4PJDE

Structure of human mr1-5-op-ru in complex with human mait c-c10 tcr
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
197
structure length
188
Chain Sequence
QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVVDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 188
sequence length 197
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdE02
1Z5LA 5FUCE 3PL6C 1BJMA 1KB5H 4KZDH 2E8ZA 4UMGA 2B2XL 3EO9L 2GJ6A 4OZIF 5CJQL 5IW3A 1IRAY 2X4PB 2GITB 1UWEL 4P57A 1N5AA 3NIFF 5KANG 1RUAL 3GRWA 3MRLB 1DQJA 1XEDA 1N3NB 2R56L 1AD0A 1DBBH 4RGOL 5A2IH 1EK3A 4YK4B 2X4NB 1TMCB 1RU9L 4RMVA 4BK5A 1P5VA 1UWXH 2KDGA 4MS8C 5KVGH 3B43A 4GG6F 3MNWB 3CLEL 3F6IA 5EOTB 4Q6IC 4TSBL 5DMGD 4JM2F 4NGHL 1CXIA 4NO2B 4DN3H 5HYSB 3CC5B 1PSKH 3IDJB 5D7IA 4RGMC 3ARSA 4P9HH 4PP1C 3V5DA 1MCPH 5EUOB 5EZOH 4ETYA 1QUNA 2HKHL 3QXDA 3WIIL 1S7XB 3W82A 3I2CL 1TZIB 2L4OA 2EO1A 3G5VA 2R69H 1RIHL 4JKWA 4KAQH 5DFWH 1B0RA 5D6DA 4MAUL 2XPGB 4GRLA 1T4KA 2WAHA 3SKNB 1G9NL 2AQ2A 3UJJL 4WVRA 3HR6A 5EPMB 4K3DH 4W6WB 1OGAD 1TETL 3O11A 4QXUL 1GGTA 1RK1B 2BOCB 1MCKA 2X4SB 1CD0A 3HS0B 5ALBH 3TLRA 3BRFA 1U95A 3LN5A 5GRVK 1M1SA 1ND0A 2CKNA 3SQBA 5J7CC 1MIMH 3P73B 2B4CL 3OAUH 3D18B 4GRMB 3UTQB 1WAAF 1ZTXH 4GRWB 4D9RE 3MLRL 1LK3H 2A6DB 2VZUA 4HH8A 4UAOC 1A7QL 5CBAA 1L6XA 4R26L 2DLIA 1UKSA 2VC2H 3NA9L 2GK2A 1RZFL 4JQVA 4OCWL 1Z2KA 1WT5C 5CILH 2ZWLT 3H9ZA 4XPBH 1I75A 1DLHB 5A1AA 2XY1A 3CVIH 3PNWB 4K2UL 2R29L 3BKMH 4AIZA 3IKCB 5DQDH 4K7PY 2X4OA 5HVHB 1T04B 2BMKB 3BEWA 3MRNB 4NQCD 4QHUA 1N5YL 2A6IB 2VDPL 3W2DL 1KJMB 3V52L 1U36A 4NQDE 4HX1A 3F5WA 3OXRB 2X89D 3ILQC 2BVOA 4TSCL 1AC0A 1QA9A 3WSQL 2D0FA 4ZSOA 3JVGA 4N68A 3TN0B 4AENB 4DZBA 4PJCE 2BVQA 3KPMA 1A7BA 4F8QA 1C5CH 3R1GH 4HW6A 4X6FA 5DC4B 1YNLL 4AJ0A 3U7WH 4MA7H 5DFTA 1KYOK 3PL6A 1T1WA 4KKCC 3PQYD 3HE7C 4U1MA 1QNZH 3SDYL 1ZLUK 5KVFH 1DQMH 3NIGE 5JR1H 5GZNC 4G8EA 1P9MC 5I30L 3QPQC 5IQ7L 3KPRE 5B3JF 1RULL 3O9WA 3ZKXC 4DKEL 2ZCHL 3RX8A 3RIAK 3H0TA 2IADA 4KC3B 2Z31B 1R3JA 4KTYA 5C71A 2HRPL 3GBNH 4RIRB 2HFGL 2OJZL 1NEZB 4PR5A 4Q6IA 4ODVL 2GSGA 4Z7VE 5HGAA 4PTTA 1ZA6B 4KMTL 3VMOA 1OT2A 1N7MH 1BJ1H 2K9UA 4OZ4A 4ALAH 3FB6B 4RX4A 5ID1A 3WHXB 2HH0H 1MFAH 4JFZL 1AGBB 4QXGL 4YHLL 1JV5A 1C16A 1OB1B 3Q6FB 5T1LA 4U1SA 4XPTH 4MA8H 2E3VA 4KHTH 2BCKA 1AI1L 1JMZA 4WHTA 4BZ2H 1IGTA 3L3IA 4NQDB 1QLRA 4AEHH 4GW5B 1KJVA 2XTJE 1F42A 1WV7T 1D5XA 2OP4H 1INDH 2VISB 4WW1B 1DQDL 4G5ZH 1EBPA 4QRRD 4DJMA 5BXFB 5DK2A 2J5LB 3QNYB 1P84J 3VXSE 3M8OL 1L7IL 2YEZB 3VU2A 5E70A 5EZJB 2R2HB 5HGBA 3S36H 1S7RA 3MBEB 1KUMA 3QUZB 4HGMA 3ZKND 4KKBD 4JRXE 1MCSA 3P0GB 5I19H 1LO0H 4PD4J 1LEIA 4LOUD 1Q0XL 2Y9RT 3U4BH 3PDOB 4JE4B 2ITDA 2GK0B 3TCLB 3D0LA 2ATPB 3CD4A 3P40A 3KPRB 3TO4C 4LLWB 4GLRH 2Y07H 1J0ZA 4PUBH 3PV6B 4MZ2A 4ZPVA 3UC0L 3S9DB 1G7IA 1H9VA 4PG2C 4PLKD 3H9HB 3HN3A 1TJGH 1WT5A 3B3IA 1X5HA 2BY1A 4HT1H 1CVRA 5J1AA 4Z78A 3GMQB 2O5YH 4ZS6C 3L5IA 4Z7VB 1F90H 3CFCH 3O6FD 4L3EA 5BRZE 4U7KA 1GOHA 1F45A 2D0GA 4OBSA 3HI5L 4QRQB 1OTSC 4LLUA 1U91B 4OLXL 1Q1JL 1JZ8A 4HUWA 4KGJA 5GRYA 4ODSH 2X41A 3MV7A 2OYPA 4YHOH 1OARH 1T21B 2KZWA 3PIQA 3DETD 1KB5L 4KZDL 3QFJE 3U46A 1NCNA 2EXWD 4X7TB 1FFPA 3MFFA 4OV5B 1RZIB 2VLKE 4LSPH 4MCYA 4JQIH 3K4DA 2IEPA 3MXVH 4X80H 5HY9A 1DBBL 3DROA 5JLZB 1MLCA 3BFOA 3HFMH 1QHPA 4Y2DC 5CMAA 3VXSB 4B0MM 5J13B 3UTTD 3SKOA 1VENA 3B4NA 5KVGL 3WO3B 1L4IA 3OR6B 3EDJA 4LFHG 4JRXB 5E6YA 4I0CC 1P9MA 3CNKA 3S37H 1NKRA 2EE9A 2H3NA 4G6KH 2IPKA 3MROA 2MSPA 5JO5A 5F7FA 4DN3L 1J0HA 4P46A 3N50A 1PSKL 5FKAA 1FLTX 1IEBA 1YEHH 4HXAH 4LPVA 4P9HL 5D1QD 2MQ3A 1MCPL 4OQ1A 5EZOL 3SJVE 4U2ZA 5D2NE 2EO9A 5I8OH 4DN4H 4P9MH 5JOPD 4JZJB 4TUOA 3ES6B 3ARWA 5K33A 5MENE 2J6EH 4QRSA 4NN7B 2R69L 3BZ4A 1K4DA 4KAQL 3UCRA 3VXTB 5AYUH 1LQSR 3ARRA 4JFEA 1KIQB 4W4NA 5B39A 3RIFK 1EUTA 1P53A 5BRZB 4K3DL 3GUTB 5HHNA 4P2QA 4LLQB 4XCNA 5DZLA 1DE4A 4XT1C 4Y7MA 5C9KA 5FYJD 3QXWA 5ALBL 2DOCA 2GUOA 4MAYD 3ZE1F 1MIML 3QFJB 4OFVA 2WINA 1R5WA 2NQCA 3OAUL 5KJRH 3T4YA 4J3VA 2VLKB 3MLWH 1ZTXL 4IMLB 4Y1AD 1LK3L 1TQBC 3BOVA 3HNTH 3BYYA 4FQXD 3E6FA 4XPFH 5E5RB 3O8XB 1U41A 4JVUA 2V2WB 2VC2L 3MNZB 3L1OH 4Y4FD 4CNIA 3EHBC 3DTXB 5BVJB 2BVPA 5DJAA 1FBIH 4JDVB 5CILL 1JP5A 4XPBL 2XQYK 4IOSD 2CLVB 2X10A 1NC4D 4I1NB 4WI5A 3CVIL 3EFFB 4WGVB 3TO4A 2ENYA 3C60C 4OIBA 3BKML 4NT6B 1A7RH 1QEWB 5DQDL 3E3QE 3NPSB 5CD3B 4PG2A 5T3XH 1MAMH 2QTEA 1F6AA 3DPBA 3HPLB 2W59A 4Y19E 2OTWB 3SDXE 5D2NB 4DKAA 3KXFA 3ARDD 5AG8A 2AAVA 4N8VB 3OHXB 5HJ3A 5MENB 2EXYC 5JW5B 5C09D 4R4ND 3A6OA 3S4SB 2EIEA 3EGSB 3L5WB 4XNZB 2P8PA 1A6WH 1DUZB 5F7HA 1C5CL 3R1GL 3DVNB 3EYVB 3U7WL 3B8SA 4NRXA 4MA7L 4JREB 4ZFGH 3JZ7A 1QNZL 3MRGB 4NQSB 5KVFL 1DQML 5INDA 1BJ1J 2N56A 5JR1L 5HGHA 2BOBA 3FONB 5F7NC 4N0CD 5IB4A 4DVRH 4FFVD 4Y2DA 4UT9H 5MI0B 3W11D 5DJDA 4BSWA 2PXYD 3F7YA 1XIWB 3GBNL 2DAVA 3AMKA 3ESUF 3GMRA 3QQ4B 1FSKB 3PWUA 3ABZA 4YNYA 5HI3D 4C54A 2LTQB 3GJEA 1WTGT 3TZVB 1N7ML 1AGEA 3O41B 4AG4H 4P5TD 4ALAL 4GG6E 5IW1A 3TVMC 4NUJB 4EZMA 4PRAA 2HH0L 4Z8FH 5IK3A 4GBXD 1KOAA 1MFAL 3UBXA 4YXHH 4MD0B 1HN1A 4KROD 4DZ8B 2VAAB 1FZKA 3V0AC 4CAGA 