2B1AH

Crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug1033 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
226
structure length
226
Chain Sequence
EIQLEQSGAEVKKSGESLKISCQTSGYSFSDYWIGWVRQMPGKGLEWMGIFYPGDSDSRYSPSFEGQVTMSADRSTNTAHLQWSSLKPSDTALYYCARLGGDYEDSGADAFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 2219, light chain
publication title Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
pubmed doi rcsb
total genus 37
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aH01
1PEWA 2BXZA 2H1PL 3L3DB 1HI6B 4JR9H 3B83A 5F7LB 3WXWH 1EJOL 5BOZG 1AGCA 1OB1A 4HFUH 1EXUB 3GSNA 2P5EB 3ARGC 4PJ7A 1K3IA 3U79A 5DJCB 4ZUSA 1TQBB 3CSPA 4L9LC 4JKMA 2FLBT 4BH7B 4ZUUA 4QRRD 5C0GB 4LHUD 1DQDH 3K81A 4WGWB 4K94L 4ZFFB 1ZANL 3CSBA 1K6QL 5H94A 1RPQA 5GGSA 3BH9A 4Q6IC 3MV7E 5DJZA 4QOKB 3W82A 5GSRA 1UKQA 4L1HA 1NANI 1UQSA 4OLYL 3CH1B 2I07A 3KPSE 1DQLL 4B5EA 3HNVL 3ZKSD 4Y7MA 1CXHA 2C7UB 3QDME 4M7JH 4E42A 5ISZB 3LQAH 4DKFH 3UJTL 1T7YA 5FA4B 3BZEB 3T1WA 2HFFB 3OJ2C 4HKZB 3DO7B 1WT5A 4JDVA 4OZFB 5F1KC 4BELD 3SKOB 3K4AA 4UT7L 1JRHL 1HQRA 1R3KB 3HTLX 1IGFH 3T04D 1ETZB 1FGNL 3T8XA 5KVMC 3DTXB 2VLJB 5GQBA 1HXYB 3VXRB 3LPFA 3FHQA 2ZNXA 3L3GA 1FHGA 1KPVA 3CVIL 3G6JE 1DL7L 3LN9A 5ELIA 4FQ2L 5T3XE 4PJGE 3F7PC 4UUJB 4F33A 2PYEA 3BKCH 4EJ1C 4NQEE 1LNUB 4PJ9B 3UJIH 5TDOB 2F8OA 4XXDB 5HHVL 1W8NA 1JI2A 1AI1H 2D9QB 4C56A 4Z77A 1FG9C 4HFWA 4ZFZA 4WHTA 4XPBH 3QCVH 3VFMA 4TVPL 3SJVB 4TPRL 3QXWA 5F9DC 3R8QA 3JTSA 1UA6H 4XB7A 4F7EB 3FL7A 4PJDB 5GGSY 4DOHB 1EVTC 2BVOB 4KH2A 1W72B 4NO2B 4Y2DA 1KEML 1F4XH 4FQ1L 2VUOA 1CD0A 1IAIM 4JPWH 3WE6A 5KS9B 3S8WA 3QH3A 3FMGL 1MQ8A 5CZVL 4OZIE 4JGJA 1P9MA 5L7XL 5I18H 3VH8A 5IVNA 4IJ3C 1MJJB 1CQKA 3KPPB 2H2SC 2BNRB 3EJJX 5CLWA 4YUEL 5IR1B 2E8YA 3MJ9H 1JVKA 5GGUA 1S3KL 3CNKA 1RUKH 3WNLA 5B21A 5KN5A 4FTVD 2GJ6D 5FA3A 4N5ED 3SBWC 1LO0L 5EU6E 4X4YA 3RDTB 3IVKA 4I48A 1YEGH 3VDBA 1YPZB 1X44A 4PRNA 3QUXC 3TO4A 1XF4A 4EN3B 1AH1A 5D4QA 3J7HA 3O4OC 2F9BT 4H1LB 4PJAA 3MRQB 1FCCA 3LQZA 4DTGL 2AEQL 3MRHA 1MI5D 1XT5A 3MRFA 2BOBB 5D72H 3HE7A 4MXQC 4ONOA 5AUMA 3SGJC 2FO4B 1FNEA 1FN4B 2Q3ZA 5IMLB 2NYYC 3IETA 3EYOA 4ALAL 2V9QA 4HC1A 3DHJA 1HHGA 4YBHA 3MLRH 5FYJH 2EEDA 4G42A 4KVNL 5TGBA 1WEJL 2WWMC 4U1SA 5I8CB 3SCMB 3PWVB 1JN6A 1NL0L 1T2JA 1RUQH 3OKMA 5FDWA 4UT9H 4A6YH 4JCLA 4L9DA 5GGRA 1N26A 2F15A 4HK3J 4MCZA 1CD8A 3DROB 2QSQA 4JRWA 3CIQA 4JR9L 3WXWL 4NFCA 5DMKA 4HFUL 4Y19D 3HAEG 2QQKH 4FXGA 2IF7A 1AGEB 2M1KA 3C5SA 5CEYB 4MJ6B 3U0TB 5AAWA 4MA3A 5KG9A 4PV8A 2BSRA 1X6LA 3GIVB 2NY6B 3QWRA 4U1GC 1YDPA 1DQDL 4FMFA 2PTTA 3V7AE 5ILTH 1FNSH 3TP4A 1FFOA 4Z7UA 2Y6SC 3EZ8A 4IMLA 2EDYA 4ZSOE 2ZP0T 4QXTB 1T5WA 3BZ4B 4GQPH 3MV8D 3D39A 1G9EA 4JM2B 4I18B 4M7JL 3ARBD 1KOAA 1ED3B 3LQAL 4PRIE 4Z8FH 1H0DA 2BJMH 4DKFL 5T3ZH 1J0YA 1JPFA 3EO0B 5GRVK 5C09E 5FK9B 5CGTA 4N0UA 4EUPA 4MX7A 3SGDI 2VAJA 2F53B 4KJWD 4LCWE 3BT2H 3B2UD 4JFOB 4OCSH 5EUKB 2F74B 3MV7D 1IGFL 4Y5YA 1PY9A 4X5XB 3EDJA 4XI5C 5GGRY 1WK0A 3KPSD 4DFHA 1UH2A 4MDJA 2YEZB 4P2QA 1HHKA 1FZOB 3QXTA 2Z4QB 1T89C 2E7MA 3C87A 4IOIB 4OKVA 1UZ6F 4NRYB 4FFVC 1JZ7A 3QDMD 5TF1H 2VDKH 3WKMH 4LLVA 3BKCL 3UJIL 1OD7A 5HI5D 4CVZB 2AXFA 2Y06L 4XCFH 1AI1L 5JDJA 4UAOC 4H20H 4XPBL 3QCVL 3RVXD 4S1SH 4JY6B 1UA6L 1JRHI 4X4XB 4NQVA 3KJ4B 2DDQH 3MRGA 3RTQC 1T03H 1F4XL 3H3BC 4ZO8A 2A9NH 4JPWL 5D9SA 5E1AA 1D5XB 4GKSA 1GOFA 3MLWH 4ELKB 2VQ1A 4XNMA 3SDXF 5T3XD 4G6FB 1BQUA 5I18L 1IGTB 1QNZH 4NQED 1NBZA 3BP6A 8FABB 1MJ7H 3LPWA 2O61B 4GBXC 1JGEA 5EO0B 5GPRA 3IJSB 3MJ9L 5GS3A 3MV9A 1RUKL 1D6VH 2WINA 1DE4B 1QYGH 3EDEA 1X5IA 5E8NA 4Q7DA 5CSZB 1VEMA 5GZND 3QHZH 4GRWB 1YEGL 3WMSA 1U8KA 2KH2B 3RX5A 4M1DH 1OWWA 4TSBH 4Z7OE 1KTLB 5E5MB 5JIHA 4L8SC 1TPXC 4LCUA 4NT6A 3O3DA 3MRKA 3ULUH 5D72L 4HWBH 1HQ4B 3MCKB 2CO7B 1KIQA 4DUVA 3MJ8B 2AAVA 4FQJH 2EDRA 3HB3D 3MLRL 5FYJL 5EU6D 2LE9A 1AP2A 2V5RA 4LAQH 3D3VB 2X5PA 4GRLC 3QP3A 1RUQL 1XR9B 1WBYB 3TZVC 25C8H 1T5XB 4A6YL 4IS6A 1S78D 4D0DB 2OI9C 4HGWB 4QRQA 4RGNE 3NMEA 4HV8A 4JGMA 1HHJA 1S7WA 3PHQB 2OXHA 1IT9H 3TF7C 1HEZA 3I85A 4RDQG 3VXNA 4OF7A 5JOEA 4PJEA 1UKSA 2GAZA 3VJ6B 4GKZA 3IT8D 4FQQB 2QQKL 2VE6B 3O3BA 3UJJH 3LQMA 1UEYA 2QR0A 1MJUH 2B39A 3GUTB 4TVSa 4LBEA 4R4ND 4HH8A 3RZCB 5I1GH 5C07E 4HUUB 1F2XK 1IGJA 1NGXB 3EGSB 4EI6B 5ILTL 2FJHA 3H8NA 2BOCA 1HI6A 4FFWD 3BGMA 4G8GE 4UINH 1EXUA 2P5EA 2GY5A 2V6HA 5IROC 5DJCA 4JZNB 4HLJA 1C7SA 3V6FB 2MQCA 4APQD 2MKWA 4BH7A 2YC1A 4Z8FL 3V6OC 2DQFA 2R9HC 1FNAA 3PQYD 5C0GA 5T3ZL 1BEYH 2BSSB 4P4RB 2YSSB 1S9XB 2HJKB 3T0EE 3NABH 2BHUA 1T1ZB 4LCIH 3MA7B 1ROWA 3BT2L 4QHLB 3DOSA 5FB8B 3WDJA 4YDIH 5F7MC 4OCSL 4XVSH 2G2RB 2ADGB 2JELH 4F7MB 4L8CB 1S7VB 2XWBB 2C7UA 4O5LH 1A6WH 3HHRB 5ISZA 5MEQA 2EDLA 2BRQA 1NC2B 4JO1H 4WCYH 2D31A 4YHZH 5FA4A 3BZEA 1TTFA 5TH2B 3IDYB 5TF1L 2PYFA 2EYTA 2VDKL 3WKML 4PRID 4HKZA 3DO7A 1P53A 2VXSH 4F9PA 5IJVB 1JHKH 3CXHJ 4XCFL 5C09D 3SKOA 4AG4L 4H20L 5F1OB 1R3KA 1NC4D 1RD6A 1EUUA 4S1SL 1EA9C 5FO7B 2BC4B 4L4TE 3DTXA 5F7WC 2VLJA 1HXYA 3VXRA 2DDQL 5GS0D 2XN9E 3GFUA 5K33A 1T03L 4JJ5A 4LU5H 3IU4H 3KLDA 2A9NL 3G5XA 1M7XA 3QFDB 3P0YH 1V3LA 4W70A 