2ICWB

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
190
structure length
184
Chain Sequence
b'GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 184
sequence length 190
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2icwB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2icwB01
2F53B 1UQSB 1LEKA 4PJ8D 4MB5A 5KVMC 2YEZB 1BJ1J 3P4NB 3RWEA 1S7UA 5BO1H 4HH9B 4YQXH 3O3EB 1P69B 5I1KL 4OZHA 4PY7B 2HKHH 2ZSVA 1BEYH 2VKWA 4LLUB 1B4JL 1FAKT 1OAKH 5D71H 4ELKA 4NZDA 1ZEAL 2CO6B 3PV6B 1QFWM 1Q9WA 1NGXB 5E2UL 3BSZL 5HHMB 1LDPH 4XNMB 3RVVC 2GAZB 4G8IA 4NN7B 2MSPA 3ALWA 3EFDL 1G1CA 3GSWA 4M7LH 3VFSB 1XIWA 4NQED 5I1LB 1RK1A 1EFXD 4TULL 1Z0NA 1W8NA 3PXJA 3U7WL 1KT2B 1NC2D 1ZVSB 4L4TA 4JLRA 3O8XD 3ILQC 2MTPA 3GBLA 4NQTA 3UTZA 4JFZL 4XH2A 1C5DA 3E0GA 5EUOB 1I7TB 1IGFH 4FABH 4S10A 2AXFB 4Z95H 5BVPH 5BS0D 1X5KA 4FQ1H 5GJTH 5CCKH 4P5TC 4CN4A 3KYNB 3QHFH 3NOIA 1XCTB 1KEML 3HN3A 3MRPB 4OZ4A 1U3HC 3VFTA 5JZ7C 3LB6C 2FEDD 1YQVL 4NKMB 4C56B 1PX4A 2VJXA 2VXVH 2K7PA 2IPUK 5HD8C 2Z4QA 4NKQB 4KKLC 4WVRA 1J8HD 2H41A 4YGAB 1U8MB 5GS2D 1TJGH 1I3RB 4UTBL 5HDOA 3UX9B 1FORH 3V0VA 1S5IH 3MC0A 2NPLX 2PCPB 4DUXA 4PJHE 4NDMA 1DZBA 3MLRH 2CGRH 3W0WD 5FB8A 2IAMA 4JN2B 1OOAA 1OGAB 3LSOB 4X6CB 4NOBA 2ZJSL 4R4FH 5CP7A 1IM9A 4HKZA 2FB4L 4HK0A 4NT6A 4XRCB 4LF3A 1JPSL 4U1MB 3QEQE 2D0GA 1CD1A 4KZDL 5JIIA 4P9HL 1M7DA 4BZ1L 4DQOH 5I6XC 5ILTH 1CLOH 2CUIA 2Y6SD 4UU9A 3ARUA 4HUNB 5AAWA 5F3HB 4U1LB 1MJJB 5IBLC 5KSUB 4XBEH 3R8QA 5I1CH 5C0GB 1DSFL 3UTQB 4PV8A 25C8L 1UZ6E 3PHQB 3FONB 4O51B 1IC7H 1S7TB 2X4SA 3HE6D 4P2QD 4XNQA 3CX5J 4PJAF 5E9DA 2BK8A 4PD4K 1VHPA 2FX9H 4B5EA 3IDJB 1RU9L 3B8YA 1PBYA 4LSTL 2XPGB 5CJ8A 2DM3A 3ALXA 1NCWH 1TCRA 2YRLA 3NPSB 4HK3J 4D0BA 4FQ2H 3S88H 3DURA 3IAQA 1P9MA 4Q9BA 4IIQC 3QCTH 4TPRL 5CJXA 1HXYB 3RHWF 4R26L 1CXHA 2C1PA 4BJLA 1ZA3A 3MLXL 4JN1H 4F80A 5HXMA 3ISWA 1DEEA 4NQDD 2C3VB 4U6YA 2E3VA 1MCIA 4QRUA 4IMKC 2F58H 2OZ4A 1F5WA 3QEUA 1XGTB 4OI8A 1AQDB 4KJPD 3PDDA 3W9DB 3BZ4A 1AE6H 3PWPA 4HT1H 3C5JA 3B6SB 4UINH 1I3GH 1Q8MA 4DTGL 2C9AA 1T1ZB 4DW2L 1BZ9A 1IAIM 2JELH 3HZVA 2C7UB 4PTTA 3ROOB 4S1QH 2XG5A 2JB6A 1RZ8B 4LPTA 4NN7C 3RWHA 3VXMD 2PTTB 1PJ9A 3JV6A 1UG9A 4MNQA 2I25N 3UTSA 5ISZD 1YEEL 2R56H 4X9HA 3MUY1 3ULVH 5F7KC 1FYTA 2OR7A 4KK5D 1KPRA 4LKXB 2VLME 4QHUB 5C0BD 2VDKL 1GIGL 2P48B 3GMMA 3HFMH 3ULUH 1LGVA 5DK2B 5IQ7L 1CFTB 3LEYH 3B9KC 3T0EB 5C9JA 4FMFA 4P2OB 3VFPB 4X6FB 3WN5C 2DYPB 4LSQH 1U8KA 3GFUA 4LCIH 1KB5H 3H9SD 3N1QC 1F3RB 2VLJB 5EU7E 2DLFH 5JXAL 3LV3A 3BE1L 1ZT1A 5C0JB 3AC0A 3H9HA 2GJZB 1BQLL 1QBBA 4PG9B 5FYJL 4Y1AE 4AH2B 1VGEL 2LAGB 1G6RB 2NY0C 5J1SC 3B5TA 1J8KA 2HG5B 3L3KB 1VCAA 1DE4B 1YEDB 3PE9A 2P8PA 1W0WB 4UIMB 3UTTB 5D2LE 1K3IA 4CU8A 1OD9A 1A9EB 4LARH 4CBPA 1CQYA 3FMGH 3VXPA 1EHXA 3MQIA 1O7SA 4YHKL 4MA3B 3V7MA 4HV8B 1NUFA 2EDYA 3JVGC 1EERB 4A6YA 1X5GA 3QZWB 5C0CE 2YPKA 4JQVC 3KYKH 3QH3B 3S37H 2VAJA 3L5IA 2ERJB 4HC1A 4PP1D 2FL5A 3L95A 5DRWB 3TT1L 4P4RB 5C0EA 1L6XA 3FOLB 1KJ2B 3VXSA 2P43B 1K85A 5MP6H 4OZIB 5F6IB 3GNMH 4GSDL 5FA3A 5KAQG 4ZO7A 1NFIB 1BQHB 2E7MA 5D1QA 3T0AA 1X4ZA 1KXTB 1EMTH 1NJ9B 4JG0H 4AJ0A 5CSZA 4G3YH 2DJSA 1MI5A 2ATPB 4DVBA 3L1OL 5IROA 1TTFA 1Q1JH 3T65B 1CYGA 1HHGA 1F11B 5D93C 5E8PB 5JW5A 1J5OH 3C8DA 1RK0A 3RY6C 4HKJB 3OKEB 3DXAD 4Y4KB 1GZQB 1JPFA 1NDGB 1NGQH 3VW3H 2DIAA 3IDNB 4CVXB 5D7LB 3OKLA 1F4WL 3BKYL 1IEAA 1HHKB 4FTVA 5DSCA 4HG4K 3ULVF 2YKLL 3GIVA 4FQJL 1KCSL 2BY1A 4UQ2A 3DARA 4YIQB 4QXUL 3UP1A 4LQ1A 1YDPA 1OTUC 3E6HB 3TFKC 3ET9F 3L5WB 5F89B 1HWGB 4QRTA 3GJFA 3P0VH 2GSGA 4ZXBA 4R97B 4OIIH 1CDCA 3QO1A 4GMSH 4WWKD 4CAGA 4XB8A 3RA7L 5FYKU 2R23B 2MNUA 3WFBL 5JHDD 3UJJH 3QAZB 3HUJF 1HH9A 4H25A 1AD9B 1Z3GL 3WLBB 2DDQH 3GSUA 4OD1H 1A5FH 4P2OC 5KOVC 4X6DF 3EYQD 2RBLA 4DN4H 3TCLB 1YNLL 4XPHL 5C0RL 1Q0YL 2GYSA 4Y19E 3KJ6H 1JNHB 3SN6N 3RVXC 3X12A 5ETUB 1F3DH 2KPNA 5GGTL 3GGWB 3QNYB 3BRGC 1KN2H 4B7LA 3MOAH 2VXUH 3FQRB 1AFVL 1J05B 3QXAA 4PRPD 5IGXL 4N9OB 3OR6A 4WNQB 4YDKH 4J3VA 1UWEH 3O9WD 4APQB 5I2IA 3ARBD 1KTDA 4Z7OE 4G6JH 2BMKA 4NRZB 5B39B 1KNOA 3ZDXE 5GSVA 2NY4C 1KPUA 4NCC2 5DZNA 4YPGA 2W9EL 4W6WB 1HSBA 3VD7A 1E0OB 1QOKA 1A9BB 5J6GB 1K4CB 4HJ0D 1WISA 1JNNH 5A1AA 4J1UA 1CFQB 2DTMH 3ZDZE 2CRZA 5JPMA 1KIQA 4RGND 3KPSD 3OB8A 2F5AL 4WW1B 3RIFF 3VGGA 1HN1A 3S4SG 3HNTL 5EFIB 1DVFC 3NCMA 3NCYS 4PRHE 4NP4H 4XHJC 4G9FE 4M9OA 3VJ6B 4JJHA 5LCVL 5GGRB 2ZKHL 2HLAA 1Q9OB 1BIIA 3C2AH 3WNNA 2BERA 4PREA 4JO2L 4YFLF 1D5MB 3EOBB 3ILPB 3CD4A 3BQUC 3S35X 4K94H 5EZOL 1ORSB 1WWWX 1GPOL 4ZAKD 4ODTL 2VDPL 3LQAH 4LCYB 3FO1B 5K59E 3MV9D 5DHYB 1DQDL 1IVLA 1VGKA 1QLEL 1UADC 3FRUB 3QEQA 1YMMA 3MRLB 3CAFA 4P9MH 3MJ8B 4XP9L 3AB0C 3TEUA 2V5TA 2QHRL 4OD2A 1YEFL 2XRAH 5CSGA 2QQKH 4RWHA 1QBLH 5DEFB 5C7XL 2HJKB 3G6JA 1AXTH 1TPXC 4EZMA 1IZKA 1VB9A 4A6YH 5I76A 2AGJH 4N0FA 1T21B 1UWGL 3KPQB 1S9XA 5IBTL 3PWUA 3CPLA 1KLFA 1EVTC 5JOFB 2AK4B 5GRYA 5DWUH 5IKCB 2IADB 3FTGA 1IILE 4PJDF 4X6EB 5F96H 1MLBA 4UQ3B 4GMTL 4MSWB 4AM0B 4QEGA 2R2CA 4MCYA 4Y5XA 3BZFB 3U6RB 5CGTA 3Q5TA 1EXUB 5DTFA 3VRJA 2R29H 1CXLA 3QG7L 3EO1B 1PY4A 