1GS7A

Crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs7A02
3NP3A 1VLXA 4UANA 3WKQA 3X1FA 1V55B 2GHZA 1TU2A 4AX3A 3FQ1A 3SBQA 2H47C 3FU7A 4KO7A 1CYXA 3NSYA 4NAJA 2HXAA 1AIZA 3NSFA 4KOCA 3ABKB 4HAKA 3CVDA 4A68A 1ID2A 5B7EA 2WO2B 3FQ2A 3AG2B 2UX6A 2HRGA 1ILUA 1DYZA 1GY1A 2QT6A 2FQEA 3TASA 2YAHA 2CJ3A 5I28A 3EH5B 5AFAA 2P80D 1A4BA 3EH4B 2YAEA 1XB3A 4WKXA 1PZCA 2IH8A 1XB8A 5E9NA 5D4HA 1AR1B 4P5SA 4KOBA 3OD3A 2N0MA 4E9QA 1ET8A 2XLLA 4GY4A 3G5WA 1WA2X 3FSAA 1BXAA 4KO6A 1QLEB 3DIVA 1M56B 1BAWA 2UXFA 1PNDA 3NYKA 3OQRA 1KDJA 4DPCX 4HALA 5F7AA 1L9RA 4G7RB 2HZHA 2HX9A 1SHWA 2WO3B 1IBYA 1ZDSA 3T6ZA 3DKHA 3S8GB 1KBVA 3EF4A 2ZXWB 2FNWA 2BHFA 1GSKA 1TEGA 1UATA 1NDTA 3MBWB 1MZYA 4E9SA 4DP6X 3UAEA 1A4CA 3NJJA 1I53A 4FAAB 5B1BB 3NJIA 1ZIBA 1OCRB 2UXGA 4BDVA 2PLTA 3QJRB 4QKTA 1WS8A 1YLBB 1J5DA 2EILB 4BK5C 2FT8A 4HHWA 3ERXA 4X4KA 2VM4A 1BQ5A 5F7BA 4A66A 2PCFA 5I6PA 9PCYA 3ABLB 4F7KA 3FQYA 3IEAA 2XYBA 1KGYE 2IWKA 3FSVA 2Q5BA 3WKPA 2BP8A 3N2JA 2IWEA 1RZQA 1ILSA 4E9WA 1MG2C 2BO0A 2PPAA 1RKRA 2ZWNA 3PPSA 5AZUA 4W9ZA 3PAZA 1KDIA 2J5WA 1AS8A 4TXVB 4YSDA 3S3CB 4M4RB 3NJFA 1TEFA 1W6WA 3EH3B 4G70B 4W1TA 4YSAA 1PF3A 2AVFA 2AZUA 4BWTA 8PAZA 2UXVA 5TK2A 1GS7A 1WAEA 2BP8B 4YL4A 2GB2A 1NWOA 2VN3A 4A2FA 2R7EB 5LDUA 1X9UA 1B3IA 3AG1B 2ZONA 2VW6A 1ZDQA 1V54B 3L45A 3QJQB 1E65A 1M57B 1V10A 2PPDA 1JERA 1A4AA 3N55A 3NJMA 5A7EA 2JKWA 1T5KA 4DP9X 4CSZA 5I6NA 2QPDB 3ASOB 2EIJB 3WNJA 3OMAB 1GS6X 2XUWA 1L9SA 3PLYA 5IY5B 1SHXA 2DWTA 2GSMB 4DP5X 2BW5A 4YSTA 1J9SA 1OCZB 2Y1AA 5I6LA 1CYWA 1IC0A 2JXMA 2IDSA 3NP4A 1F56A 4RH4A 1AZCA 1ASPA 4YSCA 2MRYA 3X1GA 3CVCA 2TSBA 4PCYA 3ZDWA 1AG6A 1IBZA 3SBPA 1FWXA 3ASNB 3V9EA 5I5IA 2BZ7A 1JXDA 1N68A 2Q9OA 3IN2A 3FU7B 1AACA 1JZHA 2OJ1A 1SFHA 2W8CA 3JT2A 1PLBA 3PCYA 1IUZA 2BP0A 5I26A 4JHVA 1PCSA 2GC4C 4ZK8A 3WI9A 3AG4B 4E9TA 4GP5B 4UF7C 2YQBA 5B7FA 4DP8X 1BYOA 3HEIB 1FA4A 3TA4D 1AZNA 1KV7A 2XVBA 2XWZA 2YAOA 4YSEA 3NJNA 1SDDA 3HB3B 1PNCA 4A67A 2I7SA 2IDQA 1HAWA 2VSMB 2IDTA 1IKOP 2HX7A 5ANHA 2PP8A 3X1NA 2IH9A 2X87A 3QPKA 4A2HA 1TKWA 2UXTA 2RACA 4N4YB 2BZCA 4AKOA 3GYRA 3NSCA 3C75A 1AQ8A 2YAMA 3S8FB 2HRHA 1NTDA 2XX1A 3WNIA 1PAZA 1QHQA 3CZUB 2IAAC 1ETJA 1MDAA 1OCCB 3FU9A 2FT7A 4M3HA 6PAZA 2EIMB 1A8ZA 4JHUA 3ZBMA 1CUOA 2YARA 1BEXA 2FTAA 3DTUB 1BQRA 2PPCA 2MTAA 1GR7A 1SNRA 5B1KA 2GC7C 2J57A 2VW4A 2FT6A 2OV0A 4YVNA 4WTQA 4DP1X 4DPAX 1AS6A 1E5YA 4BDVB 1OE1A 2X88A 3S3DB 1ASQA 4GYBA 4YSRA 6PCYA 2AANA 1PY0A 5AKRA 1E67A 2XU9A 1MZZA 1JXGA 2CCWA 1CC3A 2QDVA 1J9QA 4CSPA 4NERA 4GP8B 4UAHA 2GBAA 4E9YA 1NIDA 4FA7B 1NPJA 3NSDA 1GW0A 3QJTB 1OCOB 3GXUB 3RYMA 3T6WA 2BW4A 4DP0X 5EHFA 4HIPA 1SF3A 3UGEA 2W88A 1AZUA 3FSWA 2DV6A 1JZFA 3FYIB 2FWLB 1L9TA 3OMNB 1ET5A 2DY2A 3CDZA 3S3BB 1JVLA 5B1JA 1SF5A 3TU6A 3NJGA 1J5CA 1PLCA 4A2GA 3AY2A 3X1BA 4YSPA 2PP9A 3NJLA 4HCFA 2XV0A 4E9XA 2J55A 1M9WA 1E5ZA 3FYEB 3NT0A 1OE2A 1GS8A 2DYSB 3D12B 4P5RA 4DP2X 5PAZA 1N70A 2VW7A 2QPEB 1PZBA 1NIBA 4HZ1A 3UABA 1PLAA 7PAZA 1L9OA 1E30A 2CAKA 1X9RA 4MFHA 4A2EA 1FFTB 5FC9A 4QLWA 1R1CA 3CVBA 1JZIA 1WS7A 1HFUA 3EHBB 4HHGA 1W8EA 2HLEB 1ZPUA 1ASOA 4DP4X 2P80A 3BVDB 4E9RA 3QJSB 1OOWA 2YXVA 2VMJA 1MG3C 1GY2A 1EHKB 1ZV2A 2DWSA 4KO5A 1NIEA 1XMEB 2IWFA 1JXFA 3FS9A 1AS7A 3OM3B 1AAJA 2GI0A 4G7SB 4EF3A 2I85A 1BXUA 3TBBA 1ADWA 1RCYA 2TSAA 3SBRA 3H4FA 3KW8A 5PCYA 1KYAA 2XXGA 2VM3A 5B1JC 2EIKB 3X2QB 3WIAA 3AW5A 4YSQA 4HCIA 2FQDA 2ZOOA 2B08A 2NRDA 3JTBA 2XXFA 4PAZA 1AZBA 4G71B 2OCCB 1PZAA 3IE9A 1OV8A 3T71A 2BP0B 4YVUA 5B1AB 5I6KA 2QDWA 4BXSV 3AZUA 4AKQA 4DPBX 2CALA 1NICA 1NIAA 3MX0B 3FPYA 3KW7A 2XX0A 3AG3B 1BYPA 2HX8A 3IN0A 2WSDA 5I5MA 3H56A 4YSSA 4F2FA 1XB6A 4YSUA 1WA1X 2GIMA 1KCWA 1J9RA 2FQGA 3QQXA 1SDDB 2J56A 1SFDA 5B3SB 1JZGA 2FJSA 5D4IA 2CUAA 3FU8A 3T6XA 1NPNA 2PPEA 5I6MA 1AOZA 3ABMB 3NJKA 4YSOA 1WA0X 2EINB 4E9VA 1JZEA 1JOIA 3WG7B 4F2EA 1JVOA 1HAUA 4KNSA 4HCGA 4G7QB 4DP7X 4G72B 2YAQA 1KCBA 1BXVA 1DZ0A 2E86A 4N8UA 3SQRA 2A3TA 4A2DA 4JKNA 2PCYA 3UADA 2XV2A 1A3ZA 2AFNA 5D4JA 2FQFA 3OMIB 3GDCA 3T9WA 2YAFA 5B7MA 2B3IA 3PXLA 3FSZA 4AZUA 1NINA 1JZJA 3V9CA 4BXVA 2LLNA 1EZLA 4ENZA 1GYCA 1AG0A 2I7OA 3U25A 1NWPA 3ZIYA 1NIFA 5I5JA 3QJVB 2JFCA 1BQKA 2YXWA 2R7EA 3FT0A 3NJHA 4AI7A 7PCYA 1AZRA 2PPFA 2CBPA 2BWDA 3PAUA 4L0PB 4NB7A 1OF0A 1URIA 1OE3A 4K9JA 3H4HA 1AANA 1J9TA 1QNIA 2DYRB 1RZPA 4BWWA 5I6OA 3TBCA 4KNTA 1SJMA 1CURA 3CG8A 3IBOA 2IDFA 4KO9A 1L9QA 2IDUA 2UX7A 2VSKB 4Q89A 2H3XC 1NZRA 3X1EA 3UACA 2BWIA 1L9PA 2H5UA 3ABGA 3CDZB 3QJUB 1ET7A 2Y69B 5TK4A 4GP4B 2XV3A 4KNUA 1A65A 1PMYA 4BWUA 1ZIAA 3BQVA 2PP7A 3T6VA 4GXFA 4Q8BA 1KBWA 4AKPA 1W6LA 3FPXA 3UAAA 3PAVA 2AZAA 3ZX1A 2YAPA
chains in the Genus database with same CATH superfamily
