH 4XMPH 4XTRD 1R5IB 1RZKC 2VLLB 4XRCB 3MJ9H 1TJHH 4P57A 2NNAB 2NY2B 3TIDB 3RWHA 3VXOA 2XKNA 4ENEC 2X4RB 4RSVA 3N1QC 3INUL 1ZSDA 5L88L 3VFRB 5C0IA 1ZLUK 2FEEI 2VLJB 4MHHG 4HKZA 2DDQL 4FFZH 3MLYH 2P5EA 1HDMA 5B39B 1KYOK 4PLNC 3N9GL 1AQDB 3HCVB 3CZJA 4K8RC 3TZVC 2HFFB 1QSZA 4KUCD 3G9AB 1FL6B 5FGCE 4OQTL 3DGCR 2P7TB 1K5NA 2GT9B 4KUZL 2GI7A 3ARFB 1T22A 4XVJH 4JPIB 4OCRH 3CH1A 2NZ9D 4XMPL 4Y1AE 4MA7H 1XGQB 3X12B 1I9JH 5EO9A 1MHEB 2F5AL 4X99A 5IHBA 1FVEA 3EOBB 4GMTH 1NMBL 2VDLH 2VN7A 1UYWH 2Y23A 5D7SH 3WS3B 4JFXB 5FCSH 3G6JE 2ESVE 5JUEL 4XPBH 1FYTA 4ONGL 5J57B 4HJ0C 1PLGH 2UWEE 3T09A 1NCAL 5IB4A 5GS1B 3ESUF 4LU5H 4M8QA 4PFEA 2JK5B 4PPTA 3HE7D 2QADD 1BLNB 1BOYA 3ILQD 4EVNA 5HPOA 1QA9B 3JV0A 2YC1B 4LNRA 1RJYA 2DI8A 2APWA 5IFHL 2ORBH 1S7WA 3E6HB 2DBLH 3TBYA 1NEZA 1KT2B 5IQ9A 1IKNC 5I1CL 2A1WH 1BMGA 2PCPB 3GUTA 2AEPL 4S1SH 5CJOL 2IH1A 4WWKD 3FQTA 3VFWB 3SQOL 2C4XA 1J0ZA 3O6LH 2PO6C 4G7VH 3PGDA 3OR6B 1KCKA 4NDMB 1OAXL 5DT1L 2R2HA 3UTOA 5K9KB 2CKBL 3GSUB 3C5ZB 5IR1A 3F7QA 3TO4D 5CILL 4PJ7F 4P46D 4MJ6A 1TNNA 1P9MC 1QFOA 3U46B 3SOBL 2B0SH 2JB6B 3U46A 1ZKAA 3LRHA 5ALCH 4V1DB 1QRND 3LB6D 4KHTL 2I26N 4WCYL 1BFOB 4EI5B 2A1WL 1DLFL 2JIXD 5GJSL 3DJ9A 5ETUB 1G7HB 3M17A 5EA0H 3SGJC 4WHYH 2ZPKH 1E27B 5B39G 3QFDA 3JWNC 3T3PE 2GSGA 1JWMA 1KLFA 4GQ9L 3K81A 1XCTA 1QFWL 1D5ZB 4ZSOB 1HINH 2WANA 5DJYB 4JGJA 5F97E 2HMID 4E5XB 1Q9WB 2GJJA 3DOSA 4KDWA 1S78C 1T04A 4G6JL 4U6YA 5B8CA 4Q58C 5JQHC 4L29B 4MSWA 4YZFE 1WZKA 4QHUB 4LL9A 2V2TA 1RIVL 4MJ2A 4WO4D 4XBGA 1NGYA 1BVKA 3TH3T 4MLIA 4ZFFA 5ANME 3K1KC 2VN4A 4M1CD 1KLGB 5L0QB 4UTAL 3D69A 2VZVA 3K4DA 5IVXF 3WDJA 4UT6H 3HI6L 2DQUL 3CU1A 4NZRH 3UTSB 4F7MB 1QFWH 4KUCF 3HZVA 1CD8A 4LEOA 1UJ3C 2OQJB 1DTUA 3S4SB 2BNQB 35C8H 2Z0BA 3QCVL 2NY3C 3MLZH 1QR4A 5IBUB 4L4TB 4AEFA 1FIEA 4BQ6A 5FYLL 3GMMA 3KPQB 4ONOA 1T2QL 2CIKB 4CVUA 2VYRE 4U49A 3KR3H 4ZTOL 5DC9B 3VFTA 2X4QB 4Y4HA 5DT1H 5L6YH 2WW8A 3EDEA 4N90E 1ZLVH 4CMHB 2LQRA 2CDGB