4DGVH

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody hcv1, p2(1) form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
226
structure length
226
Chain Sequence
EVQLLESGGGVVQPGRSLRLSCTASGFTFNNYGMHWVRQTPGKGLEWLAVIWFDENNKYYADSVRGRFTISRDNSKNTLFLQMNSLKTEDTAMYYCARDISLVRDAFIYFDFWGLGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords HCV1 Heavy Chain
publication title Structural basis of hepatitis C virus neutralization by broadly neutralizing antibody HCV1.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2012-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dgvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dgvH01
4Y16C 3RWCA 2WUCL 4HIHB 5HHQB 1A6VL 2Q8BH 3SO3C 4U1JB 4CMMB 5EZOH 1UM6L 5AYUH 1DUYB 2AVGA 1QR1A 3UX9B 3WNPA 5FCSH 4NHCL 3HC3L 3OG6B 5T1KD 3EKCA 2V5TA 5DZLA 1FAIH 4ZUVA 3UYPA 1M7IB 1LP9F 4NM8H 1MRDL 4LKXA 4LLVA 1P7HL 4WCYL 1H8OA 3QHTC 4DZ8A 4RNRA 3WCYA 3S5LA 1A7RL 4LFHG 4OF0A 4RMQA 4UTBL 1GXEA 2XKNB 3BZFA 4BUGA 5T3ZH 4LRNL 4PRNB 5FK9B 5DQDH 5DJYB 2W65A 3TN0B 4S1QL 1PDKA 3DYMA 4N8CH 3OAYH 5AG9A 2Z35A 3ARVA 4DCQB 5GGRA 2JTDA 2EIEA 2M8XA 1DFBL 5HYIA 4F7TB 4XVSL 3ZZ1A 1S9WB 5MHSE 2YWYA 4D8PB 2DQIL 1KGCD 3VXMD 3T65B 3X14B 1G7HA 3WFBH 4PGBA 1H3GA 5FCUH 4M5ZL 5E08L 4TPRH 1UQSB 1JWSA 1YEIH 2BX5A 4MWFB 4LHQB 2ICWA 2DICA 5E6IB 5HGDA 4U1NA 3RP1A 1INDH 2XYCA 3D6GA 1RK0A 4JHAH 4MA7L 3DTXA 1R3KA 5C2BL 1NFIA 4G42A 3IYLW 5D1ZD 3GB7A 2VLLA 5MENA 2YBRB 1I3UA 5D6CA 2ICWJ 1T5XB 4HIJB 3PNWA 4P2RE 4I9WD 2FL5B 5HD8C 1CQYA 3QIWC 2ZUWA 4JFEA 4UILH 4P4RB 4NWUH 5C0CE 5I8KL 2DYPD 1MLCB 2XWTA 3DYPA 4LHUB 5KANI 4XT1C 4FQIH 2F5BH 1NC2A 1MJ7H 4OTXL 1HH9A 1VFBA 2R4RL 5GRZA 1MRFH 4YDVA 3KPRA 5I1IH 2VSDA 3TIEA 3TO2A 3RIAF 4RWHA 4OKDA 2CLRA 4X6EA 5FO9A 5KS9E 3W2DH 3MJGX 4G6AC 5SV4A 4J4PA 2Y23A 3PGDA 2NY5C 1SEBB 4XNQB 5ICZA 1JNJA 5IQ9A 4NRZB 4FQ1H 1FG2B 1YNTA 3SBWA 2EDXA 4J12A 3CDYA 4NQCA 4E5XA 3V4VL 4YHOL 4JZNA 2W0LA 3QIBC 1ZA3A 3RNKB 2VO5A 2YC1B 4Y5XC 1ND0A 1JTTA 1WBZB 2RHEA 2DM4A 5B8CC 1CXFA 4QRTB 5L88L 5MEPB 1G9NL 3QZWG 2XY1A 3BHBA 3LRSB 2C7UA 1FO0H 2O5XH 3TBYA 4EQ2A 2Z8SA 3V79C 2ZUXA 4XGZB 2QHRL 5LAXA 4OGYH 1C5BL 4KDTA 5C9JA 4R3SA 2Q76A 4RX4D 3CVHA 4Y4HC 5DS8B 4M1DL 5F71A 4OIIL 2A74A 3SDCB 5F1NA 4G8IA 2A1WH 5EZIL 1PAMA 4OD2B 5D7JD 3STZB 1MLBB 3O11B 2HRPL 3HI1A 1V3LA 4UINH 5CEZL 1NAML 1IQWH 3V6BR 1IQDB 2HLAA 2BXZA 2VERN 4NQTA 2DDQH 5CBAB 3WFCH 2CIIA 5IW6B 3SDDB 3U7YH 2CH8A 1G7PA 4HT1H 1JPGA 4XNXH 1FZKB 3TLRA 1MAMH 1B0GB 5FHBL 4MQTB 4L9DA 5FYLE 5JHDA 5EBWB 4Z95L 4XCYB 5I8OH 2DBJA 2OS7A 2NY6B 1WF5A 2HG5B 4XZUB 3QO1A 1TIUA 1MY7A 3FL7A 4YK4B 3MACL 2ZPKH 3NMEA 4MNGE 5KSBB 4A6YH 3M45A 2V2TB 1UXSA 1GGBH 3BEVA 3QXDA 2ADGB 4GRWB 1QFWL 1XIWC 1FGVL 3FQWB 3C9NA 3OHXA 5F9DC 5EO1A 5IB5A 3AU1A 2CPCA 3VWJC 4IOFC 1EPFA 1HEZA 4ZAKA 5B22A 2CKNA 4MNHB 1MIEL 1QVOA 4OCXH 3GJFK 4AY0A 3NFSL 4Q6YA 2R2HA 5GS1A 5BZDA 3BN3B 4YFLI 4TNWF 4NRXA 3IKCB 1DLFL 4JY6B 2P5WA 3T4AA 3GUTB 2BVEA 1DEEA 2MQ3A 2X4TA 4UT6H 5HHPA 5JW5A 2ICEA 3OZ9L 1XGRA 2NTSP 5SWZB 1UEMA 3H42L 1LQSR 5K9OA 1HK6A 2WQRA 1XH3A 4G6FB 4PJ8B 1ZA6A 5FA4B 1F4XL 1DQJB 4KVCH 3PP3K 3L3OA 2ATPA 2WNGA 5HYFA 2F8OA 2F9BT 3IU3B 4H25B 4XC3H 1CG9A 4Z78A 1CT8A 4KJWC 4BQCA 5J57B 3CFDA 5JR1L 3PXJA 1CDYA 1MJJB 4HKJA 3WIIL 3DLQR 4KMQA 5DJAB 2WM0A 4YEEA 1HI6A 2VISB 3BP6A 4KK6D 5IM7B 3KLHD 1AC0A 1ZEAL 1IFHH 4WU5A 2MCPL 3U9UB 3UTZA 2AABH 1IKFL 4XPAL 2X4NB 5D5MB 3U48A 4EDXB 1G6RH 1ZSDA 2VOTA 3L3GA 4HZAA 4JFFE 3UROR 5KOMC 1MQKH 5I17B 3BSZH 1UWXK 4LEOB 4KJPC 2GSIA 4XCEA 3T3ME 1LEIA 4I3RL 4OI9A 1MCNA 4FQCH 1LDPL 4IOIA 3QUYD 4NN6C 3SGDI 1XZ0A 2CSPA 3DSFH 3WEXA 1U8MB 4PP2A 4GXVL 2NY2B 4YH6A 5DD1L 4PB0H 5EU6B 5HHOE 3F12B 5K9KA 4BA8A 2VZTA 1CK0L 4WHYH 4JKKA 5IHUL 1RVFL 5I1EH 5C0IA 2IMNA 5EA0L 2AJYL 5BVJA 1WZMA 3U0WL 1WCBB 2FIKB 3V7MA 4NOFA 4L4TE 2BY0A 3ET9F 1SM3H 2BVPA 3LH2L 1OVZA 4U6HB 3ARZA 4OAWB 4WW2F 1AR1D 3SKNA 4K8RD 5I18H 2R0LH 4HF5L 1DBMH 4GS7C 1HH6A 5IOPA 1CLYL 1GHFH 4TUKH 3GM0A 3K3QA 3PWUA 3KYKH 3VD3A 3SOBH 2EYRB 2C1PB 2Z91A 1PSKH 3IJSA 1U93A 1XCTA 1P53A 2A77L 2WANA 3LMJH 4TNVK 5SV3A 3E8UH 2NX5E 1UM4L 4JKWA 4NJAL 3VCLB 3SJVE 5IEHA 4BH8B 2NR6C 1S7WB 4PRIA 1ZE3C 3SN6N 2D4FA 4KTDH 3DV6B 5ESQB 5KJRL 1II4E 2AV7B 3MBXH 3QUZA 5EN2A 1CS6A 3KPLB 3MLWL 4WI7A 3N9GH 1TZIB 2YRPA 1YEGH 5BJTA 3P4NB 1H3WM 1C5CL 2P42B 5DK3A 3X3FL 5DVOA 2HTKD 3DHMA 4JDTH 4DKEH 4H1LH 2NTFB 5I66B 3HA0A 3WV0A 3DRTA 2H8PA 5HYJE 3PQYE 4XP6H 4L8SC 4HWEH 4Y4FC 1WIUA 3PV6A 1RUML 4AM0B 1KC5L 1MQ8A 4G6ML 3KG5A 1U8KA 1XCQB 5DJ8A 3LVEA 5E1HB 5L2KB 3T09A 2YD2A 4JM2A 1T03H 4GJTB 1FDLH 1R5WB 1KN2L 2H45A 3TBWA 1PVHA 4K2UH 3SE3A 1VACA 3N85L 4JRYA 3PXHA 4K7PX 4AL8H 2VXUL 3TPUB 1U95B 1RUKH 3EYOB 3WHXB 6FABH 5LGJA 2DQTH 1FNGB 2P4AB 3UTQA 1X9QA 2F53D 2D7MA 1HZHL 5I6XB 4KROB 1NBVL 3ULUC 3TF7C 1TPXC 2BC4B 3ARUA 2J8UF 3CDFA 2IADA 3O9WB 4X99B 1C16A 5ID0A 2AAVA 1D9KA 4HUMB 4PR5A 4RMUA 5L2JB 2BMKA 1P9MC 4QRRD 1XF2A 3SGDH 2DQUL 1TDQA 4WI8A 5T33L 3CLEL 3DUSA 4IIQB 2EECA 4CADA 3EUUA 3M17B 4O51A 3IFOA 4LSUL 4F8TA 4ELKA 3HMXH 3BUYA 5GS3A 2EYSB 3QRFM 2DMBA 5FM8A 2FATL 1KTKE 4ONOA 3O2DH 4AMKL 