1NCUA 1ODUA 1VLXA 4NUJB 1TTBA 4HOZA 3Q0HA 4S2SA 1OD9A 1WEJH 5HJ3A 4TNGA 4PJ6A 4RFNC 2Y36H 4AMKH 2JK5B 2RA1A 2EKSB 1DQML 4K94L 1CYXA 1JG9A 4GS7C 1MUJB 2XHNA 1JPGA 4B41A 4TNWK 5FF6A 4KOCA 3KL5A 4HIXL 3NMEA 3PHQB 3H55A 2R4RH 4EQ3A 3E9TA 3CZEA 2C3VA 4HXAH 3KBFA 4LSUH 2NSQA 4AIZA 3D25B 4NPJA 1EXUB 3ELAT 3KHOA 3MJ7A 2NW2B 3BZDA 3JUZA 5ADOH 1KFGA 4JM4H 1BM3L 4C56A 3L3OB 1M7IB 2JV6A 4NZRL 3GKWH 1C16B 3T2QA 4RFOH 4HEPG 3KYKH 1SOSA 3IETA 4U1KA 2K70A 5SX5K 4XNDA 2VLKD 5SV3A 2ZCHL 3K3QA 2XLLA 3FT3A 3L9YA 1WFJA 1XCXA 2F54E 1KY7A 3QJFB 3FTZA 4X5LA 2X4OB 4KO6A 2AXGA 5FA4A 1NLDH 1ZA6B 4GIOA 3VXSB 3BT0A 3O3BA 4P5KA 3MRPB 1AY1L 1S7XA 2KUTA 4ZX6A 5CKAA 2EUVA 1UCTA 3ZDZB 2OYKA 3DDGA 4G8FB 4A7GA 1S2EA 4UDUB 2XV6B 3V0JA 1TTGA 2ED8A 2X3AA 4ERSH 2XWDA 4IRSB 3SPIA 5I0WA 3T77A 3QIBB 4L8BB 3X14A 3Q2WA 5BQ7B 4FLOA 3K2UH 4U2YA 3QFJA 5CD5D 1AR1C 4O2CB 3MBWB 3DX8A 4FMKA 2ADYA 3FN3A 5HGAA 4LVOB 4P46C 1S7TB 3U1QA 1P7HL 4CL7A 3E2HC 1DQMH 5C0IB 4FGMA 4OIFA 4H2AA 4K94H 5I16A 1GGIL 2N3JA 2RR3A 4J2QA 4LLDB 2CUMA 2PLTA 4HIXH 2ZUUA 5D7KD 3UCRA 2LOEA 3IFLL 4CVWA 4IMLA 1XR9B 3MTXA 5JORB 1T5WA 3HB3C 1W72A 3HC3L 4A37A 4KKRA 2AXHA 3SE4C 6FABL 2CKNA 5B39B 3BKYL 1BM3H 2VLRA 4NZRH 2ZOUA 4KU1A 5EU7E 2RQEA 3TEWA 5D1XA 3O3DA 4V1DA 3VI3B 1PJ9A 4UQ9A 1NCWL 2FO8A 3JWNG 3BGAA 2XQYG 5B8CC 4GLRI 3GMLA 1ZSDB 5F93C 4QRUB 3QDGE 1NKOA 5T1MA 4X0KA 4KX7A 1ZVSA 1ND0A 3CE1A 4K71C 1AY1H 4YSDA 4FZ8H 4BFFA 1LP9A 4HUMB 2G3XA 2H9GA 1MRCH 4Q7DA 1KJ3L 5E7FA 1A2YB 1X4ZA 3VJ6B 4N2BA 1YNTF 1G7LB 2Y1YA 4OZGB 1J7VR 5AKVA 5DF0A 3S8WA 4F8TA 3WV0A 3L3KA 5EZOL 5TQ2L 3QEQB 2ZQKA 3VRLE 3P2TA 4N68A 3MGTB 3V0AC 2NNAA 4X7SL 1KNOA 2EABA 1V10A 5HDRA 1IAIL 5I1GL 2DJUA 4PJIA 2I69A 3UG4A 3RUGB 1GGIH 1ZANL 1LNUB 2AHIA 3MN8A 4HBCL 3EYSL 1LDSA 3I6LE 3IDIA 3IFLH 1F42A 4ZOEA 5FWQA 2D0FA 3MV8D 2PCPB 1R0AL 4RDQF 1FV1B 3DX9A 2LW3A 3HC3H 4OIAA 5GIRA 4PRPB 3KLHD 1SOXA 5BZDB 5KYXB 1C5DB 3CFUA 3WFHA 3GRGA 4YK4C 5H2BB 3BKYH 1E5CA 5EF1A 2CXGA 2Q0ZX 4L37B 3ARYA 4F8QA 3O2DL 3OAYK 3Q13A 1NCWH 4GRMB 2WBXA 4XO3A 5C2UB 3IDMB 4WI0A 4AZ8A 3D52A 5E5LA 4L5FE 4WFED 3F7QA 3ZE1B 2KYIA 1AACA 1KJ3H 2WWNA 4AQEA 1SFHA 3PCYA 1IL1B 2C1OB 1YCSA 3WUWB 5GGSB 1E9QB 5EZOH 5TQ2H 3GKZA 1PZ3A 4RAVA 4JM0A 5DZJA 2RHEA 3CK0L 4PGEB 4X7SH 1VFAA 5DUBB 1J0YA 1W8NA 1IAIH 4A6YA 1NC4B 3NSXA 5I1GH 3DYPA 2A9BA 1T1YB 1XEDA 1JN6B 1QFOA 3S37H 1ZANH 1H5BC 2YJQA 3VMOA 4HBCH 4HUKB 3UTPE 2AQRA 3EYSH 2C9UA 3QXAA 3HA0A 1JGEA 5FYJD 4Z77A 3DIFA 3BSGA 5DQ9A 3QSKB 4KX8A 1R0AH 3GYRA 3C75A 1ES0A 1RAMA 1OZUA 1S9VA 1QHQA 4HUUA 5IVXE 1T22A 3RWDB 1LEGA 1TNNA 3O2DH 4Q6IA 1HWHB 2EIMB 4ALAL 3BAKA 3UJTL 3C12A 2UZXB 2Y2WA 4IHBA 4YO0A 3O11B 3BP6B 1BAFL 2DQGL 5TTRA 2E7LC 2IFGA 4JMNA 2APWA 4Y4HD 3CSFA 3FCUB 3Q8CA 1MCQA 3T08A 3ML8A 1H3UA 1GHFL 4G43B 1SJVA 4AUYA 4KKBD 4UT7L 3GEWB 2D7PA 3HBPA 2UZIL 3BCDA 3RDTB 3ZTJG 1J8HA 2N7BA 2YPLA 2UY7A 3CK0H 5AW7B 1UD5A 3QEGL 2H8PB 5D7JC 1XV8A 2FJGB 4NERA 3FOLA 3KAAA 3S4SG 2O61B 3HS0C 5EU4B 3OF6A 1GAFL 1U21A 5DMKA 4JPIA 3SY0B 5C8JA 2JJVA 2R69A 3RYMA 3TEZA 1EO7A 2Q3XA 5LXVA 3N0PB 3WLBB 4C55A 1O75A 1TIUA 3ZQ9A 4RFEA 1G1CA 1FPTL 3MLSL 4GI6A 1EEYA 1X7QB 4IKIA 2NY0D 4Y4KD 3G9VA 3IJEB 5HHME 4F1ZA 2VDQB 3KYOB 2BNUB 1T7ZA 4ADJA 2NUTB 4KX9A 5JOFA 4N6RA 2N01B 5INCA 3IGLA 1D2PA 4KQ4L 4WNQA 1MFCL 3SYPA 3QIUC 4AIXA 5HI3C 4NKDB 2XV0A 2ZXCA 3D3VD 4ALAH 4P57A 3FN0L 3NIGB 5J3HC 3BW9A 5DJ8B 3RDJA 1OGTA 4YDVB 2B9AA 2ZWYA 2JI1A 4WDIA 1AXTL 1N70A 2NY3D 4P49A 5EO0A 1TVDA 2Y5TB 2BIPA 5D2NC 4BCZA 1BAFH 3EBGA 4Z76B 2OMUA 2VITB 4IRJC 4JG5A 4QLWA 2DB8A 2F8OA 4BGLA 3U9WA 4I89A 4W9IC 2EEAA 1GHFH 3MRBB 4UIMA 1W15A 2TAAA 5FPIA 4AGOA 4ICXA 2UZIH 3QJSB 4HCRL 3W38A 2VLME 2YRBA 3TL5A 4Z3JA 3QEGH 4M5SA 1HDMB 1ZV2A 3GSXA 3BAJA 1JXFA 1F1GA 4MJ6B 5KN5A 4G7SB 1GAFH 2MWCA 1ZD6A 3VXRA 2V2TB 4HUWA 2B1AL 2TSAA 2NX5D 3GSVB 3SHSA 4PM1A 3CZNA 1H0DB 1KYAA 2FX7L 3HJEA 2VM3A 3PWVB 3MLSH 1FPTH 4F33B 3GRBA 4O51B 1RV6X 3BZFA 4JFEB 4X8JB 4R5TA 3SZ6A 4G6JL 3VVVA 1OGSA 1X5FA 1PZAA 1ONQA 5JPNC 4Z7UB 2GJ6E 1KB5B 2IADB 3K6SB 4KQ4H 4QF1B 4FG6D 1MFCH 4AEIL 3B1UA 5DYFA 1LK3H 3BH8B 3JWDC 1TSRA 4HS6A 3FN0H 3CUPB 3T0ED 2VWEE 3LNIA 2OL3A 1AXTH 4YS4A 4UQEA 3JQOB 3HUJA 1VHPA 4NXSA 5I8CA 1FNHA 3OAZH 4OKDA 3AVEA 2A6KA 3DOSB 3HTLX 1IC5L 2L0DA 4OW6A 1LEIA 1IARB 1AOZA 4CSTA 5I9QB 3MJ9L 2EINB 4E9VA 5T3ZL 1NUDA 4C59B 4R4NC 2XQYA 5F2FA 4HCRH 3ATAA 4KKAD 4PJAA 1KPRB 4FXGB 4ODWA 4DF9A 3CZSA 2AF2A 1CICA 2P5ED 3AWGA 5JYLA 3UADA 4ENED 2B1AH 5CHNA 2YR3A 2FQFA 1MCCA 3WHE0 2MKWA 2FX7H 3W56A 2AJZA 1NDMB 3Q2VA 4PPTA 2ED6A 1XZWA 2G5UA 1M42A 2IBZY 3IMVA 1SZNA 1WFTA 5K9KA 4G6JH 3PL6D 3ZZ1A 4KZDL 1RZGB 1M6UA 2ESVA 3TCTA 4N1CA 5GSRB 2BIHA 5EDXA 2CO6A 3KJ6L 4P4KB 4AEIH 1JGIA 4LPWA 4NRYA 1G6RA 4HU8A 5FX3A 4KGLA 4BRVA 2V2XB 3CFCL 4AUUA 3UTQB 1PBYA 3P0YH 1AD9A 4U1MA 3TF7C 2FO1A 4OBSA 1BEYL 1T7YA 5C3TA 7CGTA 5IHUL 4K9EC 3CFDA 4MWFB 4IBYA 4N2NA 5FWRA 3OKLB 1KC5L 2W0LA 5I6OA 1KSRA 4RBPH 1IC5H 3KPRB 4DO6A 1UJ3C 1ZSHA 4TUJB 2JQAA 4KC3B 3N5AA 3MJ9H 3AWFA 3MXWL 5DZ9A 5T3ZH 4LHQB 4ODVL 2H3XC 1NZRA 5GZOD 2BNRB 4JEGB 3BI9X 5LGYA 2BWIA 4WO4C 5CBAB 2HFEB 1AC6A 3KS0H 3PAYA 1YY9D 4PJ9B 5MEND 4MGXA 4ZODA 1I8MA 1DVZA 2PYEA 2EIDA 3WAKA 4N5EC 3TIDB 3PV6B 3DX1A 3UEQA 3VGFA 2FCBA 2BZDA 4OV6F 5CILL 1GGUA 4LT7A 5GGRY 2B7DT 3QDMD 2I9TA 2GHZA 3HMXL 5D8JL 3LZPA 2WQWA 4YGAB 3ARBD 4XNUL 1LXMA 5SWZD 4KZDH 1AIZA 1R24B 3BH4A 1ID2A 3BOVA 1RSFA 