1MWAB 4MNGB 1LNUA 3MLWL 5E6IB 4RFNB 4XXDA 4X5LA 1IM9D 2DJUA 3CUPB 4HQQH 1QNZL 1CDYA 1MJ7L 1DBAH 1GIGH 3SJVA 1A7QH 2DM7A 1FO0B 1UEMA 4F7EA 3CXDH 4PJDA 2NXZD 2BVOA 4ZNCD 5EBMB 1W72A 2FEDC 3OHXB 4NO2A 4WTZA 1D6VL 3ZO0A 1T83C 4RSVA 4X9HA 1QYGL 2VLME 1YYLH 2EKSB 2VZ1A 4G3YH 3QHZL 3QO1B 5D7LB 4RX4D 1T80A 1FC2D 5HGAB 4M1DL 3VXTA 1MJJA 3KPPA 4TSBL 3RY6A 2BNRA 2VLRE 5IR1A 3WDHA 5D2LF 1AO7B 4HCRA 1J1PH 5IVZB 3ULUL 1XGYH 3O8XC 4OZ4B 4HWBL 5KSBB 2CIIB 3ZT7A 2R2EB 1UACH 3O6FC 2BNQE 2N1KA 5HVGB 1YPZA 5AWNH 4OFYD 3ZDZF 5LKNA 4EN3A 4XMLH 3P4NB 5F6IB 1X9QA 4LAQL 3HE6D 4CMHB 4OUUB 4CAGA 25C8L 5I1KH 4RNRB 5IMMB 1C1EH 2BOBA 1J18A 1MRCH 1P4IH 1DANT 1MCCA 2FO4A 4TYUA 1NCDL 2ZUVA 4XHQA 4OD2A 5IMLA 1IT9L 3DX9B 1UJ3A 5IM7B 4LVNC 5DQDH 2VAAB 3S36H 3BPOC 5D7JA 3UJJL 2ATKB 5MP6H 5I1EH 5DO2D 1OP5H 1U8QB 5I8CA 3SCMA 1MJUL 3B5GA 3PWVA 4FZEH 2JKXA 2MMXA 2Q8AH 5JIPA 1F6FB 3DYMA 1A1OB 5I1GL 2HT3D 4J3OC 4RMWA 4EIZC 1WTLA 5DRXB 2OR8A 1KB5H 4OFDA 1WWWX 1YEIH 3AAZA 4UINL 5GRJH 3CDGB 4ZFOB 1MRFH 2C26A 4ZD3H 1AGEA 5CEYA 3LEXB 4MJ6A 3U0TA 4PG2C 1YN6B 3ILPB 4PJFE 4OM1H 3QQNA 4EUPG 3FZUC 2I60H 4MNQD 5J1AB 3GIVA 4N9GB 1T2XA 1BEYL 2X41A 5A16B 4PJXB 5I1CH 3NABL 1ZWIB 4LCIL 3DECA 5C07D 4NQDB 4LSQH 3QNZB 4YDIL 4XVSL 4HZLB 5AZEH 1I4FB 4R2GD 2JELL 4Y4HD 1E28B 3HPJB 4OAWB 3NFPB 2NXYD 4O5LL 4Y5XC 4YNYB 1TMCB 4G8GD 1A6WL 4HGMA 4UTAH 4I18A 1ED3A 3IFNH 1EHLH 4JO1L 4WCYL 1KLGB 4YHZL 5KSUB 3EO0A 1PJ9A 4EDWH 4KZEH 1WZ1H 1RJYB 5F89B 5FK9A 2WBJC 5T5NF 2K7QA 3DO3A 4NWTH 2F53A 2VXSL 1EFXD 1JHKL 5SWSE 2EE3A 1DQMH 1Q8MA 4JFOA 5EUKA 3X12B 5TQ2H 3T0ED 2YWYA 2F74A 4Z7WF 3DYPA 1NFDF 3SDDB 4Z7VA 4YHYB 2R8SH 4X5XA 3NZHH 5L0QC 3BD3A 4IRJC 1FZOA 2Z4QA 4IOIA 2X4NB 4CVXB 2YXFA 3EYSH 3MRDB 4NRYA 3IU4L 1U41A 2H32H 5IVXE 2AEPH 1MH5B 4GMSH 1EEZB 4CVZA 1T0PB 2QBWA 1EMTH 1Q1JH 4P2RE 4UOJA 1MHEB 4TTGA 2EICA 4NQXB 4HQQL 2Z9TA 1KCKA 2KBGA 1DBAL 1GIGL 3VMOA 1A7QL 2HKFH 1JNLH 4JY6A 3PDGA 2F19H 3CXDL 4P59H 4M6NH 4OJFH 1IAOB 3T77B 3CCHB 4L4TD 3S5LA 3KHOA 1PEZA 5M94B 1OTTC 4OCRH 3ULVF 2HN7A 2XN9D 1YYLL 2XZZA 1D5XA 3WLWD 3SDCD 1AD9B 3OKKB 4ELKA 1WIUA 1QVOB 2CLVB 2AXJA 4NQUA 4S2SB 4IOFD 1S8DB 2O61A 5EO0A 1NGWB 3IJSA 3R06B 1XFPA 5E4EC 1J1PL 1XGYL 3VGDA 3QEQE 4G9FE 1UACL 2MOVA 1DE4A 4W68A 3QA3B 5CSZA 4RISH 3OJMB 1X5XA 2GJJA 4LP5A 1JZ5A 1UZ8B 5AWNL 5I1JH 2EECA 1FL5A 2VLMD 4XMLL 4OCYH 3CDCA 5FHBH 5JNYB 4ZUTA 4YGVB 1KTLA 5E5MA 2YBRB 1WT5C 3UROR 2D4DA 2FRGP 5I1KL 1FNHA 3RWDB 4YFDB 1C1EL 2JB6B 3WDIA 1MRCL 1J0KA 2DQCH 3P30H 3IXAA 2VLRD 3MCKA 4NIKB 2YUZA 2NQCA 2QQNH 3MJ8A 3PHOB 1XF2B 3V5HB 3WL9B 5DQDL 1CBVH 3S36L 2YA0A 1JWMB 1ZLUK 4Y1AD 2BNQD 5MP6L 3D69B 5I1EL 4M61B 4URTB 3MJ7B 3C2SA 3U4AA 3D3VA 4FZEL 1WBZB 4QRRB 5LAXB 3KVQA 2M8XA 4LHUB 1XR9A 1FPTH 4NC1C 2Q8AL 1WBYA 2HFGH 1T5XA 3LEVH 4U0QB 1OWRM 1AGBB 1EH9A 4D0DA 4HGWA 2EXYC 5D5ME 1EPFA 1KB5L 4U0RC 1HHIB 5JOPE 2VZ3A 3DPBA 1YEIL 4Y2DC 5GRJL 1G0YR 4ZD3L 1JE6A 1MRFL 3L7FA 4FQQA 4GQ9H 3TYFB 5HJ3B 1A21A 2WSKA 3DETC 3P40A 5GZOC 2X4SB 2E6JA 4LL9A 2FHBA 4G6JH 4OM1L 3RWJB 2EE9A 2I60L 5CSGA 1CT8B 4RFEB 3RZCA 1P9MC 4HUUA 3U9UB 1NGXA 1G0DA 4LVOB 5F7DB 4EI6A 5I1CL 4GJTB 4PG9B 5IB2B 2VDMH 5MI0C 1BJ8A 5DC4B 3E2HB 3TJEH 4LSQL 1EIBA 1IE5A 5AZEL 3MR9B 5J13C 3QEUB 2Q86B 4JZNA 1U92B 4UTAL 3V6FA 5F8RC 4N5UA 5EB9A 3IFNL 3IJYB 4U7SA 1H3TA 5B39B 1EHLL 3TO4C 4Y16D 2J8UF 1EO5A 3LS4H 4P4RA 4EDWL 4KZEL 2WMPA 3O6KH 1MCLA 1WZ1L 3IJHB 1S9XA 3D85A 2HJKA 4NWTL 1T1ZA 3TNNB 3MA7A 2ZPKH 5FB8A 1KCLA 1DQML 3BHBA 4CL7A 1KNOB 3HE7C 5EZJA 5TQ2L 1DJSA 3T2QA 4F7MA 3H9HA 3H9YA 4ODUB 2WBWB 2R8SL 2XWBA 2GSIB 3VMNA 1FVCA 5T1KD 2ZUXA 1QFWM 4NQCA 3F6IA 3STZB 1NC2A 3EYSL 2R23B 4X0KB 3MNVB 4KGLA 5F9WB 2AEPL 4PP1C 4GMSL 4TNVF 2CDFB 3ARSA 4ENED 3WN5B 1EMTL 1Q1JL 5IJVA 1DFBH 2R2BA 4PRDB 4OBSA 5D7IB 2F54A 2F5BH 2OYPA 4WTZG 2EKJA 4MAUH 1PQZB 1ZS8B 5SWSD 3ZE0E 2HKFL 5FO7A 5DSCB 1JNLL 2BC4A 1CD9B 1QFPA 2F19L 4P59L 4M6NL 43C9B 4FTVB 4OJFL 3CFKB 2GJ6B 3LKOB 3GZKA 4JQXA 1CLZH 3EFDH 3DNKA 2W59A 5BW7A 3TBWB 3QFDA 4OCRL 2KL6A 3TWCH 1MWAA 4MNGA 1Q9WB 1V7MH 3O11B 5E6IA 3SGEI 2APFA 5JW4R 1Z0NA 1DUZB 1XAUA 3K74B 1WWAX 4NWUH 4KK9C 1WICA 5MEPA 3CUPA 4OZHF 4WV1A 4TTDC 1U93B 4BFEA 5ABDE 2GI7A 4KK8C 4P2RD 2DLFH 1MI5B 1YY8A 1FO0A 1HXMB 3TN0D 4JAMB 5LGJB 3QUXD 4NN7B 5EBMA 5F9AC 1Y0LA 1TVHB 4Z7WB 3WS3A 5SWZE 2CUHA 4YLQT 3T0AA 2EKSA 2Z92B 4RISL 2P5WE 5IFAH 4Z0BH 5D7LA 5IGXH 3DX7B 3L5HA 3RHWF 5I1JL 4P9HC 5HGAA 4OCYL 5FHBL 2IFGA 3NIDE 4BSVA 5L2JB 1AGFA 3N1GC 5DD5H 3E6HA 4LDOB 3VRJB 2FBJH 4WFEE 3KLAB 1AO7A 4OLVH 4XNZC 2N7BA 4JFXA 4FN0A 4JZOB 5H2BB 2DQCL 4OZ4A 3P30L 1BM3H 4ISVB 4Y5YC 5ESVB 1BJ1J 2IG2H 2R2EA 5IV2A 4XPAH 5GS2H 5DRWB 2QQNL 4NUGH 5CSBA 4TSAH 3MMEB 4Y19B 5ANMB 3QEQD 4G9FD 4LLQB 1YNKH 1CBVL 3WJLA 3P4NA 1ZEAH 4U1IB 4CGTA 3VE0A 4DCQB 1IZKA 1FPTL 3SKNB 3GSUB 4GW5B 2E9BA 2HFGL 1UVQB 4RNRA 1IMHC 3LEVL 3V6OE 3SPVB 5DJ0B 3LN4B 1U8OB 2DLEA 3IYLW 5T1LA 3T1FA 5K9QI 4X6DF 2D0GA 2XWJA 4NRZA 5IM7A 5HGHB 4RAUB 2I25N 3BYYA 2VAAA 4CBPA 1OQXA 1ZOXA 4GQ9L 5KBNC 2ATKA 2Q8BH 1BMGA 5D7KD 3VFUB 1E4JA 1U8QA 2LU4A 2Y6SD 3ARBB 4G6JL 1CGVA 2QV2A 3L3JA 1F4YH 5BS0E 