2B1AH

Crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug1033 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
226
structure length
226
Chain Sequence
EIQLEQSGAEVKKSGESLKISCQTSGYSFSDYWIGWVRQMPGKGLEWMGIFYPGDSDSRYSPSFEGQVTMSADRSTNTAHLQWSSLKPSDTALYYCARLGGDYEDSGADAFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2219, light chain
publication title Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
pubmed doi rcsb
molecule tags Immune system
total genus 37
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aH01
4HFWB 4YDLC 3HHRB 3N1GC 4MCZA 4GRWE 3FFCE 5DGQA 4APQB 4A2MA 2C1PA 1A3LH 2GW5A 3Q6FA 4MA3A 4M61B 2H8PB 3L1OL 3KXFD 2EDQA 2P4AB 3VFOB 2IGFL 3UJJL 5HD8C 3CZFB 4NKDB 1IM9D 2A74B 4U0QB 2XWTB 4X80H 4F80A 3MODL 3ILPB 3IU3A 1Q9KA 4LLYA 2C7UB 2PYFA 4F3FB 5CJXC 4XP6L 3KPSA 4KV5F 2EEBA 4LL9A 1RZGA 4M62L 1Q94B 1LO0L 5TQ2H 1C12A 1FRGL 5E2TH 2J8HA 2P8MB 1R3HA 2FIKA 4U1JB 2AGJL 4PJ9C 1CQKA 5JQ6H 1BFSA 4TRPH 2E27L 4OBRA 5L0QB 1FLTX 5E24E 2HH0H 2XNAA 4R7NA 4Z7WE 5JPMB 1BHGA 4E5XA 43CAB 4PP1C 2EE9A 3IU4H 3GSNB 1DQMH 2VITB 3GMOA 4WFED 3D2UA 1KENH 4PJGF 4Y19E 3H3PH 5KS9B 1PLGH 3NTCL 4M00A 1BLNA 3DO7A 4H25A 5B39B 2BX5A 1TVBB 1P4BH 1ODAA 5DMKB 3MV9A 5DT1L 1ED3B 2IG2L 2JJTA 4OGXL 3C5ZA 4YBQD 3VU2A 2EKJA 1T2QH 2AVGA 1GOHA 4L4TB 4PRHE 4WFGD 5F3HA 2R9HD 3MLVH 3LHPH 3KNBB 4M6OL 5C0IB 2ADJB 2CH8A 3MO1A 5IKCB 2MSPA 3PWLB 3M1BB 3VXUA 1J1XL 2BZDA 1IBGL 3L3OA 2IAMA 2FZ3A 5B3JE 3ET9F 4UIKL 1WIPA 3VD7A 4MS8C 2P43B 3ECBB 4XX1E 3HZKB 1KTDB 5IW1A 1QLFB 1FFPA 5D7KE 5EBMB 1EVTC 3GUTA 1QFPA 3GSUA 5FCUL 4NKIH 1QSFE 3D3VA 4KJYA 1FGNH 4P2RA 2R0KL 1P6FA 5F7DB 3CPLB 4YHMH 4O9HH 4UUJB 2VLRA 5IQ9B 1ZTXH 3EW3B 4FQHB 1T5WB 1E6OL 3OAYH 3G5ZA 1BF8A 5TJWK 5DFVC 2W9EL 2AP2A 2J6EH 2HVJB 1I3VA 3A6OA 1MSPA 4AENB 4BH7A 5KBNC 3MV8A 4YQXH 1A4JB 3VXME 2CMRL 3TT1L 5HYJE 3EYFB 2ITDB 5KVEL 1UJ3C 1F6FB 5A3IC 4TNVF 2GJZA 5HHXH 3K4ZA 2AXFB 3T77A 2XN9E 2V17H 3SDYL 4NN6C 4OD3H 5F9WC 4Y4HC 3RWJB 3L3JB 3WXVH 5GRVK 3G6JB 1ND0A 3OR7A 2FEEL 5JXAH 1A14L 3LKPA 1MY7A 1FZJB 3BXNA 1C16A 4ZOAA 4JFZH 3QEHA 1CGVA 3PABB 1BOGA 5I18L 3P4LA 4MVBC 1FDLH 4OGYH 2QHRH 2D7PA 1KN4L 5EA0H 4GAYA 4CMHB 2LE9A 2NY6B 1OCWL 4Q0XL 1G9MC 3TBVB 5E99H 3U4EB 3KPQA 4BH8A 1Z3GL 4LVHB 2Y6SC 5CCKH 2ZCHH 1S9XB 3QIUC 2X09A 4WUUA 4EVNB 1H8NA 5FGSA 4ODSL 2R29H 4Z5RB 3ROLA 3BUYB 3GSXA 4WFFE 4OZFH 3HI5L 1MFBL 4Z95L 43C9B 3M17A 2FGWL 1G9MH 3U0WH 2FEDC 4PGBA 2VDKH 4N8VG 2DM7A 2ADFH 5AZ2L 4MXWL 5DMIL 5TGBA 4J1UB 1VKXB 1A4KA 2PYED 3JTSB 1S9WB 3RIFF 1YNTA 4PRBA 4U6XB 3QHFH 1PBYA 2VLJE 3LKSA 5HYEA 1CWVA 4HZLA 4DN3H 2OXHA 3CLFL 2AJXH 5GS2D 3R06B 2IQAA 4GAJL 4HKXA 2B7DT 2Z92B 1DDHB 2VR4A 3GRWH 4Y4FB 5F1NA 2IANA 4QXGH 4CVWA 2QQLH 2LU7A 4ZFOA 4NNYB 4UOJA 1N7MH 4OCRL 5DUBB 3EYSL 3L6FA 3EJJX 5K9JH 2BHZA 3G08B 3KLHD 3I3BA 1OAYH 4HUUB 3W2DL 1EHNA 3MR9B 1NAKL 2DM4A 4IRZH 5I8KH 3L95A 5DMYA 4GG8A 2R15A 4M5ZH 5B4MC 1KJ2A 3GMMB 1F3JA 3EOAA 4TVSa 4M1CC 1RIVL 2VQUA 3OHXA 3GSNL 5DD6A 4RZCA 5FA4B 2A83A 3GSRB 4RISL 3HMWH 3QULA 1M1SA 4AYFA 5T5NG 4XGZB 2IWGA 4LFHD 3FFDB 3MLRH 5DA0B 4ZFFA 3ZDXE 1NGWA 4G6JH 1AQKH 4F9LA 2XPGA 4DW2H 3V7AE 3BIAX 3UTTE 5TF0A 2YC1A 2QKIB 1S5HB 2E6JA 5JDSA 3SDCD 3TA3D 3VG9B 1KG0B 4K3HA 4JKKA 4P9ML 4TTDD 3W9DB 5J9PB 4YX2H 2WWMC 5C0BE 2EXWD 4LNRA 1OD7A 3BHBA 3DLQR 3MRQA 4GW5A 2F19H 2FJGA 1MIML 5E4EB 3T2PA 5KVGH 4Q6IA 5HVGB 5F96L 5B39G 4JN2B 1JHLL 3MFFA 3O9WB 4HEPG 4LRNL 4FQCL 1MPAH 4ZOBA 1P6AB 3E6HA 5EO9B 2BC4B 2Y1VA 4XCNB 4E42A 4P2CG 1ZANH 4KDWA 3FQXA 3A6BL 1IQWL 3OPZL 3W0WA 5LQBL 1GAFH 2F54A 5DEZA 4FMFA 1YY8B 4S0TD 5E1AA 3C6SB 3QISA 1RUPL 4LCWA 3H9SD 1EAPA 1QFOA 4X6CA 4MJ4A 4YUEH 1T7WA 4MCYB 1INDH 5JW5B 2WAHA 4KKLC 1I9RL 5D9SB 3C5SA 1D5ZA 3X11B 1I1AA 4WFHE 5MENE 3QAZB 2DM3A 1FNGB 1TITA 5FYJH 1QYGH 1LEKA 2OI9C 4AL8L 1MFDL 4IHOB 1FNAA 1JGVH 3SY0B 4N1EA 4LPTA 5SWQA 5A40E 2AEPL 1MLCB 3PWPA 3F7VB 5E00A 5I2IB 5SWZB 4YHKH 1JN6A 2PXYA 4M8QB 3WMSA 3M07A 3RWCA 2V5SA 3RRQA 4GQPH 4Y4FD 5FDWA 4X7EC 3S88L 1LGVA 4NZDA 4LCCA 4ZSOE 1KPRB 2X4PB 4FFYL 4G8IA 2OR7A 4UV7L 3PGCB 3BKML 4PYHA 4YZFF 4YNYB 3BSZL 1W0VB 4BFIA 3MRFB 1C5CL 4L5FL 2L7JA 5FO7B 5KSBA 5D1QD 3VXNB 4XBPA 5FK9B 4RAHA 1YYML 5DD3L 2EDEA 3MLXL 4X6EB 2WINB 3F12B 3O4OC 4OZGB 3OKDB 5E2WH 4MHHI 2DBJA 1SMOA 3BZ4A 1BIIA 4MYWB 5C7XL 4N9GA 4HMDA 2B4CC 2G5BB 1X5LA 4MSWB 4ODHH 3VWJA 2VLLB 3KYKH 2H2SD 1RY7B 4AMKL 3BGFB 4KK6C 3BMWA 3QNXA 2AJYH 1S9YA 2DL2A 3QCUH 3UTPD 5HGAA 3TBSB 1R24A 4P4RB 4R96A 1FQ9C 5ICYA 3K8LA 2B4CH 3QEGH 3SKNB 4GMSL 1EJOH 3IFLH 3F7YA 3VI3E 2F8VA 2MKWA 3BYYA 3DSFH 3LN4B 1EEYB 4R2GC 3V5DB 3FQRA 4K07A 4XVJH 3D0LA 3MRDA 4X98A 4ZXBC 3TPKA 5C0EB 1IAIM 3O9WD 3UZVB 3PF2A 3SCMD 4XWGL 5JR1H 4MCZB 4Z7QF 2C1PB 4XP5L 1MCFA 3Q6FB 4MA3B 4PJXE 1UEMA 5FYKU 5TFSL 4KU1A 4LIQE 3MTRA 5GQBA 4JQXA 3IU3B 3VFVB 1Q9KB 3MV7E 4LLYB 4P5MA 2PYFB 1EXUB 1RZGB 4ZPTA 5F6IC 1T0PB 3S36H 5IHLB 4QCIA 1C12B 4PJDA 4GKNA 1NUFA 2C4FU 3HG1A 2FIKB 1RMFL 2M2DA 2YN5A 3N0PB 5IT2H 1F00I 4WW2A 5JUEL 5MERA 5E8NA 4I0CC 1U58A 3M8OL 3MNVA 3DHMA 2Q3ZA 1NC4D 4NQED 2CKBH 5I8OL 1OWWA 1LO4L 3QQ9C 4M1DH 1WICA 4KUZH 5KVDL 