1GS7A

Crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
b'QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs7A02
1ILUA 1NIFA 1PF3A 1NPNA 4AI7A 4DP6X 2AANA 4HHGA 3NJJA 3X1BA 1ETJA 1BQRA 4KOBA 1XB3A 1XB6A 2VW7A 3IN2A 4M3HA 2UXFA 3JT2A 5B7MA 2XLLA 3ABMB 3GXUB 5TK2A 2XV0A 3T9WA 3QQXA 2CUAA 5AFAA 1ADWA 1OOWA 2YAFA 1DYZA 2UXGA 4E9VA 1OCZB 4DP1X 2EILB 2FQGA 4UAHA 4QLWA 5B1KA 2IDTA 2OV0A 2XUWA 1TU2A 4PAZA 1PMYA 2DYRB 1SF5A 3UACA 3PLYA 5D4HA 1ZIBA 1BEXA 1JZGA 4W1TA 3BVDB 2BW4A 2ZOOA 1L9RA 4CSZA 2CALA 3EH5B 3OMIB 3FPYA 2EIMB 3NP4A 5B1JA 1N70A 2R7EA 3NSFA 3NT0A 3CDZA 2FQEA 5I6KA 1CURA 2PPFA 3N55A 3PAZA 3X1EA 5I6MA 3QJRB 4X4KA 2HLEB 4HZ1A 4YSPA 2TSBA 2VM3A 1HAUA 1NINA 1XMEB 1NPJA 1NWPA 2LLNA 3H56A 1KDIA 3UADA 3PAVA 2XX1A 4UF7C 3EHBB 2XV3A 5B1AB 2Q5BA 3GYRA 3WNIA 6PCYA 3AG4B 1PY0A 2CAKA 1RKRA 2YXWA 1ZPUA 1URIA 4YVNA 1L9SA 1M57B 2XXGA 4GP8B 3NP3A 3CG8A 3SBQA 2Q9OA 3SBRA 1V55B 4DP4X 1L9QA 1W8EA 2IDQA 1NWOA 2VSKB 3WKQA 3QJTB 1NZRA 3EH4B 1UATA 2VW4A 3FPXA 3QJQB 3X1NA 2BP8B 3UAAA 5FC9A 3AG3B 2BW5A 5I6OA 1MG2C 3AY2A 5PCYA 2H3XC 1ASOA 4JHUA 1GW0A 1CYXA 2GC7C 2YARA 4BK5C 4F2EA 4JHVA 4HCIA 1JVLA 6PAZA 1AAJA 4N8UA 1X9UA 2IDSA 4KO9A 1I53A 3ASNB 5B3SB 5A7EA 2FNWA 3AG2B 4YSTA 4HAKA 1OCOB 4DP7X 1J9TA 2QDVA 4G72B 2OJ1A 1L9OA 4L0PB 4ZK8A 2H47C 3V9EA 4P5RA 3TBCA 4BDVB 4P5SA 4YSOA 3ABLB 3IE9A 2YAOA 4KOCA 4Q8BA 2GIMA 3TASA 2PP8A 3UABA 1RZQA 3CZUB 4QKTA 3FSZA 4AX3A 2FQDA 8PAZA 4ENZA 5I6LA 1E5YA 1A3ZA 1VLXA 3IEAA 1E30A 4GP4B 1ET8A 4G7QB 3IN0A 3NJKA 1EHKB 4BWUA 1GS6X 1MG3C 2DWTA 2DV6A 2NRDA 1PCSA 1ZDSA 3L45A 4WTQA 3CVDA 1JERA 3FT0A 1NTDA 1B3IA 4YL4A 5F7AA 3AW5A 2BP0A 1GS8A 4NAJA 5E9NA 2CBPA 3NSYA 1GY2A 1WA0X 2H5UA 4A2HA 2RACA 1PNDA 5PAZA 1NDTA 1OF0A 2IWEA 5TK4A 3ZDWA 3TA4D 2FT8A 4F2FA 2B08A 2HRGA 1ET7A 1E67A 3MX0B 5I28A 1J9SA 4E9RA 2BP0B 3NJHA 