1NUFA 4JHZA 1JGLL 1U9KA 4D9RD 3WOVA 3GRWA 3CFKA 4LVHB 3CFCH 3ECBB 4FF9A 4WFFD 2KZWA 1ZHNA 4WV1A 5C07D 1H8LA 5AVUB 1UB5B 2DMBA 3LPPA 2A5UA 3HZVB 1DQKA 1BEYH 1XB3A 3V6OE 3RNKA 2JKJA 5L2KB 1WRFA 5E9NA 1S9XA 1KC5H 1QSVA 5DJDA 4LDOB 4E9QA 1NGZA 5E8PB 4BUGA 3K72A 1FNGB 4PRHA 3BPLC 5T3ZD 2XBTA 3MXWH 4FXKA 4Z7OE 5DZPA 4ODVH 5JDSB 5F9DC 3MKGA 1QSEE 1Z5HA 1MDTA 4PREB 1BZ9B 1ZHKA 1BMGA 3DC0A 4KKNA 2CLRB 4Z7VA 2ADIA 3I9IA 5CLWA 3ARED 3IAQA 4K3JL 3ZKXB 4N22A 2OJZL 1MVYA 2R1XA 2XQBL 2Y24A 4UT9A 1XO8A 2ZXWB 4P59L 3AFLA 3WJMA 3VRLF 3O4OB 3II2A 2WTRB 4TRPL 5CILH 5AB0A 4DCQB 1JZ7A 3INOA 4Y16A 3IWVA 3HMXH 4GIPD 5D8JH 3TBYB 5B1BB 2YSTA 3M07A 4YE0A 3C6LC 2QQLL 4FRWA 2CIIB 4IBTA 3L7FA 1DZBA 4NI3A 1DVFB 4QXUL 1JXJA 3DXAE 5AVRB 1KEML 1MXGA 5H4YA 3S4SA 5DYOB 1SJEA 4BHUI 3BN3B 5AL8A 3AUVA 4QYAA 2VL4A 4LSSL 4IJTA 1G7IB 4MCMA 1JGLH 1EAPB 1SXCA 4MB4A 2ZAGA 3VXMD 5CD5C 3D2UD 4EIZC 4WHTA 1DBAL 4WQOA 1QUNB 1I8IA 2WSKA 3ABLB 2R0KH 3UO8B 5C7XL 1CIUA 3PF2A 2W59A 4GXUN 3DVGA 1SMAA 3W3BA 4X5WB 5AW4B 2APXA 2IAMD 2VR6A 1HOCA 2NYZA 3S3SA 3LKPB 3EYFA 5EEXA 3KNBB 4QRPE 4YXHL 5JW4Q 1H15B 4RVBA 3MA9L 1VFOA 2W07A 1XGRA 4MA3B 2UZYA 3VRJB 3VSQA 2HKFL 5IB2B 3PAZA 2ITCA 4HX1B 4X7CC 4HOXA 4F92B 2IPTL 1B0GB 4M8QA 1QR1A 3L4ZA 4P04A 3E6FB 1B3JA 2X2UA 3R06B 3DHJA 3FFOA 4PRIA 4K3JH 1CGYA 4KI5D 2OJZH 4RFNB 3MNWB 2AK1H 2XQBH 4A2FA 5LDUA 1X9UA 1M1XA 4JZNA 4P59H 4GS7B 3KGUA 3RPKA 1KMGA 1P9MC 3AQDA 1V54B 4BKSC 4F58L 2VJ0A 4TRPH 1E7VA 2G30A 3MACH 4AV5A 4JY6B 1RY7B 4PCTA 4NQUA 3ESUF 3V7AE 2Z31A 5HHXL 3WLWD 4DEPC 3C09B 1CL7I 3Q5YA 1JBJA 3DLQR 3MRQB 4QXUH 3MCG1 4IMKC 4K07A 2OQJA 1KEMH 4KK5D 3QUHA 4WJKB 1UA3A 5AUMB 1E9OA 2QPDB 3BZ4B 5L9DL 4JHAL 4LSSH 2O6DA 4NZDA 1GS6X 3TJHC 4PGJA 1L9SA 2WTPA 5HP5A 3VFNA 3TT3L 2G2RA 3MRGB 4WI3A 5A2AA 2V17L 4CKQA 5KS9B 2Y1AA 3I3BA 5DC4B 1DBAH 4MCZB 4OB5L 1RPUA 3GMMA 1T3FB 3BWUF 1ZLVK 5C7XH 4F27A 4K94C 3OXSB 5IFAL 5IVXF 3MRHA 3CVCA 4XCFL 3JV0A 4U31A 1I1FB 1T0NA 5DFTA 5DHYA 4YXHH 4AM0A 1T5XA 1VACB 4ZDHB 4OF7A 1SN0A 3UTTB 4OJEH 3F5WA 3MA9H 3V9EA 5IFJB 2GFBB 2GAZA 2Y6SD 2BVQA 1WFIA 3I2CL 5HYJE 2FIKB 1MHCA 3KLHC 1FG9C 1AMYA 1YDPB 2H4EA 3PJSB 5MI0C 3GBML 1G9NL 4OM0L 5I26A 4NZTL 4BV1A 4HAFA 3IF1A 2EDYA 4JHVA 5DMYA 1KCLA 1AGEA 1NBCA 4UQAA 4PR5B 1EZUA 3CPLA 5F1IB 1E6JL 4MQ7A 1A3LL 3QRGH 4AEHL 3HG2A 5K33A 2WMPB 4F58H 1U8KA 2QADC 4RESB 1I1CA 2CBQA 1OT2A 2WHVA 4Z23A 5HHXH 2V7HB 4MA1C 1M3JA 3HB3B 2VSDA 3U2SB 3W9DA 4FE9A 3EFFB 4MYPA 2VSMB 2IDTA 5IQMA 2HX7A 4G8GE 4B7LA 5L9DH 4H4NA 4JHAH 5IF0B 2GITB 2V2WB 4WI6A 5EU5A 4NOFA 2BZCA 5H8DA 2VSCA 5AB9A 4ZMAT 3BZEB 3EXJA 1P4IL 3OKDA 1KJVA 3TT3H 4XRCA 5B8CB 1FHNA 1AKPA 2V17H 3LKOA 5D9SA 5FUZL 1F45A 4OB5H 3V6ZA 1IGJB 1RZ8A 4JRXB 3ZUNC 1BVKB 4W70A 1CLVA 2E47A 4K71B 5IFAH 3OWRA 1E3XA 2FZ3A 2X2YA 2GJRA 1K8IB 2EDBA 4XCFH 2EUZA 2UWEA 1VERA 3NFSL 4GMTL 5J5EA 3TX4A 2WQUA 1KCSL 3I2CH 3JTTB 1BVNT 1FLTX 2FT6A 1G4RA 4DPAX 5IMLA 3FO1B 1OE1A 1B2YA 4I4WB 3OG4B 3GBMH 2J3SA 1U8OA 2X4PA 4ZW5A 1G9NH 4OM0H 4NZTH 3SGEI 4BFJA 4LCCC 5IFHL 1WDAA 3MSPA 1ZJBA 3O6FA 5LB1A 1A8JH 3IJ7A 1E6JH 2NCEA 1A3LH 4AEHH 4E42B 5ABDE 1U8HA 5IBUB 5JIIA 1IMHC 2PNDA 3IKKA 4GP8B 1E27B 1EDYA 1N8OE 4Y5YB 5F3BA 2QKIC 1Q9WB 1KZQA 5E5MB 1E4WL 1N8ZB 2GEQA 3OKNA 3MNVA 4MJIA 4Y4HC 3B2DC 1VEPA 4WF7A 4LU5L 5EORH 1EO5A 2ERJB 3PABA 1N6VA 4PRAA 4F7MA 3HI6L 4OQTL 3UTSB 2DD8L 1A02N 3JV6B 4KKBC 1B0IA 2DQIL 1JUFA 3C8HA 1T6VN 2FWLB 1P4IH 5TH2A 5C0BA 1KCRH 1G6VK 4MS6A 5FUZH 1A22B 1A6VL 1LJMA 3TU6A 3LN9A 4G82A 2F7QA 4OF0A 1CG9A 4NAQA 3VFTA 1HZKA 5DS8B 3DA0A 1E5ZA 4NQCA 3NFSH 4GMTH 3S6CA 1QBBA 4I9XA 4LOEA 3LKNA 3D0LB 2WKOF 2NY0C 4OD1L 1KCSH 4P9ML 1GGTA 4Y4KC 4PJDE 4F80A 5C6TL 5KWYC 4OZHE 2BHZA 1XEUA 2CAKA 1E30A 1DN0A 2EVJA 2YGOA 2ARWA 2JIXD 1WH0A 1G9MC 1D9KA 1ZEAL 3WEAA 3J2PA 5IFHH 1HT6A 1YUKB 5CMAB 5DK3A 1JCVA 4MDRA 4EI5D 1EERB 4MB5A 3DURA 1H5BB 1IIKA 3FL7A 4J12A 1GGCL 5EU6A 3LCYA 4X6EB 2NY3C 1BFVL 3LTVA 1VA9A 4PV8A 4KZEH 3FB6A 2Z8SA 1E4WH 1DO5A 1UT1A 1U3HA 4NO3A 4LU5H 2FR4B 4R8WL 2XXGA 3WSQL 3HI6H 5DZAA 2X28A 4OQTH 2PR4L 3X2QB 3MMEA 4JFUA 2DD8H 5SWSB 4MAYA 5I0XA 1KWGA 3G08B 2DQIH 3MLVL 3Q06A 1DQQB 3F6JA 3UEZA 1GZHC 3P3RA 3SOBL 4I85A 4RGNE 5DHVH 2OP4L 1E4KA 1UFUA 2WAHA 3K2KA 3UYRL 2OSYA 5I6KA 4G42B 5DJAA 3V5HA 1JWMA 4M48L 5IMKA 1U8PB 2DLIA 4ONOA 4NQXB 1BOYA 5D6CB 3U82B 1CTMA 4J8RB 5I5MA 1ZK9A 4H8WC 4YSSA 3UTOA 1XB6A 3HHSB 3CVHL 1CK0L 4JL2A 2C3XA 4P9MH 4OD1H 5C6TH 4NPYA 4WWKB 3RWEB 5F0PB 1ZHLA 3P2DA 3QQXA 3VCLB 4MXQD 4D7BA 3ZT7A 1F1DA 5CU9A 3RURA 2CJUL 5B3SB 3BWAA 5CLTA 5D7JB 1D5IL 1PX4A 1E7UA 3FH5A 4N87A 4R4FL 4OLYL 5IESL 3QORD 5EOTB 1ZEAH 3HS0B 4UQ3A 4FG6C 2R39A 4U6YB 4EAEA 1UQSB 3L2LA 4Q52A 4ALAC 4BJLA 4KNSA 4HCGA 4G72B 3ZZLA 2YAQA 5DJYA 3F84A 1QFWI 1BXVA 3T0EC 4UM8B 1GGCH 2ZZUT 3DX4A 5EPMB 2FVNA 1BFVH 5BV7B 3V55A 2R2BA 2NTFA 2I9LB 3VXUD 1E9PA 2ZAIA 2A7BA 2CUIA 2XV2A 3BN9D 3ZN6A 2XNAA 4BH8B 3MV7E 3GDCA 3JWOL 4R8WH 1JHTA 1J05B 3LPGA 2AEPL 3WSQH 3WELA 4F7CA 5EZLA 2PR4H 2FHFA 4GSXA 4JDZB 3VM5A 1PU0A 2K9FB 2ZOWA 5E5UB 1ZV9A 3MLVH 4Y0GA 