4XPTL 4MA8L 4KHTL 1CE6A 5ISZD 3QWRA 2B5IB 4N8CH 4Y19B 4MJ5A 3KYOA 4BZ2L 3SDXB 3ZYJA 1FRGH 4AEHL 1DVFC 4OZGF 1UZ6E 4ZYKB 1QO3B 2OP4L 1INDL 3VA2C 4G5ZL 3RVXD 1UQSB 5J3HC 5I66A 4YGVB 1HCVA 1F02I 4R2GD 1G7MB 1AO7A 3QIBA 2PTVA 3S36L 4F37K 1Q9LA 2IGFH 2EDDA 3BT2H 1XCQB 3DRTB 4OCMC 1BQSA 4CADB 4LKXA 4I0PB 3P4OB 4OZHE 5FYLH 1IEAA 5I19L 1LO0L 4YEEA 3LS4H 3GMNA 2ZG3A 5D2LF 3U4BL 2YPVH 3SDCC 1JWMA 3B2UC 3OJ2C 5F7YC 5MEOB 4OCYH 4Y4KD 1YPZE 1OGTA 3VRJB 1J0IA 1Q38A 3TGXA 1TTFA 2FBJH 2YRPA 3C2AH 2AW2A 4LAQH 2ILLA 2Y07L 3FL7A 3MRRB 4PUBL 5GS1C 4QLRA 1U93B 3CVHH 4WRLA 9CGTA 4Z7UF 3SDDD 5HGGS 4K8RC 3QUYD 5IGXH 1TJGL 1ZAGA 5IMMB 4HT1L 1WISA 5D7LE 1EDQA 4J23A 4PJFA 2O5YL 5GGTA 4IS6A 2J8UF 1F90L 3CFCL 4AYFA 2EDXA 3VFMA 5FOJA 3T8XA 2PR4H 4OKVB 5C0BA 3MJ8A 1NBVH 4QTHA 4ODSL 3W39B 2F58H 2APFA 4AL8H 1SVCP 2Z35B 5B22A 5KG9B 1MFBH 4YHOL 1OARL 4KK9D 5C0NC 3BEVB 3D25B 3T4AB 5H8DA 4QOKD 4HSQA 5IW6B 2V9RA 4KDTA 4FQPA 4U4BA 2XQBH 4LSPL 2OS7A 4JQIL 5ALCH 5EOCH 1QFHA 2BNUA 3V2AR 3MXVL 3G5XB 1K5NB 2XKNA 4X80L 3GMPA 4X8XA 4FXKB 3HFML 4U7MA 1HHKA 1LEKB 2ICEA 3UTZA 5F7MC 2QSQA 1K8IB 2APTA 4C4KT 1SYSB 1K3IA 1MCDA 4HIXH 4N1CA 4OZHB 3ULUD 1XH3A 4IBLT 3S37L 4G6KL 3I6LD 5C0DB 1EGJA 1GC1C 2Z4QB 1N8ZA 4NSKA 2ATKB 3CXDH 3PWLB 3HZMA 4W68A 3GK8H 4M7LT 1YPZB 2BVEA 5BW7C 3SGDI 3ULVH 1YEHL 1T0MB 4HXAL 2BERA 4GS7B 4LLVB 4RAVB 4H88H 4G6FB 4JY5H 5T3ZD 5E8PA 2EE6A 3T3MF 5BZDB 3S3PA 2EC9T 4FQHA 4MDIB 4WFFE 5I8OL 4DN4L 4FA8A 2NY2B 4P9ML 4I48B 2J6EL 4U3HA 5FB8B 1S9KC 4GKNA 2ITCA 3CSGA 1DANT 5AYUL 5D7LB 3TVMA 4JKKA 2FBOJ 4GRWF 2HT2C 5T5NF 2IQAB 5IIEB 3MRIB 4P23B 2WBJC 4G9DB 5K59F 3DVFA 1GL4B 3QDMA 4ZPTA 1MHCB 2VDQH 1BD2A 3X11A 1X5YA 4YLQT 5DO2C 1NKOA 2YWYA 3CUPA 4WJ5B 3RA7H 4MDJA 1Z5LB 1INEH 2CR3A 1DVFA 1DL7H 1XF4B 2IAMD 1N5AB 5KJRL 3MLWL 4KKAC 1W0WB 1MFNA 4B5EA 4U6TA 1CS6A 3HNTL 1IAOB 4XPFL 1OAKH 5TPWH 1DZBA 4I4WA 3L1OL 3OJDB 2VXTH 3SDCA 1CFTB 5CP3A 1FBIL 3M45A 4K07A 1IT9H 5KS9A 5FGBC 1X5KA 2BSSB 4W6YB 4WENB 2WLYA 4ZXBB 2I07B 4WDIA 1A7RL 1MCIA 3CPLA 2SEBA 5GS1A 3TA3D 5E5MB 2XICA 5T3XL 3V5DB 3H9SD 1MAML 3SO3C 4LVOB 2JELH 3QXDB 3PDDA 4Y4HD 3LQAH 2RFXA 3KJ4B 4MJ2A 1KXVC 5E8NA 4AZ8A 1B0RB 3TBYA 2WWMC 1A6WL 3DSFH 4LEOA 3QQNA 2P44B 2BZDA 3AB0C 4PLJD 4HQQH 3ZYZA 2X7LA 3OZ9H 1TVHA 2NR6C 3R4DA 4UBDC 3BQUC 4LDOB 1J1XH 3WKNA 4ZFGL 3O11B 3E6HA 1AQDA 3JBG7 1ZHKB 4MXQC 1F5WA 4MNGA 4YBQC 1RUPH 2FR4A 5ACZB 5ITBH 5DVOA 4PGDA 2WIMA 3ZSTA 4EN3C 4UT9L 4OM0H 2ZUQC 4M5YH 1KJ2A 5TDOB 3GDBA 2UUDH 2E7BA 4ZS7H 4XAKE 1XT5A 3TBVB 1OY3B 2YSSB 2O61B 1CGSH 3CFJB 4RFEB 5IHBA 1ZT1B 1MRCH 2G2RA 3MSPA 1AIFB 3QJHB 4AG4L 2CLRB 3BP4B 5MERB 2YS4A 1MUJA 1ZGLB 1CCZA 4Z8FL 4AIZB 3LAFA 4YXHL 1DCLA 3FO0H 2FH8A 4QRTA 4H5SB 1QFPA 2X4OB 4N0RA 1LNUB 3LN4A 4AMKH 3RNKB 3BEWB 4HLZH 1BZ7B 4KVCH 5J1SC 5FAAA 2CDEA 1G7QA 4N8CL 3QIWC 4POZD 1FRGL 1MNUH 1JGVH 1TXKA 6FABH 2BVOB 5GHWH 5CEZH 4RMUA 3FTGA 4ZSOB 4D3CH 2CDGA 4DZBB 4PJGA 5SX5H 4HMEA 2UY6A 4X6FB 4ESKA 3V7AG 1Y0LA 2IGFL 3RHWF 3BT2L 3PL6B 5C07A 5FYLL 5JNYA 3LS4L 3QBTB 3B6SA 2YPVL 1IM9A 5FOBA 4G8EB 5F89A 2VOTA 4UQ3A 4OCYL 1NGXA 5MEPA 1FYTE 3BUYA 1FPTH 4PRBA 3K4ZA 2FBJL 3C2AL 4LAQL 3UTOA 1DUYA 4FP8H 4YXLH 3CVHL 1A6ZA 1CYGA 3H0TB 4IHOA 2IADB 2XY2A 1KT2A 3V6ZA 1CXEA 1R3JB 2FD6H 5EOCJ 5IGXL 1RHFA 2CKBH 1Q9OA 3MXWH 5FGBA 5GGTH 4I18A 4PR5B 4Q6IB 3AREA 4W81A 5ECJE 1BECA 5HGAB 4JG0H 1YJDC 2R2EA 1U8IA 3N85H 1CQYA 4OZ4B 2PR4L 4RGMB 5IJVB 4NO5B 1EO7A 3LEVL 1SJEA 4POUB 1NBVL 1JV5B 3RAJH 3DUHA 2F58L 1I8MA 4AL8L 5IMKA 5D1ZA 5I16B 1MFBL 1IC4H 5LXGH 5GRUH 2D31A 1H3XA 4U1SB 4HZLA 3VFTA 4AQ1B 1U8KA 4R7NB 5ILTH 2AV7B 5CZXC 3VI4E 1IGTB 3L3IB 2XQBL 5ALCL 1QLRB 5EOCL 5TDNA 1KJVB 1PX4A 4ODTH 4A2LA 3GSNH 1RIVH 5DRXA 5DK2B 5FO9B 1UGNA 4GKSB 1ZHNA 5FCUH 3V95A 3BQUA 4L8CA 5DURB 3TN0D 5J56B 5HGBB 1JPGA 2Z0BA 4HIXL 4EVNA 3BKJH 1KCUH 3ET9F 1P7QB 4GJTB 2KZ1B 4RNRA 1KIPB 3ZKMD 1I7ZA 3CXDL 1HH6A 3BAEH 3C08H 4LVEA 1WCQA 3H2WA 4N0YH 3GK8L 3UXFA 3FN3A 1FYTB 4KJWD 2V5SA 4ZAKC 3NABH 4H88L 4UAOB 4JY5L 2HJKA 4X8JB 2NLJA 4ZPVB 1G7IB 5IV2A 4BQ6A 5GSRA 4D9RD 4RZCA 5J6HB 1Z9MA 4IRJC 2FECI 2Z31D 4Z78B 5J1AB 5CZVH 4Q9RH 1EXUB 5DRZA 2DM2A 1A9EB 1VFOA 1RUMH 3IDIB 1H5BC 2VDQL 3I6GA 4HUWB 1J86A 4X98A 1GGCH 1HOCB 3RA7L 3KLHD 1E28A 3FQWA 1QR1A 1INEL 4OKDA 3PIQB 3HC0A 3U46B 1DL7L 3ZDYF 5C0IA 3MFFB 4MCYB 4G8FA 2Q3ZA 2DLGA 2VXSH 1NAMB 2IANE 1QSVA 5I8EA 3WE6A 5TJWK 4XI5D 4NQDD 3DROB 5HY9B 3FO9B 1OT1A 1MLCB 3ZHDA 5CMAB 1YEIH 2C3XA 1OAKL 5TPWL 3HE7B 4ZUUA 2R9HD 5EO9A 3CMOH 4PJ5A 5J57B 4WFGE 2VXTL 3EOYG 5CP3H 1RUKH 3E1F1 1ZHLA 3HPJA 4WWKC 3MNVA 1IT9L 3FZUC 5CJBA 3MBED 3QUZD 3RPKA 2VNCA 3MROB 2P8LA 2MKLC 3WEXB 43C9A 3TIDB 5JO5B 5IBUG 5CUSH 3CFDA 1X6LA 3CCHA 3MOQA 1FO0A 1OWWA 4HJGA 3QQ9C 4NQVB 5IM7A 2OK0H 2JELL 5GJSH 2X40A 3KPRD 5HTSA 4DFHA 3DECA 3RZCC 3LQAL 3VFWB 3PP4H 4TUOB 5I1IH 3WFBH 1Z9OA 2PW1A 4WTXA 3VXPA 5FF6B 4Y5XC 2L7UA 4GOSA 5DJCA 3DI3B 3DSFL 3ZL4H 2FYYB 3MR9A 3ORJA 4Y5VC 5CEYA 1BOGB 4HQQL 3VXUE 4AIOA 3OZ9L 4HS6A 4H8WH 4TQEH 1BMGA 4APQA 1QSEE 2C3VA 2GJJA 1J1XL 2BY2A 4K55A 5DVKA 3PJSB 1MY5A 3INUH 4X7SH 3MRQA 