4E5XB 2E5EA 3C60A 1O5DT 4KKAD 1NCWH 3GMOB 3D2UB 2Z8WC 5MEPA 5L6YL 1BLNB 3DO7B 2D31A 4H25B 3BD5A 2OX5A 2VC2L 4M43H 3OAZH 1LP9A 1MCPH 1QBML 5FYKD 4BUHA 2HA1A 3GBLA 3MV9B 5EOTB 1RJZA 3BRDA 3V4PH 3NZHH 2GT9A 3RNQA 3QUZD 4JRXA 5D1XB 5GXBB 5D8JL 2QLVB 3SE8H 4KZDH 1WWBX 5F3HB 4U7SA 1FO0H 3HC3L 3RTQD 4HC1A 3CXHK 3MO1B 1BOYA 3S98A 1QKZL 4MNGA 5KSBF 5GGTA 4DK3A 5HDBF 3G6DL 4UV4L 3L3OB 2IAMB 4NZTH 3U46A 2FZ3B 4X5XB 1D5XA 4AH2A 1QFHA 5I1DA 1U8JA 5IW1B 3ZT7A 3UYRH 1FFPB 4KI5C 2L4OA 3EYUL 5CEYA 4YXHL 1RURL 4HUMB 1B0GA 5C07A 5J1AB 5JXEC 5IWLA 3GUTB 3GSUB 4MXVE 2J1KA 4EBQH 2CQVA 4LF3A 4JY4A 3D3VB 4KJYB 4P2RB 4ONOA 3RGVD 2HRPL 3T8XA 3KG5A 4BK4A 2VZTA 3EYVA 2XZZA 3CX5K 4H88L 1NMBH 4RAVB 5E03A 3I9GH 4NQUA 5EIVA 1QRNA 4ZG1A 1MHEA 3G5ZB 1LK3L 2HWZL 3GKWH 1MRFH 5CWSA 4M7KL 4MZ2A 1YN6A 4WRLA 3UO1L 3MV8B 3ZTJG 5EU7C 5IFAL 1XCQA 1IEHA 4JQVA 4UBDC 4XMPL 5J3HD 2BSSA 2GJZB 1ZLUH 3IKCB 4JZJC 3C6LA 3T77B 2FBJH 5C6TH 4HIXH 4C55A 4RAUA 5EU6A 1ND0B 4OLEA 1I9JH 3OR7B 3P9MB 2DIBA 3LKPB 3NIFE 1U3HA 3BXNB 5IMOA 1C16B 4JPVH 3KPSD 1WEJH 1BOGB 1A6UL 2FX8H 1AJ7H 3DJ9A 5EBLA 3NIDE 5GISL 2ZUVA 3MLUH 4GAYB 3TO4C 1C7TA 1FNEA 1C8PA 4JFEE 3IDMA 2E7LA 4L3EA 3X12A 4P3WA 3KPQB 5IQ7H 4BH8B 1IZKA 5HI3D 1LQSR 3GK8H 2O5YL 3KLAA 2CJUH 4WEUD 3NCJH 1YEGL 1QFUH 1F58H 4WUUB 3WKNA 3LEYH 5C0NC 3S35X 1D3CA 1NJ9A 1REIA 1T20A 3D2UD 4LARL 4A6YB 3ROLB 3ARDC 3GSXB 4KQ3L 5TH2A 3KDMA 3M17B 4PBVC 3H42L 4PGBB 4WI4A 5FYLD 3LPFA 1OPGH 2BXZA 4X7TA 4RGMB 5TGBB 4XVTL 2PTTA 3C5ZD 1HINH 5F3BA 1YNTB 5TE4H 4PRBB 2ZWLT 5C8JA 1RAMA 3LKSB 2BVOB 3BPOB 1PG7X 4ZO8A 1BD2B 1N64H 2IQAB 3BIKB 3DURA 4M7LL 3VXUD 3ULUD 4MMXC 4HKXB 2B1AL 3UTTD 2IAMD 3A6CL 3GKZA 3FB7B 5F1NB 2IANB 5I0ZA 3KAAA 3RY5A 4C56E 4ERSH 4L8CA 5L2JA 2NXZB 2APFA 2XFXA 2NW2A 1XGQA 4JFOA 4ENED 3RHWK 2R8SL 3L6FB 2V6HA 3O6FD 1HZHH 4OAWA 2RQ8A 4HLZG 1A6WH 4OV5A 2WBKA 2CR6A 2P1YA 1FG9C 3L95B 1QPXA 4GG8B 3UTSA 2VKWA 1KJ2B 1F3JB 3E1F1 2MFNA 3WJLA 5AWNH 1S7RA 1CFVH 2FJFA 3ARGD 4D2NA 3OHXB 1LVEA 2VLRD 4RZCB 2XKUA 2DQTH 2A83B 4RGNB 1JPFA 4GQ9L 1OAZH 4K2UL 4P0DA 2LU3A 2Y36H 3O3DA 3VXRD 5CZVL 4CDGC 3V4UL 2DQDH 2Z35A 4ZFFB 1NGYA 3IDIA 5E94A 1UM5L 3SJVE 3MV8D 1NGWB 2EE2A 1T89C 2XPGB 2XV6B 4RA0C 3OAYK 3MRMA 1CLOL 2YC1B 1J0ZA 1JRHL 2CDEA 4LVNB 1P2CA 3MJ7A 1CXKA 4LNRB 3TN0D 3BHBB 1AXSA 3MRQB 4GW5B 2FJGB 4XVSH 3AUVA 4HG4J 5IMMA 5KANI 3GO1L 3MFFB 4RGOH 2C3GA 5EU3A 4KK8D 2OBGA 3E6HB 4BZ1L 2LFGA 4PFEA 5I6XB 1UACL 4HFUL 3HTLX 4E42B 5BZDA 2D7NA 3FQXB 3GNMH 2H9GA 2F54B 2X7LA 3RBGA 1A7QH 4EI5A 3K2MC 4NUJA 5E1AB 1BFVL 2UVFA 4LCWB 4X6DE 3VXOA 1EAPB 1JGLL 1UEYA 1OL0A 3EO9H 3C5SB 1D5ZB 5GZOD 2AS5M 1I1AB 4Q9QH 1LO2H 4HXBH 1F3DJ 1TPXB 4QXWA 1J11A 1UWEL 2A77L 1NPUA 4ZFZA 1BPVA 5GGVH 4AM0A 5HJ3A 5T1DL 3O6LH 1LEKB 1YECH 2H2PD 3R1GH 2ICWI 4X4YA 4P5KA 2R2HA 1UKSA 5TE7H 1TZHA 4UIMA 1FFQA 5SWQB 2VJXA 4KVNL 3PWPB 5DD0H 5E00B 1LEIA 4QY8A 2B5IC 5IF0A 1JN6B 4PG2C 4IRSB 4H8WH 2PXYB 2Y4SA 3VRLE 1CICA 4PY7A 4N5EC 4JO4H 3JV6A 5FDWB 2VDQL 1BAFL 1RZJL 3T2NH 4LCCB 2A6IA 4MNQE 2IMNA 4G8IB 2ZP0T 1CTNA 3PG2A 3VH8A 4Z7UA 2N56A 1AI1H 1RUAH 3AVEA 1WCBA 5E9DA 1CFQA 5KSBB 4CW1A 5GGSY 2HJLA 5E8EA 4XBPB 1LDPH 2V7HA 3H3KA 4M7JL 1UCTA 1GGBL 4RGND 4A6YL 5FOBA 1OAXL 3WE6B 1ZGLM 5E2UH 1QQDA 1X4XA 2AJVL 3BZ4B 1BIIB 4N9GB 4M93B 4ONFH 1IT9L 3FT4A 3DVGA 1NLDL 3VWJB 3WDJA 1MEXL 4CU8A 12E8H 5KVFL 3U6RA 3MLYL 3HS0B 4GW1A 5ICXB 3QNXB 1ZLWH 5CZKA 3QUXC 4L8SA 1S9YB 2IJ0C 1R24B 4R96B 1HSAA 5AYUH 1NL0L 2LAGB 3O3BA 4PJ7E 2AK1H 4OLVL 4HUVA 2WBJA 4QRQA 3RVVD 3D18A 2Z0BA 3F7YB 4PY8J 3JWNC 3SQBA 1KJ3H 4DQOL 1T1YA 3FQRB 3D0LB 4X98B 4R97B 5C0JA 4D9QE 1U8QA 4QRPA 2GK0A 4HPOL 3IT8D 4HK3J 1S7XA 1ZLSH 1KJ2L 2VN4A 1VB9A 3W0WD 4GJTB 3MACL 4P5MB 4CL7A 2AABL 1FORL 1XGUA 2C3WA 1Q8MA 4ZPTB 4LCWD 3QIWD 3BKJH 2IBZX 4PJDB 4XI5D 3SBWC 4GKNB 2WQ8A 2E7CA 3HG1B 4QOKA 1YYLL 1YMME 1IQDA 3BDYL 5I15L 1F2QA 3IJSA 4YHOH 1I1AD 4FS0A 1OM3L 4ONGH 5MERB 1U58B 3F6LA 4PB0L 3MNVB 1P5UA 2GTZA 4HCRA 3BRGC 3UJJH 1XF3A 3TF7C 1AKJA 1DBML 4Z7NF 3C60B 3MODH 3V5KA 1HDMA 5D71L 4NRYB 2VXVL 3TM6A 5CJ8A 5MEPB 4LHUB 3PWPD 3OMZA 2D31B 3V6OE 2AGJH 1WK0A 3VXPA 2VSDA 1LP9B 4FG6D 4HF5L 1QOKA 2E27H 2XQYG 3V7MA 1RJZB 3HE6A 4EOWL 4F8TA 4KC3B 3FRPA 3VI4E 2GT9B 3RNQB 1RV6X 3BESR 2Q76B 2IQ9L 5JLZA 4Z7UF 1MCQA 4KAQL 5BO1H 3ARXA 4NRXA 4CJ1A 4L4TE 1T83C 4IOFD 3T0XA 4MNGB 4U6VL 3U46B 1OTSD 1D5BB 4XAKD 3OAUH 4U33A 3QWOB 1D5XB 5DEGB 5I1DB 5HDOA 1U8JB 1PG7L 4YDIH 3ULSA 4ZO9A 4CVUA 3AB0C 5CEYB 2ICES 1B0GB 4DKDC 1CVRA 4QHKJ 5C07B 4W4NA 4LF3B 4JY4B 4MAYD 3VWJD 4PB9L 4M6OH 3ZTNH 5C09D 5EUKA 3TV3L 3CCHA 2DBLL 3T8XB 3WS6C 3QO0B 2W07A 3B9DA 3EYVB 3CUPB 4FXKA 2ATPA 4UIKH 4JRYE 1QRNB 4HAGA 1MHEB 1DFBH 1FL6B 1A1OB 1MI5B 5CWSB 2O61A 1MFEL 3IDNB 1UM4L 1JJUA 1YN6B 4FOMA 2J12B 2BOCB 5FCUH 1H9VA 1XCQB 1JHKL 3VFWA 2BSSB 2BRRH 2R0KH 1MQ8A 2HJFA 4YBQC 2ATKA 3C6LB 4G6KH 1QLEL 2UWEA 1DQLL 4FP8H 2R9HC 3TWCH 3P4NA 5GSRA 1E6OH 1HWGB 1T21A 1NKRA 1BQUA 1J12A 3QDMA 2DICA 4I77H 1SM3H 4AEEA 1U3HB 5IMOB 3G6JE 3BP6A 4TUJA 1BJ1J 2CXGA 1EMTL 5ITBL 1CT8A 4N0YH 2CMRH 4LQFH 5KVEH 5EBLB 5I1LA 4P3CH 1LMKA 3TJEL 1FNEB 2YXMA 