4PJDE

Structure of human mr1-5-op-ru in complex with human mait c-c10 tcr
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
197
structure length
188
Chain Sequence
b'QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVVDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNDFACANAFNNSIIPEDTFFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
molecule tags Immune system
source organism Homo sapiens
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
total genus 37
structure length 188
sequence length 197
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjdE02
3VFVB 5GSVA 4EI5A 5IKCB 1BD2E 4U3CA 4OZHF 5IVXB 2H2SD 2ADJB 3DMMA 1S7UA 4PRAA 1VSCA 1RQ5A 1QFUH 3WJJC 2G2RA 3NFPA 3SGJC 4WFED 3AY4A 3EFFA 2NX5E 2BNUB 4M61A 1KIPB 3PV6A 4OGXL 4XI5C 4Y2DD 4A6YH 4NHUB 4BQ9A 2Y5TA 3SO3B 4YHPA 3ARFC 2QSCL 2Y9RT 1A02N 5DD3L 4MS8D 2QSQA 43CAA 4BYHA 2EDFA 3GMNB 3ZT7A 4L8CA 2YUVA 1TJGL 4NGHH 3DRQB 5F89A 3E6HB 4JG1L 4K07A 1IBGL 5D70H 3MRJB 1N0XL 4LSPH 3KAAA 3RNQB 2X4SB 1JGEA 1OD7A 4YHIA 2YPVL 2AEQL 2J8UB 5DJ0B 1NCDL 6CGTA 1KJ2L 3FFDA 1XGYL 5EN2B 2VH5L 3WYRA 1NCWL 4Q9RL 2C3HA 4O9HH 3OKKB 5ID1A 4U1SB 1F3DH 4NOBA 1TZGL 5JHLH 2DM3A 2JJTA 4NNPH 4F7MA 4NCC2 5C07B 3CSPA 3KWWA 1DCLA 4OCSH 1PBYA 4QRUB 4DUVA 5BRZE 3TVMC 4W6YB 3U4BH 4G6KL 5E08L 4YBHA 1JIBA 5SWQB 1T89C 5D93C 5TJWK 3MLXL 4ODWB 2YK1L 5H37G 3T1FA 1M4KA 5CZXD 1U41A 2V7NA 2OR7A 5FUOH 5AWNL 1AGEA 3MCLL 2YS4A 1A6VH 2DQFA 4GG6A 1ORSB 1MJUH 5DD6A 1JWMA 4JQVA 2VXVH 4FFYH 3GGWB 4JFOB 2VAJA 5ACZA 3HMXL 4HUKB 4EUPA 3BYTA 3QFDA 2XY1A 4YLQT 2EDNA 3GEWB 5SWZD 5D1QC 3VU2A 4D94A 2K7PA 3VG0H 3QQ4B 2DM4A 1TTUA 3C8DA 4QTIL 4EOWH 5DZLA 2BVOA 4R3SB 2DLHA 4YHLH 4L5FH 3KXFD 5IM7B 2DWDB 4JGUA 5JHDB 4FMKA 4HK0A 5JHDE 1SEBB 3RWJB 3PHQB 2ZKHH 3QNYB 1RK0B 5HSFA 1OGTB 2NLJB 3Q3GA 1NAKH 1VFBB 2PYFB 3U48A 1O7SA 2A1WL 3QIUB 3TN0B 5I1LA 4MAUH 2JJWA 3OJDA 4NQXA 1F45A 4KDVA 2EDLA 4JPIA 3PWJB 1T21A 3K1KC 3PV6B 2EDTA 2QR0A 3UBXA 1S9KC 2Y5TB 1WAAE 5K93A 5GRJL 2ED7A 4PP1D 4HQQL 4NUGH 3V0VA 1HYSC 4MQ7A 4CMMB 3I9GH 1JNNL 1H5BA 4P23B 3U1SH 3OB0K 2ESVB 3MRJA 2FR4A 3BJ91 3GBMH 5E99L 4JFEB 1GGUA 2PXYA 5BS0B 3QG6B 1G0DA 3DX7A 4XPAL 3RU8H 4RMVA 3OKDB 3UTSE 3SKJL 1TPXB 3LRSA 2VITB 4L1DA 5FKPA 1C08A 4DZBB 1ES0A 2Z91B 4YWGH 5J1SC 2Q6WB 5JNYB 1JPFA 2DBLL 3WNOA 1T4KA 3ARDD 1LWRA 5KVGL 2D7QA 4PJ7B 2VO5A 3LKPA 2P49B 3SDDA 1HHGB 3IS1X 1NC2A 2PKDA 2BOBB 1UWXK 5LGKA 3PQYD 5IMLB 4AY0A 1DQQA 2L7JA 4JZJB 4O4YH 1I1YA 1QNZH 4J3WA 3KYAA 3RGHA 4M93B 2LV4A 1I85A 4GG6F 2IEPA 4GKSA 3GJFH 3TNMB 3TBYA 1S7TB 4BZ1L 4E5XB 1KNOB 3QIBC 4FZEL 5HPMB 3C9NA 3NPSC 2VLME 1PKOA 1P4IH 2OQJA 4XZUA 4POZD 1A9BB 5C0FA 5C0BA 3WL9B 3ARBA 3HZYB 4OCWH 3G5XA 1OVZA 2VDPL 1EJOH 3T77A 2NZ9C 1VFAB 2EZ0D 3V7AG 4G80B 2AKRB 3G5VB 3RGVD 4XNXH 3VXTA 4PRPA 5EOQH 2AJUL 2GTZB 1IEAA 4F7EB 4OGAD 2BVOB 4R3SA 4Z77B 1R5WA 5EU7C 3CVIL 1IRAY 1HXMA 4PJBB 1C5BL 2AQ2A 2COQA 4WW2A 1IGTA 1RUKH 2ZUXA 3CD4A 1UM4H 2C3WA 3T3ME 2UYLB 5IESH 2FB4L 2DQJL 2BNQD 2F5BH 3MRIA 3O6KH 4HUVB 3L5XH 5FYLE 5F1SA 5M95B 1KF9B 4JKMA 1UA6L 3QO1B 3PWNB 2BSTB 1YEIH 4O9HL 3K4ZA 1KCUL 1J0YA 4WUUA 2H6PA 2FL5A 4RIRA 1FHGA 5B38B 4R2GB 1NCBL 2AVGA 4CGTA 2JJVA 2NY2C 3IXAB 4X6CF 3UROR 2J4WH 4WEBH 2Y6SD 1LP9A 3U9PL 3L3IB 1N59B 4LDOB 5CJQH 2FJFA 2XQYG 1QEWA 2X5PA 3SDAD 1QLFA 1OF2A 3MNVA 3CMOH 1T7VA 3EDEA 3UJTH 4KTYA 4UOW1 2G60L 1RFDH 1FNEA 4XPTL 4LDEB 4TNWF 5BS0A 4D0BB 4PJBF 8CGTA 2DJSA 5DVOA 3N1MC 1Q38A 1VEPA 2R4RL 4OGYH 4JFXB 2EDHA 5C07E 4QRRD 4NNXB 3QDGE 2VLRD 1MCRA 1YQVL 2Q7NA 4JPKL 4ZD3L 5HYQB 1T5WB 4UV7H 1G7LA 3BPLB 1FDLL 4HV8B 4GRMB 4Q9RH 1NKRA 5FM5M 1J8HE 1NEZG 1WWBX 5IG7B 4YHZH 1RZKL 5DUPH 3GIZH 2P5EE 4CBPA 1WGOA 2AJYL 4R26H 5E5MA 3VFSB 3MXVH 4ZUWB 3TEUA 4PG2A 5E9DA 1ROWA 2X4TB 4UT7L 3C60D 1BFTA 2KZ1B 4OFDA 2ZSVA 1UJ3A 1MCDA 2YK1H 4HAFA 5DRWB 2W0KA 5FO9A 4EVNB 3QUKB 2NW2A 3PHSA 4KTDL 4TTDC 4AENB 2GJZB 5KZCD 1OLLA 1TCRB 4G9FE 3BKJL 2QKIB 3IDNB 4H88L 1BFVH 1F6AB 3RDTC 5J11B 3MCKB 4NKOA 5AWNH 3I6KA 4FQLH 4FQCH 4ZAKA 5B22A 1JGLL 3DSFH 5T5FL 3PNWB 4AJ0A 4JHWL 2VZTA 3RY6C 4EKXA 4P4KA 4WI3A 5JW4M 1HCVA 2EXWD 4LRIC 4PJIF 4U1JB 4NN5B 3H42H 1HH6B 3VH8B 4KAQH 4MVBC 3S37H 1X4YA 5DJ6B 1TMCB 3RTQC 4NQCA 4YXLL 4U1KB 3BT2L 4ODTH 1Z2KA 2IH1A 3L1OH 4X98B 1IGCL 4KVCL 5DEFB 1BF8A 1Z6JT 3BPOB 1RUML 4WGWB 1QHPA 3ULUH 4V1DD 3QXDB 1IEBB 3NACL 3TZVC 1L0YA 2HN7A 2V7HB 3E3QC 4FQQA 1BECA 4JFHE 3ILPB 4WFGD 1Q9KA 2NPLX 2XTJC 2W1NA 3OAZH 2Q7YB 3SKMA 3U7WH 3IETB 2EIZA 1LD9B 3DHJA 1FAKT 5DHXB 4ZOAA 4MXWH 2R0WL 5BQ7A 1UC6A 4YE4L 32C2B 3LZFH 3CAFA 1U8LB 1IGML 2FJFB 4F37K 3T08A 1ZS8B 1WIPA 3V2AR 4FOMA 1DJSA 4GQ9L 1BQLL 3CH1A 5DR5H 1OAKL 4I4WB 5J0BA 3WNPA 1BWWA 4NQDE 1QKZL 1NDGA 2Z31C 1IGIH 3H9ZA 4DEPB 5J1AA 5IJVB 1B0RA 1P6FA 5BVPL 3SO5A 4PJEB 5TPWL 1TTFA 4QRQB 3GDBA 4KTEL 4UU9B 3C6LD 3UTZA 4HDIB 3F6LA 1I9EA 2XKNB 4TTGA 3GMOB 4U6HB 4PJ5A 4Y4FD 4Y4FB 5I18L 4JR9H 12E8L 4WUUD 4KK9D 5D5ME 1SM3L 2YRZA 3NTCH 4WY7H 4O58H 4NQTA 4FFWD 2VDOH 2UUDK 4MLIA 1M71A 4PB9L 1FYHB 4PRBA 1QBMH 3AFLA 4LSUL 3IAQA 1H3PH 1MH5B 3EZ8A 4MA3B 3WN5B 3SQOL 4X6BA 2NZ9D 2PYEA 4WTXA 1R24A 