4R8WH 5GZOC 2GUOB 3NCYP 5C3TA 1RUPL 3MJGX 1NBZB 4M61A 4H1LH 5DSCA 4P59H 1WGOA 3EJYC 5ITBL 1HQRA 5CEXB 3B9KC 3WUWG 4DVBB 2FZ3B 1UT9A 4OM0L 4M5YL 3RWJA 1PZ5A 3RWCB 4C56A 5D7SH 2M1KA 3E6FB 5IBTH 4S10A 2DQDH 4BH8A 4ZS7L 2WV3A 3T77A 1VKXB 1H3TA 4CNIB 4OF0A 1CGSL 2I24N 3VXSD 1KTDB 2V17H 4PJEF 4PRHA 5DJAB 2W38A 1MRCL 4XP9H 4CDHA 1FVEB 2CO6B 1UENA 2IBBA 2CSPA 4YHIB 3LIZH 4JRXD 4WTWA 4ZAKA 2VL5A 4YEFA 3FO0L 1IAKA 2NCMA 1EAPA 5D1XC 5DI8A 3BDYH 1YY9C 4AMKL 5EO0A 4OF8A 4KVCL 3X12B 4IRJA 4D9QD 2VSCA 4I0KA 1MNUL 4BQBA 3MJ7A 1JGVL 6FABL 1IC5L 4PREA 5HJ3B 5GHWL 5CEZL 4FQQA 4D3CL 2R1YB 1A5FH 1AO7E 1H5BA 4NHUB 2P8PB 1I1CA 4HUVA 3D2UB 2XA8H 1GPOH 3MLTB 4NNXA 3MMEB 3LKPB 3VWKC 4Z76B 2PKDA 2H26A 4LMQE 5BRZD 1D5IH 3WMSA 1CICC 3D1MC 1JGDA 5HGHB 2X09A 5GRXG 3BSZH 2BOBB 2ZZUT 3REVB 1S7UB 2FWOA 4NPYA 1JYNA 3QFJD 4Y2DB 4TNVF 1QPPA 5HYEA 4FP8L 3CSPA 5JIHA 4YXLL 3FQUA 3UYRH 4PB0H 5ANMA 3GHEH 2VLKD 4BSWB 1EPFA 3TWCH 1MAKA 3F7YB 2FD6L 1AR1C 3NFSH 2CKBL 4FQJH 3GMRB 3MXWL 3PWPE 3F7QA 5GGTL 2NZ9C 2P1YA 1FNEB 4RGNC 3O8XD 4YNYB 4WHYH 4U0RC 5ENWB 2D7NA 4JG0L 3QI9C 4P2OA 3VXMA 3N85L 1AGEB 1W72A 5HI5C 1ONQA 5F93C 5IW1B 2PO6B 3DXAA 5DQJA 4PRAB 1EA9C 1I7TB 3LEXA 3TPKA 3RAJL 3VXQB 2CGRH 4F58H 1IC4L 5LXGL 3RZCA 1FZKB 5GRUL 3ARXA 5KW9H 3JWOC 4EUPA 4PB9H 3H7LA 3QZWA 5GS2D 5ILTL 1HHGA 4R3SA 4Y5XA 3KYOB 3DIFA 1BWWA 5IT2H 3WO4C 4ODTL 1P69B 3GSNL 1RIVL 4Y5VA 5I66B 1YN6A 4HKZA 4QO1A 2FJGA 4GXUN 3QSKB 5MEND 5FCUL 1UJ3A 1AO7B 3O3AB 4Z7WE 2BHZA 3W5MA 4JANA 4P4KB 3SPVB 3BKJL 4OI8A 3G5YB 3NTCH 1IEAB 4PJXF 2P48B 1KCUL 3VI3F 3QUMH 3ILPA 4ZNEA 3LB6C 5FHBH 3B9KA 4KJYB 1J1OH 3BAEL 3GO1H 2C5DC 1BVZA 3C08L 3QAZC 4N0YL 5FGRA 1TPXB 5GS0D 1ZA3B 4O9HH 4XVSH 2RCSH 5C08E 1TQBB 3X13A 1EMTH 3CX5K 3NABL 1BAFH 1OLZA 1WBYA 4MQTB 5IMLA 5HHOE 1QSZA 2Y23A 1JGUH 1VGKB 1X7QB 4LIQH 2VRAA 1MVUB 4IRSA 2CRZA 1JK8A 3KYKH 4PGEA 3PWPB 3Q48A 5CZVL 1XIWD 2VQ1A 4Q9RL 1NJ9A 3C60B 2OZ4H 3V7AE 4GAJH 2FIRT 4K3EH 3G6DH 4UB0H 3TZVD 3RNQA 1RUML 3T8XB 4CVXB 5D1XA 1BD2E 3GHBH 2C7UA 2NY5C 2NMSA 3NCMA 3OAZH 1GGCL 5GGVY 3QO1A 4Z18A 1E6JH 4ENED 3KPQA 3EYSH 1ADQA 3DVGA 1AR2A 4WEMB 3F65A 2VXSL 3FB5B 3BZFB 5IB1A 3H8NA 3U79A 2BNUB 5JQHC 3T1FA 4CN4A 2OL3A 4Y19D 5D7IF 1C7TA 4YE4H 1ACYH 4BFGA 4EKXA 3VWKA 1HHKB 1IC7H 1YEIL 4Z7WB 1UEMA 5IUSA 3CMOL 4TTDC 2Y5TA 1CICA 1RUKL 3AU1A 3VWJA 3IDGB 4QHKI 4NFBA 3FT4A 1K4CA 4I0PD 4LNRB 1N8ZB 1SJHA 3RWIB 5CUSL 1FO0H 3X14A 4LHUG 3HZMB 3MRFB 4YDLC 5C08B 3B9VA 5E8PB 2OK0L 5HGDA 3LKNA 2ORBH 5HHOB 5GJSL 4KMQA 1P6AB 1VGEH 3U9PH 3PP4L 2OMNA 4X6DF 3UZEA 5BQ7B 4QHMA 5I1IL 3WFBL 3QI9A 4KPHH 4J3WA 2ITCB 4M3JA 2X4QA 3RVWC 2DIBA 2H2PD 3LRHA 5GGRY 3IAGC 5F8QC 3TVMB 2YD5A 1LE5B 3ZL4L 3BHBA 3LS5H 1YMME 1YEDA 3PHQB 4H8WL 4ODBD 4TQEL 5TDPA 1IQDB 3FCTB 1ZVSB 1BD2B 3JV0A 3X11B 2ENSA 5EH1A 2Q7YA 3CUPB 3INUL 4QKXB 4X7SL 1EJ6A 5KN5B 4R8WL 4EI6B 4FG6C 1DVFB 3T3PF 3NCYS 4P59L 3BIKA 1WEJH 3KPSE 2GIYA 4M7JH 1MCOH 2J12B 2PTTA 3DYOA 2YUZA 2XZZA 4KI1A 2R2CA 1F6FB 4N0UE 5D7SL 4EDXA 5IBTL 2DQDL 1LP9F 2F53A 5GJTH 4I4WB 1KCRH 2VITA 4TUJA 5TGBA 2N4IA 2GYSA 1LO5A 2V17L 5CLTA 5FEBA 1GSMA 2YBRB 2H2SC 3SDCB 3BISA 1WITA 1NGQH 2OQJA 4XP9L 1AXTH 4WGWB 4K71C 3OGOE 3LIZL 3QDJA 4K94C 4XP6H 1FL3B 3KG5A 3RY4A 3DWTA 3FT3A 3OTTA 4M4RA 5GS1B 5LG1A 2AV1A 4GKZB 1FG2A 4TULH 3K2MC 3BDYL 4LKCA 1AH1A 5B21A 1A21A 2EE3A 3Q6GH 4K23H 3KPNA 5DHXB 2EDTA 4G6FD 4XRCA 4OUUA 1MAJA 2JJUA 3STBA 1WICA 1GYAA 1PYWB 5FV1L 4QHNA 2NY2D 4D9LH 1KTLB 4Y89A 1REIA 3TBYB 1A5FL 2EYTB 1VERA 2XA8L 1GPOL 4LEOB 4LLMA 1YMMB 2X7LB 5D7LD 1FV1A 2EDRA 1JE6A 3U0WH 5C2BH 1YC7A 5BV7H 4ZO7A 3VG9B 3E6HB 4FQIH 4P23D 5IQ9A 2H1PH 1D5IL 3QDHA 4MNGB 3BSZL 4X4MA 1Z0NA 4LCUA 4YDJB 2EH7H 3D39E 4PGDB 1YYLH 3RGVC 3IJSA 2P8MA 3RTQB 5DYOA 1NMCC 3UYRL 3IRZA 4O2FB 4PB0L 3GHEL 4N0UB 3TWCL 5HYIA 4KUCD 3NFSL 4FQJL 1BF2A 3QNXA 3AGVA 2DM4A 1R3IH 5EN2A 2AERT 3R06A 2E9JA 2G2RB 3A0OA 4FTVE 4ONHB 5EBLA 5AUMB 5GGRA 4PG9B 5DZOA 3B8YA 5C0RH 4BKLA 3MA7A 2CGRL 2ARWA 1AE6L 3M1BA 3SGKC 4F58L 4ZXBD 1L6ZA 1M7DB 4RMWA 4EUPH 4GQ9L 4NCC1 3W9EA 4HIJA 4PB9L 3VGAC 1OGAA 5DWUH 3ARFC 5F7WC 5FXCH 3SY0A 3GI8H 4DGIH 4NBZB 1N4XH 3ZE0F 1T66D 4WFFD 3FTGB 1B9ZA 2FHFA 2WBJB 5IR1B 3IDUA 4EBQH 1EZVX 2Q20A 5HPMA 1B2WH 3OKLA 2FL5B 1J7VR 4CVUA 2EDLA 4IM8A 1Y0LB 1KB5B 2HWZH 3KYMA 3HI1A 5C07B 1E6OH 3NTCL 5JMRA 4DKDC 3QUML 3VFOA 3BGMA 3B6SB 1FNAA 1IM9B 5FHBL 5FOBB 4MLIA 5F89B 3VDBA 5IBUB 1IGJA 1J1OL 1NGXB 3GO1L 4UILH 3WL9A 3RUGA 1N64H 4O9HL 1ZHBB 2ZUVA 4XVSL 2RCSL 4J8RA 5K9OB 3D39B 1EMTL 3RL2A 2QQLH 3WKMH 1BAFL 1QBAA 4XHJD 1DUYB 1FJ1A 2J8HA 5E2WH 1JGUL 1U8NA 1CIDA 1P84K 3S6CA 1NCTA 1A3QA 4LIQL 4AM0A 2YD7A 1Q9OB 1WF5A 3KYKL 2HVKA 3ZE2E 3KPLA 3EO0B 1RY7B 4YPGA 1QVOA 3MRJB 1U8IB 2X89A 4L29A 4XWOC 2OZ4L 4PD4K 1VB9A 3F7PC 4GAJL 4WO4B 1Q9KB 4K3EL 3G6DL 4UB0L 4ETQA 3GHBL 4I2XA 3SO3B 4RBPK 1YUHB 1I8MB 1E6JL 2FIKB 2D31B 3QT2A 5C9JA 5ESAA 3EYSL 1EJOH 1FVDA 3NOIA 3V0WH 5FUZH 3VFTB 4V2CB 3PQYA 1U8KB 4NKOA 3FO2A 1F2XK 3WUWB 2OL3H 4P5MB 3Q5YA 4LCYB 1VSCA 3AB0B 1J8HA 4YE4L 5L2KE 1FCCA 1ACYL 3ULVF 5KSBA 4ZOBA 3BQUB 1CXKA 1IC7L 2EDJA 4L8CB 