2ICWB

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
190
structure length
184
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 184
sequence length 190
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2icwB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2icwB01
1R5IB 4HWNA 2BVPB 5LGKA 5IJVA 1NCBL 1QLEH 4JVUA 4O58H 2PR4H 3QHFH 5FYJD 1VKXA 4ZUUB 3MNWB 3VGEA 4GKSA 5CD3A 2OK0L 4PRDB 5D71H 4G6KL 2XG4A 5AYUL 3V6ZA 4BK5A 4XTRD 5L6YH 3MRJA 3CX5K 4R96A 2DQGH 1OAUL 3I85A 5EOCL 5ALCH 3D1MC 1E6JL 3P9MB 4FN0A 2ATPA 2IPKA 1DBKH 3INUH 2PXYA 4FQXA 1S3KH 3T65A 2VQ1B 4EN3B 3QUKA 4XT1C 5IB3B 2E6JA 3MV9D 3CVHA 3FT3A 5IQ9A 3BP5B 1FFOB 4YBLB 3BP7A 4A6YL 2R4SH 3STLB 1JWSB 3STZB 4G8FB 1I1YB 4N9OB 5TE7H 3MRFB 1UG9A 4PJ5A 4NKDA 1KFAH 4LSVH 1GC1L 4WW2C 4M8QA 4NQTA 4UIMA 3VXME 1PKQB 1T2QH 2OI9B 4CVUA 4O00A 3WUZA 5GISL 5TQ0H 3TGXA 1TLKA 1ZHKB 3PIQB 4HUWB 4I0PB 1E4XI 3QO0A 3VXMA 3F65A 3JWDC 1ZV5A 4M1GH 3A6BH 5F1IA 4OFKA 2CUHA 1DEDA 2NLJB 3KHQA 3CDGB 2X4OB 2Z35B 5D2NE 1LDPH 1GYAA 1UCTA 1RFDH 1A1OB 2R23A 3L3OA 1UZ6F 2A9NH 3RY6C 3O3DA 2D7QA 2AKRA 4M7LL 3UTTE 1FZOA 5C08E 5MEPA 1E4KA 2WBJA 2HTLD 1AFVH 1KLUA 4OLZL 3WS6A 4HH9B 1BF2A 2HKFH 3B3IA 5EPMB 5D9SA 3VWJD 3S34H 3UTTA 5I9QB 1S7WB 2I24N 2K1MA 5HHPB 1YNTB 4K94C 3BP6B 3I6KA 4OLXH 5EDXA 1SEBB 3NACH 5JIHA 4NUJB 4NJAL 3E6FA 3I02A 4R0LC 5JOEA 4R9HA 1DDHB 5FYKD 3MRDB 2Z93B 5C07E 3RNKB 4P3CL 2BDNL 4WEBH 1R5IA 4MA8H 2BVPA 1BWMA 3WLWC 1TQCC 5KSUB 1SJXA 2EEDA 3BDYL 5ISZD 4HUNB 3O3AB 4ZUUA 1RUQL 3MNWA 1N2RB 1V7MH 1DSFL 5A2KH 1KTKE 1KC5L 2D31A 3NCJL 1DN0A 3GSUB 4WTWA 2CQVA 3GKZA 1IZJA 5DURB 4OKDA 1AO7D 2WANA 3ARVA 3PGFH 3G5XA 4TYUA 1G9ML 3EYUH 4WUKL 4MS8D 4EN3A 1JNLH 1PLGL 5IB3A 3C6SB 2DWDA 3MXWL 3SKJL 3IDIA 3BEWB 3O6KH 4R26L 2A38A 1HWHB 3BP5A 1LP9B 3LCYA 3BKCH 5CIPB 1SJVA 3STLA 1JWSA 3STZA 2BHZA 4G8FA 1I1YA 1XF4B 5IKCB 3TFKC 1TVBB 4JGJA 1ERNA 2ZJSL 5CKGA 2OXGA 2XZAL 1PW3A 1TETL 1PKQA 2M26A 1AD9B 5MI0B 1JMZA 2CLZB 1T89C 5F1NA 2O5ZL 3HC4L 1F5WA 3PIQA 4P4KC 5FM5O 3RQ3A 4YHLL 3C2AH 2BRQA 5IF0B 5E4EB 3VU2A 1YYML 2NLJA 3S37L 3LSOB 1IEAB 3CDGA 4CW1A 5EN2A 5IBTH 5E5MB 4HLZH 2OCFD 4G6MH 3VI4F 4J3XA 1F3DJ 4J6RH 3GKWH 3NAAL 1A1OA 2DF3A 3MREB 4IOFC 3QUYD 1P7KB 3GK8L 2EYSA 1ZOXA 1NBVH 5HYSB 4KKLD 4OZ4B 3AY4A 3RWDB 5ID1B 1A4JA 1H3PL 4GG8A 4HH9A 4KROD 5AZEH 4ZFFA 3BOVA 5EPMA 3F5WB 3FO0H 5HHPA 2WINB 1YNTA 3BP6A 1SEBA 3HMXH 5T3ZD 1VGKA 4XP5H 2O5XL 1MCIA 1DDHA 3X14B 3MRDA 5GRUL 1IEBB 4QY8B 3RNKA 4F9LA 2WLYA 5SWQB 3HI5L 4Y19D 5GJTL 3MCLL 5KSUA 3WNPA 2CDEA 1GXEA 4DEPB 2NZIA 1QG3A 2XWBB 3O3AA 1SQ2N 4DQOH 5M7QA 4WI6A 4QRTB 4MZ3A 4LVOC 1J1XL 1N2RA 4GFTB 1EA9C 4EDXA 3QDAA 4L9DA 2Y6SD 3ROLB 1JMXA 3WNNA 1AGEB 4Z7OE 3E3QC 4NKIH 5D1QC 4JPIB 4DN3L 2EIZB 4J4PC 3L95B 3RTQB 5DMGC 1LP9E 2WV3A 3V5DB 3DHMA 3GSXB 1CLZH 3BEWA 4TULL 3O4OB 5F96L 3FHAA 2XOTA 5I1IL 4M7JL 1LP9A 1ZANL 1F4YL 4JO4L 5CIPA 4M62H 2ZCLH 1N7ML 3H2WA 2BXZA 5IROC 5HI3D 1XF4A 1TVBA 2EIBA 1T20B 4YR6B 1TENA 4JB9H 5I0DA 4LHQB 4N0RA 1GVIA 2DQUL 3CIQA 4ZAKD 4XP9H 4TVSa 3Q5YA 3PWLB 3U9UA 1VADB 5ID0B 2DKUA 1DVFB 2F19H 1Z9LA 1F4XL 2HRLA 1TQBB 3LSOA 1IEAA 2B4CL 4K7FB 4FABL 2OL3L 5E5MA 4OLVH 2VABB 3Q0HA 1EEUA 2NYYD 5IV2B 4XCEB 1E6OL 4KFZC 4FQ1H 1WZKA 4NN6B 4P23C 3MREA 1RZ7H 1F6FB 1P7KA 1PY4A 3PF2A 5HYSA 2YC1B 1U3YA 4OZ4A 4GBXB 5JDJA 1N5AB 1U8LB 3RWDA 3H9HB 2EDRA 2XN9D 3PWUB 4B41A 4OBSA 3F5WA 5K33A 12E8H 3SDCB 2WINA 1RURH 3IS0X 1G6RB 4UBDD 1G9NH 3KXFB 1MQKL 1QFWI 2OP4H 4E5XB 1PYWB 1T1WB 4P2RD 5EA0L 3LKSB 4QY8A 4RISL 5SWQA 5JQHC 4PJ9C 3LH2L 5GGVH 5I1KH 5E24E 4JQIH 3EDFA 4ZXBB 1I1AD 3O3UN 4NKMB 3TH3T 4QRTA 3CFEB 2FB4H 5EZIH 2I60L 2XTJD 3VFPB 1AGEA 3BUYB 5T3XD 3K2UL 4JPIA 1U2HA 5HVHB 3CNKA 2ZUSA 5H35A 5DSCB 1P9MC 2QSTA 1JPFB 2AJ3B 2EIZA 4OSUH 3L95A 4G7VH 2FSEB 3RTQA 3MNVB 1BX2A 5E6ZA 3V5DA 3GSXA 1QRNA 1FYTB 2EH8H 1WZMA 4MJ5B 3K1KC 4KZDH 2K9UA 2JIXB 3NPZB 4U1JB 4YFEA 3ZDYE 1DQDH 3MCG1 5HDBE 3MGAA 2QKIB 4KXZH 4PJCB 43CAB 1WTGT 4FQJL 1OAZH 1T20A 4UIKL 4YR6A 3OKDA 1IKFH 1JRHI 5CGTA 1IGCL 3FB8B 2QQKL 2OLDA 3P0VL 1YEHL 1PBYA 3PWLA 1VADA 4V2CB 4BUHA 5ID0A 5JW4M 4ONFH 3QIBD 1DVFA 4GRWH 3PXJA 1Q38A 4X83A 2DQHH 4APQD 3NH7L 4X7SL 4YFDB 4K7FA 1M6OB 5FCSH 2QQNH 1UXWB 2VABA 4UTBL 3O3EB 5IV2A 4NO3B 4XCEA 3V4UL 1NMAH 4RX4A 4OQ1A 3DRTB 4WW1B 2ZG2A 3TP4A 4FQXC 5F89B 1A6WL 4W81A 4PG9B 2F53D 2GUOA 2YC1A 1N5AA 3VXPB 5FHBH 1U8LA 3ARQA 1F2XK 2H32B 4A6YB 3H9HA 3MJ9H 3KXFE 3PWUA 3W82A 1FO0B 5HHMB 3Q2CA 3SDCA 3FN3A 3H9SD 3GSWB 3KXFA 1PYWA 4DCQB 1T1WA 3LKSA 4BKLB 1QBLH 1VESA 4M6AA 2IG2H 5ACLA 3LQMA 1QBMH 3MBED 2ITCB 4ETQB 3U9PL 4ZXBA 2AJXL 4YDKL 4NZDA 2R0LH 3MACH 5EWIH 4FOMA 3VFPA 3EIFA 3BUYA 4W70A 3MFGB 2ZNWA 5F7HA 1BJMA 4DGYH 5DSCA 5JMOC 5JR1L 3EDDA 4G5ZL 4KKCC 1FYTE 1JPFA 1SM3L 2AJ3A 2EYTB 2FSEA 3MNVA 5JW3L 1C5BL 3LEXA 4B7IA 2FX9L 2KH2B 2VWEE 2VXTH 1PG7H 1E4KC 2WBJC 4PJCE 5ALBH 5KS9E 4FZEL 3CXDH 3ZL4H 4KKNA 4MJ5A 1IL1B 4Q0XL 1OP3H 2JIXA 1LK2B 1TZHA 4J3VA 2DB8A 3AREB 4JFOA 4U1JA 5HHVH 4XI5D 4OF5A 4IEFB 2QKIA 4PJCA 43CAA 4KKBC 5AG8A 5HYJB 3A6CH 4K3JL 3SKOB 3FB8A 4JGUA 