4IRJB 5JPNB 4FQCL 2D31A 1MCFA 2W65A 3PP3H 4ETQA 3VU2A 4R97C 1IEBA 4XP1H 2PW2B 3BP5A 3NFNB 4PJIF 1ORQA 1Q0XH 4KTEH 1RUKH 5LAXA 3MRRB 5IB3B 3UJTL 1GC1L 2VITB 4OD3H 2OLDA 4OZGE 5IOPB 4YX2L 3WYRA 4LIQH 1NCBH 4JR9L 1DBKH 2ESVE 5GRVL 3UC0H 5C0IB 1ZLUK 2NTFB 4NWUH 5CHNA 4GQ9L 3QJFB 4YE4H 2V2XB 3QI9A 5MEPA 1YNKH 5CLWA 4APQC 3I3BA 3PF2A 4TSCL 3VFNB 3ARGD 3P30L 4NRYA 3WKML 5TF1H 2MCPH 1ED3A 2HT4C 3UPRB 4Z0XA 1YEHL 3MMEA 2D0FA 4HKXA 3WXWL 1CDHA 3OKKB 4H20H 5DF0A 4GAGL 4JO3L 1OSPL 4TVPD 1PZUB 4BZ2L 5HYSB 3U1SH 5AZEH 4D9RD 2ID5A 2F8VA 4X83A 2YZ1A 5FKAB 3QUXA 2UYLA 3IFPA 1KTRL 3HAEB 3KVQA 5I8EB 4JPIB 4RAHA 3ULVD 3V9FA 3MNVB 4XCYB 4ZD3H 5INCB 5J56B 5EU6D 1S78D 4U6TA 1LO0H 4EBQL 4PGJA 3D3VD 4JFDB 2XICA 2VKXA 3H6JA 5HHQA 2B1HL 3W11D 4J6RL 3RUGF 3LN9A 1HKLH 1ZWIB 4HWUA 4Y1AA 3DROB 5IHLB 1PG7X 3QUZB 5ICYB 3U0WL 4GAYA 4M1CC 1NDMB 1BGXH 5I1HL 1B0RB 5D5MF 4EEEA 2B2XH 1XZ0A 3QIUD 4CU6A 3NGBB 4U1KB 5C2UB 5IW1B 4TYUA 1F58H 3KYOA 1S3KL 5SWSD 2ZUYA 5GSRB 4LKCB 5HGDB 1OTSC 4Y4FA 4JFQA 2EXWC 4QRQA 3ZKNC 2ADGB 1X5AA 3MLTB 4YGVB 3VGHA 3RIAK 3VH8G 1KLGB 3OJMB 4TUJA 43CAA 2F74A 4QHMA 4M3JA 4NKOA 4OM1L 1NUGA 4KGJA 3MLZH 5IBUB 4NQDA 3OKNA 1QQDA 3IFOA 4V2BA 1FDLH 5ABDE 1AR1C 4UTAL 1FPTH 1B2WH 4KK6D 5M7QA 4Z78B 1ZLSH 3EW3B 3PGCA 1OARH 4M4RA 3TIEA 1YY8B 3ZKMC 2GITB 2E8YA 3OB0H 3ZTNH 1KGCD 3H42L 2FZ3B 2FEEL 1JNLL 1P7KB 4LVNB 5CILL 1OF2B 1U3JA 4YLQT 4Z7VE 2VDRH 2CLZA 4FQXD 1T0NB 3I6KA 3SCMB 3CDGB 4KJQD 2Q6WA 2ZP0T 4OCWH 1WBXB 1N3NA 1GOHA 2J6EA 4ODVL 3CVHL 3A6BH 1J1PL 1ZGLA 1FVEA 2UVEA 4UBDD 5HHPA 5T1DL 2FJFB 3NBNA 3QDJE 2WWMC 2JIXA 4RX4A 2P5ED 1JNJA 2V7HB 2EXYD 2CDEA 3GSVB 4OLYL 1PAMA 3IKKA 2EDXA 1SYSB 2VAAA 4X7TA 3O3DA 1MFCL 3H9SA 4D8PB 2OCFD 1OP3K 2CKNA 4PJ7F 3U0TB 1OAXL 1RJYB 3MUJA 5A3ID 3ZT6A 2FYYB 2X42A 4ZFFA 3PDGA 4J4PC 2QQLH 4EN3B 4H8WL 4L9DA 3NACL 2A6DB 3O45A 1RURH 4M1GL 2DTSA 2YSSA 3CFKB 5DA4A 3TO4C 5EH1A 4TTDD 3RWIA 5I17A 4RAVB 4JM4L 2VOTA 1Z0MA 5DVOA 4F9PA 1A6WL 1FZMA 3BP7A 4MWFB 1QACA 4S1SL 2NXZB 2I9TB 4XWOD 2QBWA 1RVFL 5F9WB 5TPWL 2A9MH 2XN9E 2XA3A 3BKMH 3LAFA 5FHAL 4BH8B 5C8JB 1R3LB 2VUOA 4PUBH 3RWGA 1K9TA 1S7VA 5GHWL 3RVUD 5JIHA 2ZOKA 3NGBC 1FE8H 1A7QH 1I7ZA 3SJVD 2XTJB 5BW7C 3MRFB 5DC4B 5F7EL 1U8NA 2Y06H 8FABA 2XIDA 4F7MA 2ZG2A 3DUHA 3MA9H 3S6CA 4M7LT 1OL0A 4G8GD 2P5WE 5B38A 2BNUB 4G9FA 4PGZA 1QVOA 1L9MA 1F3JB 4PR5A 2ITDA 4TNWF 5BO1L 4YQXL 4ZO6A 1U8PA 4I13B 3ARFB 2AXGA 1FNGA 3BD3A 3BKCH 4O58L 3KLHD 1NGYB 1UFUA 5D6CA 4LCUB 4Q6IA 4G9DB 4ENED 4OB5H 1U2CA 5DURD 1BBJA 4MJ5B 1JWUB 4GAJH 3D0VA 3MACH 4LCWE 1GHFL 4U1IA 3T2QA 1CVRA 1Y6NR 3G08B 4XC1H 1AR2A 5GS1A 1WFOA 1Z6JT 4YK4C 3AAZB 4JZJA 3N0PB 5EG6C 1UA6H 4LLVB 4Z76B 1SJVA 1MFBH 5DJ8A 3MCKB 1MNUH 4CVUA 1IGFL 5EZIH 2D7NA 4Z95L 4OBSA 3TVMD 4FQ1L 5CCKL 1NC4B 4X98A 3IETB 3HC0B 3UYPA 4WI6A 2J4WH 5ITFB 3V5HB 1NCDH 5IVNA 4LVNC 5TE6L 1YYLH 4RBPK 4ZS7L 5FGBC 2WIIA 3OKDA 1K8DB 2VXVL 4I3RL 2NR6C 3CIQA 4PJBF 5BJTA 4E41B 2R69L 4W81A 1DEDA 4POZC 1QHPA 2ED8A 1FORL 4Y4HB 1S5IL 2PTUA 3EBAA 1V3LA 5KN5A 4UV7H 3MLRL 2CGRL 3P0YH 3DBXB 4OF0A 5C6WH 2YA1A 5I1IH 4R4FL 3MUGA 3D18B 2KKQA 1RUQH 2AJYH 1JGDB 3BH8A 2ITCA 5IB4B 3TO2A 4BELD 2Y5TB 3CUPA 2XZCH 1QFWI 2O5ZH 4OFKA 4DQOL 4NHCH 1X5JA 4OZGA 1BLNB 4IRZL 15C8H 2ZCHL 4ZFOA 1U91A 4XBEL 3QQ3B 1S7WA 5DZLA 1MCWW 1AO7E 4X8JA 4LCCA 4PRPA 5H2BB 4EN3C 1ACYH 3WO4B 2GK0B 4R4NC 3T8XA 3VXTA 1E6JH 2AEPH 3BPNC 3WBDA 4OFPA 5IEHA 1MRFH 4HFWB 4IS6A 4QKXB 1FHGA 1CT8A 2FX9L 4H1LH 2H26B 2HTKC 3GKWH 1NCWL 1NEZA 4NQCB 5IK3B 4D0DA 5L8KB 4FQ2L 3S88L 3KPSA 3CLFH 5ERWA 1I8MB 2BVPB 4OM0L 1CGXA 5TFSH 1FV1A 4HUUB 2EH7L 3KGRA 2VXSH 2BVTA 4KJWC 4JN1L 3SE4A 2PXYD 5A2KH 3UPAA 5DD0L 3RWJB 3S34L 3KYMB 3WNKA 5IWLC 2FHBA 1DLHB 3G6AA 4HIXH 1TQBB 4F8QA 3KPRB 2RJMA 3MJ7A 4G8EB 5E5MA 3KR3H 3WL9B 3K4ZA 1AE6L 1E4JA 4ZPTB 1U93A 5HJ3B 4NQSB 3MV9A 1CDBA 1QEWB 2DI9A 2HRPL 5D2LF 1CU4L 4OCSL 4GW1B 4EI6B 4TVSa 1JHLH 3CCHA 2JELL 4YC2C 4S1QL 3U4EB 3OKMA 3OXRA 1QRND 2Y7QB 5I1GH 3DVFA 3BD5A 1IGIL 4KK9D 1JGVL 4NNXB 3PUCA 2CDGA 2ICEB 2R56L 4LMQE 4MD0B 5DJDA 1A2YA 2E7HA 1RZIB 2AV1B 3QQ4A 3TM6A 4EKXA 5LGHL 5CZXC 1HKFA 2YD5A 3SKMA 1U58B 3HFML 3LKPA 4AG4L 2VLLA 3ULUL 1EEYB 1V7MH 1X5XA 3A6CL 3F7YA 1R24B 3MLYH 5JNYB 1T03H 5I15L 2VRAA 4LCIL 5H35A 5L88H 1KB5L 3LVEA 2GJ6E 5JLZA 3QIWD 3OHXA 5EOQL 3X3GH 4EI5C 2YC1B 5BZWA 4ODBD 2DQDH 4JKPH 2D3VA 2V17H 3PGFH 1FCGA 2EIZB 3MNZB 3KNBB 1U8HA 1MLCA 5CD3A 2IMNA 4DGIH 3Q6FB 4U49A 5A16B 5I1DA 1C1EH 4Q2ZA 5ICZB 4R0LA 3MRBA 3GSOB 5DJAB 2YPVL 1OQXA 1PEWA 5GS0C 3FB6A 1JV5B 4KH2A 4KTDH 5FM5O 3H3KA 1P1ZB 4H1LG 2JJSA 4WJ5B 1FZOB 5DQ9B 4HF5H 1IAII 2O93L 2VZUA 5E4IA 4LPWA 2ED9A 1FZKB 4MMXC 3D0LA 2UUDK 3T4AB 3ECBA 3I6LE 2IANE 4Z7VA 2E7LA 3NCBB 5HY9A 1YEGH 4P2YA 1T0MA 1T83A 3ESVF 2OJZH 2LTQC 1OCWH 3FT3B 2R0LL 1IMHC 3WO4C 2H9GB 5E6IB 3D6GA 3KYKL 3S37L 1INDH 3ARGA 4P46D 4PJCE 4U7SA 3KPPA 1G7LA 3STZA 1FNLA 1G9MC 4UMGA 2HVKB 2IALA 3QDJA 4X80H 3HC4L 4QWWD 4OLZH 3GNML 3RHWK 1AXSA 4EVNB 1OWRM 3C2SA 3JTTA 1EMTL 3FN9A 1SJXA 3DI2B 4MB4A 4IMLB 1XH3B 2O5XH 4XPBH 1D5ZB 2XZQH 1T04B 3TBSA 4DGYL 