4XH2B 1UWXK 4K3HA 5L9DH 1JPGB 1MJ8H 4EVNB 5F21B 3ELAT 2G5RA 4AH2B 4X7FC 4LFHD 3C8DA 3PL6D 4HKXB 1UACH 2ICWA 2DB8A 3RGVA 3RVUC 4HBCL 1CU4H 4EN3B 3VD7A 1FO0L 1C8PA 2PF6A 2ZUQB 2X4RA 3SE4C 1KTKE 5IFAH 2ORBL 5DA4A 1PQZA 2NLJB 1VGEL 2IFGA 5E2VH 3K4AA 5IV2B 3U9PL 5EFIA 2GFBA 5JA9A 5GSRB 4YHZH 2XNAA 4KPHL 1H15A 1MHHA 4HV8A 1N6QH 4PGJA 1N6VA 3LS5L 2R1WB 3ARGB 4Y8DC 5DRZB 1A6TA 1F3JB 3SGKA 4QRRA 5I75C 2YR3A 3I6GB 4PRNB 5JHLH 4PP1D 3ARFA 3FQWB 1QR1B 3QIWB 3HC0B 1OP3K 3VXNB 1MWAA 4MNQE 3UPRB 1UXSA 5C0IB 1WEJL 3W0WE 4M7JL 1MCOL 1T89C 2E27H 5I8EB 5FM5O 2W07A 4XBGB 3QJFA 1JCKA 5L2KB 2ZKHH 2BNRE 3R8QA 5GJTL 3O0RH 1KCRL 5F44A 3VRIA 5EO9B 5GSVA 1RV6X 3F12A 4NOBA 1JZ2A 1D7FA 1PW3A 1EO5A 1ZHLB 3HPJB 5DURD 1QLFA 5I15H 1NGQL 2WIIA 1AXTL 5AZEH 2P5WA 2EDQA 2R0ZH 4YZFF 3VGGA 2NW3A 4ZFZB 5DVNA 4ZOAA 4XP6L 1TCMA 1KB9J 1WZ1H 1P7QD 5J11C 4NO0A 3CCHB 5EU3A 4BK4A 3O6FA 4HJGB 4TULL 1WSST 1QQDB 5GGVH 4WV1C 3Q6GL 4K23L 4X9BA 4NQXB 1L0YA 1D5MB 4PJ7A 2ZUTA 3CDCA 1FGNH 3STZB 1W0YT 4D9LL 5DJCB 5HBBA 4U2YA 4XVTH 2QHLA 3MR9B 3H3BC 4GO6B 4OTXH 3U0WL 5C2BL 4RA0C 5BV7L 5DJYB 3OKDB 4N0CC 4EQ2A 4FQIL 4Q97A 4N9GA 2H1PL 3UTTA 2CK0H 3QNZB 2OJEA 2YK1L 1LGVA 3TT1H 3DUSB 5DSCB 3DO7A 2VTFA 1YA5A 2EH7L 4Z7QE 1YYLL 4MD5A 5DGQA 3CGTA 3ILQD 3WFEH 1VADA 4YQXH 3RWJB 4TN9A 2AJ3A 1DFBH 1ZVYA 3D85B 4L4JA 1G7JB 3H6JA 3Q5TA 5D1QA 1S8DB 4IEFB 3TH2T 1R5IA 2BY3A 1R3IL 5I1LA 3L6FB 1FP5A 4KKCD 3LRSA 3HE7D 1U8JA 3FMGH 1UB6A 3AS3A 3QR2A 4KH2A 5I1EH 3SE4A 4U6VL 3DXAE 3KPTA 2OM5A 4U1LB 5C0RL 1ORQA 2VL5B 4TNVK 1T3FA 4XCYB 1KLFA 3QPQD 1IAKB 1BBJB 4QGTA 4U1KB 4PRIE 2CO7B 5DI8B 2CIIB 4U1IB 1KPUA 4R2GC 5EO0B 1X3DA 1G6RH 1A6AB 5DWUL 2FLBT 2W91A 2DS4A 2EIBA 3GI8L 5ICYB 3CFKB 3MJ7B 4DGIL 1N4XL 2D7PA 4P48A 1T5WA 3QEGH 3NGBB 4XGZA 4YBHA 4QRPE 1FFOB 1H5BB 5DD6A 4EBQL 4HUVB 1VPOH 1B2WL 4HPOH 4Y4KC 4JFED 2HWZL 1GRWA 3TC9A 5IVXA 1E6OL 3CX2A 4FQXA 1HXYA 2APXA 2H26B 3O3EA 4PJFF 1Z0MA 3NPZB 5KOVC 4R0LC 1T89A 1OF2B 4UILL 5ESQB 1N64L 5JORA 4P2CG 1TJIH 2FWOB 1WIUA 4R4BB 5DMIH 1NC4A 1WFNA 2QQLL 3WKML 2DQJH 4DOHE 1HILA 2X4TA 3NAAH 3FQUB 5E2WL 5ANMB 3ZDZE 1JUFA 2COQA 1WQVT 5FK9A 1E0OB 1KG0B 3RRQA 4XCEA 4WWKB 4NWTH 4ELME 3TT3H 1R5VB 2OBGA 4X6CF 4F3FA 4HUUA 2K3TA 5E56A 1KGCD 4KK9C 3OKEB 1JZ7A 2AKRB 5T3XE 4WFGD 5C09A 1ONQB 3DXAB 2HVJA 5DQJB 4LBEA 3E8UH 4P4RA 4MQ7A 1N59A 4PRIB 2NW2B 3F62A 3OJVC 1EJOL 2X1WL 3V0WL 3HG1E 5FUZL 5IEHA 2Q7NA 4P3DA 3DIFB 2OL3L 4FMKA 5CHNB 1AFVH 3HCVB 1JHLH 2HAZA 5C6TH 5L2JA 4X0KA 4CJ1A 3JTTA 4PJBA 4UOW1 5E2UH 2EIZA 4Y5VB 1HH9A 3RQ3A 5TH2A 3RVTC 5F3BA 4KQ3H 4HKZB 3L95B 4P3WA 4PY7A 4ZS6D 3TP4A 2FJGB 3SBWC 4AT6A 4OZFA 4QRPB 5EC1A 5L9DL 3KPPB 2BSTA 1OTSD 3D2UD 1G1YA 4G7VH 4ZO9A 1MJ8L 4YPJA 1SEBB 1PAMA 3KPOA 5E9DE 2B20A 4LCWE 5DT1L 1UACL 5DUMH 5F9JA 3B9KB 1CU4L 4MD4B 5DJXA 1EX0A 1MHPH 2PYFA 1FCGA 1RZ8A 2XIDA 4P5TA 4XMPH 4XVUC 2VDKH 2W60A 4DOHB 5IFAL 1XF1A 3MLUH 4GBXA 3H7BA 5E2VL 4Y2DD 2FSEA 1KPVB 2I5YH 2YRLA 3D87B 4YHZL 3BKYH 1JK8B 4PGEB 1E4XI 3EDKA 2XXMB 5ISZA 3UO1H 4ELMB 1N6QL 2R1XB 1D6EA 4NQTA 2VQ1B 5BCAA 4QHKJ 5KSAC 4HWUA 3RNQB 4PJDA 5D1XB 1HYRC 2FO4A 1NDMA 3QUKA 3QO1B 5JHLL 1MEXH 5LGJB 2DQEH 4S1DC 2VDOH 3BD4A 5KS9F 4LVHC 3DVGB 4JFXA 2VN7A 5E7BA 4JRYE 4X6EA 2ZNWA 3O3UN 5IB1B 4JHBA 3U0PB 4ZUSA 3QWRD 1QRKA 2E27L 3T1FB 3TF7C 3U30C 4Y4KA 3OF6D 3SOBH 1U2HA 3NN8A 2XA3A 3VWKB 2ZKHL 2F53E 3O0RL 2XXCB 3FN9A 2HG5B 4U1HA 5F97E 3TA3C 1AO7D 1Y18B 3SDDA 3QUYA 5JA8B 5I15L 2ZOLA 5FDWB 4R0LA 3NZ8B 5AZEL 4Q9QH 3VFNB 2R0ZL 5E9DB 3QDJE 3VXRE 4PFEA 4LCWB 4P4KD 5I1KH 1WZ1L 5DA0B 3RWGA 4OFKA 1IGIH 4B53A 5E95B 1CGWA 5HI4D 1BIHA 1PG7H 5GGVL 1R24A 2EYRB 1UA6H 3IXAA 3LKNB 5HGDB 2UZXB 4O2EA 4QXTB 4R90H 3TO2B 2R23A 5ICXB 5HDBE 1FZMA 1HXMA 1B4RA 1CDHA 4QHMB 4U0RB 1FGNL 4BJLA 2YUWA 3QI9B 3EHBD 4DK3A 2LU3A 1SM3H 4JN2A 4K3GA 4OFIA 4NZDA 4XVTL 4WU5A 1ODAA 4EI5C 3PWPD 2XWTA 5KAQF 4JKPH 4OTXL 3W5NA 3OGCA 3UAJD 3C60D 1OWRM 3PGDB 3QWOB 3WFHA 3MODH 3CFIC 2BSRA 2CK0L 5C0BD 1BIIA 1WWCA 2GI7A 4X4ME 3WNMA 4M1GH 3TT1L 3WO4B 1PX3A 1WFOA 1E27A 3MFGB 4JRYB 3T0AA 1YN7A 2BDNH 3SBWA 3N1FC 4DCQA 1X4ZA 5GS3A 2UV3A 3WFEL 4DUVA 3TBTA 5I18H 3UJTH 4YQXL 4WW2F 5EA0H 3D5OF 1DFBL 1SQ2N 4OZFG 2F53B 4TUJB 1X5IA 2AGJH 4JPKH 3IU3A 3ARPA 5I17A 3T0EC 3WFZA 3HUJA 4H1LG 3GJFH 3L3JA 2V2TB 4PLNC 3FMGL 3QAZB 5I1EL 4E5XA 3LKRA 4LPWA 2KQMA 2D2OA 4JGJA 3QDJB 3VXRB 1AKJA 2J8OA 4EIGB 5B3NA 4PJGF 4NZRH 4XWGH 1KLGA 2IJ0C 2WM0A 5EC2A 4M7KH 4ONOA 5GPRA 1S9XA 1PEWA 1MY7A 1FG2B 5L88H 4M02A 4YBLC 4QCIB 1CGXA 1TFHA 1G6RL 4Y5YA 5C08D 5FYJH 2QQNH 5F7DB 2ESVE 1HI6A 2JK5B 1QLEH 4QHNB 2R15A 3QEGL 2BNQA 5J9PB 1VPOL 3OXSA 4HPOL 1ES0A 3TVMD 5HYJA 5F70A 1ZT4A 4P2YA 5FUCC 3TBSA 4QNPF 5IQ9B 4MA1B 4NNYB 4L3AA 3NACH 1QHOA 2B39A 1NMBH 1BD2D 3IJHB 4M8QB 5IJKC 5F96H 1MOEA 4LCUB 4GAFB 3G9VA 1TJIL 3LY6A 2P8MB 1DVFD 1KC5H 5DMIL 2DQJL 3ARVA 5DYOB 3NAAL 5J3HD 1A47A 1JF1A 4RMTA 1M4KA 3TA3A 1X5ZA 4KI5F 3S8WA 4U6XA 3BPOC 5BJTA 4J7RA 4F7MA 1FC2D 4NWTL 2KKQA 3TT3L 5EN2B 4JGMA 1KFAH 1IAIM 3HKFA 2C4FT 5K9KA 3CSBA 4ISVB 4OLVH 1RJLA 4YDLB 2Z9TA 3SDCD 4XPAH 2WLZA 3B2UD 1A6VH 3E8UL 