3GM8A 4HMCA 5AYQA 4EI5D 4HGMA 1J9CT 5HDLA 3PDOB 3RWHB 4ENED 5D96B 5EIVA 1MRFH 5ESAB 3H3KA 4IIQB 3QWOB 4D9QD 2BSSB 2IPUK 4W4OC 4HAFA 2XPGB 1UXWA 2X9YA 2OZ4H 3O3EA 4WWKD 2PO6B 4NO3A 4AH2A 1YPZB 4TUKH 4HXBH 1ZA6B 1BQUA 3IYLW 4LSRL 5GS0C 4EN3C 2A77L 3HFML 2VLMD 1KB9K 4JO1H 1C1EH 5C6TL 2H32A 5I71B 3MTRA 4A6YA 1CLYH 4MCYB 5FO7B 3ESVF 4WWID 1FO0A 3ZDYF 3TO4D 1SY6A 4ZOAA 4JHAL 4JN2B 3NZHL 3GSWA 2ZG3A 3QZWA 4PTTB 3MOQA 4PJEE 4NP4L 5EU3B 3QYCA 4JFPB 3KLHD 5F9JA 1QSED 5I73B 4BKLA 3BIKB 2CRIA 4XP4L 3ZHKA 1MCPH 4Y5XB 2W65A 2XI9A 3MJGX 4M5ZL 1N4XH 1IGTB 3ES6B 2XXCB 3WHE1 3DGCR 4OZGA 3R0MA 1KYOJ 1JF6A 4QRPB 3IDXH 5BVPL 1WAAE 2YK1H 3RGVA 3U82B 4N0CC 4AEIH 2EYTA 5T1KB 1WAAA 3QBTB 4Z7UF 4YUEL 3UJTL 5CZKA 1AGFA 2BJMH 4XVTL 2AXGB 3MYJA 4HG4J 4PB0H 5BJTA 4LDOB 4JO3H 1IL1A 5HYJE 3TIDA 1U93A 1LK2A 1C5CH 1FRGH 3AREA 2VQUA 5I9QC 4H88L 4NQED 5DJ6A 5F7EH 3RFZC 3ARZA 4RWHA 1TMCB 4XP6H 4NQDD 1QA9B 3WFCH 4CDHA 1BMGA 5HYJA 4P3DB 3P4MB 3SKOA 1V3MA 2AK4D 5B4MC 1LEIB 1I9RH 1S7RB 3WJLA 1CDGA 4Y4HB 3QIUD 1FGNL 1P7QB 3PDOA 4Y2DC 4DKFH 3KPOB 4ZO9A 4ZUTB 1J8HD 3RWHA 2DM4A 4LSSL 3EYQD 4MHHG 4OCRH 1YY9D 5ESAA 1N6QH 2VN7A 4IIQA 5J0BA 1JGEA 5HYQA 1ADQL 4M7KH 3OV6A 1IC7H 2BSSA 1IGML 4M7ZB 2XPGA 4DAGH 3RAJH 2YPVL 2PO6A 3WSQH 1YPZA 3GMQA 3FN0H 2XACC 1EJ6A 3BDXA 1ZA6A 5JIKA 1NFKA 5FYLL 1ZKAA 5DA0B 4PJCF 5KS9F 3CPLB 4HK3N 4GAYB 1A6PA 1LD9B 3WFHB 4MCYA 5FO7A 2X44D 4MCZA 4S1DC 4JN2A 2WW8A 4UOW1 3X3FL 4JHWL 1N8ZB 3JV4B 3WDJA 1MIEH 5FDYA 4PRAA 5IVOA 4PTTA 5DUMH 3SGEH 5EU3A 2GJZB 3BIKA 5J6HB 4OD1H 3LMJL 3WXVH 1MHPH 2XRAL 5E2JA 4CVXB 3J8F7 4QRPE 4Y5XA 3U6RB 2DBLL 1S9WB 1ORQB 5L88H 1IGTA 4XVJL 3ES6A 4LF3A 1YJDL 2OL3B 4KQ4L 4LASH 1PZ5B 3JTSA 2W60B 3FAXA 4QRPA 2AV1B 1I8LA 2VO5A 2E9JA 4LGSB 4P2OC 2OXHA 6FABH 1TVHB 3NABL 1HI6B 2D03L 5AAMA 4YLQT 1FC2D 4P9ML 1YYLH 5EU5B 4LRIA 1LO3H 4O02L 4F58L 2AXGA 3MGOA 3ARTA 4YIQB 4YDLB 1JP5A 1BFOB 5KG9B 3R1GH 1OF2B 3I3EA 1RZGB 2EDQA 4HQQH 1VFUA 4PJEF 1OAYH 3O3BB 4QCIB 1QA9A 1S7QA 3DO7B 4P3DA 4QGYA 1LEIA 2DQDL 3IFNH 5BQ7B 1S7RA 4Z7NF 4Y4HA 4WV1B 2V17L 5CJQH 3VWKB 1X44A 3QWRA 2Q6WB 1P7QA 1FZJB 1CI5A 4ZUTA 2AQ3A 3GNML 3HC3H 5IHZB 4XVUC 5IMKB 1ZA3A 1MJ8L 3FCTB 2IBZX 1TCRB 2HAZA 3TJHD 4MJIB 1G6VK 1NGPL 2NPLX 2ZUWA 4ZODA 4NZJA 1MI5B 2R4RH 3O81A 3SQOH 4U6YB 5FXCH 1UXSA 2CLVB 5C0EB 4LEOB 4XMKH 2WWMC 3CPLA 3PV6B 4GAYA 4C58B 2A0LD 1LD9A 1AQKH 2KUTA 4S2SB 3VFWB 2AEPH 1LE9A 4IRJA 1MLBB 2CKBL 1N8ZA 3MOBH 1YEJH 4JZJA 3Q48A 2GJZA 4PJFB 1YEDB 4O2CB 3BFOA 1LEKA 3C5JB 5J6HA 4TSCH 3RUGB 2R9HD 4CVXA 3U6RA 3DHJA 1S9WA 2L7UA 1ORQA 2C3WA 3SDDD 1DVFC 1MJUL 3V79C 4M3JA 1L0XA 1PZ5A 4D9RE 2W60A 3EJYC 4JLRB 1XZ0A 3KPRB 4NZUL 4ELKB 2AV1A 4MA1B 2O5YH 1I8KA 4KRPD 1JBJA 5GIRB 1ZXQA 4QXGH 1HIML 1NCCL 2E27H 3EFFB 4KJPC 1VEPA 5EU5A 1GZPB 1VFAB 2FX8L 3HG1D 1BD2A 2APBA 5DFVD 1Y6NR 4YIQA 1LDSA 2BVOB 1CXLA 1BFOA 1K4CB 5KG9A 3OAZH 1OF2A 4Q9BA 5BZDB 3SDCC 4N8VG 4XC3L 1MCQA 2QADB 4IMLB 2A1WL 3DO7A 1F6AB 3RDTD 4F7CB 3GBNL 2HFGH 4L8SB 1VGEH 4NNYB 1KB5H 1A3RL 4WV1A 3VWKA 1FFQA 2Q6WA 2DQEH 3G6AA 1FZJA 4UOJA 5EC1B 2CK0L 4MJIE 1D9KB 4LCUB 4TVPH 4ZXBC 1BZ7B 1R5VA 2ADFL 1EFQA 4J12A 1X6LA 4X7DC 4X6BB 2DM7A 5IMKA 3FCTA 4MJIA 3V6OE 2OSLA 2OJEB 2PTUA 4Q58C 5DK2B 2FEDC 5D4QA 3QHZH 3L7FB 1MI5A 4WFED 3BKJH 4LCYB 4M8VA 5DJZB 2CLVA 3V6OA 3HB3C 4LEOA 4CDGC 5C0EA 2X2YA 5DRZB 3PV6A 2Z8SA 5J9PB 3UZEA 3MRGB 3MYZA 3T0WA 1I9JL 3EO1B 1BF8A 5KW9L 1IT9H 4MYWB 1J5OH 5GRZA 4S2SA 1CS6A 4PJFE 3VFWA 4OLUH 4LAJH 1MLBA 5LCVH 1KGCD 1P6FA 3FFDB 5D2LB 4KQ3L 4G6FD 1A14L 2XKSA 3KDMB 4ERSL 1MY7A 5ESQB 4PJFA 1YEDA 4O2CA 3C5JA 1HQRB 3OKMA 3QCUH 3KPRE 3RUGA 5BV7L 1I3GH 3QQ4B 4JCMA 4OAWB 4N0FB 4Q6YA 3WNLA 3WIHA 5DQJB 5KVFL 1A7RL 4RBPK 3HNVH 4DOHE 1JF1A 1UEMA 3ZDZE 2AJSH 1KF9B 1C7SA 2LQRA 5HHXH 1FNEB 4JLRA 1OTSD 1TJHH 4ELKA 2VLLB 1E4XH 3VA2C 1IVLA 5GIRA 5IFHH 1DL7L 2A74B 2JJVA 4KMQA 5KJRH 4YDJB 3MLXL 4AMKH 5D7JB 2I25N 3QRFM 1EHXA 3IJSB 1DBAL 1X4ZA 1ZLSL 3SKNB 5JXED 5EFIA 5F8QC 5J8OA 1CGXA 2P5EB 5FM4A 2ZWLT 3JV5A 1GZPA 1JNNL 5A16A 1CE6B 3AS3A 2JKXA 5IB2B 5JHDD 1Q0YL 4JVWA 2YD3A 1IM9B 2IFFH 1JPST 1K4CA 5GRWA 5DMKA 5F7NC 5IFAL 5BZDA 1XR9B 2YS4A 3WDHA 3QQ9C 3HI1B 1MWAH 4IMLA 1A21A 4F7CA 4MQXC 5CAYB 4OLEA 2HJKB 3CLEL 4L8SA 4R4ND 3T0EB 1OGTB 4NNYA 1QOKA 3UC0L 4N8CL 4U3CA 5I30H 4QEGA 3GI8H 1GGCL 5EC1A 5K9JH 4O2EB 4PLKC 5E6ID 3SHSA 1JZ8A 4U3XA 2FHCA 5BW7A 4LCUA 1CG9B 4U6TA 1BZ7A 3U4BH 5CJ8A 4HJ0D 4X6BA 3PHOB 4ONHB 4Z0XA 5DTFA 1XGTB 3QHTC 4BELD 4HZAA 1B0RB 3RGVC 2OJEA 4LQFH 5SV4A 4GMTL 1FIGL 3BQUD 3TZVD 2QHRH 2XZZA 4LCYA 5TGBB 5DJZA 3T2OA 1OP9A 4I3GA 4UT6H 4JREC 5DRZA 1NKRA 3EFDL 1Z9MA 4YQXH 1BP3B 5J9PA 5D2LE 3MRGA 2J88H 4X6EA 4GQPH 3EO1A 2BSRB 3WBDA 5F6HJ 5HVGB 1CXFA 3ARBC 3WXWH 4UDTB 1WTLA 5EB9A 5LXGL 2UWEB 3FFDA 2NY5H 4Q9CA 3KDMA 4PP1D 5ESQA 2DM2A 4IS6B 4DGIH 2H3NB 4MX7B 3ZE2E 3QQ4A 4OAWA 1TDQA 4N0FA 2A9ML 5DQJA 2IBGA 5EBLB 3LAFA 4KGJA 3HR5B 4NC1E 4XPTH 3QUZD 5L7XH 1H3WM 3ZDXE 1C12B 3IFLH 5DA4A 2IF7A 1FNEA 4QLRA 3RWGB 5M95B 4ALAH 1II4E 1L7TH 4FZ8H 3FL7A 2VLLA 2BVQB 4CJ0A 4IIQC 2W9DL 3QG7L 2X4TB 