4P5KB 2J8UF 3RVVD 3D3VA 3ZT7A 2EYTB 1UYWH 3LN5B 2RHEA 4MJID 1J5OL 5J6HB 3ZTJH 2FGWH 2GUOA 3VXRB 3ZDXF 4ZPVA 1Q9KB 1JYNA 5E99H 3MA7A 3MV8A 3QWQB 2C1OB 4Z7NF 1KB9J 1A7RL 3ILQD 3HI5L 3PNWA 3O2DH 2Y4SA 4N8VG 3K4DA 4YXHL 4RGOH 5I8CB 1TFHA 4P5TD 1JCKA 3EYFB 2XN9A 4H0HB 4IM8A 4M48L 2FATH 1MAJA 3P9LA 1CBVH 2NX5D 3P11H 2JCCB 4PRID 1U3HD 1ZA6B 5JZ7D 1HINL 3LB6D 4IRSA 2VWEE 4X6DA 1WICA 4LPCA 1SEBB 5SWSA 2IEPA 4PJFF 1ADQA 3HA0A 3P0VL 5CBAB 4MA8H 3EDEA 1LNUA 5HD8D 4OIIL 2G9HA 2F15A 4KKLD 5EOTB 3QA3B 4W68A 2YUVA 1H8NA 4ODSL 3HE7B 1R3JB 3HRZB 3OKOA 4GXUN 3P4MA 2OZ4L 3UJJL 2HLFC 4NJ9H 3BAEL 5DK0A 4TTGA 3O0RL 2DDQL 3WUWA 5J3HC 4OD1L 2DL2A 2EEAA 2ORBH 1BFOB 4DN4L 5LWYL 2EEBA 4HLJA 3CMGA 4AT6B 3T0DA 4JY4B 5ID1B 3KJ6L 3RBGA 1HHJB 1HHHB 4NPYA 4CMHC 4ORGB 4DVRH 4PP2B 2VQ1B 3MOAL 3MV7B 1MQKH 4X5XB 1J88A 4YDKL 3ZLQC 5BV7H 1UWEL 3CH8A 5IBLD 4U6VH 4UT9H 1MFDH 1AJ7H 4QT5B 4G6JL 4DJMA 3IDMA 3K2MC 2Z35B 1R5IB 2A6JA 2QKIA 5JMRA 2OTUB 5MI0C 2CK0H 3TH2T 2APBA 1OAZH 4GRWB 3MFFA 1OM3H 2HT2C 4YHLH 3WKNA 4Y8DC 5IB1B 2DTML 4UT6H 4G7YH 3X3FL 2X4QA 3MXWL 4FXKA 4QHKI 4D9QE 2PW1B 1ZSDB 4F7PB 5FECA 5EC1A 1QFWH 3CLEL 5ANMB 3EO0A 2F54A 3FT2A 4YBHA 4R9HA 4BM7A 4NP4L 3VG9B 2B39A 3SQOH 2YXFA 3GMOB 4L8BB 4WDIB 4D9LL 3C2AL 4HZLA 5CWSA 4LMQI 1JGEA 2CDFA 3C6LA 3DECA 3GM0A 1CDJA 4LGSB 4XMLH 3ZTJG 3KPTA 4KRNA 5FUOH 1N6VA 1ND0A 4K94L 4KAQL 5C0CD 3OWEA 2V5YA 5FIEA 4JFHE 4I4WA 4L8CA 1CF8L 3BW9B 5DR5H 4X5WB 3QXDA 4O02L 3A6OA 1MVFA 2OK0L 2Y1VA 4HH8A 1N4XH 3KHOA 4P9ML 4FFZH 2G2RA 3WS6C 4FQHB 1MCRA 4XCEA 4FNLH 3REWA 2FIKB 4PJDA 2XRAL 3CFBA 3LQZB 4RGMC 2QQKL 1QBLL 4D0CA 2BX5A 5DJZA 2IBZX 3GMRA 4A6YL 2YRPA 4XP6L 5GPRA 4GXUM 5D6DC 4MD4B 4EIZC 1JMZA 4OI7A 4L3CB 4R8WH 3WDHA 3TZVB 3BWUC 4DKFL 1MJUH 2GSIB 4OZIF 3V6OE 3QNXA 4DKEH 3WHXA 3CZFA 1WCBB 5IFAL 4Y5YA 1IQDB 5HTSA 2FH8A 3GRWH 4ZFZB 2YK1H 2PUQT 3SO5A 5KZCD 4M8QA 4HX1B 3BP6A 3HI1A 1KIRB 4C83B 3B9KD 1FNHA 5DS8B 5FDWB 5KW9L 2E9WA 1H8SA 3EYOA 4FQQB 3Q3GA 3FCTB 3LKQB 3WDJA 1ZK9A 4U4BA 1YC7A 5JXEC 2FO1A 4G8GA 4PJ5D 4YHYB 3L5XL 1A6ZB 3DX7B 5E8NB 1I1YB 5C70A 1IAKB 4QRPE 4UOW1 5DRZB 1BREA 1Q0XL 4KTEL 4JG1H 5KSAA 3F5WA 2DB8A 2DWDB 4P23B 3FT4A 3TBVB 2DQEH 2XKNB 4LIQL 1B9ZA 3SO3B 5DC9B 2NY0D 4Q7DA 4XZUB 5DJ0B 4NN5B 3KXFD 3RNKB 3FJTA 1DBKL 5ALCL 1E4XI 4NYLB 1AHWA 3QDME 4XXDA 4U1JA 3V7AE 3WEXA 4NWUL 4XAKE 2AQ3A 4F7CB 4LPXA 5CEZL 3G9AB 4QRSA 1FC2D 1T80A 1YNTB 1P84J 3VFGH 5D7JB 1VFBB 2FX8L 1J1OH 4O4YL 2V5MA 5B3NA 4Z77A 2ZUXA 5DD6B 1AGEB 3RNQA 4Y19D 4K55A 5C09B 4M4PA 1I1AB 4N0UB 5J11C 2MCPL 1ADQH 3PWJB 3PJSB 2XWBA 4L9LC 2R9HC 2BVQB 4LBEB 3OGOE 2EC8A 1K8IA 3BVNB 4MXVE 3RUGA 4PRBA 3MR9B 3RWFA 2GJ6A 2BDNL 3T09A 1HIMH 2ZCLL 3BT2H 4L4VA 5JW5B 5T1KB 4XMKL 3IVKB 5DXWA 3BUYB 1JZ4A 1LO0L 4WUKL 1ZLWH 3H8NA 2F53E 3L3OA 4MA7H 4PB9H 1U8JB 4YUEL 4JQXC 2OTWA 1MFAL 4XNZB 4PRHD 3X17A 5F3BA 3V5DA 5I0DA 3BKJL 4FXLA 5J12C 1T7ZA 2X4NB 2X4UB 3LDBB 1HI6A 4PJ9B 2DL9A 1UEYA 3C5ZA 4JM2B 4R4BB 1RY7B 2M26A 4ONGH 5FM5M 1ETZB 3FFCD 4AQOA 3I2CL 5DVLA 1JIBA 3O41A 4WUUB 1EX0A 3TNMA 3TGXA 2D2OA 1OTUD 4OCYH 4Q0XL 5EUOE 4ODUA 2ADFL 1BAFH 4JRXB 3TFKD 3LH2H 2RAMA 3UROR 1NMBH 2YD7A 4P9HC 5D9SB 3HZYA 4DGVL 3NFPA 4JFYA 1S9KC 2ZCKH 5F1IB 5I8OH 4K7PY 5J8OA 3QHZL 4GG8A 5C07E 4WI8A 4C56E 2EDJA 3EDFA 1MCPH 5TQ0L 1YN7A 1I4FB 3THML 2CKBB 3BX7C 4P2OD 4YH6A 1FDLL 3LEVH 1BJ1H 1FIGL 1OSZB 1FPTL 1OGAE 3BP4B 4X6CE 3RVXD 1OARL 4Z7UE 3QUYB 4PBVC 4Y16A 3AXLA 1GAFL 1G7MA 1I9EA 1QPPA 3BEVA 2Y25A 3V0WH 3DGGB 3L7EA 4LNVA 1VFAA 1A1NB 1XF5A 4NC1C 2NY4D 2YPLE 2NNAA 5JOPE 4OCWL 1DP0A 3F12B 1WWBX 4ZS6C 2P45B 1I7UA 2WLZA 1HYSC 3LEXB 3A6BL 4PJ7A 3PP4H 1HK6A 1ACZA 5D7JC 2PF6A 4L8SA 1KULA 2BVOA 2DKSA 5HGBB 3V4UL 4O5LL 2ESVD 2CLRA 5FA4B 1DQJB 3TA3B 2NZIA 1UB6A 4H88H 1DVFD 3DPBA 4WFGE 1CFSA 4QY8A 4HAGA 1KJVB 3S5LB 5EULV 1LHZA 5EPMB 2RCSH 2WIMA 5SV3A 3BQUD 3QWOB 4MDIA 1CE1L 5ENWA 1CD9B 4G5ZL 4BUGA 1CICC 3V79C 1UJ3B 2QQLL 1N5AB 3FB7B 4LVEA 1RURL 3VWKA 5AZ2H 1FL3B 2H8PA 4TNVK 1QTYT 3EDKA 4I0PA 1SYVA 2QSCH 2MFNA 1KBGH 5GGVY 2IWGA 3IRPX 2CXKA 2X70A 3DUUA 2ATKB 5CINH 4XNZC 3HZMB 4GKSB 4WO4C 2ZSWA 4PV9B 2NW3A 2A9ML 2GY5A 4MMZC 1P4LA 2FBJH 3BKML 3JWNC 4EOWH 5J06A 1DN0B 5IT2H 3QRGH 4G8FB 3HG1B 3P9MB 5TDPA 1W0VA 5L2KA 4NN6C 1QNZH 4PGEA 1YMHB 4HUKB 4ZQKB 2HFGL 4LSSH 4PUBL 1MCHA 4PJ9C 4HLZH 1FE8L 2UZYB 1INQB 3QCVH 2VL4A 1BX2B 4P46A 5SV4A 1ODAA 5IR1B 1UH2A 4PJ8B 4N8PA 1RJZA 3AREC 3MA9L 3X11B 2GTZB 1LE9A 5D2NE 5BMFH 3TBTA 4K3JL 1A1OB 2X10A 4YXKL 3PP3K 2EE6A 3DIFB 3SKOB 1WAAE 3ZDYF 4PRNB 4QTHB 5DQJA 3MCLH 3RZCC 3TBYB 2XY2A 2YXMA 3WDIA 4NC1E 3TN0C 2PYEE 2VLJE 3SDDA 3MLPA 4OB5L 4NQEB 1EFXB 4JAMB 2EDHA 1NC2B 2G75B 3MACL 3OPZH 5DD3L 3O8XB 1FZJA 4HAFA 3VD4A 1U3YA 2EE9A 4I18B 3GI8H 4PJBA 2QTEA 5BS0B 2NY1B 3QFDA 2QJDA 3R4DA 1MFBL 1FH5H 3JTSB 4TQEH 3QUYC 3U0PB 2P4AB 4LGPB 1TQCC 1KJMA 5I74C 3MREA 3VCLA 4APQD 1T2QH 4DN3H 2AV7B 3UTTE 2D7PA 5IVZA 5FO8A 5MEND 1TVHB 3AS3A 3V6OA 5I1AA 1EJOL 1YYLL 1J8HB 1IAOB 2X9XA 4R2GC 3VFVB 3DV4A 4W70A 2EH8H 5KOMC 3LPFA 3GSQA 2UZXB 1CG9B 5A43C 3W0WB 4EDXB 1AP2B 1HCVA 12E8H 3BDXA 