4BKLB 1CR9H 2ICWJ 1VHPA 3ZHKA 3RY6C 3W9EB 2BC4B 3M17B 4K8RD 4WHYG 5FO7A 2GAZB 3SY0B 3W81A 3V8CA 1AFVL 3HRZA 1JHLL 5D71H 3VFPA 5C6TL 3C5SB 1J8HE 5E2UL 1QSFE 4KQ3L 3BI9X 2DKSA 3S5LG 1GOGA 3UMTA 3OKLB 2DM3A 2YA0A 2X4PA 4X4ZA 2GITA 3VFVB 2ZP0T 3PXJA 4G7VL 3KYMB 3MRLA 4NUGH 3HI1B 4OF7A 5TFSH 1L0XA 3JWDC 1XF5B 3IDYC 1YMMD 2JF1A 3RKPA 1RVFH 5DUML 3F8UB 1OSZB 3FJTA 4FOMA 4G6AC 5C0GA 4GKOA 4FXLA 2BHYA 1QD0A 3WNOA 1MHPL 1LHZA 2CRMA 4J8RB 1OW0C 3MNWA 5CJOH 3RL2B 4XMPL 3MV9E 2VDKL 1BQLH 1EO8H 1LDPH 1U3YA 1BZ9A 3MLUL 1OAYH 3RTQD 1KIUA 2MMXA 3MOBH 3T0EA 4NO2A 2I5YL 3DHJA 2AXHA 3BKYL 3CC5A 4K71B 3IDJA 3LH2H 3LKSB 3UO1L 3KLHC 1G0XA 4LSSH 5EUOA 4EDWH 5F6IB 4YHYC 5MP6H 4UINH 4DTGL 3Q2CA 1FORL 1IARB 3V0VB 4I2XB 3CDFA 3IETA 5I1GH 1I85C 2AJVH 2D9CA 1MEXL 2NXYB 5CEZE 3DYMA 2VDOL 2XPGA 5ESAB 2X1QA 2R0KH 5D7JC 3VG0H 3SKNA 4NKOB 2R9HC 5A43C 5JZ7C 3EYFA 1RK1A 1J8HB 2X4SA 5DJ0A 3SOBL 2YD4A 2HT2D 1YECH 4I13B 4F2MB 4NKMB 1XF2A 4HH9B 2WBJD 3P73A 3ROOB 1CVSC 3D18A 4GRMA 3UTQA 5IJKA 3NCBB 2GTZB 4Q9QL 2X44D 4DQOH 5C07D 3RGVB 2I9LA 5I1KL 3EAKA 1SJVA 3HHRB 2Q8AH 1IGIL 1P7HL 1IM9D 1X5AA 4KKAD 1RURH 4AEIH 1PG7L 5ERWA 1URLA 2A6JA 3MV9B 1UA6L 1GZQB 3D39D 1DLHA 3OKYA 4R97B 4M1DH 4YDVA 5FYKU 1I9IH 2J4WH 3PNWA 4R90L 4PJ7E 5EFIB 1PY4A 1A3RH 5DJ8A 1EUUA 3MJ9A 4J6RH 3IKCA 5TQ2H 2YHGA 1H15B 5F1OB 3RWEB 1SM3L 4HUMB 4BZYA 4M6OH 3RY5A 1T04A 1U0QA 3WS6A 2A6IA 4JKPL 1KJMA 5JW4Q 3P9MB 3OXRA 2DJSA 2R4RH 3VGAB 3MODL 5E4IA 3U9UA 4AENA 3ARFB 1WK0A 3ZSSA 5BS0E 3THMH 4M1GL 2XTJC 1PZUB 4JCMA 1MWAB 3ULUH 4ERSH 1UXSB 4NFCA 5I0ZA 1DEDA 2BDNL 5J13C 1ACZA 5I18L 3UJTL 4P0DA 5EA0L 1Q0YH 2WWMD 3P11H 1L7TH 5DC9B 3CDYA 3GM8A 4F33B 2NR6D 2AGJL 3F12B 4JPKL 5CD5C 4UBDD 3BQUD 5MHSE 2IBZX 3HA0A 5JW4N 5I1HH 2JB5H 4TOYH 2P5WB 4MXQD 4QT5B 4YBQD 1OW0A 4NZRL 2Z31A 4Q9CA 4XWGL 2V9TA 3O6LH 4KKLC 2V5TA 4M7KL 1JF6A 4LK4A 1NEZA 2QSCH 4EN3D 4Q74A 2CKBB 5L88L 1FDLH 2XG4A 1UH3A 2O93L 4MXVF 4JY6B 4GW4A 1FVCB 4PJIE 5FYJL 2QQNL 4G6JH 4PJ7B 2VLLA 4XCCH 4GMTH 1AGBA 1NL0H 3HE6C 1QLEL 4ZUTB 5DDHB 3IJYB 3EZJB 3SEPA 1NDGB 1EFXA 3BJ91 3HI6H 4NQDA 3ARGD 2UWEE 3GMLB 5DHVH 5KVMC 4WW1A 5D7JA 4JO4H 4M43H 5I74C 1BJ8A 5BXFA 1KTRL 3NACL 3GGWA 1NMBL 2LU4A 3G6JE 3QNYA 2C3WA 4A6YA 2OJEB 4PJCA 1A7OH 1R3LA 4HFUH 3RI5F 5BS0B 5F96L 1ZT7A 2XACC 2YEZA 1U9KA 3QIWD 5EZJA 1IEHA 2R2HA 4G42B 4MD5B 1KC5L 3I84A 3MBEA 3VFRB 3QRGH 2DI7A 1VADB 3ZKQD 2C1PB 4U6HB 2CXKA 4HXBH 1K9TA 4OGYH 4PJHE 1B3JA 1HDMB 4LDEB 1R5IB 2FX7H 3TCLA 1CDUA 5L2KD 2E9WA 3KPRA 1KFAL 4LLWA 1A22B 1JHKH 4GXUM 4OLVL 3S36X 2VZTA 1A6PA 2YOCA 4XPAL 2ZCLH 4RRPA 1ORQB 4FABH 1A6VL 4LSUH 5DUPH 1CR9L 5A2JH 2JLLA 1FH5H 2HKFH 1HE7A 3GMQA 1I4FA 4Z7VA 2D7MA 2WP3T 4GFTB 4OCXH 1NC2B 1HYSC 1MIEH 4PJIB 4QRQA 5D71L 4G80A 2DRUA 4XZUA 4RFOH 5CCKH 4MMXC 4S1SH 2FRGP 2YUVA 4JREC 1T21A 5I75B 4X7TA 3WDHA 5E8DH 4IDJH 5GS0C 1V3MA 4NUGL 5TFSL 5K93A 4G9FA 2UWEB 1RVFL 2ADJB 5JLZA 5CKGA 3G6JB 3W9DB 4UT6H 2HFEB 1PD6A 5JORB 4Y88A 1EFQA 5T1KB 5CJOL 3HMXH 1BQLL 1EO8L 1LDPL 3MYJB 1HILB 2X4TB 15C8H 4JRXA 5F9DC 5FM8A 5I1AB 1OAYL 3MOBL 4PJHB 1H3WM 1A9BB 1BP3B 4JO2H 4C56D 4XCEB 3D85D 4ORGB 5E7FA 3LH2L 4F3FB 3ZDXF 2P24A 4LSSL 4U49A 4EDWL 3IDNB 5MP6L 4KRNA 4L9DA 4UINL 3QIUB 2J7LA 4PJDE 1M6OB 3QHZH 1HK6A 2HVJB 3S37X 3BPNC 4WV1B 4HJJH 4P4RB 3F7VA 5I1GL 2AJVL 2B5IC 4NFDA 4MQ7B 1N59B 2I26N 2ZG1A 2R0KL 4B7LA 3VG0L 4NKDA 3T04D 2OLDA 4S0SD 4X0KB 1ZWIA 3JTTB 2G75B 4LLQA 1UCBH 4CGTA 4ZD3H 3WJLC 2GSIB 5F3BB 2BSED 2H6PB 1YECL 4OZFB 5EC1B 1CLZH 4RISH 3QFJA 5D8JH 5H94A 1P7KB 5AAWA 1UVQA 2VLKA 1A8JH 4GRWH 5LAXB 2A9NH 3GKWH 4IMLA 1YDPB 4DQOL 5EIIA 3T65A 5DJXB 4LSDA 2Q8AL 3L7FB 2V2WA 2YUXA 1EVUA 3MNZA 4YC2C 2PYFB 3C2SA 3DTXA 1RURL 4G8GE 4AEIL 4HIEB 4V1DE 3BDXA 3C6LC 2W60B 1BWMA 4X6BB 4O4YH 4M1DL 2CPCA 5DTFB 1I9IL 3MJ9H 2J4WL 3EFFA 3PHOB 4FRWA 4D0BA 4FN0A 1A3RL 1HKLH 4J6RL 1QEWA 5C0EA 3D48R 1WIPA 4OLEA 5CD3A 1T03H 1I1YB 3VRLE 1WCBB 1SY6A 2APWA 4M6OL 4WWKD 2DQIH 3FZUD 3EYOB 1VACB 3IT8D 5DMYA 3ULSB 4KI5E 3HPLA 3LKQB 3SJVA 5HVGB 3UDWC 2OTWA 4PJDB 5D2NA 4RRPG 1M71B 1T0PB 3FRUB 4N8VA 2R4RL 4JM2C 2W0FB 1NDMB 3OHXA 4ODXA 5JW5A 3QQ9D 3S4SA 3EGSA 1CXLA 1RZJH 3DXAD 5FYKE 3L5WA 5KANI 2YWZA 2HA1A 4OLZH 3VXOB 1NANI 3THML 1HHHB 1DUZA 3K8KA 3ULUL 4ERSL 4JFXB 3DVNA 1RZGB 4PRID 3GSXB 5TF1H 4U33A 4PV9A 2R8SH 3RFZC 1A4JA 1A6UH 4NQSA 1S7QB 4WUKH 1RZKC 1Q0YL 3P11L 2YD6A 1L7TL 4WUUA 4POYA 2VABB 3PDGA 3QEHA 4ZDHB 3O2DH 4ZUWB 1IZJA 3FONA 4QRPD 4WFED 4E41A 1QFOA 4TVPE 5I1HL 2ZOLB 2JB5L 4JPWH 4TOYL 5C0AE 4RAUB 5GZOD 5GGSB 3VJ6B 4FFWC 3EJYD 1XIWA 3O6LL 4KZEH 5FHAH 3B9KD 3B5TA 2QSCL 1CIUA 4G8GB 4XCFH 4V1DB 1R24B 3TZVA 3IXAB 3V5KA 3O41A 4OF5A 4YXKH 2R23B 5H2BB 4G6JL 4XCCL 4GMTL 4C58B 3P9WB 1NL0L 2DLEA 4P23C 4J1UA 1RUQH 2YD3A 4ZOCA 4DFIA 4PTUB 2ADIB 4WU5B 3ZKSD 3O3BA 1OTUC 3NVQA 4N5ED 4Y19A 4LCIH 3HI6L 4O58H 3SDXA 4P49A 1CZ8H 4J3UA 4ZYKA 1QO3A 1A4KB 4JO4L 4M43L 3WFHB 5D1XD 5E0QA 4YGVA 1A7OL 3QCVH 4HFUL 4W6XB 3UX9B 2VYRE 3WJLA 3CZJA 3EOAA 3UZVB 3QRGL 1XCQA 3DRTA 3P4OA 1AXSB 4PGZA 4HXBL 4OGYL 1GVIA 5FECB 5MEOA 1CK0H 2FX7L 5K9JH 1ETZB 3LKOB 3IU3B 