3OPZH 3U2SB 2P5EE 3LB6C 4HT1H 2A74A 4OZFG 4MB5A 4YDJA 4EUPH 5FUZL 5D7JA 5JHDE 4X7EC 3VFOB 5IHUL 4QHLB 3SKNA 2CDFB 3TESA 3JUYA 3CMGA 3SKMB 4H8WC 1CGWA 3VXUA 3WIFB 1CE6A 5IB2A 3QRGL 2W9LA 4TTGA 5I71C 3C08L 4YBQC 1WCBA 1IM9A 4RFEB 3C2SA 3T0EE 3HE7D 3WL9B 1I7ZB 1V8HA 1XR9A 3S35X 3HI1A 1FJ1B 2ED9A 4Y88A 2HJKA 3T0EA 2ZUXA 1OGTA 3C60B 5DK0B 1W72L 2ZG1A 4Z8FH 5ABDE 4ODSH 3PWJB 4Y4FC 1F58H 5EIIB 4O2EA 1JUFB 3HTLX 5DLML 3ZDZF 4OQTL 3RWFB 4KVNH 4KK9C 4WO4B 1RZKC 5IW3A 3PHOA 1S5IH 4WHYH 1NCWL 3W2DH 1P69B 3V5HB 1WF5A 1D5XB 1BVZA 1HQ4B 1XGTA 1MFEH 3LQAC 2IAMD 2YPLD 1I8LC 4XNXL 2EE2A 4WDIA 5BRZD 2F54D 4I77H 3I75B 4I0CC 3TA3D 5TGBA 4H20H 1C7TA 1S5HB 2YMXH 2GFBA 5DWUL 5IEHB 2AXFB 2COQA 2UWEE 4P99A 1NSNH 1S7TB 4U1KB 4LHUD 1N64H 2H6PB 4TSAH 1QSFD 2BSRA 1Q72H 4AG4H 4XAKD 4CMHB 1HKLH 5D93C 4X80L 5ITFB 1JVKA 5GHWL 5I1DB 3GMNB 4AJ0A 4BSWB 1AIFB 4GSDH 2DD8H 2H3NA 1CIUA 15C8H 2CMRH 4LIQL 5EBLA 3HR5A 2FH8A 3N85L 1ADQA 5FYLE 5MEQB 1NGQH 2E6QA 3P11L 2BVQA 1GH7A 3PP3K 4XPHL 2X4TA 3DV6A 2B20A 3U4AA 4D9LL 3QIWD 5DC0A 4GS7C 5F1OB 2VDKL 3VFOA 4JM4L 4RMSA 3VXQA 4QHLA 2X1XR 1BZQK 2CDFA 3TBSB 4M1CC 5JW4Q 3SKMA 5D2LF 3WIFA 3PWNB 3LQZA 1KJ3H 4F8QA 3I6LE 4ZUVB 4RFEA 2CKBB 4Z77B 4N90D 1K85A 1MJ7H 1I7ZA 3BKYH 1UM4H 3WL9A 4PJIB 4IRJC 5D8JH 2VXVL 1FJ1A 3BGAA 4N9GB 4JZJC 3FQTB 3C60A 3ULUL 4LVNC 3PWJA 4R4FL 4RMUA 4HULB 2DMBA 5EIIA 2EDOA 1JUFA 4Y1AD 4RDQG 3ZDXF 4CVWA 1L9NA 3ECBA 1XGRB 4HAGA 3HE6D 4PRPA 5FUCE 5LGJB 5JOPE 3RKDC 4D2NA 3B9KB 3OKLB 5ICXB 3V5HA 1ZLUK 1UADC 1CBVL 1D5XA 1HQ4A 4WUUD 3GB7B 3RZCD 4WFGE 5DVOA 3N06B 3TVMB 3I75A 2J4WL 4KK8D 2F74B 1HDMB 2E5EA 1PZUB 2AJUH 1ZHBB 2MCPL 4J2XA 1OGAA 5CJOL 1GOGA 5KSBF 2AXFA 4R90H 3VFNB 1S7TA 4U1KA 1UKSA 4FP8H 1JJUA 3V0VB 3SCMB 3GSNH 5L2KD 5ITFA 4Y16D 3RIAK 2LU7A 4NQXA 3QO1B 5JW4R 5I1DA 4KVCH 3GMNA 4BSWA 1AIFA 4PLNC 1FPTH 4WV1C 3VWKC 1AO7B 5CBEB 3QWQB 5TPWH 4WI8A 4HCRH 3QP3A 1VACB 2HKHH 1SVCP 2OJZH 1GHFL 3MV9A 4GAGH 1MNUL 2P47B 4P3WA 1BWWA 4YXLH 4R6UA 1RAMA 2VIRA 1N26A 3BX7C 4K7PH 5I8KH 4OUOA 4P59H 2IWGA 3TBSA 3VGHA 3DX7B 2UWEF 4PJIE 4N90E 3PWNA 3D39D 4AYFA 3AXLB 4FQIL 3VFRB 4ZUVA 5DO2C 2CKBA 4Z77A 5EBGA 1FQ9C 4NRZB 4U6XB 1U42A 4M43L 2VZSA 1N6VA 1F4WH 3GHBH 5AD0A 3ZKQD 4BZ1L 2NXZC 4PJHB 2PCPB 1I9IH 4N9GA 4DFHA 2DTSA 2XWJB 4N8VB 5J1AB 1F11B 4IBLT 3N9GH 1UA6H 3WD5L 4KC3B 5KZCD 1XGRA 3ARSA 1MRDH 3F62A 5LGJA 1A6AB 1DEEB 1V3LA 3B9KA 3OKLA 5ICXA 4Z78B 3ULVH 3U36B 3E2HB 3HZVB 4KUCF 4OGXL 3VWJA 4BQ8A 5TFSL 4XAWL 1RUMH 5KVDL 2ARJB 3EOAB 4NHCH 2ZUUA 3X17A 2F74A 1KG0A 1HDMA 1NAKH 3UTZB 1SJHB 4JFFB 4LU5L 1OM3L 1EFXD 1PX3A 4HIIB 1HILB 4Z5RB 5L2KE 4UNVA 3RVWC 3UTQA 2JCCF 1CLOH 4YEFA 3SCMA 1D5MB 5DJ2B 3Q1SL 1GGTA 5SWZD 3RGHA 2B7DT 3RVTC 4XXDB 3QO1A 3O6FC 2QADC 1FORL 3RNQB 5I2IB 2CXGA 2GTWB 5B22A 4K2UL 1AE6H 1AO7A 2Q7NA 2PTVA 2YD1A 2NR6D 1ZEAH 4TTDD 4FQHB 2B2XH 3LDBB 5DJAB 5AWNH 3HNTL 5AZ2H 5C2BH 5BW7C 1VACA 1OTUD 3VRLE 5IM7B 4XXCA 3IJYB 4JPWL 1WZ1H 5E8OB 2N4IA 2YBRB 5MP6L 4QXUL 3G5YB 4BK4A 5J13C 3GSRB 3P9LB 3UO1H 1DQQA 4ZYKB 3ARDD 1BGXL 1EUUA 5CUSL 3SGJA 2QR0B 2I5YL 3DX7A 3MUJA 4MDIB 5HVWA 4OI8A 2GTZB 3AXLA 4HC1H 3UPRB 2YD9A 1VPOH 4NBZB 4PJHE 4MAYD 4ZTOH 5EOQL 2DLEA 4KJQD 1CFTA 4U6XA 4K3DH 3O2DL 4UILH 2BNQE 2DAVA 2PCPA 3BE1L 2XWJA 4N8VA 1DQLL 5J1AA 1F11A 1F4AA 3MA9H 3FN9A 2XFXB 1KCVL 1LNUB 2PN5A 3TWCL 2R56L 3BWAB 5TQ2L 4PLOB 3U7AA 3NTCL 1A6AA 2ZCHL 1DEEA 3IU4L 2BSED 5IBUG 1FN4A 2X1PA 3FZUD 4Z78A 2FBJL 3Q3GB 4Z0BH 4JHZA 3MUY1 1IAIM 3K0WA 1NANI 3SGDI 3U36A 1Q9WA 3GRWA 4JFFE 5ADPH 2BNRB 1LGVA 4TPRL 2EEBA 2X1QA 3NFPB 2K3TA 2ARJA 3EOAA 1TTGA 5D7JC 5HD8C 5DHYB 3BMVA 4PJIF 3UTZA 1SJHA 2Z31C 3UTPE 1J0YA 2BOBB 4LLWB 4S11A 4WI5A 5CS7A 4HIIA 3MRLA 3P4NB 1HILA 3MJ7B 4WY7L 4XRCA 3UP1A 3T08A 3GM0A 1CE1L 3ARGB 2VDLL 5SWZE 3OKOA 1RULL 1NCAL 1J8KA 5B3JF 1D5MA 3LIZL 2N1KA 2HT2D 5DJ2A 4P5TB 5I16B 1KEML 5FECB 2CJUH 2Q3ZA 3MZTA 3C09B 3NCEB 3RNQA 5I2IA 3ZTJH 2GTWA 3VCLB 2AS5M 5D6DA 3WFDL 3O9WC 4QKXB 2FWOA 2Z91A 4YHOL 2NY2B 35C8H 2R8SH 4KTEL 2Q8AL 4ZSOB 3L7EB 4OF0A 5DJAA 1EAPB 1B88A 3MLUL 4BUGA 4PGBB 1FL6B 5KVEL 5IM7A 4LAQH 4WHDA 5E8OA 2YBRA 3DWTA 4XPFH 3LQAH 1CFQB 2FBOJ 1NLDL 3GSRA 3MPCA 3P9LA 2DTMH 5E2UL 5E8DL 5DS8B 4ONGL 32C2A 3GBMH 4ZYKA 2APVA 3NA9L 2R2HA 2VC2H 5C0IB 2AABL 5IWLA 3FB6B 2QR0A 1U8HB 3VXTB 4PG2A 4MDIA 1FFNB 3ARFC 3TCXA 2OM5A 4ZAKA 2D7PA 3UPRA 2EKJA 1JNHA 4Z7WA 1MREL 4PJ8D 5HGDA 2FLRT 3QUXC 1XF3B 4P48A 4PRIB 3CDYA 5HI5C 1U3HC 4OLYL 5KAQF 4HLJA 4HWUA 1BQHG 1T7VA 2XFXA 1PSKL 5BMFL 3BWAA 2HRPH 1RUPH 1YNKL 1OPGH 1GIGL 2ESVD 5H37H 2IQAB 3VRLF 5DVKA 4X5XB 3L3JB 2BNRE 4NC2B 4G6JH 1ULVA 1EEQA 3TPUB 3Q3GA 1NGYA 1OTTD 3MV8D 2XN9A 3WS3B 3WUWG 1AR1D 1X5ZA 4PUBH 1XGUB 2BNRA 4RGND 4YJZL 4R3SB 5GJSH 3NFPA 2A83A 2FATL 5E9DE 1H15B 3D18B 5C9JA 5HXMA 1FG2B 2BOBA 4LLWA 3BT2H 5I1CH 4P9HC 4E41B 3P4NA 3MJ7A 1INEL 2UZXB 4PJHF 4K3EL 4PGDA 3IU3B 4GKNB 1U8JA 3MXVL 1T66C 5C6WH 3ULUD 4G8IB 1K9TA 4P5TA 5I16A 5FECA 4ZSOE 5T5NF 3LRGA 2OTUB 4YHYC 1CLCA 1K5NB 3S9DB 3VCLA 5J3HD 2FGZA 2VDMH 4Z6AT 1KN4H 2Q76B 4NJ9L 1CXEA 4DK6A 4ZSOA 1EAPA 2NZ9D 