4RWYH 4KRPB 4Y2DA 1WJ3A 3IDMB 5B38A 4UT7H 4L3EB 3VFGH 1Q0YL 2FLBT 3TVMA 4OSUH 5I1IL 3KLAB 4I3SL 1A22B 1AC0A 1FLRL 4IEFB 2VLKA 3S4SA 1G6RA 2CPCA 1RSFA 3GM8A 3QQ3A 1ROWA 3ZE1E 1NJ9B 2QV2A 1T20B 3DMMA 5I18H 2HYMA 3L3KA 5GS0L 5TH2B 2FECI 3KDMB 3UJTL 1A7NH 3CZJA 4J6RH 4Q0XH 5FCSH 5BVPH 3I3EA 4AG4L 4X7TB 4XHJD 1Z3GH 2EDLA 2AJUH 1HKLL 5F3BB 4JRXD 2NY1B 1CU4H 1QBBA 2BNRD 4RRPA 4LP5A 1X5AA 4BYHA 5C8JB 4YH6A 1YPZF 4BZYA 2RFXA 5GRWA 4XNZC 4BUGA 5C3TA 4QWWD 4XP4H 3DURB 1LO3L 3ZL4H 2C3HA 1MFBH 3DGCR 3I85A 2FGWH 1NFKA 1WF5A 3QUMB 2J2ZA 4L8CB 3NFNA 1J8HA 2XFXB 2NW2B 5I73B 2GCYA 3S97C 3TH2T 4K3DH 4OJFL 5D4QA 1I3GH 4OAWB 4NCC1 4OV5B 5L0QC 4FQXA 3UTSB 4UU9A 5B8CA 2HLAA 2Z93A 1SEQH 4JFHD 5D7IA 1S7RB 1OSPL 2FJFB 4JM4H 2Q7YA 3NABH 4PUBL 1I7RB 3O3AA 1UYWH 4G8FA 1I8LC 2EDBA 3WNLA 1QRND 2VL5B 1BBDL 3TT3L 3EZJB 2Z35B 1NGYB 3IDIB 5E94B 5FEBA 5CFHA 4PGZA 3WS3A 1IARB 2FYYA 2M1KA 4GXVL 1NAKH 3FZUD 2EH7L 3IFNH 4GAGH 4ODWA 1JMZA 3GSNH 4CVZA 3MJ7B 4HC1L 3OJMB 1ACYH 5I30L 1C7SA 5GGTL 4HIEB 5EU6D 1E4KC 1AXSB 1ZLUK 4LHUG 5IMMB 3LOWA 3PHQA 1P7KA 2HT4D 3VJ6A 4YBLB 5EU3B 1NMCC 2OTUA 3I6KB 4PJ5A 2V7NA 3QDGA 5IVXA 1KXTB 4MJIE 1RD6A 5BZDB 3KLHC 1U3YA 5JIPA 2P42B 5GS2H 4PRPE 4W4OC 2H9GB 2X7LB 4EI5B 1SBSL 5L8LB 1AH1A 3VXOB 4KK5D 3HNVH 1TNNA 2YUZA 5JHDA 4KV5E 4LRNH 1M7DA 4FQCH 2P5WA 4Z7VF 3ELAT 4XC3L 4PJAF 3PIQA 4ZFZB 4DAGL 4AM0B 4XB8A 5HJ3B 2BVYA 4OF8A 5SV4A 3F62A 1FHGA 2R0WH 4MXQD 4X4YB 4P5KB 5F70A 1IGTB 2R2HB 3SDCC 3TA3C 1TZHB 4UIMB 1KIRA 4TTDC 5DJYA 1HNGA 1N6QL 2EXWC 2WQRA 1LEIB 4QY8B 1I9RH 5IF0B 5I1GH 1I8MA 4HIHA 4PJGE 5SWZE 4YIQA 5TDOA 1CICB 4PY7B 2Q87A 3JV6B 3VGHA 2QQQA 2L7UA 4S10A 1MCJA 1VDGA 3BKCL 2A6IB 2WBWB 4NJ9H 1ZA6A 3ARFA 4CN4A 4CJ0A 2D7MA 4AL8H 3VH8B 4Z7UB 3SKMA 4OZIA 1WCBB 3SKJL 5E9DB 1CFQB 2AEPH 4CW1B 1JPTL 3UTSD 4LVHC 5E8EB 4DVRL 2V7HB 5EPMA 4PRAA 1M71A 4OFKA 1RFDL 4RMTA 4Q9RL 4FZEL 5FOBB 1IRAY 5DQ9B 1G7MB 2MPAL 1QQDB 3S88H 1AD9A 3IS1X 1HXMA 2BVEA 2NLJA 3FT4B 4FFYH 3DVGB 2WUBH 2X41A 2JELL 4HKJA 4ISVA 3MUGB 4HWZA 4UOW0 5I1HH 2X10A 3LQAC 4D9RD 4N8CL 1H15A 4L8SB 5ERWA 5DD3H 4MNHA 3PDDA 1B0WA 4N0CD 1I1YA 1HSAB 1X5JA 4XRCA 2LABA 4HUVB 2XZAH 3AREB 5C2BH 3LQMA 4QRQB 2DN7A 2I9TA 4NZUL 1MQKH 1UXSA 3NAAL 4KUCD 3QUML 5D72H 1LE9B 5IHBA 1KN2L 4PG9A 1T1YB 4JZOB 4BQCA 4Y4FC 3LQAH 1QNZL 1RVFL 2OTPA 3F58L 5C0JB 4AMKH 2JIXD 1U8QB 2GK0B 2UZIL 3MCLL 5T1LD 2OP4H 3JUYA 1S7XB 5TDPA 4HWUA 1WZMA 4R26L 5D1QC 1GZPA 3ISWA 3VMNA 4EI5D 1XGUB 5E95B 3T0EB 3TP4A 4GMSH 3STLB 3QZWA 3A0OA 2VWEC 1IMHC 4PJBA 1IGYA 2RBLA 2HP4A 4QOKB 1IKNA 3AY4A 5CUSL 1IQDB 3IJSB 5J13C 1JVKA 4XWGH 2D3VA 2R4RH 5CGMA 4TPRH 1QFWL 5DVOA 2GTZB 4WU7A 2H2SC 3EOTL 1XF3B 1AKJB 1EBAA 3V5KB 1HDMB 3VGDA 4CKVX 1MFAL 1J88A 3B5GA 3VG9C 3QDAA 4WNQA 2Q8AL 2YSSA 1J05A 3Q6GL 3G5YA 3VXPB 4O2CA 1ITCA 4WEBH 4LMQE 2I07A 3M8OH 5SV3A 1WFUA 3O9WC 2GEEA 3ZMRA 4PJ9A 3LEVL 5IW3A 3SCMC 2Q6WA 5JLZB 4X7FC 3T4YA 4NRXB 5D6DA 1YPZB 4OF5A 1BP3B 4JQIL 1U36A 4F15B 4NQDA 4TN9A 2HFEA 4EIGB 2VC2H 3HZVA 1BZ7B 4KTDH 2DQJH 5DA4A 3U82B 2N1KA 3ULSB 5F9AC 3QHZL 5EZJA 1F11A 1PKQB 1KFAL 2UY6A 4JG1L 3MRLA 3QAZC 5FECA 3MBXL 1A6PA 5DRWA 4NNPL 5EUKB 3CCHB 5DJ8B 1X5FA 3GBMH 1MNUL 2F53E 2O26U 1INQA 3G6DH 4P2RE 5I71B 3ULVF 4KKAC 4FXKB 4YE4H 2HKHH 3HE7A 4OGZA 4HMCA 1D9KB 2VOTA 2WBJD 5L88L 2O61B 1RURH 3V79C 1BFTA 4G9FD 4LNVA 4FA8A 1ZLWK 3HI6H 2HJFB 2ATKB 2J6EA 3QUZC 1I1RA 3BGMB 1TVDA 2OLDA 3UJIL 4HW6A 2UWEB 4QRPD 3QCTH 5EC2A 3P4NB 5GSRB 3RTQC 1T21B 1U0QA 1UM6L 1J1OL 3QDMB 1LK3H 2BP3A 3H9HA 4FQLL 5CHNA 1CBVL 2X2YA 3BD3A 5L2KA 6CGTA 3BP6B 5E6ZA 4TUJB 5FOJA 3P9WB 5FYKH 5IUSA 2E6PA 4MWFA 5F7EL 4MLIA 4N1HB 3E8UH 5I1LB 4Y4KD 4OB5H 5IVZA 4YHPA 5B38B 1JNLL 4ZS7L 4KROB 3P2TA 3TVMB 3VH8G 4P5TA 3ZDYF 4FTVE 5DK0A 3RGVC 4OKDA 1AKJD 2VLKB 1QZ1A 4YEEA 5BS0A 4WHYG 3S4SB 1DVFB 3IDYB 3HKFA 2MHAA 3DMMB 2PTUA 3B8YA 2DQIL 4DGYH 3C08L 1V3KA 5GISH 1TZGL 2Q8BH 2MOVA 2VZSA 1U2CA 3HE6D 1CL7I 1IGIL 3LKNA 5J3HC 4ZD3H 4NUGL 3NFPB 1CFNA 2O5YH 1KCVH 4FNLL 1RJYA 1RZIA 5T33L 4OZFA 1YEGH 4FQJL 1F8TH 1JCKA 4G5ZL 2RFXB 4JB9L 4R4FH 1JYXA 5I1EH 3CSPA 2DJSA 1UWGL 25C8L 4C54A 3QIUA 5AAWA 1KACB 1BD2E 4OQTL 1YY9D 2DD8L 3H42H 2YWYA 5CSGA 3NFNB 1J8HB 3RHWF 3DHJA 3ARVA 3MCG1 4XP1L 2IANE 4CGTA 4M5YH 1EIBA 5F7UA 1B9ZA 5I16A 4HCRL 3MRIA 3GRWA 1XH3A 5EB9A 2H41A 4U1LA 5D1ZA 5B8CB 4YZFE 1GH7A 2HLAB 2Z93B 3CFJA 4HWBL 2Q7YB 4H1LA 2F9BT 4HDIB 3O3AB 3FOMA 3TBYA 2B1AH 4G8FB 3A6CH 1T1WA 4DGVL 5J06A 3JVGA 4M6NH 1P9MA 4XPGL 4R8WH 4KY1L 4MJID 5FM8A 1VFMA 5C3LD 3KYNA 2N4IA 2R8SH 1T7VA 4QRRE 5D93B 4MJ5A 5DK2A 3DVFA 5F7YC 3WS3B 5DRXA 2AXGA 3O2DA 3PXJA 4G6AC 5GGUA 3RUGA 4G43A 2Q1EA 5IEHB 3C5ZC 3RWGA 4ODWB 3SGJA 1CG9A 4JFDA 3VD9A 1J5OL 3LIZL 1DBKL 2EDDA 4CVZB 4ELKB 5J12B 4WHTA 3EDEA 4GQ9H 5IHUH 2WP3O 5SWSE 3WHE1 4LHQB 3ULUC 3KPMA 4Q9CA 5HHVH 2IAMC 3BX7C 1UM5H 5FYLH 3VFNA 2J88L 2O5ZH 1P7KB 3VJ6B 1MY5A 2VDOL 4ELMF 1UKQA 3B8SA 1A6VL 4ENEC 2OTUB 1PY4A 3FRPG 4PJ5B 1HE7A 4F9PA 1BVZA 2Z91A 3QDGB 2FR4A 4Y2DD 3SDDA 1O0VA 3QXWA 1K8IA 4XNYH 3VG0H 4PTUA 3O6FC 4RFNB 4HPYL 2ENYA 1FAIH 3ULUH 3OZ9L 5CIPA 4UDUB 3BPNB 4U7MA 3ARGC 1IC1A 4JLRA 2VLKD 