5IB5B 1AGDB 4PJ5D 1A1OA 4WW2B 1BIIA 2B5IB 3JV4B 2YUVA 1BECA 1HH9B 3DUSA 2VDML 1YMMA 4W6XB 5C0CE 3TJEL 2P7TB 2BFVH 3MV7B 4RMRA 4QXGH 4Y8DC 3S97C 3CDGA 3QDGE 3KPSB 4M7KH 1KJVB 4M00A 4PY8J 3LEXA 2IPKA 1YN6A 2QADC 1HNFA 3ILPA 5JOPD 3HNTH 1WFNA 1MVFA 2A1WH 4ZTPH 4HXBH 3QDMB 4N9GA 1ZT1A 3LS4L 1KTKE 2VITB 4DKAA 4PJXA 3M07A 1ITCA 1RK1A 3O6KL 5TDNB 1QHOA 2Y7QB 3L3HB 4XI5D 4LLDA 3QIUD 1Q94B 1ZWIA 4NQDA 3QNZA 5DI8A 4H5SB 5CD3B 4LMQE 4HZLA 1I4FA 5LGKA 2KZWA 1E28A 3HPJA 3OJVC 4OAWA 3NFPA 1ZGLP 3VGAB 4RMQA 2FBOJ 3SE3A 4E0RA 1IGMH 1J0HA 1KLGA 5KSUA 2X40A 3DRTB 4G43B 1PYWB 1RJYA 1NGPH 3CSYA 2VZSA 3HLAA 4PJGB 4K7PH 3HS0B 5BOPA 1DFBL 4NQEB 3C08H 3QIWD 1CCZA 2F5BL 2P1YA 1JNJA 3SDDA 4MAUL 3S5LG 4ZQKA 3I2CH 3HG1E 2QHRH 3AS3A 5AEAA 4L5FH 3EOBA 2X4NA 4ZPTB 4CVXA 1CLZL 3MRDA 3EFDL 1P84K 4XGZB 4GBXD 3TWCL 1EAPB 1LO3H 1Z9OA 1V7ML 1MH5A 1EEZA 4RFOH 4LCCB 1MHEA 4NWUL 4KFZC 4NO0D 4O51A 3GGWB 3CZJA 4PUBH 5EIQA 3G5ZB 5FYJD 4Q9CA 3BWAB 1IAMA 3GIZH 3VXME 2QQLH 3VFRA 5DDHB 5GRYA 3MPCA 5EFIB 3T77A 4NOBA 3CCHA 1Q9LA 3DXAD 4J3XA 5D1QA 1EGJH 1FYTE 1O7VA 1NBVH 1CVSC 2Z8SA 5IFAL 5GHWH 4Z0BL 1AD9A 3OKKA 5IGXL 5EU6B 4HWZB 1QVOA 2CLVA 3KPOB 2DTMH 1JUFB 1S8DA 2H8PB 2OL3B 5DD5L 1CGYA 5I1LB 3R0NA 3WD5H 2J2ZA 1NGWA 1YNTB 3R06A 4PLOB 3CFBB 3TT3H 5I76B 4LGRB 4OLVL 3RWEB 3DX8B 3HUJE 4DN4H 4BH8B 1IAKB 1BM3L 3MNZB 2IG2L 4NQTA 3NCMA 4XPAL 2A73B 4NUGL 5F93C 3QA3A 4TSAL 5D2NA 3AMLA 4X9FA 3TZVD 1UZ8A 1YNKL 2OTUA 3RWCB 3T08A 2XKNB 4PP2B 4DVRH 1ZEAL 5JNYA 3I6GB 3SDAA 4YGVA 4M4PA 3IS1X 3RVTD 4F9PC 4XPTH 3PJSB 4DJMA 3C2AH 5EU3B 3RWDA 2WM0A 2A2QT 2JB6A 4OZHB 4WI4A 3OGCB 4AIOA 3SE4A 4OZGE 3CC5B 4BJLA 3PHOA 4ELMF 1XF2A 3KYKH 3V5HA 4KMTH 5JDSB 3G08B 2V5YA 5EUOE 1VPOH 3D69A 2Q8BL 4APQB 5HY9B 4M61A 3W11C 3MJ7A 3V6ZB 1IL1B 3PQYB 5LAXA 4LHUA 4MAYD 4YIQB 1F4YL 2YD5A 5F9JB 1DQQB 4OCNC 2VNCA 5I75B 3SKMB 3CDYA 4NRXB 2HLAA 3K8MA 3GMQB 4R97C 3UX9B 3V52H 5D70H 3HZVB 1A6TB 4PGEB 1HHIA 3UTQB 2BFVL 4ETYA 4YDLB 4QXGL 4ZSOB 3TGXA 4OD1H 1X5LA 3QYCA 4L8DB 4LLUB 1C16B 2CKBB 4UOW1 4M7KL 5HJ3A 5GGVY 2X4SA 4QTHB 1EERB 5SWQB 4P3CH 1VFUA 3HNTL 2A1WL 3PWNB 5D8JH 5HTSA 3RWJA 5F70A 4ZTPL 4HXBL 2HMIC 1HK6A 1CT8A 4RFEA 3MXWH 4PRIB 3U9UA 1P7QD 3ARYA 4PJCE 2D7NA 5F7DA 3BEWB 1GZPB 4PG9A 5IB2A 1JZ3A 3RY6C 5BS0D 3JV0A 5GJTH 5C09B 3H6JA 4PY7B 4IRSD 2D3VA 4QGYA 1NC4B 4YPGB 4BZ2H 3GSVB 3LPGA 3D0VB 3MR9A 2UUDK 3WHE1 5C0CD 4V2CB 1CZ8H 1EFQA 3QEUA 3GSXB 4WUUA 4BQ8A 2DL9A 5E9DA 4CJ0A 1U92A 3RDTC 1YUHB 1X5GA 4UU9B 1ZGLM 1IGML 2WUCH 1B2WH 3IJYA 5B39A 4EN3C 1I8MB 1BJMA 1QQDB 4PJ7E 2EIZB 1I8IA 1LO5B 2NY0B 1NGPL 4FZ8H 3TNNA 2CGRH 1IM9B 4K7PL 4OQTA 1BVLB 1WIPA 2OP4H 3C08L 1KNOA 1AXTH 4CU7A 3X17A 2NY1D 1NKRA 3V0WH 3I2CL 4ODUA 5B38B 2NXZB 2Q76B 3QWQB 1URLA 1UJ3C 2GSIA 2FECL 2QHRL 4U1JA 5E2TH 4OGXH 4L5FL 3UPRA 5HVFB 1FQ9C 5D7JC 4JG0H 4XCEB 4HBQA 4G8EB 2LAAA 3SO3B 2R23A 2EIBA 4XAWH 3WCYA 3SCMC 3MNVA 1LO3L 1OAYH 4HUWA 2H9GB 4J3VA 2YD6A 5EA0H 2CDFA 4RFOL 3WN5A 4PRDA 1G9NC 4E41A 4PUBL 3VG9C 4GUPB 1ZS8A 5EC1B 5DSCA 3GIZL 4LSRH 2QQLL 3Q6GH 2EO9A 1JZ4A 2VN7A 1LE9B 43C9A 1PKOA 3LKOA 4WNQB 3HG1D 5HYFA 1JWSB 1BBDH 2R0KH 3NH7H 1GH7A 1EGJL 1Q9WA 1U8LA 5GHWL 4F7PB 1B6DA 1XGUB 4KKNA 1DUZA 1EEYA 1B3JA 3ESVF 3O8XD 1X5YA 3HE6B 2DTML 3WLBB 3S36X 2E7LA 1G7JB 1U93A 1ZHNB 1D5ZB 4M03A 4QF1B 3WD5L 1MI5A 2PYEE 1HXMA 4PGZA 3TT3L 4TUKH 2VDQH 2D2OA 5DEGB 1VEOA 4JKKA 4DN4L 1TVHA 3VXMD 1FORH 4C56E 2ICWB 4Z7WA 4TNWF 3FB8B 3BI9X 4M8VA 1A4KB 4I18C 3GI8H 5FO8A 2Z92A 2BDNH 3ROOB 3RPIA 3T3MF 3V95A 4X98B 4DVRL 3TLRA 1A7PH 1YEEH 4HIEA 4U7MA 4GXUN 2ESVB 3O2DA 3ALPA 1PLGH 3FJTA 4XPTL 1JYWA 3VRJA 3VGHA 2W0FB 3C2AL 3P9MB 4JZOA 4ISVA 1A02N 2PTVA 4Z7QE 3RGHA 1UH3A 3MMEA 3KYKL 4KMTL 4UQ2B 3FRUB 4YXLH 2NZIA 1VPOL 3JBG7 5FGCE 3MO1B 4NJAH 4U1IA 2FJFB 4MNQB 4OF5A 1A64A 4FRWA 4IEFB 4BK4A 3GSUA 5IB4B 1UVQA 3Q5OA 1G7HA 1OARH 3SPVA 5DJ0A 1X4ZA 3LN4A 1G6RB 5C07B 2RR3A 5KANI 4FMKA 3V52L 5D70L 4PJAE 1NPUA 3KJ4C 4R2GB 3S3PA 2YUXA 4GKNB 4RAUA 4Y4HB 3D87B 4OD1L 2NXYB 4G8GB 4YHIB 2X1WL 3VFUA 1HINH 3RX7A 3ARBA 1KB9K 3LDBC 4P3CL 4RCAA 5D8JL 1BD2A 4HKJB 4OV5A 5IB5A 4ZFGH 1TQCB 1AGDA 2EDDA 1MEXL 2APBA 3MXWL 3JV4A 2DIAA 1HH9A 1EFXB 1F90H 5GJTL 3S3SA 2GQHA 3UO1H 3T0EB 1ERNA 4BZ2L 3P4OB 4GO6B 3KPSA 1CZ8L 4JVPA 1KJVA 3RIAF 2EC9T 2WBJD 3VXUB 3U46B 4OIAA 2OR7A 3V8OA 4NC2B 3BISA 3QDMA 2WUCL 4MXWH 1B2WL 5DHVH 3ZYZA 1I1FA 2EDJA 3MBEB 1I75A 4H25B 2VITA 2UWEF 5TDNA 4ZO7A 5EC2B 3JWDC 4FZ8L 1Q94A 3V8CA 3AXLB 3EDKA 4GS7B 5LWYH 2CGRL 4IRJD 2OP4L 2JJTA 4MB3A 3KLHC 1AXTL 5CD3A 4WVRA 5FUOH 1BQLH 1QOKA 2JCCB 4XNQA 2O93L 3B43A 3QQ9D 1XH3B 3NTCH 3V0WL 5BQ7B 4Q9BA 4KKAC 2KDGA 4TUOB 5E2TL 4Z7UE 4OGXL 2C1OB 4L4TB 3N0PB 4JG0L 4KHTH 2XN9B 1ZVYA 4XAWL 3GHEH 1PYWA 3SDCB 2IH3A 1OAYL 5EA0L 5CLTA 4PJGA 1INEH 3HS0A 4P46D 5HYQB 4XAKE 1KACB 1XGRA 4I2XB 2HJFB 1OTTD 1A2YB 3MRMB 3O2VH 4LSRL 2DQTH 3Q6GL 2Z91A 1CXIA 1MCEA 1LGVA 4ZPTA 2FECI 1BBDL 5CEXB 2R0KL 4PGJA 1EAPA 1KFAH 4LARH 3NH7L 1AE6H 4ODXA 2RB8A 3RZCC 1VESA 4P2QE 1CGTA 3HR6A 2J8UA 3DSFH 3SKUD 2GTZB 1PKQE 4OIBA 3OX8B 3G5ZA 1X5JA 3BWAA 1WFOA 2QLVB 4RQQB 1TITA 5DDHA 4TNVK 1VADA 