2WUBH 3ZSTA 3SHSA 5DK3A 3SDXE 3DYPA 1H3TA 4PJXB 5BXFA 4UV7L 4BKLA 1NAMA 2B7DT 2OTPA 2BOBA 3O6MH 1UCBH 5FV1L 5M94B 5D8JH 1EAPA 5HHNA 5FOJA 1RUQL 2AJYL 3MRDA 3E8UH 3RWDB 3BGFB 4ELMF 4L5FH 1MIEH 5ACZB 4R90L 1A6AA 2BC4A 4WI7A 1VEPA 4KVNL 1H3WM 2FJHB 4HKBB 15C8L 1HDMB 5BVJB 1O5DT 3GIZL 2OI9C 5EBWB 3U48A 4K3DH 4GW4A 4M1CD 5IW3A 3HE6B 4QOKD 4P2QB 5EWIH 2MOVA 4HLZG 4KQ4H 4NO5B 4RMWA 1G7PA 5I18H 2DKUA 5TQ2H 4QHLB 1F13A 2J6EL 2AEPL 5SWQB 3GMPA 2ICWB 2HFEB 1MRFL 4D3CH 2A74A 5D96B 4NO3B 3JWDC 5D7LE 3CVIH 4ZUSB 3VWJA 1WZKA 5BZDA 4OF5A 1OTSD 3RX7A 1L0YA 4NJAH 4DZ8A 1CE6A 1Z5LA 4UIKH 2EXWD 4NKOB 3X13B 3ZKND 5FUZH 2IPKA 2R2BA 4HUVA 1N64L 5F8RC 5ESQB 5TFSL 4LOUC 4K8RH 1MWAH 5GS0H 4M7JH 3IKCB 2VXSL 4OKDA 1A14H 4HEME 3IS1X 1QHOA 2FWOA 2AJZB 2Q20A 3BIBX 3RL2B 3MRGA 4IOIA 1K4DA 1AY1H 4M7ZB 1DBBL 3DVIA 3BISA 3O3UN 3L3IA 3C60A 2AJUH 1A4JA 5T3XD 1DBJH 1N8ZA 1PDKA 1LO4H 4HIXL 2BRQA 1AR1D 4NQVA 5AD0A 3HS0A 4YDJB 2H3NB 1J0KA 2F53A 4HHAB 1UQSA 4GKOA 1F90L 4M6NH 2YEZA 3WLWC 3P4NA 3VXMB 1LO3L 3ZKMD 3OB0K 4HH9A 3O3EA 4V1DB 1BJ8A 2P5WD 4PY7A 4DKAA 3D25B 3SGDI 4LLUA 3BESR 4RZCB 1G9MH 2Y9RT 5ISZB 3PV6A 2HJFB 5IVXE 1NGXA 1XCQB 3K3QA 4XNMA 2GAZA 4P99A 1BOGB 1YQ2A 3C8KB 5J1TC 5C0BB 5I1LA 3VFSA 2QSQA 1RZKH 2NY1C 5SWZD 4FP8L 5BRZE 1B4RA 4XP4H 1U36A 4GT7A 4YDIH 4NWTH 1KT2A 5IMMB 4B41A 1ZVSA 4OGZA 2CXGA 4P2CG 5SX5H 4YR6B 5EUOA 2EDOA 1I7TA 3HNVL 2AXFA 3N1MC 3MLYL 2R0KH 3NIGE 1T03L 3KYNA 2WWMD 1WBZB 5L88L 1CGYA 1XCTA 3QDGE 3Q2CA 3IAPA 3L6FB 3WE6B 3MRPA 5T33H 2VN7A 3LIZH 4M62H 3X3GL 1NFKA 4XP5L 1CXEA 1JHKL 2O5YH 4NKMA 1D6VH 5JTWA 4U6HB 4C56A 1NH6A 5FGCE 2DQDL 4JKPL 2VE6B 5F6HJ 2V17L 3PGFL 2HH0L 3DNKA 1U8MA 1JN6B 4Q9QL 1I3RA 2WSKA 4ZOBA 4GG6B 1KUMA 4J4PD 1FO0H 2Y72A 2PCPA 4F2MB 4I0KA 1WK0A 1C1EL 2R4SL 4JN2A 1OGAA 3U36B 3LSOA 3TO4D 4X6CA 4OF6A 1AXIB 3HLAB 4OJFH 3BGFC 4KTDL 4JFDD 1A4KB 4XRCA 4HF5L 4U1MA 4NSKB 1NAKL 3ZE1F 4G6KH 1YEGL 5F3HA 3S37X 2OJZL 1MJJA 2VL5B 4U1LA 5KSUA 1VSCA 5C92A 1VKXB 2DQCL 4HXAL 5C0GA 5J13B 5C08D 3UTQA 2XQYG 1INDL 1K6QH 1GC1C 3PHQA 3FONA 4O51A 1S7TA 3MBXH 4MGXA 5EC2B 2AAVA 1XR8B 2ITDB 3H7LA 3Q48A 4FQIL 2PO6B 1NMAL 4X80L 1ZTXH 4LLQB 2APWA 2DRUA 5HHOE 3CFJB 2QQQA 4BH7B 1FGNH 3IDJA 2Q8AH 2YA0A 3B2VH 2Z8VC 2EE2A 2XPGA 4JB9H 4P4KB 5DYOB 3QIBD 2O5XL 4XPGH 1WZ1H 3K8KA 3AS1A 2N7BA 3NIFE 1HXYA 3RTQD 4ZFOL 2WWKT 4GLRI 3DXAB 4X0KB 1UYWL 2GIYA 4LSVH 2XY1A 4P57B 1ZVYA 4XBGB 5I1EL 1NCNA 2C3VA 1R6VA 5E99L 1BQUA 1PLGH 3RY6A 3SGKA 1XGTA 1TITA 1YECH 1MJ8L 1AQDA 4J3XA 2OL3B 3EYVB 1OAUH 5I71B 3W9DA 2XA8L 1T0PB 4LLDB 4RFNB 1QYGL 3B6SA 3IDIB 2QSTA 2FATL 1UH4A 1T1ZA 1WCQA 1A6TB 1MVUB 3P11L 3GHEH 1DL7H 2C7UA 3ROOA 3NVQA 1RZ8A 4WWKB 2PTTA 3BO8B 5IJKC 1XGUB 2NR6D 3ZYJA 1MH5B 2NY2C 4H0GA 5DQDH 3NFSH 4HWBH 5JHDB 3VRLF 1JZ8A 4POZD 1BVKB 4OCRH 1FRGH 2HWZH 3LMJH 4LKXA 5L7XH 4M02A 4QHUA 4PJAB 3BMWA 5DK2A 2ORBL 1WAAA 1CFTA 2B20A 1H9VA 3T0EA 3VFMB 1T1XB 4P2OA 3VFPA 4X6FA 2DYPA 4PRPB 2DLGA 1A7OL 2Z91B 5FK9B 2VLJA 5C0AE 3O9WB 3BN9C 3ARBB 1KCLA 2ARWA 4JFFB 5BV7L 3PQYD 4U6VL 3WHE0 2VLRD 3ARVA 1MFDL 4YFDB 5C0JA 5LGKA 2OR9H 4P2RD 2GJZA 3T1WA 5IFJB 3WXVH 4PG9A 4R4ND 4AH2A 4AEIL 3KPOB 1G6RA 5EORL 1OAZL 1SJEB 4ZOAA 2HG5A 3L3KA 1N0LA 1RMFH 5KSBE 1OM3L 2X4RB 4YHLL 5M95B 3TWCH 1DE4A 1YEDA 3W9EB 4UT6L 1UWXH 1TETL 4P59H 4ZSOB 4B0MM 1W0WA 4UIMA 3UTTA 5DD1H 3O4LE 3DSFL 5AG8A 1A9EA 2Z93B 1QFWL 1S9VB 3DV6B 5JIKA 3BMVA 4JANB 1PY9A 2HMIC 4HV8A 2DQHL 3MXVH 5DJ6B 5GIRB 3KLAB 2WP3T 1P7HL 3QZWA 3SDAB 4KJWD 2IAND 4UAOC 4XMLL 4ZAKB 3PABB 3QH3A 1G7JB 3Q6GH 5BCAA 4YXLH 1MCBA 5FUOL 5GXBB 2JF1A 1FVCB 4J3SA 3V7AG 2PO6C 1VFMA 5DRWA 4P4RA 3CFIC 4BUHA 3FOLA 1KJ2A 1D9KC 5D7SL 4J3TA 4OZIA 3IJYB 4P4KC 1N4XL 1MPAL 1NFIA 1BQHA 4JVPA 4OCNC 1REIA 4FNLL 1NJ9A 1Y0LB 5HYQB 3NA9L 5IHZB 1WIOA 2ILLA 1YPZF 3PG2A 2ATPA 3L3JB 2AS5M 3L5JA 3T65A 5A2FA 2IF7A 1F11A 4XVUC 2BNRD 3SPVB 5E8PA 4JDTL 3VXQB 1MJUL 3QSKB 4QRRE 4E9LA 4JFZH 2DM4A 4DKEL 4HKJA 3OKEA 4Y4KA 1GZQA 1NDGA 5CZXD 3BH9B 3IDNA 4CVXA 5D7LA 5I71C 3L3GB 1HHKA 4IJ3B 4H8WC 1FP5A 1KEMH 1JP5A 4YDLB 5C6PB 3FB8B 4GRLC 3K0WA 1YQVH 4YIQA 4RMSA 4KMTH 4OCXH 3E6HA 3BFOA 1W72B 4UTBH 3B9EA 1XF2B 3L5WA 5F89A 2ADJB 1U8LB 1WLHA 4EI5D 5GRJL 2NZ9C 3EJYC 5EZLB 1QSZA 4KHXH 3DETC 1CZ8L 1T6WA 1LO5B 2FB4H 3CXHK 3U46B 2R23A 5L2JB 1JPSH 1P4IH 3PL6C 1WBYB 1AD9A 3S36L 4KZDH 3QFJE 4NIKB 3WLBA 5GS0D 5IUSA 2X41A 2G5BB 4WHDA 3TCLA 4Z8FH 5CJBA 4YZFF 4WEBL 2YS4A 4XVTL 1JNHA 4Z7WE 1J1OL 5ETUA 3T3ME 3V2AR 25C8H 3QNYA 2RQ8A 1MCNA 2EECA 4LK4A 3FQRA 3W5NA 1J05A 4JFEE 4WNQA 1ADQL 4I3GA 1WZMA 4APQA 1AGCB 1QKZL 4NRZA 5B39A 3BIAX 3LKOB 2YBRB 5C6TH 5L0QC 1RU9H 4JHZA 4DUWA 1GVIA 1FFOB 1A9BA 1HE7A 4NNYB 5J6GA 1K4CA 3L3HB 3NCEB 5EBMB 3VD5A 5CIPH 4TPRH 4NQCD 1CFQA 1IAIL 5EU6B 3D39D 2XTJE 1AGFB 1HIML 1AGBB 2P47B 4WW1A 4K2UL 2NY3B 3MLXH 4Y7MA 2MMXA 5EFIA 4MS8C 2JLLA 1FQ9C 4H5SB 5GGVL 3SDAC 4MA7L 4PB9L 4ZAKC 3VJ6A 2APFA 5GGRA 4F57L 5J89A 5LXGL 1Q9OA 1KB5B 1EUUA 1D5MA 3EOBA 1I8KB 3ILPA 1JZ3A 3QIUB 5GRUH 1ORSA 1RPQA 1EO7A 1A21A 4HCRA 2Q8BL 4LCYA 3FO1A 3HUJB 2F5BH 3ZT5A 4DTGH 3ETBF 3F62A 