5ICZB 5DSCB 3S37L 3V8CA 4I2XE 3IDNA 3QEUA 5TE6L 3KPLB 1IQWL 4G6KH 2FWOA 4PR5A 1ZT7A 2EXYC 3MLVL 1NDMB 4YDKL 1QSVA 1FFPA 1VB9A 3LDBB 1PKQE 2OSLB 3T0EE 2NW3A 4MYWB 5E6YA 3L7FB 2DYPA 3ARZA 5FYKH 4PGEA 2QJDA 4GRLC 2VXSH 3L7EB 3PWPE 3KYNB 2BNRB 2OJEB 4PJEE 3GUTA 3LIZH 4NQCB 4PTTB 4XNZC 1OAUH 2NXZB 3TT3L 3D85B 1CDBA 3Q6GL 5TF1H 3ULVC 2VZUA 5DYOA 1U8KA 3VWKC 5I75C 4GG8A 1H3XA 3B8SA 2KQMA 2D4DA 5CEZD 2QQNL 3UTSB 1U8JA 2ENYA 4BH7B 5DVLA 3TIEB 2FLBT 4XNUH 2WUCH 4LSRL 4WV1C 3O3BB 1H3TA 1JL8A 1EVTC 1Y6KR 1GIGL 3DI3B 5HI3C 3RAJL 4HS8L 5KANI 1QFHA 4ENEC 4GAGH 1P53A 4MCZA 3B5HA 4KK6D 1LO2H 1MRCH 4WVRA 1JF6A 4U1LA 4HLZH 5TGBB 3TT1L 3WSQH 1S9VB 5J13B 4GRWH 4QYOA 1MWAL 1AR2A 2NY6B 4HWZB 2PO6B 1HYSD 3HNVH 3LHPL 5BRZB 4FQ2H 4P9HH 1DBKL 3NPZB 1AD0B 4HJJL 3RWHB 1R0AH 4WI5A 1LEKB 4ZNEE 2ZNWA 4WV1B 3MLYL 5KS9F 1K85A 1W8OA 4GFTB 4HLZG 2WV3A 3VD4A 5IQ7L 2J88L 3QULB 1QQDA 3BWAA 5K9JH 3G6DL 2B4CL 3HRZB 5FYJH 2BXZA 3MJGX 4ERSL 2AXGA 3FOLB 1WCBA 2XNAA 3EHBD 1G1CA 1QD0A 4LHUD 3BAEH 3VFRB 5C0JA 3LKOA 3KPMB 4OFIA 4G6AC 5HVHC 4UDUA 5FYKL 2VLLA 2X9WA 2PYEB 1JGDA 4HJ0D 3H3KA 1I7RA 1PY9A 2VXSL 5KOMC 2RJMA 2P4AB 3MJ9L 3RWFB 3GNML 5HI5C 1WF5A 4H1LA 2FDBP 1CLOH 1WBZB 4XTRC 2Y36L 4LKCA 1E4WH 1FGVH 4ZQKB 4YDVA 4CVXA 2XZQL 1ZLWH 5MERA 1KJ3H 4DGYH 4I9WE 2NNAB 4JRYA 4HIJB 1NBZA 3CXHK 1JZ5A 2MQ3A 5CGTA 4FXKA 4UUJA 4YNYA 1BOGB 4AIZB 1YYMH 2AQ1A 4AM0B 2JJSC 2OBGA 5SV3A 3QPQC 3QQNA 1OAQL 5FYKE 1KBGL 3UYPA 5IVZA 4FP8L 3VFTA 3V7AE 5HYJD 4HT1L 5DJCA 3VXME 3RTQB 1B0WA 4N0RA 3N85H 3ZE2E 1AH1A 4FG6D 2P8MB 1D5ZB 1D5BB 3HZKB 4L4JA 4X6EA 3VXOA 4XGZB 3VI4F 3UPRA 4K7FB 5E8NB 2IMNA 3NIFF 2HMID 1FVEA 2HVJB 4N0CC 1H3UA 1IAOB 3O3AB 3HLAB 1DSFH 4UBDD 3WUWB 3QAZC 4H25A 1F3JA 1S9VA 3STZB 1U8PA 3HC0B 5B39A 1MI5E 4K9EL 1J05B 2G9HB 4NKQB 5EWIL 2A6JA 1KB5H 2OCFD 3BDYH 5AAWA 3MBEC 1QO3A 2Q86A 4BSJA 4O2CA 5C9JB 4L8BA 1FLTX 3LPGA 3K1DA 1T1ZA 1PX3A 4KK8C 3F7VA 1W0WB 4QCIB 3ZE0E 5INCB 5HGAB 3TP4A 3S5LA 4RRPG 4OSUL 5ILTL 2VDKH 3K80A 3WEXA 4OD1H 5HXMA 5F7NC 4XNQB 3BUTA 3N50A 2Q8BL 5JLZB 1KB5A 3JV0A 2F58H 1KV3A 3MLWL 4NO0B 5JUEL 1U8OA 1MVUA 1J8HD 1XIWB 3IAGC 4CJ1A 5IFAL 1MFAL 2HFEA 3SDCA 3MBEB 3LIZL 4NCDA 3FCTB 4FTVD 4WU7A 1XCQB 1LO5A 4YDIL 4AL8L 1YMMD 5FOBA 4LGRB 1IZKA 4N0UE 3BDBA 1FORL 43C9A 5IW6B 2B0SL 1A8JH 2PW2B 5TE4L 3D3VD 4OLVL 2YD4A 3G04B 2YD1A 1RMFL 4URTB 4XNUL 5CGMA 1YUHA 4R8WL 1OP3K 4FP8H 4HK3J 4PJ8B 1X4XA 4JANB 3WFEH 2LVCA 3IDXL 4HH8A 4HS8H 3FT2B 4LSTH 4PRNB 1IVLA 4PGZA 3QXWA 1YNLH 1B0GB 1N6VA 4AEHL 3FL7A 3MR9A 1WJ3A 3L3KA 5JW5A 2NMSA 3RBGA 4KTDH 2EKSA 2CUMA 1JTTA 4X80H 4Z7WA 4PJHA 1EFXA 1IC4H 4J6RH 4NQVB 4M7JL 1JPGB 2V6HA 3OZ9H 3FFCB 2DI8A 3QEHA 4NZJA 3R4DA 4MXVE 1RHFA 5MP6H 2YD6A 4P2RA 5KVGH 5SX4H 2Z35B 4RFOL 2Q1EA 3RTQA 1IAKB 3MNZB 4JQIL 4W4OC 4CKVX 5I1EH 5K9KA 1Q9LB 1PQZB 2R1XB 4P5KA 3FRUA 2F5AH 4CW1A 1Q94A 1FCCA 1JYWA 5AZEL 4NSKB 5HDQH 5KOVC 4B7IA 3IFLL 2EDYA 4P4KC 5CWSB 1BIIA 2VISB 1WFUA 3QIWC 4D9QD 1K4CA 2FX9H 2JB5L 3G9AB 4RX4D 1NGYA 2DDQL 2X4OA 5FXCH 2BY0A 5FUCC 5HYJB 3QI9C 1KB9K 5I1JH 1A7PH 1GCFA 1TZHB 4WTZG 2J6EL 3VXSA 1F4WH 1J0JA 4IOIA 4Z5RA 3EO0A 4RGMB 5HHME 3F12B 1GGIL 1L7IL 1ORQA 5C9JA 3REWA 1IC5L 5GJSH 3VXUE 2OS7A 2XICA 5FO7B 1MJUL 4KY1H 1P69B 5E24E 1E28A 4HPYL 2JELH 4YK4B 1T1YB 4LLAA 4HFUL 4MNQE 2MHAA 4LMQE 4WDIB 2PNDA 4X7DC 2B1HL 3BEVB 2KDGA 3DX6A 3ARBC 1OAKH 3ILQC 5ESVB 1DZBA 4WI6A 3CXDL 3T4YB 2HFGL 3MRRB 3G08B 4NDMA 2NY7L 4HS3B 4WJ5B 1AKJA 3P0VH 3B83A 3BKCH 1BGXH 1XCQA 4M1CC 5IHUL 2A6KB 5ALCH 3FHQA 1T1WA 2ZOLB 2E9JA 3TJEH 2VZ3A 4BKLB 5I17B 3KLAA 2NX5A 4XAWL 3ARGA 2Z8RA 3DVNA 4U6XB 1YPZE 4NFDA 3O2VH 3OL2A 5E2WH 1X5JA 4Z78A 2WBJA 3GSOB 4X0KA 2GSIA 3VGGA 1RURH 4MDJA 1S7SA 4WGVB 4HIHA 1PVHA 3GI9L 2XTJE 3E2HC 2RQ8A 4HQQH 1JPTL 4ESKA 3MRMA 2GY7B 4Y2DB 1MCLA 1KJVB 4M48H 1GRWA 3FKUS 4RMUA 2Z4QA 3JTTB 3WHXB 1UA6H 4Z0XA 4HKXA 4LSSL 1U58A 5GS0D 4XP1H 2R1YB 1YEHL 5I74C 5TQ2H 1QSFA 5E6ZA 3K8LA 5KSAD 4QO1A 3HCVA 1IAII 4NNYB 5EDXA 4JJ5B 3D0LA 5EC1B 4YWGL 3VXRB 1IM9B 1Q0YL 3ARRA 3LN4B 2DBLH 1X5HA 1S3KL 3NIGF 4ODVH 1CQKA 4IIQA 4U1HA 5T3XD 1AE6H 1MI5B 1JK8A 2JCCA 5K9QI 3LPWA 4I5BA 1EZVX 2A6DB 5GRUH 2VAAA 1D5MB 5HVWA 2ED9A 3CDGA 4ZAKD 5I15L 1A6ZB 5D7JA 5KSBB 4P57A 3FB5A 3NIDE 2YD7A 2M26A 5C0IA 4FXLA 4M02A 2D0FA 5GHWL 5CEYB 5DQ9B 4RZCB 4P2YA 5DT1H 4YBQC 2QADB 3NZ8B 3ARXA 2FRGP 2HKFH 1DUYB 5J57B 4DVBB 2XWJB 3SKNB 4V2BA 1T1YA 4LPTA 2DTML 1MCCA 3M1BA 1TLKA 5LGHL 2QBWA 1U8MA 1A22B 4H88H 1KIUA 3QIBD 4KI5F 2O93L 3B3IB 3RUGB 3WKMH 4PGCA 2UVFA 4M9PA 4K7PL 3ES6B 4PIRF 3BSZL 2D2OA 3VA2C 4PJ7F 4YPGB 3OGCB 2R0KH 2GFBA 5EO1A 4OQ1A 3QQ3A 4NQSA 3GK8H 1H5BC 5GGSY 3RVTD 1MIMH 2EE2A 5DJYA 4I18B 3IF1A 1OSPH 2AK4D 4ZXBA 3GBNL 2EDDA 2JJTC 3REVA 3UXFA 2P8PA 3VJ6B 2IANB 4KRLB 3VXMA 3LEXB 2HMIC 5EPMA 4YHLL 4X6FB 1BZQK 3IJHA 3HN3A 5I1JL 3TV3H 3R1GL 3S34H 4E42B 4LIQE 1FGVL 3E3QE 4BZYA 4ZTPH 3QNZB 3BO8B 4P2QE 4G8GA 1I7ZA 5L2JB 5C3TA 3QISA 5GS0L 3RPIB 2W9DL 3VWJC 4NNYA 2V2XB 2AAVA 5A3ID 2R39A 2Q76B 3D39B 4NQED 4UIKL 3MRFB 3PJSA 1AHWB 5GJTL 1UH3A 3MNWA 3MRGB 5T3ZD 5J06A 1R3KA 4J3TA 5MEND 1H3PL 1BAFH 3IFOB 5C70A 4HKJA 1MFBH 