1E4XH 1AXTL 4RA0C 5ALBL 1DL7L 3EYVA 5HVGB 3SY0A 1QLFA 1S7XA 1DE4B 3FT2B 1D5BA 4EVNB 1KYOJ 3RJDA 4M1CD 4E41A 5IVXF 1ZHBB 2DKMA 1JZ5A 1FPTH 1I9IL 4AJ0A 1CD8A 4C83A 1RFDH 1K8DA 3MRDB 3V8CA 3C6SB 4PB9L 1KCRL 4HV8B 3TJHD 3PL6C 3LEVL 3V6OE 3WO4C 15C8H 3BKML 3UTSE 1BHGA 2MHAB 1TENA 3J7HA 1L7IH 4KHXH 5HGAB 1C5DA 1WV7T 4DZBB 3MLVL 3CSYA 3QCVH 2ZUYA 1HKLL 3MUGB 2GCYB 1U8QB 3H9HA 1S9YB 3GHEL 3IDIA 4LCUA 4FZEL 3ULVE 4NOBA 4Y4KA 1YJDC 4M6ML 4RAUA 5K9QG 4OFKA 5EO9B 1W8OA 4HUXB 2YN5A 4N9GA 1QFUL 4WO4C 5GS0C 4KKLD 4QOKE 4NUJA 1UVQB 3BIAX 3ILPB 5I1JL 4GG8B 1LEKB 4I0KA 4JY4B 4K71C 2LE9A 4N8VB 1QLEL 1DVFC 2LQRA 3GMMA 3VXSA 3JWDH 5E56A 3WLBB 4CU8A 3FB5A 1CL7I 2WWMD 3N0PB 5D72H 1VFAB 3L1OH 4GT7A 5EBLA 3D85A 1F6AA 3U83A 4OZFB 1KOAA 5MEND 2FX9L 5EU7E 1KB9J 1N5YL 1A4KA 2R0WH 1IAMA 3WHE0 5B3JE 4QHMA 1Y6MR 2CLZB 3JWOL 4DTGH 5BW7A 3KPSA 3HZVB 4JFED 1MCDA 1U0QA 3E3QC 1JF5A 3MRLA 2F54A 3K8KA 4S1RL 5TFSL 4D9RD 1CCZA 4FQXC 1NC2D 4XAKD 3UPAA 1UKSA 5GSVB 4JFPA 4YNYA 3KPRD 1SYVB 3AREA 4YFDB 1MCBA 3T04D 1AFVH 2B0SH 1A1OB 3C8KA 4ZSOA 4PJ9C 1AHWA 1MHCA 5KBNC 3QHZL 3EYQD 4TSBH 3BO8B 4J4PD 4MXWH 1Z0NA 2N56A 1LO3H 1CR9H 1Z2KA 4S2SB 1CICC 1RIUL 5CIPB 4NQCD 1EMTL 5FB8A 2OP4L 2VXQL 2UVEA 1J1XL 5TE7H 4KU1A 4LK4A 9CGTA 3P9MA 3T0DA 1ZGLB 3VXQA 1MWAB 4QNPE 3C5ZA 2HH0L 5EU3A 1JHKH 1DQTA 4YDKH 1F45A 3D39B 4YE4L 2AS5M 4RBPK 2EH7L 4LPVA 5JPMB 5IV2A 1K8IA 3X11B 5DD3H 1CFSA 2UZIH 1DSFL 1NGXA 1KG0A 3WFDL 3AM8A 3MRJA 3VFNA 3VFGH 1L4IA 4WHTA 3AY4C 4H26B 1PLGH 4WEBL 1C08A 2OX5A 1CWVA 1W0WB 3ES6A 1NCAH 3VH8B 3TCLB 5MEOA 3HFMH 1OD9A 2VDPH 5IEKA 4K23L 3QBTB 1LP9A 3PWJB 1YNLH 1GH7A 3FQUB 1ODAA 1CL7H 4Z5RA 1J8HB 1NL0H 4OZIB 3DSNA 2QSVA 5JHDD 5F3HA 4M7LT 4IMKC 1NGPH 2DQDH 1MPAL 1XF3B 2EO1A 4BKLB 1Q9WA 1F2XK 2C1OB 1WT5C 5ETUB 5D70L 3GMLB 1FFPA 5IMLA 3PWLA 2JIXA 1DBAH 4OUOA 4DQOH 1VGEH 4L3CA 2XXCB 4OCNC 3SDYL 3IVKB 4MAYB 3VD7A 1W0YT 1MRCH 3B8SA 1UT9A 3OAZH 1G9EA 3P2TA 5GS0H 4F9LA 2NY3B 1LWRA 2XG5A 4F7MA 4I2XE 2IPKB 2PKDA 3BT2H 3O8XA 4ZAKD 4S0SD 1L0YA 2JE8A 4ACPA 4P46A 2N7AA 3RWJA 1KJMA 1BX2B 1HKFA 2XACC 3WXVL 3U6RB 3U2SB 1U8OA 3ARSA 2YHGA 2O5YL 4TRPL 5KVDL 1C12B 4PJ5B 2P5WD 3WL9B 3DURA 4F7PB 2XNAB 4L8CB 5CEYB 2RR3A 3LQMA 3RY6A 2VLRA 4NPYA 5DXWA 1I3RB 3C8DA 4Z7UF 4X9FA 3VFPB 1KLUA 3KYMB 5DJXB 1HDMA 5D7IF 4I9WE 4WTZA 1SY6H 1Q0XH 1WISA 1WZKA 4GKNA 5DRZA 3W39A 4NRYB 3JTSB 1DBKL 3SKOB 1JPTL 5HYSG 4JVWA 3TA3B 3NFNA 2VQ1A 3QISA 3VFVA 4ZNEE 3C09C 3MFFB 4JVPA 4NKDB 4AZ8A 2D0HA 2J3SA 1IGCH 1OAKH 3BE1L 4GW5B 1DCLA 3VG0L 2DJ4A 3KPMB 4TVPE 4F57H 1WCQA 4M8VA 3R4DA 2A9NL 3CFEA 4OI8A 1WIOA 4PJ7B 5I76B 2OI9C 3WFEL 1FFOA 5BRZA 1N0XL 3T8XA 1DUZB 3QEQA 1INEH 1ZLSH 1MFNA 4LSVL 4NYLB 1I7ZA 1K6QH 5E8EB 2IANB 1FFQA 1IEAB 1D6VH 4PJAA 1QNZH 2XWJA 4HXAH 5FHAH 1TETH 3BRDA 5DHXB 5C7XH 5IHLB 1A7OH 4YHNB 2IFFL 3VFRB 1UWEH 4OF7A 1NMBL 4Q74A 4JB9L 3TM6A 3BD3A 1T6VN 5AUMB 4KKAC 3MTRA 2BFVH 4MAUH 3DVGB 4QHNA 3WDIA 1G6VK 3OG4B 4HBCH 2AP2A 4NZUH 3WKNA 1I9EA 3SCMA 4GXUM 5TGBB 2GQHA 3FKUS 4CL7A 1T1XA 4HPYL 3LKQA 1U8JB 2VXTH 3FCTB 1MEXH 4DN4L 5DZNA 1W72H 1ZKAA 2QQNL 2YPVH 2BNRA 4LCIL 4RGOL 2XQBL 2BXYA 3P73A 3QDJA 3VDBA 4GG6A 1KF9B 3L9RB 4HIHA 5HHQA 1CDIA 4LEXL 4U1JA 2EO9A 4CMMA 4HC1A 1DUYA 3DBXA 3FN0L 2W1NA 3MRIB 4WIQA 3ORJA 5E94B 5F9WC 3FQRB 4HJGB 4IOSD 5BZWB 3RX8A 1FLRH 4HDIB 4OCYL 3MO1B 4PRID 2YN3A 1PZUB 3TZVC 3VXPB 1M7IA 1O0VA 1TNNA 4W68A 3C2AL 4MD0A 4ENED 2L0DA 4DN3H 1V05A 1YEEH 4KWUA 1IRAY 3QUZD 2KZWA 4KGJA 3IXTA 3CU7A 4KV5F 4M48L 1UACH 5K59F 3VD4A 3NA9L 1FP5A 2R9HD 4M4RA 2XKNA 5I73C 1DJSA 1KTRL 2MJWA 1XR9B 3D2UB 1X7QA 4PRNA 4YBLC 3RZCB 5FK9A 2BY2A 5DJYA 2VXVL 3R1GL 3TN0A 5D1XC 2DQEH 1DBJL 1OAYH 1Z5LB 4AQOA 1BM3L 2X6MA 4R4ND 4M7LH 3S5LG 3I85A 5F7EH 4DCQA 3RX5A 2XTJD 3EHBC 4F7TA 1S9WA 2GJ6A 4D8PA 4ISVB 3C5JB 3T65A 4YAQA 4YBQD 4OM0H 4QHKI 3X14A 3U82B 3TH2T 1H15B 4JM2D 3S97C 3JVGC 4LSPL 4L3EB 3BGFC 3FO9B 2HT2D 4MWFA 4PBXA 1YQ2A 3MUY1 3U7WH 5E6IA 4JRYD 3NCYS 4MXQD 5AEAA 4AIXA 4JFDB 3GHBL 4OCRH 3QIUC 4ZD3H 5D1QB 4BFEA 2YBRA 1T5XA 2WUBL 4HIJA 4U6TA 1NLDH 2ADFL 2FL5A 1G7LB 1D9KD 4GAYB 3UTTE 4OKVA 2ZNWA 3F5WA 4X7SH 2F58L 2AI0L 5IFAL 1RAMA 4U49A 4ELME 1CDHA 2IBGA 3I50H 4NT6B 2H6PA 3SDXE 4HD9A 1JNHA 4LHUA 3ZKXC 5E0QA 4PJXF 1CE1H 5ICYB 1A2YB 1R24B 3PV7A 4X6DE 5EU4A 3C6LC 1DBBL 1JI2A 4D9LH 1ZT1B 1R3IH 5FYLH 4U05A 5C6TL 3CFBA 1NCDH 4F15C 1GGCH 5L0QC 3Q3GB 1AXIB 5F9JB 1T83C 2VR4A 4BYHA 4GAGL 3IFNH 1F2QA 4E41D 4DOHB 1FNSL 4NRZA 1OCWH 3VXTB 5IVNA 1FG2A 3SO5A 2JLLA 3KPNA 3T0EE 3SHSA 5EOCH 1FAKT 1I3GH 4LPTA 3O6LL 4KKCC 1HHGB 3FO1B 4JHZA 3BESR 1CI5A 3RRQA 5ELIA 2R8SL 3RNKA 1N59B 2F19H 2YC1A 3QXVA 5IBLC 1WBZA 4QRTA 3AB0C 4GOSA 3S7GA 5MEPA 5C0FA 1FBIH 4CGTA 3IF1A 3LRSA 2R0KH 4XGZA 5IMOB 2LV4A 1FCCA 3UJTL 1S7VB 1OAXH 5IIEA 5DS8A 4Y4KD 3NCFB 4PLJC 5GHWH 3LY6A 3SDCA 3MRRB 4UMGA 4Z7WB 1CDUA 1QHPA 1TZGH 4LLQA 3STZA 1MLBA 3O11A 3JXAA 4HPOL 1KYOK 3WN5C 1F6LL 3OKLB 1IQDA 5IG7B 3UJJL 1CLCA 1CN4A 2PW2A 5CBAA 5HHXL 4G7YL 1QSEB 4J3OC 5SX5K 3T4YB 3O6FD 3MR9B 1U41A 1FZKA 3FB7B 1B0GA 3VXSD 4DKAA 3RU8H 1Q0YL 4P99A 1E27B 3D85D 1QPPA 3IS1X 1IC1A 2ENYA 3GMNA 4XCYA 2EDJA 