2MHAB 5EFIA 4TUKL 1K8IA 2VDQL 2VLRB 1FORL 3OKNB 5C0DA 1A3QA 3L3OB 1S7RB 3IDIB 3GI8L 2BDNL 4MDIB 4Y1AB 2BNQB 2IBGA 4S0TD 4HWZA 5EU6A 5EULV 5CZXD 1W8OA 1UG9A 4OGYH 1B0GB 1MSPA 3KPOA 1TZHB 1WLHA 5KAQG 1JUFA 3PNWB 1A7PL 1YEEL 2H8PA 2OL3A 5I1LA 1UXSB 1PLGL 1U2HA 4K8RC 3CFBA 2B1AH 4WTWA 5D6DA 3RWEA 3DX8A 3G5VB 2NY5C 2NY2C 1IAKA 1YJDC 3MNZA 2A73A 5EOCH 3FFDB 2XACC 4LNRB 1VFAA 4LHUG 4MA1C 1NUNB 4YXLL 3RWCA 3IDXH 4ZUWB 2M26A 2EXYD 2XKNA 3MV9E 3IDYC 4NJAL 3FB6A 4PJBE 4ZS6D 2XTJC 4LVEA 2HG5B 3AM8A 3KJ6H 3X13B 2H45A 2W9LA 5EU3A 3RHWK 1OARL 3I50H 4OZHA 5GZOD 3DETD 5K9OB 3OGCA 5JO5A 1UYWH 3LEYH 3MXVH 1CS6A 3S4SB 4DAGH 3CC5A 2NZ9C 4JKLA 1ZT7B 1KYOJ 2CIKB 1HYSC 5JDSA 4JQXC 3NA9H 5BW7C 4APQA 5HY9A 1HINL 3DVNA 1NFIB 2C3WA 3V6ZA 1IL1A 3VW3H 3PQYA 5E6IC 3BYTA 4Y16B 4YIQA 4PJFB 4RFNC 1A6VH 3CVHB 4ZFGL 3MTRA 1DQQA 4WV1C 3RL2B 3MCLH 3SKMA 2AQ3A 4NRXA 1F90L 2NTFB 3GMQA 1RZ7H 1F13A 4YH6A 1WCBB 3HZVA 3UO1L 2FGZA 4PGEA 5FOBB 3UTQA 3ZTJG 1F3RB 3T65B 4BQ9A 1WIOA 4L8DA 1T1XB 4LLUA 3SQOH 1C16A 2CKBA 2VLLB 5T1KB 5JW3H 4OLWH 2GIYA 4QTHA 1BREA 4BQBA 3ARZA 3PWNA 1CDBA 3DSNA 3TCLB 4MXWL 4NBYB 1JHTB 2IEPA 2DWDB 3ZKNC 2NNAB 3PUCA 3BPLB 3BEWA 3W2DH 3L6FB 4PLJD 5LWYL 1S5HB 3ZDXE 5F3HB 4PY7A 1VACA 3WIFB 1NC4A 4YPGA 1KCVH 3U4EB 5M7QA 3GSVA 5SWSB 3D0VA 2HTKC 5FUOL 1BQLL 1ZGLA 1F58H 3GSXA 1S5IH 3NTCL 3KG5A 4PP1D 1L7TH 1OGTA 3NA4A 1YUHA 4UU9A 5F6HI 4KUCF 3BP5A 3WJLC 4KHTL 1I8MA 5F6IC 2P5EE 1JBJA 1QQDA 3GHEL 3WNMA 1BVZA 3ROLA 4CMHC 1LO5A 1WUNT 2CRYA 3P9LA 1INEL 1BVLA 1M6OA 1RHHB 1XGQB 3AU1A 3WFDH 4N0RA 1LILA 3TN0B 3DUUB 3K8LA 4HX1A 2Z8RA 2BZDA 2ZG1A 2Z8WC 1UT9A 5B38A 3KXFD 3O2VL 3K8KA 2DQTL 3ZZ1A 3FONB 2IGFH 4U1KB 1UFUA 3V4PH 1X4XA 4XCEA 5E24E 4TTDD 3KPQB 3MROB 1X5ZA 1QRKA 2EYSB 5FFLA 1KFAL 4LARL 5J8OA 1AE6L 5I73B 2H9GA 1CTNA 3CDFA 3UTZB 4W81A 4PBWD 1CGSH 5T5NG 3QBTB 4HKBB 3B9EA 3DSFL 4JFQB 2G9HB 5AD0B 2JIXD 4GUPA 2MQ0A 5EC1A 1E0OB 5HSFA 4XAKD 4AZ8A 2FX7H 2Y23A 3RGVD 3NCJH 4WNQA 3VA2C 4XVTH 1LHZA 4LIQE 3REWA 3C6SB 3T4YB 4PJIF 2OLDA 5JUEH 1XF3A 3QEQB 4G9FB 4OFYA 3QUZA 1PGRB 5JQHC 1N0LA 4LP4A 1XGUA 4KRLB 4OGYL 5FYKE 5J56B 3HE6A 3WLBA 4GAFB 1TZIB 43CAA 2X10A 3WUWB 1G7JA 3RBSA 1IEAB 1ZHNA 1D5ZA 4QF1A 4P2QD 5MERB 2B1AL 4QHNB 3V2AR 5DEGA 3OXRB 2YN3A 2DMKA 3FB8A 3JV6B 3DGGA 1MCBA 5EOCL 1A4KA 3GMNB 3SE3C 5DLMH 4PJDE 4DOHE 5IK3B 1KTDB 4YJZL 3ROOA 3IDXL 1YEFH 5BJTB 4NZUH 2A74B 1JZ6A 1OQOA 1BQSA 4QRPD 3OAYK 2ESVA 3K4ZA 4HS8H 4PJ5B 2AJYH 3KJ6L 4O4YH 3VRLE 5B3NA 2B4CH 2W0FA 3F12B 3TO2B 4R7DB 3I50L 3HMXA 3M45A 2P45B 3P9MA 3SDDC 1LEIA 4YHYC 1UYWL 2MPAH 3LEYL 3MXVL 4NKMB 2EZ0C 3BMVA 4DAGL 1LQSR 4LLWB 3BGFB 5D5MB 2G60H 3GMOA 4HJ0C 2HH0H 1Q9KB 3FRUA 3DUHA 3ULUF 3RWGB 4NN6B 3NA9L 1U0QA 3MO1A 4GSDH 2GYSA 2X70B 4P3DB 3V6BR 2FJFA 4MNQA 2BXYA 3VW3L 1AXIB 1EDQA 1A6VL 5IW1A 5IB4A 3RKDC 1TVDA 3SE8H 3SGKA 3QIUB 1NAMH 3MCLL 5HPMB 1G6RA 2P8LB 2QADD 4KDWA 4KC3B 1RZ7L 3CXHK 2UUDH 2P8MB 1B0RB 1LP9E 4GKNA 4K7PX 4Y4HA 3QULB 1GPOH 3SQOL 4YHIA 5JW3L 4OLWL 2W1NA 3ESUF 5D1QC 4UAOB 4HT1H 5B8CB 2HFEB 3QCUH 1RVFH 3FO0H 4HKJA 5DFTA 2VXQH 4EZMA 5HYSG 3S96B 1GGBH 3W2DL 4MSWB 1OL0A 1EBPA 3QIWB 1IC4H 3MUHL 4WW1B 5DJ8B 1KCVL 2W92A 4NKIH 4G6AC 1F58L 3R0MA 1S5IL 1D9KD 4N8PA 1L7TL 3VXUA 3VD4A 4JB9H 3CMOH 1XGPB 1U2CA 5D2NC 5TDPB 3U46A 3VFGH 4C54A 5JPNB 1X6NA 5HPOA 1LK3H 1JMXA 4GBXB 4G8FA 3MBEA 3FOMB 2GFBB 4H25A 3SDAC 1IGYB 5HD8D 3LKPB 2GT9B 2J1KA 1LO4H 3BPCB 4KRMB 3AXLA 4NO0B 5DZLA 1TTGA 4KDTA 2VXVH 4W6YB 3WFDL 4J3TA 2JCCA 2KZ1B 2CDEB 3CU1A 3SE4C 2EDNA 5BQ7A 3DMMD 4BKLB 2BP3A 2AJVH 4PIRF 2PCPB 2IGFL 2C1OA 1CDUA 4A6YB 3D9AL 3V4PL 3DXAB 3QRGH 1RURH 2YHGA 5IP4A 2C1PA 1YA5A 2DB8A 3TJHD 2C3GA 1CGSL 4KY1H 2VWEC 2E9IA 3FTGB 3FQRA 4G5ZH 4I2XA 2XZAH 2HJFA 1IKNA 1A2YA 1F3DH 2A6IA 1L9NA 4LFHG 3PDDA 3MC0A 3AC0A 3M17A 3VXOB 5LQBH 2FX7L 1QHPA 4K7FB 2YPVH 4XVTL 1X5KA 3EHBC 3DV4B 5CEXA 3W5MA 3TZVB 4Z7VE 5JUEL 4JFED 1HILB 3NFSH 4PRAA 5CINH 1TIUA 4HS6A 3OBAA 3MOQA 3ULVH 4U1NB 5T33H 4LVOC 2GTZA 3BZFA 5DGQA 3OX8A 5E00B 4NBZB 1RZFH 3E2HC 4RQQA 5ICYB 2MHAA 3MNWB 5JXED 5EOQH 2DQDH 2P8PB 2V2XB 2AKRB 2W91A 3OKNA 1FL6A 1S7RA 4Q9QH 5C0BA 3IDIA 3OR6B 5ESQA 4HC1L 4D8PA 1ZHKB 5IHBA 4MDIA 4Y1AA 2BNQA 5DLML 3C09B 1YEFL 1B0GA 1TZHA 3L3KA 4NZUL 4P9MH 3BPNB 3PNWA 4MAYB 3BKMH 4HS8L 5FYKD 1UXSA 2V5MA 2AJYL 4O4YL 3U4BH 3EOTH 2B4CL 3K4DA 1KC5H 3G5VA 5HHME 3SDYH 2MPAL 4LLAA 4YAQB 3H3KA 1MLCB 2G5BB 5JA8B 3FFDA 5B3JF 2G60L 4V1DD 3QEHB 2HH0L 4Z7NF 1UC6A 2VO5A 3MRPA 5F44A 4ZUWA 4O9HH 2YD7A 3ZLQC 3Q3GB 1Z2KA 4OB5H 5F9WC 3LKRB 4HEME 4TNWK 4LSTH 5F6HJ 3HZMB 2HG5A 3WN5C 3NIFF 1MCKA 1P7QB 3X13A 1PDKA 2EDXA 1H3WM 3SE8L 5BS0B 1NAML 5K9OA 3IDNB 3P73B 4IRSB 4MGXA 3AFLA 3S4SA 4FP8H 4MA8H 4P57B 2HMID 1ZT7A 2CIKA 1NAKH 4N5EC 4LOUD 1GPOL 5GGTH 1NFIA 4U7KA 1QG3A 4HT1L 3QCUL 1RVFL 3FO0L 4Y16A 5DEFB 2R0ZH 4IRZH 4PJFA 3KGRA 5AG8A 5E2VH 2VXQL 3RI5K 1A1MA 1RSFA 4LEXH 3RL2A 3F7QA 1J8HA 3ZKMD 2E7LC 1GGBL 4XP5H 1KCRH 3B5HA 4MLSA 2NTFA 3BMWA 1IC4L 1WCBA 3VFSB 4NN7C 5FOBA 4XVUD 5DUMH 1CE1H 2AJXH 2OR9H 3P0GB 4FFZH 4CMMA 2NY1B 3T65A 4NKIL 1T1XA 2PR4H 3VXPB 4ZUVB 1H3GA 5T1KA 3BWUC 4JB9L 