1NCCL 1R3JA 3GO1H 4EUPA 4Z78B 2I5YL 1CI5A 1L6XA 2GJ6E 3DMMD 3S34L 4NNXA 4ACPA 1M7DB 2P5WB 2CKNA 2EDWA 4BZ1H 3HNSL 2AXJA 5HHOD 4UTAH 4PJCA 3TZVA 1U8KA 3PIQB 3P0VH 5HHPA 4X4MA 5LG1A 5IM7A 3BE1H 1R3KA 2DJUA 1ZVSA 2AKRA 2C3XA 4TNWK 1MCIA 5FUCC 3ME0A 4M03A 5HGGS 1KIRB 1JGLH 5DJYB 3UC0L 3MPCA 3TN0C 3MV01 5CGTA 4FQ1H 4XPFL 1I8MB 4HIHB 4DJMA 3MX0A 1VGEL 4YIQB 5TDOB 4OLUH 3WNKA 1IGMH 1UWEH 1QEWB 3WFZA 1J8HD 4KK8C 3QG6A 4XMLL 4RIRA 3SE9L 3NZ8A 4JGMA 4EI6A 4ALAH 4C4KT 4OZIB 3K74B 1CR9L 4FQXD 4KVNH 4NC1E 4QHMA 2G9HA 3GSWA 5EU4A 1M71B 3MRPA 1F3RB 1JF6A 1S7WA 4XPAH 5F9OH 5HDBE 1GGCL 4ODVL 4DUXA 1NGQH 4KRNA 5T5FL 4XPHL 3EUUA 1AD9B 4I13B 5GZOC 5CZXD 1HXMB 4KZEH 1C5DA 3OKNA 4HKJB 4ISVB 1U3ZA 4YDKH 2NX5A 4HWZB 5B38G 5E8OA 3GMRA 3RUGF 1PVHA 2A38A 4U1NA 4CRPA 5LKNA 2H2PC 2RGSA 1H15B 1NGPH 5ERWB 1JZ3A 4MNHB 1MUJA 1I1YB 3MXWH 3PGDA 4WCYL 5ADPH 3VD4A 3BPOC 3QXUA 4PV9A 5L9DL 3PL6D 4H5SA 2AJVH 4OFYD 2I9TB 3Q5OA 1UXSB 2X70A 4PG9B 1KIQA 1NLDH 3VRIB 1A3RH 4I4WB 4UDTA 3Q3GA 4HBQA 1DL7H 4ZQKA 2NY2D 1J10A 15C8L 4YFLF 5TDPB 1MREH 3NCBB 1NL0H 3RIAK 1IGFL 2W9LA 1GZPB 1C08A 3U7YH 3I3DA 3QZWB 3HLAA 4HJJL 3I6GA 4L29A 5FM5O 4PJBB 1GZQA 4RGNC 1IGYB 4U1GC 3WIHA 3P77A 5JHDD 1RIUH 2A2QT 3QFJE 4PJCF 2AK4A 3HG1E 2XY2A 5D2LF 2ZUWA 1HYSD 4WU7B 3U9PL 4MA7L 3KR3L 4X8JA 1KJ2H 3FO0L 1BM3H 3PGFH 3MACH 1MCSA 2FATL 2W60A 3FO2A 5HYQA 2BJML 4WNQB 2XTLA 3S8WA 4QNPF 1GCFA 3SGEH 2UY7A 1J05B 1YYLH 4J12A 4K8RD 3G5YB 5I15H 4MAUL 3RVVC 4O2CB 1HEZA 2ZSWA 4HWNA 4Q6IC 4PB0H 1UENA 5TDNA 3UBXA 4PJ9B 5DQJA 4S1SH 2Q6WB 4QHLA 3KLSA 5JHLL 3ARFD 4KVCL 3T4YB 5D71H 3FQNA 2VXVH 3IJHA 5HYSA 4OZHF 4POYA 4JRWA 4NQDB 2ZCKL 1RU9L 5AAMA 4MNGE 2HFEB 2A6JA 2WWKT 3HZVB 2Y5EA 3QIWC 3BRFA 4HF5H 1MCDA 2YS4A 5TQ0H 4NCC2 4LPYA 4XI5C 3S35H 4HUKB 4GXUN 5EZJB 1F11B 5DRNA 2BCKA 3IGAA 5E8PA 1I1AC 1II4E 1S5IL 3U7AA 3PDOA 3MRLB 1NCAL 5FECB 4KAQH 2E7MA 5C07E 5DRWB 5DR5L 1KLUA 1INQB 5D70L 4ONHA 3ALPA 2DWDB 5D7LE 2VUOA 4RQQA 2FX7L 5A2IH 4G7VH 1V3LA 1RK0A 3FTGA 1I8IA 5TE6L 2R39A 4FG6C 4Y5VC 3RWEA 6FABH 1MI5E 4OQ1A 4GW4A 2BFVH 4PB9H 2VR5A 4K71B 4LCCC 2HVKA 1R3IH 5JXEA 3JTTA 4M8VA 2P8PA 3OF6D 3PHSA 5EC2B 4RFOL 4QXUH 3CIQA 4MX7A 1T66D 5FUOH 4IOFC 3MXVL 1KIPA 3H9HB 5CHNB 2FB4H 5L2KB 1ZVHA 2JLLA 3Q48A 1MFEH 1OTSC 4WUKH 1W8OA 2NW3A 5DSCA 4MWFB 1DBAH 4ELMB 2F5AL 3KVQA 5EG6C 3E6FA 2AJSH 5IVZB 2V5TA 4WEMB 4Z0XA 1VERA 4XVUD 1EZVY 4MAYC 3VWJC 4P5TB 3IAPA 5DK0B 4UB0L 2VLME 4LKXB 1D6VL 4L3EE 1XGYL 3O2VL 4NN6B 3ULVL 5BS0B 1EMTH 3E2HC 3W82A 4DGIL 2MHAB 3PNWA 1BQLL 2WZPD 5A2JH 2VSCA 3K8KA 1WWCA 4FHBD 5INCA 2JB5H 1E6JH 1LHZA 4G8GE 3O45A 5A1AA 5BMFL 2D0GA 2ID5A 4K3EH 2G60L 2R2EA 3X3GH 4OUUA 3LV3A 5I1IH 4MQXD 1RJYB 1RZIB 4OZFB 3DUHA 1INEH 1HKFA 3U48A 3IAGC 3IYLW 3RVUD 1YEHL 2FEEI 2WIIA 1CGWA 4X4XA 3C2AH 4URTB 3QIUB 4JQXC 4NQDD 1A3LL 2PO6A 5EBWA 3H3BC 1OLZA 3FOLA 4R0LA 1HYRC 1Z9SA 4YGVA 5EN2B 3D1MC 1HKLH 2XWBA 4WW2C 3WN5A 4GFTB 1VADB 5I16B 3MRIB 5TQ2L 5E2TL 1XH3B 1T22A 4U1LB 5D1ZB 2NY3D 3BQUD 3CFJB 1WTGT 3GIZL 1VGKA 3IXTA 4H1LB 3TJHD 5JQ6L 1TCRA 3FOMB 3WDIA 4G7YL 1T1WB 2LV4A 3DX6B 2P46B 3HE7D 2HH0L 3QZWG 5J1SC 1MIEL 1OGAA 3CSYA 3KYNB 4PJFA 3IU4L 5DK2B 3MJGX 5HGHA 1KENL 5DRXB 3H3PL 3THMH 2AXGB 4KI5F 3IJYA 1PLGL 4XHJC 5GGUB 1MCNA 3RUGB 4G43B 3P4OA 3RWGB 3QEQE 1CG9B 1P4BL 4JFDB 3WSQH 4YGAB 1CE6A 1BWMA 2DLFH 2R69L 1P4IH 3HN3A 3MLWH 4QWWC 4MJ2A 1T2QL 1BBDH 3KPMB 2A6KB 4IIQC 4S2SA 3T1FA 3MLVL 3BOVA 3LHPL 4Z8FH 2GFBA 3LVEA 1HK6A 2HTLD 1RUKL 3OKKA 2EH7H 1S8DB 3BZDA 3LDBB 5DQDL 5EO1A 3IF1B 2Z91B 2FR4B 3SDDB 1CFSA 1K8IB 2IMMA 1FFNA 3LS4L 5I30H 3CDGA 4P5TD 2VE6A 1IC7L 1VA9A 3MLSL 1FYHB 4OCSH 2BSRA 1OF2A 4PJEA 4JLRB 2ESVA 3FN9A 4NKIL 1R3JB 4GOSA 4EUPB 3FO9B 4X9HA 3IFOB 4NNXB 4YHML 4O9HL 4F57H 2D2OA 1URLA 4PJCB 3TZVB 2A9MH 1U8KB 5HHMD 1T7YA 5HHPB 1ZKAA 3VMPA 1DBBH 5IM7B 1CD0A 5E70A 2J6EL 3FZUC 3DPBA 1R3KB 2XZQH 4NFDA 4KGLA 4YQXL 4JFFE 1LD9A 4F7CA 1W0WA 1OTTD 2D9QB 1BFOA 1WAAA 3L5JA 5EOQH 1CS6A 3BJ91 5K9KA 2WP3T 2X42A 2V17L 1IILE 3LZFH 4OD3L 5I74B 3S36X 3WXVL 3RKDD 3V6ZB 4XC3H 1PEWA 2HT4C 5HI4D 4L3AA 5JXAL 2P49B 3QG6B 1LDSA 4RIRB 3LQZA 3NGBC 4JFZL 2NCMA 4WO4A 2KH2B 2X4UB 1A7RL 5I76A 2E7LC 4NM8L 4KJQD 3MUJA 5HI5D 4OGYL 4YO0A 4Z7UE 3EDJA 4QHMB 1N6QH 2G9HB 2KZWA 2OI9B 5D1ZD 5EA0L 3GSWB 2A9NL 5E9DE 3MRPB 4KK5C 2LAAA 3V9FA 1S7WB 1UADC 5E99L 1EEZB 3HUJA 2NNAA 3VCLA 4M4PA 5CKGA 4POUB 1WFOA 4HGMA 4X9FA 1BJ1H 2ZCHL 2FIRT 4I18A 4PG2A 4XBGB 4NYLB 5JA8B 1C5DB 3OKNB 2UZXB 1A47A 4NQCA 2Y9RT 4J7RA 2R29L 5F1IB 1E4XL 5E8OB 5JOFA 1KTKE 3SN6N 3KPRA 5K9QI 4MXQC 1G9ML 4JFDD 2VDKL 1RFDH 3U79A 2ADFL 3GMLA 1MUJB 1NFDA 3SOBH 1GIGL 3B4NA 4Q9RH 5C0AA 1ZWIA 2HT3D 2AQ1A 3BKYL 1QFWM 2LU4A 4PV9B 4H5SB 1KEGH 5L8KB 2HG5A 4ZYKA 2X70B 1F6AA 3QHFL 3L5HA 1U8OA 2JELH 3ZKXC 4JVPA 2AJXL 4NO2B 3EOYG 3OTTA 1DQDL 3CU7A 1KCUH 3PXHA 4NFCA 4FMKA 4XH2A 4NZJA 4ZQKB 3VFMA 2GSGA 3GRWL 4OZFG 5D96C 3SDDD 4QXGL 2QQLL 5BOPA 5EULV 3SDAA 3IRPX 1C08B 1VEOA 4PJEF 1A7PH 3WJLC 4BKLA 1YDPB 3HLAB 3I6GB 1HQRA 4L29B 1OAYL 3CU1A 1GZQB 4AEIL 3T0EE 4IRZL 5I8KL 5IVOA 3P77B 3RBSA 1H5BA 1RVFH 1UXWA 3F5WA 2AK4B 3DV6A 3TZVD 