5B22A 4LHUG 5DHYA 4DW2H 5C2BH 4HULB 3FRUA 4ONGL 3BI9X 1BMGA 3MRLA 2ICWJ 3VD9A 3MJ8A 1ZOXA 2B4CL 2XQBL 2OXGA 4NUJB 3QR2A 4IBLT 1YEEH 1EDQA 5DMIH 5DEFA 4JGMA 3LH2L 2HJKA 2DLTA 4OFVA 1NMBL 3P4MB 4GLRH 3CK0L 3MZTA 1T21A 1ZV5A 3KPQA 1GIGH 1RSFA 4LGRB 3RDTC 3WUWB 1XF1A 5IQ7H 1FL6B 5JOFA 2IGFH 2AK4A 4PJEE 2CO7B 5IKCA 2HLFD 2IADA 3A0OA 4X6EA 2OQJB 4UQ3A 4MSWA 4AM0A 4C59B 2K1MA 5JXAH 3BZFA 3U6RA 1DQTA 5DZOA 1EXUA 1X6NA 2ED7A 3GSNB 3EO1A 3MGTB 4U3XA 3L9RB 3UDWC 4IRJA 4E42B 3TBWB 5ECJE 2XWJB 4WI3A 2PNDA 5JPNA 1RUPL 2NQCA 2A83B 2PW2A 5F21B 1C5BH 3NFNA 4FQXB 5IVOA 2BSSB 3S4SB 3FZUC 1JHTB 4XPTH 3VMPA 3MRRA 3OR7B 5IB3A 2VITA 3KPLB 5CEYB 3QNZB 1I1RA 5IOPA 4F37F 1HQRB 1S9YB 3RU8L 2WBJD 2Q3ZA 3O6LH 2HT2D 4KRLB 4ZYKA 4YHKH 4NZUL 5C0IA 2VDLL 2NTFA 2R1YB 2V2TB 1QP1A 1GGIH 3QJFA 2P5EB 3GKZA 4WV1B 5DEGB 4HUWB 1SHMA 1MELA 4M5YH 4H88L 1ZMYA 2V2XA 1KCRH 2HKFH 3GZKA 4XCFH 2VTFA 1JRHL 3B3IB 4JPVL 3TT1H 3VFNA 2J3SA 1WIPA 1OTTC 4ETYA 3QO0B 3UPRA 1FVDB 4LLMB 4MAYC 2VH5L 4I0CC 4ZUVB 3OKKA 3VE0B 1P5VA 1CWVA 3E3QE 5HYSA 3VI3E 3C08L 2CIIB 4W6YB 3E2HB 5FKAA 1W2KT 2NY3C 2XI9A 3VI4E 3ULUC 2UWEB 3HAEA 4EUPH 4LSUH 5I8EA 4JPIA 4Q6YA 3MNVA 4OAWB 1RZGB 2HT3C 4XCYA 5INCA 3H3BC 5D7IE 5C1MB 1JJUA 1WJ3A 1L0QA 4JFDA 3MX0A 5HI4C 4NQUA 4PJIB 3QZWG 1ZWIA 3CFDB 3ARWA 4MNGB 3QUZA 2KBGA 5ICYA 1QNZL 1IGJB 1KCSH 3SJVB 1NDMA 1QSVA 1QRKA 1B0RA 5EO9B 3UYOD 1SQ2N 2X4OB 1XGRB 2DBJA 3IDGB 4XXCC 3OG6B 1JWMB 3BPOB 5HDBE 5BW7A 2FR4B 1BQHG 1JZ7A 4U1KA 3LS4L 5IW1A 3PWVB 1EO8H 3P4OB 5GRWA 1K3ZA 2HFFB 5GSRA 4LKCA 5HGDA 5JXED 3RA7H 3GSRB 3MCLL 4JVWA 4HW6A 1QSED 1RZJL 3WFBH 3MGAA 3CDFA 2ADGA 2P42B 4YGVA 5DURB 4DZBB 2H45A 1Z3GH 1FCCA 1KLGA 5JDSB 1CXKA 3D9AH 1YNLH 5DFWH 4XPHH 3OPZL 4KY1L 1Q0YH 4HCRH 3SOBL 2DIJA 4LP4A 3IDYC 3GJEB 5C07D 5FKPA 3ZHDA 3BIKB 3FB5B 3GI8L 2IAMC 1AFVH 3TVMB 1NFDE 4QGTA 2ARJQ 2HTLC 3K46A 1GYAA 4Z78A 3TC9A 3MRJB 5FGRA 4DN3L 1YY8A 2W9EH 2GITA 3IS0X 1QR1B 3QT2A 4DEPC 2FZ3A 4KK8C 1P7KA 1OF2A 3ARQA 2R9HD 3OGCB 3SCMA 1T0NA 3VRIB 1UACH 3CDGA 3LN4B 12E8L 5D5MB 1WBXA 2F5AH 5D1ZB 1QZ1A 6CGTA 1E4XL 2Q86B 1KG0B 5DI8B 1BIHA 4YWGH 3O6ML 5LCVH 4EUPG 4X9BA 2ZKHH 1XGQB 1ZHBA 2FJFA 2VLKD 3P9WB 4KDTA 3E8UL 1ZLWK 2I07B 5FYLE 3FRPG 2YHGA 2V7HA 2H32B 4U1GC 5EZOH 3GSVA 1GPOH 2VDQH 4ODTH 2VDPH 3EHBC 4LLWB 5DMKB 2MQCA 1SYSA 3BXNB 4D8PA 5CJXC 1DQDH 2R2HB 3U0TA 5B3JE 1RJYA 1QLEH 4YDVB 1PKOA 5EWIL 1JGUL 5E8OB 2FYYA 4X4XB 2D7TH 2VLRA 4L4TE 5I18L 4HGWB 2QHRH 4EN3A 4JHBA 2A6DA 1YEFH 3VH8B 3VXRE 2DM2A 3CFKA 3TV3L 1DFBH 4D3CL 5C7XH 4YHNB 1ZHKB 5FCSH 1XGPB 5ESAB 4XWOC 4UT7L 1UWGH 3V52H 4ALAL 4RAVA 5AAMA 4JQIH 3TF7C 5IBTH 3UTOA 3VA2C 3GSXB 8CGTA 4NJAL 4WFED 4MWFA 2R4RL 1C5CL 2I9TA 4ODWB 5FUZL 3DMMB 4K8RL 2PXYB 2EYSB 2JCCE 2XZAH 5TH2B 3VGEA 4BH8A 3O6KL 4FG6C 3CX2A 3TNNB 5C8JA 2P46B 1R3LA 3UXFA 4NO0D 1JGLH 1CD8A 3QG7H 4BQ9A 3BPOC 2VQUA 3P3YA 2AJUL 5EIIB 4F7TB 3MRFA 1CFVH 4FQCH 1DBJL 4JREB 4KI5C 3QEGH 1ZS8B 1EUTA 4QCIB 2OX5A 4L4JA 1X7QB 2MKLC 5C71A 2BNUA 4GJTB 1F3JA 1QG3A 3ARXA 3UJTH 4MQSB 1QRNB 5GGRY 3W81A 2VC2H 4RMRA 1R5VB 3O6FB 5ELIA 3ARFA 4YX2H 1UENA 1H3XA 1JZ6A 2HAZA 2YUXA 3EUUA 2BSTB 4JR9H 1NGYA 4BQ8A 4LCUA 3MOQA 5IM7B 3MRIB 3MV7E 2PYED 1T89A 3M8OL 3QXWA 4MJ5A 1JWUA 1VENA 4GQ9H 1NMCB 4FZEH 4ZS6D 1RZKL 4K94C 3G08A 4XP4L 3DX6B 1HYSD 4NWTL 3LQAC 3AAZA 3BD4A 2X1QA 5D7JD 5A2IH 4TSCH 4LLVA 4Z76A 3P30H 3WKMH 1P4BH 3MCKA 4GRWE 2R0KL 3QIWB 4L3ED 1I85A 1NC4A 2C4FT 3W39B 3IETA 4Y0GA 3HC0A 3SKUD 1FNAA 1AC6A 3H0TB 5ITFA 3V5HA 5T33L 4M62L 1JL8A 5E03A 5CAYB 4BZ2H 7FABH 1K8DA 1XR9B 4WGVB 1TXKA 3OJDB 4H26B 5D1ZC 2YR3A 4E41A 1MHCB 2X4PB 4LFHG 1CICD 1MRCH 4Y4HA 2C3XA 4PJHB 3QUMB 3DBXA 3PWPE 3B5GA 3L3DB 5FO7B 2EZ0C 3JUYA 1J0HA 5T1KD 4O00A 4XCCL 3S3PA 1NSNL 4J6RH 2M1KA 3D18A 2DQTH 1JGDA 5IB4A 5AUMB 3U0WH 3VFUB 2Y5TA 1FFPB 1P53A 4WO4D 1DUZB 2A6IB 4OTXL 2OP4H 3MUZ1 1BLNA 4PJXF 3EO9L 3MTRA 1CGVA 3QQ3A 2AW2A 2QADB 4F3FB 1H15B 3CX5K 2PKDA 5H2BA 1FYTE 3AM8C 3C87A 1K6QL 4PJ9D 4KI5E 2GK0A 1XMWA 2VERN 3MBXL 5FYJD 1S3KH 4S0TD 1YUHB 2IH1B 1NAML 2WV3A 3M17B 4HFWA 1EA9C 3VGAC 1R3HB 4MX7B 3ARED 1MAMH 1W0YT 1JK8B 1FGNL 2Q8AL 4DWHA 3B2VL 2H26A 1HXMB 4NCDA 4E5XB 2COQA 5DUPH 1T22B 2ENYA 4NQCA 3BUTA 1JFQL 3DMMC 1X4XA 5IK3A 3IU4L 5IB5B 3RZCD 2Z0BA 4OM1H 3TN0D 1T7XA 4MJIB 2DLIA 4JKLA 4QNPE 1I8MA 2BVPA 3MOBH 1JF6A 4HUUA 3GMLB 1OLZA 5DLMH 4ZXBC 4YNYB 2EKJA 5CGYC 1U8IB 3RWJA 1H5BB 5ADPL 3KYMA 2A0LC 3DOSA 1X5IA 5IQ9B 1DLHA 1OP9A 5IVZB 4P5TB 3KPRA 4G8EA 1G9EA 5GGUB 1RIUH 3WL9A 3QUYD 4ZPTA 3H42H 5HJ3A 4NQSA 1CGTA 3O6FC 2NX5B 1QEWA 4PRIB 1U3HB 5CILH 4CJ0A 1SVZA 4KK9C 1Q94B 4GW1A 4EI6A 1SY6A 5E1HB 1DL7L 2F8OA 3I50L 3U4EA 2Y7QA 5E0QA 1QFPA 3CVHH 1UGNA 4R2GD 1DQQB 1Q9LB 2W0PA 4NNXA 1MOEA 3DHJA 3NFSL 2ICEA 4MD0A 3BGMB 3VXSE 4OCRL 1HQ4B 5T1DH 3GEWB 1RZIA 2AV1A 1FRGL 3DWTA 5FAAA 3LMJL 4G43B 3BZDA 1U58A 3D5OF 4LL9A 2MWCA 4CL7A 1EEYA 4HD9A 4OLYH 5BRZD 3ZHKA 2H1PL 3PWLB 2M2DA 1R24A 3WD5L 5JNYA 5I6XB 1CDYA 4DOHE 4G6FD 3V4PL 2GT9B 1MCKA 3ZE0F 2L7UA 1G1YA 2C4FU 2YC1A 4M1GH 1TZIB 4OZFH 1ONQB 2YWZA 5FYKE 1U8QB 4KMQA 5KS9F 2OR9L 