1PZAA 2YAEA 2P80A 2UXVA 2BZ7A 3CVCA 4KO5A 1A4CA 1OCCB 4YSAA 2PPEA 1KCWA 4G7SB 3ASOB 4DP9X 5D4JA 1ID2A 2CCWA 2J55A 3HEIB 2PPCA 2GI0A 3X1FA 2FQFA 4Q89A 3FYIB 1HAWA 1QNIA 2OCCB 1J5DA 3S3BB 2J57A 1BYOA 1JZEA 2IWKA 2VN3A 1KBVA 1NIEA 1OV8A 2DY2A 3UGEA 2MRYA 5D4IA 5I26A 4PCYA 1JZJA 1FA4A 3T6WA 3WNJA 1V10A 2R7EB 2DWSA 3NJIA 1NICA 1ILSA 2FT6A 2JFCA 3CDZB 4YSSA 1KYAA 1L9PA 4JKNA 4YSCA 1OCRB 2W88A 3C75A 1SDDA 1SFDA 2UX6A 3OMNB 5B7EA 2YAQA 2IH8A 5I6NA 4AKOA 4E9XA 2FTAA 2ZONA 3WKPA 2EIJB 4A2GA 1A65A 1E65A 3T6ZA 3DTUB 3FU7A 4YSDA 2TSAA 4A2EA 1J5CA 4E9WA 1RZPA 1AZRA 3KW8A 2N0MA 3H4HA 1V54B 4K9JA 1PAZA 1WS8A 3CVBA 4A66A 1ZV2A 1T5KA 1AZNA 2ZWNA 4E9YA 1PLAA 5ANHA 2YAPA 3SQRA 1CUOA 4DP2X 1AANA 3RYMA 1JXDA 5AZUA 2WO2B 2VMJA 1WS7A 3ZIYA 1MZZA 2CJ3A 4G71B 3PPSA 4HCFA 1BXAA 4G7RB 2HRHA 3OQRA 4KNUA 3T6VA 3T71A 2HX9A 3BQVA 1TKWA 1ZDQA 1PLCA 1PLBA 1M56B 1AIZA 1N68A 1SHXA 1W6LA 4E9TA 2YXVA 2B3IA 4G70B 4DP8X 3X1GA 1F56A 2BHFA 3S8FB 3QPKA 2IWFA 4YSRA 4KNTA 1OE2A 2GC4C 4BWTA 2GHZA 2P80D 1SF3A 4GY4A 2EINB 2I7SA 2HZHA 2AZAA 1IBZA 1PZBA 3TU6A 5I6PA 2XWZA 1TEGA 4DP5X 2GSMB 1GYCA 1JZFA 2J5WA 1IUZA 4MFHA 4E9QA 5I5MA 3FQ1A 3X2QB 2J56A 3QJVB 4M4RB 2QT6A 4A67A 1JXGA 1AQ8A 1A4BA 4NB7A 3FQ2A 5F7BA 2QDWA 2IDFA 4DPCX 3ABKB 1BAWA 3GDCA 1SJMA 2IAAC 1WA2X 2I85A 3ZX1A 1SHWA 3NSCA 1OE3A 1AG0A 2UXTA 2XX0A 1JZHA 1AS6A 1L9TA 1JOIA 3ERXA 3NYKA 3PXLA 1ET5A 5I5IA 3FSAA 2AZUA 2PPAA 2WSDA 3S3DB 3FYEB 2QPDB 4YSUA 2YQBA 1EZLA 1WA1X 3FSVA 2FWLB 1AR1B 3ABGA 4UANA 3DIVA 1J9QA 2BWDA 1BQKA 1QLEB 2XXFA 3MBWB 1NIDA 1AOZA 3NJFA 1SNRA 4AZUA 3QJSB 5EHFA 1PNCA 1RCYA 2XV2A 3FQYA 1KCBA 1AACA 3DKHA 2VSMB 3PAUA 3OMAB 1BYPA 3FS9A 2FT7A 2A3TA 3T6XA 2W8CA 4CSPA 5IY5B 2X87A 4GP5B 2JXMA 5B1JC 2YAMA 1CC3A 3N2JA 4WKXA 5AKRA 3PCYA 1KV7A 2X88A 3FU8A 4A68A 3WG7B 3U25A 2BWIA 1AS8A 1YLBB 2QPEB 1GR7A 1GY1A 