4PJ7F 1JGUH 3WFBL 3BPCA 3QA3B 4JR9H 4EOWH 3N50A 4AEHL 5ITBH 1QFWL 5E99H 2EDWA 5DD1H 3SDXA 1UWXH 3WCYA 3O6MH 2PUQT 1F97A 5DS8A 4PB9H 3DIFB 3MLZH 3BXNB 1RHHB 3BJLA 4WI3A 4KK5D 2MTPA 5C0IA 3FB6A 1U8HA 3VXTA 1RVFL 4OZFA 1FFNA 1BECA 3NACL 4D0BB 1NBQA 5E7BA 2PYFB 1OCWH 3Q6GL 4PRIE 3W11D 2ZSVB 3CK0L 2EIDA 1H8SA 4XNUL 4HLZG 1ITCA 2JJTC 3VGBA 2HMID 1XF3A 7CGTA 2CDGB 1YEFH 2EXYD 2CSPA 4XTRC 3PUCA 4P46D 3WLBB 1T04B 4DKEL 1NL0H 5AG9A 1RJLB 4G8EB 5MEND 3KS0J 5B8CC 3P3YA 4PGZA 3P77B 5HSFA 5EBWA 3BEVB 4O9HL 2IQAA 4AL8L 2VUOA 3L3JA 3HZMA 5TH2B 1RUKH 4MD5B 3TPUA 5CJXA 3SN6N 1JRHL 4FNLH 1T4KB 4WCYH 4XGZB 1XGUA 1Q0XL 3CFCL 1CICB 1JTOA 4R3SA 1XFPA 4UT7H 4BSVB 3I2CH 3MRHB 3D25B 5GSVB 1IILE 2WBWB 2L7JA 1CK0L 4M93C 4OTXL 2KZWA 3D18A 4NCC2 5EU6B 1FG2A 1HHJB 4YDVB 4E41A 3AC0A 1P4IH 1JHKL 3O8XB 5LWYL 1OARL 1WFNA 1AY1H 1EHAA 2YUWA 3V4VL 2P24B 3GZKA 4LNRB 1KJVB 4G8IA 4KHXL 4UT9H 4KI5D 4MXWL 4FG6D 2OTUA 1K5NA 1IQDA 2ZCKL 5I1AB 3EYOB 4KK6D 2UZIL 1MH5B 1MEXL 4KU1A 2Q76A 3HLAB 1Q9OB 4I9WE 1C5DB 4QOKB 4TNWF 4G9FB 4PJAB 5JUEH 5HPMB 5H8DA 1G9EA 4HIXL 1DTUA 4QF1B 2V2XA 3B9KC 4YE4L 3RPIB 2HTLC 3LKPA 1MY5A 3AU1A 1NFIB 3DYPA 4F37K 1QFPA 3D0VB 5F7FA 3K8LA 5KSAB 3VWJC 2EC8A 1XGPB 3DIFA 3TYGH 3GO1H 3BXNA 3MUGB 4NM8H 3DO3A 1DUZA 1OP3K 1S9VB 4C54A 4W4NA 5I8OH 5GSRA 2F15A 1UC6A 4D0BA 1KJ2H 4MNQD 2PYFA 4J3TA 4GRLB 3X12A 4JQVA 3S3PA 5IEKB 2ZSVA 3P40A 2BOCB 4JE4B 1KACB 3AFLA 1YY8B 3U46A 5EO1B 4XWOD 4M5YL 2CDGA 4DQOL 3TPKA 3WLBA 3QEGH 1T04A 2R69L 2AJVL 3O2VL 5C1MB 4G8EA 4HEPG 4NO0B 3HRPA 4NKIL 3HR6A 3BEVA 5CZVH 4LHUG 4AEFA 4UINL 5I18H 1YC8A 4JG1L 3V2AR 4MD5A 1JHLH 2BRRL 4IRSB 4XXCC 1T4KA 5EU6E 3GSOA 3T2NL 2VDQL 1CICA 1FIEA 4BSVA 1NC4D 3MRHA 1XIWD 1A9BB 3D25A 4WFHE 5GSVA 3JTTB 5D7SL 1J0IA 1FLRH 1BEYL 2LU3A 4LLUB 3SGJC 5EU6A 2C4XA 1HHJA 5FOJA 4XBEL 1AHWC 3MA7B 4O4YH 1YQVH 3I3DA 3DRQB 3O8XA 3S3JA 5JPMB 2R29L 4QWWD 5FF6B 2P24A 4EI6B 4LNRA 1QFHA 1KJVA 3MMEB 3EYVB 1HINH 3ARXA 3BKML 3KYKH 3TCLA 4GRMB 4QOKE 4G9FE 4PJAE 1TZIA 4ZPVB 1MH5A 2XZQL 1CFSB 3HLAA 4G6AD 4TUOA 4AQ1B 2NXYB 5I19H 1T1XA 4NZRH 5IVXB 1Q9OA 1C5DA 4XMPL 4G9FA 1A6ZB 4PJAA 4LCCB 4KKLC 2M2DA 2APXA 3GMOB 2ZUTA 1R3HB 1RZ7L 4M4PA 5INDB 3RPIA 1OSZA 4L29B 4AZ8A 5IVNA 1NFIA 2VLKB 4KROC 5FUOL 4YPJA 5KSAA 3IRZA 4PYHA 2X05A 1XGPA 2VZUA 3MUGA 4JFEB 1BVLB 1S9VA 4Z7QE 3QUMA 3ULUF 1XGYL 4GRLA 5IEKA 2BOCA 2FO1A 3B9AA 4KTDH 1YY8A 4MAUH 3LRSB 2BVYA 5EO1A 3MLTB 2I07B 2Y6SC 1N6UA 3NVQA 5CLWA 5EC2B 3QDMD 1N0XH 1GPOH 4OM1H 5IB1B 4L4TB 4NO0A 2ICWA 1T7YA 1TJGL 3P0GB 5IFJB 5E03A 4DW2H 3G6JB 2WUBH 1NCDL 2G2RB 5JQ6L 2D0HA 3FONB 1CDBA 1QBBA 1HNGA 3P73B 2PETA 1AXTH 1RIUL 4ORGB 1WEJH 3U30C 4YX2H 3K74B 1B0GA 3DMMD 5DZOA 2P46B 3WFEL 1JPSH 1A9BA 5HI3C 4X0KB 1DBMH 3JTTA 1KN2L 1IAIL 5IWLC 1NUFA 4PD4K 1ODAA 1KIQA 4UTAH 4PG2C 2EC9U 1EDQA 3MA7A 4ZAKC 4DKDC 3DRQA 3LKOB 3D6GA 5JPMA 5EZJB 4D3CL 4NHUB 2B5IC 4HIJB 5FF6A 4X6CB 4DVRH 4EI6A 4OIIH 3GHEL 2HVJB 3D87B 3G9AB 3MMEA 3EYVA 4ONFL 1M7DB 4Y5VA 5IVXE 3OSKA 1ZWIB 3RWIB 1DBJH 1CDUA 2DQHL 4GRMA 1JZ3A 3L3KB 5E7FA 3MJ8B 3AVEA 2NYYC 1CFSA 25C8L 4LLMA 5IVXA 1JGVL 2A2QT 2VLKE 1A6ZA 2CUIA 4QXTB 4LCCA 2A6IA 1FNGB 3GMOA 4NZTL 1A6UH 2BMKB 1R3HA 5INDA 2VXQH 3E8UL 3CVHH 2F5BL 4JFEE 1EZVX 4EBQL 2VLKA 4PGEB 3I6GB 3O4LE 4JKPH 2ENYA 2MNUA 2NY1B 3QI9D 4UBDC 2PKDA 4JFEA 1BVLA 4J1UB 3JWOH 1HYRC 1G1CA 4NYLB 3MLRH 1FBIH 1U36A 2HWZH 4H1LH 5DQ9B 3DYOA 1Y18B 5C0BB 4JZOA 3RWJB 5I15L 1OB1A 5C0AB 5TE6L 4L4TE 3MLTA 2VZ3A 4P5KA 5BS0D 2XTJC 1LO0H 3PWPB 1AGBA 1P4BL 3C09C 3JWDL 1EGJH 3G6JE 2C26A 3K4ZA 4G8GE 4L4TA 1IGJB 1JTTA 5GZOD 4HJJL 4FTVD 4MQTB 3S36H 3G6JA 3BRDA 4ZOCA 4LSTH 3DX8A 2F8VA 1KPUB 4RFOH 3DROB 1CGYA 3DLQR 3P73A 1IFHL 4ORGA 4ZDHA 3VFMB 3BIBX 3L3IB 2SEBB 4Z7VB 3V6FA 4NO2B 2XQYK 2YOCA 3IT8D 3WUWB 2ICES 5F6HI 4CADB 4G6FB 5GRVL 4JFZH 4N1HB 4X6CE 4GT7A 4MGXA 4K94L 4X9HA 4LK4A 1PEZA 1EV2E 1NFDB 3BHBB 4M6NH 2UUDH 5EZJA 3QIBC 1A1MB 1CDIA 1R3JB 3RX5A 2HVJA 4APQC 2WQRA 1ZWIA 3RWIA 4OZIF 4I18B 2EDTA 3L3KA 1IGIH 4M1DL 1X5HA 2MPAL 1EO8H 1G7MB 5ECJE 3PQYD 3IGAB 1NCUA 1P2CB 1WIOA 4QXTA 3GI9L 5I8CB 2LV4A 1FNGA 3LD8B 4WU7B 2R1YB 2BMKA 3HG1A 1S9YA 4HKJB 4OLWH 3PGDB 4PGEA 4OF8A 3FJTA 2X7LB 4YHIB 4ZQKB 4Q6IB 3CLFH 1JHTB 2DQCL 5KANG 2XA8H 2NY3B 1I4FB 5C0BE 4J1UA 5KVGL 3OAZK 3RDTA 1RI8A 3MRQB 3UXFA 1IGFH 3QDJB 1ZAGA 1Y18A 2MQCA 3PWPE 2YA0A 5E6IB 2PW1B 5M94B 4K23L 1UWEL 3LN4A 4XPGL 5BS0E 5C0AA 2FYYB 5DD5H 3NPSB 4GKZB 1QPXA 3MLYH 3PWPA 4GXVH 2XA3A 4FQCL 1IGJA 5I1JH 4HPOH 4XC1L 1GJIA 1F45A 1RU9H 5D70L 3V0AC 4HIHB 2D7TL 2Z0BA 4U7MA 3WMSA 3NCYP 4Z7VE 1BQHA 5FO8B 2ILLA 1KPUA 2Q8BH 2ZOKB 3DROA 3T3PE 3ULVD 3QFJB 4FXKB 3VFMA 2BJML 4JFDB 3L3IA 2SEBA 1RJZB 1NFDE 4Z7VA 3UBXG 4C4KO 4NO2A 5C3LD 4XI5C 4OD2B 1H3XA 3WUWA 1UWGL 4WFFE 1KIUA 2EH7H 2J6EL 1NLBH 1TNMA 5FB8B 1NFDA 1B2WL 3BHBA 3FB5B 3C5ZD 5KTEH 1RZJC 5B21A 4PJXB 2YKLH 1RUAL 4R8WH 4NC0B 1A1MA 3SE9L 1R3JA 3LS5H 3B2VL 1MSPA 3TN0D 4XCFL 3G6JF 1KPRA 1ZHLA 4I18A 2D7NA 4HKXA 3BZFB 3KJ6L 2AXJA 5HHOD 4WWKC 1NBZB 5FO9B 4OCXL 1CL7L 1P2CA 1V7NL 4JY5H 2EZ0C 3O45B 5DJDB 5JXEA 5I8CA 