2YA2A 5A2FA 4KHTH 1NAMA 2R1YB 1OT2A 3EJJX 5BXFA 4XCFH 2VLJB 5E5MB 2BK8A 2EXWC 2IPTH 4XZUA 3KXFB 1JTOA 3O3DB 4J6RH 4TQEH 5HSFA 3E1F1 4B53A 1MCJA 3KPSD 1OD7A 3SDAB 3ZYJA 5KSBA 4C54A 2V2TA 2M2DA 1KJ3H 2ADGA 1YEKL 2F54D 2FJGB 3FQWA 3RUGE 2ZSWB 4OF8A 5KSUA 4P5TB 2UUDK 4L9LB 1TITA 1CLOL 3K81A 1NSNL 3ZDZE 1JJUA 4MNHA 4O9HH 4KC3B 3ARED 4RGNE 1N4XH 2O5ZH 3LEXA 3S6CA 4XPTH 4M43H 4PREB 5T3XD 1J0YA 4I5BB 5AZ2H 3IKCA 2HVJB 4KRPD 5E2UL 3GUTA 1KB9K 2BCKB 4ZDHB 3G6JE 5LXGH 2ZSVB 5SWZA 3H0TA 5DRNB 4LSTL 5F88B 2VDQH 2F53E 3H2WA 5LWYL 3B9DA 1GIGL 4MJ5B 3VXRB 1H5BB 2CMRH 2ZUSA 4PJ8A 5FA4A 4ALAH 3E6FB 3OTTA 4JFYB 4ODTL 3IU3A 4H25A 4H0IA 4QRRE 3PWPA 4BELD 1GGYA 1WBXA 2FH8A 3C5ZD 4WUKH 1RUPH 1MJJA 3LV3B 2R29H 5DJAA 1AD0B 4KVNH 2R0ZL 1ZLWH 5KS9F 5IM7A 5B4MC 4YHZH 3KHQA 3D25B 2IQ9L 3U9UA 5FGSA 2X4NA 5D5MA 4CUCA 4EDXA 2FHCA 1EFQA 4DK6A 4EBQH 2E9BA 2E7LA 2VDLH 3O0RL 3HMWL 1FV1B 5I17A 4UV4L 1IILE 4MA1C 4LEOA 1BWWA 1JNNH 4ZS6D 3CMGA 4XVJL 3UPRB 1OAUH 3UYOD 4PJEF 3DI2B 1X5ZA 4K3DH 3WIHH 3T0BA 5JLZB 1RY7B 2P5EB 1U8MA 4FFZL 1RK1A 2QBWA 4XP4H 2ZCHH 5IBTL 5EU6A 3F12A 3ARGC 3P11L 1RUQH 5JOEA 1OPGH 2YD4A 4KTEH 3S88H 2JIXD 1WCBA 2FIKA 1K85A 3VWKA 4YC2C 3I02A 4JRWA 4U6HA 4OAWA 4XBEH 1QD0A 4F3FB 3KHOA 5LCVH 2JELH 1EBAA 3RVWD 1T20B 5HDQH 1JMZA 2JJSC 5FYJD 2Y36H 4N0FB 4IRJC 1WAAA 2HP4A 2A6DB 4P5KB 3O8XD 2C1PA 2EYRA 4EUPG 4XBGA 3CSGA 5TF1H 4P46D 3VCLA 4HJJH 4BH8A 2EIBA 4TPRL 1S7WA 1BGXH 3IDMB 2CKBL 2Y1VA 3DV6A 5ESQA 1OAZH 4OIAA 1INDL 5I19H 4UTAH 4FP8L 1GCFA 1N64H 2NLJB 4IDJL 2CUIA 3P4NA 4N0YL 5HHVH 5MERB 2VLRD 2JCCB 4N9OB 5MENE 4RA3A 1W0VB 3K1KC 3V52H 5TE6H 5FUZH 1G7JB 3BQUA 4FG6D 1NCWH 5E99H 3CSPA 5J12B 1UYWH 2YPKB 5BOZG 1PX4A 4JFEE 5I15L 1VPOH 4M6NH 4Y5YC 1T0NB 2DBLL 1L9MA 4AM0A 4P3CL 4YDJB 2P24B 3SE9L 5DUML 4P9MH 1XCQA 3SE4A 4D9RE 2PCPB 5JDJA 4XAKE 3U4AA 4MYWB 1R5WA 3QULB 5HI4D 3QI9C 3W5NA 5GXBB 2EC9U 5EU5B 3TPUA 5A2LH 3U4BH 1MVUA 1U95A 3EYOA 2P46B 4XI5C 5I74C 5BRZD 1FNGA 5GZND 2X1PA 3QEQD 1GOGA 2CLVB 5T5FH 2BC4A 3M07A 2NY7L 3O9WA 4X99A 4HMCA 3JUYA 1NUNB 1WJ3A 2GUOB 1HWGB 3LQZB 5L2JA 4PY8J 1HINH 3B9AA 1KB5H 1PX3A 1EDQA 2CO6B 1PKOA 1EGJH 1E4WL 4LCCC 4HS6B 1TJHL 3TNMB 1MFBL 4IIQA 2EEBA 3QQ4B 3WS6A 3M17A 3HE7C 3P0VH 4G9FB 3RTQA 1G7IA 2BHZA 4HFWB 3HAEH 4OGYL 5EIIA 4P3DB 2AJUH 3SCMD 2EYSA 4CDHA 4OFVA 3BEWB 1BP3B 3VFWB 1X5JA 1A14H 5J4MA 1L7TH 3MMEB 1CDBA 3ULVL 1ZANH 2DQCH 3IDUA 2BNRD 3VU2A 3QNYB 4Z77B 4CVXB 4YHIB 1DE4A 3QDJD 3FT2A 3NN8A 3SGKA 5DMKB 1A3RH 4EVNA 4XP9L 3T3MF 2GAZB 3V0VB 3BIKB 1FO0B 1ZTXL 4PRHB 1ZHBA 4HS8H 4TUJB 4GH7B 2QKIB 4CJ0A 1F4YH 3BPLB 4XVUC 3MRDA 3C6SA 5ECJE 2HVKB 4HV8A 1NCBL 5L9DH 3RX7A 4PV8B 5CJ8A 1I7RB 4X5LA 4MQXC 1MCIA 4MDJB 2A38A 3CH1B 5JHDE 3PIQA 4Y16B 4DZBA 3SO3B 1TQCC 3MUGA 4UU9A 1U8QA 5D2LB 1S9YA 1D7FA 5FGBA 3TN0D 1T2QL 3FZUD 1V7MH 2Z9TA 5F6HI 5FUOH 3AS1A 3NCJL 1RUAH 2PW1A 3ZTNH 4MVBD 4N90D 4U6VH 5D2NC 3OGCB 4Q9RH 4NNPH 5HPMB 3VI3E 1CF8L 4C4KO 4HUXA 2GJ6D 1JFQH 2AK4B 5E7FA 5DZOA 1BOYA 2RCSH 3PWVB 1UVQA 4YR6B 3ILPA 3AS3A 1KIRB 4GG8A 1LEKA 4JY4A 3PP4L 3ZL4H 4N8VA 2APFA 1J10A 1BBJB 2VYRE 4XC1H 3G6DH 1PBYA 3MZGB 4FQPA 3QAZC 5E6ID 3NABL 4I3SL 1VFAA 2X4OB 2Q87A 1U92B 4A6YB 4HMDA 1BEYH 2AERT 2G9HA 1F11B 1BJMA 1T2XA 4TOYL 5L8LB 3MLYH 1GPOL 1DP0A 3RGHA 1I1AC 5A3IC 3HI6H 4JCLA 4LLDB 2CLZA 5D7JC 2WZPD 5FM4A 3H9YA 4Q9QL 4RIRB 4JQVC 3HZVA 1A6UH 2ID5A 3MCLH 3RAJH 3WD5L 1JUFB 1Q9LB 5CJQL 3ALWA 4LHUD 2EZ0D 4GAJH 4PG2A 4U3HA 4F58H 5GSVA 3INUH 1B2WL 1RURL 2YD1A 1SYVA 5IWLA 2RQ8A 2W92A 5DLMH 2CJUL 3QIWB 5FYKU 2B7DT 3BO8A 4KZDL 4XPHL 2X42A 2NY5L 4QTHB 2OBGA 3FAXA 1BZQK 4ZS7H 3FFCD 4S2SA 5HVWA 1AXSB 4NO0B 3HG1E 1VEMA 3RIFF 3BSZL 3BPNC 4TSAH 5KTEH 2ZCLH 2WP3O 4FQCL 4K7PY 2IF7A 4PJDB 4S0TD 4M6OH 1QZ1A 1ZGLA 3PDOB 1JWMB 2B1AH 1S5IH 5JW3H 1G6RB 5I1EL 3TGXA 3D39A 3ARDC 3EOTL 4CU7A 5JPMA 5D8JH 1SJHB 2MMXA 1FL3B 3X11A 4LCYA 3SDCD 2VSCA 3G9VA 4NZRL 2FEDD 3QIBB 3TJEL 4KMTH 1GVIA 5DMGD 2EC9T 4Y5XB 3SKJH 4H26A 4Y7MA 5B8CB 1W0WA 3MRFB 5ALCL 3VH8A 3TCLA 1K5NB 3KYKL 4P9HH 3C5SB 4PJBB 3PWJA 4Z8FL 3RVXD 3FQUA 4Y4HB 3S37L 3RA7L 1XMWA 3JV5A 4OZIA 4PRIE 1FL6B 4XNUL 2ARJQ 3HKFA 4NCC1 5CEZD 1XF3A 5KVFH 1PY9A 3L3HB 1BFOB 3PABB 1TTFA 2R39A 2NY6D 3DARA 4KK6C 5ETUA 3IJYB 3TH3T 1B0RB 1I8LA 4P2QB 5CHNB 3DROB 4BZ2L 2J12B 5HHNB 3HN3A 3T2OA 4MAYA 3GMPB 4LDLB 5C09B 3ZHDA 3LRGA 3DGCR 4K94C 2XZCH 3OX8B 3MQIA 2OTWB 3QRGH 3QUKB 5I8EB 2XTJE 3EO9L 4CJ1A 1UENA 1HYRC 2G60L 5IGXH 4V1DA 4UBDC 3CFJB 1MI5B 5DTFA 1BX2A 3QUYC 2AQ2A 5J6GB 2BVUA 4TVPL 3U6RA 3ZKMD 5EWIH 4JRYE 1C12A 4ZYKB 4PJ5A 3ZDYE 3WL9A 1RUKL 1XIWB 3OAUL 4PY7A 4F7PA 2XNAA 4QHLB 5CEYA 2QJDA 5SWZD 3H6JA 1R3HB 3DNKA 3VWJB 1I3RA 3P30L 1IC4L 1GC1C 2H1PH 3VFPA 4G6FD 4PJ8D 4P2YA 3KYMA 5DJXA 4ZO6A 3MJ9L 4C56B 2IGFH 2BSRB 4O02H 4RAHA 1K2DB 1QYGL 5INCB 4NRYA 3JTSA 1MFCH 3P9WB 3PWPD 3SKOA 1PGRB 1VB9A 4X83A 2I9TB 1MCHA 3TA3A 2VC2H 1CE6A 4NKDA 3MFFA 4PRAB 1MFEH 3O45B 4MLIA 5SX4I 3KPMA 4WTZG 3ESVF 3O2DL 1EEYB 2PETA 5ERWA 3D3VB 1NMAL 5J9PA 3CDGB 4PJ7A 5I76A 1RHFA 2EH8L 4LRIA 4NP4L 4X6BA 4FS0A 1DUZA 1DQLH 2HTKC 3GSNL 1FLTX 1IBGH 3WDHA 4KKBC 1YMMB 3V4UL 4NYLA 4E41E 1LO5A 