2EIZA 1RHHB 3MNZA 3VGFA 1L0XA 1UXWB 1WITA 4YAQB 3WXVL 3KNBA 4FTVE 3S96B 2NXYD 2A2QT 3GMNB 3Q6FA 3HI6L 5A16A 4N68A 5ICZA 3GSOA 1W8OA 4S1SH 1RMFL 5CEZE 4PG2A 5DJAA 3TWCL 1JV5A 5TPWH 2IMMA 4HUVB 1P1ZA 4P59L 4WJ5A 5DQ9A 1FZOA 4IIQB 5D2LB 1FZKA 3WNLA 1BD2D 3T4AA 4WUUE 3TH4T 5GHWH 2QADC 4U0QB 4LOUD 1IGTB 5MEQB 2XQYK 3FT3A 3HMXA 5C0CB 3QQNA 4FOMA 2H9GA 4JRXE 5E6IA 3WJLC 4MB3A 1QBAA 1PD6A 4XBPB 4YXLL 4LRNH 4MLSA 4C58B 2EDBA 1IBGH 1KXQE 2VQTA 1RIVH 2HVKA 3TYFB 3PIQB 1BJMA 4U05A 3CU1A 2QEJA 4Y5XC 4O58H 3U7YL 4GRMB 4EVNA 4UDTB 3WLWD 5HHOD 4I9WD 4IMLA 3WS6A 1XH3A 1KELL 1GHFH 1IM3B 1D5ZA 1HNFA 1T04A 4PY8J 1CQKA 2FO4B 2J7LA 4P5KA 3O81A 4IDJH 1EHLL 2EYTA 1H5BC 3T2OA 3LN5A 3VXUD 5J6HA 5DHVH 4ESKA 3VXRA 5E2WH 2AERT 1Q9KA 1CD0A 2ARJB 1AI1L 3QUKB 5KZCB 2NY1D 5JORB 2C1OA 4J3WA 3B9KB 3REVB 2PN5A 1BBDL 5HGAB 3RX8A 3IT8D 3WN5B 5TE6H 1T1YB 4ZS7H 2CQVA 1PSKL 1MHEB 1JPST 4KMTL 3PGDB 5I8CA 4I3RH 4OCXL 4PJ5B 2J5LC 3EYFA 4KZEH 1RQ5A 2R69H 2JCCA 1MFEH 5I19H 4H1LB 5ACMA 5F9JB 1ZA6A 2BY2A 1SEBA 5HHVL 5KBNC 1D5BB 3STLB 5JXEA 4OZFG 5CBAA 4KHXL 4LEXL 5EUKB 5EOTA 3QA3A 3BJ91 2NY0B 3HE7A 3KXFB 1R3JA 3HRZA 4LVHB 4XB7A 1P4IL 4QHKJ 5E95B 3S36X 1TVBB 1YMME 3P73B 4K23H 4CJ1A 2FJGB 1IJ9A 4X4YB 1XF3B 3MJ9A 4RMTA 1RUML 1BFOA 4OFDA 4IRZH 4Z8FL 1QSFD 1CLCA 2ZCHH 3QUXC 4AT6A 4JY4A 5JUEH 5ID1A 4RFOH 4Y19B 3G6JE 5EU7C 1HHHA 1HHJA 2XTLA 1BP3B 4ORGA 4PP2A 2VQ1A 4U33A 3MCG1 5EA0H 3MV7A 2KZWA 4X5XA 2IH3B 2OJEB 2E6PA 1RUAH 4Z7QE 1SJHB 5C0AD 2J8UB 4PGDB 5ID0B 5F6HI 4QT5A 4YEEA 1F00I 2Z35A 5C6TL 1BWMA 1R5IA 2OTUA 3HG1E 2EIEA 3MV11 5JDJA 1RULL 5IB1A 1UM4L 1DBAL 4NKDB 5KSVB 4OM0H 5C86A 2EH7H 5TDOB 2PW1A 3WNPA 1ZSDA 4F7PA 3F8UB 1V7NL 1J86A 1ZE3C 5ANMA 1YY9C 5D93B 3O4LD 5DD0H 4PRHB 4JRYD 4N8VB 3S34H 4Y4FC 3GMOA 4L8BA 1CFBA 4PJFB 4WDIA 2J12B 5J4MA 2DMCA 2EKSB 1J1XL 1I1CA 1MEXH 3CC5B 5GRUL 4MXWL 3P77B 1QUNA 1HOCB 2HRPH 1CU4H 4NQEE 1G6RL 3SE9H 2BVEA 2F5BL 2QV2A 4OCSH 3BW9A 5F88B 3FFCB 2X1OA 3INUH 4X5WA 1NEUA 5C2BL 4BSJA 4XVJH 3QISA 4V1DD 1TZGH 4FQHA 1EJ6A 1IGIH 3M1BB 1JGVH 2FIKA 2APVA 1JMXA 5BS0E 4DFHA 5IHUL 4ZUUA 1OAYH 1NQBA 4LNRB 4U6XB 3LQZA 5DMIL 1IRAY 1FBIH 5GRZA 5LGHH 4MD4A 4MDJB 2NY2D 4AG4H 4L3CA 2H2PC 3MO1B 4OBRA 4R7NB 3TZVA 3I84A 2GSIA 3A6CH 2W0KA 4UB0L 1J8HE 2IGFL 1E4WH 3CH1B 1WCBA 4ACPA 5I15H 1IQDA 1DQLH 1KJ2L 4ZTOL 5I8KH 3RRQA 4ZFZA 3W0WE 1UT9A 2IPUG 4HX1A 3MJ6A 5EOQH 5FUCE 4L29B 1KIRA 4C83A 5EIVA 4X99B 5T1LD 3GI9H 5DS8A 5FDWA 1L6ZA 1UKSA 2BZDA 4FQQA 5DDHB 3FCTA 3LKQA 5JHLH 3TLRA 4XI5C 5D7IF 3BN9D 3NZHL 2MJWA 3HB3C 4HBCH 4WU7B 3KYAA 1A6ZA 3DX7A 3QPXL 5E8NA 1I1YA 1IAKA 1C5BL 1G9NL 5DRZA 4ZG1A 2NY4B 4XX1E 3C5SB 5IESL 4XPTL 3K2UL 2YPVH 4LVHC 5FFLA 1J10A 4WRLA 2DWDA 3OXSB 4P23A 3TBVA 3N85L 1EZVX 2XKNA 3WFDH 3RI5K 3G5YB 3FQUB 3DX8B 4XZUA 3LHPL 5DJ0A 1KF9B 3RNKA 4P2QE 3O6LL 2ESVB 2XFXB 1S9WB 4NYLA 4OCLC 3UEZA 4ZFGH 1DVFB 1GGBL 2K3TA 2VUYA 1T20B 2LVCA 3DX9B 1GGIL 4F7CA 2E9JA 1YNTA 1NLDL 2Z92B 2R0LH 3LZFH 4MNHB 5D7JA 1VFBA 4M5YL 1KCRL 2HKFL 1B3JA 4XCFL 1NGPL 4F9PC 4YBLB 1FLRL 2P24B 5DD6A 1AGEA 1IGYB 4WTZG 2HMID 4PLKC 2NY5H 5C09A 1WT5A 1IL1B 1I1AA 4N0UA 4WFFD 3BQUB 3PWJA 3PJSA 4JFED 2DBLL 3HC4H 2LVEA 1X5HA 4M5ZH 2BVQA 4LBEA 1KSRA 5HYFA 2PO6D 3F7VB 3W82A 4NQDE 3O3AB 5FHBH 3BVNA 3S97C 1R0AL 1D9KD 5E8EB 3MR9A 4LAQH 3AB0B 5KAQF 4P4KD 4KWUA 3HZKB 4PJGF 4B7IA 4LSUL 4AK1A 4DGYH 3WCYA 5T1KA 1TPXB 3IVKA 2X89D 1I8LA 3BUYA 3DTXB 4KVCL 1N0XL 4GUPB 1ITBB 5IV2B 2DMKA 1U8JA 1U42A 2NY6C 1A7RH 4XVUD 3VXME 2PETA 3N50A 3MZGB 3HI5H 4Q6IC 1N5YL 5FGSA 3T3PF 3RVWC 2GW5A 5ISZE 2DQUL 3QWRD 4YXHH 1UVQB 4PGCB 3SKNB 4M48H 2X4NA 2X4UA 3ULUF 4GRWH 1JPTH 4PJ9A 5GS1C 1HSAB 1T7WA 5C0BE 3DVGB 4JM2A 4R4BA 4BSVB 1R3KB 1C12B 4GRLD 1ES0B 1HINH 1ETZA 2DI7A 4FFWC 3T0VA 4HWEH 3VFWB 4WUUA 3N1GC 43C9B 5DJ2B 1EO8L 2ZG1A 1IKFH 2BOCB 4OZHF 1UEMA 1LO2H 4ZNEA 4ODSH 5D7KE 1I7RB 3H9SE 3AMKA 4JRXA 5JO5B 4CNIB 2OZ4H 5D9SA 2NZ9D 3EJYD 3NA4A 5AEAA 1E6OL 3BAEH 4OSUL 3DETD 5F1IA 3O0RH 1OPGL 5DGQA 2CK2A 1P7QD 3D9AL 5LWYH 5I1JH 4HCRL 3FO2B 3PL6D 5IIEB 1I4FA 3EFFB 3RKDC 4OLWL 2CKBA 1ZHLB 1JPGB 2BNQD 4GG6E 5FYJU 5KTEH 3I3DA 3LRSB 3D2UD 1OSZA 3OF6D 4HPOL 4K3HA 5F7LB 5ICXB 4ZOEA 3SDCB 5ADOH 3BP4A 3NIDF 3IGAA 4JFFD 4C4KT 5MENB 3QUYA 4JO1H 5DMGC 4F37K 5EU3B 4G42A 4HQQL 3V6FB 3DGGA 5SX4I 5IB2B 3Q1SL 2CIKB 1KCKA 1A1NA 1LP9F 1UACL 4LCCC 2E9IA 3X3FH 3MXWH 3F12A 2AKRB 4OUUB 3CLEH 2QL1A 1SM3H 3LEXA 5JQHC 5CZVH 4YWGL 2F19H 1CXFA 1F6FB 4D9LH 3LKNB 5HGBA 5CUSH 2D9CA 3NCYP 3QEHB 4YBLC 2Q7YB 5FA4A 1DQJA 3LS5L 3TA3A 4MS8D 4KFZC 2Z8RA 2XG4A 4HXBH 3SDAD 4KAQH 1KJVA 4KMLB 3S5LA 2VDQL 5GZOC 2PTVA 1CF8H 2W9LA 4QOKB 1Z9SA 5F97E 1U6AL 4QTIL 3WIFB 5EPMA 3NH7H 4O02H 2DS4A 2OK0H 3QWOA 3AY4C 5EN2B 1URLA 2D7TL 3IJHB 3SE4C 1HCFX 3LRGA 1UJ3A 6FABL 1FL5B 1N5AA 3FB7A 1H8OA 1FL3A 1DFBL 2KH2B 4XP6H 3V52L 1PQZB 1ZXQA 1ZHNB 4JQIL 4DKFH 4XWGL 4HC1H 2ATKA 2FD6H 3HZMA 4GKSA 3C09C 5IFAH 4XTRC 4PV9A 5F1NB 2F9BT 1R5WB 1DN0A 5INDB 5F7WC 5GGTA 3RDTD 5BV7C 3QDHA 3HG1A 3P9MA 4G8FA 3U4AA 2XZAL 3GMQB 3U4BL 1C7SA 1YMHA 4ZQKA 2X4TB 3HPLB 2UWEF 1JGLL 4KKBC 5KW9H 