5KSAC 5EZLA 3RI5F 3M8OL 1PAMA 1FJ1B 3RZCB 1JHLH 4C57C 2J8OA 4S1DC 3HG1B 4YJZL 1P7KB 1NMBH 2R8SL 1HI6B 3T65A 5JW3L 3E0GA 3WS6C 2AJVH 1F4WL 2X4QB 1MCOL 3KJ6H 4LF3B 4N8CH 4WCYH 1YEEH 4N0YL 5E8DL 4NWTL 5MEPA 3S4SA 2DMCA 3ARPA 5DRNA 1T1XA 3JTSA 4OZGB 5FB8A 1NCAL 3GMMA 5CINL 5GSRA 3RVTC 4JG0H 1CQYA 3VRLF 1I1AB 1CI5A 4TVPH 5HI4D 3MA9H 1S7UB 4X5LA 3CJJA 2GJ6A 2JTDA 1SBSL 3QXTA 1K3IA 3DROB 3DV4A 5I0ZA 4J1UA 4YDKH 1ZHLB 3LV3A 3X11A 4FQPA 5D96C 3ZKMC 3VFMA 4R4NC 1JFQL 2D03L 2X4NA 3RWIA 3RX8A 3D25A 1KJ2B 2X1XR 4D0DB 4OD1L 1TJIH 3O9WA 1ZHBA 2YOCA 3ARVA 3QEQD 5GXBB 3QH3B 1XAUA 4QRTA 3TVMD 4GBXC 4X4ME 2WBJD 1FFOA 1EX0A 2Y6SC 2F19L 4WTZA 1T7ZA 5D2NB 3I50H 1F02I 1RURL 1CGWA 3QJHA 5KSVB 1MHPH 1RUQH 5SWSE 4G6FB 3HA0A 4U1MA 2DI9A 3MRDA 3MYZA 4LKXB 2EDWA 5MEOA 5DGRA 1U93A 4OLUH 4Z7QE 5E2VL 2BOCB 5FUZL 1S9XB 4I13B 4KI5D 1Q9OA 2HA1A 3QXVA 4QRSB 1RUKL 4EI5B 4MJ2A 4IRSC 3TYGL 1F13A 4LCWA 1NLDL 5C07A 4G8GB 5HHOD 5MHSE 3ARWA 3UJIL 3JWDC 2R0LH 2R23A 3QIWD 3VRIB 2AJZB 1UACL 4OGAC 4XC1H 3EFFB 5B21A 5IK3A 3FONB 3K8MA 4Y5VA 4JREC 1S7RB 1MRFH 3C2SA 3QUYA 5J4MA 3RGVC 1T2JA 3L5JA 4BJLA 1OCWH 1UZ8B 2YZ8A 1HK6A 2FSEB 4F80A 1ZHNB 5I30L 5CJQL 1GGBL 4UQ3B 1S3KH 2E27H 3MRBB 4MMZC 1I8KA 2V2WA 2D0HA 4XPGL 1CE6B 3RVWC 3WFDL 4JFDD 1VDGA 5DJ8B 1JGEB 3WO4B 4TPRH 5F88B 4TNWK 5FYJE 2H1PL 2VUOA 1IE5A 3OKYA 3TYFA 2VDML 1P9MA 2Q3AA 5TH2B 1NSNL 1HSAB 1JUFA 3RGVB 2XYCA 5C0EA 1EFXD 4WHYH 2QSVA 4RFNC 3WNLA 1P84K 3OKEB 3C8HA 3PXJA 2GAZB 4XB7A 1ZLSH 5I1DB 2D31A 1T22A 2H32B 3BD3A 5DFVC 2FIRT 3VG0L 2R1WA 3L9RB 4IS6A 2R2CA 2HH0L 4JFQB 4K71B 1NFDE 1I1AA 3BGFB 2NY3B 2BVQB 4NN7B 1YJDH 1GOFA 3MRHA 3DXAA 5BV7L 3UJTL 4YZFF 2APFA 4QHMA 1KIQA 2IBBA 4HWNA 4LBEB 4R90H 3UBXB 5KBNC 1AGEB 4FQXA 3P73A 3P30H 4J3UA 1EAPB 1UKQA 3W39A 1A2YA 4G9FB 4PGDB 4RISL 2LE9A 3DBXB 3MV7E 2NR6D 5GJTH 2IAMC 5AAMA 2CD0A 1AXIB 4KGJA 3L3OA 5CP7A 5I1AA 3PWUB 3BGFC 3RJDA 4C56E 3D9AL 5D1ZC 5HHNA 2O5YH 5DJ2A 3X14B 5E4EB 4F9PA 1Z5LA 3FFCE 2IPTL 4JAMB 4TUJB 3QJHB 1NLBH 3RL1B 4PJIE 5ANMA 3RHWF 4LU5L 5MENA 1T0MB 3LY6A 4Z95H 1I75A 3T0VA 3DUSB 2AJ3A 5KG9A 4KUZL 4TUKH 3KNBB 4GRWB 3S96A 4XPAH 4Y88A 4PRHB 3V52L 3VFUA 1QLEL 5DUBA 3CK0L 1O5DT 1HQRA 3AB0B 5C6TH 3MMEB 4X9GA 1JGUL 2WM0A 1S8DB 1RJZA 4XMLH 2BCKB 1NEZB 3JWDH 2OX5A 1JRHL 4ONHA 3JVGC 1HHGA 4N8CL 1G9NL 3LKNA 4RGNE 1CLZH 2IQAB 1XGYH 4XCYB 3L5HA 1BM3H 1I7UB 3WFHA 3MV8D 4KRNA 1JPSH 3F6IA 3AREA 1Z0MA 4J2XA 2EH8H 5LWYL 1DLFH 2VXVL 4FS0A 3TNMA 2CO6B 3TN0C 2SEBA 3SDAB 2GHWB 4Q0XL 3LS4L 3GSWA 1L4IA 4K94H 5I8KH 1IGCH 2OQJB 3K4DA 5CILH 2VKXA 4EDXA 1FZMA 5IW1A 3EJZD 3MRKA 3PQYA 4LP4A 2NY2D 1R5IB 4FABH 5KSAB 5DQJA 4JFDA 1S7XB 5I9QB 3UEZA 2G5RA 2AKRA 5EC2A 4R4ND 2LFGA 3C60C 3FQWB 1WZMA 3TLRA 3VI3F 2XXCB 1T03H 4XBPA 3JZ7A 4JFPA 2W91A 5LCVH 1JBJA 1KIRA 4Z7UE 4OI7A 5HHXL 3QHTC 4DN4H 2BVYA 5K9QG 4FFYL 2WUBL 3STLB 4JDTH 2VERN 1I1RA 1KXTB 1ITBB 5SWSA 1CFQB 1DLHA 5HGBA 1H3GA 5EB9A 3GHBL 2XXMB 3SGEH 3TBSA 2BSRB 3TWCL 3MV9A 5LJYH 3HRPA 1FYTD 4XPHH 1CG9B 3IFLH 3ZLQC 1O7VA 1CN4A 5DMIH 1RIVH 4NBYB 1Q9WB 2FIKB 1LP9B 4QRPB 2DDQH 4EBQL 3QDMA 3CK0H 1A9EA 5TF0A 2A1WH 4KKNA 4UIMB 3ARBD 2GTWA 3JWOC 5ESAA 2D7PA 3SKJH 5HD8C 1L0QA 2ZCHH 3O0RL 5HJ3A 2G75A 5HHNB 4P2QA 3TN0D 5FHAL 4YX2L 3ZHLA 1KENH 4XX1E 2HFFA 5JDSA 5C0CA 2A74A 4OQTL 5C0GB 2C1PB 2NTSP 4B41A 5EOTB 4ALAH 3QCTH 4LQFL 4DTGH 3KS0H 2BFVH 3C8KA 1KTDB 4OZHA 3BX7C 1C1EL 2WMPA 3RVUD 4HFUH 1S5HA 4KKCC 3PE9A 1YC8A 4LGSB 2NY0D 1NGXA 4OM1H 4BK4A 3QI9D 1JHKL 5IOPA 2A0LD 1UJTA 2EYSA 4YHOH 1V7NH 3DETD 2V9TA 2WWMC 2IG2H 1X5GA 4NJAH 1FN4A 3O6LL 2BNQA 1LO4H 2UWEE 5E2JA 5BO1L 1YMHA 4FTVB 1RIUL 1JVKA 2AJYH 4R26L 3TJHC 5B8CB 4S2SA 4A6YL 5LAXA 5T3ZE 1EUTA 2ATPA 4Q6YA 2UWEB 3VFNA 3VDCA 4R7DA 3LSOB 1A14H 2A6IB 4LLVA 2LAGB 3W5NA 4OD2B 5F21B 3AU1A 3JV6B 1HXYB 2FO4B 3R0NA 3EYSL 4KKCD 1ULVA 3CUPB 3BKML 4OZGF 5AYUL 5JW4N 1M7IB 5T1DL 1KCRL 4G7VH 3FTGA 1LO3H 4EIZC 1G6RA 3MOBH 4GXVL 4YIQA 4NHCH 2FO1A 3MLTB 4JFXA 4FQIL 3IGAB 3O2WL 1P9MC 3RAJH 2HT3C 5DK0A 3QNXB 1ZAGA 4N5ED 4JM4L 1KPRA 4XP1L 2Y25A 5IROC 1I3UA 1NCBH 2B7DT 4ZUWA 1J9CT 1A6TB 1V5JA 3QA3A 1SJEA 1XT5A 4KZEH 1SEQH 4BH8B 4PG9B 1J11A 2PR4H 5MEQA 4GW1A 1YPZB 2OI9B 1RJLA 1V8HA 3GM0A 2EE6A 1JGUH 3F62A 4PY8J 2ZZUT 4CADA 4PRHD 1Q9WA 3ME0A 4ELME 2VLJD 5L7XH 1A3QA 1UVQB 2Y36H 2CRIA 2ITDB 4QRPA 1FZJB 3EGSA 1HQ4B 3MLZL 3T0ED 4PBWD 3S4SG 4HGMA 2CRZA 2Z92A 1VHPA 4NC1E 2CIKB 2EO9A 4J23A 4PREA 2VRAA 1KPUB 2V5RA 2OTWA 4P0DA 1YMMA 1NAML 4JZJC 2D9QB 2EC9T 3ZT6A 1PW3A 1C5CL 3U9PH 4OT1L 3VXUB 4R97C 3AM8A 3FZUD 5EBWB 1NGXB 3V6OC 3B9KC 2I24N 3PP4L 3T2PA 4CUCA 3DX8B 1PG7X 1T7YA 1XF4A 4D9LH 5C2BH 1TJHH 4X9FA 1A6AA 1XR9A 4BQBA 1Q9KB 5CZKA 5KSUB 1OGAE 4JN2B 1CFTA 1X5YA 3SKOA 3FO1A 4X9IA 2VWEC 1QLRA 4ZYKB 5L8KB 2CJUL 5AD0A 4Z7VE 3SGDI 3S97C 4JRXE 1NCUA 3EYUH 3VDAA 1CU4H 3BZEA 1QSEE 4PV9B 2AI0H 3DVFA 4OZFA 3QPQD 4WUKL 1CT8A 1F58L 5FK9A 3RTQD 3T04D 1WFTA 1A1NB 2QQLH 4XP9L 4OUUB 4N8PA 1FRGL 1QBLL 2HJKB 2YWZA 1ZOXA 3THML 1R3HA 5EBLA 3OJMB 4Y4KC 1ZT1B 4F8QA 3SE9L 4M1CD 2YXFA 5IGXL 1UYWL 1G7PB 1ZVHA 1M05A 5AZ2L 5F7DB 3GMPA 1FYTE 2B2XH 2Q8BH 5HPMA 1MFDL 1PX4A 