3QG6B 5E8EA 1ZLUK 1IEAA 4D3CL 4ODVL 3MC0A 2OCFD 2ZUQC 3L5HA 4QNPF 4BM7A 4YHNA 3CUPB 4FHBD 3VFRA 1HQ4B 4W70A 5C07B 3EO1B 3U1SH 5IFJA 2AEIT 3QR2A 5EU6D 1RHHB 1MJ8H 2OR9H 5LQBH 4U7KA 3DVGA 1J7VR 1FJ1B 4L5FH 5ABDE 1G7QB 5SWQB 3GSNB 4OCWL 5TGBA 1BQLH 5IR1B 5CMAB 3HB3D 3VWKD 4AT6A 1N6UA 3GJFB 1U8JA 2CDGA 3FCTA 3TYFB 1JZ4A 1JV5B 1RULH 4APQC 5C0EB 4NN6B 1H8SA 4RISL 5E6YA 3L9RA 1J0ZA 2HKFL 1NKRA 4JPWL 3GKWH 3MRIA 5AZEH 5E94A 3FQRA 3KVQA 4HJGA 5BZWA 4QRPB 4HDIA 2J8OA 1U36A 3MO1A 4MD4B 5IF0B 3VJ6B 2DTMH 2V7NB 3VXSE 4ZFGH 2JB5H 4EEEA 2ZKHH 4QCIA 3SQOH 1EHLH 3PJSB 1YC7A 2DB8A 4X7FC 4GS7B 1JRHI 1BVLA 5C92A 4P48A 1AY1H 1IAOB 3D9AL 1B6DA 5HJ3B 1X5XA 5C0BB 4MQSB 1XR9A 3RZCA 5CEXB 1QG3A 1WITA 4KI5C 4HK3N 5I30H 3BQUD 1UM5H 5L8JB 3ZDXE 1Z5LA 1RIVH 4NNYB 3KPSE 1MCPH 4OGAD 1QUNA 4OLUH 4U1IB 1N26A 4ZTPH 2R23A 3C08H 4M1CC 4Q2ZB 1F02I 3KS0J 4ISVA 2F54E 3C5JA 1A6TB 1H15A 3UP1A 4Z18A 1F8TL 2PR4L 4L3EA 1JGUL 3FO9A 5SX4H 1LO4L 3AS0A 1CTOA 3V5DB 4UIKH 4J7RA 1L6ZA 3T2NL 5BMFH 3VGBA 2OK0H 4L8SB 4Y4FB 4PJGF 4KROD 5D1QA 5EDXA 5IK3B 3ULUL 4IRZL 3EO0B 3O9WD 4P23A 1K4CB 5TE4H 4GAYA 5JXEC 4OF5A 4K8RH 1EJOL 2IEPA 5DHYB 1OAQH 5ITBH 1WEJL 1X5YA 4NT6A 2R2CA 3RTQD 1JYNA 5ICYA 5BVPL 1A2YA 2QTEA 4OLXH 1TQBC 4X7DC 3ZYIA 4ZXBC 2HAZA 1TPXB 5CD3B 1ZT1A 3CXDL 3GI8L 1L6XA 2QQKH 4N8PA 1YEDB 2DIAA 2GJJA 2FO4B 3Q3GA 2QSCH 1R3JB 2Y7QB 5F9JA 4LHUG 1AP2B 4AG4H 4KK8D 2D7OA 3FQTB 3VXTA 4M7ZC 5DJ6B 5JDSB 5E8NB 3NZ8B 2PTTA 1HIMH 3LQAL 4NUGL 4OLWL 2EE2A 4JO4L 3RWEB 3FO1A 2ICES 1GZQB 35C8H 1N59A 1WWWX 5EUKB 4BZ1L 4K3JH 1ED3B 3EJZD 3PGFL 1S9XB 1NL0L 4LVEA 1BZ7B 4OJFL 3KYAA 4B41A 1P1ZB 4X9IA 4RMSA 1JRHH 1U58B 3MJ6A 5IMOA 1I4FA 5D7KD 5F8QC 1I7UB 2DQJH 3MRRA 3VW3L 1IGFL 4Z7WA 1VGEL 1YJDL 4DQOL 4OGZA 4YX2H 3EYQC 4J4PC 4GRMB 4MDIB 1CGWA 4AYFA 3PL6B 4U6YB 3OKLA 5EZLB 3WO4B 5IG7A 3P77B 1BQHB 1HSAB 4R26L 5DC0A 5TQ2L 3SBWC 2HJLB 3BT2L 5AAMA 5FYJE 1FZMA 1QSEA 3T4YA 1MIMH 2NXYC 1AGEB 3VFTA 4TN9A 5D71H 3MR9A 4Z7NF 2E27H 1SEQH 3FB7A 3QEUB 1TVBB 5DD0H 1YC8A 3CAFA 3VXUB 1C8PA 3LS5H 1E27A 2DD8H 4IMLB 1AIFB 4X4MA 3ZKSD 3MXVH 1FORL 3DX6B 1DTUA 4FNLL 2R1YA 4WO4B 4AEHH 2VLJA 1MH5B 5E5MA 2XRAL 3PGCB 3KXFA 3LHPH 5GRVL 2VLRE 3O3DA 4K71B 4DGYL 1OW0A 3BRFA 4WUUB 1PW3A 3SDAA 1DVFB 5F96H 3V5KA 5E03A 2A2QT 1Q0XL 4JO2L 3PWNB 4UIMA 5BO1H 4QXUH 1CLZL 2ZSWA 3P0YH 1OP5K 4P5TA 4L9LA 5F7LB 4ODBD 2VZSA 4XXCA 1A7PH 3SE8L 3UC0L 4K9EC 4ERSL 4Q0XH 4Q6IC 1F4HA 3HUJF 3H3BC 5I0ZA 1NGZB 2VN4A 4AIZA 4OV5B 4PREA 2ZOKB 2DM7A 1A7QL 2UY6A 3TBTA 2HVJA 5FUCC 2BCKA 3DGGA 3J8F7 3QUML 4ZDHA 3QJFB 3WLWD 3K7UA 1EO8L 2ZJSL 2DF3A 5JOPD 5DRNA 4O2FB 2V6HA 4FQXB 2HWZH 5F88A 1EFXB 4ELMF 4MJ5A 3QEQE 3VXRA 5E2VL 1H5BA 3B83A 4YXKH 3BAEL 3SDXF 1FCGA 4TTDC 5ESVB 3E6FA 4PJAE 1HCVA 1EVUA 2AQ1A 4JFYA 5I1DB 1MCOH 4X6DF 4PJ9B 3R0NA 4R7NB 1UWEL 3LN5B 4MXVE 2VDNH 3MLXH 5JIPA 1VGKB 1FL5B 1RIHH 3D39D 3LV3A 4Z7VB 2QADC 3HNTL 1UZ6E 4PUBL 2VXSL 1CICB 4JFFA 4DW2H 3IAGC 1E28A 5GS1C 3A0OA 3BWAB 2XWBB 3D25A 4TNVF 4ONGH 4LSQL 3PHQB 3DUHA 4KZEH 4HK3J 3GZKA 2BNRE 1JE6A 3QDJE 4GG6E 4XAWL 4ODWB 2QL1A 4NWTH 3BW9B 1CQKA 1DN2A 4AEIL 3S3JA 5CZVH 2EDRA 3UPRA 2NZ9C 3QXWA 2CK0H 5I9QC 3TIDB 2Q8AH 4HUUB 2DQHL 3S4SB 2P5EA 2DTSA 1EUUA 2IWGA 4JN2A 1UACL 1HSBB 2XKUA 2Z8RA 2DIBA 2Z31C 2H2PC 3M1BB 5DSCB 5EFIA 3ABZA 1TJGL 1U2CA 3ETBF 3NPZB 4HGMA 4MAYD 4HWBL 5I1CH 2E7BA 2P7TB 1GL4B 2EDDA 4OSUL 4F37K 1PG7L 3RI5K 3QPQC 4N90E 4XX1G 1T20A 1HHKB 4ODXB 2Y06L 2NY3D 3OBAA 1LGVA 2UV3A 4N0FA 5GGUB 1KEMH 2A6DA 4P5KA 4QY8A 3KGRA 1JL8A 5IVZB 4V1DD 3EZ8A 2G2RA 4O00A 3QSKB 3IDMA 5GGTL 4MSWA 1A0QH 3CNKA 1JIBA 3HI5H 3ROOB 5HDBE 2GKIA 1Q72L 2MPAH 4PJ5D 1QEWB 2XZAH 2OLDA 3NAAL 2NLJA 3QQ9C 1A3LH 5MERA 1JZ6A 2JCCA 1T3FB 3GSWB 3KR3H 2K9UA 3CVHH 1GOHA 4HXBL 5FKAA 4JG0H 3LIZL 1W0VA 4OFPA 5DR5H 3RUGF 3VGHA 4RWYL 1G7JA 3NCEB 1GJIA 3CIQA 1EAJA 4YXLH 3MJ8B 4H0HB 3ZDZF 3H7BB 4HH8A 4PJEB 2GTZA 5AG8A 3PG2A 1T0NA 3N06B 4YDJA 4HHAB 3TA3D 4CVUA 1CE1L 3LEYH 2XY2A 1AE6L 2PCPA 4A2MA 4JZOB 5EORL 4NQVB 1P6AB 4K9EH 2VRAA 4PRDB 3FMGH 3QULA 5C0ND 3QEGL 3L5IA 1SMAA 3IDNB 3RNQB 3G6JF 2Y5TB 3QUZC 2PF6A 2UY7A 5EU5A 1NMCC 3KPPB 3Q0HA 1ES0A 4XNYH 4WJ5A 2CIKA 3TCXA 5KVEH 1S78C 3DXAB 1YEHL 1LMKA 5ANMB 2CLVA 1EEUA 2I24N 2A6IB 1AGDB 1FGNL 3MA7B 3C09B 4EKXA 2GUOA 4JO1L 3LQZA 2DI7A 3I9GH 2YWZA 1D5IH 5GGVL 2P47B 3TNMA 3QHFH 3QQ4A 2OI9B 2W07A 4G9FA 4G8FB 2J6EL 4HFWA 3SGJC 4C4KT 2RFXB 4P3DA 1Q1JL 4M9OA 3BEWA 3O2VL 1PKQB 3MMEA 3ZKNC 4X6CF 3ZKQD 4X0KB 1S7SB 1TZGL 3QNYA 1CFTA 1CVSC 3MCKA 4BSVB 2JJTA 4CVXA 4YHIA 4HKZB 5DMKA 1LO0L 4YHKL 1E4JA 2FX7L 3EIFA 2GAZA 3V0VA 1KEGH 3BIKA 5IMMB 4PRHA 2YA1A 1J1OL 2QKIA 5BV7C 5FGCB 3QCTH 1J05B 5CSGA 4JQIL 4HQQH 2RJMA 4E42B 2HVKA 1MFAH 1YYMH 4YHMH 4MS8D 4PV8A 1I7RA 2FWOB 3TO4A 4PP1C 4ONFH 4MDJA 2M1KA 3CH1A 2XFXB 4Y16A 2YUVA 1SBBA 5CEZE 4DUVA 4P0DA 3C2SA 3RZCD 5D2LA 5DK0B 3FO2B 2P49B 4RDQF 1SJXA 2X1XR 4M02A 5CGYD 5F9WB 4FQLH 2EE3A 2OTUB 5DJ2B 5LBSH 2NW3A 4MLSA 3OGCA 3TZVB 3LOWA 4LF3B 5KSBE 5HPMA 3L3DB 1S7UB 4XNMB 4GRWE 3OB0K 4MQ7B 2IH3B 3PWVA 4YR6A 3WKMH 1KIRA 2VDKH 2ZG3A 4KGLA 5I73B 3PDDA 4L3ED 3B9VA 4AENB 3L6FB 1BBJA 4YBLB 