4R2GB 2UZIH 3O2DL 4X8JB 5D2NA 5DVMA 3RVWD 3MLRL 5GIRA 2MQCA 2W60B 3FO2B 3MRKA 2YPLE 4G6JL 3UEZA 1WAAF 5HYQB 1AQKL 4N0CC 4DW2L 4C59B 1CIDA 2XACC 4PGJA 2LVCA 3K7UA 5C9JB 2ZSWB 3SBWA 4YHYC 2XICA 3NBNA 5TDNB 1XR9A 5D7LD 3SPVA 3EOTH 3UBXB 5DQJB 4GMTH 4QHLB 2PCPA 5KVGL 5FV2A 2EO9A 1F4WH 4KTEH 1MFAH 4FZ8H 3FQNB 3IJHB 4KTYA 5HYSB 5ISZA 3QRGH 1MPAL 3GIVA 3O4LD 1GJIA 2KUTA 1A9EA 1YPZE 2XWJB 2GJJA 4EI5C 2V2WA 2A6JB 5DURD 1NANH 3IDXH 1UJTA 1CGYA 4F7MA 1P53A 4ZFGL 2NMSA 1GAFL 2A73A 5DRNB 2BCKB 4P2QE 3IGAB 3LEVH 1Z0MA 5E8PB 2BY0A 3PDOB 4LLDB 1DLFH 2ITCA 2G2RA 4YUEL 1INDL 1PKQE 4JHAH 4ZNEE 1VCAA 2NX5D 1Q0XL 2PR4L 1GGYA 5GRYA 1JMXA 4ONHB 1FG2A 3RKPA 3KXFA 1NFDF 1EHAA 5FHBH 1T83A 1CF8H 2DQUH 4WGWB 4EUPG 3O81A 3OR6A 1RK0B 3FTGB 1I8IB 3WNMA 2CDFA 4KHXL 2X4OA 1OAUH 5LBSH 4GW4B 1UZ6F 1T80A 4U7KA 4YHKL 2D03L 3CXDH 2HVKB 3JTTB 2P8PB 4LLQA 3D6GA 4V1DD 1KPVA 3KHOA 5E4IA 1KIPB 2CDGB 2WANA 4F33B 4OF7A 3CDFA 3NCCB 3QDME 3MLZH 4BZ2H 2NW3B 5DSCB 3MZGB 4D8PA 2HMID 1HH6A 3ARRA 3EO0B 3E6FB 2EKSB 1UB5A 1TENA 4AZ8A 1CZ8H 3HI1B 4F7TA 4POZD 5E2WL 2ZUYA 5JW3H 4JZJB 1J1OH 2NXYD 5MP6H 2C26A 3ARYA 1RI8A 2CK0H 4ODHL 2GITA 5KG9A 3PNWB 3VWKA 1I8KB 3KYKL 3WLWD 3G5XA 4JDVA 1A8JH 1RK1A 2WBJC 3OL2A 1FVDA 3MYJB 2AJYL 3O45B 4GG6A 4Z7VE 5IB5A 2R2EB 4M1GL 2WSKA 3LV3B 1JTTA 4PJAE 2B4CL 1UVQA 1EJOL 4JHBA 4JGUA 4IMLA 4XVJL 2WLYA 2WIIB 1MELA 2K7QA 5ESAA 4X4XB 3LD8C 2J8UF 2DQIH 2Z4QA 2EDNA 2Y5TB 2VKXA 2PO6B 4R7DA 5EBWB 3FOLB 1MH5A 1WBXA 4NT6A 4R0LB 4YGVB 2HT2D 5CLTA 4AK1A 3ESVF 3WLBA 1TFHA 4Y4KC 1QD0A 3T3MF 3T08A 2XWBB 5T33H 3AS0A 5GGRY 4FQJH 3S36L 3NH7H 3OKEA 1T22B 2FLRT 4PS4H 5IT2L 4BJLA 1A3QA 4JG0H 2CSPA 3WO3B 1VGKB 4HG4K 1TCRB 4UNTA 2CKBL 4LCYA 3QT2A 4M1DL 4KUZL 4G9DB 3CSYB 4XP1H 4B7IA 4Q2ZA 1BWWA 4ZUTA 1NCWL 5FGCB 4PR5B 4FFWD 1TETH 4HCRH 3ZSTA 3IJYB 1J9CT 3HE6C 4XPTL 2X4TA 3FB6A 3P4OB 1AO7A 4M43L 3MOAH 1U8NA 3L7EA 3T0AA 5IB1A 3BH9A 1CE6B 4HHAA 1B2WH 2C4FT 3V4PL 4DGVH 3RA7H 1JYNA 4XPGH 5I9QC 4KY1H 1FVEA 2MCPH 4K7PH 1L9NA 5C2UB 2P7TA 4LU5H 4TVPD 4GS7C 5GS1C 4S2SB 4LSPH 1YY9C 1DSFH 4XWOD 3T1FB 4TSBL 4QRSA 2GFBB 3G9VA 3ZE2E 2AJ3A 3OKKB 4PJIF 4KHTH 5BOZG 2RR3A 5DEFA 5BRZA 1J5OH 1CFSB 1FFNB 5DD1H 3QBTB 3ZYJA 3GFUA 5KVMC 3CDGB 2VE6B 1PZ5A 1JUFA 4JKPL 1VSCA 5ENWA 1EHLL 2BSRB 1OF2B 4JJHA 4PJEB 2ESVB 5CP7A 4EBQL 5I71C 1S7VA 3O0RH 3GBNL 3VGFA 4LMQI 2J88H 1J1PH 4PLJD 2W0FA 1E4KA 2B1HH 2P45B 4S1QL 1FBIH 1G7QA 4U2YA 2DMKA 1JTPA 1GGUA 1NMBL 2P5WE 3I9GL 2XTJB 3D69A 4HPYH 1WVZA 2FCBA 3BPLC 1JRHI 1MRFL 4TNWF 1FNSH 3OZ9H 3FN0H 2WMPA 4Y7MA 4JFPA 5ESQA 1LD9B 4F7CB 4JHWH 1CXFA 1W0WB 4D3CH 3MJ6A 1JV5A 3FQWA 1F6LL 1U8MA 2HTKD 5K9KB 3S34H 3L5IA 2E6QA 2BERA 2DKMA 2FBJL 2BNQA 2RHEA 3LKOA 1JPSH 4RNRA 2PO6D 3CMGA 1Z5LB 4XPBL 1JWMB 1PZUB 4M7ZC 1D6EA 1I9JL 1MJ7L 2NY5C 4NN7C 1KCSH 3LQZB 1S3KL 3L5WA 4WO4B 4Y2DC 1FZOA 2FX8L 5I76B 3OB8A 1AJ7L 5E08L 3UC0H 4NM4H 4YO0B 3MLUL 1ZXQA 3DROA 1KCRH 1IC5H 1W8NA 5T3XL 5HXMA 1JGUH 5IQ7L 5E6IA 1E4WL 1NCDL 3HUJB 2NNAB 2NY5H 3IDYC 3NCEB 3QEUA 3VCLB 3DMMC 3NCJL 4I18B 1OGAD 2UZYB 1AGCA 3QNZA 2FX9H 1F58L 3PV7A 1MCEA 4NDMA 2DQGH 5JOFB 1MRCL 1RZFH 3KPRB 3DUSA 1EGJA 2DAVA 1A0QH 2WV3A 4P9HC 1G6RH 1NFDB 1OPGL 1CGXA 1ZWIB 1R3LA 2AW2A 2ZG2A 4ODVH 4OF0A 5C0AB 3UAJD 1XF2A 5T5FH 5GRXG 1YC7A 3QXDA 2HG5B 5ACZA 4BQ9A 1G9NC 5TE4L 3T0BA 3H9SA 1QPPA 1U8OB 5T3ZD 3MRCA 7CGTA 5IFHL 3VFRA 3F7PC 5F7KC 5KS9F 3HNTL 3ZZ1A 3QI9A 4P9HH 5CD3A 3VFTA 4NWTH 4XH2B 5J6HA 1A02N 4XBEL 3VFMB 2GSGB 2LVEA 3RIAF 4ERSL 2J5LB 4WCYH 3GI9L 4FQXC 1NBZA 3JV4A 5ID0A 1G9NH 1QSED 1DN0A 5L9DH 3QUXB 4DK6A 5HYIA 4BKLB 4KGJA 2YZ1A 4L9LA 5IBTH 1HQRB 2ESVD 4OF3A 5E5RB 1HHGA 5C0RH 2IPKA 4P4KD 2UV3A 1H5BB 1XIWD 5CZXC 5AWNL 1CFVL 1UXWB 3F5WB 4UAOB 2VXQH 4RX4D 2DQTL 3DV6B 3ZE0F 5D93C 1IAMA 4E9LA 2X4NA 2XTJD 1MOEA 3LEXA 4ZPVA 5E6YA 4F58L 2DQDL 5GIRB 3ZDYE 2CLRA 3MRKB 2ADGA 1F4XL 2Q7NA 5J12C 5D1QA 2ED8A 3PL6C 5F7HA 3ZHLA 5KSVA 5C0DA 3BDXA 4EZMA 1CK0H 5T1KD 1CGTA 4JANA 4KMTH 3GB7B 5DUMH 5AZEL 1XR9B 3SPVB 3Q5TA 5C08B 4QLRA 1YNLH 1HHKA 1FSKC 4XVSL 2PCPB 1WIUA 1KEML 1BGXH 4WO4D 2NY2C 3DVNA 1E0OB 4RGOL 2BJMH 4RFNC 5ISZB 3GIVB 5C92A 1A9EB 2J8UB 1M7IA 3C09B 4BFGA 2V2WB 3BPNC 3IDGB 4MAUH 4HK0B 4C57C 3T2OA 3NFSH 3GNML 3HC4H 2A73B 2E3VA 3QXVA 4WI2A 1A7QL 4OLXH 1JGEA 5JPNA 5F88A 5JHLH 4Z7WA 2ITCB 5FUZH 2G2RB 4NQCD 1HYSC 3CH1B 4I2XA 3F7RA 4I0PD 3UROR 1AR1D 3SCMA 1OQXA 3ZDZF 4Q9QL 1LO2L 4KDVA 4Y19A 2V5RA 1KTRL 2ZCKH 1FG2B 4HXBL 5C71A 3KXFB 1MVUA 1PEZA 1MCOL 5GGVL 3REWB 1WZKA 5JO5A 3QG7L 3OR6B 4K8RC 1ETZA 5KN5A 1TQCC 5TE7L 4Z76A 2CDFB 2X4OB 2BSTA 1NCAH 3KWWA 2YUVA 2VIRA 5DD0L 3UDWA 4PRHA 3QJHA 2YD8A 3AB0B 2W0LA 4M48H 4E41E 1CDUA 3TIEA 1G84A 3L3IA 3ARFC 2Z8VC 4LLQB 5D70H 4NQEA 1KPVB 4X7DC 4JO4L 2F74B 1UA6H 3SDAD 3T2NL 1I3UA 4K8RH 1RIHL 2Z8RA 5IESH 2YXFA 4Z7OF 1AI1L 1RUAL 3QPQD 4HEME 5IMKA 5TE6H 5H2BA 5L2KE 4UQ3A 3I75A 1D5IL 5JMOC 3BW9A 4L1DA 1HH6B 3QDJE 4LLAA 4HWEH 1QSFA 1UB5B 1X5KA 4PJIB 4Y88A 4HUXA 1XAUA 4ELME 4PRIE 5I1JH 4P99A 4NO3A 4U0RC 5H8DA 1AGBA 1BQHA 5MHSE 3V8CA 5E2UL 1MCCA 2ZKHH 3VXQB 1I4FA 4HIIA 3W11D 4QRUA 2DQFA 4OIIL 1L7TH 4XAWH 5KG9B 1KTLA 