2NXZC 4LSQH 4P5TA 2W0PA 1QACA 2MCG1 1D9KD 4OLYL 5C0AD 4BH7A 5HI5D 4Q7DA 4P2OD 4JFEE 1T0PB 5L88L 3CVHH 3CSYB 2NY1C 5F71A 2CKNA 1NAMH 5DC9B 2ZUTA 4DKDC 2XA8H 4KHTL 5I1GL 5BV7C 4KQ3H 3MO1B 1QFWI 3F65A 4FQJL 3MROA 3C6LB 1GIGH 5T3XL 2FYYA 5E1AA 2X42A 4L9LC 3WD5H 1JYXA 1EK3A 5ITBH 4NRXA 1CGTA 4PJ8C 3HE7A 4ZFFB 3BUYA 5GSVB 4F7CB 5IKCA 5ERWB 3WN5C 4PV8A 3AS1A 3ZSSA 3TFKD 4JFFE 1IGJA 4J8RA 1SQ2N 3KPNB 1JWSB 1FC1A 3KYNA 5IP4A 2DWEB 2LTQC 5C08A 2CDGA 3GSUA 4LHUG 3V6OA 1J7VR 1I9IL 2HTLC 3GM8A 2WK2A 2C3VA 1D6EA 3FB8A 5HYIA 3DO3A 4X5XB 1IGYA 5DYOB 2DOCA 5CCKL 4KKLC 5AEAA 2VDOL 5I8CB 1SMAA 4DKAA 2NY0B 1C5DA 1MFBL 1C1EH 3SJVE 4MXVF 1QLFB 5ACMA 3G6DH 4BQ8A 1F58H 1XF4B 4PJXB 4UT6H 1DL7H 2FGZA 4I1NB 5I8EA 5GGSB 1ETZA 1Y18B 1FSKB 2OI9C 1NGZB 4JN2A 1G9NC 4MAYB 3MRNA 5E8EB 1T7XA 4HH9B 3L3GA 5JIIA 5AD0B 1G7LB 4G5ZH 3DURA 1YY9C 1MLBA 4O51B 2I60H 4N0YH 2A0LC 4XCNB 1U3HA 1A5FL 4YDVB 5MP6L 1FIGH 4WFEE 3DUUB 2O61A 4WIQA 3EUUA 3G6JA 4JM2D 1DANT 5CKGA 1VFUA 5D6CB 5I66B 3O2DL 4MNQB 3OQ3B 3AROA 1YC7A 2N7BA 3FN9A 3QUYC 1KCVL 3C5SB 3WIFB 1NKOA 4JPVH 1JPST 2AXFA 1SMOA 3BI9X 4QHNB 5FA3B 5HD8D 3VWJB 4AM0A 1I7TA 4TNVK 4OKVB 2EECA 3G9VA 5DWUH 3V95A 2ERJB 3MV9E 3IDIB 4PJXF 2FX9L 5DVNA 4G6JL 1OB1A 3T0EA 4WFHE 5F3BA 3NOIA 3MCKA 3WIIH 5HBBA 3O3DB 3UX9B 4D0CA 3ZO0A 1VGKA 4LHUA 3D39D 4NQEB 2AEPL 5D7IB 2PTTB 1FH5L 1D5BA 4APQB 1A0QH 5CBEB 1MELA 2EYTB 3TH3T 4Y19B 3TBWB 1MWAH 3MBED 3SO3C 1CL7H 3T3PE 3VCLA 3P4OA 1ACYL 4EI6A 3OV6A 4PJCE 5B39G 5JR1H 2ERJC 4UOW0 3T8XA 1E6OH 3BRFA 1BFVL 3QQ9D 2EEDA 4N1EA 4D9LL 5C2BL 2VIRA 3KXFE 2E9WA 4HUWB 1SBBA 2G9HA 3B6SA 2RFXB 3D87B 2CKBB 1JNHB 2G5BB 4UT6L 3S6CA 4CU6A 5D7LA 4XPHL 5F44A 4JPWL 1JWSA 3W11D 5AYQA 1KCSH 4HUXA 1F4YH 3C2AH 3BOVA 4N8VA 2QR0B 2ICEA 4FG6C 4P3CL 4JKPH 3SBWA 4OCNC 5EU6A 4ZUVB 3A6BL 4MLSA 3U82B 1ZMYA 2WBJC 4FQ1L 3O45B 4JRXD 2JCCF 5FV2A 1ZEAH 1RUPH 2VXTL 1OAXL 5IB5A 4KDWA 2EIBA 2KKQA 4KJWD 1T5XB 4HWBA 3SGKC 3MLWH 1INEL 5GRVK 4PY8I 3BMWA 3CFKA 4ELKB 5JPNA 2VDMH 4MXWL 2XKNA 4ZUUB 4CU8A 1CS6A 4PJCB 4G9DB 4Y4FA 1LO0H 1A6UL 3NA9L 4XBGA 4OZIA 1IAIL 4TRPL 4F9LA 1LO2L 1MRCL 1B2WH 3IU3A 3U36A 3PABB 4HUUB 3IJSB 4HJ0C 5JA9A 4QHLB 1AGFB 1BLNA 1K3ZA 1JWUB 4HZLA 4G6AD 2DF3A 2MKWA 3K4AA 1U8QB 4X6BB 2I27N 3SDXA 1HEZA 4GRLA 5TQ0L 4PGBB 3U0PB 1B6UA 2FHCA 2NR6C 3BISA 4J3OC 4XMPH 4ODUA 3SDYL 1RFDL 3G5YA 5IGXH 2XZQH 3FQNA 5JLZA 5JOPE 4JY4A 1WFNA 3MTRA 1URLA 4JCLA 4KKAC 3RKDC 5TFSH 5JXEA 4OCXH 4MX7B 5C0BB 3WL9A 1IM9D 5FUZH 4TTDD 4CNIB 1AGCA 4MD5B 3DVGA 3VXNA 2PTTA 3H9SE 4RFNB 3HHRB 2H9GB 4R2GD 3UTTB 2MQCA 3SDCD 2LQRA 4JFFD 4D3CL 2R4SH 3C5ZB 2VDLL 4HW6A 1AY1L 2GKIA 2HWZL 2RR3A 3TH2T 3IDMB 4WO4B 2YA1A 5I1CL 1X6LA 3MXVL 5JW4Q 3UTTE 3Q5YA 1BX2A 2ATKA 1I4FA 5I1KL 5CILL 3AREC 5F7LB 4ETYA 1KG0B 1YYLL 2D7OA 2E9IA 4RBPK 2VN4A 4RGOL 3QG7L 3QO1A 2FX8H 4JZOA 4KK6C 4TSBL 4WI8A 3WLWC 4Z7WB 2H6PB 4RIRB 1CGXA 4Y5XC 1EUUA 5IBUG 4ONFL 1D7FA 5BMFH 1I9JL 2VLRB 2VLMD 2VZ1A 5FA4B 3CLEH 3MLZH 1IARB 1J8KA 4AH2B 5A2LH 3BWUC 1U8NB 3FQUA 2Z31A 3KPSB 2Q20A 3PHQA 5ESVA 3LKSA 4NQDB 2HG5B 1YEGL 5ESQB 1UXSA 4UIKH 5EUOA 5F3HB 4JM2A 3HR5B 3F7PC 3ISWA 3MRPB 3WCYA 1QSEA 1OPGH 4HS3A 4WJ5A 4RAUA 2CMRL 1M6OA 4XCFL 3V6FA 2HFGH 3GHBH 5CIPH 4Q2ZB 2ZOLA 4Y16A 3V5KA 1FO0H 3G6AB 4FHBD 4UDTA 4OAWB 2A9MH 3KLAB 3MLSL 3VD5A 3QWRA 1P4IL 3V0VB 3LMJH 4QRRE 3RVXD 4JG1H 1EBPA 5GS0C 4X80L 3TBTA 1P1ZB 3CSBA 2GK0B 2EDQA 1DBJL 1F6LL 4WHTA 3Q1SL 1CGVA 4HKBB 3U30C 4XNMA 5HHPA 5AG8A 1E27B 2F53E 4RFEA 1XIWC 2F53B 5GS1A 4NYLA 3IU4H 1NANH 3K0WA 1XR8B 3CLFH 1LE5A 4IRZL 1P4LB 3PGCB 3BZFA 4NO0D 3OR7B 5IESL 2ESVD 1BVKA 2XZZA 2DQTL 3B9DA 1TETL 1J12A 1P7QB 4ZAKC 4MCYB 1YEHH 4KUZH 1EPFA 5C0AE 3RDTA 5E8PB 3P9LA 1YECH 4P5MA 4NZRL 5FDWB 1WFOA 4Y4KD 1RZ7H 2F74A 2VKWA 4FXKB 4YNYB 3KJ6L 3ZHDA 4Z7VF 3BP5B 3M17B 3MV7A 5IQ9A 4OIIH 1OAZH 3WHE1 3VI4E 4OLWL 4DCQB 2WNGA 4HCRH 2P5ED 3JWNC 3O11B 3HG1D 1FZKB 5CUSH 1C7SA 4OIAA 4PP2A 5IJKA 4QOKA 2XG4A 2K7QA 3GSNL 4MAYC 2C4FT 4E0RB 5ID0A 7CGTA 1AO7A 1T3FA 1KCRH 1NEUA 4HIEA 4CU7A 5EZOL 1IT9L 1YQVH 4JPKH 3LN5A 4L8DA 3RWEB 1T0NB 1MF2L 1S7VB 2Q7YA 1Y0LA 2FH6A 3E8UH 2NY7H 5HGHB 4PJBA 2ARJB 3T09A 4GBXB 4BFGA 4NKMB 4P49A 2B4CC 1N7MH 3BYYA 1QSFD 4ZDHB 4ZFOL 4R96B 1I9RH 2DLEA 4J12A 2UZXB 4LAJH 5FO8B 1ZKAA 4K7PX 1Z9SA 3PGDA 2W0FB 1LP9E 2LABA 1C12B 2AXJA 4MQXC 1CGYA 5FM8A 3SDYH 1RPQA 1TQBC 1GGCL 4HJGB 3V5KB 4F37F 4GUPA 4LSPL 1J87A 5D1ZB 1BJ1J 4V1DE 4IMKC 4KKAD 3RKDD 3RI5K 3WUWG 3W2DL 1PG7L 4DZ8A 3JSSA 1SYVA 1PGRB 1LVEA 4K9EH 3A67L 1U8OB 1CXHA 3GK8L 4D3CH 1UACH 1KN2H 1FDLH 2P8PB 3QRFM 4LLDB 4F2MA 4GS7B 5DGQA 1NBYA 2J3SA 3EYFB 3CU1A 4QT5B 1HHJB 5DURB 4DVBA 2VE6B 1MCNA 1NAMB 5K9OB 4KVCH 4N90E 4LPUA 1E4XH 4M4RA 4N0UA 3CVHB 2HH0H 3ZDZF 4IRJD 5JORB 3RZWA 1MJ8H 4UI2A 4BQCA 1FNLA 5H35A 5CUSL 5I2IB 4G8EB 1TFHA 3FT4A 1DE4A 4PBXA 1A7NH 3CZFA 3RUGA 1K8IB 1BOYA 2N1KA 4I3SH 4O2FA 4XNYL 4HGWB 1PKQB 4PGCB 2LVEA 4YEEA 3L7FA 4FQCL 4LLWA 4YHPB 3OKMA 1NMAL 5BOZG 2OR9L 3O81A 4LSDA 5IF0B 4LCCB 1I85C 4M1GL 4AT6B 4MWFA 4X9HA 3D69A 2IG2L 3IDJB 4NRYB 2GY5A 4G7YL 1R5VA 2WZPD 1TIUA 2YRPA 2YRLA 4I8DA 2VDNH 3L6FA 4LEOA 4PJ5D 