4JANA 4X5WB 5D1XB 1E6JH 1D5XB 3X12B 1U92A 1NBZA 4A6YA 2Q3ZA 1J0KA 5ILTH 3CZJA 1UEYA 2WP3T 1F11A 3NFPB 2X9XA 5D1QD 2VDRH 4U0QB 1NANI 5JOFB 3GNMH 4MJ4A 5HGBB 4N8VG 4P23D 4Y4KC 5SWZE 1F4WH 1BLNB 5EZJA 4LLDA 4N0RA 4R6UA 2W38A 5ICXB 3BGFB 4RIRA 4EOWH 1RZJC 4Y2DC 5IFHL 1YUHB 3NIDE 4KK5C 3MBEC 4OZFG 4R8WH 1JUFA 1Q9LA 3F65A 1U3JA 2FIRT 3WXWH 4MCYA 3QIUB 1Q94A 3RVUD 2XA8L 1JZ3A 1CGXA 3ZT6A 3O6FC 4P59L 1CD9B 4PGEB 3AXLB 1DEDA 2Q3AA 1OLLA 4OFDA 2Q6WB 1LVEA 1ZT7B 4FZ8H 3HZKA 5D93C 2YUZA 3D18B 3QIWA 4UT7L 4CNIB 1RZKH 3MUZ1 5DQ9B 4N68A 2W9LA 4X98B 4L4VB 3HC4H 3F7VB 5D5ME 4QTHA 2E8YA 3GIVB 3ZKXB 5DMIL 4AQ1B 1AXSA 4NO0A 5TPWL 1H3PH 5IQ7L 3C6LB 2NNAB 3G04B 3BYYA 3S36H 4K3EL 4N0UB 5KAQG 4PJDA 1FIGH 1FH5L 4K3DL 4F15B 5T1MB 5L0QB 5JQHC 1RZGB 1JWMA 1BBDH 4PJHB 1YECH 2R69L 1AGBB 1H3UA 1VHPA 2QSQA 4XX1E 4G6KL 5EU6E 1X5IA 1AKJB 3JBG7 4LSRH 4QTIL 3SEPA 1SJHA 1FL3A 3QH3B 3L7EA 1IT9H 1MOEA 1ZHKB 1RZ7H 3QIBA 3SPVA 1U8HB 3KPQB 2PUQT 4KRPC 2ZNXA 3NACH 5HY9B 5B8CA 3AB0B 2XZZA 1MF2L 2P8MA 1K5NA 2XICA 3C5SA 4H20H 4JPKL 4XTRC 4PJBA 5BV7H 5DVLA 1WAAE 4HFUL 1IGJA 2R1XB 4RRPA 1JN6B 3ILQD 1K3ZA 4HJJL 4Y4HA 1BGXL 5IB4A 4P57B 1IM3B 1FL6A 3S98A 5T1DH 3VH8G 1NANH 3AAZB 3L3HA 1BFOA 3PABA 2VLJD 3V95A 3IS0X 3BIBX 5CLTA 3KXFD 1B0RA 1GAFL 3VI3F 4P2QA 1NBYA 5E8PB 5E6ZA 3DROA 5HHNA 3AM8C 4ONHB 5DEFB 5T1LA 3SDAD 2L7UA 4LMQI 1RZFH 5AWNL 3GMPA 1R0AL 1GGIL 4GXUN 5C09A 2J1KA 3RVVD 4Q7DA 3EBAA 2FNBA 3OX8A 3DO7A 1XGPB 2B4CC 2FB4L 3OKKB 4O58L 2OTWA 3QUKA 3O4LB 4P5TD 5I8EA 2HMIC 2H2SD 4GMSL 1CFVL 1UCTA 4KY1H 3BISA 3NTCL 4I77L 3CFJA 4LARH 3VGGA 5L2KE 1MI5A 1VKXB 1F00I 1EAPA 4OZGB 2ERJC 5J6GA 2DQGH 4YHPB 1N6QH 1X5AA 1YEFH 5EIQA 4Z7OE 1JP5A 4QO1A 3BN9C 2B2XL 4XHJC 4ZYKA 1XIWA 4J8RA 3ZE1F 2B5IC 2W9DH 4QHLA 1NKOA 3TPKA 1R3HA 2BERA 3RIAK 2FX8L 4FA8A 1MHPL 3VXRD 1A64A 1YEJL 1XF5B 4L4JA 2R4SL 3E2HC 2AJXH 3LPGA 4X8JB 3U4EB 2A6KB 1RZJH 2BVOB 2VE6B 1IC7H 1YNKH 2BSRA 1KELL 1UWGL 3OJMB 4F9LC 1VERA 1K2DA 1JF6A 5INCA 2Y5EA 2I9TA 5MI0C 4HUWB 4YBHA 3O8XC 3ARFC 3QXAB 1QBLL 2XQYK 4YPJA 3GMRB 2HTLC 3O45A 4JFFD 3B9EA 4XPBL 4CW1B 4MB3A 4XBPA 4L8DA 1EEYA 3CMOH 3MJ9A 4MCZA 1A5FH 3D3VA 2QLVB 1V7NH 1CVRA 4G7VH 2WK2A 2ZUTA 3KJ6H 2FEEL 2XN9B 3RKDC 2I5YH 2YK1L 1A3RL 1Z3GL 4HLZH 1ZHLB 1WUNT 1YMMA 3HMXA 4NM4L 3HAEB 3QG6A 2YPLB 5HHMB 1YY8B 1A6ZA 1RJYB 3CX5J 5FO7A 4PTUA 3CUPA 3O2DA 2VH5L 3BKYH 1HQ4A 3EO1A 2P5ED 3LKRA 5C0AB 1B4JL 5GISL 2DI8A 3HZMA 4JY5L 1RHHA 5AAWA 1FJ1A 1XGYL 2A9ML 1G7QA 3MOBL 4Y89A 3GSNA 3IAQA 3RQ3A 1DQDL 4WHCA 5D7KE 4KQ4H 4MA1B 1JPFB 3GJFA 1KIUA 5T3XH 3TYFA 1IJ9A 1JV5A 5E9DB 1BD2B 2AXGB 3ELAT 5C0EA 4PJFB 5L7XH 1WWCA 1MY5A 3IDXL 4JG1H 4KPHL 3ARGB 1LO2L 2DLFH 2IPUK 4MZ3A 4H8WC 3RJQB 1XGQA 5ITFB 1YYLL 4QRPA 5IW1B 1XGUB 2WLYA 4MD4A 3GI9H 1SJEB 4OQTL 1CZ8H 2V2WB 4I0CC 5HI3D 3VJ6A 5C0RH 5IF0A 2APTA 1MNUH 2YMXH 4YC2B 5CILH 1MJUL 2CGRL 4XCCH 2Z92B 5L6YL 3PJSA 1X5FA 3T0XA 1UC6A 3O2WH 3K4DA 3EJYC 4HIXL 1S3KH 3SCMC 3K0WA 5HJ3A 4IRJB 2KPNA 5CEXA 1MCKA 2AK1L 1N6VA 2NYYC 1KFAH 4JDZB 2ICCA 4NQEB 4TNWK 4X7EC 2PYEB 1UH4A 5A40E 1NGYB 2A0LD 4NNYA 3MYJB 1R6VA 3NIGE 4U1IA 3VXNA 2C3WA 3DMMC 1QP1A 4Q2ZA 5FKPB 4JM2F 2E7MA 1A6TA 4YHLH 4NCC2 1AQKH 1HCFX 3EOYG 2HFTA 3NCCB 1KN4L 3ZDYF 2MWCA 4UDTB 2HA1A 3TWCL 1NPUA 3UTTA 4MX7B 1F13A 4L8SA 4Y4FA 1CXHA 1IAII 4Y5YB 5IK3A 3DOSA 2BOBB 1FYTB 4OM1H 3FZUC 3OAYK 5CFHA 3GBNH 1K4CA 3REWA 3KLDA 5I2IB 5JOPE 1LD9A 1T1YA 1WVZA 2BNUB 1S7RB 1HYSD 1FRGH 5J1SC 4OLVH 2BJML 3S3SA 3WSQH 2D7NA 1E0OB 3QI9B 5DHYA 2UWEB 2IG2L 4IRSC 4O2CA 2FZ3B 4OLYH 5FYJH 2UVFA 3EYSH 5MEQB 3LDBC 4BK4A 5KZCB 2WWKO 4G9FD 5I74B 2VZ1A 4LOUC 3VRLE 1KV3A 4M7KH 2QQQA 2NY4C 32C2B 4F7EB 5CD3A 2EYTB 4QWWD 1OGTB 3D39E 1C7TA 1KXTB 2BRRH 4POYA 2ITDB 2ORBL 4GKSB 2OL3H 3LN9A 3BYTA 3T0EA 2VL5B 5ADOL 4NBZB 1OP3H 2FO4A 1P9MA 5H2BA 1R3JA 2Y7QA 3CJJA 4M62H 1LEGB 1AP2A 4LCCB 3FQTA 5GJSL 4PRHD 1TJIL 4UB0H 3HE7B 5DJ6A 3EDDA 1OLZA 5JDSA 1CD1B 3H9SB 3NZ8A 5IROC 3UMTA 1JHLH 3GO1H 4H0GA 5I1AB 1GZQA 5GGQL 5EUKA 1ED3A 4MA3B 3ULVD 2AKRA 3TO4D 5DUBB 1J8HE 4OZIE 1AC6A 1P1ZA 1SVCP 4PG9A 3PDGA 1U58A 4Y16D 4OGXH 1OSPH 2WIIA 3HNVL 3FHAA 5IKCA 4PJGB 2B1HH 3DRQA 4GSDL 3VRJB 1ERNA 3IGAB 3T0VA 3T3PE 3C60C 4BJLA 2GYSA 3M8OH 4PBVC 3RWFB 4ZTOH 3MCG1 4XRCB 3TV3L 4GRMA 5B38B 2HJFB 4MDIA 3PL6A 2O26U 4U6YA 5EZLA 1MHHB 3P77A 1BQHA 1HSAA 1MREH 1T2JA 2ADJB 3VD5A 1NLBL 2HJLA 3S35H 2QQLH 4DVBB 1JGVL 1F90H 1KCKA 1F3JB 1T1WB 4HEPG 5K9JL 5DURB 1IAKB 1TQCB 2PO6C 3EDFA 5T5NG 3QEUA 5HYSA 4WNQB 4D0DB 4FABH 3VXUA 3RL2B 4FQJH 2X4QB 2AJ3B 4S1SH 5D2NB 4IMLA 1AIFA 1RU9H 2WBKA 5D4QA 5LGHH 1A9BB 1IAIH 2OJZL 3DX6A 3OXRB 4QXGH 3F8UB 4FQQA 3UTOA 5GS2H 4PJ5E 4WO4A 1ACYH 1MH5A 4WW2C 4CN6A 4POZD 4HUKB 2D7QA 4XMPH 1HHIA 1BFVL 2F5AH 1TCRB 4I4WB 2BP3A 2FEDC 4WUUA 1KCSL 5EUOB 1NFDB 4KQ3L 2MSPA 5C3LD 1KLGB 3MGOB 3QAZB 3QUXC 4LVHC 1G9NC 4I18C 4XPGH 4DGIH 1NGWB 3BH9B 1FVEB 2EDEA 3ARBA 3RVXC 3D48R 1I1AB 2YD5A 4YWGH 2I25N 3ZTJG 5HD8D 4YFEA 1E6OH 4LQFH 5D7JB 3QIWD 4OV5A 1EEQA 3P40A 1H8NA 4ZODA 2XQYG 2WUCH 3IJHB 1A6VH 4WWID 4Y8DC 2DWEB 4PJ7E 5DRWB 1UM6H 3QJFA 1JPSL 3JSSA 1YMHB 4O2FA 4FQXA 3N1GC 1EFXA 3HC3H 1Q9KB 