5T1LA 3B2UD 4PLKD 5DUPL 2ZP0T 3HC2A 1I7UB 3SOBH 1TDQA 2K0RA 4OZIB 2E4FA 2OP4H 3VTMA 3UYRH 3LNDA 1NKGA 4UT6A 2EE6A 1NCIA 5D2NB 5CD3A 2X1QA 4M48H 1OHQA 1IGML 3DROA 3AGWA 3OV6A 4IRJB 5FK9B 4BSJA 1RUAL 3SO5A 2OMXB 4ZMWA 1MCDA 1IT9L 3CVHH 2J8UB 1CK0H 3UPRB 1U8NB 1OE3A 1VAHA 2VERA 3PNWB 1J0IA 1BBDL 2CJUH 3EYVA 3PL6C 1QWUA 4BWWA 1D5IH 4R4FH 5IESH 4OLYH 2YOCA 3ZZQA 5GRVL 3LD8C 5ETUA 4LCYA 1K2DB 1O6VA 2HRPL 4H88L 4KRNA 4ZMTA 2R2CA 5F72S 1YPZB 2BHYA 2VSKB 3F12A 2ITDB 3Q9QA 1PFCA 4RETB 3DVIA 4WTXA 4OI7A 2ETWA 4Z78B 5A7BA 2P48B 5LBGA 3I75B 4KNUA 5MEPA 1EO8L 3T6VA 4Y9BA 2P24A 1II4E 3FFDB 4N90D 3WIFB 4PP2B 3FPXA 1DTUA 1XF3B 3ARFD 4JZOA 4QKXB 3SDAA 3JWOH 4TLSA 4GBXC 2AEPH 3ZRFC 2F0CA 2ALWA 4LPXA 4CU6A 2O5XL 3T1FA 2YKLL 1TJIL 5DUPH 5AENA 5A2LH 3H9SB 1FSKC 2P8PB 4X7TA 3MNZA 1RJCA 4X0NA 2YOAA 2XWTA 4JGNA 2GY5A 4KDTA 4NHUA 2F53B 4KRLB 1YY9C 1KXTA 4HIEA 3GDBA 4JKWA 4P4RB 2G4GA 3REVA 3WNPA 4ZYKA 1IGMH 1GMEA 2E46A 4EUPG 5C9JA 3TFBA 4NC2B 1RUAH 2QZQA 3SE8L 1IT9H 2CPUA 4XI5D 3B9DA 2DQJH 2EUXA 2J6EA 3UTZB 3CQFA 1BBDH 1R3KA 3L3HB 5FF6B 2DWYA 3FRUA 1HQRA 3C6EA 4Q9QL 4G9DA 1DFBL 4X7EC 4K73A 4ABQA 2HRPH 4H88H 4FABL 4F37F 2Z1KA 4E0RA 1QSFD 4RISL 1INQA 2X1WL 4L23A 1WFOA 2C9VA 3LPOA 4J28A 2WYZA 1FL5A 4C56B 5DEGA 2E6PA 2COQA 3NCEB 4M5YL 4TUOB 1NC2D 2E7DA 4U1KB 2V5MA 1EO8H 2NZ9D 3TBSA 4PQXA 3FHEA 3ZO9A 5JOPE 1GTFA 3QI9D 3V4PA 2FNWA 3P1VA 3ULUL 3ALPA 4NT6A 5DJ6A 4G1MB 1XZ0A 1Z9SB 3O3BB 4E9SA 4PD4K 3ECVA 5AOKA 2JNZA 5EUKB 2O5XH 5M95B 2JI2A 2YKLH 3KPLA 3UAEA 3VFOB 1WWBX 4LIQL 5I1KL 4DQOL 1TJIH 4PJCE 1U91A 4HC1A 5F44A 4BDVA 2DICA 1GYVA 2C4XA 3MOAL 3RB7A 3TO2A 2NZIA 4YMPA 3T2NL 5AWNH 2XXMB 5BJTA 2X6CA 4XODA 5FYLE 3T77B 2IANE 2FT8A 4JDEA 2DWEA 2C9AA 3WEXB 5AW0B 1S7SB 4YXLL 2LAGB 2VM4A 3AMKA 3SE8H 4FYQA 1YECL 2VDRL 3EIFA 4PY7A 5JW4N 2VC2B 1GA2A 4GRWE 1A6PA 5KJRL 1D6EB 4ZFGL 1NFAA 5FXCH 4MASA 2WVVA 3IS0X 4HWEL 3TV8A 2AQSA 2RCSL 4AK1A 5BS0A 1CGWA 5JPMC 2Q5BA 3OPZL 3NCJL 5BZZA 2FGWL 3AB0C 4WO4B 1JV2B 2X2HA 1ILSA 4RLDA 1DFBH 2YUWA 1X5JA 2EE9A 1FZJA 2BO0A 1C08B 4R2GB 4TUUA 2D2OA 4FABH 1RKRA 1X5ZA 5DRWB 2AEQL 4L8SC 4RISH 3TVMC 3L1EA 3DJZA 2H1PL 3MUGB 3SGJC 1I8LA 4OJFL 1I8UA 1UM5L 4RQQA 2EO7A 3UFIA 2E8ZA 1PF3A 4PVLA 4M5YH 4XVUC 1LEKA 3E3QC 4DEUA 2CUHA 3QCUL 1DQDL 2BVYA 2IAMC 4BKLB 3S5LB 2DH3A 3IVKA 3ULUH 3HG1D 3QEUA 4L0ZA 3MLWL 4X80L 4DERA 5F7DB 3C8KA 5IG7B 2Z0UA 5K9JL 4YHKH 1LP9B 1W72L 4G59C 3T3ME 1QO3A 5I1KH 4LIQH 4YIQA 4HZLB 4DQOH 5FECB 4DP9X 1CGSL 3VG9C 4XMTA 2CO7A 5C0AA 3RZCC 2MPVA 4FQHB 5FV2A 3L7EB 3T2NH 3I84A 5FLVA 2GEEA 3WMSA 4ANKA 2P8LA 2EIJB 4I2XE 4OZ4A 3ASWA 3VDCA 1CQYA 2GSIA 4YXLH 1LE5A 2CU9A 1J9SA 3SDYL 5DK2A 5GS1B 5DO2C 1YECH 2VDRH 4N2MA 5KJRH 2W0FB 5LAXA 2Y7LA 3D0VA 5EFIA 4IS6B 3R19A 1QWNA 3WLWC 4HWEH 2RCSH 1FN4B 3QJHA 2VUOA 1OXYA 1HI6A 3NFNA 4P8QA 1WT5C 5KANI 3OPZH 5D1ZA 2EXWD 3NCJH 2FGWH 1K5WA 5DJXB 5ALCL 2JQZA 4KK5C 5CSZB 5F7MC 5F7KC 3SBPA 3TIEB 2J1ZA 2CGYA 1F58L 3B2PA 2AEQH 3U1PA 3H53A 2X7LA 3WFHB 2N0KA 4PJ8A 4OJFH 2E6JA 5SWQA 1J8KA 1UM5H 1QW9A 3VSTA 4E41B 3VD2A 5EIIG 4ZK8A 5KSBE 3QCUH 1DQDH 5DJ2B 4Q6YA 3C6LB 3ULUD 4UF7C 5E4AA 1CD1A 3LRMA 5H35A 1BYOA 5I24A 3MLWH 4X80H 1W0YT 2ED9A 5HDBE 3HE6D 4GT7A 5GSVB 5K9JH 4Q74A 3QYNA 2Y6SC 1W72H 4HAGA 3K0WA 4XMXA 1DJYA 1CGSH 3NDZE 5HYQB 1XMWA 4GG6A 3MV01 1HC1A 2IQAA 4PBDA 1IKOP 2C4FU 3GMOA 4R83A 4DT2A 3HLAA 2GHWB 3CV5A 4F37K 2HTKD 4QOKA 3U7YL 2VIRB 1KF9B 1DVUA 5MERB 3GJFK 5DLML 3QQ4A 2HVJB 1DJZA 5F6IC 5CR8A 3IDYB 3KGTA 3SO3C 4XX1G 4NQEE 4DK5A 1B4RA 1CXFA 5ALCH 3PGDB 4PJ7B 4GQZA 1JGEB 3BUPA 3VXPA 5K93A 2WLLB 3DIFB 3CHXA 2E76C 3ESMA 3KWXA 1F58H 1J12A 4OJDH 2MTAA 3QFJD 4A7VA 1J11A 1S9VB 5ITBL 2OTWA 2VW4A 5I1DB 2E74C 4PJDF 4N0FA 4EQ2A 4OZHF 4QXTA 4DUWA 4PEEA 4MRCA 4A6YL 2YN5A 4OGXL 3TM6A 3FTGA 1A9BB 3DVFA 3QYCA 1PY0A 3RI5F 5E51A 4DEPB 1XF4A 2SODB 1ED3A 1DL7L 4FQPA 4FN0A 2X12A 2RTTA 4U4IA 2OPCA 3EZ8A 1KIUA 3QAQA 5CJBA 3P77B 4URKA 2X4NA 5CLZA 3VB9A 4MZ3A 1UD6A 3U79A 4IKNA 4AH2A 3L4UA 3OLIA 5D7KE 1JZ4A 1P2CB 1KLGA 4FNSA 2VLRD 4GMSL 1ZT7A 3VGDA 3DRQB 5D1XD 1RK1B 4V1DD 2W88A 4P06A 2UY7B 3U7YH 3CGTA 5ESQB 3OMNB 5DLMH 3VFPB 3C2SA 4FA6A 3BGFB 3WNLA 3V0DA 3FH8A 3DK0A 4XXWC 1L6ZA 2JB6A 3UAJA 2WW8A 1T4KA 2HAZA 1UA7A 4PS8A 4ZUUA 3MRDB 4LRNL 3SJVA 4QNPE 3PXJA 4XOAA 4PHXA 1N0LB 1BIHA 1PZ5B 4JZJC 2XG5A 1ZTXH 4P5RA 5F21B 1OE2A 1M7DA 3ZRSA 5JHDB 3MRJA 2QPEB 4YBHA 1U3NA 3VWKC 3HN3A 1TO4A 3HAEB 3KYAA 4GUPB 4P5TA 5ITBH 2GJ6A 5JOFB 3DV4A 7PAZA 4CDGC 1QW8A 2P4AB 4ADGA 3OC5A 4A6YH 2QADB 1RZ7L 2XVGA 4X6FB 4OGXH 5GRZA 1TETL 4ZSOE 3IPEA 4MA1B 3AAZB 2WXOA 4QDGA 4Q2ZA 5D93C 4CVXB 1DL7H 3SBWA 3Q8BA 1VFBA 3O81A 4WDIB 4H1LB 1ZY9A 4KO5A 4MB1A 1YNLL 4MZIA 2OMUB 2D3NA 5MEQB 1WQVT 4NUPA 5IVNA 4JO5A 2AQQA 4AQ8C 1IC4L 4TLTA 1AE6L 3V5DA 1G9NC 1GOHA 1TTAA 3Q3GB 3UCQA 5IBLD 4GMSH 3CLFL 2EIKB 3OSVA 4K2UL 4JFPB 4B9CA 4F2MB 1ERNA 2CE6A 4EI5C 2OMWA 5DHDA 1HOEA 2ZKHL 1BZQK 3WJLA 4XX5A 1PY9A 4QIRA 3ISWA 1NEPA 5I8EB 4BXSV 2CALA 1TZAA 4LRNH 4FFVC 3SYQA 5E70A 5C0GA 5FM5M 1BVLA 2HX8A 5ENWA 1MCOL 4U0RC 3DI3B 3EGXA 