5EU4B 4U1GB 3LD8B 1XF3A 4KAQL 3VWKA 5I16A 4O5LH 4NBXB 4XAWH 3NCJH 3HE6A 3EOTL 1ND0B 3BT2H 6FABH 4DVRL 1LK2A 1WBXA 3H9SB 1T3FB 3UYOD 3W9EA 2VJXA 3VRJA 4PS4H 4MD0B 3ULUE 4L8DB 3RWEA 3NCBB 1CZ8H 4MD4B 4XVTH 1C5BH 1MRDL 4LQ1A 2CH8A 1YY9D 3KPSD 2WQRA 3RWCA 4Z7WF 3BZDA 3HAEB 1DDHA 5A2JH 5FGBC 3EYVB 1VKXA 3HZVA 3U7AA 1J8HA 3MRFA 4YFLI 5AUMB 1CLYL 3V8OA 1RU9L 2O5YL 3QZWB 3PWPD 4K23H 4RRPA 2EH8L 3ARYA 5LWYH 5FCUH 3LV3B 4AMKL 15C8H 3T3PF 1PSKH 3P9WB 4HEME 3WO3B 4X6DB 4BUHA 4PLNC 3R06A 3RFZC 1VERA 4WRLA 4JO1H 5DK2A 3THMH 5CEZE 3MODL 3FO2A 1QYGH 2VQ1A 3BWAB 4QTHB 2HT4D 1U8LA 5FGBA 5I74B 1TJIL 4QNPE 5EIIA 1ZGLA 4M6MH 5E2TL 1QPXA 4HEPG 3GMLB 4OFKA 3KHOA 3LQAH 4UTAL 4WW1B 4ZTPL 2A6KA 5J8OA 1LILA 4WWKB 4Y4HC 2VYRE 5C6PB 4HXAL 4XCCH 3NFNB 3VI3E 2FEEI 1PLGL 1Q9OB 4HS6B 3RRQA 1NC4B 4WI2A 5KS9B 5M7QA 4EN3B 3VMOA 3I75B 4OIBA 2UZYB 5DRZA 2CR6A 3T3MF 4PJAA 2B1HH 4XVJH 1D5IL 3GSOA 4K94L 4Z7UF 4F7TB 1I3RB 4QTIH 4EOWL 1HSBB 2ZSWA 1TDQA 1IT9H 1OSZA 2F15A 2WW8A 3PWJA 2YPLB 4NJ9L 2E7BA 1GSMA 3UPCA 5E99H 1DUZB 1WIUA 3BVNB 1TZIA 2OL3A 4EJ1C 1UCTA 4NGHL 2Z31D 4JHZA 1MRFL 4XP6L 5IMKB 1D9KC 1BOGA 2AABH 4OJFL 2YKLL 3AMLA 4NC2B 2X4UA 2FWOB 3QUML 1K5NB 4I0PD 3VFTB 2AK1L 5DK3A 1YEEL 3VFGH 2BHZA 1OD9A 2Z93B 1GZQA 5D7IE 1NCAH 3NIDF 1IGFL 3VXMD 3UDWC 1KCLA 2XWBA 3BGMB 5TH2A 2W59A 2OMBA 3OR6B 2ZUQB 5JQ6H 4XHQA 3INUL 1CICB 3VWJD 4LSSH 1GAFH 3L5IA 3QI9B 3C5JB 3O6FB 2HJFB 4KK5D 4P46C 1MF2H 4NJAL 1UXWB 2BVQA 4S1SH 3MRCB 4P4KD 3T2QA 5BO1H 5CEYA 1OT2A 1L0XA 4KI5C 4HPOL 5D1QD 2N7AA 4LIQL 3PXHA 1H15B 4K2UH 4PJDF 4WEUD 5T3ZL 5FUOL 2H8PA 4NC0B 4YBLC 3TH4T 4YGVB 1PDKA 1ZHNA 2I07B 1LE9B 1F11A 3ZE2F 1U8IA 1J88A 1CXEA 3IRZA 2PW1A 2FATL 3U2SB 2QQKL 3VGHA 3FO2B 4LLMA 1A2YB 3MYJB 1NUDA 3VG9C 3NIFE 4MAYD 3WJJA 3ARBB 3MA9L 5L88H 3BKMH 5AYUH 5J9PB 3QXAB 3MQIA 2NXZD 4PJ7E 4RAVB 3IDYB 2BP3A 1N64L 2VNCA 5I1GH 4NP4H 1OOAA 5CZXC 4KPHH 4X83A 4ZPVA 2NY5C 3ROOA 2V17H 4R0LB 4WHCA 4XP4H 3TZVB 4UQ2A 1I3GH 1RZGB 1ZA3B 3ZKMD 3BESR 4X4ZA 4E41E 3K8KA 1DP0A 1Q0XL 5JXAH 4ZSOB 4I3RL 4HIXL 4X4MA 1FH5H 3BW9A 3MSPA 1YN6B 1AJ7L 2XOTA 1YMME 2VOTA 5DVMA 1HKLL 4U2ZA 1JTPA 3WJLC 2DQEH 2AABL 4OJFH 1ZWIB 3A6BH 1BVLA 4HUVA 2NXYC 3QJFB 4XXCC 5I8OH 1CK0H 1XIWD 3SBWC 4YFDB 5LGJB 5HYSG 4Z7VB 5L2KA 1B90A 4PJ9B 2B1AH 2XPGA 4IDJL 3DYMA 5HYSB 3C87A 2CDFA 2VDRH 3HNTL 4M43L 3FRPG 4P46A 3INUH 5I9QC 4C59B 4ZFGL 2ZUUA 1MCWW 2X4UB 1KB5L 5LXGH 1QRND 4XX1G 3T0BA 3WHE0 4P2OB 1G6RL 3P0GB 3VXRD 1AHWA 2Y1VA 1UZ6E 3EKCA 3MRGA 1FVCA 4MDIB 5IHLB 5F6IC 3GJFA 4Z9KB 4U6YA 2YSSA 5B4MC 5BZDB 3GJEB 3KPOA 5JO5B 4M62H 3DTXA 2ZPKL 2PCPA 5IFJA 1OTSC 1BIIB 2VISA 2JLLA 1DN0B 3OXRB 4HPYH 5FM5O 3QP3A 5F89B 1MHHA 2HP4A 1PD6A 4TYUA 2EEBA 4PJGE 1CDJA 4YQXH 1HI6A 2IADA 2VLKB 5KJRH 5TDNA 2GITB 4DN4L 1CXIA 5F1OB 1CIUA 4M6OH 1N3NB 4K8RL 4XT1C 4DOHB 4DKFL 3K7UA 4LCYA 4OV5A 1YNTA 1FO0B 5HHMD 5FO9B 3WLWD 3CFJB 4D9RD 3VGEA 1NL0L 4EUPH 3MRLB 2DRUA 4M00A 1JF1B 4L3ED 1R3LB 3VGBA 1T83C 4HD9A 4OM0H 4YAQB 5DD3H 2W60A 3C6SB 3C08L 2I9TB 1X4ZA 2NXYD 1A3RL 1OGTA 3BEVA 3QXAA 4QXUL 3RVUC 3S36X 1N26A 1U3HC 4MJ6B 1DBKH 2MSPA 3E1F1 4K3EL 1LNUB 3P4NA 2FD6H 2VTFA 5HGDB 3U4AA 3C6LC 5ILTH 3SDCC 4MVBD 2N4IA 2ZG2A 4EUPG 3IDGA 1HCFX 4R2GC 5H94A 1T21B 4OFPA 4M6ML 4LSVH 3X11B 3PHOB 1G7JA 5AZ2H 2F58L 2FX7H 3P30L 3D2UA 1NCDH 1GGTA 2NY5L 2IH1B 3BW9B 3A0OA 4YFEA 2EH7H 1RHHB 1ZHBB 2BVPA 1GYAA 1LK3L 3STLA 5JOEA 4Y4HB 4PJFF 3WFBL 4LCUA 3C2AL 5D72H 1XIWA 4L3CA 5ACZB 2HN7B 2GYSA 4Z76A 5HDQL 3MBEA 4L29A 1HILA 2XA8L 3WFEL 2YEZB 3QQ4A 5ALBL 1BREA 1H3VA 1KT2A 3V4UL 2R0ZL 3MA7B 4ZUTA 2E8YA 3VXQB 3WD5L 3KXFA 2GEEA 4FABL 1J1XL 2HVKA 2ZKHL 1T04B 1U58B 2YA0A 1IM3B 5TDPB 1INDL 4RWYH 5D6DA 1KEMH 5FDYA 4IMLA 3HZMA 2C3XA 4YUEL 3ARUA 3TGXA 2ZCKL 3TPKA 4PD4K 2C1PA 3QUZB 1WITA 3QDJE 1IGMH 1WTLA 4DKFH 5JW5B 1FVCB 4MQXD 2JELL 1QR1A 4XPFL 4NT6B 3O4LB 5TE7L 4U6YB 5BZDA 5GS2H 2AV7A 4FXGA 5DZOA 4GOSA 3EJZC 5EU3A 1X5LA 3GBNH 4LMQI 2EXWC 5IB4B 1DN0A 3OXRA 1CGUA 5GRWA 3LS5L 3B8YA 3MV11 5DD1L 5I1IH 1G7QA 5FKAB 4X6CA 1CE6A 2VWEE 3B2VH 1MWAB 4OV6F 4KTEH 1BQHG 1FNFA 5IHUH 3QG6A 1N3NA 3SOBH 3ULVH 3OKDA 4LOUC 4PLKD 4EBQH 2FJGB 3HKFA 5HY9A 3SY0B 2Z91A 2VL5B 3NA4A 3QFJB 4G43A 5ISZA 5E2WL 4CADB 2OXHA 4AEIL 4YEFA 4HJJH 2P7TB 2D31B 4OD2A 1KLGA 3B9KD 2IPUG 3EDFA 1RZKC 3SPVB 3BXNA 2V5TA 3PIQA 2F54D 4C4KO 2DYPB 4Y2DC 2A38A 5K9JL 1P5VA 1NGWB 4YDJB 2DB8A 4P3DA 1KIQB 3M45A 2GIYA 1RIVL 1N4XL 3MOQA 4G42B 5F9JB 3VDBA 4NO5A 1KIPA 1NMBL 2R8SH 1LEGA 3ZE1E 1OTTD 2EDOA 2YMXL 4E41A 1CR9H 4LCIH 1XZ0A 2HRPH 3DV6A 2HT2D 3PL6B 5ELIA 5CEXB 2BVPB 4LPYA 1WTGT 3HI1B 2C7UB 1I8MB 3MGAA 5C0CE 3NACH 3TIEA 1INDH 1PZ5B 2VC2H 2X2YA 4NKIH 5CJ5A 4GAFB 4NM8H 2QSCH 1VFOA 3BP6B 5DD0H 3ZZ1A 3TT3H 1A0QL 3KLSA 4DUWA 3ARFA 3F5WA 5HHXH 1FNAA 1JJUA 2P5WE 1HH9B 2KQNA 5EOQL 1HOCA 1TJHL 1ZSDB 3KXFB 2A83A 2D7TL 4S0TD 3B9AA 4Y4FC 2XKUA 4HWUA 2QLVB 1OAYL 4CVUA 1NCTA 3QEQA 3RWHA 4XNZB 4ZFGH 2MNUA 2WBKA 1PYWA 4WV1A 4XC3L 2XG5A 1JMZA 3MUHL 4XP6H 3PV7A 2EYRB 2XY2A 3FOMB 2RIKA 1XCTB 1BQHB 2W9EL 1L6XA 3VXUA 5D71H 5L2KD 1W72L 4NPYB 3SDDC 5I18H 3QSKB 1MFNA 3FO0L 1NGQH 4HKJB 5C2UB 5EA0L 