3GMQA 3VWKB 1DQJA 2C3VA 8FABB 3RTQA 5BS0E 4W6WB 12E8L 3G5XB 3VXMA 1YQVH 4JDVB 1W0YT 1V7NH 1RK1B 5JQHC 1FVDB 4MB5A 1VEPA 4GG6B 4BK5A 5AYUL 5IB5B 2AK1L 2NR6D 1JZ7A 3PUCA 2KKQA 4LKCB 1WZ1H 1UVQB 4KKNA 1XGYH 3O2VH 2EIBA 2ZUQC 1KJ3L 4IMLB 1JWSA 1T66C 2V9QA 3RGVA 1X5IA 1G0YR 2Z4QB 1CVSC 1U95A 2MKLC 4R7DB 4FABH 1MH5B 1WBXB 4NT6B 1D7FA 5BMFH 2DLHA 1TIUA 1ZLSL 4UMGA 3ARBA 3WLBB 3WV0A 3HB3D 3U9UA 3S3JA 1XGTA 3V0AC 2NY0D 1OT1A 2FO4A 4XXCA 5EIQA 2FGZA 3BKJL 1MCLA 2NTFB 1EFQA 2OR8A 4XVUC 3OKEB 2DI7A 2VDPL 4YHOL 3MUY1 4ONGL 4DOHB 3B43A 2HKFH 4KH2A 4LCYB 4XNZB 3WDHA 3G04B 1HWHB 3SQOH 2C5DC 1JIBA 1KC5H 4PJ8D 4KMLB 2IADA 1WZLA 4S1DD 5M94B 4Q2ZB 1T1XA 4ZUTB 3V2AR 4L8BB 4Y16D 3T1WA 2Z8SA 5DDHB 4WWKA 4PY8I 4Y1AD 5BW7A 1RZKC 2R1YA 3ZHKA 3FB6B 2DS4A 4MQXC 1U8NB 3GIZH 5EWIH 3L7EB 5IB1B 3BH9B 3RUGE 1PX4A 3RVUC 2YPKA 2NPLX 4G7YH 5D6DC 1I1CA 5C6WH 1NQBA 1FVEB 1SJEA 3EAKA 1MIEH 3RVXD 4LAJH 2P7TB 3LN9A 3B5TA 2P8LA 3JWDL 1V05A 5BO1L 4UT9L 5DJ6A 4X83A 2Q86A 2OMNA 4CBPA 1OVZA 3O6KH 4QRSB 2OK0H 1NUDA 2AJ3B 2QQNH 3WO4B 5CEZD 5DEFB 3OAUL 5BRZB 5I17A 3LH2H 5EFIA 4H0IA 5L7XH 5ALCL 1JTOA 3FRUA 4YDIL 4X5LA 1PZ5B 2CUMA 4JDZA 1JUFB 5AD0A 2PYEB 2R69H 2BY1A 2NY3C 5FV1L 5ENWB 3ZKND 1FN4A 3BQUC 3TJHC 2JTDA 1B88A 4EXPX 1G7HA 1QLRA 3LS5L 5CP7B 2F58H 1G1CA 3VWKD 3HE7C 3ZTNL 2OMBA 2W0FB 5CJOH 1G7QB 1RUKH 5BZWA 1YEJL 1YZZA 3NCYP 5DQDH 3UTTA 2D4DA 4EEEA 3C87A 4LVOC 4OZGF 3O2WL 3FAXA 1NUGA 1AD0B 1DFBL 3LS4H 4JM2D 1IKFL 1NMCB 3D69B 5D2LE 5F8QC 3TBWA 3WUZA 1IC7H 3CVIH 4K71C 5HGDA 3QWQB 3MLSH 4JFPB 5ESQB 2RCSL 1W72H 2KBGA 3O6FA 1JV5B 1YEDA 3FQWB 1U8MB 1ZHKA 3FQUA 2BRRL 2CRIA 3BT2H 4G6MH 4G6KL 3LKOB 3ARGA 5FYJE 2JCCA 5A2LH 4NOFA 4RNRB 4PPTA 4QNPE 4FP8L 3TWCL 4CMMA 3WL9B 5CEZL 3VXRA 1K8DA 1EO8L 3H7BB 1D6EB 1Z9MA 4I77L 4JGJA 1SM3L 1QA9A 2HTLC 5DWUH 3L5WB 4N0YL 3RAJL 1FZOB 4IOSD 4LQFL 4QHKI 5F71A 1TNMA 4P3CL 1AGDA 4I9WD 4P5TC 3BN9D 3DRTA 5GPRA 5I1KH 4RWYL 1I7ZA 3VGAB 4OZHE 3SDCB 3TA3B 4OKVB 4UT7L 1F02I 5E6IB 3VFGL 4OSUL 5MENA 3LPGA 3QEUB 3TN0A 1SVCP 3H2WA 3FB5A 3WKMH 1AGCB 3QNZB 3VA2C 1P69B 1ZAGA 4NC1C 2XZCL 1A7RH 4NDMB 4NM8H 1CGUA 4HULB 1NSNL 4FQPA 2FNBA 1AO7D 2A9NH 1A7NL 3LKRA 3RZCA 1RPQA 4J6RL 4RFEA 5BVPL 5DD5L 3SE4A 1QO3A 4NO5A 1K2DA 1OTTC 3BZFA 1R3LB 2Y23A 1XF2B 2AJUL 4WI5A 1T03H 3QXDB 4CDHA 1BEYH 5ACZB 4P23A 1CU4L 4D9LH 3IRZA 3E0GA 2R2BB 3H9SB 4ZSOA 2I26N 3MRCB 1FGVH 3RKDC 2EYSB 3VFRB 3QUYA 4L4VE 3JBG7 3DI2B 5HI4C 1E4XH 4XP4L 3CVHA 2YA1A 3QI9B 3ZL4L 5CD3B 3PP4H 3VFTB 2X5PA 5J6HB 3G6AA 2P5ED 1ZSDB 2WNGA 5BRZD 3AAZA 3MMEA 1S7TA 5F6HJ 4KJQC 1GIGH 1N6VA 4LOUD 5HI5C 1NBZB 2CO7B 3JV4B 5D1ZC 3BKYH 5ID0B 2ZG1A 4YC2B 1DN0B 4K3DL 3LAFA 4B50A 4L9LB 3VW3H 1NEZG 3BP7A 1I3GL 3VXSD 3F8UB 1HHGB 3OB0H 2IPKB 2M8XA 3JVGC 1KB5A 1P9MC 3MA9H 1IAKA 5JTWA 2COQA 3ULUF 1SEQL 3CFDA 4JM4L 5E2JA 1DQDH 3NABL 4OBSA 1HXYB 1UYWL 4HS3A 5JIKA 1YEKH 2X4NB 4KJWD 2AK4E 4TTGA 4CNIA 3LEXB 3HZMA 2CIIA 2CGRH 1XF4A 4FQ2L 4ZPVB 1CLYH 3X14A 2DQHH 2YRZA 5CJQH 4H1LH 2CLRB 3SGJC 1YN7B 2ADGB 1UKTA 4UNVA 3MQIA 4AEIH 5D5MA 2HT3C 4Z9KB 5D1QB 2BY3A 3OX8A 3IFNL 4GAGL 5FO8A 2JCCF 4OFVA 1GGIL 5KSVB 2BNQD 3BEWA 4LLUA 5C0DB 4JANB 1ACYL 4PJXA 3O2DH 4PLNC 3HR6A 1JNHA 1HHKB 3SE3A 3INUH 5J13B 1SJXA 1WFTA 4YDVA 4MD5A 1KJMA 1KELH 3LDBC 4HMEA 4F9PC 1NC2A 1WISA 1I7TA 1P84J 2FHFA 3DVNB 3MV7A 4I48A 3WHE0 3RWDA 3SDDC 1CDCA 1T04A 5ADOH 4FQQA 4YR6A 4WDIA 2DYPA 3J7HA 4P57B 3UMTA 1M7IB 1BX2A 1CE1H 2MCG1 3QQ4A 1IFHL 1L0XA 4GLRI 4Y5YC 3VE0A 5E6ID 3MRNA 4NO0D 4M9PA 2F15A 4U3CA 1JGEB 5JPNB 3WFCH 4O00A 5F88B 1A6TA 1QFWI 1VFAB 3TIDA 3BN3B 3HNVL 3TZVC 4KPHH 1AE6H 4I2XB 4DUWA 5LAXA 3U1SH 4K9EC 4EDXA 3SCMB 5CIPH 4Y19B 3RVWC 1GL4B 4EN3D 2DLIA 4EUPH 2IBZY 1L0QA 3PQYD 5HDLA 4ZFGH 3IS0X 2R0WL 1NANI 5JO5B 3BP5A 5C0CD 5KN5B 4Z76B 5F9JB 5I75B 3QIWA 1MRDH 1OT2A 4XZUB 2BSTB 5I74C 4K9EH 3KWWB 2VIRB 2V2TA 1YJDL 4J3XA 3QJHB 3CC5A 1K3ZA 5I1GL 1Q0XH 5DUPH 3QI9D 2PR4H 3TIEB 3ZKQD 4KI5E 5ESVB 4W6YB 1G7JB 4NQEB 1NC4B 2DQCH 5IHZA 4NKMA 1FV1A 4W68A 2DMCA 1OB1A 4QT5A 4NJ9L 4ODTL 3DNKA 4WI3A 5IMKB 1MF2L 5H2BB 4UQ3B 3I75B 4KHXH 2PKDA 3BW9B 1WITA 4C58B 2Z31A 1QSFB 2D03H 4HUXB 1N5YL 2NY7H 1MCKA 1Q9OA 4Y5VA 4NO3B 4UTBH 4LFHG 3WHXA 3RVTD 1BQHB 5EU7E 3CK0H 2NYYD 1I4FB 3QUZB 4HIIB 1X6NA 1FCGA 4Y8DC 3MLTA 4LEXH 4QRUB 2DQFB 3QRFM 3HR5A 2WUBL 4N0RA 1F90L 4PGEA 1DQJB 2C3VB 2EYRA 3RTQB 3V8OA 3VI3F 5D5MF 5I1HL 1VFUA 5JNYA 5K9QG 4HD9A 2D4FA 1F13A 3GHEH 4JDTH 4P49A 3PWUA 3IXAB 4NKOA 2V5YA 3FFCD 1LK2A 4TULH 2XZAL 2EIZA 5C2BL 5ALBH 4LPUA 5EC1A 4NZRL 1MQKL 1XCTA 5D72L 4KDTA 1EO5A 4MAYA 2FHBA 1K9TA 2APTA 1JWSB 1PX3A 3LQAL 3RGVB 5C09A 5IR1A 4JO2H 1U95B 1UT9A 3EKCA 2OP4L 2QQKH 5KZCB 4RDQF 4JFEA 2HMIC 1BQSA 4M1GH 1ZHLA 4MDIA 4N90E 1XGTB 4PD4K 3MA7A 2FO4B 2OJEA 7FABH 3MUHL 4KMQA 1SY6H 5FB8A 3FCTA 4U31A 4HJ0D 2NXYC 5IVNA 5J6GA 3S37H 4I5BA 4Y19D 2R4RL 5J8OA 4TPRL 3LN5A 5DHXB 3K1DA 3WIHH 4QYOA 3WLWC 1UCBL 1NBVH 2OZ4H 4OM0H 2W0PA 2IADB 3CDYA 3GI8L 1T1XB 3KPSB 4X6CF 2L0DA 1XFPA 3FKUS 4Q97A 2VUYA 4WWKB 2MQ0A 5FGCE 1R3HB 2R1YB 4PRHD 2YK1H 1JWUA 2VXTH 4U1MA 2QADD 3FONA 3WD5H 3HC0A 4WEBL 1KV3A 3K1KC 1X4ZA 1R5IA 