2BVPA 4F2FA 3BMVA 1J9CT 3ZGIA 1KCWA 2AXJA 4LCCB 2GBUA 3KS0J 3Q2NA 3LS5L 2K6WA 4QJ4B 1YEGL 2FJSA 4ZUSB 5BZWB 3NCYP 1RZ7H 2FECL 3ENEA 4KWUA 2I07B 5JTWA 1SM3L 3IMUA 1TETH 2P5WA 2XOTA 3B9KA 3VFNB 2QKIB 3ABMB 1DUZA 4OGZA 2XPGB 1SXSA 3PU7A 1RU9L 4U1IA 4CRPA 1MNUL 4NO5A 2O93L 4ELKA 5I2IB 1QLEL 3OTTA 4KVNL 5A43C 2NW3B 2FYYA 1YNLH 1ZGLP 1MAKA 4MXQC 4DOHE 3ZDZE 1PKQE 5IIEB 4JFOA 1EXGA 1I7ZA 1IC4H 2BSTA 1AE6H 4MMXC 5B3NA 5F89A 5KSVB 4I9WE 1F8TH 3QORC 5FYJE 4PGBB 3CLFH 3CZJA 5B7MA 3Q7JA 4K2UH 5FYKL 3SDCA 3FSZA 3OJDA 5HI4D 5D7SL 4I88A 4NO0A 2ZKHH 1F11A 1NAMA 4LOUD 2VZ3A 2OL3L 1CICB 2EIZA 2J6WA 2D3LA 4RNRB 4XPHL 4TQEL 3O4LD 3OAWA 1L5GB 3AY4A 1A9EB 4NSKA 1KXHA 3RI5K 1EDHA 3PQYA 5CCGE 1EJ8A 3ZKMD 1MCOH 3ML9A 4FQQB 4I18C 2VQUA 2AJZB 2CBPA 5C0JA 2CCLA 2A4EA 5I76B 5KSAA 2IV8A 4L3EB 3PREA 1CFNA 4R0LC 1J8HD 2EXSA 3RKPA 3LS5H 1TQCC 4FKEA 1BYNA 1YEGH 4GNKB 4Y7MA 1SJMA 2CO6B 1NMBH 2N56A 3OF6D 3CG8A 1SM3H 4NRYB 1AQHA 1MJ7L 3NESA 3MLZL 3I02A 3B7YA 2CA4A 3BSZL 4JM2F 3OX8A 5JIPA 1MNUH 3V6OA 5IREA 1R6VA 3NSJA 2VISA 2H5UA 1QLEH 3ABGA 4KVNH 4NUMA 1X5LA 3CFDB 5IB3A 4YDLC 2ICES 5SX5H 5EN2A 5GRWA 1PZSA 4FQXB 3IJ9A 4PG9B 2AZAA 4R84A 3KLAA 2VLJA 2Z7ZA 3NP3A 4IW4C 1QSEA 2P26A 2CO4A 1G6RL 5FYKH 3DJTA 5EIIA 5ID1B 3HBZA 5D7SH 1EX0A 2QFPA 1WBYB 3ZQWA 3N85H 4HIHA 4UIKL 3T4AB 2I25N 2VN7A 2AMGA 4PJCF 4U1JB 4XPHH 3B43A 4TQEH 5AYTA 3CVDA 3VRIB 4XOCA 2PYEB 1WCQA 4ZMZA 2MHAA 5IV2A 1TSHA 1N6QL 1BLNA 2EYRA 3ARFC 2QT6A 1IBHA 4Z5RB 1OP3K 1K5NA 4O4YL 4XXCC 1KBGL 4OBRA 3B3IA 2YAEA 4PRPE 3TN0A 2ZX6A 3MBEA 4GRWF 1F18A 1AXSA 1DQIA 2ZXBA 4EDWL 2YJLA 4Z3IA 1HZLA 2A9CA 4AJYV 3T0EB 1AC0A 1TMCB 2HP4A 3L9EA 4JO4L 4R90L 1MJ7H 3C60A 3CCHB 3VXRD 3ZQXA 4WTWA 4ETQB 3HFFA 2IC2A 2KL6A 4WV1B 3MLZH 3SN6N 1HHJA 3V0WL 3BSZH 1JDDA 4XI5C 4Z0BL 1NOFA 3MLUL 2B0SL 4CVUA 1SHWA 4ZXBA 3JVGC 1E4JA 1PKOA 2NX5E 3DNKA 1FO0B 3JZ7A 3LDBB 2WLNA 3WNOA 4HJGA 1AO7D 5L4MA 4HOMA 3L3IA 1KIQA 1Z5LB 3RU8H 4NBXB 1G6RH 1HL9A 1F00I 4X8CA 3IU3B 3FRPG 1EPFA 3ARGC 2X4TB 4U3SA 3T3MF 1DDTA 3NJIA 4UIKH 2WZPD 1VEOA 3RJQB 5DEFA 1LK2A 4M7LL 3I6KB 2DQHL 5T5NF 2EAEA 3FQ4A 3HW7A 1RVFL 2BJML 4N3UA 2NZ9C 4WEBL 3TWCL 3GSQB 2EILB 4LZKA 2Z6FA 3QI9C 5IMOA 3PDOA 1N6QH 3JWOC 1N6UA 3WFEL 2VDKB 1BJ1H 1XIWD 5FO8A 4Y16B 4WJ5A 5CN1A 4OV5B 2OXGB 4QRSB 3FDWA 1PSKL 4O4YH 5I6PA 1KBGH 1OGAB 3BESR 3F3HA 1ODAA 3S4SB 1BZ7B 3U4EA 4EDWH 4JQIA 3WKPA 5AWNL 4LPYA 1AKJA 5AYUL 3N1MC 4JO4H 4ZQTA 4R90H 2XDHA 3MUJA 2Y7OA 4JVUA 3DI2B 4UT9L 3QUXA 4EOWL 3INUH 1SJXA 4XTRD 3FU5A 3N41F 3V0WH 4FMFA 5LDSA 3BAYA 3NJFA 3WEBA 1I8IB 4GBXB 5HBBA 4P3CL 4W1TA 2XWRA 4Z0BH 3L5XL 3QZPA 3MLUH 2JB5L 2H1LM 1HEZB 5EV7A 1DUYB 4U05A 3BQUC 4ZFFB 3KPSB 4PJGE 2ESVD 4R5XA 4XBGB 3K8LA 3S3JA 5KSBF 3ZE2E 1P84J 3ATBA 4QHPA 3W9EA 2JKNA 3SGDI 5C0DB 4NKOA 3DUUA 3DUSB 1JZDC 1U3JA 5JIKA 5CLYA 4M7LH 2DQHH 3GHEL 1RVFH 2BJMH 4GXVL 1M1XB 2WQSA 3AC0A 3H3KA 4TNEA 3KVQA 3QUMA 4XN9A 1RPQA 1PEZA 2PWFA 2Y2TA 1OTSD 4RGOL 3Q8FA 4KJYA 1PSKH 2FLBT 1KTLB 3E6HA 4YBQC 1UWXK 5GGVY 4MMZC 1R9FA 4N2FA 4TLKA 1OKEA 2DBLH 3BGMA 1HCVA 5I8OL 2IJ0C 2TSBA 5AYUH 4ODHL 1KLUB 1Q9OA 4WI4A 3S34L 5JW3L 1OAKL 4HIJA 1GZPB 4N1EA 1LO3L 4UT9H 2E8YA 3NIGE 4ZFZA 4EOWH 1FNEB 1JXDA 1N68A 2LU5A 3U4AA 3CX2A 2R2EB 4AGNA 2VDOB 1UOLA 4P3CH 3BUYA 1ZKAA 1KYFA 2E9JA 2JB5H 3TBWB 1INEL 2K4AA 4MXVE 4NRZB 1DLHA 3MX0A 2ZXAA 2EXWC 4HK3J 5DVPA 1R3HA 1CO1A 5H37G 3P69A 2CPCA 3ECWA 1AZNA 1T1WA 3BRFA 2Q8AL 3WDIA 1MHCB 1MSPA 3MRNA 4IRZA 3VQ1C 3MQIA 2YAOA 3F62A 1NFDB 4JFDA 1E6OL 2DLFL 2E0PA 1DQLL 5E24E 3OGOE 3KBPA 3ESPA 3CPUA 2WVTA 5ANHA 3S7GA 2F6AA 3GHEH 4PHZA 3Q2LA 4GXVH 2H0PA 4IU3B 3CPLB 4QRRB 4XVSL 3QNYB 2RACA 4UV4L 2GK0A 4WFFE 2YA2A 3BAIA 5C07E 5JPMB 3ULUC 4PRHD 3S8FB 3LQZB 4HUNB 1Z32X 4L1HA 3QS3A 4RGOH 2EH8L 3HE6C 4ZFOA 1DJSA 2ZG3A 2BK8A 3CQPA 4JANA 5A16A 1H3TA 2A0LD 4L8SB 2W92A 1JXKA 3TVMB 1PLGL 3LRKA 3B1TA 1P1VA 3MRFA 4Z7UE 1K6QL 4L4TD 3SIKA 5I8OH 3Q6FA 4OIBA 1SYVA 4ODHH 1ETZB 4QNPF 5T3ZE 5KAQG 4ANXA 3S34H 4KGJA 5JW3H 1OAKH 2FJUB 1BPVA 5FV1L 2YXMA 1LO3H 4IIZA 4B6ZA 1KJVB 2HTKC 5KVEL 4IHOA 4LSPL 1TR7A 3ARTA 4LO9A 4WTQA 3T6QC 3BH9B 1E0OB 2J25A 4HW6A 3MR9A 4KHXL 5DRXA 4Z3HA 4OFKA 4XN4A 2QELA 4DIXA 4PV9B 1INEH 2AANA 4UQBA 3P9WB 1B4JL 3DJ9A 2ZUYA 3LIZL 3CFBA 1TQVA 3FF8A 3Q01A 3EJJX 4JHWL 1T66D 4X6DE 3RZCB 4Y5VC 4RRPA 2DEXX 2A6JB 4XNBA 5FIEA 3ZU8A 2F1AA 1NPJA 1E6OH 1MH5A 4J3BA 1JRHI 2DLFH 1TPXC 5DK0B 1DQLH 3BIBX 1OAXL 4KKLD 1K4DB 3VQ2C 4N2OA 1J0JA 2XTJC 4QRTB 4YPGA 2VGLM 4NYLA 4XCEA 4CC4C 2D7TH 4UV4H 4CN6A 3HE7B 2Q7YA 3CC5B 2Y7SA 5BCAA 3D06A 2EH8H 3CZFA 4TF4A 1OTTC 4GQPH 1X7TA 5DMGC 5CEZE 2XT1B 1G5AA 1W0VB 4MJIB 1AGDA 3FO2A 1MVUB 4OLVL 3AJ7A 1K6QH 3MUZ1 3L9BA 1BDYA 4BE5A 4PRID 3TPUA 4AE0A 2ZF8A 3MFFB 2EEBA 1UA6L 3NZHL 3NT0A 3P9LB 1JUFB 4IBQA 5AOJA 3WHXA 4HG4J 1GGBL 4K7PY 3UBHA 5KVEH 4LSPH 3OXRA 1T89A 2VR3A 3X3GL 2A1WH 4KI5E 4XAKD 2Z31D 1LMIA 2ATKB 2C3HA 1QVOB 3FQWB 1MQKL 1MKFA 1IM9D 1B4JH 2XFXB 1WICA 4Y19D 3KPRE 3LIZH 5DD3L 2JTDA 1YY8A 2YPKA 4BUQA 3BRGC 4JHWH 1MPAL 3TT1L 5HJGA 2VR9A 1GY2A 1KELL 3QA3B 