4RA3A 1RD6A 1DQMH 1U92B 1QLFB 3B5HA 2R1YA 4WU7A 1OL0A 4JG0L 4MVBD 4P49A 3PGDA 1AI1L 1FVDB 1ZLWK 4YHIA 3GIZL 2V7NB 4O51B 4Q6IA 4U0QB 3BPLB 3LY6A 1JHTA 1JZ5A 3QDJE 2V2TA 2V5RA 3O6LL 1I4FA 4XB7A 4X6CF 5EBMA 3RKPA 2AV7B 1IAKB 2GEEA 3QXTA 3CSBA 1YEEH 2QSQA 5DD0L 3QDJA 1T7ZA 5I1EL 4BJLA 4F57H 1Y6KR 4DVBB 3O8XC 1IC4H 2E7HA 1CGUA 4NNXB 4TNVF 3H7BA 2PW1A 5E6IA 4CU6A 1D5ZB 2FYYA 2NY6B 2HH0L 4LSQL 5E2TL 2QSCL 5E2WH 4GKZA 5IT2L 3V0WH 1YEGL 3LS4H 4HWBH 1DBBH 2IMNA 3ABZA 5INCB 5C0DB 5JW5A 3A6OA 2FX7H 3BQUA 4K71C 3DUUA 4L3EB 5D5MA 5DYOB 3VRJB 3QFJE 3BJ91 4HIHA 1KEGH 2XQYG 4JFDE 1BM3H 3ZT6A 2ZKHL 5FO8A 1RJYA 2ZOKA 3OGCB 4LHUB 4BZ2H 1QSFB 3QFJA 4FXKA 5BOPA 3CFKB 4JFDA 3VW3L 1RJZA 2B1HL 3PL6D 3ZKXB 1B9ZA 2VQTA 3MBXH 1RPQA 2Q3AA 1RK1B 3HMXA 3FRPG 3ORJA 4I4WB 4OD2A 2NX5B 2YR3A 2DN7A 5TDPB 1Q9KB 5FB8A 3FB5A 4CMMA 3QIUC 4JRXB 3ARRA 5C86A 4PJXA 4NIKB 3FFCD 1FL5B 4YAQB 2BFVH 1OSPL 5CBAB 1B4JL 3X13B 4UQ3B 4ZFOB 5FOBB 2M8XA 5TE4L 4NWUL 4EZMA 5I1GL 4JDTL 4DZ8B 1KTDB 1YY9C 3IXAB 3NCCB 5K9KB 1VERA 5F3BA 3LEYL 4XZUB 2KQMA 3BZFA 1AGDB 2RB8A 2VITB 5C8JA 5D1ZD 1ZHNA 3IF1B 5F6IC 1CZ8L 2ICCA 1F4HA 1NBZA 3H3PH 5FO9A 2WSKA 3TH4T 2VLJB 1RQ5A 2RGSA 4G7YH 2FL5B 3O45A 1FGVL 2RR3A 4R7NB 1U92A 1QLFA 1X5XA 5L9DL 3T3PF 1OY3B 1MCWW 5EH1A 1CGVA 2P49B 1FVDA 1NFDF 2V7NA 4O51A 3HE7A 2AEQL 3TH2T 3V4PH 3OAUL 1NANH 3SE3C 3SGDH 1INDH 3L5IA 1OAKH 4JPKL 3UTSB 3AAZB 4FXLA 3ESUF 3W5NA 1WWCA 2AV7A 1IAKA 3L1OL 1YEKH 1LILA 4W6YB 5AEAA 4HBQA 4H5SB 3MODL 1V3KA 4DVBA 2B4CC 2CRZA 4I3RH 4NNXA 3CXHJ 1FH5H 1D5ZA 4Q74A 1HCVA 4GRWB 1JPTL 4ZFGL 3OJMB 3CFBB 5DJ8B 1DFBH 1HNFA 1KCUL 4L3EE 4K9EC 1EEYB 4E42A 5K9OB 3I3BA 3MR9B 4Y5VC 2IAMA 2YPLA 2ZOLB 5INCA 5C0DA 2F54A 4IM8A 3S96A 1FNAA 4L3EA 3X3GH 3U7WH 5DYOA 4NQVA 3VRJA 3B9VA 3TA3A 4LFHD 1ZGLM 3GBLA 3QEQD 1CGSL 1F90L 2UYLA 4LCCC 3OKEA 4IHOB 2AGJH 1IAMA 4LHUA 2J2ZA 2NX5E 2HTKC 4XNYL 1QSFA 5C0GB 4YDIL 3CFKA 4OCWL 2XQBH 2HVKB 3PP4L 4R7DB 3CGTA 1JGLH 1G6RH 5BCAA 3IDNB 4K7PX 2CGRH 4JRXE 4I4WA 1RK1A 4V1DD 4FQLL 1DLFH 4WW2B 5TDPA 3VGDA 2DQFB 1VDGA 1CIDA 3S88L 3VFSB 1A7PH 2BP3A 4CBPA 4JRXA 1FL5A 4S1RH 4YAQA 2E6PA 5JA9A 4K8RC 3X13A 2GJ6D 2VZTA 4ZFOA 5FOBA 1KCSH 1R0AL 2VLJE 4DZ8A 1KTDA 1BFVL 4XMLL 4TVPL 2CLRB 4HK0A 3DVFA 4OCSL 3BGFC 3KLDA 3MRIB 4OM0H 1IBGH 2VLJA 4QTIL 1OAXH 4W6XB 1RMFL 1REIA 4QHKI 5ENWB 2FL5A 4R7NA 5SWSB 4IRZL 1H3GA 2MFNA 3OZ9L 2LAGB 4XWGH 1IM3B 5ERWB 4GMSL 2X41A 4HWEH 3UTSE 1DCLA 2DDQL 4KPHH 4KGLA 2A0LC 4EEEA 4S0TD 3DSNA 3K80A 4N5EC 3B6SB 2VRAA 5EOTA 4M6OL 1T5WB 1CQKA 1GAFH 3AAZA 4FMKA 2LVCA 5EU4B 4OLUL 4HF5L 1NCBH 4R0LB 4GRWE 1EJOL 5LCVL 3EO0A 2R0ZL 4UB0L 4JRYD 2OK0H 1J1PL 5C71A 1TQCB 4G6KH 3AROA 2BHYA 5AYUH 1WUNT 2NY4D 3K81A 3SDDC 2GITB 2ZPKL 3CFBA 1JTPA 2F58L 2UV3A 1OAUH 3EYFB 5EIQA 5EOCH 1E6JH 3MR9A 4LRNH 1ACYL 2ENSA 4WUUA 3W0WB 3PGCB 2ZOLA 4KRPC 1CFNB 1QYGL 3RVUD 4XVSL 3B5TA 1MELA 5JPNA 4QXWA 3TT3L 1F42A 5E6YA 4A6YH 4QGTA 1LO4L 4IHOA 3MJ9A 5GS0L 5C0GA 1FE8L 5DFVC 4ZMAT 1JI2A 1GC1H 4XCNB 3IDNA 2C7UB 5GISH 3C6LD 4TQEL 4WW2A 3KPSE 3B2UD 3SGKC 3RDTC 2DQFA 1MRCL 4P4KD 1UACL 1FCCA 4HJGA 3LKRA 2FGWL 4RFNC 2X4UB 3IVKB 5F44A 4E0RA 4HFUL 4LCWD 3BGMB 2CLRA 4EIZC 3LKNB 5SWSE 1KELL 3MRIA 3MJ6A 4M4RA 1IKNA 4IOFD 1LO2L 5JO5B 5CGMA 4EKXA 4OLZH 1U58A 4O2FB 3RY6A 2EO1A 3S8WA 5SWSA 4ETYA 1WFUA 2VLRD 1U6AL 1IM3A 2VH5L 2C3HA 3D39A 5ERWA 3TLRA 1WSST 1MCOL 4NJAH 5J4MA 3ZKSD 3B6SA 3RU8L 3T0XA 3U83A 1UJ3A 4AK1A 1T5WA 4P3CH 2BDNH 1YZZA 2P5WD 5EU4A 3SQBA 3T4AB 2DMCA 3BDYH 1ZVYA 3EOTL 2Y07L 3FQXB 1RUQH 4PJDB 1IC5L 3SPVA 5J11C 2X4NB 4WHYG 5DJYB 1DSFH 3W0WE 1QR4A 5CD5D 1KC5H 1S7XA 3D2UB 2GITA 1T1YB 1MHCB 4LVOB 1ZTXL 3IAQA 1OTSC 1YMMB 3BD3A 1E0OB 2QSVA 2FJHB 3PGCA 5D1QB 3SJVD 1G9MH 1I1FB 1I7RB 4WUKH 4ALAL 1O7SA 1PLGH 2OZ4A 3UZQA 3MXWH 3SKJH 2O61B 3I9GL 3B9EA 5F9OL 1U8KA 4OZHB 1U8PB 3HPLB 4R26H 2I9LA 2VL4A 4PJGB 4X6FA 5JXEC 2Y72A 1A6TB 1EFXA 2VR5A 1I3UA 4ZNEE 2YD6A 2YD4A 2LU4A 1J0KA 4GAFB 3NOIA 1DUYB 2ZJSH 2XZAH 1TETH 5EUOF 3T8XB 4F33A 5TF1L 2C7UA 3VXRB 3HC4H 4TUJB 2XXMB 5JDSB 4PBVC 3UBXB 4F7MB 4M02A 4R4NC 2DI8A 1ORSB 4PBWD 4YHLH 4YGAB 4QYOB 1YYMH 3S37H 1VFBB 2Y23A 4QNPF 5E6IC 1JWUB 3BH8A 3VGFA 1EVTC 3O0RL 4L1HA 5IHLB 1M7IA 1WBZB 2MKLC 1F2QA 1HYSD 3EKCA 2RCSL 2X4UA 4HJ0C 1BVKB 1G7LB 4LKXA 3KNBA 3NAAH 5FGCB 3BGMA 4LLDA 4JY6A 3O2WL 3GK8H 3W2DL 1T5XB 4OIBA 3ARDA 3BQUC 4P23B 3TZVC 4FS0A 5F1SA 5D7IB 3RX8A 4O2FA 1H3PH 4I77L 4L9LB 5EO0A 3G6DL 2X89D 1WBYB 3FT4B 3ZT5A 2CRMA 2O5XH 3ETBF 1S7SB 5H94B 4Y8DC 2J6EA 4JFXB 5GRUH 4TSAL 2LAAA 4F9PA 5J1TC 5CZXC 2N7BA 2PYEB 3HI5H 1K4DB 5HGAB 1FG9C 5GJTH 3MCLH 2BNUB 3T4AA 3T09A 2GYSA 1P84K 1M71B 2AVGA 4RQQB 3FQXA 4PJDA 1J1XH 2B0SL 1YMME 1TJIL 2X4NA 4GXUM 4PJ9B 1TITA 3E3QE 3D2UA 3QNYB 3QUZC 4FFYL 4HFWB 2FD6L 1T1YA 4DN3H 1OVZA 1MHCA 3BW9B 4JKWA 5T1LD 2APFA 4BM7A 1UCBL 1YMMA 3HS0A 3MV8B 3VRIB 2FJHA 4IMKC 5F7UA 5D1QA 2VISB 1I7RA 1I1FA 3MOAL 1QZ1A 2CKNA 1ED3B 4WENB 4TULH 4L5FH 2ICEB 4OZHA 4LLYB 4PRHD 5F96H 4Y4KD 4PJGA 5IR1B 3QNXA 5I1IH 4M7JH 3UJJL 1A6TA 3RVXD 1ZANH 4JO4H 1F4YH 4XHJC 5I74C 1JE6A 1HK6A 1N7MH 