1XZ0B 2DQFA 3VWKD 3ECBB 3HUJB 3U36A 4JEGB 2O5XH 1JHKL 1IAII 3L3JB 1RAMA 3MRRA 1U93A 1D5ZA 3U4AA 3KNBA 1AKJB 5F1IA 2ZCLL 4FABL 3C6LA 4AQOA 2PN5A 4LSUL 5DUPL 5E9DD 3NMEA 4LCWD 1FH5L 1CFSB 3JSSA 4EXKA 2HKFL 5KOMC 5JIIA 4OB5H 4KV5F 3G9AB 5C6PB 4OCXL 4PBVC 4CDGC 1MIEL 3MRPB 3SHSA 1AR1D 4N1HB 4OKVA 4GG6A 1X5JA 1NFDE 2DWDB 2BJMH 5HHVH 3RUGF 4RFOL 3O6KH 5CCKL 3GBLA 2NZ9D 5KSAB 4S1SL 4J3TA 5KG9A 3UDWA 4PIRF 3QI9D 1BVLB 3OXSB 5IW6A 2IALB 4JM2A 3GMMA 4N8PA 4ZFOA 1QBLH 5E8DL 2EZ0C 1O0VA 5HI5D 4JZOA 4IDJL 5HYJB 4NOFA 3TBSB 3G5XA 4LVHB 3K2UH 4NRZB 2QHRH 2AEQH 1LEKA 4UIKH 4UT6L 5GRVL 5EBWA 3ARBC 5CWSB 3MLPA 1K8IA 3FN0H 1SYSA 3HMXL 15C8L 2Z91A 1NCCH 4OZHA 4JRYD 1RK0A 2C1OB 3I50H 2Z4QA 2ATKA 3Q3GA 3DUUA 4JO2L 1YPZA 1I3RB 4RAVA 4LLVA 1UZ8A 2F53D 1H0DA 4N90E 5K9KB 4QRUB 5BZDA 3EW3B 3ROLA 1RJLB 3LB6D 4MDIA 4M93C 4XXDB 5KSBF 3QHZL 3QFDB 4IJ3B 4F80A 3T0WA 4HJJL 3OAZK 1XCTA 4WI9A 3QDJD 3VXRD 1VEMA 3DGCR 5D7LA 2VL4A 2QR0B 2IQAA 5BO1H 4FXGA 4P23A 3FHQA 4G9DA 1MHCA 2XTLA 1EZVY 5E24E 2UYLB 1NFDB 3PGFH 1W0VB 1UCBL 3OWEA 2D7TH 4ZD3L 4EI5B 1PY9A 1T20A 5DK0B 5GRJH 1FZOA 3BRGC 1CLZL 4RISL 4HCRA 2LAGB 5D8JL 1XF4A 3D6GA 2M26A 5JHDE 1J10A 3TNNB 1YYMH 3LV3B 2A9NL 5SV3A 3GKWL 1NPUA 1W0WA 5B38G 5FKPB 2YKLH 2VDNH 5C0GB 1IAOA 2C3GA 3FFCE 4C57C 4GG8B 3OJDA 4U1JA 2O26U 1CGUA 1AQKH 1CFTA 4PJ9C 1BZ9B 3OB0H 3FQTA 4O4YL 1C7SA 2A9MH 1BZQK 3MJ9L 2BSSA 3T0EB 1HKLL 4ZXBA 2I07A 4LLDA 1RJZA 4TTDD 5GS2H 5J1TC 5E5MA 3RWDB 3U2SA 4WIQA 1QFWM 3RWHB 1T03L 2L7JA 2ADGB 3UJIH 1FAIH 2DQIL 3HB3C 1OM3H 3MTRA 5IB2A 1JPST 1D9KC 1HWHB 1T7YA 4YBLB 2VH5H 4D94A 4M6MH 3IETB 1RZJL 1Q94A 1S78C 4OLZL 3GEWB 4HC1L 4XNQA 3N1QC 1ZLVH 4WU7A 4CW1B 1S9WB 2RBLA 1U8PB 4LRNH 5TF1L 2R0LH 3KJ6H 2VE6B 2G60H 1ZANH 2R8SL 1NEUA 1W2KT 2VLRA 3DV4A 3EYFB 1A6UL 3GIZH 4WUKL 3RVWD 1ZHKA 5DJ0B 3SE8H 5BV7B 4PGCB 5E6IC 4FNLH 1XF2B 5ACZA 1OCWH 3ZHLA 3O2DL 1U3ZA 1CDYA 5JHDB 3BH8A 5AZ2H 4JPWL 5JW3H 4H25B 2NTFA 4UU9B 2I9LB 2AXFA 3ARBA 5TDOA 4FG6D 1N6UA 4KZEL 3TBVA 4OAWB 5FHAL 2YSSA 1XFPA 3K8LA 1NFIB 4Z7NE 2O61A 3IGAB 3CFJA 5ERWB 3Q5OA 4RFEA 4XCFL 2A6JB 1ZT1A 3TNMB 1AIFA 1WLHA 3BPOB 1I7UA 2BVYA 3QJHA 4YDVB 5I1DA 2CLRA 3BP4A 5MERA 2G9HB 4YXKL 1S7SB 5DJ8B 2M2DA 1ZGLA 2WK2A 12E8H 3A6CH 4KDWA 2V7NA 1MI5E 4KK5C 1UADC 1RUQL 4H5SA 2H2SD 1CN4A 4BA8A 3LPGA 1P5UA 5GIRB 1LNUA 3RNKA 5FIEA 1BZ7A 1NANH 3T0XA 4PRPE 1MCHA 2LABA 4LCIL 4O58L 1E4JA 3ZDXE 1CZ8L 1EBAA 3U9UB 3BZEB 3QCVL 3L9RA 1YZZA 2E7CA 2RGSA 3GSRB 2NXYD 3KYAA 4PJAE 1S7WB 2QADC 3O2VH 1A64A 3BE1H 2F54A 4MCZA 1J8HD 2DBJA 3IDYB 1CK0L 5K9JL 2APBA 1F3RB 2O5XL 5LKNA 1I8LC 4JO3H 5HHQB 1T5XA 2YRZA 2XG5A 3PWNA 5EBGA 2WWKO 2E6JA 3RGVD 2EC9U 4TNWK 5IVXF 3T08A 1LDSA 2D4DA 4OB5L 4LPTA 4JPIA 4GW4B 2YA2A 1CLYH 1J12A 1DANU 3WCYA 3MV9D 1SJXA 5IJVA 4NO5A 2VLLB 5EOQH 5BZWA 2BJML 5HHVL 3TM6A 3O6KL 4K9EC 4YHYB 4TSAH 4KK6C 5KSUA 4X83A 5I16A 3HAEH 3KLSA 1OSPH 1EFXB 1QBLL 4OCSH 4R7NA 2AV7A 1K8DB 4PRPB 4G9FE 2K7QA 3HC4H 2WMPA 5D7JB 3GI9H 5DQ9A 3WS3A 4NJAH 2CLZB 3K2UL 5FO9A 4MGXA 3GGWB 2QHRL 2AEQL 2VZVA 4A6YB 4GKSA 4KRLB 4YHMH 4PJCB 4UIKL 1R3LB 2GY5A 1G7LB 3K80A 1ZT7B 3ARFD 4BZ1H 4J12A 3JTSA 43CAB 2BRRH 2IG2H 3FN0L 3RU8H 1U3HC 2KH2B 4PJAB 5E6IA 2JCCE 1NCCL 1G9MH 1P7QA 1IAIH 3I50L 4LPUA 1VCAA 1KIPA 3BMWA 3C8KA 5D5ME 1FYTA 5AEAA 3LD8C 2Q6WB 4Q7DA 3V4VH 4PJBF 4X8JA 2VLME 1HWGB 2XZQH 1RD6A 1JRHI 2P5WD 4HD9A 2DQGH 5J6HA 3OAYK 1I4FB 5IFJB 2LU7A 4NO0D 1KACB 1EXUA 2H45A 1NCAH 4Z5RB 5BO1L 4JGUA 1A9EA 5E03A 2C9AA 4UDUB 4MJIE 3IDIA 5IBLC 4G80B 4XZUB 5E94B 3PGFL 4HWNA 2D7TL 2R2BA 1HOCA 1NH6A 4D0CB 5FV2A 2DL9A 5GRJL 4XWOD 1X9QA 5H37G 2P49B 3GRWH 4HKBA 1BEYH 4H0IA 1YYML 5DD1H 1NAMA 4G9FB 2XTJB 4NRYB 2V2XB 5ACMA 1ZMYA 3FO9A 2YKLL 3X17A 2VDNL 1LO3H 1P4LB 3BH9A 5TE7H 5CSBA 3HE7A 1T7XA 5DVMA 5DHYA 3ARYA 1HIMH 4XPHH 2A0LC 1AQKL 5BS0D 5FYJU 3L3OA 1D6VH 3AS1A 2JCCB 2DI8A 3RPIA 2A9ML 2W0KA 1BPVA 1LO4H 3WEXA 4NM4H 3TIDA 2IH1B 1L0QA 3V5HB 1V3JA 2VR4A 1S5HB 4M1CC 1I8LA 5D5MB 2P24B 2PO6C 4NQVA 3UJIL 1FAIL 2IWGA 1OM3L 3RVUD 3RVVD 1I9EA 3VFWA 5IKCA 5SWZE 2VH5L 4I9WE 3F7VB 1LMKA 4M6ML 3HC3H 4PLOB 5FF6A 1ZS8B 5M95B 4PPTA 4NZJA 5IHZB 3F58H 2FYYA 4MQSB 4NKDB 5HVFB 3GB7A 3HE6B 1BOGA 4QF1B 4IIQC 5BVPH 1LO2H 4LRNL 2R0LL 3KJ6L 4KY1H 4MJIB 2G60L 1ZANL 1ZWIB 3PJSA 1KULA 1NC2D 3T0BA 3GIZL 1Z3GH 3SE8L 2D0HA 4BELD 3ARZA 4FNLL 4P4KC 4WUUE 1NBZA 1DEEB 1OCWL 5I74B 4E41E 5H94B 4XPGH 5CEXA 1UVQB 4DVBA 5HI4C 1HCFX 2DIJA 2FZ3A 5AZ2L 4JRWA 1TPXC 2LE9A 5JW3L 2IANA 3RWCA 1A0QH 4IMKC 5EIIB 1DN0B 2HJLA 3T65B 1JL8A 1U3HA 4IRZH 5JUEH 1KIRB 1VKXA 1XGPA 5E99H 1KTDA 4MJ6B 3C5JA 1FVEA 5T1KD 1MCNA 4YHIA 1YEEH 4D0BB 1GHFH 4YR6B 3UAJC 12E8L 5C0EB 1N2RB 3LN9A 3ULUF 2YPKA 5D2LA 3BPLC 3UBXI 2K1MA 3X12A 3SJVB 1KEGH 2A6KA 1G6RB 2QL1A 2VLJA 5IROC 5C1MB 4ODXB 3QIUD 3VH8A 3QQ3B 3S7GA 5SWZB 3PGCB 5D9SA 2R1YA 3OG4B 2X2YA 4YGAB 4Z7UA 4NHUA 1XF3B 1G9NC 1XGYH 3D2UA 1OQOA 3KLAA 1B88A 3MLTA 5JPMB 3MMEA 3VXUA 3LKPA 4Z76A 1QSEA 4PV9B 5J06A 2DICA 1I8IA 1A4JB 5DEZA 3O2VL 4HPYH 2MQCA 3BE1L 4JDTH 4Z7OE 2B4CC 4WUUB 2D3VA 4PBXA 3RL1A 1MJUH 3REVA 5ID0A 1S7UA 3QEHB 