3O3UN 2JJWA 3EAKA 4DO5A 4G1EA 2BNRE 1DN0B 2GI0A 1XGQB 2Q10A 5FFLA 1CE6A 4P23A 4EI6B 5CZXD 4U3XA 2VDLB 3S3PA 5F3FA 4G8IA 3ZDZF 1ZS8A 4TS6A 5HHPA 1OAXH 3QWOB 2NSMA 5JMOC 1QHOA 3IMWA 1EH9A 3MGAA 1JNNL 2CG9X 2I24N 3WIAA 4F7EB 2C3WA 1HHKB 2APSA 5CJOL 4YHOL 3SO3B 1IFGA 4L0YA 4HJEA 2WCSA 4PAZA 2CNZA 5EU6B 1PTZA 1AZBA 1UM4L 3GO1L 1Z9PA 2EDEA 4PV8B 3BJ91 4JFXA 3FRPA 3AZUA 1CXEA 4G9FB 4HEME 2OI9B 2WZ6A 3W1ZA 3MV7A 3NA4A 4OLVH 1U3HB 4NO3B 2XSKA 2FJHA 5CKGA 2UYLB 3K74B 3IN0A 2GBVA 3MMEB 1LWRA 3EYOA 3L17A 5IBLC 4K3GA 3NZHH 1S7WA 1UA6H 4X6BB 5DD0L 4EXKA 3D9AL 2V5RA 4Z7WB 1OWWA 4M1GL 5GPRA 5TGBB 1NGYA 1DVYA 5JDJA 5FS5A 4NQSA 4JRYB 4GI9A 3X3GH 5L2KE 3QR2A 1BA9A 5AW6B 5FA3A 3T6XA 1NPNA 1MQKH 5K69A 4KI1A 4YSOA 2YSSB 2WCGA 1NCAL 1JVOA 3CFEB 3D09A 3DX6A 5DD3H 4DAGL 3CFNA 2NNRA 3RILA 8FABB 2XTLA 1MPAH 3D87B 3TT1H 5E7BA 1BX2A 1MI5A 1KELH 4WUUB 4IM8A 2E86A 3LXCA 2E9IA 4AENB 3PYCA 4A2DA 3TO4A 3QIWC 5TDOB 5CN3A 1LMKA 2EDXA 3FAXA 4J4PA 2NQCA 3SCMB 3S5ZA 3ZT6A 4PW9A 1QPPA 2O5ZL 1M7UA 3L5WA 5D2LE 5FR3A 2CHXA 4UQ3B 1S6NA 3OMIB 3T9WA 4AGQA 4WHYG 4YX2L 2CD0A 3FTYA 4MCYB 1JNNH 3BP5A 4PYGA 1HSBB 2ZP8A 2B3IA 3L1FA 5ISZA 5DC0A 5CJOH 4YHOH 1JZJA 1JPFA 5D1QA 2AEOA 3NPSC 4M4RA 3GO1H 5TJWK 3ZHNA 1OB0A 3L3JA 2R2BB 5EBLB 4DK3A 1M2OA 5I1HL 3LY6A 2EDJA 1R5VA 4AQAA 1NGPL 3VWKB 3RHWF 2LVCA 3DMMD 1S78D 5JW5B 1CU4H 1KG0A 5EEWA 4O02A 5FFOA 5M94B 1MIMH 3DVNA 2QVKA 1YMHB 2WIIB 5T1LB 5DD0H 2VZTA 4B5EA 2BNQA 3D9AH 3O6FD 5C0CB 2VDMB 1E40A 4M1GH 3APFA 3VXTA 1H6UA 4LARL 2ZYRA 3KWUA 4EN3C 1O6SB 1E3ZA 3TYGL 2LVEA 5TQ0H 5CD3B 3LEVL 3DROB 5D72L 1YEIL 5T5FA 4LEOB 3RKDD 5FKAB 1GSMA 5C09B 1NCAH 3ZKMC 4KH2A 4DAGH 5E6IA 4MJ4A 2XKNA 4L9LA 2XWBA 3EADA 5F9JA 4IBWA 3DHUA 2EDKA 3SPVA 1BV8A 2XV3A 2PCXA 1KCKA 3DO3A 5C0BD 2MOVA 3S9DB 2W0PA 4NQDA 2O5ZH 3CN3A 4PJXB 4JBSA 1XCQB 2HFGL 4OY9A 1F3JB 4LLWB 4LCYB 3ZX1A 4YX2H 1JF1A 3RRQA 1IFRA 2CNYA 2CSPA 2X6AA 3BMWA 3KM2A 3O8XA 1I1AA 3QO0A 4YPJA 3HS9A 3B8YA 4NQCD 2H47C 2Z91A 3QZWG 3V5KB 1ZLSL 5I1HH 5FCSH 4C83A 3DIDA 1WIPA 1O7DC 1MQ8A 1QBLL 2OYMA 3AG2B 4L4VB 4ORGB 4IDLA 2F18A 5CIPB 4XPGL 1A6ZB 4X9FA 3AXLA 5GZNA 4KK9D 4WGKA 5LN4A 3ARSA 2DQCL 3LIUA 2PYFA 1WZLA 4M43L 4OJYA 4LARH 5BZXA 2VR8A 3BAXA 3B7RL 2B16A 3H9YA 3QZLA 3TYGH 4CVZA 1P0SE 4DVBB 5KYWA 2WLZA 3LEVH 1G7PA 4LKXA 1YEIH 2B1HL 2LGNA 5KG9A 5I18L 5I1AB 1Q0XL 4WIQA 4XH2A 3BUQA 1FIGL 5ECGA 3TCXA 4FFZA 5DS2A 4MMXB 2WO4A 1YHPA 4MAYD 3A4EA 3W11C 1GOFA 1U0QA 1R3KB 2IO5A 1CDGA 2V7NB 3QPQC 3U6RA 1YJDL 4G6AD 4ZAKA 2I5YL 4G9DB 3H8NA 4LLMA 2HFGH 4PJFB 3WTUA 4YH6A 2LFGA 4PJGF 2VUYA 1SEBB 3P9MA 3OQ3B 2F7OA 4K4KA 3ZE2F 2DIAA 43CAB 4PW3A 2HVBA 1CFTB 2JELL 4H40A 4NLAA 3VACA 4WKZB 4PRBA 2HT4C 4LKCA 2V37A 1MWAB 3K6IA 3QWRA 1ZLSH 2OR9L 3LMJL 4XZ4A 4W6WB 2GSGA 4BGDA 1QBLH 4U1HB 5HHOB 1ZS2A 3I9AA 4FJZA 1TQCB 1U3ZA 4NT6B 4XPGH 5EF3A 3L3GA 3ERXA 4BK4A 4JCWA 4J1UA 2VDPL 1SHMA 3LB6D 4TYUA 2PCFA 2DQCH 3D85A 4LF3A 2Y4SA 4M43H 4YC2C 1KGIA 2CLVB 2ZCLL 5IHZA 3TNMA 1M71A 1QFPA 4OLUL 3FSVA 2XFGB 3U30C 2FNBA 2ATAA 3DRTB 3MCYA 2B1HH 2ARJB 5AZEL 5I18H 1Q0XH 5CAYB 3DETC 5B39G 1OAZL 1FIGH 1RHHA 2DTSA 2PXYA 4XC3L 3QUZC 3VFSB 3MV9A 1XIWC 4TXVB 5AAMA 3NIGF 1F13A 2CO2A 2WVVB 3CU7A 4Z7QE 1ZLVH 4HS3A 3V8OA 5J1SC 4HYTB 4ZOBA 1UD2A 3QP3A 1LQBC 1WAEA 2GW5A 1D5BB 2OX5A 5EO1B 3RHWK 1YJDH 5JMRA 1S46A 1LO5A 2R7EB 2I5YH 1OP4A 4MXVF 2VABB 3UZVA 5IK3A 3WAJA 4KVPA 4GAAA 4PGCA 3PDDA 1IAII 3GBEA 1IGFL 1QLRA 2JELH 4JDTL 4HV8B 4XTRC 4PWIA 1XR8B 5LBSA 3K1KC 3ZJAA 1HL4A 5KSBA 2OR9H 1NBYA 2WWKO 3LMJH 3BHBB 4JFYA 2K9UA 2CDFA 3AU1B 3ES6B 3GZKA 1LVEA 4XPBL 4X4XB 5IY5B 2DWTA 1C8QA 2VXSL 2GSMB 3UTSE 3C8KB 1WTLA 2VDPH 5ALBL 4UOQA 1CYWA 3MRIA 1DHKA 3GMPA 5DRZB 3TWYA 1NEZA 2ZCLH 4OLUH 4KH9A 1M1SA 3QG7L 3X1GA 1HJCA 4XVOA 1AG6A 1Z66A 4Z7UF 2AI0L 3HZYA 5AZEH 5BVJB 5HDLA 3CJJA 2GSIB 3HC0B 4TLUA 1OAZH 2BVOA 4QHMA 3NCBB 3SDAD 2Q9OA 4XC3H 1NUNB 3X17A 1X5AA 1OTSC 3EO0A 3OHXA 5EFIB 4JAMA 4BHUA 1J5HA 3P4OA 2BSRB 1IUZA 1SXZA 4BYHA 1RUPL 3ZMRA 4N90E 2A38A 2X4UA 5K9QI 1OW0A 2P49B 3H7BB 1D2OA 3ARGB 2DKMA 5HGGS 1BLIA 5HVGB 2AXWA 4XN5A 2OTUA 5AEAA 3HEIB 1FC2D 4FC3E 1K4CA 4BH7A 1BIIA 2X7LB 4UDTA 1IGFH 4P2RA 1XGPB 5B1CA 4JDTH 3PWUB 5DZVA 4KPHL 3QI9B 3RGVC 5SWQB 2EE2A 4LCWA 4ZO8A 2ZYIA 4UAOC 2B8OT 2JKXA 5B4MC 3O45A 5CR1A 2X87A 4RMQA 4JQVA 4XPBH 1XGUA 2VXSH 4EDXA 2A6IA 3IMTA 5IWLC 1HHGB 4HH9A 5ALBH 1PAZA 2CHZA 4HKXA 1UUSA 3G6JA 5EZJA 2QLVB 1VKXA 3IT8D 3EFOA 3CMGA 1SYSA 2ZJSL 3HZMA 3OKEA 3RA7L 3SDDA 5KBNC 3GK8L 3NACL 3K4ZA 4N0YL 3QG7H 1MW2A 1IX2A 4CU7A 4YHPA 2H32B 2JCCA 1QSFE 2AI0H 4H26A 4QOKB 4OLWL 4YBLC 2D3VA 1F41A 5HY9A 3BQUB 1HILA 3PHOA 1WP6A 3AQZA 3OZ9L 1RZKL 4F7PA 4FXKC 4LRIA 3JBG7 1D5ZB 3DX2A 1D5XB 1RUPH 4MHHI 1IGYA 4CDHA 4UU9B 1W91A 3Q6GL 3QCTH 1L6XA 4KI5F 3LOWA 5GS0C 3UIYA 5AG8A 2R27A 2WLMA 4B7IA 4CMHC 4D0BA 2IOOA 1AI1L 3KCPA 3P4NA 1WZKA 4P2OC 5ACZA 5ESVB 3L4YA 3ET9F 4WAFA 4OFDA 3GS7A 4KPHH 1IGCL 4MLSA 4QXTB 4HHAA 3FB8B 4J3OG 3GXUB 3IJSB 3L48A 2BW4A 2CKBL 2VMDA 3AACA 3K4AA 5BS0D 2QFRA 3BVWA 4WI8A 5EHFA 4XBPA 3UGEA 5L0QC 