5C8JA 3M07A 5DS8A 1ZA6B 3LH2L 1SY6H 3MLYH 4LPCA 3Q6FB 3SDXE 1KLFA 2ICWA 4BFEA 1CDIA 3VFGL 4F7PA 1MWAA 2HTLD 4MGXA 4JG0L 1U36A 1E4WL 3WNMA 5ECJE 5DFTA 5INDA 5DQJB 4V1DB 1QPPA 2VLLB 2R2BA 1MIEL 4I77L 2FJGA 3KYKL 4XRCA 3TA3B 3EJYC 4OD3H 5CLWA 1IQWH 5GGRA 1OWWA 2EC8A 4KGLA 1VGEH 1SY6A 4U0RC 1GC1H 2DQCL 3UTPD 4MJ5B 5DJZA 4NO2B 3KPRE 2DJ4A 3HS0A 1U95B 5ERWA 3OJVC 2P44B 5ALBH 5T3ZH 3O8XA 1U8HA 3ETBF 5DRXB 4YBLB 5EZJA 3MV8B 3WDJA 3GSXA 2NY1D 4AIZA 3MV9D 1M05B 5C08B 3MOAL 1XGPA 1KJ3L 4I3SL 3GMPB 1S9YA 3AS0A 1M1SA 4E41D 4OCYH 2DQUH 4FQIH 1MCIA 4MQ7B 4NKOB 2C7UA 5C7XH 1I8MA 3OKOB 3DSFL 5T5FH 3DMMB 2FJHA 1IQDB 4JKWA 5I8EB 4PP1C 3VD7A 3PF2A 1NCCL 1F6FB 3NGBB 3PGFH 3CX5K 3OF6D 4HT1H 5E6IC 2HLAB 3CCHA 3U79A 3OAUL 4UT7H 43CAB 4UU9A 5DD5L 4RAHA 2PETA 5KAQF 5D8JH 3DVIA 3GMOA 4QRSA 1YEKL 3GB7A 3P9MB 2R0ZH 1TTGA 2Z8SA 1N0XH 4UAOC 4ZUSA 5CS7A 4HUMB 3WMSA 1MUJB 5BV7B 2CUIA 5JTWA 4UOJA 3ZE1F 5I66A 1WC7B 3VJ6A 4K3GA 1DQTA 1FIGL 5H2BA 1NBVH 1QFOA 5L0QC 2X4PA 3O2DA 4NN5C 3DX9A 4Y8DC 4OFVA 1FNGB 2IC2A 2AV1B 3EDDA 3DOSA 2BFVL 3D85D 1BBDH 1VPOL 3L5WB 2XZCH 2AJXL 1E6JL 2Y7QB 3BP4A 4Z7QF 4OCSL 5E5RB 3MRBA 2WIMA 3P40A 2V2WB 1FV1A 4KMTL 4V2CB 1IILE 1QKZH 3P0YH 1ETZB 3LQMA 1U6AL 4Y89A 3V0AC 4N0FA 3TBVB 5SWZA 3T1FB 2PW2A 4G80A 3V4VH 1S7QB 5GZOC 1C08B 1MFCL 4WI9A 4KJPD 5HHOE 3FB6B 5MHSD 5F6HI 4ODXA 4JANA 3WS3A 1KXVC 1ORSA 2PO6C 4M7JH 5I1DA 1J10A 3B9KA 5FYKU 5CGYD 1JPSL 3KJ4C 5D5MA 2OR9H 1K6QL 2AGJH 3VFOA 3QA3B 4ONGL 3OX8A 1KPVA 4I48A 4P2RD 4W81A 2EC9U 3DXAB 4YO0B 4YXKL 3QFDB 1MCHA 2Z9TA 4JZJA 3D18A 1I1YB 3S36H 1IGIL 1A6PA 2BX5A 1ZK9A 2W65B 1EEYA 4I3GA 3C08H 1QVOB 1W72B 5DD5H 3D48R 4MJ4A 4C54A 4BM7A 4K3EH 4ELMA 4S1DD 4XBEH 5LQBH 2V2TB 3AXLA 4G8GD 2HTKD 5IMMA 2YKLH 25C8H 5IV2A 3F58L 2DMBA 5ETUA 4KUCD 1AD9B 4M3JA 3VD9A 3QUMH 1RULH 3BQUA 4PY7B 1K4DA 2HT3D 1AP2A 1FCGA 1ZTXH 3EIFA 4ZO8A 5DHYA 3VXPB 4NZUH 1NGYB 4F7EA 3GSVB 1J86A 3IFPB 4OF0A 4NNXA 5HYJA 4RSVA 2YZ1A 4Q6IA 5D2LF 2ESVA 4DQOH 3X12A 4Z5RB 4NO3B 3MMEA 2MOVA 4WWKC 4LLQB 3QFJE 1WSST 1A7OL 4EDWH 3IJSA 2BCKA 1QNZL 4B7LA 2IH3A 4LSRH 1EO8L 1OAYH 1G7HB 3OG4B 4Z0BH 1E28B 4RGND 5DJ0A 5HI3D 3VFWA 4PRIB 3TZVD 4M8VA 1BD2D 4BFIB 3GSQA 1KYOK 3IXAA 4FQXD 2B5IC 2HYMA 4JHBA 1HKLH 3Q3GB 2PYFA 5ISZE 2Y7QA 3BP4B 4JDZB 5LCVL 4CMHB 3BZEB 3G5ZA 5IFAH 4YHKH 4LQFH 4U6VL 1Z9MA 1Q1JL 4M4PA 3FAWA 2AEQH 3QULA 3CPLA 2ID5A 3WXWL 4JHWH 2B8OT 3TFKC 3EO1B 3KYOB 1T20B 4PJFB 2ICES 3O41B 2HTKC 5DDHB 3TO4B 4KRPC 1IMHC 4OZIB 1YEIL 2DQFB 4JFZL 4GG6B 1NFKA 5C0BE 1N2RA 1AGFA 2MPAH 3T77B 1XF5A 4MNGB 5IEHB 5DF0A 2F53D 3OAUH 4JFOA 2E7LA 5F7UA 3EOYG 3TYFB 3TA3C 3MLXH 1HEZB 4FQQB 4MSWA 5HPOA 1IL1A 1NFDA 2APTA 2ADIB 2QADD 3CVIH 3ZKQD 5J56B 4H1LB 2E7CA 1ITCA 4PJIB 5CGYC 2V5YA 5E1AB 5BQ7B 1EERB 4HFWA 4JQIH 3LKRA 1IGTB 4GBXD 4XXDB 5B39B 2X1QA 2IF7A 1PG7H 5F7HA 5EC1A 4X5WB 1NC2B 1GOHA 4OGYL 5C0CD 2PXYC 4RISH 3BQUB 1MCWM 3H8NA 3UZQA 1WIOA 1AP2B 5DHYB 1LO4L 3FB7A 3TCLA 2CDGB 1KNOA 3HG1E 5INCA 4M6AA 1RZKH 3C9NB 4S0SD 5C09B 2XWTA 3QDAA 2R29L 1LGVA 4MNHB 1F5WA 3MLSH 1KB5B 1HN1A 1MEXL 3HFML 4TUKL 5T1MB 5D8JL 4HG4J 2J8HA 2L7UA 3LMJL 5A1AA 2Y72A 3UPRB 5DUML 4ZODA 4MHHG 1KELL 4DOHE 2BNQB 2V7HA 1EHAA 4M7ZB 4PRIA 4UAOB 5GS0H 3WN5A 1ES0B 3FQUB 2DKUA 5DQDL 5FYLL 1IKNA 4CRPA 3BZ4A 4JY5L 4UB0H 3Q0HA 3DRQA 1XH3A 1YEDA 4IBLT 1ZS8A 5FV1L 4X7TA 1KUMA 3RBSA 1NEZA 2GSGB 4L4VD 3DUUA 3CH1B 1MIML 2YPKB 4Q0XH 1E6JH 1M6OB 3KPRA 15C8L 2ADGB 3X3FL 4MNQA 1O0VA 2X4TA 3DYPA 4YIQB 4JQVC 1JI2A 1ZVSB 5F1IA 4DN3L 2M8XA 3TNNA 4U1SA 4N5UA 4OKVA 1T20A 5EO1B 1XGQA 3V5DA 3P77B 2A73A 3JXAA 5HHOA 1NUNB 1RJYA 3ILQD 5DJXA 3KYMA 3SJVB 3MRKB 3PQYB 4LHUB 4HWBH 5DFWH 5ID0B 2X4RB 5F9OH 2GW5A 5GISL 5DJAA 5KSAA 3QCTL 2WWKO 4Z7UA 3U83A 4BUGA 1EXUB 4AG4L 3LN5B 2P5EA 4XH2B 2H3NA 4QLRA 5A2IH 3CDYA 1XGUB 1MFEL 1BQLH 4LHQB 1ZLSL 2CDEA 3GSRB 1SYSA 2R29H 1IKNC 3HC4H 4NRZB 4KC3B 2VLJE 3FT2A 1BZ9B 2RB8A 1IEBA 2VLKD 1RIUH 3MR9B 5EU5A 2Z8VC 4OCRL 4ZOBA 5BMFL 1EJOL 1LEKA 1IFHH 1FSKC 35C8L 3DRTA 4JJHA 4LAQL 5L9DH 3KLHC 3MCLH 1CFSB 3WLBA 4EVNA 2ICWI 3IETA 4KV5F 1AGDB 4X6DE 3O4OC 4ODSL 2FEEL 1LMKA 1CL7L 4JR9L 4MHHI 4FFZL 1AXSA 1CXKA 3QDMB 4NZUL 3WFCH 3I6LE 5E00A 2W9LA 1ONQB 5DTFA 2H32H 5DHVA 2R1XA 1IJ9A 3SGJA 5IB5B 4HWEH 3O3BA 4X7CC 5D1XA 2RAMA 1TENA 1B3JA 2XTJD 4HF5H 4QXUH 1T1WB 2DBJA 5DRNB 3P11L 4EI5D 5HYFA 4LVOB 1NAKL 2CIIA 4HCRA 1OGAD 5KS9E 2BNQE 1MCFA 2X70A 5JPMB 1HIML 2P48B 2WBJB 3BZ4B 4G9DA 3QYCA 3EO0B 1UGNA 3LEVH 4PJ8D 2YN3A 2FEDC 5E8DH 4LSQL 4O58L 1J1OH 1DE4B 3GJFK 5EO9A 1FN4B 4OZIE 3NPSB 1T83A 1XGRA 1RZJH 1UWEH 3CH8A 1F3RB 4M7LT 4QKXB 2ORBH 4IM8A 4S2SB 5D1ZA 4XB8A 4UUJB 5GRZA 2D7MA 2DQGL 4HAGA 1G7PA 2R9HC 4DAGH 2WIIB 5F8QC 1BQUA 2R2EA 4I2XA 4P48A 1RZIA 1LO0L 2D03H 1NDMA 5E94A 3PP3K 4GRWF 2VABB 2A9ML 1A7PL 3LOWA 4U0QB 4XP4L 1EBAA 4WI4A 5CIPA 2EKJA 5EOCL 5KW9H 2IFFL 1MOEA 5GRYA 4EIGB 4ORGA 3IGAA 4PJXE 4IIQC 1FPTH 4NN6B 4XGZA 2W07A 4S1QH 2P5EB 4XH2A 1S7WB 4YHYB 3PWPA 3N85L 1G7MB 2AK4A 1EJ6A 3AS3A 3GSRA 5I71B 2QQKH 3PP4H 3V0WL 3CFBB 2ZP0T 4HC1L 1CF8H 1RI8A 1GGCH 1X7QB 4U1IA 3I9GL 1NC2D 1S7RA 2KH2B 1P4BH 1WVZA 4PRBB 5CFHA 