5ITFB 3FT2A 3FFDB 4E41B 5CP7B 4LGRB 1OD7A 4MVBC 5C2UB 5HVWA 4JO3L 4OZIE 1WWBX 3CFEA 3NIFE 2AJUH 5E6ZA 3WXVH 1MCWW 2BRQA 1FNEA 1CG9A 5ENWA 2EDFA 1BBDH 1KCSH 1CDJA 1MCJA 3V5KB 1CLYL 4HIHB 1U58A 2CIKB 2PO6A 3RBSA 5EOQL 1I7TA 3VXQA 4TSAL 4J1UB 1U8LB 2YZ1A 4M48H 5A2KH 4Q0XH 3HZKA 1OSPL 4LSTH 3O3BB 3ZT7A 3JWNC 3BPNB 4S1RH 3NH7H 4OCSL 1QTYT 4UI2A 3OF6A 3HC4L 1AHWC 3GI9L 5B38B 4NJAL 5F1KC 4BH7B 4IIQA 2XYCA 3MO1B 4YHML 2Q76A 3O3AA 2Y25A 4BZ1L 2BRRL 2IG2L 5HYFA 3RU8L 3EOAB 1IILE 4P4KA 2VZ3A 3SPVA 5HHME 3GSQA 3O6MH 3G5YA 4YO0A 1KEMH 3MUGA 1G9ML 1IAIL 4JHZA 4YWGH 4KJYA 2N7AA 1ZA3A 4DGVH 2DQFB 4WFHE 1KPRA 4IMKA 5MEQA 4K7PH 3U36B 3V4VL 5J89A 1R6VA 1D5ZB 4YC2B 2AJZB 2WUBH 2XZQL 3KNBB 5F1IB 1WUNT 4OZIB 1VGKA 2BXZA 1X7QA 3C6LB 1NGPH 3FRPG 3KS0H 3BP7B 1WAAE 1MVUA 2DQGL 3LOWA 1FNGB 3PWPA 4PGBB 5C92A 4OGZA 4OLWH 3QDAA 2XV6B 3ZT6A 1NGYB 3C60A 4OCRH 1NCAL 3OMZA 4UTAH 5FO8A 4G8GD 4TRPH 4V1DD 4CVXA 4GG6B 5F7EH 1T83C 5T5FH 2NY4B 5B4MC 3IF1A 1DBMH 1RI8A 1CQKA 2AK4E 5HHPA 5IROA 3VG9C 4JM2B 3GMMB 4ZFOB 4LPXA 1VA9A 3GRWL 4JZOB 2V7HA 1BEYL 4NQEE 2FH6A 1U3JA 3FB5A 3BZFA 3O4OC 5DD1L 2Y6SC 3VH8G 2E8YA 2F74B 3RTQC 1LO3L 3SN6N 3TPUB 5EUOF 5TE7L 1XGRA 5EBWB 2DLFH 4Z7WA 2ZUSA 1HIML 3O3DB 2MHAA 4XPHL 5FYKD 3SE3C 3OKOB 3C8HA 2RIKA 3QWQB 1D6VL 3RVTD 1EHXA 2Z91B 5B8CC 5JOPE 1JPTH 5HHMB 5GISH 4YJZL 1XAUA 1RK0B 1T1YA 1LO4L 3IDGA 3BKCH 1IM3B 4NM4L 5JDSB 3TJHC 4LNRA 4D2NA 2W9LA 3RWIA 3Q3GB 3DUUB 3MRFA 1JRHH 5E1HB 4OI9A 1QFWI 3P0YH 1UZ8B 1X4XA 2HTKC 1H0DB 2NNAB 5C08A 3ROLB 5C8JB 5HHOA 4UQ2B 3VW3H 5CJ8A 4TVPD 5B3JE 5BQ7A 1KXQE 5FYJE 1XCTB 3HC3L 1AKJD 3KWWA 4HDIB 5C0FA 4XVUD 3LSOA 1A1NB 5CBEA 4F57H 1MFDH 3NIDF 1LE5A 2VXVH 3F58L 4FXGB 5E2TH 3PHQA 5BVPL 4Y1AE 1LO2L 4KY1L 1IQDA 3FCTA 1ZVSA 1CT8B 2IPTH 2VLRE 4OFYD 1RJYB 2DIAA 1Z3GL 1T20B 5KN5A 1TNNA 1N0XH 1FZOB 4HK3N 4EI6A 5SX4H 4LQFH 2AK4B 5KSAD 1JWSB 1YEFH 2BNQD 4XPGL 4NQEB 3RIAF 4DWHA 5DJ6B 4XNXH 3DX6B 4JDZB 3B9EA 4S0TD 3IFOA 5IFHH 5HYJD 5HYQB 5I1JH 1OAQH 1A0QL 1F11B 4S1DD 4CU7A 2JJWA 3V6FA 5JUEL 3G08A 4L3CA 5E8EB 1CF8H 4U1JB 5E99L 2YBRA 4XXCC 4U3CA 3FQTB 1KBGH 1I8KB 4MZ3A 1YEEL 1YEKH 4HUNB 5T5NG 1GHFL 3SCMC 1FL3A 1J05B 4LLDB 4OGXH 1RJZB 3B5GA 4P9HC 4WO4C 3U2SB 4GKZA 3QP3A 1SBBA 2P5EE 5E4EC 3QH3A 4ORZC 3V4PH 1G0YR 5IB2B 2CMRH 4HGKC 4ZG1A 4D0DB 5T33H 1KEGL 5DD3H 4O02H 5JW4M 5C86A 1ZE3C 2F8VA 1PYWA 3JV4A 1KTLA 1Q94B 5E8OB 3KLDA 3FB7B 2EYTA 1XGYL 2H32A 1Z9LA 4HEME 4XNQB 1ZKAA 4LARH 1YMMA 4WU7B 3AS0A 4RFNB 5D96C 5D93B 4XNYH 5IWLC 2VLRB 3DV4B 3AC0A 4HPYL 5IVZB 2F54E 5DC0A 4JDTL 4EI5D 5J12B 2Y5EA 4YDJA 3V8OA 1CI5A 3KPSA 3RTQA 3PWJB 4DVRL 3BH8B 3GJFK 1VDGA 2NTFB 1KCVH 4JFPB 4O2FA 2X9XA 3SE3A 3ARBB 2AXFB 1A2YA 3LHPH 4N0UA 5CJXC 5C70A 2AJUL 3BWAA 2AXGB 3WXVL 3ZTJG 3N1MC 4P5KB 1CFNA 4HHAA 5J8OA 1BBDL 1CLCA 1BVKA 1KCSL 3RZWA 4Y16C 1I9RH 1I7UB 3U82B 1C12B 5I1DB 4ONHA 5AUMA 5BW7A 5E08H 4PG9A 4G7YH 1ULVA 1IKNC 3ARGC 2V7NB 5CINH 3T0ED 2E5EA 3BX7C 1M7DA 4M48L 4M93B 4Q0XL 2P5EB 4LSTL 4S1RL 1MH5A 1XGUA 1CDBA 1LE9A 3NH7L 1SMOA 3NIGF 2YMXH 4N90D 2H9GA 1U8OB 2HYMA 3MRDA 3C9NA 2WBJA 1MHEB 5IR1A 1QRNE 1LWRA 2DD8H 3ETBF 3OQ3B 3L9RB 3KS0J 4JM4H 2VWEC 4WI8A 2FL5A 3K74B 2MFNA 1KB5A 3AS2A 2D9QB 2X1PA 3O6ML 2DQUH 2IH3A 2DKUA 1KEML 1FFNB 1IKFH 2E9BA 3I02B 5IHUH 3SE9H 1WIOA 2F54B 4MCZB 4Z7VF 4YWGL 4D8PB 2IBZY 3FOMB 5I8CA 3C5ZC 3IB4A 3VFGH 4BSJA 2UVEA 5DK3A 1HZHH 1ZHBA 4DGVL 1N26A 5K9OA 1T7ZA 3D39A 4K7PL 3OJMB 3PWVA 3ZE1E 2WUBL 1KJ3H 5JHDD 1T5XB 5CIPB 1NGPL 3PWNB 4GAGH 4QWWC 4PJ9B 3DX8B 4YHPB 1HKFA 2NY6C 5KVDH 1I9JH 3EO0A 2JKXA 2DYPA 4RDQF 1F6LL 3MRJA 3SCMA 4OLWL 4OCRL 4JPIB 3QRFM 4UTAL 1IQWH 4WO4A 1Q9KA 1DBJH 4FTVA 4TRPL 2Z8VC 1AGCA 5F7EL 5BZWB 3UYOD 1AP2B 5T5FL 3U83A 5CJ5A 4C83B 1YUHA 5KSUB 4QEGA 1D9KB 4XP5H 5SWQB 2FIKA 1K2DA 1DBML 4HFWA 4WI7A 4HF5H 1S9VB 5EZIH 1I1FA 5EIQA 3WUWA 3I6LE 4L8BB 4P5MA 5DQ9B 1BX2A 4LCYA 5EDXA 3WS3B 2GTWB 1DTUA 1ZLWK 2RHEA 2B0SH 4UV4H 2ZOKB 1QRNB 2DLFL 4Y2OA 4XH2A 4NZUH 5IWLA 3JTSB 4JJ5A 3MV8E 2P4AB 4BUHA 1FAKT 1HNGA 5E6IB 2O5ZH 3L3DA 3L7EA 5CSGA 1JPTL 5GISL 1EGJH 2YXMA 1OTTC 1YQ2A 4AH2A 3BKCL 4HKXA 4N0FB 2F5BH 4EN3A 4JFQB 1TIUA 3C8KB 1HNFA 1I3VA 1JRHL 2DMBA 3ULVL 3D69A 3P0YL 3EDFA 4O00A 5CJXA 4KQ4H 5EZLB 1BM3H 1I1RA 1H8NA 1QYGH 2XOTA 1KLUB 3VW3L 5EU6E 4G6AD 1F4HA 1F4WH 3V6BR 3BP6B 4G8IA 3HLAB 4F57L 1MFDL 1T6VN 2HFFA 2VXVL 4C4KO 2JJVA 2R1WA 1IKNA 3ARGA 1OD9A 4I8DA 4GUPB 5DEFA 3I75B 5E2TL 5IB5B 2OSLB 3NGBC 1F3JA 4JFOB 2YC1B 3UPCA 1L9MA 2IPTL 4PRNA 5EIVA 2W1NA 2R2BB 3P2TA 1U92B 1N0XL 1A1OB 4O5LH 3QIWA 5F1SA 3SO5A 5GGQH 4LQFL 5L8KB 3VXNA 3UPRA 1YEFL 2PCPB 2WUCH 4HKBB 1CFVH 2X1XR 5DRWB 1K3ZA 4XNXL 2UZYB 1EFXD 5IFHL 4PRPD 5I1JL 1OAQL 4XBGA 3BH9B 5L2KA 5D7JD 5CSZB 1A14H 4WNQA 4OT1H 4OZGE 5DHYB 1CF8L 2QADB 4YDKH 5CLWA 4PYHA 1I7RB 3MV8B 5M94B 1CBVH 3L3OB 1BFVH 5JZ7D 2P43B 4KJQC 1QFWH 4LP5A 3RPIB 1OPGH 2F8XC 1KBGL 1YEKL 4ZFZA 1ORSA 4WTZA 2JB6B 1BHGA 4OGXL 3O4LA 4K8RH 5H35B 1NGZA 5AG9A 1FNHA 5ADPH 4XTRC 1QQDA 5D2LE 3V4PL 3IKKA 1JZ6A 1NBYA 3N9GH 2CMRL 4NQXA 3TEUA 3AUVA 1IGFH 5T33L 2VUOA 5EU6B 2VLJE 1D5MA 5DD3L 