3IFOA 3DX3A 3ZHDA 1AZUA 4AEEA 1H8NA 4AT6A 3FT2B 1QD0A 1HIML 3QNZB 5EN3A 5G4MA 3ZHFA 1IEAA 1HE7A 1JVLA 5E08H 4B0MM 3MREB 2FEDD 5A6LA 4JJ5A 2ZJSH 1FGVL 2FWOA 4L2YA 3RA7H 4LLUA 1KLGB 2XZAL 3GK8H 1AMXA 3NACH 4N0YH 2AERT 2L7QA 3QQDA 4YQXL 2DN7A 1IQDB 3D7PA 4M02A 1M9WA 1ICTA 1OM3L 3O3EA 3UG3A 3WN6A 4OLWH 5DJCB 5PAZA 4NUJA 4JPQA 3M17B 2DAVA 3OZ9H 2I32A 1RZKH 1Q0YL 2JK5A 2WXHA 5EZPA 1DSWA 1MUJA 4U6HB 3ULVD 1XF2B 2OZNA 4MJ5A 4AW4A 3SJVB 3Q6GH 3TONA 5IGXL 5C0AD 1OQOA 1S9YB 3EHBD 3HG1E 3LRGA 3G6AB 4N5UA 1GJUA 1MCFA 2XG5B 2E4TA 4UOJA 4E9RA 2H41A 1AI1H 2YXVA 3D25A 1EXUA 5DJ0B 4TTGA 1U2HA 4EUPB 2NW2A 2EDTA 1YPZE 4UNVA 2W81C 1IAKA 1HSAA 3HOGA 5HI5C 3P4LA 2N7SA 3L3OA 1IGCH 4DNLA 1M7IA 2I85A 1C16A 4YDZA 4G3YH 2D9QB 1TLMA 4GW1B 2C4FT 2KZ1B 3K81A 5KBPA 2Z4QB 3FAWA 2Z31C 2CKBH 1QR4A 3HE6B 5D2LF 2PN5A 3UTPD 4HMDA 3QJFA 3STBA 2X4OA 1UD4A 3AW5A 5AVSB 1ZA6A 1VFBB 3VXSA 2K3HA 1B0RB 1NGWB 2A74B 2J21A 3MRPA 4LSQL 4PJEB 1HIMH 3AADB 5C0ND 4DVRH 4G8FA 1NM9A 3CSYB 4RIRB 4H20L 4UDUA 4PJ8D 4I3GA 1I1RA 1FGVH 1FH5L 1PD1A 1A3RH 4IRSA 1TITA 1Q0EA 2H26A 4FULA 2VDRB 1BYPA 3MC0A 3QIBA 3F7LA 4L8BA 2F53E 2GUYA 4YQXH 5LG1A 5BQ7A 3KBHE 1OM3H 5E2VL 4O2CA 3MBWA 4LAJH 2DW5A 1JMZA 1S7TA 3HI5L 1SDDB 1Q0YH 1D7BA 4JPVL 1FH2A 3MFGB 4Y5VB 2Q87A 1WIUA 4LLDA 1FG2B 5JLZA 4TL4A 3WJJA 2WJ7A 2DL2A 4BCYA 1BVLB 5IGXH 2Z7UA 1XR9A 5JORA 4OFIA 4PCKA 5DUML 5EUOB 2AEIT 1OM9A 1U8MB 1TPXB 1P53A 3X13B 4AIOA 4LIQE 3HI1B 3F58L 5E2WL 5IM7B 1BQHG 2XTJB 3SQRA 2A3TA 5KVMC 2M8XA 5B39A 4MSWB 1PVHA 2DJ4A 1AZVA 4C56E 3K46A 3S35L 3FKUS 2X09A 3VI3A 1XL4A 2FE0A 2L4OA 2ZYHA 4LHUB 2YAFA 1PG7H 4KBPA 1NQBA 2KLRA 1CLOL 1OGPA 1ZSDA 2WOYA 3HMWL 3KVDD 3PXLA 4QRUA 4FX5A 1NCGA 1MCBA 2EP6A 5HHMD 4LSQH 4PWFA 4L05A 4FNTA 5KUMA 1OAYL 1QRNA 3MCKB 1TCMA 1TYEB 1A2YA 4UINL 3VJ6A 3UGXA 1G7LA 4JMXA 4H20H 4OZGA 4JW3A 1FH5H 2MQCA 2F7RA 3F6IA 4P0DA 3QEQA 5HYSG 3QFDB 4P5MB 3MGTA 1MRFL 2PPFA 3ARDB 4PVBA 3SDCB 4L0PB 1IEHA 3BD4A 3D1MC 2A73B 5E2VH 1WISA 3QFJE 1ZA3B 3SPJA 5HDQL 1F11B 1IBFA 2DMCA 3HI5H 1GH7A 3WY2A 2HG5B 4OVVA 3VD4A 2EIZB 5J9PB 4JPVH 3RUGA 1KV3A 1LNUA 5KS9F 4GKNB 3IBOA 1AGFA 1V3MA 3PQYB 1QYGL 3DMMC 3E7JA 1YO4A 5GGSY 5KANG 2PCPA 5DUMH 1SPDA 3Q43A 1FV1A 4ZX5A 3HR6A 3Q5OA 2VLMD 5KYYB 2JKSA 3F58H 5E2WH 4D2NA 5BZDA 5KYXA 3DBXB 4KHTL 4N0UB 1C5DA 3ZL4L 5H2BA 2ICEC 1EBPA 4X9GA 4ZJ9A 4ES8A 1NAML 5HGDB 4WFHD 2HVKB 4L37A 3S35H 1JZ3A 1YEDB 3MBXL 3UAJD 1BJ1J 3PAVA 4GRMA 5D1XE 1X5XA 2EC9T 4UM9B 1BJ8A 4FA8A 3HMWH 1CLOH 2KDGA 5FGSA 3RKDC 3L4VA 1KYDA 4F9PC 3C5SB 1MFDL 5AZ2L 2AKRB 1IVTA 1OAYH 1G5GA 1LP9E 1IL1A 4UINH 5AW5B 1PG7W 2C1OA 3AQYA 4HAKA 4NDMB 4P5TD 2GJ6D 1F6LL 2CM5A 3WUWA 5GGSA 1E9QA 1S7QB 3ULAB 2G0KA 4PJBA 3WS6A 2QHRH 3G9AB 3QS2A 4M8UA 3KLKA 4RA0C 2AJ3B 3KLAB 1DYZA 1MRFH 4PGEA 2HT3D 3GXFA 5DUBA 4F91B 1F2QA 5HDQH 1NC4A 3ARZA 3WO4C 4ZQKB 1T1YA 1JN6A 4S0SD 9CGTA 3O6ML 3IDUA 4PJIE 4J39A 2A99A 3QWNA 2WKGA 3PHAA 3QIWB 5EC2B 1QYGH 2X2IA 3RY4A 1E2WA 1AD0B 5ICYA 2XYCA 3NTCL 4ANUA 3GXPA 2WZ0A 3PY9A 4ZMLA 2QQNL 3FCSB 3WEMA 1JV5B 4OR1A 4KK9C 4M8RA 3TN0B 4KHTH 2R0ZL 5AAPA 2WZAA 3ZL4H 4IOFC 4G6ML 1ZDSA 1NAMH 5E94A 3RWDA 3UDWA 3ZTCC 2X3CA 3RVTD 1COBA 2NY1B 3NPSB 3LXAA 3R8QA 2AK4B 3MBXH 3C60B 3POCA 2UZXA 2PWDA 4YFLF 3VGAC 1HHJB 1UJTA 1TZIB 3O11A 5A2FA 4R3SB 3BP6A 1X4XA 1MFDH 3ILDA 2Z1PA 5AZ2H 4JQXA 4M7ZC 5IB4B 3MYZA 2Q1EA 2V4LA 3FUDA 3BVUA 4G43A 4I0PC 4Q14A 4G6AC 1E4KC 4GAYB 3TJPA 4EN3B 4NQVB 1NJ9B 2P5WD 3B9KD 3RDTA 5DI8A 4FQLL 1BQ5A 5JQHC 2H8PA 2FJGA 1EHLL 5CZXC 2O61A 3QVAA 4LEXL 4XO4A 5EU4A 4AIEA 3MRMA 2VZSA 5DEFB 1XGTB 4E5XG 5JR1L 3SY0A 3O6MH 4HJUA 1P7QB 4UMGA 2D73A 5IZ7A 4PB9L 3WLBA 3NCWA 3PDOB 4HFWB 3D39B 2YD0A 4K7FA 1WYJA 3IJEA 3NTCH 2CIKB 4KUZL 2BNUA 2QQNH 3LB6C 3RPIB 2BY0A 5LAPA 3JV4B 3N04A 4Z8FL 4G6MH 1QASA 2X70B 5EEZA 1OSZB 5E8EA 2VN3A 5DHXB 5DJ8A 4YDVA 4W4OC 3NIFB 2N7AA 1JERA 2Y7QB 5JQIB 4QPEA 2ZT9C 5HGBB 5KSAD 4APQC 2WQ8A 2VITA 4J3UA 2FWUA 1XBDA 3T5WA 4Z76A 4M7JL 5TPWL 3II3A 4IBSA 3GBNH 3MRBA 3OMAB 2FJFB 3ZDYE 1VJSA 4DFIA 3PLYA 4FQLH 2BW5A 1HDMA 1EHLH 2YPLE 4HWBA 2OBGA 1T1ZB 4MJ6A 1F56A 4NJAL 1ASPA 2MRYA 2DWXA 5TE6L 2V2TA 3ZXAC 3GSVA 2KQNA 1H0DA 2A6DB 4PB9H 1CFBA 3VWJA 3WNNA 5DDHA 3PWVA 4F33A 3LKQA 4LVNB 3NCFB 2BZ7A 3GJFH 4XP1L 2WGXA 1A21A 3R18A 4O51A 3FULA 2D7MA 2BX5A 1QSED 3IN2A 4JFEA 4KJYB 4KUZH 4X8JA 3O0RL 2ZAHA 3JT2A 4XCNB 4Z7UA 3U30B 1EVUA 1KB5A 4PSPA 4Z8FH 3K6SA 3IPFA 4QF1A 5IUSA 1PCSA 1H3PL 3AG4B 3NCMA 4ADIA 1BXXA 5CO1A 4E9TA 1NFKA 4GW4B 3SD2A 1UHVA 2NXZD 4PMFA 3BP4B 3CUPA 4NBYB 1JP5A 4HD9A 2HPOA 3GPSA 1RFDL 3SDAC 1P6FA 4ZPTA 1U33A 4OF3A 3ZUCA 2KZBA 1FAIL 3N42F 4M7JH 2D8KA 1E8XA 2GJPA 2OM5A 2DEYX 3B37A 3DOSA 4ZW7A 3MBED 4EKJA 4JPSA 5C08A 3SKJL 3X1NA 3L4XA 1YJDC 4B3EA 3K4DA 1R3HB 4YC2B 4NFBA 4N4YB 1KGUA 1H8SA 2WK2A 2F8XC 3N3EA 1UFGA 4FLQA 4KDTC 1T1WB 1NTDA 4KQ3L 3GXNA 5LCVL 3IJYA 1ZJAA 1KPRA 4FXGA 2IF7A 1CD9B 4M3KB 5F9AC 4NJAH 1X7SA 2CZNA 4CGTA 5TE6H 3QUZB 3D4ZA 2IMNA 2QV2A 3VXRE 4AQ1B 3QQ9D 3QNFA 4ZXBD 4QRPD 2GIYA 5E4EC 1NDMA 3FFCB 2FX9L 5IBTL 1BQRA 3PWPB 1GR7A 4XP1H 