5TE4L 4N0CC 1INQA 5JHDE 4KRPD 1BX2A 4RDQG 1CFVL 4MVBC 5IR1A 3QEGL 1LEIB 2ICWI 3L5XH 4PJ8A 3IJSB 4BFIB 2VSCA 3KPMB 3X11A 1AH1A 1WUNT 2GTZA 3E1F1 3QXUA 1L4IA 1AKJB 4WI9A 3NABH 4PJAE 2P5WB 1MHHB 4JFXB 1A1OA 3FO9B 4MXQC 1M6OB 1NCAH 3DIFA 3SKOA 2VC2L 4PRNA 4QTHA 3N1PC 5FYKH 3TBYA 2E7CA 5J7CC 4UUJB 4PRPE 4MYWB 3FZUD 1FSKC 3N9GH 5ALCH 4HS6B 4ZYKB 4NQEA 2AK1L 1EFXA 4JAMA 4HFUH 5SWZB 4PRDB 5CEZH 1NC2A 2G75A 2ZPKH 4LCWB 3O8XA 4FZEL 1NGWB 4MQTB 2FX8H 4O4YH 1MY5A 2AJ3B 4WY7H 5T5FL 3QHTC 4I18A 4GOSA 2J1KA 3SDCC 2DN7A 2IQAB 4R0LC 5BS0A 4KV5F 2IC2A 3JTSA 1P4BL 3GJFH 1T66C 3BN3B 3L7FB 3U0PA 4RGNE 1EBPA 1HZHL 3KPSE 4UILH 3O2WH 5HYJD 3HCVA 3HR5B 4KROC 1FJ1B 4ZSOE 4NC2B 4PYHA 2AV7A 2FX7L 2G60L 1TVHA 2ZWLT 1FG9C 1OTTD 2E7LC 1J8HA 3F58H 3H7BB 7FABL 1IAOA 1T83C 3O2VL 1M7IB 2BCKB 4IHOB 3VFVA 5DD5L 4YHIB 4GKZB 4ZDHB 3PHOB 1K5NB 3EGSB 4MAYD 1CG9A 2OSLB 3W0WA 2BDNH 3EJJX 4EDXA 1AP2A 1MRCL 2ZCLH 3TO4B 4XMKH 4OFYD 1XFPA 4PJXA 3MNWB 3D69B 1MCOH 1KJ3H 3MV9E 4WUKH 2NY3D 4M1DL 4TNVF 3ULUD 3BHBB 2K9UA 2ADIA 4WI2A 4YUEH 3NAAH 1D3CA 5IEKB 1MFAH 2HT3D 2DQTL 5C3LD 3RWDA 5ACZA 1QSFA 5KG9B 3BKJH 5K93A 4RNRB 2FJHA 2OP4L 5HI4D 4HKBA 5C08B 1HDMA 3EYSL 5DUML 5BVJA 1F6AB 3VDBA 5EBWA 5IP4A 1RJLB 1AO7B 4LRIC 2L4OA 3HE6A 3ZYOA 4P2QA 3I2CH 1CL7I 3JZ7A 4NO5A 3LKRB 4QHLA 3ES6B 2L0DA 5SWQA 4Q0XH 2ICWA 1T4KB 2HFEA 3KDMB 4L4TD 2ADFH 2EICA 2VDMH 4NO3A 3IU3B 4K9EL 1MAML 2RIKA 5EOCJ 4ZUSA 1OB1B 4FQPA 4DGVH 3QIBB 3RPKA 5H8DA 4F7EB 4PFEA 3CNKA 5DUPL 3QHZH 4GXVL 2C26A 3RTQB 5E24E 5I73B 1ZT7B 3N06B 1C16B 4HS8L 2AXHA 3X13A 3UMTA 2GCYB 5TQ0H 4M6OL 3RVTC 4IRSC 5FKPB 3MOBL 5ESQA 2VXQL 2OM5A 3THMH 3IKCA 4NZTL 5DLML 1G7HB 3K8MA 2AJZA 1FIGH 4YK4B 3OX8B 3RL2A 2WWKO 3OZ9H 5EZJB 1NGZB 2RFXB 5HPOA 4NOFA 2ENSA 3FQXB 1E4KA 3E6FB 2IAMD 3R0MA 2R2EB 4N0RA 1GAFH 2V5SA 5I16B 4ODXB 3TESA 1RIUL 2HTLD 1AIFB 1I3UA 3SDYL 1IM9D 4ODHH 4YDJA 4YEFA 1E27B 2H3NA 4HHAA 2XYCA 4ELMB 1X5YA 4HMCA 3VXMA 1H0DB 4KI1A 4V1DA 1PKQB 2X5PA 3U2SB 3IB4A 5KJRL 4JZNB 3D25A 4JO4H 4RZCA 4NCC1 4KK8D 5ISZA 2HJFA 3V4VL 5D1XB 1XCQA 2JJUA 4X7SL 3MRQB 1BOGA 3C8KA 1WFTA 3QB7C 5IJKA 3V4UH 4O5LH 5C0BA 2DQGL 1UC6A 1ZHBB 2ZNWA 3GBML 3FOMB 2PR4H 5IMMA 4TVPE 2ZUUA 4S11A 5E9DD 4MD5B 3T77B 3WJJA 2FHCA 4D9RE 1BFVL 4YR6A 1ZANH 2VYRE 5F7HA 4U3CA 5DRXB 4I77H 4YPJA 2J88H 4OQTA 2B4CC 1WBZA 3MBEB 2A1WL 5HVHB 1FAIH 5EU6E 3PQYB 2N1KA 1CE1H 2E6QA 3L6FA 2VLRB 3WE6A 4G5ZH 3EHBD 3D3VE 2FCBA 1LK2B 1M4KA 1NBVH 4P2RB 3MRKB 5F9OL 2N4IA 4U6HA 1EH9A 4C55A 2VE6A 3C6LC 1TNNA 3MV8E 3DYOA 4MHHI 3BPNB 1S5HB 1JN6A 5H94B 1GOGA 4GG6A 4PGBB 2DWEB 2EDFA 4F2MA 5KVEH 1F2QA 2JJWA 3U36A 3ZMRA 2JE8A 2XNAB 1B6UA 2VMFA 2FECI 4M93C 3HLAA 3HUJE 4AIZB 5B4MC 1A4KA 2E27H 3FO0H 1IGCH 3SGJC 4X6DE 4NSKA 5SWSE 2HFGH 1FYHB 4NHUB 2IANB 4PJHF 2VL5A 4N5EC 2PYFB 3JXAA 5GS2H 1VKXA 4MNQD 1JYWA 4FG6D 4S2SB 3UTSD 2BFVL 1B0GB 2WP3O 3U30B 4LRNL 3FQWB 2GFBB 2R8SL 4K3JH 4KPHH 4P3DB 5MERB 4PJCB 4YXKH 5EC2A 4AIOA 4Y5YC 1IBGL 1XR8A 4PBWD 3V6ZB 1RIVL 4KI5D 1WZLA 2PO6A 3QIBC 1CI5A 1MUJB 2BXZA 4LLQA 1I9JH 3CFJA 3HC3H 4BH7A 2BSRB 3RTQC 4PLOB 5IMOB 3CFEB 4YC2B 5I73C 1MCCA 4P4KA 5DYOA 4OKVB 3LKSB 4JY5H 2DLEA 5K9KB 1UZ6F 5E4EC 5DD3H 2BNRB 4PLJC 5GRVK 1WIUA 4NFCA 3EOAB 1KGCE 2WBKA 4IDJL 3DXAA 4X0KA 1L9NA 1NCUA 1MREH 4P57A 1JTPA 5KSAC 5E2WL 4XBGA 3RPIB 4ZOCA 2VO5A 4KJYB 3KS0J 3EJZC 2H6PB 2LABA 2OL3A 3EYVA 3V5KB 1AHWC 1EJOH 2VB5A 4LLDA 2F54E 5E6ZA 1OW0C 2C3WA 3IDIA 2Q1EA 4KZEL 1A6TA 4EI5B 3WHE1 1MVUA 3D48R 2Y36H 5D1XC 1MFEL 5I19L 2P5EE 2X44D 4WWKA 4CVZB 3BO8A 1XGUA 3S9DB 5D1ZD 1MH5A 2MHAB 4GFTB 2CUMA 5FXCH 5JHDA 1BECA 1BVKA 4TUKL 2CRMA 2OR8A 2C3GA 2BY0A 4OLUH 1A7NH 1MWAB 4KHTL 1S7XB 3BYTA 4TOYH 2Y07H 4K23L 3MROB 4R90H 3VXSD 4PJAA 2EZ0D 4KVNH 4YBQC 2WUCL 4HS3B 1ZLVH 3PL6A 3MBEC 4PJDE 5FV2A 3GIZH 5HVHC 3VFMA 1T1XA 5JUEL 4RFOL 5D1QD 3T2NL 2Z91A 5FK9A 1ROWA 3TPKA 1SY6L 3WV0A 2LTQB 3O9WA 3I02B 3ARBA 4ORZC 5EA0L 2K7QA 1MI5D 4QF1B 1RZJC 1RUAL 2AEWA 2J6EH 4JFFA 4O2CB 4RRPA 1KC5L 5DHXB 4Q9RH 4XAWH 1GCFA 4LU5H 2DM7A 1A6VH 4JJ5B 5IFJA 3IXTB 2EO1A 5TJWK 1KCVL 3QCUH 3KPOA 1F4AA 5KVDH 2APTA 3K74B 1GGTA 1SJEA 4FTVD 3D39B 1PG7L 2WINB 4GKNB 2X4RA 2HJLB 3C5ZC 4JPWH 3W9EA 1FGVH 5AYQA 1V3JA 5I75C 1F4XH 4ZSOA 1N64H 5LG1A 5BOPA 5CEZD 1E28B 4G8GE 3OAYH 3AFLA 2Z93A 3DMMD 1YN6A 4XX1G 1S9VA 3DV6A 1EK3A 4N1EA 3PWNB 1GL4B 3MRMB 4JANA 4POUB 1DBBH 4JEGB 3BPCB 1NANI 4JRWA 5EDXA 4X4ZA 5DJ6A 5GIRA 1KPVA 3KLAA 3U30C 3SDAA 4Y89A 4ZXBD 1F6LL 4ZAKA 2IBZY 1CL7H 2GTWB 3PABA 1G7JA 4LQFH 1EBAA 3DUSB 5CGYD 1MEXL 5DO2C 4U3HA 1TCMA 1KEGH 1FVCA 3RX5A 2EDKA 2A0LD 1F90H 3SE9L 2YN5A 1LO3H 1F45A 3INUL 3L5HA 1TENA 3MGOB 4XVJL 1FO0B 3IJYA 3O6FD 5F72S 1TZGL 1H3PL 1G7IB 1KIPB 4DAGH 5HI5C 1JVKA 3STBA 1Y0LA 1OAYL 5HYQA 5IHZA 4WTXA 4CADB 1MRDH 2D7MA 4Y16C 1FBIL 4XC3L 2YD4A 3BOVA 3F65A 3L3JA 4FP8H 1EFQA 3SPVA 3HMXL 3T4YB 1CTOA 3HRPA 4AEHH 3VXQA 3VXNB 1VFUA 1D7FA 1OWWA 4MZ3A 1LEGB 3RUGE 4G80B 5GGSY 3HNVH 1WSST 4N8CL 1E4WL 1DJSA 3BH9A 2GKIA 1DQLL 4F33B 3L3GA 4ZO8A 5I8KL 1OHQA 2MQ0A 5D5ME 3ULSB 4Z18A 4L4VE 4S1DC 4BQCA 3FB8A 4XP5H 5FYLL 