3IBOA 4N4YB 4A2DA 2IDUA 3OM3B 1BQ5A 1GS7A 3EH3B 1FWXA 9PCYA 4KO6A 1JVOA 1W6WA 2GB2A 2BP8A 2Y1AA 3V9CA 4KNSA 2Y69B 4YSEA 1IBYA 3G5WA 2XVBA 3JTBA 1JXFA 5B7FA 1HFUA 2PCFA 4HHWA 4DPBX 1SDDB 1PZCA 4HCGA 3NSDA 1TEFA 1KBWA 1E5ZA 3NJGA 3TBBA 2HXAA 5I5JA 4A2FA 2E86A 1JZIA 1SFHA 1DZ0A 2JKWA 2I7OA 2BZCA 3AG1B 2ZXWB 2VW6A 3S3CB 1AZUA 4NERA 4BXVA 7PAZA 3FU7B 1IKOP 1FFTB 4BWWA 2MTAA 3SBPA 3AZUA 3H4FA 2HX8A 2XYBA 4DP0X 1ASQA 4KO7A 1NIAA 1AZCA 1X9RA 3S8GB 3UAEA 1WAEA 3EF4A 4BDVA 3HB3B 3WI9A 1BXVA 4HALA 1BXUA 1CYWA 2UX7A 3D12B 2PLTA 1MZYA 3NJMA 5B1BB 3OD3A 1AG6A 3WIAA 4AKQA 3KW7A 2FJSA 1OE1A 4YSQA 1QHQA 1R1CA 1GSKA 4W9ZA 4BXSV 1AS7A 2VM4A 1A8ZA 2PPDA 2AFNA 1NIBA 2IH9A 1AZBA 3NJLA 4E9SA 2DYSB 2YAHA 1KGYE 4DPAX 1ASPA 2WO3B 4GXFA 1ZIAA 4TXVB 2AVFA 2XU9A 2PP7A 4GYBA 3FU9A 1MDAA 2GBAA 3QJUB 4AKPA 2PP9A 2HX7A 4EF3A 7PCYA 3FSWA 4F7KA 1J9RA 4FAAB 5LDUA 1KDJA 4YVUA 3ZBMA 3NJNA 1XB8A 4RH4A 4FA7B 2BO0A 1A4AA 2PCYA 1M9WA 2EIKB 1IC0A 4HIPA
chains in the Genus database with same CATH superfamily
3P0GB 4MJIA 3IMWA 1NPNA 2DDQH 5IJDC 4HOWA 4WV1B 3MUJA 1TMQA 4J3SA 2WY3B 3KPPB 1RV6X 4P9MH 3U4EA 2IFFH 4GO6B 4Q2ZB 2AJZB 4MCYA 4MJ6B 1N6VA 4R26H 3A6OA 2XLLA 3MLWH 3N1GC 1AR2A 2CUAA 1ADWA 4QRQB 3WKMH 1DYZA 4OZ4B 5I1JL 5JIQA 1MFNA 3SSGA 3TONA 3FU5A 4GT7A 1U93B 1Z3GH 1DANU 2EYTA 1L7IL 2Y6TE 1VRSA 4H8QA 3STBA 2OV0A 3UMTA 1D9KA 2CK0L 4HBCH 1IAOB 3N91A 3VXUA 1JZGA 4CSZA 1WF5A 1L9RA 3QWOB 3O6FB 3QEHA 2B4CL 5AYTA 1QSEA 1SRDA 5AD0A 1OW0A 1YEFL 2KT6A 2J8UB 3LPGA 2DKUA 3EO9H 2GITB 1ZLSL 5DCCA 1IMHC 3IDXL 1QSZA 3ILEA 3P4LA 4J3BA 4HMCA 3VXME 5K9OB 2VR3A 4GMSH 3SZ6A 2P52A 3MLRL 4MMXC 1Z3RA 4NUMA 3WMPA 1BMWA 3EUDA 4L4TB 3A5VA 4J6RH 3VH8G 3EBHA 3DXAB 1FYTE 1KB5H 2EIDA 4JRXD 1E5AA 2LR4A 4F9PC 1T1YB 2XFGB 2EH8L 2XQYK 2ZKWA 3MLYL 3GIVA 2O6EA 4HD5A 3FH8A 5F96H 3OR7A 4KI5C 5HI4D 