5IMLB 3FQNA 1DUYA 3HE7C 3BPLC 3MRNB 3T8XA 5L8JB 2I9TB 1FZMB 2W59A 2DQUH 3E6HB 3DVGB 3VXRA 1UM4L 5EO9A 5JDSA 3UBXA 4F7MA 1ORSA 1MJJB 1DE4B 1F4XH 3GJFK 3IFOA 1UGNA 2OQJB 2GK0B 1DJSA 5FGCE 2B4CH 4FA8A 4FABH 1JWUA 2OL3H 4JKLA 1WBZA 1MFAL 4R97B 3DV4A 3DUSB 3DSFL 1BVKA 1G7LA 2PNDA 1E6OH 1NAML 5D7IE 2HG5A 2P8LA 3V6ZB 2ZUQC 2IAMC 4GLRI 1T5XA 4OUUB 4HH8A 2PXYD 3MV7B 4P23A 1FV1A 1UM6L 2ATPB 2IPKB 3M45A 4FQXB 3TA3C 4X5WA 4L9LA 3OX8A 3ALWA 3OJVC 3P4OB 4G9DA 1WBYA 4JKKA 2GKIA 4Q9RL 2PYEE 1QVOA 2VXSL 2ZUVA 4POYA 4LPVA 2FCBA 3CZFB 3FOMB 1MQKH 1S7SA 2E3VA 1QP1A 3AS2A 3RIFF 4JFXA 1UYWL 4LVEA 5EA0H 5CEZL 2ADGA 4RISH 4C57C 2PYEA 1G9NC 1K4DA 4PJ5B 3LH2H 4NKDB 3GSNL 2DM3A 3SDYL 2BNUA 4LEXL 5GGUA 1KB5B 1M71A 1ACZA 4RQQA 1N5YL 3QJHB 3QEUB 5HYEA 2I60H 2VDRL 1U95A 3VXMD 1UM5H 3K2UH 4DK3A 1QTYT 3BW9A 3F7PC 5F1IB 4DKAA 3MV8A 3VRIA 3T0AA 1DQJB 3BN9D 4GG6F 2VISA 1ED3A 3QIWC 4CU7A 4LARL 4B53A 2ICEA 4LLYA 4YWGL 2R0KL 4RGMC 3SDAD 5GS1B 5IR1A 1ZLUH 4KY1L 5DRWA 1FZOB 4OD3L 4WHCA 4YXHL 5MEPB 5IMLA 1KLUB 4J3OC 4Y2OA 4FQJH 4UIKH 3UTTD 5C08D 3B3IB 1IGCH 3MRNA 5D9SB 2QQKH 2R15A 3P0VH 1YEHH 1FZMA 4R2GB 4FFVC 1P5VA 5DZNA 3E6HA 3VD7A 5T5FL 1SVZA 3I02B 1XMWA 1H3TA 4P2QB 1MJJA 5DVNA 3V9FA 3NH7H 2OQJA 4IDLA 4X7SH 1R24B 3RL1B 3DYMA 2XG5A 1D6VL 5C07D 4MWFB 5LJYH 2BXYA 3HE6C 4WI9A 5FV2A 3DUSA 4UTBH 3FMGL 3MV7E 5I76B 2OBGA 3V4UH 4U33A 2D31B 1AC6A 1A6WH 1DN0B 4Z95H 3SO3B 4OUUA 5L8LB 5E5RB 3PXHA 3MV7A 3VDAA 4LSPL 4NRYB 1UWXK 3G5XB 4KK8C 2XZCL 1WJ3A 2IADB 3QPXL 5FCUL 2DWDB 3P4OA 2W07A 3IDIB 2AXHA 5GS2D 4CVZB 2V9TA 3CZFA 3FOMA 4PJ5E 3L6FB 1NH6A 1MLCB 1UT9A 4Y16C 3ZYZA 2IBBA 1MWAB 1FO0L 1SY6L 4LSUL 3ZSTA 4TVPE 3DUHA 3U9PH 4LPUA 2AJXH 4YDKH 1KB5A 3QJHA 5F1NB 3QEUA 3VI3E 4I0PD 3VG0L 1TVDA 5A1AA 2Q20A 5CILL 5D7LB 1NMBL 5D7IF 3VD3A 5JR1H 4G5ZH 1MIML 1SM3H 1FVEB 4CW1B 5EN2B 1DQJA 3HCVB 5JW3H 1C5BH 2XWTB 2FX9H 1EBAA 1IKNC 2J7LA 3KPMB 4HD9A 1XIWB 3VFGL 4MNHB 1A6VL 1WIPA 4FZEH 5GS1A 2EYSB 4Q0XH 4UV7L 3EBAA 4NUGL 1AJ7L 2VJXA 1A4JB 3ZTNL 4GG8B 4ZFFB 2IANB 4K3JH 4P2QE 3ZTJG 1J0JA 1VB9A 5EG6C 1OLLA 1VPOL 1UJ3C 2OMNA 5B4MD 5BV7C 3FOLA 1VEOA 1VGKB 3MLWL 2L4OA 3ZHLA 2GJJA 4P2QA 3T2QA 2VZ1A 1R24A 3RL1A 4Y2DB 2CDEB 4MWFA 3BYYA 4PGCB 3AS1A 5I76A 4EDXB 2VUYA 2AK1L 3ZO0A 1O5DT 4W4OA 4LSRH 3QH3A 5DURD 2A77H 3HFMH 3TC9A 5C6TH 4NRYA 5HYIA 5ADPL 3RWEA 2IADA 2X42A 4JHAH 2YA2A 3NZHH 1NQBA 4CVZA 4H8WL 4S1DD 3VFUA 1G7IB 4NP4H 1QFUL 3L6FA 1PKQE 2HLAB 5C0RL 1MLCA 5C6PB 1GZQB 2AI0L 4XP4H 1MWAA 4P5MB 1EHLL 5LQBL 4M5ZH 5D7LE 1JNJA 5GXBB 3NN8B 3U9UB 1MAML 3OWEA 2NR6C 4TTDC 5I75C 5BVPH 2VXUL 4U6HA 1CGTA 2ADJA 5DUPL 5D7LA 1B6UA 3ZZ1A 1FVEA 4YZFE 1RZKL 3U0WL 3D85B 3HCVA 3OL2A 4P2OB 3BO8B 5GZNC 2XWTA 2D4DA 4YUEH 3DMMB 3UJTH 3KPMA 3ARDC 5IVZB 4XVTH 1XIWA 3RHWF 4RCAA 4MNHA 4UDUB 5HDQL 5D1XD 2IANE 1JZ2A 4OFPA 4H88H 4NQUA 2IANA 3P30L 4BFBD 4KJQC 1NUDA 4FQ2L 2RQ8A 4F9PC 1FGNH 3LVEA 3LZFL 1BIIB 2XY1A 4N0YH 3MZGB 4M48L 4HEME 2JF1A 4LSSH 1D3CA 3VI3F 1W2KT 4NSKA 3VDCA 1XGQB 4AEEA 3QDGB 4Y2DA 1ADQH 5K9QG 1PFCA 1IGMH 4PGCA 2YPVH 3GGWB 3QQNA 3FZUC 1JFQL 1HSBA 2DWEB 1IGYB 3TJEL 5FYLH 5HDOA 3MV11 5DT1L 5H35B 2Y5TB 4KI1A 2WM0A 3RTQD 2VKWA 3S36X 1FNFA 4X99B 4MMZC 1BX2B 2WWMD 1OAQL 3BZEB 2A73B 1HHHB 3X3FH 1QRNB 3F7RA 4JHWH 1MHEB 3Q5OA 5DR5L 5F9AC 1G7IA 2E7LA 1ETZB 2QTEA 2HLAA 5C2UB 1GZQA 2HT2C 3LMJH 2XRAH 5C70A 4P5MA 4EXKA 4C56B 2DBLH 3OKDB 3QDMA 3SO5A 2W0PA 1YJDH 3L5JA 3GMLA 4KQ4H 3NN8A 1EBPA 1FYHB 4NN7B 3M1BB 1CDJA 4FTVB 5KSVB 2W38A 1K2DB 1NAMB 2O93L 1XCTB 3TT1L 1U8OA 3NABH 5BO1L 3QCTL 1KSRA 3D85A 2C3GA 5GGSB 3ZKMD 2D03H 5JLZA 4P2OA 3BO8A 1Q1JL 3F12A 2G9HB 4P9MH 3DMMA 4RX4D 1X5KA 5IVZA 4O02H 4F58H 2V5SA 3DVNB 5ADOL 1FNHA 4UDUA 5C0NC 4GBXD 4L9LC 1NJ9A 2GUOB 3BZ4B 3PWVB 3SDCD 5A2JH 4UQ2A 2DQDH 3GSNB 4IDJL 1BREA 3ARYA 2WAHA 1CXKA 2V17H 3KXFD 3QDGE 2NY7L 1BIIA 1U9KA 2JB5L 4HBCL 3JV6A 5T33L 4JM2B 3GNMH 3QXAA 3T0BA 3L5XL 1FNSL 5J06A 1XGQA 3QDGA 4RAUA 2WWKO 5BZWA 1A9EB 1MJ8H 4ZXBD 1BOGB 1WIUA 4PRNA 3OTTA 3UTOA 4ODVL 3DXAB 1NGPH 3BN3B 4YZFF 3GGWA 1OP5K 2PF6A 2X4SB 3IKCA 2DWEA 1OTTC 1KCRL 1IGYA 4FHBD 4MA7L 2FEDD 3OHXB 1J1OL 2Y5TA 4NO5A 4RGNC 1T6VN 1QRNE 2DRUA 4X99A 1EO7A 1NBYA 1FSKC 2P8PB 3LEXB 3BZEA 1FYTD 1ZGLB 1A22B 2A73A 1HHHA 2V5YA 3R8QA 4HUMB 2CKBH 1MFCL 1MHEA 2NTFA 4C56E 2JIXD 2DQJL 2EXWD 3CCHB 3BESR 2W0LA 1ETZA 1TZHB 4JFOB 4K07A 3ULUC 2DKSA 1AH1A 4AY0A 1XAUA 5FGRA 4C56A 4OFDA 1MF2L 5J3HC 1MJUH 3BPOC 1J88A 1HH9A 4PV8B 1A47A 3N1MC 3M1BA 4NZUH 4FTVA 2NZ9C 5KSVA 1K2DA 3ARPA 1NAMA 1XCTA 4R97C 4BH8B 4PIRF 3V52L 3WIHL 2VDPL 4Z7OF 1KXVC 3CAFA 1HEZA 3BP4A 4BYHA 1HIMH 1NCCH 3FQWA 5GGSA 1JF5A 4YK4B 2G9HA 4OCLC 1IJ9A 5BOZG 2FX8H 4AH2B 3DVNA 1I1RA 5MHSE 3M8OL 5CEZE 1LP9F 3JSSA 3BZ4A 4M3KB 4FFZL 4XC3H 4POZD 2JK5A 3W11C 3DARA 2A1WH 3PWVA 1FDLL 3GSNA 2UUDK 1KIRB 1A3RH 2O26U 1MCEA 4QRRB 2HMIC 4MQXD 2DL9A 4HS8L 5DD3L 3QZWB 4L8CA 2V7HA 2VKXA 2CK0H 1LMKA 2EXYC 1YECL 3DXAE 4JM2A 4PYGA 2RJMA 2ADFH 5F9JB 1RSFA 5HI4D 2DQIL 4WGWB 1A9EA 1BOGA 2W65B 1LEGB 4HCRA 3BAEL 3DXAA 4XP1L 2QHLA 2X4SA 3ZE1E 4OZGB 4Q2ZB 5HTSA 