3CMOL 3VFGL 3NZ8B 4HIHB 1JK8A 3PGFH 3CX5J 1LK3L 1JHTA 3MREB 4JDTH 5FDYA 2NNAA 2ICES 1I1AA 5ESAA 3ZE2E 3L6FA 3FO9A 4OZFH 1LO4L 3EYFA 4JN2B 1S5HA 3BAEH 4M48H 1RFDH 5FV2A 5F3HA 5B38G 1GC1H 5D7JD 2VXVL 3C5JB 3U4EA 4HJJH 5SWSA 4BFBD 3F8UB 3HAEB 4I1NB 3O0RH 5ICZB 4KJYB 3VXSD 2AJVL 4G80B 1I7ZB 3G9VA 3HG1B 6FABH 3B8YA 3QRGL 1RURL 1ND0A 1SMOA 4NKOB 1RJCA 3TA3D 1R3LB 2CRIA 3MLPA 5EBWA 3RIAK 4EI5D 3O8XB 1JIBA 3C8KB 1N2RB 4KY1L 1U8NA 2YZ8A 1RHHA 3U83A 2AI0H 4G5ZL 4R4BA 2XZAL 3TN0A 5DUBB 1JI1A 3RBGA 1KULA 5LG1A 5FYLE 1MOEA 2VDRH 3FONA 5LQBL 5C71A 4YEFA 2ARWA 4QHMA 2YPVL 3JTTB 3KPQA 3L3IB 3MROA 4I77H 1V05A 4NGHH 3ARBC 2QKIB 2EYSA 4AIZB 1HOCB 3NFSL 5CINL 1Y18B 1NGQH 5T1DH 3ULVL 3RIFF 2B5IC 5T5FH 4NQCE 4JFQA 5T33L 4KJWC 2G9HA 2UWEA 1XF5B 2DIJA 1RZFL 5DMYA 1B9ZA 3OV6A 2XTJE 1QEWA 4HLZG 3LHPH 5EOQL 4ZPVB 1U8IB 1MCQA 2DQDL 1G9MC 2N7AA 3C6SA 2F54E 3M8OH 4CADB 3QUYB 1CQYA 2PO6B 4Q9QL 2IQAB 3QEQA 4G9FA 2R56H 2C3HA 4JVUA 2V7HB 2X05A 4H1LH 1MCHA 2CKNA 5C9KA 1TZIA 4P9ML 4XB8A 4PV9B 2RAMA 2CMRH 3BKML 2OXGA 1X7QB 5F7UA 3T0BA 4MNGE 5MERA 3U4BL 3EOTL 2JJTC 3RVXC 1KC5L 5DQ9B 3EYQC 3KLSA 5CIPB 2VDNH 1FGVH 3FQWB 3OXRA 3SDYL 1H8NA 3JV6A 5DK0A 3P4MB 3VGAC 3MUY1 3GMNA 5CJBA 5E0QA 4H0IA 2XOTA 4DVBB 5IK3A 2C4FU 2VTFA 4O9HL 4CKVX 2A74A 1ZHLB 1ONQB 4OB5L 4LSTL 1U8MB 4PJ5A 3QCTH 4WFFE 5GIRB 3ISWA 4JFHE 1R0AH 4X6EA 5DD6B 4NNYA 3DI3B 1HKFA 3F12A 3PWUB 3TO2A 3DWTA 5D7LE 4CRPA 4MQSB 1UZ6E 2A9MH 3WJJA 3MRIB 4MQXD 4NKMA 7FABH 5FXCH 3EAKA 4LLWA 4F15B 2I5YH 4FP8L 4MA8L 2OK0H 5D5MA 1D7FA 3K1KC 1Q9KA 1NAKL 1OTSD 5HHMD 3WO4B 3RWGA 3MJ6A 2WBJB 3VFVB 1AO7E 3NIGE 3PHSA 2X70A 4P3DA 3FN9A 5GGTL 5ETUB 1U6AH 3LKSB 2R0ZL 4IRZL 1RZGB 4M7LH 5E2VL 3PV6B 4LQFH 3VDAA 2J3SA 4LEXL 3TVMD 3QIUA 1N6VA 5HPMA 4XP5L 4TOYH 1KCRL 4IRJB 3U2SB 3I02B 4PJCB 2P8MA 4DFIA 1B0RA 3QXDB 4XCCH 5F71A 1CE1L 2AJXL 2OR9L 4FFZL 1MCNA 5HHXL 3QULA 4I5BA 4KVCH 5IBUG 3QUKB 2NR6D 3OKLB 4JCMA 2PR4L 3GBMH 3QDJB 3BIKA 3EFFA 3VI4F 2D03H 3HB3C 4WI7A 5B8CA 5EIIB 2HFEA 1CFQB 3MJ9A 3PGFL 1JYNA 3KLHD 3UZVB 2PW2B 4JKPH 4JDTL 1IBGH 1MAJA 3S96A 1HZHH 3QQ4B 5HDBF 2RCSH 2E8ZA 1MIEH 4MSWA 1JPGB 4P46B 3QIWA 3I6KB 3F5WB 4PJ7B 3BAEL 4M48L 5LXGH 1RFDL 1S78C 4WW1A 5DJ8A 1GC1L 5E7BA 1U36A 5D6DC 4HJJL 1CL7H 2MJWA 1BX2A 3QXVA 3FAXA 4ZUUB 3O0RL 4JRXA 1XGPA 1KT2B 2YD2A 1YMME 5JPNA 3E0GA 5H94B 6FABL 1CD1B 2F8VA 5EPMB 5GSRB 1JP5A 3FOMA 2GFBA 2YXMA 4ONGH 4R4NC 1OAKH 3LKPA 2GT9A 2Y4SA 4GFTB 3AM8C 4NO0A 4N0FA 3UP1A 2BY0A 2AI0L 1O7SA 2GITB 5I8OH 4K3JH 3U6RB 1JHLH 3ILQC 2CDEA 4FFWC 3HZYB 4PB9H 5GXBB 4BKLA 4XVJH 3BP7B 3DJ9A 3OXSA 2VDRL 2PCPA 1N5YH 3K2UH 4A6YA 2Z35B 5FGRA 3DXAA 3SY0B 4APQC 4I77L 1FG2B 4NGHL 3G6AB 1BOGB 3HR5B 1KB5B 2LFGA 1NGQL 5T1DL 3GJEB 1W0YT 5EOCJ 2RBLA 3FTGA 3WNOA 2QSCH 4ODVL 3UBXI 4MHHI 4B53A 5T5FL 5I75C 1SBSH 2W9DH 1X5AA 2B7DT 2LV4A 4F2MB 1CXKA 4WWKD 2DYPD 3L3GB 1KPVB 3MLZH 3LHPL 4K7FA 3D85D 3DV4A 3M8OL 5FYLD 3W9DA 3NCYS 1ACZA 4GRWH 1HILA 4HFWB 4ZFZB 5BV7C 3LH2H 1SQ2N 2R56L 4KJQD 1NDMA 4U1NA 4XMPH 2IANE 2NY2D 5FUZH 3E3QC 3JWDH 2CMRL 1FDLH 3O45B 5DD0H 5E00A 3VGEA 3S34H 5ICYA 4NQCD 2BK8A 1NKOA 4L3EE 3MNWA 1Z6JT 4JFZH 3QH3B 2P8PA 2VDNL 1FGVL 2IBBA 2XTJD 3Q5TA 5EG6C 2WAHA 3OR6A 1ZHKA 4POYA 2F54D 3TCXA 2WZPD 1P5UA 4MAYA 3O41B 5GGUB 2NY0C 1BZ9A 1N59B 5FGCB 1SMAA 3QCTL 4YHOH 3DARA 1FFNB 2Q7NA 1HYSD 1YY9D 5FA3B 4PGCB 4MQ7B 3EOAB 7CGTA 1BBJB 3IVKB 5DJYB 2FL5B 2NXZC 4LGPB 1NBQA 7FABL 2DAVA 1MLCA 1XF4B 3PWPD 2I5YL 2EE2A 2G5BA 2OK0L 4GW4B 1PVHA 4OI8A 1IC1A 3B9DA 3SO3C 4RZCB 5DUPH 2RFXB 3MRHB 3Q3GA 1PY4A 3LKRA 3C9NB 3MRFB 1U6AL 3HZMA 1JGDB 4O2EB 1FNEB 4M7LL 5D2NE 4LQFL 4MXVF 1G6VK 5I6XB 1F4AA 2XT1B 5BS0A 4WFFD 4K9EC 3IDNA 3P73A 4TOYL 4JFHD 4IRSA 1C5BH 3LRSB 2A6JB 5D7LD 1FVEB 4G42B 5TGBB 4XCCL 2X4OB 4OFKA 4U1SB 1E4KA 5KTEH 3EYVA 4KVCL 1GRWA 3GBML 5MENB 4OT1L 3QUZC 2D03L 3MGOA 1AO7D 1FBIH 4MCZB 2VZUA 1YEJH 1F97A 3HE6C 4JKPL 5A1AA 1IBGL 5I8EB 2EDOA 1HZHL 2UZYB 1J87A 2RCSL 1MIEL 5DQJB 2PUQT 4ETQB 2DQHH 5LXGL 5DXWA 4QO1A 3MRLB 4BUHA 1VKXB 2VWEE 3ELAT 1YJDH 3KXFB 1CL7L 3IAGC 4NC0B 1ES0B 4UNVA 3VXPA 4ZUVA 5JIIA 4ACPA 1CK0H 2VDPH 3NZ8A 4HIHA 3DVFA 2FO1A 3MGTB 5IESH 1VHPA 4PYGA 3MREA 3C6LA 2CUMA 1RZIB 5T1LD 5I0ZA 4ONGL 1LK2B 1OAKL 3WS6A 4A2MA 1A6AB 2HT3C 1RIVH 3QZWB 4ZNEA 1OHQA 3C5JA 5I8OL 3MZGB 2JIXB 4K3JL 1HCFX 1KJ3H 1JHLL 3ZDZE 3BX7C 1H0DB 2VQTA 2HT2D 1O5DT 2VXTH 4PB9L 3RGVB 4XVJL 5EO9B 4KJYA 2WLYA 4G80A 1I7ZA 3HG1A 3K2UL 1N7MH 3LVEA 1N5YL 4HWUA 4EUPB 2D0FA 1KJ2H 4NKOA 4J12A 1YMMD 1R3LA 3LY6A 2WBKA 4WUUE 4XNZB 2XNAB 5E9DE 4LHQB 4JHAH 3C8KA 1N2RA 4MMZC 2QSCL 4Y0GA 3SGKC 4LLMA 1SBSL 2X7LB 2W9DL 1UGNA 4P2QB 4XT1C 2FHFA 1FO0H 4OKVB 1PKQB 2DN7A 3MLZL 4R2GC 1HSAB 4Y4HC 2AVGA 2NXYC 12E8H 2GEEA 4RGMC 2AXFB 2G75B 1H3VA 3L3IA 2R2CA 4FS0A 4AIZA 3BXNA 1HOCA 3LH2L 3ALWA 5L8KB 5AYUH 3NAAH 3O3AB 1QSFD 3WO3B 4QRPB 2EE6A 4XMPL 4ODTH 5FUZL 1YECH 3JWDL 3MRGB 1SJEB 1FDLL 2YD4A 5DD0L 3S34L 5EIVA 1MVUB 2IAMD 2FNBA 2W07A 3R1GH 3THMH 5D9SB 4XNUH 5E1AB 1U8IA 4JFZL 3UYPA 5I74B 4LSUH 1GGUA 3R8BB 2K1MA 4E41E 3OB0K 3QUYA 2PO6A 1M4KA 2IQAA 4K07A 5F8QC 1NMAH 1J0ZA 3I3BA 3MBEC 