2W1NA 3BGMA 3HS0B 3PL6D 4JGJA 2XXGA 4WWOA 3U36A 4A63A 3CZNA 3JWDC 4MDIA 5SWSE 2WXHA 5EOTA 1IFGA 4UNTA 4S1DC 1IGYA 4GBXD 2OYKA 4MNQD 1YN7A 4XN8A 2CO7A 3AG3B 5I6OA 4HS6A 4JFUA 1A6UL 5J12B 3S36X 3IK2A 4OSUL 1JCVA 2NYZA 2PWGA 2HJLA 2PTUA 2Y72A 1NCUA 3SKNB 3UTSD 3QIUB 4MS6A 1QSFB 5TQ2H 4KO9A 3D33A 3WV0A 2DZEA 1MRFH 3ILDA 3HUJE 1KB5A 2NY5H 5I1EH 4HAKA 4QPEA 2AEPH 1J0YA 1OGSA 3NCJL 2OI9C 4P2YA 4PJ5A 1YQVH 2QDVA 4RWYH 3CE1A 2EVFA 3RX9A 5GQBA 2MWCA 4OD1H 3IS0X 5HI3D 3PABA 3MFFB 4P9HH 3ZZ1A 5D7LE 5FYJE 2KL6A 2XVGA 1EFXA 4FTVB 4LKCA 4NXSA 1I3GH 1RZKC 1DVZA 1RH8A 2HKHH 2XXCB 2E0PA 2C9RA 1A3ZA 5EOCL 2ZJSH 4DO5A 5C6TL 2QHRH 4Y9GA 2AQ1A 3BRFA 3QC6X 3PF2A 4KQ0A 1JPFA 1NM9A 5DS1A 3OKOA 5FM8A 1FFRA 4BH8A 3U1SH 1ZT4A 5C0DA 1I4FB 3T2NH 4QDGA 3UROR 1U4EA 3TBSA 5ALCH 1XCTA 2WXJA 1UH4A 3NRPA 1ODAA 4YL4A 2O5YL 1BMGA 4PRBB 1JNNL 2RAMA 4JQXC 3AW5A 3BAWA 1CK0H 4XAKE 1OGTA 1MCSA 3UPRA 4IGBA 3WFHA 1KB9K 3OJDA 5DD6A 2GABA 2R0KH 3HG3A 5A16B 1S9VA 2X4TB 1QFHA 3CBKB 1KT2B 3G9AB 3MLSH 4FEIA 4IJ3C 2ORBH 2D7PA 4G43B 1GTNA 35C8H 2CLZB 4HAGA 1ZSDB 4AXWA 2BNRB 2VXQL 1IC4H 3LQMA 2GSIB 3O3UN 4GT0A 5GJTL 3PWNB 1I7RB 3GBNL 1JV5A 1P7QD 2BFGA 2P80A 5J1TC 3GJEA 3GPSA 2C3HA 3L6FB 2ZXQA 3D0LB 5D4JA 4LEXL 2YA1A 5EO1B 3AQDA 4EQ3A 5JQ6L 2YA2A 4TLTA 3EDJA 3MRQB 1J8RA 4B9GA 1G7LA 3FCBA 2NYYD 1GYVA 1P6WA 2FGWH 3DGGB 4KMTL 4EDWL 4LSSL 5DC0A 5TJWK 5I30L 5ESAA 4Z18A 4GG6B 1ZE3H 5DLMH 4DGVH 3BVNA 1JGDB 4GFXA 3MODH 4J28A 2E7DA 2N7BA 4TF4A 1WWAX 1ZPLA 3VE0A 5FR3A 1OO2A 3KNBB 5E94B 3QDJD 2Y25A 2YD7A 5BS0D 3D87B 3TIDB 5C0FB 3ZKSD 3T2OA 2IH8A 3FUMA 4FQJH 1YJDC 2P24A 5EEZA 1QACA 4A2GA 3ZU8A 3F64A 4PB0L 4JJ5A 4RESB 1OHQA 5TDOB 5DUBA 2VDKL 2PYEB 4P23C 2P45B 5J3HC 1ZY9A 4KXDA 4BUHA 2PCPA 4OCRL 3EBGA 4JRXE 1TCRB 4XP1L 1FNEA 1IT9H 1RUAH 3WE6B 2PWHA 4XVSH 1AHMA 1ETB1 3U1PA 4GS7C 3LZPA 3A4FA 