4GW5B 1JHKH 3GI9L 4L8SC 4CMHB 1KLUB 4NM8H 2YMXH 4WEUD 5D72L 4ISVB 3DLQR 2VWEC 5JHLL 2HH0H 1W72A 4Q9QH 4OLXL 2O26U 4HBCL 1XF2A 2ADJA 1U8LA 4QRPB 1F4HA 4PB0H 5L9DH 2VDNH 2R4SH 5EZLA 1T2JA 3WUZA 7CGTA 4K8RC 4AEEA 5MI0B 2CRIA 3GUTB 2WBJB 1LO5A 4M43L 3U46A 5L2JA 3WFDL 4JZOB 1SVCP 4I48B 1QLFB 5E2VL 2B1AH 4YHPB 1P84K 1WBYA 2CPCA 2XOTA 2WM0A 1NAKH 1IARB 4U1NB 3VWKC 2OL3H 3QDMB 4ZFGL 3QEQD 1YMMD 2G5BA 5TF0A 4UDUB 4I0PC 1FNEB 1VPOH 1N26A 4P5MB 3LZFL 2DQCH 4HXAH 5F70A 4OF8A 4X4ME 2QADD 1YPZB 4CMMB 2NY5L 3G5XB 3C8HA 5B8CB 5T5NG 4A2LA 1AGCA 4FQIH 4HIJB 1NMAH 4JVUA 5E00B 1A3LL 3LKOA 2YBRA 4YFLI 4M5ZL 2E8ZA 1KYOK 5MEOB 4HIIB 3UZQA 5IMLB 1Q72H 1JWSB 5FHBL 1A1MB 1FFOA 1RZKC 3H3PL 4NNYA 3L3HA 4LAQL 4UNTA 3MJ9L 3B2UC 5EB9A 5EBMA 3UBXB 4TUOB 5EU6A 4RGMB 1AGFA 1X6LA 4HUXB 4M03A 1AGBA 4Z7OF 5GJSL 4XNXH 1UJTA 5I1EH 4H5SA 4DCQB 3JWOL 4LEOB 1WTLA 2VDOH 1QRNE 4WHTB 1KB5A 1MJ8H 1T1WB 3JV4B 5AYUH 3SDDC 2Z9TA 4JFPB 1I8KA 3FN0H 2XA8H 2WAHA 4MLIA 3QIUA 3ZDZF 5B38G 1QYGH 3FHQA 4NZRL 4PJ7E 5E1AB 3HUJA 5E94B 2FLBT 1JPTL 4BFGA 1F2XK 5CKGA 1X5LA 1P5UA 1YEIH 3UAJC 4HWEL 1AD0B 4XXCA 4JGJA 4O2EB 2NY7L 1IKFL 1QSEB 4NUJA 1LO2L 2CR6A 3QI9D 3ARZA 1LQSR 2YRZA 4PYGA 3WNMA 4PY8I 2IFFH 5F7FA 2Z8WC 3V6OC 4XNUH 4BSWB 3D87B 5K59F 5K9JL 1QFUH 3C6SB 2Z31B 5HPMB 1A6UL 2VLMD 1LK3H 5C07B 4RMVA 1FL6A 35C8H 2YD9A 5I1JL 2EYRB 1A6PA 1A7OH 1WV7T 1CDUA 1IAMA 2OQJA 4NO2B 5E8DH 1XGYH 5EO0B 1LP9A 3QUXD 5KTEL 2AJXH 1JRHI 1R3IH 5ADOL 1NCTA 4RAUB 1UXSB 3GSNA 3MGTA 3L9RA 4E42A 4OGYH 3TBWA 5J11B 2XWJA 4FMKA 4Z7UB 4JO1L 4ONOA 4UNVA 1S8DB 4L9LB 2A83A 4AEIH 5TE7H 1NPUA 5L2KE 4FQXA 5EORH 2BSSA 3S4SA 1RD6A 4L1DA 4MHHG 4F15C 2WBJC 4C54A 1JHTA 2NW2B 4M00A 4Y1AD 3QULB 3OR7A 4QXTB 2DQFB 2OBGA 3KPLA 5CEYA 1O7VA 1TETH 3QNZA 2YPLB 5DJYB 2J8OA 3DSFH 1HQRA 1S9YA 1T3FB 1SM3L 3KPNB 4JHWH 2VLKB 2RR3A 5CZVL 2DQHH 2F19L 2R1YA 2V2TA 2LU7A 1RAMA 3OAUH 3K1DA 3GK8H 4KKAC 2FH6A 5CUSL 2P5EA 4M61B 4WV1A 4XNYH 5DEGA 3VWJC 4HUWA 4LHUB 3U9UB 5EU5B 2YD1A 1YY9D 2VXTH 1W72H 5B8CC 4OZGF 4HXBL 3TH3T 4J2XA 4Y4FD 2I60L 3B3IA 4OT1L 4NC0B 5E70A 4KDWA 4RRPG 4HUMB 2R1WB 3QO0A 3NH7L 5D7SH 5J12B 1FVDA 1CLYL 4MJIE 4LLMA 4WI4A 1MPAH 1M71B 3GHBH 4UZGA 3CSGA 4ZUVA 5HVFB 4QYOB 3VE0A 4PJBE 5FM8A 1NEZG 3VA6A 4ZUUB 3C60C 3NA9H 2CIIA 1KXVC 1WGOA 2R1XB 2UV3A 1LVEA 3WFCL 2UWEA 4U0RB 4OAWA 1RZGA 2HP4A 4JDTH 1RZFH 4I2XB 4HC1L 1C7TA 1NANH 1EEZB 2FD6L 4CN1A 2NX5E 4K7PH 4PRIE 2V7NB 4AL8L 1CGSH 2APXA 3T08A 1TJHL 4PJIA 1HHIB 4NO0B 2H2PD 4YHZH 3CFDA 4MNGA 4ZMAT 3N1FC 1IGJA 4TVPH 4PS4H 3SJVA 4QXGH 5EO9A 2W92A 3VFOB 3M07A 2X4OA 1XGRA 2W9DH 3ROLB 2W38A 3IDGA 4JY6B 1BZ7B 2Q76B 1JWMA 2L7JA 3SE3C 2FR4A 5GRJH 1YYMH 3NABL 4WFHE 3PWVA 5D2NB 3UZVB 2UVFA 3P4OA 1NCAL 4J8RB 2HFFA 1CZ8H 4XI5D 5CIPB 5KVFH 2JIXD 3HB3D 3GSRA 4RX4D 2YOCA 4HIEB 2P8LB 5FYKL 2Z31C 3ZE2E 2PYEB 5D7KD 4DZBA 3N9GL 1U2HA 3S36H 2D03L 4O9HL 3V6BR 5JDSA 4HFUL 3K81A 1YA5A 5TGBB 5I30L 3VFRB 4I8DA 1U41A 2ZPKL 1IC1A 1FIEA 1EVUA 4WEBH 3AMLA 3B5HA 4XVTH 1JI1A 3G5ZB 3GJEA 3BIKA 4G7VL 1IKNA 3FB5A 4WY7L 1D6EB 1BHGA 1FFNB 4JDVB 3TVMA 4L3EB 4Y5VB 5CJ5A 5E5UB 1QKZH 1U92A 1L7TL 4UILL 3O2WL 5A2JH 2W60B 3MRJA 1MCQA 1H3GA 4AENB 4PLKD 1QR1A 1T5XB 4ONHB 1A7PL 5DJXB 3F58L 1S7QB 4HIHB 4GQPH 1CICB 3OGCA 3VRIA 1IAIH 3TT3H 3LN4A 1NBZB 4J3UA 1CN4A 5D5MA 4HZAA 1DBMH 5D1ZA 4F9LA 4K2UH 1J0IA 3SDXB 2Q86A 1YEKL 1MY7A 2CKBL 4HK3N 1KG0A 4X5LA 5DT1H 1IT9L 1MCOL 1KJ3L 5DI8A 5GGVH 5JIPA 4KU1A 4XGZB 3RP1A 1BVLB 1L7IH 2XWTB 4F57H 3NAAL 5LXGH 1XGQA 5LGJB 3GSNH 1WVZA 4WO4B 4G9FD 2I07A 1T6VN 4Z7VF 5JQ6H 2CMRL 2DD8L 3NPSC 4FFVC 2H32A 2JJTA 5HHME 2Q8BH 2NY6D 1G0YR 4LLWA 4NN6B 5DMKA 1A8JH 3BXNA 1JZ2A 1YJDH 4LSPL 1AQKL 2LU4A 4U1HB 2R2HA 3RVWD 5C9KA 2NLJB 4YDVA 5GGQH 5E8OA 4X4XA 1A64A 2B4CH 1OAQH 2XQBH 4JDZB 4Y2DB 4HGWA 5T3ZL 3AM8A 3AREB 4M7KL 1Z9LA 1BM3H 1NBYB 3VH8A 3EOYG 4U0RC 3SGKC 4YHNA 1ZHKA 2VDML 1XGPA 2A9NL 2W91A 5ESAA 3U9PH 4FFWD 3CK0H 1NKRA 4X4MA 3DO7B 3ABZA 3EKCA 1WEJL 3RZCB 4CVWA 3F7RA 3QJHB 1JTOA 5HVGB 2YN3A 1F8TL 3TN0B 1QFOA 1RHFA 3GSXA 4W6XB 4ODWA 1A02N 4PJ5E 3S3JA 3MODH 3DMMA 3FAXA 1EEQA 4JKKA 2BSED 2PXYA 2EYSA 1A22B 5TH2A 5IW6B 3TNNA 1QA9B 3OZ9L 3IGAB 5ESVB 1BWWA 2HFTA 3RKDD 1HEZB 5EIIA 3DRTB 4F7TA 3WIHA 3KXFE 5D2NC 3RWCB 1RUPH 1X5FA 1ZS8A 4G42B 1TQCB 1QLRB 2LFGA 4X6BB 4QCIA 4S1RH 5I74B 1IQWH 3QRFM 1X7QA 4ODHL 4HMDA 3JWDL 3R1GH 3T0EC 4AQ1B 5DMGD 2ZUWA 1QRNA 1B90A 1XT5A 4K7FB 3KWWB 1R5VA 3O6FA 3OJ2C 3CGTA 4R2GB 4EUPB 4JO4L 3HPJB 2BSTA 3RU8H 5IVXB 3WFHB 2VZ3A 5IM7A 3WUWG 3MRIA 5E6YA 4NZUH 2VDLH 4RA0C 2J8UE 2O61B 3ME0A 1N6QL 5IFHL 2EIBA 2PR4L 4Y5VC 5BRZB 3DX6A 1JRHH 4Z7NE 4JPVH 1NLBH 1ZANL 4I5BB 5BQ7B 4FS0A 1V05A 3WMSA 4G6FB 4PD4J 5L6YL 1I9RH 4I77L 3UPCA 3NN8B 3QIWA 2J88L 3TIDB 3W39A 4GBXB 3RY4A 4EJ1C 4RFEB 3QDGB 4NQXB 1FAIL 2OI9B 3H0TA 3IF1B 5LKNA 4KXZI 2VH5H 2EE3A 2ZUVA 1T5WB 5GZOD 3OAZH 1NBVL 1JE6A 4TRPH 4R96B 1XR9A 3OJDA 5FGCB 3C08H 4H26A 1U95B 4LASL 2NXYB 2X9YA 4Z0BL 1MHCA 2X4PA 1S7SB 4PJFE 2ERJC 4W4OA 1BVZA 4NM4L 4PJHA 5KVEL 1N2RB 1P6AB 3QUMA 4OGXL 4ZUWB 1HNGA 3WFEL 3L3DA 5FO7A 3BWAB