5DC9B 2XNAB 4R7NB 1SJEB 2BHYA 4C56A 1VACA 1C5BH 1J86A 2P8LB 2N7AA 3BAEL 2VDMH 3QHTC 4MB4A 2Q86B 4U2ZA 5D7KD 5DYOA 1KJVA 1QSVA 2HT2C 4XPTH 1QVOA 1QSFD 1I9IH 2IALA 1ZGLA 3VGBA 2IPUK 4DFIA 5I17B 3K3QA 4KTDL 5EFIB 1UC6A 1JHTA 2DQJL 3FRUB 1FNLA 3NCFB 4JDZB 5AD0B 3C5ZB 1N59A 5K9OA 1FN4B 2BNRA 1G7HB 1QLRB 1XF5A 4CVXA 3P9LA 3ESUF 3OJ2C 4PJEE 4HSQA 3SJVA 1QRKA 4TSBH 3T2QA 3GBML 5HYJD 3VXMD 4NHCL 3VXUB 3B6SA 5BZWB 2KZ1B 4U3HA 4IIQA 3UTTB 4YE4L 2HKHL 4FFWC 3CFEA 1IAOA 2XN9D 2XXMB 4P2YA 3HPLA 3TBWB 3D39E 1CLZL 4JKPH 1N4XH 5HGDB 3OSKA 1JE6A 1EHLH 4L8DA 2R0LH 3C8HA 3O6FB 4LCUA 3ZO0A 1MWAH 3HI6L 1YEDB 5CAYB 3C5JA 3GBNH 1ZHKB 1HI6A 4U1HA 4S1QH 3NIDF 4FXLA 1WAAE 3ARGB 1PY9A 2JCCB 2VLRB 2OL3H 3QCTL 4XWOC 4CMMB 2AEQH 4AIXA 3VXRB 1K8DB 3NPZB 5KZCD 3ARBD 5JMRA 3I50H 4BH7B 3B9KA 4FFVD 1ZEAH 5FYKL 4F7EA 4GUPA 2XXCB 1PDKA 4JY5H 5GZND 2EDXA 5HDQH 5DJAA 4J3OC 4X6DA 3E8UL 4TVPH 1OSZA 1I7ZB 4OB5L 1QG3A 2APWA 3KYMA 4WFFD 2YD1A 5MENB 4XPBH 3TN0B 3EYOA 5DRZA 4PLJC 2O93L 3MZTA 3R0NA 1MJ7H 1EDQA 3FB5B 1NH6A 3ARZA 3MNWA 4PTTA 1ZV5A 2F8XC 3QEHB 1S3KH 4R6UA 3QB7C 2X05A 4MQTB 4PJDF 2H32A 2X9XA 5E08H 4OI7A 4DGYL 4WWKD 2VLJD 2EDRA 4WW2F 5FO9A 2Q8BL 4NN5C 1HIMH 2JJUA 3BVNA 1R6VA 3LKRB 4LPVA 5T3XH 4K94C 4RFEB 3KPRE 4JPIA 4QO1A 1MAJA 4NO5B 1K2DB 3BZFB 35C8H 1E4WH 4ZD3L 1NCDH 1AXTL 2HTKC 3IVKA 1KCVL 1NFDE 4P23B 5C0AE 1F8TL 3X13A 4MNQA 1BVKA 2PO6C 4YFDB 5DVNA 4D0CA 2YA0A 4R4FL 3QUYB 4R0LC 3DECA 5I1EL 4H0GA 5J4MA 3WIIH 3RFZC 1ERNA 5DI8A 1MRCH 3CNKA 4OZ4A 1UZ6E 4K94H 3G6AB 1LP9F 3WN5C 3AAZB 2IF7A 3DXAE 3MMEB 4YK4C 1S7TB 1FYTE 5HVFB 2ZUSA 1A4KB 4M5YL 4JJ5A 1RZ8A 2DIJA 3KS0J 3BP7B 3B2VH 32C2A 5IFHH 4HZLB 4MZ3A 1KB5B 4N8VA 1ZS8A 3HNTH 3CFDB 4YEFA 1JPST 4HS3B 4XBEH 4M6NL 4R8WL 3HZMB 2CIIB 1XF4B 4ZFOB 3Q1SH 4OFPA 3X14B 1N3NA 3GI9H 4JZNA 5C0BD 2W0KA 4PJ7A 3NMEA 2EDJA 2VXUH 4KFZC 5INDA 4N68A 5F21B 5D5MB 1V5JA 4O4YL 3AROA 2WM0A 5FO8B 3EOAB 3BEWB 4LLUB 1GC1L 2X1WL 5GJTH 3U7WL 5DD6B 3J8F7 2BSED 3LRHA 8CGTA 4PJXB 2ERJC 2XKNA 4U1GB 5IHUL 1OOAA 4FXGA 3N1PC 1JNHB 5FKAA 1HCVA 3QULB 1LO5A 4YDVB 4F58H 4MD5B 4X9BA 4YHLH 1EUUA 5F1OB 1KJMB 5HHVL 1QHPA 5C08E 1NC2B 5FYLL 1I7TB 4I48B 2O5ZL 3RWDB 5DJXA 2A74A 1F4XH 1T04B 5FFLA 4YDJA 1MJJA 1P4LA 5FF6A 4FQQB 4YR6B 3FMGH 4WDIB 1BX2B 1R0AH 2FD6H 3QQ4B 4EDWH 4MJ6A 5ISZE 3IETA 2WUCH 4GH7B 5JDSB 5T3ZH 1YMMA 3TC9A 1GPOH 2J8UE 2EH8H 4QEGA 4X99A 4XNYL 3VG0L 3CAFA 2P8MA 3VE0B 5C0FA 4MD0A 3MRNB 2J4WL 5AZEH 1AP2A 4WFHD 5MEND 5E5MA 1FAIL 4P4KC 2CK2A 3ULUL 4NGHL 1XIWC 2BMKA 4NP4H 1KGCE 4GT7A 4M9OA 4RMRA 3TIDB 3IAQA 1KEMH 4Q6IB 3QWRD 3T3ME 4L3CA 5LAXB 2XTJC 4MQ7A 5JPMA 4EDXB 1I9EA 2JK5A 3TPUA 5JIIA 1IAIL 3TH3T 2G5RA 2JIXA 5IROC 4UTAL 3S6CA 2VITA 2V9RA 5T1LA 4YHZH 3RZCD 3LPWA 1E28A 4DKEL 3P0VL 4LSTH 4MD4A 3KXFE 3W0WB 3BE1L 5FGBA 5E2VH 4P23D 5ETUA 3QIWB 1OP5K 3QH3A 4X6CB 1GHFL 1KXVC 4JKLA 3V7AG 1AR2A 2V2TB 3QUYD 3CC5B 4GSDH 4FQ1L 2I9LA 4L4TA 4JHZA 1KBGL 1EZVX 3A67L 4OLUL 5C0IA 3CLEH 4WO4C 5IHZB 1IGML 2VYRE 4NKMB 1MCOH 3PWLA 1FV1B 1P5VA 3PE9A 1KNOA 1NDGA 1OB1B 4QT5B 3V0VA 3O8XA 4OD2A 3QG7H 4ALAL 1TTGA 3HZKA 4KRMB 4AIZA 4G6FB 4YWGH 3DGGA 4WHDA 2QSCL 2Z31B 4WFEE 3FHQA 5EBMA 5H37H 2F5BH 4I18C 4KRLB 2AEWA 2B20A 1Q9OB 4Y5VB 4XPAL 4R3SA 5F9OL 3RWCB 4RSVA 1D5MA 5FKPA 4PJIE 4NCDA 5F7DA 1NGQL 3CPLA 4I0PC 3VFPA 4UUJA 2K1MA 5F1KC 1AR1C 3OB0K 4JRYA 1XGRA 5I1CH 3MLTB 3V6BR 4S11A 4KZEL 1RIHH 4FQHA 4ZOCA 3RWIA 4PGEB 4G80A 4YDKL 2EYRB 5DLMH 4UILH 5D7JA 4BFIB 3ARDD 1D5IH 4WFGE 5JNYB 2HVJA 1NGPL 1U9KA 2OXGA 3PWUB 2ZUXA 4NKOB 5GRUH 3MXWL 1Q9WA 5ADPL 3SGKA 1RULL 1LK2B 2EIZB 1SEBA 3PWNA 3BISA 5EC1B 4B0MM 1XCTB 4OIIH 2IH1A 1NC2D 1PGRB 4GAFB 4MAYB 4XNUH 5F1SA 3MV7D 1A3RL 1B0RA 3AM8A 5C09B 5IR1B 2EICA 3SDAC 2NY4B 2J5LC 3VXTA 2DYPD 5FA3A 1DL7L 4KKBD 2A1WH 3ARUA 4JE4B 3PP3H 3E2HB 3QPQC 1MREL 5HGAB 4JFEB 1KB5L 1FC2D 5KW9H 1ZHLB 4MDIB 5EUOA 5ICYB 2Y72A 1H5BC 4KUCF 2PETA 3U7YL 1XGPA 3MA7B 4G9FA 1DUZA 3TBVA 4UAOC 4AIOA 2OJEB 1IEBA 2MNUA 3ZLQC 4Q74A 1ADQH 2GY5A 5EOCJ 1MAMH 3M45A 4P59L 5F8RC 4WI8A 4ZFOL 5FB8B 3MRDB 2GHWB 3WNNA 1RIUL 2W9DH 5D2NC 5J6GB 4I5BB 4EVNA 3W11C 5HHQA 4AJ0A 3LN5B 4DOHE 3BUYA 4X5WA 2BNUA 1BM3L 3N50A 3PGFL 3VD5A 1SJHA 5F7FA 4QCIB 4HH9A 5KJRH 2NR6C 3K0WA 4Y4KA 1JWUB 4WW2B 4U1MB 2VDPH 3FONB 3HC0B 4HQQH 5E8NB 3L3HA 1NLBL 4M3JA 2CRZA 1CDGA 2YRLA 1ZLVH 5BVJA 4MMZC 1OAQL 1VACB 4S1SL 3OKOA 1DDHA 1FFRA 3C09C 3KJ4B 3B2UD 3D39D 3JWDC 5DYOB 4ZOEA 1KJVB 1FJ1A 4G6FD 4WY7H 3HB3C 1QVOB 2Z31D 4NWUH 2IALB 5E8DL 1ZGLB 2NY0C 5KS9E 1O7VA 3MRHA 5TQ0L 4ZMAT 1JHTB 1TXKA 4H20L 3S35L 3MV11 2OR9L 5JOPE 4NQVA 5K9OB 2DI9A 4JRXB 2NZ9D 3N9GH 2BNRB 3SDXA 5FA4A 5GGRA 2PYEE 4IBLT 3JWDH 3P9LB 4Y5XC 4OT1H 4UT9H 5FDYA 3SJVB 3L7FA 3FT2A 3FJTA 4PJ8C 3B6SB 4RDQG 4IIQB 4S1DC 5GS1A 1LEGA 1NKOA 2H1PH 2PW2A 4U05A 4AH2B 1Y6MR 3B9VA 1IAOB 3CFEB 2DTMH 4Y16C 5ALCH 1DJSA 2YPVL 3HPLB 1I1FA 4G7VL 4J3UA 4AEFA 4L8DB 4R4ND 4LCUB 6FABL 3MOQA 3LS5H 4Z0BL 2BFVL 1AGEA 1G7LA 1HI6B 2VZ3A 4W6XB 4U1HB 2NY4D 1W2KT 1R3IL 3RVXC 3MGOA 1PYWA 2CIKA 1YEJH 1YEEL 4QXUL 3O2WH 3MUZ1 5FUOL 3CFCL 4MJIA 4JFED 5EUOF 1IKFH 3VFSA 2FB4L 3H7LA 4PRPA 