4UAOB 5J11C 1EAQA 1NC2D 1EEZB 4ZS7L 2VLJA 4C47A 3F7VB 1H5BC 2NY6D 5G4MA 2WYHA 1CGYA 5AZUA 2O6PA 3SO5A 3C8KA 4O9HL 2XWXA 4UINH 3MNVA 4XXDB 1MZZA 2NSXA 1BGXH 1MVFA 4NUJA 3FFCE 3ARWA 3LEYL 4KAQL 2DEXX 5HJGA 5ID1A 3WGUB 4ALAH 1H3WM 2J21A 1KXTA 3SHSA 1JE6A 4C58B 3NFNB 1ZEAL 2XWJA 2Y1ZA 2Q6WA 3HZVB 5A2JH 3K81A 4BUGA 4DUVA 3PAYA 3VFVB 1PLBA 5CINL 2GJ6D 2EKSA 2OCFD 4GO9A 2Y06L 1AR1D 3KBFA 4AL8L 3UTSE 2MNWA 5DD0H 2LFGA 3WLBA 3BDBA 1Q8MA 4K3GA 1U92A 2YGPA 2DWYA 1VFOA 2GHZA 4LDLB 3MNVB 3DJTA 4G8GD 4JPQA 3L4TA 3FT2A 1CWVA 1YYLH 1A9BA 5E8EB 2W0FB 2H32H 4KITB 1D2PA 5EN2A 1NCAH 2UWEF 3MRMA 4ADGA 3W1ZA 2X1XR 3PHQB 2R2EB 1K2DA 3ETSA 5C8JA 1R5IB 1BAFL 5DVOA 1ZHKB 3RWHA 3B34A 1TQCC 3VQLA 4UNIA 3QJVB 2ZYSA 4PD4K 4JANA 3EJTA 4EUPB 1H3TA 5GISH 4DN3H 1R3HB 1MFEL 1XF5B 3WS6C 2VNCA 2IH1B 4ZW8A 1H0DB 1MJJB 1ESOA 4DCQB 2R83A 1F4YH 3IU3B 1SHWA 2NPLX 4X6EB 1RUQL 1MAJA 4Y4KB 1SXZA 1OE3A 1HQRA 1NKGA 2O5XH 3F7LA 1ICTA 3BPNB 1A14H 3HG0A 4KKLD 4L3CB 3N9GL 4WTZG 5BPPA 1JOIA 3MREA 4MDRA 2VZOA 3MUGB 2JJTC 3DJSA 3OX8B 4CC4C 4L29A 5DRNA 2H32A 4N8PA 4I2XA 1FVEB 1OTUC 4ZFOB 1F1GA 4IDJL 4QNPF 2WWOA 3B56A 2O5ZL 2SODB 4N2BA 3STZB 4GAAA 2FB4L 2CO4A 3MQIA 1T2JA 2R27A 2XG5B 2P46B 3BZEA 3V0VB 4YNYB 2BWDA 5CFHA 1K6QL 2X2IA 4HJEA 4J4PA 4UV4H 1A3RH 4IMLA 5BO1H 1RCYA 1QNZL 4G9DB 2Y07H 3DKHA 4FC3E 3SOTA 1IZJA 2AXHA 2R23A 3CH1A 4X5LA 3DSNB 1KJVA 4UT6H 2X87A 4GP5B 4ZODA 5ACZB 1DSWA 1RIVH 3NUKA 1Q72L 4OW6A 4OKDA 5A3IC 4ODUA 4P5KA 3FU8A 1KCKA 3BZFB 1AS8A 1DFBL 4MLIA 4YEEA 5J13C 1QBLH 3F6JA 4MSWB 4KK9C 3R19A 4J3XA 4B5EA 3ZKMD 3RTQC 3FB8A 1LO0L 2D73A 5TE7H 1DDTA 4F7CB 3ZVVA 1DBKH 2GTWB 3ARGB 4LK4A 2LQRA 2Y69B 3ARXA 4XI5D 1OVZA 1EXGA 1IBYA 1QO3A 2Y4SA 1F00I 3G5WA 4OBSA 4X6DA 4NQEA 3JTBA 4GH7B 5CBEA 1A7QL 2CM5A 5GSVA 3V0AC 3QDJE 1N5YL 5AB2A 5JUEH 5BS0E 5IUCA 4XBMA 3SGKA 1TNMA 