4NO0D 5D96C 2X2YA 1V3MA 2H3NB 3OXSB 4LIQE 1RZ8B 4HC1L 5ESVA 2XZQH 1MRDH 2IANE 3QJHB 1REIA 4WCYH 1U3HC 3O6KL 5I1DA 4D0BB 4JM4L 4PJ9A 1CFBA 3ARTA 1A7RH 3LN5A 4DK3A 3K8LA 4UTBH 4F2MB 1IGIL 4MHHI 1NCCL 4G6AD 1J5OL 1UZ8B 1MJ8L 1FL5A 1CGUA 4LRNH 2DQFB 3CFCL 4OT1L 4Z7VA 5INDB 4S1QH 1CICA 2XWBA 5FOBB 1QRNB 4X4ZA 2FDBP 3BPNB 3QIBD 5D9SB 5JA9A 1LK3L 4JFOB 3CFKA 1K4DB 3PHQA 1IE5A 3ZO0A 1DFBH 4HZLB 2K1MA 2IBBA 4XVSH 4RFOL 4UI2A 1NUGA 1T5WB 3O3AB 5IT2L 2HFFB 4HWUA 1DQQB 5GGSY 3B5HA 4WEMB 3BXNB 4ODWA 3GSQB 2VMFA 3BW9A 1I75A 4ZPTB 4M5ZH 5E08H 5FIEA 4FFVC 1P4IL 3ARDB 2OQJA 2KQNA 5CSBA 4Y4HD 1PJ9A 1YY9C 3IAPA 3TIDA 3ECBB 3F58L 1YN6B 3BKCH 4HUUA 4MA7H 5ACZB 3S4SA 4GQPH 4OZHB 2IPUG 5C2BH 4YQXH 3WJLC 4JRXE 4Z6AT 2APWA 3AY4A 1XEDA 1HSBA 1WFNA 1MHEB 4YIQB 2C3GA 2EE9A 4XMKL 4P2QD 4ZUSB 4JJ5B 2WMPA 3UZVB 3M1BA 5DSCA 1Z0MA 5T1LD 3QXTA 3QCUL 3B9KC 4M9PA 4LAJH 2AJVL 1QFWI 5C09D 4WI3A 3VI4E 5I8KH 4NDMB 4XB8A 1HHKA 4ODXA 4K94L 4LNRA 4OTXH 4NO2B 5GGUA 1FE8L 5DQJB 1W8NA 4AH2B 1Y0LB 5IVZA 3FJTA 1J0HA 3GMOB 5FV1L 1WT5A 3U7AA 4Z0BL 4L3EE 1NBQA 3ZYOA 4OCSL 3VFUB 4HWBA 2PTVA 4XHQA 1QEWA 1XIWD 2J2ZA 4M7JL 4JFDE 3OR6B 4KTYA 1BOGB 4IOFD 3AC0A 4N1EA 4W6YB 4YDLC 3V4VH 3VWKC 4YHOH 3ZHLA 1GC1L 4N5UA 1KCUL 2VDML 3QUYB 3MJ8A 4JHWL 5L88H 1G9NH 4L29A 4TVPD 5GGTA 1CGTA 1IAIM 4XXDB 2QHRH 3CZFB 5IB3B 1T7WA 4HHAA 1C5BH 1ZVSB 4OLXL 4JZOA 1IKNC 1W2KT 1KCVL 4M1DH 4NO5B 4OIIH 5F7DB 1FVDB 4XPFL 5EZIH 1MCWM 4NFBA 3RNQA 2HRPH 3A67H 5DDHB 3GSUB 1UJ3C 3D3VD 2D03L 2GK2A 1ADQL 1ITCA 1ONQB 5CEZH 1OGAB 1NAMH 3FQNA 5LVEA 3OWEA 3DXAA 3UYRL 4O4YL 5ANMA 3B6SA 4P2OA 4KJWD 4PJAF 3K2UL 1AGDA 1YMMD 4DOHE 4OD1L 3MA7A 3BQUC 4Z0XB 4MXVF 4O5LH 4OFIA 2ZZUT 4GRWH 3KAAA 3MOQA 1HOCB 4Z95H 3MA9L 1UZ6F 4ZOEA 3SE4C 1I1RA 3UBXI 4WW1B 3GJEB 4G8FA 1EUTA 1ZGLP 3MACH 4MA8L 4DAGL 1PKQA 1UB5B 4NQXA 5DA0B 4I1NB 4BK5A 4KJPD 4JE4B 4X0KA 4GG6F 1QFWH 4BSWB 1S7SA 1FGVH 2ZUQB 4U1SB 4BSVA 4Z7WE 4D0CB 1JWUB 1RQ5A 4BQ8A 4HKZA 5FGRA 5EOCJ 4YXHL 2HYMA 5IMMA 2J6EA 1MIEH 2Y6SC 1FZJB 3CX5K 1J05A 3I6GB 1DN0B 3NFSH 4QRPD 1QSEE 1MFDL 4RGMC 4E42A 2NXZC 5DHVA 2NQCA 3FTGB 4BUHA 1BIHA 2EDNA 3MRMB 1DLFH 2QSTA 5I16A 3RTQC 5FYKL 3P4OB 4APQB 4PFEA 5JQ6L 3GRWH 5BS0B 2XFXA 3OZ9H 4X4ME 3HR5B 4GQ9L 4LBEB 4PV9A 1E4KA 4LAQL 3FO2A 2VLJE 4LASL 5DK0A 3KXFE 1O5DT 3VRIB 2OTUA 5JZ7C 2NR6D 1IEBB 5IHBA 3SGKC 3TZVA 1G9ML 3QXUA 5CWSA 3L3DA 3C8HA 1S7UA 4QHKJ 4XNMA 2F8VA 1GZPA 5HGHA 3RKPA 5JR1H 4LLWB 4MQ7A 4ODHL 5DMJB 3P0YL 3WIIH 5IHZB 5ADPL 4YHYC 5HDBF 1KJ2L 1ZEAH 1A7NL 3L6FA 4AENA 4WFGD 2ZG2A 3Q2CA 2MCPH 1AR2A 3EJZC 5D1XA 5E8DL 1IKFH 3IXAB 1D5XA 3X12A 2Q7NA 4NNXB 3UTTD 5KVGL 1A6PA 2NZIA 4X6CB 1ZT4A 4JKPL 3MRHA 4U31A 3NFPA 4Y4FD 5GRJL 3K4AA 5DUPL 5C6WH 5JOFA 5HGBA 5I1LB 3BGMA 1U8IB 1BLNA 2X7LA 4I3RH 3CDCA 1XF4A 1KJ2B 3JVGA 3AMLA 4ZUVB 5CUSL 5ICXA 3VXRE 3DX8B 1HXYB 4RSVA 3OKYA 3FT3B 4PS4L 3Q1SL 4GXVH 4XVTL 1YUHA 3MV9B 5HYQB 2V17H 5DD1H 2VLKB 3UCRA 3PE9A 1CK0H 5IHUH 4CN4A 5KANG 3QIUA 4JDVB 3BZFB 5CP3A 5EA0H 2AJYH 2DL2A 3KYOA 4GKOA 3ULUD 3U0WH 4U7MA 4FFYL 4PGEA 3AXLA 3W5MA 3LH2H 1ZMYA 2X4SB 4M5YL 2Q6WA 2G5BA 3T0ED 4R0LC 4KJQC 1KENL 3D18A 3HG1A 4HF5H 4ONGL 4KUCD 1BVKB 4CNIA 1SYSB 5DQ9A 1L9NA 1CLYH 3ARXA 3MLSL 1JZ2A 4X98A 4WWKC 3F7VA 1X6NA 1DLHB 4X4XB 2A77H 1FHGA 2CXGA 1OARL 1UM4H 4J3TA 4NJAH 5F7YC 1Y6NR 4ZXBB 3C6LA 5JW4R 3G04A 5F7FA 1JWSB 3ISWA 3T77B 5J3HC 2YD3A 4NZJA 5HGDB 4N0UA 3N1MC 2PXYC 5KJRH 4EUPA 4V2BA 4WI6A 5T1MA 1QKZL 2ZCKL 3MLWH 2YOCA 4HIEB 3CSBA 4G42B 1J0JA 4XP1L 3GBML 2P5EE 1FFNB 2EIZA 4PJHA 1E4XI 2KDGA 3MROB 1C5CH 1AGBA 1JF1B 3X3FH 4NC1E 3W0WB 1YZZA 2VWEE 1AKJA 3GSOB 5D7SL 2CD0A 4M7ZB 3JWOC 4NKMB 5B21A 1BJ1H 5H37H 3QH3A 1Q38A 5EPMA 1ZHKA 1X5LA 3TT1L 3KPQA 4PIRF 4DUXA 1RUMH 3PL6D 5HY9A 1KC5H 4G6MH 1WIPA 3TBSB 3JWDC 3K80A 3EFDL 3D87B 8FABB 2RB8A 1WZLA 4YDVB 3KPRB 5DD5L 1KN2H 5FDYA 4M93C 2R1XA 3TIEB 2V2XA 1V3KA 1JN6A 3N85H 2CRYA 2HT4D 1QFWM 5T3ZE 3VXUD 1JGEB 2VXUH 4B5EA 1BIIB 1IM3A 4YPGB 3E6HB 3RL1B 1OQOA 4KAQL 3AAZA 4WO4D 4ORGB 4WHYG 1MCQA 2V5MA 2IC2A 4RRPG 5KSBF 2JCCE 4NQCB 2DMKA 2FGZA 4E5XB 4R96B 3QT2A 5E8PA 2NXYB 5EOQL 4WUUD 2W9EL 4GRWF 4NQDB 1OHQA 4ONHA 5DEFA 1QBML 4TTGA 2DQUH 4RGND 2BVYA 5T33H 4WFHD 4PGCB 3CLEH 2D7TL 3THML 4Y88A 4LSUH 1XGPA 3OKKA 3O4LA 1QSZA 1DANU 5E2WL 5MP6L 2FATH 3ARBD 3NZHL 4WFED 1KIPB 2Q76B 3NBNA 1KJVB 3CVHB 4AMKH 1VKXA 3QA3B 1AXTH 5ALBH 4G8IB 4OZGA 1DL7H 2VZ3A 4YHPA 4W4NA 3KJ4C 2XPGB 4NZDA 4PRBA 4JPVL 3WFHB 3OKOA 5C9KA 4JN1L 2EDTA 3G9AB 2C9AA 2VL4A 1U8NA 3RVTC 2BZDA 4QEGA 3UAJD 2MKWA 2IQAB 1I9IH 4FQXD 4YGAB 4X5XB 2OMBA 1EFXD 3CVIL 1ACZA 3I2CH 5F6IC 3NIDF 5DO2D 1G7PB 4YJZL 3OAZK 2APVA 4FXKB 2FBJH 2F74B 2PTUA 4EJ1C 1KBGL 1SQ2N 2FECL 4P49A 5KW9L 4Q6IB 3U4EA 3LEVH 2BVOA 1XR8A 3BKMH 3TT3L 1IGML 4PJ9D 2H26B 1IL1B 4JO3L 25C8L 3DJ9A 4HUWA 4NKOB 3MLVH 3QFJB 4W4OC 1HKLH 1N7ML 3HLAA 3GHEH 4G9FE 4FZEH 1CDGA 3HTLX 3GMRA 1CICD 3U0TB 1NCTA 1G7MB 3DUUB 4M6MH 4CW1A 3CC5B 5TQ0L 1VFOA 1UXSB 5D5MF 3L5XL 4G6JL 1T66C 1CGVA 5GRVK 5JHLL 3C9NB 1QFUH 2Z8VC 3QYCA 2A73B 5ISZB 2XN9A 2B39A 4X4YB 5I1JH 4ETQB 4GW1A 1ZHLA 1UFUA 1KEGL 1HEZB 3EDKA 3PHOB 1QLEH 4LLUB 5CLWA 