3L5XH 1CLOH 2V7HA 4PV9A 2EZ0D 1QSVA 3VD3A 1X7QA 1CDHA 3B8SA 4GS7C 4PJBB 4YHOL 4EIGB 4FQ1H 4HJ0D 3G5YB 2IAND 4KDTC 4KZDH 3QSKB 2B2XH 4UT6H 1OAZH 2QADB 1F00I 5DQ9A 3ECBA 3EDFA 1OLLA 3FQWA 2NW2A 5I9QC 4NO3B 3QI9D 3ABZA 4L3ED 3NCEB 1G7MB 4FNLH 4WFHE 4Z9KB 2MCPH 2ED7A 3RKDD 4HULB 3TIEA 1BZ7B 4DVBA 1CN4A 5DUPL 1ZHLA 1ONQA 2H26A 2NY4D 4Z7WE 4HGKC 1U8MA 5GIRA 4IOFC 3LAFA 5E08L 5LCVH 1T0MB 3PWUA 1MPAH 1IKNC 3ARFA 4U1HB 3T0VA 3D18B 3MRIA 5D1QD 1C5BL 3PGCB 3MYJB 2CJUH 1AP2B 1E4XH 2AJSH 2BX5A 2OS7A 5KTEL 5D93B 1D9KB 3VFVA 3VFOB 2FIRT 4DTGH 4ONHB 2AEQH 5HVWA 4OCXH 3GM0A 1OW0A 2E9JA 3T09A 3LKSA 1FBIL 1HHJB 4C58B 3PV6A 1YEJL 1MJ8H 1TDQA 4QCIB 3VXNB 3U2SA 2GAZB 4GKZB 3I02A 4PJCA 4HS3B 4YBQC 5I0DA 2DQHL 3QXDA 2QR0B 4K94C 2NY3D 3V5DB 1YJDL 3DMMB 3QUKA 3SDAD 3OKLA 5J12B 1L0YA 2YD3A 4AT6B 3QDJA 1CK0L 1IEHA 1L0XA 2VDPL 4UB0H 1F3DJ 5EIIA 1IFHH 1CFQA 5C2UB 1CGUA 3LRHA 3T0WA 5IESL 2PW2A 2BOCB 4U6YB 1HHHB 3BGMB 3MV11 5DVOA 3WHXA 4DEPB 3QQ4A 4OFIA 1JPGA 3E8UH 4P46A 3I6KA 3F5WA 5HYJE 1RIVL 2X4RA 3RWIB 2A83A 1BD2E 5TQ0H 5BO1H 3S98A 4MWFA 3A0OA 1KJ3L 3LIZH 4ORZC 2YC1B 1OP5K 2DQFB 2VXTL 4NPYA 5DRNB 1CL7I 1KT2A 2GHWB 5IFJB 1N7ML 2IC2A 1CD1A 4JE4B 3O3EA 1YMHA 3UTTD 1KJ2L 4NKQB 4JFEB 5EPMA 5K9KB 5DS8A 2ERJB 3SHSA 4Z6AT 1YC7A 4JHAL 1LD9A 5DTFA 1MCWM 4WHYH 2GITA 3EHBD 3U6RA 3ZYOA 5MEQB 1VFBB 4JDZB 1FO0L 3HZYA 4LQ1A 3N1FC 1VA9A 2D31B 3LKQB 1E27B 3BP7A 3QB7C 1XR8A 4DGVH 3FHAA 2PYFB 2EYTB 2Z35A 12E8L 3SY0A 1I9JH 4Q9RH 3I84A 1FG2A 3G6AA 1BOGA 5GISH 4QXUH 3HR5A 1KB5A 4Y16C 4OCWH 5AYUL 5A2LH 3NAAL 3GJEA 4CU6A 1OM3H 5D71H 1KIPB 1DZBA 4WUUD 4ODTL 4FOMA 3S88H 1TCMA 1YECL 5E9DD 4F2MA 1EVUA 5CJXA 2IPTH 1KV3A 4JJ5B 4PBXA 1FSKB 3G5XB 2LVEA 3R1GL 3THML 5DFVD 3FO1B 4XNUL 4LK4A 4MD0A 5KZCD 1TFHA 2V9RA 2Y06H 4LSUL 2R2HB 4V1DB 4X6CF 4NO5B 3RUGF 1GL4B 1RJZA 5JPMA 5DHYB 4Y2OA 1NMAL 4ZOCA 3L5XL 1CLOL 4R97B 1IEBB 5CEZE 1KEGH 1I1AC 3BPLC 4R0LB 4ENEC 3O45A 3LCYA 1ORQB 1QPXA 1Z9LA 4KZDL 5ITFA 2B2XL 4UT6L 1TNNA 1OAZL 2CLRB 4X9IA 3RIFK 4C4KT 2J8UE 3BSZH 2ZWLT 4FNLL 2MCPL 3VXTB 2EIEA 4YEEA 1ZT4B 1XMWA 4E41D 4EVNB 3HC3H 1C5CH 4NQSB 3UPAA 1FNLA 3O41A 1N59A 4KV5F 1FFNA 4OD3H 5BVPH 5LCVL 5BXFB 4PGCA 4ZMAT 4MQ7A 3UTSA 3EOAA 3NCYP 1MPAL 1BBJA 2EC8A 5DJYA 3TN0C 2FL5A 3PGDB 5AAMA 4WUKH 4QY8B 3ZT5A 5FECB 2CJUL 4GW4A 1OF2B 1E4XL 2AJSL 4NHCH 4ZFOL 4A2LA 2A6DB 2YRPA 1LP9B 1JNNH 1DEEB 1RIHH 1I7TB 4RZCA 5KVFH 4PREA 4WFHD 2RFXA 4OCXL 1R3IH 1NDGB 2X9YA 3C9NA 4KTYA 5I73C 4O2EA 1JGDA 2XFXB 5ID1B 4OD2B 2YKLH 1MJ8L 1UJ3B 1XCQA 4P5TD 3UEZA 3LRSA 5D7JB 2A6JA 3HA0A 4M7LT 4C59B 1FVEA 3KHQA 3NPSB 2X4OA 3MFGB 3VXSB 1R5IB 5JLZA 3VWKA 4OZHE 5MENA 2FJGB 1OGAE 4UB0L 5EU7C 1IFHL 2PXYA 5J6HB 1T6WA 4H8WH 3VG9B 3TA3B 4CUCA 5I8EA 3B9VA 4MJIA 4EI5B 3UC0H 3AAZB 5DQJA 3E8UL 3LQAC 4ETQA 5IFHH 3PQYE 2HRPH 4J23A 5TQ0L 1KXTB 5BO1L 1VKXA 3MRLA 5EBLB 3KXFA 3LIZL 3ULVD 1ES0A 2VR4A 3QO0A 4YC2C 4ORGB 3ARVA 1J5OH 1EUTA 1BJ1H 1AKJD 3MGTA 1J9CT 2ADFH 1RZIA 3CFJB 1ZLVK 1LK2A 4IIQB 1OT1A 5BMFH 1A6AA 3QZWA 2BY2A 4JQIH 1UWGH 3GSQA 1WBXB 1ACYH 2JIXA 3BUYA 3WJJC 4P2OB 3H2WA 5HYJD 1T6VN 1A3LH 3E3QE 1BD2D 3K1DA 3RGVA 5EO9A 3VGGA 3BGFC 4CDGC 4DGVL 3K2MC 1A7RL 4XX1G 4NN6C 5FCUH 1RK0A 1I9JL 2DMCA 4Q9RL 3CFIC 4W6WB 5GISL 3JUYA 5IB3B 4QXUL 2X9XA 3TYGH 1XEDA 4HK0B 2XNAA 2JTDA 4OCWL 4Z7VB 1OM3L 2R4RH 5D71L 4U33A 3QIUC 1W0WB 2X7LA 5H37H 3S88L 2GK0A 4AY0A 4XPHH 4YDVB 2IPTL 5DA4A 1PKQA 3HUJF 1HSAA 1WITA 5D1ZB 2VL4A 5I8KH 1W2KT 2G75A 3KYMB 4ZODA 1JCKA 1YEKH 5B8CC 4QT5B 4AG4H 1KYOK 5GJSH 4HIXH 3O3AA 4BSWB 4DKEH 3WYRA 3EYQD 4QRPA 1KEGL 1RI8A 3TPUB 1FAIH 2ADIB 1SJEA 3QIWC 3U82B 4JGUA 3S5LB 4PGDB 1MVUA 2ZNWA 2HN7B 5DEZA 5SX5H 3O3UN 3LDBB 1GJIA 5IUSA 4ZDHB 3BSZL 2W60A 1FP5A 4XHJD 2IJ0C 3NOIA 2AQ1A 3FOLA 3K80A 5HHMB 4MCYB 4POZD 2EDTA 4FFYH 4PR5B 3HC3L 1C5CL 1MIMH 2A0LD 2LQRA 3VI3F 1WQVT 4NP4H 4PJBA 4OD3L 3G5YA 5BVPL 5CEZD 3O9WB 3TVMB 1DUYB 3QAZB 2IADA 1UB5B 4BYHA 2AP2A 4P3WA 4WUKL 3IF1B 4NO3A 3AMKA 4HBCH 3GK8H 1FL5B 1G7MA 3HRPA 3OB8A 2FR4B 4NHCL 1U3JA 4ZUTB 1BZ7A 1A6PA 4C4KO 2C9AA 1JNNL 4X6BB 1RIHL 1ZA6B 2R1YB 1A7BA 2WQ8A 5KVFL 2PNDA 1R3IL 3U1SH 4PTUB 1CICA 2VH5H 4M62H 3TFKC 3IXAB 5DVNA 2NY7H 5K93A 1T0MA 2YKLL 4LFHD 5F21B 4ZAKD 4UQ3B 4U1HA 1J88A 2H3NB 3D18A 1YQVH 4XRCB 3PGCA 2ESVE 3CFDB 3DGCR 3MYJA 1RY7B 4R3SB 3IFPB 4J3UA 1D9KA 1U8JB 4O2FA 3VFOA 4ONHA 5EBGA 1E4XI 5IJKA 2VZOA 4X80H 4CW1B 4PJ8D 1CE6A 4GG6F 1Q9OA 1AC0A 3EJZD 4H8WL 1KN2H 1NCDH 4UV7H 4QCIA 3RVTC 3SEPA 1NCAH 3UC0L 4AENA 4MS8D 2YN5A 3L7FB 4HS3A 4MNQE 1SVCP 5IFHL 2HRPL 3V5DA 3DMMA 2ZUYA 4AT6A 1J5OL 1I7RB 3BE1H 4TRPH 4RAVA 3C09C 2ADFL 3T3PF 4QWWC 3ILQD 4R4FH 4U6YA 1OGAD 1HHHA 3BPNC 4MAYC 1AD0B 1YNLH 3ME0A 4NCDA 5T3XH 5BMFL 1K8DA 4JQIL 1UWGL 5FOJA 3RWIA 1ACYL 4WWKB 2DYPB 1H3UA 1A3LL 4UDTB 2JB5H 5F97E 5DRNA 4C83B 4D0BB 2OX5A 3BN9D 1QLRB 5IFJA 6CGTA 3N85H 5F1NB 3D85B 2CR3A 5FCUL 4F7CB 1IVLA 2YPLD 4AMKH 4JFEA 5K9KA 2PN5A 3BHBB 1XIWD 5EZJB 1FZKB 1M71B 3HI1B 3TYGL 3VXUE 2WW8A 3FFCA 1WZKA 2NY2B 3H9HB 5F1SA 3UXFA 4G6KH 3SOBH 2R4RL 4PYHA 5ENWB 1FVCB 4OUOA 2E6QA 1VFBA 4XBPB 5E6YA 4JDZA 4IRSC 4XPHL 4NQCB 4MA1B 