2PW1A 2C4XA 4F7EB 4WUKL 2VQ1A 3B83A 4GUPB 2RCSH 2E9JA 3ZYZA 5DJAB 1A6ZA 4X6DB 4ZUWA 3WFHA 1DBAL 4NIKB 2AJSL 1OSZB 1TVHA 3ZKNC 4MCYA 5IOPA 3KYMB 4RAUB 2ZUTA 3VWKC 5EU6B 3EYOB 5DRZB 3X11A 5CEZH 1EO8H 3DXAD 2EE3A 4D0BA 1FPTH 2ZCLH 3MNWB 4PTTB 3TO2A 3BPCA 5CD5D 2JB6A 4FN0A 3RAJH 3PWVA 2H32B 5MEQA 3GSQA 3KYAA 3S3SA 5L8JB 4JM2C 1MJ8L 5GHWH 5FO9B 4JO1H 1TCMA 3NGBB 1KYOK 2JB5L 3BVNB 1E6JL 3ZYIA 3O6ML 4JPIB 3ZDZE 4PJGA 4K3EL 3X12B 5I2IA 1A21A 3X3GL 3IVKB 1SVZA 4OV6F 1EH9A 1N6UA 4ZUVA 3PJSA 4C56D 1INEL 4Z18A 5AUMA 3BDBA 1VENA 5DJDA 3X13B 4MNQB 5GRJL 4D0CB 2FJHA 2XZCH 3H9SE 4OCYH 4O2EA 2VAAA 3C2AL 5DVKA 5DI8B 1NSNH 4OZ4B 5HHOA 2VDRH 3MBED 4YNYA 2ORBL 3DWTA 1L6ZA 2B8OT 4LGRB 3EYQD 5DD5H 2UUDH 4GKSA 3VXNA 3AC0A 3BN9C 3CFKA 2PTTB 4JJ5B 4ZAKD 3SDXF 2WINA 2EO1A 1IGCH 32C2B 4HS8H 4AQ1B 3D87B 3SJVD 2Y7QA 3HFMH 1U91A 1E4XI 3WFBH 4U3XA 3ZKXB 4NBYB 5L2JB 1N3NB 4JFOB 1XGQB 3NPSB 4JZNB 4W70A 2WW8A 1EBPA 3WYRA 5D96B 5INDB 3THML 1K4DA 4IM8A 1BBJA 3V0WL 4J23A 3RZWA 3WSQL 1NEUA 2C1OA 1KLGA 1MFCL 1JPFB 4FFZH 1OLLA 2DLFL 2FWOA 2XKNB 5J11C 4FXGB 2VWEE 3O3DB 1P4IL 3MLWL 5FKAB 4ETQA 3T4AA 4FQ2H 4AEHH 5JORA 1LO5B 2XA8H 3WO4C 2LQRA 3WJJC 3T3PF 5EO0A 3B9KD 4OLWL 4Z8FL 5DJXB 3IFPA 4YDJB 1MJJB 1P4LB 5FF6B 5HVHC 4LOUC 4HJGA 5TPWH 3VFVA 5C0GA 3MRMB 1EXUA 4MJ6B 5LXGH 5AEAA 3IETB 2UWEF 1GGIH 1YMMB 4X99B 2CDEB 2VZVA 5C0FB 1P2CB 4MD0B 1YEFH 1AP2B 5E5MB 2R1WA 4JAMA 3UTPE 3LCYA 3PL6A 3GGWA 2BMKB 4OFYA 4OCSL 5JOEA 4J4PA 3EDDA 1A7OL 4YHYB 4UINH 1EV2E 4KJWC 4L3CB 3VDCA 4MQ7B 3S9DB 1TZIA 4F2MA 2JK5B 3TPUB 4F57L 4I2XE 2JIXB 5CSZA 5EBGA 5I66A 2A9ML 1IFHH 3RPKA 5T1LB 1E28B 1XR8A 1DBBL 4MD4B 3QPXH 2XZQL 5ETUB 3RPIA 2AV7A 4NUJB 4XCEA 2Z9TA 3QH3B 5EOTA 2XG5A 4MNQD 5EOQL 5D1XA 3W5NA 1YJDC 1J0IA 2I9LB 4I1NB 2EEDA 3LB6D 4XC1H 1VPOL 4RMQA 4YPGA 3D5OF 2DDQH 3LZFL 3IB4A 1X4YA 4YFLI 4RWHA 4JR9H 3ABZA 1KNOB 4CU6A 1A6AA 4NQEE 5FM5M 1NDGB 3V0VB 3B9EA 3O8XB 4K7FA 4OD2B 4X5XA 1U93A 4ZTOH 3VGAC 1DBJH 1M05A 4AIZB 3UZQA 1OP3K 3DGGB 5E6IC 2OYPA 5IJKA 1YJDH 5J1AA 2YBRA 4YHNA 4R3SB 5FKPB 1D5MB 4KJPD 2F53A 5FYKE 3RWFA 3VFPB 4JRYB 3STBA 3O3EA 1XGRB 1ZHBA 4GRLD 4ODTH 4RAVA 3P4MA 3RWIB 1YNKH 3HAEA 2M26A 4G80B 4EN3C 1MF2H 5D7JB 2W92A 1JZ6A 3E3QC 5C1MB 2HJLB 5D7IF 4K7PX 5KOVC 4KKCD 4CUCA 1N5YH 3V4VL 3C2SA 1Q9WB 5IBUB 2XT1B 3SOBL 5ICZA 2LTQB 5LVEA 4D9QD 3IKCA 4LASH 1KEGL 1SEBB 4OZGE 5TF1L 5KSAA 1T0MA 3PWNB 1MCBA 2VDNH 4APQD 1EGJH 3QI9C 2IH1B 3QCVH 2X4SA 3U4AA 1F90H 1B0RB 5D6CA 5CINH 3P9MA 4TSCL 3VXTB 1OW0A 1H3TA 4XCFH 1KCUL 5FA3B 3U6RB 2QSVA 5CBAA 2IPTH 4GW1B 4YC2C 4DEPB 1YMMD 4L9LC 5C9KA 1IC4H 3O3BB 5EUOB 2WBJB 5K59F 2JJSA 4FTVA 1A7PL 1XGPB 4BSVA 4G9FB 1DUZB 3D18B 1IEBB 4NZRH 3KPTA 3H6JA 4JN1L 2GSIA 3RVTC 3U4BL 2E7HA 2NYYC 4M02A 2EDOA 5HHQB 3P30L 5HSFA 1SBBA 5IVXF 3OF6A 4QRPB 4M6MH 2Y25A 2WK2A 3DIFA 4AQOA 4A6YA 4ODXA 3LD8B 4N9OB 1ULVA 4X5WB 1CGSH 2BNUB 2R1XA 2FO1A 1UH3A 4DUVA 3TFKD 1SJHB 4I3RL 5JOPD 4R90L 3I2CL 4HH9B 4MB3A 3NACH 3KPSE 5BXFA 2FSEA 4Y4KB 3VFUA 4BQ6A 4L4TD 2BVOA 2MTPA 4Z77A 1AHWA 3FQTA 3L3HB 3NVQA 5AYQA 1BD2A 4O58H 3GSOA 3RY4A 3BIKA 1A7BA 3AMKA 4ZTPH 5BVJB 1CDHA 1H3XA 1UCBH 5GJSL 4GMTL 3OKOB 3O8XD 9CGTA 1F4WL 3FB7A 3GI8H 3EFDL 4KTEL 4FZ8L 1NCUA 4Y0GA 1FE8L 4GRWH 1FJ1B 2ILLA 3QRGL 3RU8H 2BVQA 3QNYA 4P46A 4WJ5A 1DANT 3MRJA 4N1CA 3IDXL 3MRHB 4TQEH 3HE6B 4OIBA 2AEIT 4NQVB 4KK9D 5FYLE 2WLZA 3MV9E 4HJ0C 4JRYD 2AJZA 2BOBA 3SDXB 5DJZA 5GGRB 1DLFL 3BIBX 4OZIF 5I19H 1VFBA 3BAEH 4JHAL 4XCCH 4QRRA 5IFJA 5GGQL 5I9QB 5D7JD 3L7FB 5HTSA 3FT2B 4LRIC 1MHCA 1T2XA 3GDBA 4GS7B 5GS1B 4IMKC 1QR4A 3SO3C 2Y06H 1LEGB 3BI9X 3NIGF 2PW2B 3ULUE 3RNKA 3VXUE 5FHBL 3UBXI 5I75C 1CF8L 2DQUL 1RHHA 4OUOA 4JFXA 3P0YH 4LSDA 1I1FB 2ZPKH 3UDWC 4GBXA 4M3KB 2QADC 1A2YA 1ZA3A 1OAUL 5LBSL 5SWSA 2E9BA 1AGEB 5KTEL 4DZBA 1G7LB 3CXDL 1HSBA 3BQUA 3D3VE 4NHCH 3MGOB 1PYWB 4WVRA 2CIKB 3RL1A 1W72A 2ATPB 2JCCE 2VLRE 4LSUH 3N06B 4MJIB 3VFSB 4DTGH 1LILA 4PRPB 3VXRE 4GXUM 1CLZH 2NY6D 2AAVA 2PW1B 3MLZL 2VQ1B 4BZ2L 3RDTA 1MHHA 3DUUA 3PP3K 1A6ZB 4ZUWB 3WFHB 3EOBA 2VTFA 3MV8E 3BPLB 3VFWB 1TVHB 2GJ6A 1OP9A 1CZ8L 5IOPB 5FUCE 1B4JH 3RJQB 5JW3L 4D0BB 5MP6L 3B5HA 4NQSA 2CD0A 2Q3AA 1K6QH 3TO2B 3BPCB 3NA4A 2CK0L 1CT8B 2JB6B 3TYFA 2YD4A 2X4QA 4PJBF 3PWVB 1U41A 5MEQB 3GSQB 4M7ZB 1DE4A 4NN7B 1CXEA 1YMHA 2RIKA 4Y2DB 3MC0A 2YOCA 4LGSB 2E7BA 4OCWH 4PJGB 5MI0B 4RMUA 3K4AA 3EFFA 4IRSA 4ZUVB 3PJSB 2X9YA 1L7IH 3GJEA 5AUMB 5DJDB 1SHMA 2FJHB 1G6RB 2D0FA 3D9AH 3QQ3B 4O2EB 4WUUE 2VAAB 3L3KB 1ZLVK 3ARBC 5DF0A 5IBUG 5CEXA 2IBBA 5HHOB 4FFVC 4XXCC 1NGZA 4XNXH 3H8NA 5GZNC 2D0HA 3QUKA 4GKSB 2A6DA 3R4DA 1AXTH 3CFKB 3N1FC 1TQBC 2FRGP 2DRUA 2BHUA 2R0ZL 2VH5H 5GRVL 3NH7L 3EJZD 3WE6A 4YXLL 3Q0HA 4PS4L 4JG0L 2Y7QB 2KQMA 4WTWA 1TJIL 4B41A 1M7XA 1U91B 3CGTA 1JL8A 4WWKC 3HS0A 1EA9C 5ICXA 4QKXB 5BW7C 2GCYB 2F8OA 2DKSA 2ZZUT 2VMFA 3O11A 1TETL 3STZA 1K4DB 4FQXB 1BBJB 5HI3C 4UU9B 3VA6A 5DZNA 2A0LD 5D7IB 3MOAL 1CQYA 5D5ME 2C1OB 1KLGB 1S7UA 2ARWA 4K3JH 1GC1C 1B2WL 2FWOB 3RA7L 4ETQB 3T4AB 5JORB 3PV6A 4RGNE 2MCPL 4K7PL 4LU5L 4JKMA 4PRPD 1FZKA 5EO0B 4LSPL 1DSFL 2WIMA 1G7IA 3IFPB 2FYYB 1Q1JH 5LGHH