1FCGA 3RGVB 3OHXA 2ADIB 2GY7B 2UVFA 3N1GC 5FKAB 3KPQB 5HPOA 3H42L 3FQRA 1I9JH 2KQNA 2YUXA 5GS1C 2P8PA 3FO1A 1OHQA 2CR6A 2QBWA 2VSDA 4JREB 1CCZA 1ZGLA 1AGFB 3MYJB 4KQ3H 4D94A 5BJTB 1A14H 3CCHA 3ARED 1G0YR 3ARBB 3TIDB 4ERSH 1U93B 3CFJB 3SOBL 2W9EL 4R2GC 5DJ6B 2FECL 4GW5A 4KI5C 2LTQC 5T1DL 5BV7H 4GQ9L 5HYJD 5F93C 3W9DB 3ZKND 4FG6C 5KVFH 1H8OA 5A40E 1A7RH 1I1CA 1R3IL 1B0WA 4HGWB 2OS7A 4L8BB 3QXWA 4PV8A 4DTGL 3W5MA 4NCDA 3MRCA 4DGVL 5IESL 4PJBB 4BH8A 1DL7H 4LOUD 3MLXH 3R4DA 5E00B 2CO7B 3RBSA 3TM6A 4HPYL 3LEVL 1JGEB 1OQOA 5HYQB 1DBAH 1ZLSH 5HJ3B 2PO6D 3VXOB 1WV7T 2X4RB 4OI9A 3EDKA 3SO3C 5FV1L 1JNNH 4JVPA 4N68A 3GMQB 1ITBB 1Q0YH 3QXDA 5JIIA 1A4KB 1FAKT 5HHME 5LGHL 3VMOA 5IFAH 2YUZA 1ZVSB 2APTA 4QRRE 5FDWB 3S98A 3LV3A 4L4JA 1FLTX 3CLEH 4MCZB 5HDBF 1KIRA 3KJ4C 3NBNA 2MKWA 3UC0H 4N8CH 3VXNB 4QRRA 4PRAB 1GGCH 1OWRM 3T1WA 4WTZG 5HYFA 3LN9A 5DD6A 4U1NB 2MWCA 2BHUA 2R2EB 2WWKT 4OZGE 1RIVL 4I2XB 4Y4FB 5F7LB 1LO5A 4ZD3L 1LEGA 3WKML 4LF3B 4GMTH 3JTSB 4QRPD 1FIGH 1CVRA 2X5PA 2HT3D 3RZWA 4Q2ZA 1M05A 1OOAA 5DF0A 2B8OT 1V3JA 5IMMA 2ADIA 1IAOA 5FKAA 1HZHL 3KPQA 3EFDH 5T1KD 1XIWC 2J8UB 4H1LG 1T2XA 4KAQL 1CTNA 4NCC1 3CJJA 4HC1A 5LXGH 3DI3B 2EDKA 1M4KA 3MGOB 4QWWC 1ROWA 3ARBA 1K6QL 5D93B 3CFJA 3BISA 6CGTA 1SBSL 1T80A 4KMTL 3A67L 3WN5B 3DETD 2NY5C 2A9MH 3IS1X 5E08L 3W9DA 3JUZA 1S7QB 2VDOL 5DRXB 4MJ2A 4Y4HD 1AKJB 1F3JA 4HGWA 4PJBE 4XPBL 1P7QD 4L8BA 1EO5A 1F8TL 4G6AC 2W9DH 3BYTA 3QG7H 4YNYB 4PJBA 1NC2B 3ZE1F 3KYMB 1CF8L 4U1LB 1IAII 3VGAB 1YPZE 4OB5L 3ARWA 1DZBA 5E00A 5F9WB 5FUZH 1ZA3B 5I1HL 1YMHB 2OR9L 1EMTL 5HJ3A 3VXOA 2JELL 2X4RA 2H9GA 2FJFB 3IFPB 2H41A 4GS7B 4XNZC 3QRGH 5KOMC 4JFHE 3C08H 1PGRB 4V1DB 2YZ8A 1A4KA 1UXSB 1ZK9A 3OKNB 4H0IA 5IOPB 1UEYA 4GXUN 1ZVSA 2GSGB 5FDWA 4U7SA 3EDJA 4L4VB 4P9HL 3CSPA 4NBYB 2GJ6B 5IB4A 2HWZL 4I5BA 2E7LC 1LE9B 4IRJB 1W72H 3VXNA 5GGQL 4I2XE 4PLJD 4YPGB 4OJFL 5DLMH 4JZJB 4ZO6A 1JWMA 4OQTH 3M07A 4KV5E 1LEKB 1MFDL 2VSCA 4LVNB 4M9OA 4U1NA 2R2EA 4Y4FA 4I2XA 1NCWH 4JJ5B 3MLVL 4J3SA 4XNXH 5C0CB 2DLGA 3WHE0 5L2JA 1X7QB 1XZ0B 2J8UE 2XIDA 4RA0C 1I8KB 4D9RD 5DWUH 5AAWA 3DMMC 2H45A 2J8UA 2HFFB 3UDWC 3O11B 3T3ME 4KKAC 4X80H 2FZ3B 3THML 3K7UA 1BD2B 1LHZA 5CSBA 1YNLL 5GHWH 1HCFX 4BSJA 4X4MA 3WN5A 4CUCA 5JIPA 2DYPB 4LIQH 5FYJL 2LABA 5DRXA 1WT5A 1AKJA 2F8OA 3VWKD 4OZGF 3N85H 2Z92A 4POUB 4ODTL 4M6MH 2IPUG 2L0DA 1A2YB 1X4XA 3P11H 5EU7C 3G6AB 3OKYA 4XPHH 2OTPA 4YHKL 1BAFL 3KLAB 4YNYA 3UX9B 1NC2A 1R5VB 4D9LH 3ISWA 3KYMA 4U1LA 1WAAF 3PJSB 4OFYA 1YMHA 2VDKH 4MJID 3NA4A 4JM4H 2OSLB 1CFBA 2FJFA 3B8SA 3IFPA 3MX0A 1MI5D 5GGTL 3TV3L 4NDMB 4OT1L 3ZE0E 4GLRH 4V1DA 4L4VE 4S1SL 1AGCB 4KUZL 3OKNA 4KZEL 5IOPA 1YN7A 3UPAA 4G3YH 2GSGA 5DO2D 2GQHA 2VXVH 4JY4B 3OB0H 4L4VA 4TOYL 1GOHA 1NMCC 1UH3A 1CR9L 2GJ6A 4NNPH 3ULUH 3HA0A 4AENA 4R4FH 4YPGA 4F2MA 4PJBF 2NXZB 2KPNA 3CFDA 5C0CE 1PAMA 3MLSL 4NM4L 3OKMB 3UPCA 1JK8A 1R3LB 4JJ5A 5GZOC 4NN7C 1CBVH 5DC9B 5C0CA 1YPZF 1GL4B 3CC5B 1JF1B 1M1SA 3KPRD 1QSVA 5J56B 2V6HA 3HRZB 1X7QA 2A6KA 1W0WB 1QLRB 2J4WH 3VA6A 4CAGA 3N0PB 5B38G 2MCPH 4OCNC 5CJOH 1BD2E 3GDBA 4KHTL 2HFFA 2P5WB 5EFIB 3F58L 5I17B 3O11A 2MSPA 5A16B 1TTUA 1BLNB 1KJ2B 2FZ3A 5FYKL 5F1KC 3WDIA 1A0QL 3RVTD 5DMKB 1SJEA 2QADD 2AQ2A 4OFVA 4HK3J 3O6FB 2DYPA 4Q97A 4KV5F 5HGGS 1D5IL 3JVGA 4JM2C 3S37X 1YDPB 1A2YA 1GHFH 3C8DA 1D9KD 1H0DA 1MNUH 5I8EB 3KLAA 4OBRA 2CIKB 4JPVL 1LK3L 4YHZL 3RP1A 1MI5E 3PJSA 5L0QB 1CYGA 4Z0XB 1KYOK 5DTFB 1T83A 5J13B 1QFOA 4NDMA 1CFVL 4FQIH 3B43A 1AGCA 1S78D 4KTYA 1YQ2A 4OFIA 4XNMA 5C92A 1DR9A 4X6EB 4M43H 5CGYD 4HG4K 4JY4A 4AM0B 1QHPA 4X4XB 5ILTL 4BZ1H 1CL7I 3TIEB 1QEWA 3RUGE 4LCWA 4TSBL 3WD5H 1BFTA 1UZ8B 3HNSL 4LLVB 1OD9A 4HWBL 1R3LA 5B3NA 1GSMA 1FZKB 3CC5A 2VLRA 4OGXH 4XPAL 5TFSH 4XAWH 3HRZA 4RWYL 1W0WA 1QLRA 4LPWA 2CD0A 5KVDH 1X5FA 3ULVC 3H9ZA 3D69A 1C08B 4YK4C 4LLQB 3UBXI 4LU5H 5D7JD 1OM3H 2DKMA 5DRNB 3GRWL 2P5WA 3VXSB 1HSAB 2P5ED 3LHPL 2DI9A 2Z31B 5I17A 2FO4B 1ZLWH 4HV8B 1Z3GL 3VXUB 1BLNA 1KJ2A 5T3ZL 1MCCA 3Q1SH 3TNNA 1IM9D 3C5ZC 4WEMB 2E9WA 1WCBB 4MB3A 2HLFC 1FORH 4NQCB 3D3VB 2DBJA 4UV4L 3SE8L 5GRJL 4K2UH 4HX1B 4HGKC 3TN0C 1T1ZB 3O6FA 3T0ED 3QCVL 3MRRA 5I1LB 3D0LB 3HNTH 3UJIL 5E1HB 3O9WB 1YDPA 3MRPB 5JXAL 4JPWH 3VG9B 5MP6H 3LKQA 3TO2A 3ARUA 1CDCA 5I8EA 4QXUH 3H3PL 2CIKA 5FGBA 4MXVE 3IETB 2NNAA 5KVMC 4MVBC 1BGXH 4U3HA 1DQTA 3ALPA 4CL7A 2NTSP 1G0XA 5CUSH 2I5YH 4WDIB 3TBTB 4I13B 5CCKL 3GSQA 3U1SL 3KYNB 1L7IL 1FNLA 3PDDA 2GFBB 3ARFB 5EOQH 5DMIL 5HBBA 3O2DH 1QNZL 4KJWD 4X7TB 4AM0A 4NQSB 4X4XA 1A7NL 3BE1H 3K3QA 1DQLH 4HW6A 3QUXB 3TIEA 4JO2L 3UMTA 1KCVH 1VHPA 2R0WL 3TWCH 2R56H 5TQ2H 4F8TA 2P7TB 1UZ8A 1U3HB 3NTCH 2ARWA 2ZCHH 3IU4H 5ETUA 3BSZL 4LLVA 2FBJH 4P0DA 4OF7A 4L3CB 1D6EA 1FZKA 4X8XA 3QXUA 3FT2B 3KHOA 4TPRH 1MPAL 2Z8RA 1TNNA 4PV9B 4NGHL 1BBDL 3VXSE 4J23A 3NCFB 2EE9A 5FYLD 3DV6B 1C08A 2DMKA 4LLQA 3VXUE 3AM8A 5EORL 1NDMB 2X40A 4HXAL 5DRNA 3CD4A 4WY7H 2GAZA 5ACMA 3C9NB 3VXSA 1HSAA 3VXQB 4NQCE 1CE1H 2VDLH 1RULH 2Z31A 1NCAH 2FHBA 2FO4A 2Y9RT 4KUCD 1U3ZA 4HV8A 4MQSB 5DXWA 1L6ZA 4X7FC 3LIZH 3LQZB 2FJGB 4H1LB 