3IXTA 5EU5B 4ZMAT 4DEPC 3D0VB 1HKFA 1KLUA 3B2UD 1JCKA 4PJCF 3DRTB 1R24B 3SGDH 1DUYA 3W2DH 4AT6A 3BFOA 3EYOB 2DWEA 2DKSA 3E6FB 5DK2B 3BPCA 4OB5L 4IOFD 5GGUA 5DA4A 4FFVD 4GMSH 4WW2B 2CLVA 3MJ6A 1RK1B 1BFSA 1TVHB 2QQLL 3D0LB 3O2VL 2UYLA 4OCLC 5F96L 2VZSA 5GGTL 5BRZA 5DHVB 1TQBB 4OQTH 3Q5OA 3S88H 3ARGC 1OP3H 5D96B 5BXFB 3RGVA 2XZAL 1H0DB 4XPGH 1GVIA 1YMMB 3FCTA 3GNMH 4F8TA 4POYA 1CD8A 2DLFH 5FOBB 1N5YL 5A3IC 3OKEA 4R4BB 4GKNB 1MFAH 3QDJB 4XWGL 3RQ3A 2FZ3B 2JCCE 2BXYA 1A4JA 1WICA 2NY6C 5DWUL 5K33A 4XHJD 5EUKA 4FNLH 5FGCB 4U31A 5DJYB 3QO0A 4U7SA 3CFDA 4ZXBB 1G9MC 4F58L 1AI1L 1AQDA 4M1GH 4RQQA 5EO9B 4IJ3C 1D6VH 4ENED 5F72S 3RNQA 3AUVA 5F1NA 1MLCA 4YXHH 2CMRH 2FHBA 1L7TH 5EUOF 1JGVL 4ZFZA 1J5OL 2YHGA 1HDMA 1FC2D 4ODVL 5HGAA 1TNMA 1ZXQA 3QUMA 3KPPB 3TIDB 3M1BB 4ZNEA 5IHZB 4PJDB 5JW4R 2PO6A 4YHKL 3PWLA 1I7ZB 4X8JB 2BY3A 3BE1L 5IG7A 4NQDD 5SX5K 2A77L 1WUNT 3RPIA 1MHPL 1JV5A 5D7LD 4HBCL 4KQ4L 5IB2A 3FN3A 1ADQL 4U6VH 3MZTA 4OLUL 5F7FA 3KPTA 3RDTB 2ITCA 3UAJC 4P5MB 3I2CH 2AK1H 2VDQL 4J3SA 5KN5A 3NFNA 3UTQA 3CIQA 1GXEA 2XRAL 3B9EA 4Y19A 4KFZC 4MB3A 4L4TE 3VCLB 4PJAB 4I0PB 2QKIA 1HHIB 4W4OA 5D72L 2X4OB 2J6EA 4AIOA 3IYLW 4M7LL 4KHXL 8FABA 2VIRB 3VXSB 5DD6B 2UWEF 1FG2B 2XV6B 4JO3H 5DMJB 3HC4L 5ENWA 3AB0C 1KTLA 3F12A 4K7FA 1HH6A 3ARSA 3QHFL 4NZRH 4OQTA 1I7RB 1AKJD 3JVGA 3L3JB 4PBVC 1QBAA 4N9OB 4X99B 4LLUA 4G5ZL 3GHEH 2HKHL 2D0GA 4P9MH 1BIHA 5FHAH 4YX2H 5CBAA 5D4QA 3L3HA 3WDHA 1JRHI 5I1HH 4NKMA 5C0DA 4QRUA 3NCMA 4L9LB 2CXKA 3VXRE 4ZDHA 1WAAA 3GRWA 4GSDH 4AL8H 2NLJA 2AP2A 3WFBH 3FQTA 3NH7L 1NANI 4LNRB 4M5YL 1D9KB 5C0AB 2WLZA 3KDMB 2VDNL 1C12A 4GW4A 1L7TL 4NSKA 3FMGL 1A4KB 4NWUH 2XACC 3WIHL 4OSUH 5ADPH 4BKLA 2OK0L 4XPBH 3VXSD 4KI5E 5D6DC 4LEXH 2APWA 3QO0B 4XBGB 3FAXA 1EA9C 5D2NA 2YR3A 5LGJA 4N0CD 1BHGA 1N6QL 3DI2B 4NUJB 4HXAH 1PEWA 3KPMA 2GCYB 5BW7A 2NZIA 1S5IH 2Z4QB 1T1XB 3JTSB 3WHXA 2IBZX 4DTGL 4HK0B 2K3TA 1BFOA 1TZGH 4H25B 5JHLL 4HDIA 5JORA 3NABL 5TDOA 1AY1H 4LCWB 2GTWB 4R8WH 3U0PA 2BHUA 3W9DB 2ZNXA 4JB9L 1EO5A 2DLIA 3W0WD 1JV5B 2PUQT 4U7MA 5IB2B 3T4YA 4JO2H 2EDBA 1KJMA 1ZT4B 3EOAA 3KPQB 4C55A 5JOPD 4KROC 3NMEA 3LKPB 1ED3B 4MZ3A 4I0CC 4WNQA 1AGCB 4MD5A 5FF6B 3RNKA 3S3JA 5KN5B 4RDQG 5DI8A 2IPKB 1NJ9A 4QCIA 2HRPL 3UTQB 3H9SD 2FSEA 3RZCD 4GKZA 3ZDXE 1WQVT 5IVXE 5I0DA 3CFEA 4GKSB 2MTPA 4TSAH 4QRTB 4I0PA 4H26B 2JCCB 2YD9A 2XFXA 3FFCA 1A6VL 3DSNA 1DBBL 2XN9A 1ZT7B 4XTRD 4X4YB 2NY3C 5IVZB 5I75B 2ZUVA 5E8OB 4GAYA 4M5ZH 2XPGB 4DGYL 1MNUH 1YN7B 4G7VL 2BDNL 1VEMA 4DZBA 4X6EB 3VXOB 2BOCA 5ADOH 5E2VH 4ZOEA 3G04A 5E56A 3O2WH 1TETH 5C0EB 2X7LB 4PTTA 2XT1B 5HDBE 3EHBC 4KJYA 4WUUE 4YHMH 2HKFL 4KK5C 4P23D 4N9GB 1UQSA 5BJTA 4HPOH 1KBGH 5GRVL 3UTSA 2VLJB 3IKCA 5ESQA 5C92A 3RVVD 4P2OA 3QIWB 1FFQA 3EZJB 1AGBA 1UB5B 2J5LB 4GMSL 1BEYH 4JKPL 3MLTA 3MBXL 5JOFA 3QIUD 3KDMA 5DLMH 2JB6A 2J12B 5SX5H 5HVFB 3B3IA 4GW4B 4KY1L 2BERA 3GJEA 4L8SB 1I9IH 4WTWA 5FGSA 3MJ7B 4A6YA 5I8OL 3QWRD 2OLDA 1E4KA 3P73B 1QBML 4LSUH 3F7VB 4QHUA 4NOFA 1IKFH 3ES6A 2YC1B 4BSVB 2BMKA 4GXVH 5L8LB 2CK2A 2A6DA 4YR6A 5F1KC 4G6ML 3DBXA 4QWWC 1A6ZA 1FQ9C 2Z35A 2OXGA 5DJDA 4QRPD 2CGRL 3MRRA 1WBYA 1QRKA 5DQ9A 3FT3A 3C5ZC 3SQBA 4HMEA 1Q94B 3NZ8A 5MENB 5ALCL 4DGIL 4H5SB 1IEAB 4FMFA 4XNMB 1LO5B 1LHZA 1KXQE 3MLPA 5EFIA 4WUKH 1J1PL 3VGAB 1JNLH 2IGFH 4EN3A 4RA3A 1NFIA 2WINB 5EA0H 1I8LA 1LE5B 3ULVE 3FOLA 4MQTB 1QA9A 3VWKD 3MRIB 1F8TH 1BJMA 3C09C 3QWQB 5ICXA 4QHLA 1ORQB 5IBTH 4MCYA 3HPLB 3EJYD 4W6XB 4M48L 5FF6A 3MACH 4G3YH 2X1WL 5GGRY 5T5NF 3DGGB 5KVEL 3O4LE 5EO0B 4OM1L 3BH8B 4YH6A 2P24A 3EFDL 4JGJA 3BP5A 1R3IH 3M17A 5GGVH 1G7IA 2ZJSH 4ODUB 1VENA 3V6ZA 1X5KA 4X4YA 3HC3L 3EYQD 5JXAL 5IW1B 4OLEA 3D9AH 3DO7A 3DLQR 3S35L 1FNEB 1RVFL 4UNUA 1CBVL 3U46B 3OSKA 1MHEB 1E4XL 3MBXH 5JA8B 4OM0L 2EE3A 3U4BL 1J0HA 4R0LC 1UCBH 3NAAH 3GMRA 3CGTA 1F4AA 2WP3T 5SWZE 4B53A 5GQBA 1IC4L 1ZHKB 3F7YA 2DQUL 4QHKI 5L2JA 3QAZB 1I4FB 2P1YA 3H2WA 3V5HB 4G6MH 1I9JH 3KWWB 1P2CA 3SPVA 2DYPD 3VXSE 1RZ8A 4HHAB 5GHWH 4OFYA 3QIWA 5E9DB 1MCKA 4TUOB 5IVXF 4HKZA 1M7DB 3QXDA 4PPTA 1DQMH 2P45B 2E6JA 5L0QB 1B9ZA 5F9AC 5DRWA 4FXGB 3Q5TA 4M5YH 4ZXBC 2GJZA 1P7HL 4Z95L 1KJ2A 1FRGH 3CXHJ 2BMKB 4NZTL 4JFFB 3X3GL 5GGTH 5T3XH 2FHFA 2DQDL 4I9WD 1K2DA 3S35X 2FD6L 3PNWA 1UKTA 3GIVB 1ADQA 4YPJA 4DFHA 5F7WC 2N56A 3U7YL 4XCEA 3BN3B 2X40A 5GGQL 1SJHB 5DEGB 2IWGA 4ZPVB 1MRDH 4OTXH 3RL2A 1KTKE 1Q8MA 4CN1A 4U1HB 1KEML 1RAMA 1MCPL 4Y16C 4QNPF 3OGOE 3S4SB 1CGSH 4NQUA 5D7JB 3OKLA 5IR1B 1CDCA 1RK0A 4J7RA 1YYML 4G7YH 5E6IA 1UH4A 2EYSB 5I8KL 1REIA 4PJGB 3QUXA 4R7NA 5HGBB 1TVBB 5ICXB 2VSCA 4L4VA 4IHOB 4HIHB 3ZKND 2H26B 2X10A 5IHBA 3MRMB 1ZHLA 2Q87A 1I3GL 1MJ7H 5DD1H 5I1IL 4HF5L 4HIIB 1XFPA 5GS1B 1SHMA 1FZOB 3JTTA 4HIXH 2P24B 1JHTA 32C2A 3ECBA 5IVXA 3I02B 3QH3A 1KELH 25C8L 3CFCH 1G84A 3LHPH 3WUZA 4A2MA 2LTQB 1QG3A 1HZHL 4OCXL 1KEGH 4M7KL 5E1HB 3OAYH 4KZDL 1QTYT 5K59E 2AJSL 4M8QB 3WE6A 4JRXB 2I9LA 2BNUA 2APXA 5FDWA 2B1AL 1R3KB 5D1XD 3MRNB 4JLRB 1YJDC 3AC0A 4OCMC 4TPRL 1BZ7B 1RSFA 1GPOL 4ELMF 1FVDB 3OGCA 3FN0L 2PCPB 1K9TA 3DURB 4M03A 2H1PH 2UY7A 5BVJA 4NQSB 5FYJL 1DBAL 3ULUD 1NH6A 9CGTA 