5E9DB 2VZVA 5CSGA 3NVQA 4PTUB 4YR6A 4DFHA 5GGVL 3O0RH 1QRKA 2BERA 4NKMA 1RZGA 4IRZL 5JA9A 4YSRA 5GSRA 4P2AA 4HPYL 5CEXB 5BRZB 1H3PH 1TTCA 4P4KA 4WTZG 5EU7C 1JXGA 2EZ0D 4FS0A 3MPCA 2CCWA 1JPSL 2V2XA 2NY4B 5LBVA 4NP9A 3UTQA 4AVKA 2MIZA 4AYSA 1J0KA 1MRDH 1RFDH 4IHOB 4W4NA 4BZ1A 2XQ0A 1YPZF 1NGXB 4MWFA 3CN4A 1J88A 3LJ3A 3HUJE 3OKLA 4X9YA 1FAIH 3L6FB 4ZFOL 1N5YL 2KERA 1XBRA 3KWVA 3FTSA 5IBUG 1QBAA 3SKJH 3PHSA 2NXYD 4TUJA 1HXYB 3V4LA 3FO9A 1U93B 1AKJD 1QQDB 4HJSA 4ABUA 2WUCL 1SEQL 3LNHA 5LVEA 2ARJQ 3OZLA 2BNRA 4KQ3H 3JWNE 2YUZA 5LCVH 4ODTL 1OF2B 3L13A 3GINA 3QUXD 4AG4L 2HFEA 5JUEL 2DBJA 3AY2A 4YSPA 4XHQA 4HCFA 4X4MA 3K6FA 4L3AA 5D7IB 4XCEB 3PV6A 4NCC1 4ZMQA 4OCNC 4S1RL 1GS8A 2IH3B 2Q7YB 2D7NA 1V7ML 3RE0A 2FX9H 2B39A 5IBTH 2PO6B 5F7LB 5HYJD 4PBVC 1BECA 4HEMA 4L3EE 4TVUA 2X9WA 5GGVH 4FL4C 4JG9A 3FO2B 1HFUA 4IRZH 1AQDB 1R24A 4N2KA 3V4VB 2FEDC 2ESVE 4HPYH 2GUOA 3F7YB 3QULB 1U42A 3RGVB 1TQSA 1FQ9C 3TA3A 4DGUA 2FRGP 2X6UA 4OJAA 1JPSH 4UAOB 5BW7A 2LHAA 3GSNB 2Q20A 4NNXB 1GKOA 1UB5A 3P73B 3HZVA 2A4CA 2AQPA 3GM0A 2X05A 2X4SB 4M61B 4WCYL 3LZFL 1RCYA 5T1KA 1VDGA 5E8PA 4AGLA 1JPTL 1FNGA 1VCBC 1WFMA 3MLRL 3CH1A 5JDSA 2WUCH 3QR1A 3AM8A 1SEQH 4JCLA 4RMUA 4XB7A 1MJUL 3JTBA 2Z8VC 4PREA 1BZ9A 3OC8A 4ODTH 1IGTB 4AG4H 3TF4A 3LAFA 2IDCA 2WWMC 4JGUA 4YBLB 2CLRA 5JUEH 4NENB 5TDPA 4F8OA 3PE9A 4G8IB 3F85A 5GGRB 3RY6C 3NCXA 3LKSB 4A7GF 3FQTB 2PYEE 3EO1B 3A6BL 5F7YC 2HKHL 2PW1B 4S1RH 3DX7B 2WTRA 3AU0A 1V7MH 3U6XS 5F9OL 3NJXA 1PDKA 3LZOA 5F96L 1SFDA 5E6UB 3FZUD 4EIBA 1JZGA 1QZNA 2ZWZA 4MQXD 4W68A 4BBWA 2CIIA 4G6FD 3BWUC 4P2OB 1DVFA 4JFDD 1Y18B 3EH1A 1KGJA 5DYOA 3WDHA 3FB7B 4GG8A 4LFHD 1TKWB 3RWFB 1CTNA 1DDHA 1G7IA 3ESVF 4YL9A 4KROD 4M6NL 1S7WB 1EAPA 4K7PX 5G2NA 2QJDA 5CZVL 4K7PL 4L18A 4FEIA 1ADQL 5L0QB 1V7NH 1EV2E 2BHUA 1RZKC 1AJ7L 1GIGL 2K45A 4NQSB 4XGZB 7FABL 2JE8A 2V3EA 4ODBD 4X5WA 4WCYH 2VB5A 3LZFH 5D4JA 3LKPA 2Q2LA 4JY4A 4WNJA 2EVFA 5GRVK 1JPTH 4PWKA 2BRRL 1T7WA 1H15A 3MLRH 4PRHE 2L7EA 2ZKWA 4MA3A 3ZIMA 3X12A 1MI5B 4HX1A 5IB2A 1MJUH 3JUYA 5JZ7D 4GAFB 1R34A 1TVHB 3ZIYA 1B0GA 4IIQC 2QPUA 3CC1A 1DANU 1LP9F 5I5JA 4JRFA 3DBSA 2FBOJ 4Z7VE 5E1QA 3RX7A 4Y1TA 5JO5B 3KPMB 5JHLA 2JMRA 2IH1A 2WXGA 3MNWA 4FHJA 4IQHA 4TVSa 1Z2KA 2DM4A 2HJLB 3HKFA 3OZKA 1NEUA 5DWPA 5IB5B 1AZRA 3A6BH 2M2DA 3VQLA 2DWDB 2HKHH 3E8VA 1E2VA 4QMEA 1JPFB 3QEHB 3C08L 5FEBA 4JY6A 5F9OH 1IFHL 1BREA 1IRAY 4ZMOA 3KGRA 1I3UA 5F96H 4C47A 4LPUA 1WF5A 1Q9LB 5DJZB 5DQDH 2GTQA 3M46A 4XNQB 1OSEA 5DMIL 4BINA 3VFMB 4PJIF 5AUMA 5GRXG 3VDBA 4M1CD 5A2KH 3BZ4A 3C5JB 4PJ5B 2P8MB 4M6NH 1O5PA 1S9WB 1U3YA 3LSOB 4HLJA 1YNTB 4Q89A 2KQMA 5CZVH 1PZUB 4K7PH 3MRGA 1CE1L 5KS9A 1KULA 1ADQH 4MCZA 2NOYA 1BMWA 1MLCB 5M7QA 7FABH 1T3FA 1AJ7H 1GIGH 1PMYA 2YQ2A 3BAEL 4C4KT 3D08A 2BVTA 3OXSA 4PB0L 4KY1L 1JK8A 1DVQA 1Z9NA 4BFIB 4LMQE 5ESAB 1I1FA 1KBKA 2YD8A 1DR9A 3CZKA 4Y4FC 1VACA 1U95A 4FD0A 4ZDHA 1C5CL 3UTTA 4GT0A 2EC8A 2X1XR 2GFBA 5IFJA 4O02L 2ZWLT 3B7TA 1ZLWK 3SBQA 1R3IL 2FIKA 1MCRA 1UCBL 3PJSA 1BFTA 2BOCB 3NSFA 4JN2B 4L3FA 4JO1H 1M3IA 1IAIM 3QDJB 2MKLC 4P46A 1NL0L 4S0TD 2IBBA 4W93A 4M4PA 4LPTA 4LOVA 3LNEA 5F1IA 3UAJC 1JF1B 2VQTA 5FUOL 4BA8A 4YN3A 2AV7B 1J1XL 5IVOA 1CFSB 1I1AB 2WMPA 3EH5B 5T5FL 2DRUA 4FKHA 2VE6B 4N2LA 1A4BA 3C08H 1IFHH 2Z91B 2WKLA 4XOBA 4XMVA 2Y2YA 1PZCA 2IH8A 35C8L 2V7HA 4WKXA 4ZO6A 4XAKE 3QZBA 5KYUB 3U2SA 2CM6A 2VKXA 3LHPL 3KXFB 3SE4A 2CGRL 4P5TC 5DMIH 4P23D 1OP5H 3FSAA 4EXPX 3IKCB 3Q5TA 4M9PA 2Z34A 4N8PA 5IF0A 2APVA 2GITA 2V2WA 1YEHL 2DQDL 3BZEA 4OD2A 3OQRA 1NCNA 3MNMA 4G11A 4TQPA 1R5WB 5B8CA 3EUUA 1CE1H 4C4UA 1W2KT 2VWEC 1V3KA 3L16A 4XP5L 1IGJA 2YRZA 4JRXA 3VYPA 1BVKA 3BAEH 4I3SL 1G7HB 4TTDD 1KBVA 4BUHA 1OK8A 4PB0H 1HKLL 5I75C 2VXVL 4KY1H 1K8IA 5KG9B 1TEGA 3MV7D 4MAUL 3QW9A 4XH2B 4I5BB 1C5CH 4M3JA 1VEMA 1KTKE 3AT9A 3JTTA 1R3IH 3O9WD 4A7QA 5AW2B 2O26U 3ABZA 1UCBH 3FO1A 4FNRA 3U6RB 4NNPL 4DGVL 1A1OB 4YDMA 4ZAKB 3T2PA 3WJLC 3IB4A 1NL0H 1YLBB 1J5DA 3WFBL 5FYLL 4KJPC 2VAAB 1T83C 4RWHA 5FUOH 4E42A 4QRRE 3ZDYF 3VGHA 2YGNA 1J1XH 3T3PB 3JVFC 5T5FH 4MNHB 1E27A 1B9ZA 1MW0A 4PRBB 3GZQA 3DMMB 3AGVA 4YEEA 4Y5YA 3IXAB 5IR1A 1HINL 4OQ1A 35C8H 1Q9WA 2XYBA 5E5MA 3WFZA 4JKMA 8CGTA 1N8ZA 4QO1B 3K5RA 5FHBL 4HWNA 3TO4D 3LHPH 2F2HA 3OR6A 4J4PD 2CGRH 1QNZL 3HZKA 2FSEB 2DYPD 4CADA 4EZJA 2ICEB 1WZAA 2B14A 3JV6A 1YEHH 2DQDH 2XZCL 4LGPB 4GH7B 5LGHL 3S36X 3B9KC 5DGRA 2NY6C 2YQ3A 3T04D 1W6WA 3S36L 4U1LB 5ICZB 5ISZD 3N1PC 5IMMB 2AVFA 2EDMA 4XP5H 2WTOA 5D1QD 1KPVB 2P7TB 4I3SH 5J6HB 4TQ8A 3UPAA 2KDYA 1RULL 1HKLH 3FNKA 2VXVH 5E4OA 2XWXA 1B3IA 5EF2A 3WBDA 4IYKA 1A7PL 5DS8A 4MAUH 4DUXA 2UWEE 2VW6A 1N10A 2BS8A 3HCVA 4MAZA 1A47A 5A2CA 5F88B 1JF6A 1GW6A 2BDNL 3MV9B 1KTCA 3NJMA 4JVPA 5ECJE 2WUBL 2XN9B 1I7TA 1I3RB 2X6VA 2VYRE 3RL2B 2PTTB 4NNPH 2FK9A 4HGMA 2ATPA 4DGVH 4AJVA 1XSJA 3WFBH 3G6DL 3WNJA 5J13C 4HLZH 5FYLH 3FQNB 1S3KL 1YEFL 2VDNB 1Q90A 1HKFA 2X2JA 4FJYA 1H5BA 2MEJB 4LL9A 1IZJA 5KVGL 1BOGB 4Z7NE 1DBBL 4WI7A 2FUQA 4X6EA 1M6OB 5E6ID 3RX8A 3B5TA 1X9QA 4GRWH 1HINH 4YSCA 3L5JA 1TLKA