4MB4A 3F7QA 2Y36L 1KEMH 4PJFF 4NQCA 1A7OH 3D3VA 1WITA 5F70A 3RUGF 3WFDH 5C09B 1J12A 5T1LA 4HX1A 3I6LD 4HUVB 4YHOH 1T1ZA 3EW3B 4KTEH 1T2JA 2Q8AH 4YHYB 5I1LA 4D0DA 2DQTL 3C60D 3D0LA 1CXIA 3MLUH 3IDYB 3O9WA 1Y0LB 5D1ZC 1WFTA 5KVEH 1NCNA 5T3XL 4HSQA 4OCMC 3MRPA 2D9CA 4PRHA 2F5AL 4WO4D 4JQXC 3ECBB 1NLDH 4PRPB 5E8DH 5E2UH 2AJYH 1U2CA 4ONGH 3IETA 3NA9H 2Y4SA 4U1HB 2AABH 3RX7A 3FRUB 4YHML 5JOPD 1FFPB 3TBTA 5CEYB 4B7LA 4OCYL 1CDYA 4CN6A 1KBGL 4WFGD 3KYNA 1MREH 5GGRY 2AQ1A 3ARFA 1EK3A 1I85C 4WVRA 1OGAB 1KOAA 5D6CA 4PGJA 4Y5YA 2D7OA 2A6DB 4X7TA 2JTDA 4NQSA 5C07B 2DIJA 4OLYH 3QAZC 4TN9A 3IXTB 3QUXA 2N7AA 5J1SC 1PSKH 4IJ3B 5BMFH 4NQXB 3WN5C 1Z9OA 3VD9A 1YNKH 2P7TA 1GIGH 1U3HA 1BFSA 1WT5C 3VI4E 1T03L 1JL8A 4LRNL 4U6VL 5CINL 5B8CB 5ESVB 1WQVT 5AUMA 4WTZA 4L3CA 5JHLL 2E9BA 4RZCB 4NKOB 2QQLL 4MXVF 3FT2A 2H1PL 3VGAC 2VDNL 3CMOL 4PV9A 5F9WC 2FATH 2E7CA 2G75B 2KL6A 3MV9B 4BFIB 1BJ8A 3GEWB 4MJ4A 5FYJU 5DQDL 1BQSA 3ROOB 5MEOA 1MCBA 4OGAD 1NDMA 2VIRB 2BY0A 1CVSC 1INEH 5E5UB 3C9NA 3IDMB 5FHAL 4M93B 4K3EH 1F6LL 1SEQL 5C09E 3CVIL 1CT8B 1S7VB 2IQ9L 3MXVH 3NIGE 4FMFA 4XBPA 2FJGA 4H1LA 2EIEA 1A7QL 2RFXB 1XEDA 2VMFA 3SE4A 4K55A 5C09A 4U0RC 4HUVA 2D3VA 4Q9QL 4NJ9H 2JLLA 3OF6A 5AD0B 1EGJA 4MMXC 3WFBH 1S7UB 3ZE2F 4PRPE 1QKZL 1Y0LA 4AEHH 3L5WB 2XKUA 1QFWH 4ODHL 2E8ZA 3U7YL 5D2NA 3SDAA 3HI6L 3B9KD 4KRNA 3UAJD 5D7KE 5EZLB 4U1HA 3FRUA 2WK2A 3H0TA 5C08A 3TVMD 1FFPA 1RVFH 5E95B 1OGAE 3VWJB 5CEYA 5I6XC 4HUXB 3Q6GH 4YGVB 2QV2A 4XCCL 5DHVH 1KG0B 3CK0H 2ZNXA 4DN4L 4XNUH 5FYJE 2X9XA 4AIXA 2A6DA 2XY2A 3QQ3B 1BZ9B 3SCMD 2IBZY 1FVCB 3UTQB 5C07A 1RZJL 2NY4C 5LG1A 3WV0A 5JA8B 4O5LL 4DKEH 5ISZB 4PRDA 2JJTA 3IXTA 3GJEB 2ARJQ 5A3ID 1N59B 2KBGA 1J18A 4P2YA 5CSZB 4O9HH 4AL8H 1GGBL 4KDTC 4NRXB 3JVGC 3P9MA 3O41B 1BQLL 3RVUC 2DLFL 1RZFL 5B8CA 5ESVA 1JRHH 3MV9E 2VQ1A 1M7XA 5FYKU 4RZCA 1QQDB 1A5FL 4NKOA 5IG7B 1HHKB 1J05B 1Q0XH 3CFCH 1GGIL 4PPTA 2G75A 5GGTA 4BFIA 4Z76B 1FFOA 1CK0H 2BERA 4OTXH 1T83C 3NGBC 3ROOA 1DQQB 3B4NA 3MRFA 1JHKH 5LWYH 3IDMA 1OARH 2JJSA 5B38B 3C6LC 3B2UC 3VMNA 3V4VH 1CT8A 1S7VA 2ORBL 1AHWB 1ZHKA 4KHXH 2FIKB 4HUWA 4I0PA 4MXWH 2RFXA 1X5LA 2ZCKH 5C0FB 4M00A 1CFTB 2UZIH 1W0VB 4QTHB 2X4OA 1MEXH 1INQB 2X4PB 2Z35A 1UKTA 1S7UA 4RGOL 3L5WA 1B4RA 4HIXH 2BNQD 3HMWL 4HUUB 4YE4H 3QUYB 5D1XB 2NMSA 1HN1A 5ICYB 3EUUA 1FN4B 5EZLA 2EDDA 5LBSL 4I3SL 3UYRL 5IW6B 5KBNC 4KROB 1S7WA 1Q9WB 5FYKE 2EECA 4LHJB 4HUXA 4NUJA 5IW1B 3ZHDA 4JFFD 4YGVA 2Z93A 3NFSL 3NIGF 4YXKL 4LGRB 3RWCB 5ISZE 1HHGB 1OW0C 1A8JH 4LCIL 3QPQD 3MRLB 4XRCB 1MFBL 3QQ3A 1BZ9A 4M5YH 4NWTL 4Y19B 3UTPD 3QUML 1IZKA 1FVCA 3OKOB 5CD5C 1J11A 1QD0A 5IGXL 5ISZA 2R69H 4MD0B 2AJVH 3GJEA 3O2VH 1EPFA 1AO7E 3BMWA 1N59A 3GSUA 3QFDB 3KVQA 5CSZA 4UINH 4NRXA 4JG1H 3O41A 4KWUA 4X9FA 2BRRH 2FWOB 3OMZA 1Z0NA 2Z91B 3RA7L 2WZPD 4ZS7L 1QQDA 3C6SA 5IG7A 1KB9J 1HHKA 1J05A 3T2NH 2VDQH 1TZGL 4L5FL 4PS4L 2FLBT 5FGBC 4Z76A 5L0QC 1DANU 4AIZB 5D7SH 3MRKB 1BEYH 5E1AB 2OX5A 3U30B 32C2B 5IKCA 4XBEH 2NY0D 3EO9L 2R2HB 2W91A 2A6JB 4E9LA 5IP4A 1CD0A 1TPXC 4PREB 5B38A 2R29H 1A3LL 1AD9A 2R1WB 2J8HA 3T77B 2CLZA 5DJCB 4R4BB 4S1QL 1AHWA 4ZAKB 2LE9A 4C59B 2FIKA 1KUMA 3BKMH 2B5IB 3RRQA 1JNHB 4QO1A 1JIBA 1OQXA 4M03A 4Z7WB 1AXIB 5IF0A 5HGDB 2B1AL 2G5RA 5C0FA 2Y06H 1HYSC 2P43B 1W0VA 4QTHA 2EDNA 4NFDA 2XZQH 2P42B 1INQA 4NN5C 2X4PA 1YEIL 3EYSL 4HWBA 1I75A 4XMPH 3P0YL 4K9EL 4A2LA 4S0SD 4HUUA 1UVQB 1K3ZA 4ODWB 3QUYA 5D1XA 4MXQD 2H26B 2EDJA 5FUOH 5ICYA 2NW2B 4JN1L 3AB0C 5ID1A 1RIHL 4OGYL 5T3ZE 1NGYB 2XN9B 4TRPH 5IW6A 2BNRD 3MO1B 2YPKB 4BFGA 4Z7UB 3TBWB 1Z9SA 3AM8C 1XGYH 2A83B 5E8NB 5IW1A 4Y19E 3X14A 1IEBA 3NMEA 5C9JB 3RWCA 1HHGA 2G60L 7FABL 4P2RB 5E9DD 1Z0MA 3ARGD 1E4WL 5D72L 4Y19A 3D5OF 2XWBA 4UU9B 4PGDB 1I1AB 1TTFA 2AEIT 5DEGB 5GGRB 4EDWL 2HP4A 4P5TD 1U8JB 2GCYB 4MD0A 3ROLA 3SBWA 4K8RL 1UM5L 5DEZA 1TJGH 2XTJB 2DJUA 3GJFH 3QFDA 2H2SD 1QACA 2WUCL 4U31A 5CSGA 4L1DA 2NY2D 4WI4A 2WP3O 5EZOL 3IAGC 4G80B 1NCDH 5IQ7L 5JQ6H 4Z9KB 3VG9C 1KXTB 4Y4KC 2C5DC 3BPCB 1RIUH 3RVXC 5ELIA 3D9AH 1H5BC 4BH7B 2WNGA 3WFEH 3SDXB 1K8DB 4GAJL 4AIZA 4PY8J 4BQ9A 1KN2H 3MRKA 3WEXB 1IAIH 5E1AA 1IARB 4NFBA 5E2VL 5KS9B 2A6JA 2YXFA 3D48R 4ZTPL 4PREA 4Z7WE 4D3CH 2R1WA 3T77A 4OZFB 3WE6B 5DJCA 1FAIL 4R4BA 3S35L 2BY1A 3GHEH 4Y5YC 2W0KA 3WIIL 3K8KA 3EHBD 3QIBB 1IE5A 1CU4L 4APQB 4PRID 4CJ1A 3MUHL 5SX5K 3U4EB 3T04D 1QLEL 25C8H 1LVEA 2PR4L 3QHFL 4O58L 1JGVH 2EDBA 1Z6JT 1X5IA 3BD5A 4NZTH 5D71L 1L6XA 1IQWH 2PXYC 3E8UH 5L6YL 1UVQA 2XICA 1EEZB 2XN9E 4Z95L 4ODWA 2F5BH 3X11B 5EBWB 4GBXA 4EBQH 2HFEB 2DQGL 1YN6B 2F53B 2H26A 4Z7UE 5ALCL 3HZMB 2KDGA 2NW2A 3INUL 1DBKL 1S3KL 4P2CG 1JN6B 4M7LT 4X7CC 3MO1A 2BC4B 2YWYA 2YPKA 4CGTA 4Z7UA 3TBWA 1G6RA 4P2RE 1F02I 4E5XA 3WNKA 5E8NA 1A02N 2YRZA 3H9SB 3ILQD 3JWOC 2R4SL 5J12C 4E41D 2EDEA 5I15H 2DLTA 5TE6H 4P2RA 5TE7L 3NIDE 4NFCA 3HPJB 3OJDB 4U1GC 1KFAL 1X9QA 1HH6B 4LSVL 2XTJE 4PJEB 4KDVA 2G5BB 5F88B 5T3XE 3MBEB 1T2QL 4NKMA 4ODUB 1P4BH 4UU9A 3JWDH 5TDNB 1I1AA 3CFEA 3SE4C 5DEGA 2BCKB 5GGRA 3V7MA 1BJ1J 5TQ0L 2GCYA 1J0ZA 5E70A 4HJJH 1IQDB 3BN9C 4M1GL