2ARJA 5JXEA 3LKQA 3TIDB 1E27A 2BVUA 2ZKHH 4CVWA 1E4KC 3OB0H 3MZTA 2YS4A 2XTJB 5I8KL 4F9LA 1NJ9B 3QUMB 2R2BB 2JCCE 1YEKL 2F54B 3T2OA 5GJSL 1JGVH 2XG4A 4HIXL 4DKEL 1VGKB 3L5JA 1KIPA 2DM4A 3K7UA 3O2DL 2OL3H 1FAIL 3HKFA 2X44D 3QEGH 4LASH 4LSSH 3SGEH 3U0PB 2WANA 1K4CA 1TJGH 1RJLB 2NY1C 3FO1A 3MLYH 4RWHA 3PWPB 1DBBH 4I2XE 2NY0D 1RAMA 1N5AB 2R2HA 4V1DA 5MEPB 4EEEA 4NO5A 4H0GA 1CGWA 1EK3A 4WV1B 5DHYA 4FFYL 4ODBD 1YY8B 5FKPB 1IEBA 1MIML 2XRAH 1CFSB 1F6AB 2D7TH 2X1PA 4R0LA 4N68A 4NP4L 3WS6C 1Y0LB 4YHMH 1ORQA 1PG7W 4M93C 4BFGA 1FE8H 3WS3B 2EDQA 4QEGA 3QISA 1QTYT 2CLRA 3TESA 1T1YB 5IQ9A 2NX5A 4PJHF 5IHZB 4H26B 4HBCL 3GK8L 3BKYH 2UYLB 4BSVB 1AGFB 1ORSB 1ZT4A 4YR6B 4EVNA 3E6HB 5J89A 4NQSA 1OAUH 1OP3H 4JFXB 3U1SL 2VH5L 4M62L 5C0BE 1XF1A 2NY7L 5BXFA 5IV2B 1WSST 4NZDA 4Y1AE 1GZQB 4WI3A 1C7TA 2DOCA 1HWGB 1G7QB 3CU7A 3ARED 1YQVL 3PGDA 4KMLB 3RVVC 3QUZD 4Q6YA 4QY8A 5FECA 1OF2A 3VE0B 2A6DA 5I15H 1U58A 4TUJB 2CKBH 1UM4H 3O4LE 1LP9A 1DEEA 1I7TA 3MX0A 3SDXB 2O5YH 1NDGA 2DI8A 2VKXA 1F5WA 4X80L 1NEZA 4R6UA 2XFXA 5T1LB 3T1FB 1KN2L 4YHNB 5ID1A 2Y72A 4UV7L 1D5MB 2XWJB 4NRZB 1NCAL 4OKDA 1EGJA 2ITCB 4NZJA 1KXQE 2ADJA 1UXWB 5A2FA 4K2UH 4YBLB 4BK5A 3L3JB 5GS0H 3VXSA 1R5IA 2ESVD 3QUYC 2PO6C 1FZMB 1RUAH 4Z76B 1BIIB 2FJGA 3BE1L 4FABH 2FZ3B 4TRPL 4LPWA 2XXMB 5J6HA 3DUSB 1P7KB 3D0LB 2C3XA 1YMMB 3QZWG 4K7PY 2YD8A 3TA3A 3V7MA 4R4FL 1RHFA 4EI5A 1UWXK 1YNLL 3RNQA 4TVPE 5T3XL 2C4XA 5IEKB 2F58H 5FO9B 2UY7A 1G7PB 4LKCB 2IPKB 4M5ZH 5EBLA 4QGTA 1TLKA 4TULH 4X7DC 5J06A 5E8DH 3T3ME 3WSQH 1MHHB 1J8HE 1ZT1B 2JB5L 4ORGA 5I17B 4FQCH 5F7HA 5E94B 2W9EH 2DF3A 3CPLB 4I3GA 4D9QD 1RK1B 4X4ZA 2BSTB 3N85L 4LLDB 1A8JH 1T21B 4AMKL 1DLFH 5DI8B 3CFJA 1NCUA 4M1CD 4IIQA 4JO4H 1QSFB 4LF3B 1D3CA 4GG6B 4TSCH 1I85A 4G6KL 4J8RB 2YWZA 3CX2A 3SOBL 1WBXA 2JE8A 1O0VA 1V3KA 3ARFC 3W9EB 4P2OA 4E0RB 4QXWA 2IAMB 4F15C 1BFSA 2APXA 3OKYA 2ZKHL 1U8HB 3I6LE 4IBLT 3WO4C 3H7LA 3PIQA 3FQUA 3KS0H 1T4KB 1KIRB 3CSYB 3BFOA 4DK6A 3HLAB 3KDMB 5HBBA 2WLZA 5IB3A 3ET9F 1OW0C 3GBNH 4HK0A 1JGVL 1U42A 2L0DA 4ZQKB 1F8TH 4UILL 2OJZH 1W0WA 2OL3L 3VXUD 2WWKO 3NPZB 4YDVA 2IANB 3EOBB 2VZTA 5E1HB 3QEGL 4LASL 4LSSL 2ENSA 1I8KA 3L95B 1TJGL 3MBED 4QHKI 3QQ9C 5D1ZA 2ZOLB 1CG9B 3QI9B 3MLYL 4L3EB 5L88H 4BM7A 1DBBL 3KYMA 3IU3B 4O51B 4QT5A 2V2TB 3GRWH 4W4OA 4MA7H 4BSWA 1U3ZA 4PY8I 4PRPA 3VFRB 2NY4B 2XRAL 4P0DA 2AERT 2D7TL 4AQ1B 1JF6A 1CR9H 1QLFA 5BRZA 2ADIA 4ZOAA 3TPUA 2MSPA 4AL8H 4HXAH 4P46C 4YHML 2JJSA 4PGDA 5C0NC 3JUZA 1FE8L 1Q9LB 5FHAH 5D1QB 3Q1SH 4ZDHA 5CGMA 2UWEE 3KYNA 5DJ2B 4AH2A 4MCYA 1Q72H 3BKYL 1LDSA 4YXKH 1UM5H 4PR5A 5ICXB 3DRQB 1NMCB 5BVJB 1VFOA 3ULSB 4XNXH 5L2KE 1OAUL 1CLYH 3CX5K 3O9WA 3TVMA 5EU7E 1DUYA 4O02H 1GAFH 3ZYIA 5D2NB 1UB5A 5FAAA 2P44B 3FB5B 3IF1A 2OTUB 4JY4B 4RWYH 4ERSH 3T0DA 4G7VH 2NY3B 2UY6A 3VWJD 2FR4A 3SDAB 1MHPH 5I15L 1FJ1B 2CKBL 1UM4L 4ODWB 1UM6H 2DMBA 4X6BA 4KK5D 1ZA6A 2R1YA 2SEBB 4OGZA 2O5YL 2NPLX 4YBQD 1MCIA 5CZXC 4XBGA 3RUGA 4PTUA 4PJEF 2EEBA 3BIAX 3ARXA 1QFHA 3MA9H 2N56A 2CUIA 4HK3N 5D7KE 4UQ3A 1H15B 2H3NA 5CJXC 5C0BD 2ICCA 4XRCA 3CFDA 3FRPA 4PJ5E 4RA0C 4R3SA 4GMTH 3IFPA 4K2UL 1U8JA 1LEGB 3GHBH 5GS0L 1KF9B 3CMGA 1RUAL 3JZ7A 3MRCB 4FABL 1WC7B 3GBLA 4CW1A 3O4LD 2ZCLH 3UTTB 1ZLVH 4OLXH 4X7TB 4J4PD 2HLAB 4M3JA 4ZS6C 3VRIB 3B3IB 1QFOA 1A9BB 4KMQA 2OSLA 3L5IA 5D2LB 2VDOH 4FQPA 3GMLB 2F58L 5E6ZA 3U7WH 3EDDA 1U3YA 2BVYA 1NBYB 4M5ZL 5DVKA 5FF6B 1IQWH 3MYZA 2OQJA 4X8JA 5LVEA 3QXUA 4TULL 5E8DL 3OQ3B 3WSQL 3A6OA 3IKCB 4FQCL 1I7RA 4M5YH 2W9EL 5DF0A 3FT2A 3MUGA 4RMUA 5J4MA 4GW1B 1JGUH 2HTLC 1DLFL 1AD0A 4ZXBD 35C8H 3Q2CA 4JO4L 1MCJA 3UMTA 2AEIT 2I27N 4TSCL 4WUUB 5IWLA 4KU1A 3S37H 5E9DB 2BERA 5I16B 4TVPD 1T0NA 4WWKA 1KN4H 2DYPA 1SM3H 2GJZB 4UDTA 1GYAA 4U6VH 4C83A 4D0BA 5KZCB 1QLRA 5K9JH 5F1NA 4DK3A 2Z8VC 1I8IB 2XG5A 1J8HD 1NAMB 4F7CA 5DURB 4LPXA 3TNMA 1FZKA 1M71A 1R5VA 3GBNL 3HI1A 4IDJH 4JFDA 5AG9A 2FD6H 4JRXE 1FRGH 1JJUA 4M9OA 5I6XC 1F8TL 4L1DA 4IHOB 4P5MB 4PLJC 2OJZL 5ENWA 4U1JB 1I3GH 4QRSA 4XBPA 3UPRB 1JTOA 5E8PB 3TIDA 1EHNA 1QO3B 4HUWB 1I1AD 1C12A 4MNHA 5L88L 3VWKC 1NJ9A 3QUMA 5FYJE 3RWFB 4PJDF 3I6LD 5I30H 3HZKB 2PXYC 4WEMB 3GRWL 4E41B 3TBTB 5BZDA 4RA3A 1MRDH 4MA7L 1T04B 32C2B 1VGKA 3D2UD 3PXJA 3DXAE 1CR9L 4AL8L 5KS9F 3WEXA 4HXAL 2EIDA 2CLZA 3U0PA 3K46A 1RJLA 4HPYH 5FHAL 5FV1L 1U8LB 3Q1SL 1WV7T 4KI5F 3PWPA 3ARWA 4QNPE 3Q48A 5C0JB 3DV6B 3NCFB 1EEYB 1N5AA 1Q72L 1HDMB 4GXVH 3NFNB 1DBKH 3QHFH 4YXKL 1FZJB 1UM5L 4G7YH 1J86A 2Y5EA 5FKPA 3H9SD 4U3XA 1K3ZA 1CFSA 4XNXL 1F6AA 1RZ8A 5E70A 1YPZF 4QTIH 1CLYL 3C5ZD 5ERWB 2WP3T 1BF2A 1NFDB 4MD5B 4OLUH 1LDPH 4O02L 4P5TB 1GAFL 2P46B 4I0PB 5FO8B 4JN1H 2X1QA 3X3FH 1T1YA 2GY7B 2APVA 3D48R 4RWYL 5IHZA 4ERSL 3RGVC 3RPIB 4H26A 4G7VL 4B7IA 4G8IB 4S1DC 4HIEB 2UYLA 1MHPL 1NEZG 2YZ1A 1ORSA 4UIMB 2J6EH 4YR6A 5D6CB 5T3ZE 1UM6L 3AB0B 2FYYB 1TETH 3VXQA 3U7YH 3WIHH 4PRHD 3CVHH 5CP7A 4N0YH 1JF1B 3MA9L 3OR7B 5L2KD 1GZQA 1A7OH 1G7QA 2EC9U 1MAMH 2E6PA 4WO4A 3A6BH 5C3TA 1PW3A 1SYVB 2HVJB 4LNVA 1G7LA 3BW9B 5DWUH 4GMTL 5GRZA 1A14H 4TUJA 1PFCA 3GHBL 3RA7H 1CFBA 1AKJB 3SDXA 3W5NA 1G7HB 2DD8H 1F6LL 2F5AH 