4PRHE 3RGVC 5BQ7B 1YY8A 2QADB 1RJYA 1B6UA 2FD6L 3SGEI 2BNQB 5F3BA 5GS1B 2HFGL 4MJ2A 5C0AA 2X4UB 3FRUB 2WQ8A 4XB7A 2P5WB 3T4AB 4K3HA 2FX9H 1UCBL 4XWGL 3MV8B 1HHHA 1N5YH 4FRWA 5FV2A 3I84A 2X44D 1NCNA 3JWOH 5GZOC 5D2LE 3G6AA 3UXFA 1JPFA 3L3OB 4FTVB 3BP5B 1BD2A 2AXGA 5I9QB 4LRIC 2N4IA 4GRLC 4PJFA 4S1RH 5TFSH 1WAAF 4ODUB 2AGJL 5TDPB 3CH8A 1SHMA 2JK5B 3X3GH 3ARGA 2AK4E 1IM9B 4R90L 2ZUVA 5I1GH 1X6LA 1HI6B 2AEQL 4EI6B 5IW1A 4LNVA 1XGUA 2Z31B 1SJEA 3LPFA 3QHZH 4GMTL 3U9PL 1T0MA 2Z92A 1I1CA 3L3GB 4JGJA 2ATKA 2GY5A 1ORQB 3B3IB 1K3IA 1RIUH 2GW5A 1EMTH 2I60L 4IRJA 3TEUA 3B2VL 4LSSL 2W59A 2WWKT 4E0RA 4JDZA 2OP4H 2VXQH 2HT3D 2PYEA 4G8GB 4UT9L 4ZUUB 1NGYA 5GPRA 3MSPA 4OQTA 1J1XH 3F7PC 4JREC 4DEPC 3MYJA 2X4RB 3WEXB 4JEGB 3UTPD 2HH0H 1EZVY 2HFEB 4HAGA 4YE4H 2EH7H 2WSKA 5BVJB 4F9PA 1DSFH 1MWAL 2NY1C 3EYUL 1LNUB 2ESVB 4UDTA 4KH2A 2EC8A 1EVTC 3WFDH 3UZQA 3OV6A 2OJEB 4MX7A 5JO5A 4WEBH 1HH6B 1A7BA 4NFDA 3DXAD 1C1EL 4Y5YA 4P2OD 1OTUC 2J4WL 1FSKC 1Q8MA 4K23H 4OI7A 3ZSTA 2BOBA 4P5MB 1FYTA 1XCTB 1M05B 3GBLA 5CJOL 3VXOA 1EJ6A 2VAJA 3O3UN 1OF2B 2BNUA 1G1CA 1OTTD 1S7RA 3MGAA 3S34L 3SGEH 5CINL 3QI9A 2UWEA 5JW4Q 1UXWB 5E2JA 2FZ3A 2AJSL 3QUZB 1MPAH 3FONB 5MEQA 3BMWA 4PJDE 5M7QA 3JTTA 1F3RB 1NMCB 3LZFL 5BJTB 5KG9B 1CD0A 3NH7L 3RFZC 5D70H 3DV4A 3Q6GL 2QEJA 3GM8A 3BDYL 3BP7B 5JPNB 32C2A 1DANT 2EYTA 4FFWC 1OGTA 4HCRL 5CZKA 2ITDA 3SDYH 3DRTB 4GKSA 2VIRB 2VL5A 1IT9L 2D9QB 3FO0L 4XP5H 1HILB 2OSLB 1LEGA 1S5HA 4KXZH 4LCCA 4K7PL 3Q5TA 1TCMA 2DWDB 1U8KB 2H32B 4KKAD 1UA6L 3ZSSA 4P23C 1QOKA 1X4YA 3GIZL 3HE7A 1CD1A 3H9SA 4OFYA 4Z7QF 1XT5A 4X9BA 4NN7C 1PD6A 3WXVH 4PJBE 1FYHB 3FOLA 2RGSA 1P4LB 1EXUB 4TRPH 2O5YH 3O4OC 2V9TA 5DUBA 3BRGC 3O3BA 4GAFB 1DZBA 3HPLB 3KWWB 1M6OB 2VN7A 4JKMA 5F6HJ 5I1KL 1NEUA 3V6FB 3VRJA 5C3TA 1TZHA 3IGAA 4PR5B 5BV7B 4P2QE 3RWFA 2WBJC 3TZVD 4LHJB 4FXGB 4XRCA 4HUNB 1AJ7L 5B38A 4WV1A 2HJFA 5EOTB 1JPTH 5C09E 2ADJA 1UH2A 1BF2A 4RZCB 1BFTA 4NKIL 1WC7A 2EXYC 3G5XB 4DVBA 1J8KA 2JB6B 4L8BB 3TYGL 1T1WA 1YPZB 3BE1H 1WWBX 3UJIL 1NQBA 3VG0H 1IAKA 5DA4A 1OSZB 5FDWB 4KI1A 2JJUA 2A9NH 1BPVA 4WNQA 4D0DA 1MI5E 4OF6A 4DGVL 1CFQA 5F9OL 3RPIA 4TVSa 3RL2A 4X9GA 2X4QA 2AJ3A 5D2NA 3WFEH 1N0XH 1BQHG 3MLTB 4XWOC 1QFOA 3KPTA 4I0PC 4ZOAA 1H0DA 5JW4N 4LSVH 4ZOCA 5JXAL 3V7AG 3MXWL 4NSKB 4GG6B 1WSST 3TNNB 4XCNB 3GSXB 2BSED 1TCRA 4I4WA 2Q86A 2ZUUA 4P4KC 1R5VB 2IFFH 4WI2A 4G5ZL 1CIUA 1F3DJ 4LIQL 1NFDA 3LSOB 1QBAA 1KLGA 3MGOA 3IRPX 4G3YL 1NMBH 4C56E 4JB9H 1YNKL 3AFLA 3VFSB 4WI5A 1NGWA 4PJCB 3QIUD 4B7LA 4HG4J 3BH9A 1FVEA 4M61B 3EFFB 3DHJA 4HPYH 3H9HB 4JZJC 1I1AA 3I6LD 1HHJB 2BDNL 5KAQF 4U1MB 1LHZA 4DN4H 4LCIH 3HG1D 2P45B 1AH1A 1B90A 4JQVA 4RGOH 3QPXL 1EEZB 3IDYB 5KSAC 3QNZA 1CGSL 4G7VL 3IJHA 3D3VE 4N9GB 4Y2DB 4LEXH 3MBEB 4JFHE 4QGTA 2DWEA 3A6BL 3FN0H 1YMHA 2LABA 5BOPA 1WICA 1WZ1L 2VDOL 3QEHB 3KS0H 1OW0C 5F7HA 3LB6D 3O6FB 3C6LD 4OCYH 2H3NA 2VKXA 1YMME 3QO0A 1RZ8A 4PJIB 3C2AH 1P4BL 4ZFZA 1FG9C 4YUEL 1XAUA 3VRLF 5D93B 4D0BA 4M48H 1A21A 3NA9H 5C07E 4F2MA 5DWUH 4H88L 3SKMA 4X80L 4EN3A 4GW4B 1AGCA 1J1PL 2O93L 7CGTA 5DVMA 1AKJD 4IBLT 3RI5F 2VXVH 1ZLVH 2DQFA 3R1GH 4LKCB 5INDA 2GK0B 1DBJH 1BAFL 4KKCD 5IJKA 1BM3H 5FOBA 1QRNA 5D9SA 5C86A 3VDCA 4HZLA 3MLZL 4Z7UE 4PD4J 4S1DC 5JUEL 1UADC 1T5WA 2FH6A 3O3AA 3NCYP 2HFFA 3BOVA 5J8OA 3BXNA 3GSQA 4JRXB 1AI1L 4LSPH 5FOJA 4AEEA 4UOJA 3ARDA 3MFGB 4OZIF 5M94B 3JZ7A 3P3YA 3QDHA 2A83B 4PLJD 3ECBA 4QRPE 1YN6A 3OPZL 3GHBH 5ACZA 1I85C 1OTSD 1S9KC 4KRPB 1ZLWK 2J88L 2WUBH 4WGWB 4X6FB 2ADFH 4RMWA 3FAWA 2DKSA 5FB8B 4M3KB 4OLZL 5C0BE 4JJ5A 4ZUSA 2F58H 2AI0H 3CLFL 5IFAH 2FGWH 2AEPL 1NUFA 3LCYA 4JR9L 3S4SG 4R4FL 1SJVA 4NDMA 5ENWB 2NY0C 4HGWB 1UQSA 4Z9KB 3AGVA 3O4LD 2B4CL 4NO2A 3H9ZA 4IM8A 1DBBH 5DQJA 5TH2B 5C6TH 4AH2A 1WWAX 2EXWD 3ARWA 3GMOA 4BH7B 5KN5B 1DQML 4KMLB 1F58L 5CD5C 4WFGE 3VFUA 5DEGB 2FCBA 3B5TA 4QHUB 4Y1AB 5A2IH 4GAGH 1ZHNB 1FNSH 3ES6B 2Y07L 5EB9A 3UEZA 1BOGA 1MCLA 4TULL 4P4RA 3O6LH 1LP9B 1MLCA 1NAKL 1RZIB 2R8SH 1IEHA 1A1NB 3EOBB 5E5UB 4LLMB 1QQDB 3RDTC 1FRGL 4Z5RB 2LU3A 2ERJB 4H5SB 5F3HB 4I48B 1FNEB 3VGEA 4XXDA 3CZFA 5I71C 5IB3A 3RIFK 3UJTH 2FLBT 2B5IB 2BVQB 1ZVSA 2C3HA 4FOMA 5CJ5A 1I9JL 3PWLB 5DT1L 2JIXB 4NO5A 5F7DA 4JFZL 3QDMB 1FVDA 3ULUE 1SEBA 4XNQA 4CMHC 1WTLA 4PJ7F 3E2HB 5DDHA 3GSUA 2OL3L 4HPOH 1OGAA 3ALPA 1U3ZA 4PYGA 1LDSA 3UJJH 1AQDB 1RMFL 2XN9D 3MLRL 3L5WB 3MRCB 4F7MB 3WJJC 1EHAA 5HHXH 3F7RA 4G7YH 5MI0B 3O8XB 3ARFB 3OGOE 4UDUB 4J2XA 5HHMD 4Z0XA 2GFBB 4N1HB 3RWJB 4B0MM 12E8L 1U6AL 2V5SA 3MYZA 4EDWL 5B4MD 1Q0YH 3MOAL 1HOCA 2OL3B 3JV6B 5C0AD 1ADQA 1G84A 3F6LA 3LS4L 3P0GB 4WW1A 3GJEA 3MRQB 4OD2A 3PUCA 5EBGA 4AIOA 4IJ3C 4QRUB 4OIBA 2YEZB 1CTNA 4R7DB 1JBJA 3LN4B 1I9RL 4OB5L 1KLUB 1UB5A 4LCWB 3NGBC 5TJWK 3TVMC 1A6WL 4BSWA 3OKDB 2IAMC 1BD2D 1YEKH 4U1SA 5IW6A 3SDDA 2DOCA 4D0CA 3MRPB 1FIEA 2OZ4L 1IC5L 4NZTL 1CLOH 3ARGD 1NSNH 1CXIA 5CCKL 1P84K 4OD3L 4H8WL 5EBWA 4YDIL 1X5HA 2F15A 4PRPB 3V7AE 2ARJB 3FTGA 3K1DA 1QTYT 2HG5A 5E2UH 3WIFB 3VXUE 4APQA 3IT8D 3P4OA 3OJ2C 5F7WC 3U46B 2R56L 5BRZB 4ODSL 5BS0A 2EDWA 2Z93B 5FECB 4LSTH 3HR5A 5LWYH 5IBUB 1GIGH 4IRJD 5C0JB 4IDLA 3LD8C 