4O02L 5IKCB 5D6DC 4KRPC 3STZA 2QQKH 4GRLC 2X4UB 3N1PC 1ZV5A 4EEEA 4Z7UE 1GCFA 2QLVB 2AXJA 4F15C 4F37F 4LARL 4LDLB 1MELA 4NM8H 4X5LA 3DX7B 3GB7B 4NN6C 1P4BH 4XBEH 5DJYA 3U7AA 3OKDA 2EKJA 3O2WH 4X7EC 1X5LA 2J8UE 4XNYL 3P30H 2GJZB 5DLMH 4KXZI 1ED3B 1BQHA 3QNZA 5TF0A 5DHVB 4NWUH 4J2XA 3DUSA 3OX8A 5INCB 4MNQA 5F8RC 2GW5A 3H3PH 3W0WA 4UIMB 1T0NA 1MJJB 1KJ2H 5HDOA 4MWFB 2IANB 2VMFA 1KCVL 2HJFA 3BESR 3D85A 3LHPL 1G7JA 4G9FD 4NC1E 2HJLB 1K6QH 1U3HB 2XTJD 1S8DA 2BNRA 3K3QA 1GGBH 1XGPB 4OZGB 1GC1H 2GCYA 3SDXF 3L6FA 3L5XH 4W70A 3C5JB 2A73A 3WFDH 1I9RL 2EH8H 5E08L 4N5EC 4M3KB 1EH9A 4U1LA 2BK8A 2HN7B 4G7YL 3LD8B 4L9LC 2EEAA 4XCYA 4FZ8H 5CINL 3CLFH 1AJ7H 3IAPA 5CD5D 1BBJA 1Q9WB 4U1KA 1J0KA 5F71A 2YPKB 5GQBA 2CIIA 5I71B 4U1IA 5D2LB 5SWSA 4OGAC 4IOFD 4MHHG 1A6AA 2YN5A 4BQ8A 3DV6B 1AY1H 1NGWB 2YMXL 3JVGC 2A6KB 1XGQB 2VLJB 5ICYA 4DAGH 4KKLD 3CFKA 2AI0H 3VH8B 2JTDA 4X7DC 5D9SB 3T3ME 4Z7UB 1FFOA 4E0RB 2DD8L 2DMCA 4HUXB 4JM4L 3KLAB 3OV6A 3VXUB 4ZNCD 5JPNA 1QSEB 3HE6D 3LEYH 1I8IB 3NIDE 2DQUL 4GRWE 1PFCA 2J8UB 5IHUL 1IKFL 4BFIB 1TVBA 3SE9L 4MJID 4B41A 4GW1B 5K59E 3O9WC 3VFGL 1OF2A 4LHUA 3LDBC 3RL1B 5ESQA 5EU5A 5ID0B 1HZHL 5BOPA 3FT2B 2VAJA 3RBGA 1FPTL 4R4BA 4M00A 4CN1A 3MX0A 4GT7A 1UH4A 2Z93B 2VQUA 35C8H 3OBAA 2I9TA 2VZ1A 5DRNA 1X4YA 2XN9A 1KJ3L 3CFEB 3I3EA 2QEJA 4GAGL 1KG0A 3K1KC 4WWKA 5KVDL 3MUZ1 1I9JL 1R5VA 3G5ZB 2OTUB 3BN9C 1CG9B 1UZ6F 1WC7A 3OKEA 2AKRA 2ZPKH 1IQWL 3B9AA 2YPLA 3IU4H 3N0PB 1U58B 4Z0BH 1DBJL 2NY3B 1LEGB 4WTZG 1EIBA 4XP5L 2J6EA 4YH6A 4PRIA 2NW2A 3IS0X 3S35X 3HZKB 2BX5A 4PP2A 1FIEA 4HF5L 5LVEA 4LF3B 5EZIL 4OZHF 2ZSVA 3OKKA 4FQCH 4KK8C 1JYWA 1NCBH 3HRPA 4PJ8C 1F3DH 4W4OC 1DSFH 1KNOA 3HCVA 2A83B 5CHNA 2NY1C 3SJVD 4X4YA 1YPZF 2HT3C 3L95A 4IIQB 3UTSA 2B0SL 4UV4L 2Q76B 3RDTB 4QRPA 5SWZD 4I9WD 4KJPD 1A3LH 1OP3H 3SGEI 3EJJX 2OCFD 4NZUL 4X6DA 1HYSD 3KPPA 3HAEG 4NJ9H 3JV6B 4ONGH 3TCXA 1UG9A 3FQXB 2O5ZL 1SEBA 3L3GA 5DZNA 3GSQB 4YO0B 1EGJL 3MUGB 1BQHG 4EJ1C 2F5BL 4MD4A 3MUJA 1A1MB 1A02N 4Q6YA 2XI9A 5C0CE 1KPRB 4WUUD 5MEQB 2CXGA 3S3JA 3MYZA 4KQ4L 1BM3L 1VFAB 1QYGL 4E41D 2F19H 1Y6KR 3BDBA 1TENA 1IAMA 1AGDB 1F4WL 1KPVA 1RIUH 5EULV 1A7PH 1RJCA 2PYEA 4ELMA 2R1XA 4L9LA 4KUCF 3UEZA 4ODWA 5FO8B 1ERNA 1G7HA 4L8SB 1LP9A 4WY7H 4BM7A 2DWEB 3H9YA 3BPLB 2V5YA 3HNSH 5A2LH 3GMOB 3IF1B 3L3HA 4H0HB 1S7TA 5LGJA 1JVKA 2Q3AA 4O5LL 5HHPB 2V6HA 5GGQL 3OR7A 4MA1C 3AVEA 2FHCA 2DQCH 3C09C 4S11A 2WUCL 3HG1A 5F1NA 2V7HB 1CFVL 4OI7A 3U0PA 5EU7C 5F88A 3MGTB 5C0JB 4F7CB 3VD4A 1XGRB 1A14L 3IDXH 4OT1L 2HG5A 3MRCA 2MHAB 4HS3A 4YDKL 1CBVL 1Y18A 3GNMH 1BFVL 3IFLH 4FHBD 5FDWA 3NZ8A 1QFWL 1JNNH 3VFNA 1OPGL 4P46C 3P9LA 1T1YB 5E9DA 5GGUB 4LCWA 4YIQB 3ULVC 4K8RL 3VE0B 1WZKA 2APVA 4DUXA 5ADPL 3CZFA 5C0CB 3MUHL 2EYRA 5FA3B 1H3PH 3N9GL 4X4XB 4ELKB 4HGWB 1IGFL 3TO2A 4QXTA 5ICXA 1YJDH 2VZSA 3K1DA 2QQKL 3KWWB 5CGYC 4LU5H 5C0FB 3C6LD 4P2RA 5ELIA 3LSOB 5CBEB 5IF0B 2DTMH 2FJFB 2VKWA 4J3OC 3FQNB 4NM8L 1PG7X 1R3KB 1ZK9A 1P4BL 4XBEL 1I1AC 3O2WL 3PGDA 3FO1B 3P30L 3QWOA 5DLML 4CJ0A 4XAWH 2NY4D 4PJ8A 4W4OA 1TCRB 4NWUL 4U6YB 4URTB 3K7UA 1JPSH 5HDQH 1CGYA 1AHWB 4TPRH 3H3PL 4JRYA 2CD0A 4FZEH 4JM2D 1ZGLP 1KJ2L 3P77B 2EKSB 3IFOB 4HWZA 1OAUH 3K81A 2HLFD 3CDGA 1K6QL 3GSWA 1MFCH 3TJEH 3V6FB 3G08B 4L3CB 1GGBL 3WDJA 3WD5H 1GC1L 4HLJA 1GGYA 3L5XL 1C1EH 4BQ9A 3EOTH 4J3XA 2V2TA 4D9QE 3WFDL 2EH8L 4FMFA 3VXRA 3CVHA 5HHMD 5F6IC 1JI1A 3QXAA 3UP1A 2LAAA 4FZ8L 1AJ7L 3CLFL 4O51B 4CMMA 1O5DT 3TIEB 3DO3A 3VDCA 3QH3B 4QCIA 5D6CB 2IBGA 3EIFA 3LQAC 1AY1L 4WFHD 5DFVC 2Y7QA 2NXYC 3FOLA 2NZIA 4FFWD 1QACA 4DAGL 5F7DA 2AI0L 2JK5A 3JV4B 3LPFA 1DP0A 4F9PC 5J9PA 5DUBB 2H32B 2W65B 4KXZH 1U6AH 1JFQH 5FCSH 1NUGA 3GSUB 4ZUVB 4MX7A 5FGSA 1SVZA 3LEYL 2X9WA 4P3CH 4NNYA 3I6KB 3IJHA 4M8QA 3O4OB 1OTUD 1EAJA 1UJTA 2CRYA 1J1PH 3MV01 2ZUWA 3MRMA 1RMFH 2AK4D 3KPSB 1QFUH 5ADOH 35C8L 4KFZC 4JZNB 4NQED 4LGSB 5F6HI 1CFBA 1A2YB 3ZDYE 3RHWK 4KTDH 1PKQE 2IFFH 1F3DJ 3BWAB 2G5BB 4R97C 2JIXA 5B8CB 1CFNB 5DD0H 1OAZH 4HHAB 1JTTA 1W72H 4OQTA 2ZUYA 1BVKB 3GSVB 3ESVF 4ISVA 2ZPKL 4Z0BL 2XZAH 3IU4L 3QEQE 4PY8I 1YMHA 1B90A 4X99A 5DJZB 1CD8A 4G6MH 3OKMB 4F7PA 2NX5E 2Y06H 3WLWC 3BVNB 5KW9L 3WFCH 3EUUA 1MH5B 1XGUB 2BC4A 1LE9B 3M17A 4RMRA 4FQCL 1FGVH 1YEGH 1GH7A 1KCLA 1NCBL 2GAZA 2H9GB 1DSFL 4XBPA 3C5SA 1M05B 5IT2L 1GGUA 2ESVA 3MRDB 3QIBC 1P2CA 3C9NB 3TBWB 5I0DA 1I1AA 3PG2A 1O7VA 3EOBB 1A3LL 3P4MB 3VFVA 2R0WH 4NJ9L 4ONGL 4CU6A 1INQB 1T2QH 5D7KE 3FAXA 3PP3H 2LV4A 1XF5A 2WQRA 1VFBB 3QG6B 2IH3B 1HHJB 4AEEA 1R3HA 2NXZC 1T22B 1OSZA 5IB3A 3V79C 4OIAA 5I8CB 4YDIH 2VLRD 3DARA 2EZ0D 4K7FA 5IOPA 2ICWI 3ALWA 4CKVX 2PW2B 1B0WA 1IFHH 3PWVB 2F19L 3DVIA 1JHTB 1RIUL 1PKQB 4MA3A 3ARBD 3LKSA 1A7PL 2DYPB 3VI4F 2CUMA 3SCMB 4L4VA 3UYPA 1CTNA 4JFHE 1C08B 3GIVA 4LAJH 4FTVB 1IGYA 3QEQB 1AGCB 4WY7L 1WBZB 4PJEE 3V0VA 5E4EB 1GXEA 3HNSL 4DEPC 1OAXH 2GT9B 3S98A 4KDTC 3BXNB 1M7IA 1K2DB 2C3HA 4HFWB 2NX5B 1ADQH 5DMKA 3CH1B 2DQCL 3PF2A 1I1FB 3BPCB 2P5ED 4NQUA 1JNHB 4F9PA 3SGEH 2W9DH 3BN3B 4GMSH 1JI2A 2VWEE 3GFUA 5D72H 1BX2B 1QSFA 3K0WA 1ZLSH 5D96B 8CGTA 1IGMH 4F2MA 4NKMA 2K7PA