1NLDH 2X42A 2ZCLL 4OLXL 3A6CH 4N1HB 3UYRL 4YHNA 1I9IH 4X4MA 4GH7B 4NM4L 1D5MA 1DDHA 4OFVA 4KWUA 5HGBA 4FXKB 3GMRA 2VDOL 4Y5VB 3IDGB 4WEUD 3OKOB 2ITCA 4PJIE 2K7PA 3U7WL 3UDWA 1UXWA 5ECJE 5HYJB 1IQWL 5I74C 1BD2B 4OV5B 1YZZA 1R3JA 4P23A 1FZMA 1NLBH 2D4FA 3ES6B 4Z76A 4M5YL 5DMIH 2ZJSH 2FZ3A 4QHKJ 4YO0A 2IWGA 1P7KA 1QBBA 3D0LA 3BGAA 1JGUL 4JM2F 1EEUA 5B4MD 1AR2A 3FQTA 5IOPB 35C8L 2DI9A 4UOW0 5IEKA 3KPLB 5FCSH 5FO9A 2DQJH 4JREB 1G7PA 2DKMA 4LKCA 3S37L 4GLRH 1KN4L 2ZCKH 5DVLA 4JQVA 1SM3L 5C1MB 1MHHA 2BCKB 1I1FB 1L9MA 5I17A 4U6VL 1S7XB 5CUSH 5E94A 3CPLA 3OAZH 5K9JL 2BSTA 1R3HA 1T21A 4YHLH 1T1WB 1EX0A 3DYOA 4GRMB 5HYSB 3WHE0 1CICC 2Z93A 2XI9A 4IDJL 5C6PB 3LB6D 1QSFA 2FD6L 4LF3A 4XNQB 4GG6A 1FRGL 3CLFH 4J8RA 3QJHB 3LSOB 1WTGT 1G7IB 2VN4A 3ULUE 1I3GL 4KI1A 3W9EA 4KRPD 5HYIA 2BVEA 1FC1A 2IAMA 3MODH 1U8HA 5D93C 2IH3B 3RVUD 4ZNEE 1D9KC 1T4KA 1VFMA 2DLHA 1KIRA 1KCUH 3GSWA 2X4TA 3KDMA 2AQ2A 5IJKC 4HIJA 5I30L 4BZYA 1XGRB 1D5BB 4WI9A 1MRDL 5HD8C 2Z91B 4DWHA 3S3JA 4G9DA 4ONFH 2L7UA 4JRXD 2IANA 4JFPA 4U3CA 3E6FB 1HIMH 1H3XA 1BOYA 3L95A 4HPYL 3SQBA 4ODXB 2ZOLA 3DMMC 1CG9A 3QI9A 4L3EA 1DLHA 5J12C 3C60D 3H0TA 1RUMH 1GGCH 2CO6B 2ICWI 3IU3A 2J8UB 2V2TA 1Z0MA 3PWJB 4LKXB 2VLKD 4OBRA 4GXVL 1DBKL 3QHFL 2DICA 4IM8A 4G7YL 3JV5A 2VB5A 1VADB 3TJHC 4XBEH 2E7BA 1CI5A 1EV2E 1K8IB 1KB9J 4DEPC 4GRWF 4QTIL 2Y9RT 3TH2T 4ZAKB 2UVEA 4OLUL 5C0DB 1RULH 1LDPL 4XX1E 4HG4K 2CPCA 4JN1L 3X3FL 3IKKA 4HUVB 2YRZA 1CFTB 2YRLA 3ZTNH 1U8PA 3N50A 5DJ2A 2MNUA 3FN3A 3TFKD 5FM4A 3IFOB 4S11A 1P6AB 2DLGA 5D1XD 2J6EL 5ICXA 3G9AB 3DRQA 5BVJA 2ERJC 3ULSA 1TETL 2AV7B 4PJ8B 3U7YL 3WIHL 1S7UA 3CVHL 1CIDA 3OKDB 4N0YL 4Y89A 4AM0B 2VJXA 3FRPG 4ZTOH 2E3VA 1A0QH 2HT4D 1A7OL 1QR4A 3NACH 3H7BB 1L7IH 1VFAB 1MAML 1ADQH 1II4E 2XZCL 4MJ5B 3A6BL 2WP3O 5JXEC 3FB5A 4JY4A 1AJ7H 4C57C 4KUCD 4P2CG 3FB6B 4FHBD 5DWUL 1L0QA 4PFEA 1FJ1A 1A14L 4F9LC 4ODWA 5FYKU 1UKTA 2AS5M 4CN1A 1U9KA 1S7TB 3MACH 3RA7L 2SEBA 2DD8L 1DBJH 2F5AL 2AV1A 3HMWH 1NLDL 5T3ZD 1DTUA 5JO5B 1UWXH 1EBAA 1OGAB 3A6CL 3ZE2F 3L7EB 3STLA 1I9IL 3PE9A 3PWLB 3LN5B 5C86A 5E5UB 1H15A 2IMNA 1KGCD 4GAJL 2IPUK 5IEHB 1FSKC 1FLRH 2P47B 3F6LA 3DVNB 5J3HD 4QWWD 2X4UA 1IRAY 1LEGA 4YFLI 3HI6H 3BJ91 4ODSH 4PJHA 4KJPD 1NLBL 2FWOB 3MRCA 5DMIL 1NUDA 2EDWA 2ZJSL 4LEOB 1WC7A 4HDIB 1H5BB 3UTTA 1QRNE 2YPLB 4X7TA 2IFFH 1J11A 3VRIA 3B3IA 4M02A 1XIWB 2FHCA 4KK6D 1A9BA 4FG6D 4R0LC 4Y8AA 2VUYA 4UBDD 5D2LA 4JHBA 2L7JA 3HN3A 3GMLA 3QDAA 4DGYH 2DQJL 1NBYA 5FF6A 5DA0B 4P4KD 1ZSDA 5BV7B 1BPVA 2ZCKL 4WHDA 1MEXH 3IKCA 2CH8A 4LAJH 5CUSL 1WF5A 3S7GA 1CLCA 3ZSSA 4LOUC 1JV5A 3MLVH 5FGSA 3GJFH 4GW1A 4YHLL 1MCRA 3VMPA 5EORH 1VACB 3BRGC 2YA1A 4BQ6A 2FX9H 5J1TC 3IB4A 3QDJE 1MREH 1ZGLB 3ZKMC 1QA9A 3CLFL 5B3JE 1WJ3A 1OGTB 3JWOC 4Z7NE 5I16A 4X6DB 4B0MM 4L4VE 3QWOB 1UH4A 3BP5B 2GJZA 4XVUC 3MODL 5F3BB 1S9KC 5CGYD 3ROLB 1QD0A 3NIFE 2ZSVB 1TNMA 4XP1H 1KCUL 4NHUA 1NAMA 4YDJB 3P9LB 1GHFH 1M6OB 1OCWH 3AU1B 4GAGH 5KSAB 1WAAF 4HX1B 4NFBA 4AYFA 4P5MA 3OJDA 4IHOA 5HHNA 1MY7A 2BY1A 1M1SA 4ONFL 5E8PA 5C6WH 1R6VA 1U91B 4LVHB 3NPSC 1HIML 3ULUD 3C6LD 1QO3A 4JRYA 2EO1A 4MVBD 4NCC2 3RWFA 1RUML 1GGCL 3B2VH 3HZKA 3PDOA 3TBTA 3T2PA 4ZYKA 1WWCA 3TA3C 3TH3T 1T04A 32C2A 1NFKA 3U30B 5IB1B 4EI5C 3LD8B 4XBEL 3HCVB 3GSRB 3WUZA 4Y4KD 3REWB 4L4JA 1RULL 4D9LH 4YGAB 3AREB 4OQ1A 1XF3B 3QUZB 2PETA 1JL8A 3MQIA 5C0JA 3DV6A 1OP9A 2VZVA 3ZTNL 1FVDA 2EDFA 3BUTA 1QBLH 3NIGF 4RGOH 5GSVB 43CAB 1HDMA 3OAUH 2RHEA 3NFNA 4XCYA 2E27H 1PBYA 5KSBF 1FIGH 1FZJA 1R24A 3F7YB 4XWGH 4R9HA 2DKSA 2QTEA 2I26N 3RVVD 3REVB 4IIQC 5JW5B 2FH8A 1TJIH 5ERWA 1PZ5A 1V8HA 2D7PA 1I85C 1NFDA 4MD5A 3DGGB 4ZTOL 1A0QL 2DQUH 2DQEH 3QNYB 4P5TA 4U49A 3NACL 4I0PA 4P2OC 2X1OA 1L7IL 3N06B 4P5KB 3QPQD 4OI7A 1ADQL 3UBXA 4FQLH 15C8H 1AJ7L 4G8IA 4MZ2A 3GO1H 4R8WH 3U0WH 4KKLC 5IW6B 1U95A 4UIMA 5IMKA 3KPRB 5D6CA 4RIRB 2FYYA 1QSEA 1OPGH 1TXKA 3MACL 4XWOD 4ODHH 4NKDB 3EW3B 3S35H 1DBJL 2W0PA 3HMWL 1P5VA 2WNGA 1LEIB 1JF1A 1A6ZA 2BMKB 3OR7A 4EBQH 5F7NC 3GMOB 3QUYD 4K3DH 2DJSA 2PO6D 4HKXB 4EDXB 3PP4H 1SYVA 2HVJA 4JPIB 1FLRL 1Z9MA 2RIKA 2X4PB 3QDHA 5K59F 3BW9A 5D1ZC 3BQUD 5FGBA 1AXSB 3HI6L 3GMMB 3UTSE 4F37F 5IW1B 1G84A 4ODSL 2VRAA 1AKJA 4NDMA 3P11H 4W4OC 2IFFL 5JA9A 1B88A 3WFCH 3KS0J 2VIRB 2VL5B 4FXKA 3RNKA 4Y5VA 3IDGA 2JJSC 3OKOA 1F02I 3M1BB 4DGYL 4RGMB 3X14A 1DVFA 3MRBB 4PJXF 2V5SA 2J88H 1PZUB 4MQXC 5HYJA 3HAEH 1S7SA 1J1OH 3ZE1E 2HVKB 1F4WH 1OTSC 3ES6A 2Q20A 4UT9L 2GKIA 3MLVL 3NGBB 3ARFD 3LRGA 5EORL 2ICWJ 4D94A 5IOPA 2N4IA 1QRND 2FX9L 1MREL 3KPLA 4W4NA 5MENE 1JPSH 3D25A 3O9WC 3TVMC 4X83A 3QAZC 1N0XH 5JHDA 4NUJA 4ELMB 1RZKC 4MJIE 5I71B 5CP3H 5IBUB 5IHLB 1JMZA 2BCKA 4GLRI 4G8FB 1S7XA 3P9WB 1J10A 2NR6C 3IDJB 5JZ7D 1OTUD 4WJ5B 4XP1L 1FNSL 1GHFL 3L3DA 1T1WA 1A6UH 1OCWL 3KXFE 4GRMA 5HYSA 4GAGL 1K4DB 2XA8H 4JPVH 5E56A 4QRTB 5I9QB 3QJHA 4E9LA 5JW4N 3LSOA 1G7IA 1I9EA 3QDJD 1A3RH 5GGTA 2DIBA 3IDMB 2BJML 2C1PB 1ZLSH 4ZFFA 1WCQA 4L4VD 3F58H 1D5IH 3STBA 5HI3C 2VABB 4QOKA 3FQRB 3B2VL 1D5BA 4WU5B 3CH1A 5C0ND 1NH6A 4PLKD 2HA1A 4L3AA 2A6IB 2L4OA 4OSUH 5L9DH 2I9LB 1QZ1A 3M17B 3ARDD 2DI7A 3ZDYF