3VI4F 4R2GC 4DFIA 2PYED 3VRIA 4ODTH 5GRUL 1IEBA 4WUUE 3OKEB 5GGRY 5C71A 3V6OC 3BKJL 5JNYB 2K3TA 3CFIC 2GITB 4WFHE 4LLWA 3BD4A 1JNLL 4NGHL 3TFKC 5IHZA 3SCMB 3O41B 2R0ZH 1VDGA 3MLUL 3T2PA 4JY6A 1KT2B 2OR7A 2IQ9H 5FFLA 3C87A 3ULVC 4WFEE 3TO4C 3IXAA 4NNXA 5E00B 3QG7L 2LFGA 1A3QA 4BFBD 1KNOB 1DQJA 3E3QE 2LTQC 3CXHK 3DMMB 1U9KA 1FYTD 3DBXB 1WFTA 3O0RH 3HMWH 4UV4H 5I1LA 3MNWB 1U8IA 4HJ0C 4XVJH 5DFVC 1KJ2A 1OOAA 3DX8A 1HXYA 4MD0B 3QI9D 2XZQL 3FT3A 4YGVB 2IFGA 4FFZH 1B9ZA 3H3PL 3HNSL 4KKNA 3HE6C 3MV9A 2YZ8A 4CBPA 2VISA 3N1QC 5IBTH 1A6AB 1MUJB 3IXTB 5HYQA 2VLKA 3P11H 4LGRB 5KZCD 3O6ML 4JCMA 5H8DA 4XI5D 5C0DB 4JDVA 4M1GL 5EU7C 4NQUA 4B50A 3FQXB 4TUOB 1X7QB 4XMLL 5HVHC 1G1YA 2X4SA 4Z7VE 2Z0BA 5DK2B 4QF1B 2Q8BL 5JXEA 5EZOL 5AYUL 3DIFB 1VEOA 5FAAA 1BVKA 3WYRA 1SYSA 5GSRB 3W9DB 4EI5B 4IRSB 2GJ6B 3LDBB 1DLHA 5FO8B 4X4XA 1FAIL 4POZC 3OMZA 4YAQB 3HE7D 3H9SD 3IRZA 4NM8L 5HI5C 4OFYD 4ZXBA 4OV6F 2DJSA 2NY4B 5JMOC 4U2ZA 3T77A 2CKBH 2Y9RT 4L1DA 5K93A 4IHOB 1YA5A 3MRBB 5T3ZL 3BKCL 4FP8H 5TDOB 3VGAC 4HIEA 1IGTB 5DQDL 4YQXL 4IDJH 4HWNA 4N0YH 4JFQB 5ID1B 1FFNA 3MROA 1JF1A 4LPWA 1ITBB 1QFPA 3W0WA 4O2EB 3FB8B 3GSOA 4N8CL 5T5NF 4Z7WF 3S96B 4NKMA 4OKVB 3F5WB 4XVUD 4JGMA 5I8CB 3R8QA 3RWHB 5F72S 5I15H 3WFBL 2DBLH 5FCUL 2H6PB 3FT4B 4P3CH 3SE9H 1JNHB 2FRGP 4MQXD 5DUMH 2GI7A 3TBSA 4HKBB 1YEIL 8FABA 5EU4B 2AV7A 5DURD 4JHAL 3KPLA 2B8OT 5GGVY 3CFBB 1TZIA 2C3VB 4GBXC 4HMEA 1JGEA 1RD6A 1BIIA 3C60B 5H35B 3EAKA 4KDVA 4YPGA 3Q5OA 2NTFA 1X5KA 3E6HA 4RFNC 5I66A 3HPJB 3RL1A 1TVHB 2HLFD 2NY7H 4ORGA 1JYXA 4UILL 3FFCB 4MNQB 3KPNB 3DVNB 4NWUL 4R96A 3QNXB 4NQDA 2PO6B 4FQIL 2F5BL 5L2KA 1E4WH 1MJ7L 4PGCA 1TJHH 1MFBH 5C0FB 1MRFL 3IF1B 5I1IL 2AEWA 5E8OB 4UUJB 4PJEE 5EBMB 2DIJA 3UTPE 2IH1B 2I27N 3IFLH 3WHXA 1KIPA 3BH8B 4OBRA 1I1AD 3DETD 1KJVA 4WW2B 3W2DL 5A3ID 5IIEB 3QA3A 4NC0B 3ULVH 4Y5VC 4UNVA 4LLQB 3H3KA 2XPGA 3A67L 4HAFA 2E6JA 4FQ1L 4Y19B 3WFHA 3KLAB 3CU1A 3QUXB 4LVHB 4I18B 4J3WA 4XP9H 3V5HB 2PW2B 1ZTXH 2IQAA 3DXAE 4UZGA 1NDMB 4X5XA 2HRLA 5ANME 1EIBA 3IFPB 2WV3A 4CVZB 4FXKA 2F74A 1NCBH 5SWSB 4O5LL 2O5XL 1FO0L 1PQZB 4Q6IA 2H26A 3L3IB 1IL1A 5TDNB 3GMNB 3H7LA 4HG4K 3IDJB 3NIFE 2YRLA 4EN3D 2VUOA 1NAMB 4NKOA 2DMCA 3QFJA 5BXFB 2A1WL 4U3CA 4WEUD 1T2QH 5D1ZC 5KSVB 4UINL 3U0TA 3NCJH 5D96B 1G7MA 3DUUA 1IQWL 3B8YA 3CC5A 3HS0B 1QRND 4UQ2B 2DDQL 1PKQE 3WFCL 5F7MC 1CF8H 4P9HC 1B0WA 3U30C 3MPCA 1U3HB 3U7YL 2A73A 5ISZA 4HT1L 4XNXL 5KSUB 1KXQE 1MAML 4X4YA 4ETQA 1CU4H 3PP4H 4MJIB 2CDFB 3PHOA 1EBPA 2MHAA 1P5UA 2E6PA 2OM5A 4LLUA 4LPUA 3ARDD 5BQ7A 5HGAA 3NABH 3LEXB 4I3SH 1ZK9A 5FGCE 2BNQA 5I8OL 2V5YA 5GRXG 4PGJA 2GCYA 4UAOC 2X4UA 3FRUA 2J8UB 4TOYH 3R06B 2ZPKL 3GRWL 5IB1B 3MV8A 1AO7B 1GPOH 4A6YL 1A8JH 3H0TB 1GGBL 5EO9A 3T08A 3HAEG 2DLEA 4Q9QH 4WFFE 4U0RC 3VG9C 4IS6B 4LVOC 1JZ7A 3WD5H 4FTVA 4PD4K 2I07B 3BP5A 3VMNA 5IESH 2DLIA 4KK9D 5CJQH 4HKXB 4OCXL 4ODUA 3PWPB 5TDPA 3WLBA 5IB2B 1WBXB 2JK5A 4PLOB 5HPOA 3RY4A 1IM9A 1B2WH 1RURH 4OZFA 4EI6A 3Q48A 1X4ZA 2Z31A 4UT6L 2CJUH 3VFOB 4XNZC 3CX2A 3B9KB 5IVXB 4KZDH 2JCCF 4XPHH 2NY5H 1B88A 4W6XB 3MRGB 3QP3A 4KVCL 1ORQA 3B3IA 5J0BA 1PEWA 1QSFB 5D6DA 4UBDD 4XC3L 4G8GA 4ZUUA 4U1GC 3MV7B 2CUHA 3ARQA 5FM5M 5FF6B 3DO3A 2X4RA 5AD0B 3NPSC 3QDGB 1RK1B 1JVKA 2V17L 1A1OA 5K9QI 2VB5A 2HFEA 1IFHL 3EOTH 2AABL 3DX7B 1KIQB 4NIKB 1JK8B 1H3TA 3VWKB 4NZRH 1LNUA 2ESVA 4YDLB 3I02B 3WNKA 1G6RL 3TJEH 3I6LE 1VA9A 4RMVA 2OJEA 1OGAD 4QXTB 1MQKL 5CIPA 3K8MA 5J1TC 2NCMA 5ALCH 4DFHA 1TXKA 1LK2B 3TC9A 3V0WH 4ZNCD 3UBXB 4I3GA 4PTTB 4L4VE 4P5MA 4XBGB 1M05A 3DSFL 4Z8FH 1OF2A 3S37H 1MWAA 4PB0L 3RA7H 1NDGB 1TLKA 4XNUH 4F80A 1UXWA 2WW8A 1UJ3B 3FONA 2VLMD 4N0UE 4PPTA 3P9LB 5FXCH 3RWDB 2APXA 2ZWLT 4I13B 5KG9A 1SM3L 1P69B 1JCKA 4PJHE 3BP7A 5JPNA 5I18L 2R0LL 4KKBD 4BZ2H 1DBML 1Q9OB 1GHFL 3BQUB 4TUKL 2VIRA 1MVFA 2OR8A 3SDDD 3SOBL 1HILA 1PSKL 2BHUA 2OSLA 3LMJL 1CIDA 3E8UL 4ZUTB 3EW3B 3EO9H 5C2UB 1J8HA 2DWDA 2H32A 3I75B 1FN4B 2G60H 2X10A 4KTDL 2EDHA 5CJXC 3SGJA 1N0LA 2KBGA 2JJVA 3MBXL 3ULVF 3FHQA 4BKLA 3N9GL 1P4LA 4HCRA 4TVPH 1YEGL 5C6PB 2YZ1A 1EXUA 2C1OA 3FB6B 3KLHC 3GMLA 1MVUB 1TTGA 4APQD 3OAUH 5F21B 3HPLA 4JDTL 4DKEL 5BS0D 1L0XA 5D2LF 3KWWA 1M6OA 3IVKA 3P30H 1IC4H 5DD6B 4QYOB 4XP6L 4U7SA 3V6FA 4HWEL 1NC4B 3OR7B 3T0EC 3MJ9H 2IPKA 2PN5A 4RGMB 1QYGH 2NXZB 4FXGA 4B7IA 5EOTA 1T03L 5JTWA 3DI3B 3DYOA 1FDLL 5FYKD 1BREA 5J6HB 3RTQB 4H1LB 4K2UL 1G7IB 4RZCA 3G5XA 5EIIB 3U2SA 2JB6A 4L8BA 3O4LE 4AL8L 4RQQB 1YPZA 2EEDA 5FDWA 6FABL 1OSZA 3UPCA 5B3JF 4HWZB 2DQTL 5JMRA 4L8CA 3MX0A 4KI5D 1NMAH 5GRYA 1RJLB 1DR9A 5B38G 5JA8B 1TVDA 4OZGE 2EH8H 5DI8B 3TH4T 4NP4H 3NN8B 3B2UD 4KUZH 3MLTA 1AR1C 1BECA 4K8RC 3GSNH 5LKNA 1T89C 3V4UH 1MAKA 3LQAC 2IBZX 4NSKA 4D3CH 3TNNA 3GJFH 4ODVH 3I2CL 4XCNA 3GSXA 4YHYB 1R5VA 3V4PH 2FBJL 2EKSB 2DKUA 1X4XA 3LSOA 3GSRB 3HMXL 2P8PB 3MV9D 3VFSA 1J9CT 2VLKD 4GW5A 4RMTA 4PJCA 1AGFB 3PIQB 1S9VB 1E4XL 4M61A 3EFFA 4OCWH 4UU9B 1EA9C 2HT4C 2KKQA 2YKLH 1HHJA 4NC2B 3PP3H 4U1MA 2PW1B 5J1AB 5JXED 2XG4A 4RISH 5M95B 1EEZA 1FPTL 4Y2DA 2IANA 1CXKA 2HKFH 3MBEA 4JPWH 4J3XA 1RFDL 5HBBA 4ZO9A 2XN9E 3QEHA 2AXHA 4ZXBD 15C8L 3O6FA 2NY2D