3X3FH 5J13C 1CVRA 4DKEL 5D7JD 3A67H 1T22B 5CHNB 1AR1C 1FL6A 4GG8B 1PYWB 4O2EA 4DN3H 1DQDL 1EVUA 3MREB 4K8RD 5E5UB 3VGAC 2BOBA 4TULL 4ZPTA 1DQQB 1V3MA 1FO0A 2EEAA 4G6FD 1ZTXL 1YJDL 3OKKA 1BEYL 5ID1B 2VZOA 4UTAH 4OF6A 2EIDA 4UINL 4CDGC 1U0QA 1S7TA 1K4CB 1DANU 1S9WA 4NCC1 2XWJA 2FCBA 5F9OL 3SDAC 4QF1B 3AU1B 3JV6A 4GSDL 1BJ8A 3LZFL 4MJIB 1AIFB 5J6HA 4XAKD 3ARDB 4CVZB 3IRPX 3LB6C 4J4PD 4MJ6A 5E9DD 3LEYL 3GRWH 4NKDA 2JJSA 4GQ9H 3ULVD 5EBMB 2OM5A 5EORL 1U8MB 3MOBL 3NIGE 3QUZC 1FYTA 4PRDB 2BSSB 1QFPA 3TBWA 4MNGE 1FLRH 4JAMA 4TUJA 3ZKXC 4RMWA 3BEWB 2BNRA 2NY4C 2OJEA 3JV5A 1HSAA 4JRYD 1MJ7L 2X4NB 3RWIB 2K9UA 5E7FA 4KROB 1R5WB 4JM4H 3LKQA 5C08D 1KULA 2YA2A 4QY8A 3U0TB 4MAUL 3EO9H 4LAQH 1SYVB 1JNHA 2XQBH 3RWGB 2F54A 1YEKH 2YD5A 1SEQL 3V0WH 4BH8A 2YBRB 1MJ8L 4EN3C 1UM6L 4JCMA 4Z76B 3W0WE 4WU5A 5GRJH 4Y8AA 1CE1L 2RHEA 2D7TH 2VE6A 3WKML 3CMGA 2JJUA 2GJ6E 2C1OA 1C16B 1EGJA 1CFBA 3RWJA 1QRNB 3UTSD 4H0IA 3TYGH 3EGSB 2HVKB 1OW0C 4HWEL 3GMQB 3QIUA 5I1LB 4ZD3H 2XI9A 1EMTH 2QHRH 3CZFB 2C26A 3JUYA 2G2RB 3NFPB 3KVQA 4Y2DA 4ODWA 3UDWA 1GZQB 5SWZB 3QB7C 1AFVH 1JGVH 4NM8L 4JFED 4NT6A 4JN1H 1R3JB 3BH9A 3JUZA 2CR3A 5GGVY 6FABL 3LH2H 1IC5H 3IDJA 5J12C 3P9MA 2H2SC 3P4MA 1R5VB 1HNFA 4FQHA 3NBNA 3QFJD 4LRNH 5FCSH 3O4OB 3E6HA 3FQRA 1T03L 5DMKA 4O2EB 3H3PH 3GRWL 3IJYB 2IJ0C 5CZVL 1XR9B 5H2BB 1MJJB 3LN4A 2J8UA 4ZO6A 2DTSA 5FUCE 5AG9A 5F7KC 5MEOB 1FIEA 3I2CL 5C9KA 1PLGH 3PDDA 4JDTL 4QXTB 5HHQA 1SJVA 5J7CC 1QFUL 2E6QA 3HB3C 5FYLH 1NUFA 1D5IH 1T4KB 3H9HA 3S36L 1UWXH 5EOCH 2P7TA 3CDGB 5IJKC 4NRXB 1N7ML 4MJIA 5J6HB 2R23B 3QHZL 4LASL 3TPUA 3VRIA 5E0QA 2IMMA 1FPTL 1W8NA 4QGYA 3ZHKA 1X5FA 4P4KB 2A6JB 3DXAE 4XNXL 1YEFL 1IGJB 2CQVA 3MOAH 5JW3H 3QXUA 4RMQA 1G9ML 1CF8L 4CAGA 1U91A 5J89A 1V3KA 2C3VB 4EXPX 4Y1AD 1ODAA 4PJDE 1BX2B 2ATKB 3LKQB 3GKWL 1ZLVK 5J11C 3LQZA 4CMMA 1MCJA 2Y4SA 3K46A 4IOSD 3UC0H 3X12B 4QWWD 4JY5H 4LDLB 3LB6D 4MQSB 1L6ZA 1H5BB 4MXQC 4P23A 5D5MB 5DJCB 4XCCL 3L3OB 3FQXB 5B8CC 5C86A 5I1AB 2HWZH 1FFOB 2DQHH 1JF5A 2F54B 2AI0L 3HZKA 3GGWA 1G7HA 2Y5EA 3H9YA 4JFEA 2Z8WC 5IVOA 3DX7B 1MCQA 5BW7C 4KHTH 2AJ3B 4DGVH 3MRDB 3MROB 5B8CA 2CK0H 1GAFL 4AH2A 4Y1AA 3L3GB 2FGWL 2Z31B 3UJJL 5JHDA 4QOKD 3BPOC 1JPFB 4P59L 2V2TA 4R7DB 5F3HA 3HR5A 5CMAB 5F6HJ 5C0ND 4Z7WE 2ARWA 4AQOA 1HXYA 2FO4A 1VACB 4BSWB 3PWNA 1FE8L 35C8H 3W0WB 3EDKA 5E6ID 5C7XL 1U2HA 1SM3H 5KVEH 1NUGA 3SE8L 2XTJB 3X13A 1B0RB 3UBXG 2OZ4H 5C09E 2BVUA 5D2LE 5KSBF 3OXSA 2OMNA 2OL3B 4U49A 1EAPA 1W0VB 4NM4H 4F58H 3QUXC 3HE6C 3KYOA 3MCG1 4PJFA 3PUCA 5FOJA 1IAIH 4TRPH 3F8UB 1NCCH 1QEWB 5F3BB 1PFCA 3OJ2C 3FN0H 2ADJA 3RIAF 3MNVB 4NO0A 5IB3A 3AAZB 5GGTA 3UJIH 1XF5B 5IEHA 4OF3A 3RL1A 4WU7B 2VLKA 1J1XH 3VFWB 1MFCH 1DEEB 5E8EA 3TJEL 3IFOA 4C4KT 1U92A 1JUFB 3Q1SH 3MRLA 3QEGL 4D9RE 5GS2D 3DMMD 4OF8A 4LVHC 5IBLD 4L3EE 5FFLA 2UV3A 5E5MB 7FABH 1W2KT 2P46B 4HC1A 4XMKH 4APQC 1EEUA 5HDOA 1FG9C 5GZND 4PREB 2EZ0C 3TBSB 1H8NA 2X89A 1KGCE 2FL5B 4PJHB 1EAJA 3GBML 1LEIA 4RA0C 1BP3B 3L1OL 5J6GB 4JFHD 3TBYB 1ZGLM 5CEZL 4GW5B 4YDLB 3UJJH 4EDXB 1FFNA 2JIXD 4XZUB 2BSED 3U7YH 3DX6B 3OTTA 3HZYA 3CU7A 3A6OA 5T1MA 3BQUD 3MUZ1 3W5MA 5HVGB 3EJJX 1A5FH 5CLTA 4U1JA 5J12B 1FE8H 1A64A 2DKMA 5H37H 3ULUF 2ZG1A 5JQHC 1T5XA 1Z5LB 3AM8C 4FQ2L 4P9HL 4PG2C 1Q72H 4LLYA 1LDPH 4PRPB 4UT9L 3MRQB 3DWTA 2R69L 4ELKA 5JPNB 5IW3A 4NQCD 1MPAH 3KNBA 3ARGB 4IDJH 3DVNB 5FHBH 2DMKA 3QCUH 1XH3B 1YEDB 3ZTJG 3LAFA 1IM3A 4ISVA 3WIIL 3IDXH 3QIBA 1U9KA 5D7LB 3TF7C 1FO0L 3U9UB 5L2KB 3QUZA 5FO7A 4HJGA 1KC5L 4OCWL 4FTVA 4NN6C 4U1MB 3LN9A 3SGKA 4M6NL 2VITA 5FKPB 1I9RL 1JYNA 5ABDE 1QQDB 1S9XA 2DIAA 3O6FC 4P46B 4AENA 4DZ8B 3SDAA 1KEGL 4C56D 5T1LB 1QLEH 5HDLA 3FFCD 4IRJB 3H0TA 5IB3B 2VUYA 5J3HC 1M7IA 4CNIA 3H7LA 1LO3L 5IK3B 3KLHD 3LKOB 4AQ1B 3U6RB 4WHDA 4LPWA 4NN7C 1KTDA 4OZHB 3HTLX 5AZEH 1CFTB 4X9BA 1B4RA 5TE6H 3FB6A 1KN2L 4TSCL 4U6HA 4LARH 2UY6A 1T5WA 2DQHL 3CVHL 5D2NE 1SYSB 2AJXH 2FR4B 3FT4B 3HC3H 4CVXB 4OZFB 1KB9J 1E4KC 4Y2OA 3QWOA 4X7SH 2DL9A 1MAKA 3HUJE 5E9DE 1GGIH 4IRSB 5ITBL 1ZVSA 2YD2A 2F54E 2Y23A 4GRLB 3MV01 2FBJL 5JDJA 5E4IA 1YEFH 3SKMB 1A7NL 3P77A 1WEJL 1I1AD 1QSFB 5T5NG 3MXWL 1MPAL 1G9MH 1XF3B 3VWKB 4ZFOB 1ADQH 3EDJA 3WXWH 5F97E 3TO4D 4JHAL 1LQSR 1CDUA 4UIMA 1IM9A 3WBDA 4KPHL 1FLRL 5HJ3B 5IMLA 3VMNA 2QTEA 3MJ8A 1EXUA 2OTWB 2CJUH 3CSYA 4MMXC 4Z18A 3PDOB 1A1MA 3VE0B 4OI8A 1IAOA 3EOTH 4GMTH 4IEFB 1FBIL 1K8DA 5GRXG 3G6JF 3NFSL 1OTUD 4KHXH 3RVVC 4F33A 1GOGA 1U8PB 2C3GA 3HC0A 3VMPA 3X3GH 1FL5B 3QQ3B 3J7HA 4Y4HA 1C7TA 2ESVE 4I18A 4LVNB 4XVSL 3QIBB 2AJVL 5DMYA 1VFAA 4GS7C 1IKFL 2FX8L 2Q86B 3S98A 4O2CB 2JF1A 4OF7A 3LQAC 4O02L 2PTUA 1J1OL 1OQOA 2IANA 1F97A 1U2CA 4Z77A 3GSQB 2X1OA 3D3VB 1D6EB 3FB8B 3OG6B 3IJHB 1T89A 1I7TB 4QXGH 1YA5A 4P4RB 4GRMA 4NNPL 4PFEA 5M94B 4Z7OE 4OLVH 4F7MB 3N0PB 3LSOA 4HXBH 3Q6FA 3QCVL 4IRJA 1T2XA 4K7PY 2P5WD 2PYEE 4NZTH 3MRPA 3MLRL 2F8OA 4I4WA 4ZS7H 2BSTA 1FFPB 1J1PH 5HGGS 1VGKB 4XI5D 3MLUH 3LS5H 4OZ4A 1JNJA 1CFVH 4PJ9C 1MCSA 4NFCA 4PGEB 1EZVY 1UJ3B 4F15B 3RUGF 2W0LA 4C83B 1WZ1H 5DRZB 3WO4C 3MV7D 3SOBL 2X70B 5JPMA 3HNSL 1OY3B 5E95B 1U3HD 5JIPA 2P42B 4U1GC 4F7TA