1SFHA 2DQCL 3CVIL 3QO1B 5ICUA 1DZ0A 3JWOL 5IOKA 2Z31D 4KMLB 3ZYZA 2IAMD 5A6IA 4RFEA 2OJEB 4J1UB 4TQ8A 3LRGA 1S4IA 2HN7B 2HLFD 1HWHB 2WNWA 3V6ZB 2P5ED 2YD4A 3H4FA 2F5AL 1JYVA 4QUOA 1AHWC 1AZCA 1NMCC 5DUML 5I71B 2Z1KA 4WU5B 5AKSA 1WWWX 4G6JL 4EXPX 2YQGA 5HVGB 3MN8A 4HF5L 4Q56A 3ES6B 3IDGA 3Q43A 3GSVB 3HPJA 2PLTA 1YYML 1MZYA 5I9QB 4NZUH 1OE1A 1DLHA 1QHQA 5L7XH 3KPLB 2WNKA 5KYXB 1XBDA 2FBRA 1HOCB 4IRJD 4PBVC 4D8OA 1PEWA 4PJAB 3TEUA 5EMYA 1SJHB 1NFDB 3GI8L 2AP2A 1LNUB 2XY1A 5CHNB 5C07A 1U58A 5IJVA 2EE9A 1K3ZA 5JW4R 1IAIM 3BP7B 3GEFA 4W81A 4FADA 1T1WB 1BD2A 2VDLH 5FM4A 5L88H 2XKNB 3WJLA 4F7KA 2WXKA 3MRBA 5DJCB 2VLKA 2GJ6E 1ZVYA 1S9KC 1OGPA 2XBDA 4KXAA 1XGRA 3ULSB 5D7JC 5C0JA 1NCWL 3K2UH 3SN6N 4G8GE 4W4OA 4HEMA 3FCGA 2OMXA 4L3EA 3QDGE 5F9WB 3DUSA 4WFHE 2G0KA 4EI6A 5B4MC 2Z91A 1CF8L 2VMEA 3C08H 3LKRB 5G4NA 4JPWL 2P7TB 3IGAB 5FKPB 2OBGA 3WFEH 5B7MA 5AYUH 4RBPK 5CGTA 2XVKA 3DX8B 4Y5YC 3RWGA 4YGAB 4OCXH 2ENYA 3AS0A 5IB4B 3QRGL 3W37A 4E9VA 3LEXA 4U1HA 1HQ4B 4ELMB 1KLUB 3GKWH 2ODHA 1J8HD 4GI9A 4LSTL 4QLWA 2DF3A 1K72A 1LO5A 3TOPA 2NY1D 3S96B 3ZTDC 1D6EA 4QRPA 1SF5A 5D72H 4XPTH 3PLYA 4M5YH 4KKZA 1KGXA 2K4WA 1WWCA 2I5YH 2YN5A 3CMGA 3WFBH 3II1A 4KK5D 2ZOOA 4PUBL 3ZE1F 2BH0A 2COQA 3FK3A 3SDXB 4GXUN 1KJ2B 3VM5A 1DUZA 2C9XA 2OXGB 3A6BH 5DEFB 3T0XA 3H54A 1VCAA 1N70A 2R7EA 4PEEA 4GRLA 4PJXA 4N6QA 1LWHA 4PSRA 3OR6B 4PJCA 1JTPA 3ESMA 1FAIL 4XPAL 5C2BL 3X1EA 3IXTB 5LGYA 5BJTA 5E6IA 1NMAH 4Y8AA 1K3IA 1YNTF 3A67H 2XX1A 5T3XH 4H2AA 4YC2C 2UZXA 4XZUB 2XV3A 3NPZB 5I82A 2CBQA 5FA4B 3RURA 1E4WL 4FD0A 3VXRB 1XSKA 4G42B 2MMXA 2V7HB 2ZOUA 4LRIC 12E8L 4WJKB 4LPUA 1XGZA 5KVDE 4F2MA 2BP3A 1T22B 4P5MB 5EIIG 1YNKL 2AKRB 3IU4L 1S3RA 1V55B 1XGTB 1KG0B 1W8EA 2AGJL 2CPCA 1IKNC 2O1AA 1KYDA 1MCPL 3BWAA 3LOWA 1CTOA 3HS9A 1BMZA 1O7SA 4KJPD 1LTXA 1RZ8A 4M48L 4IHOA 4NM4H 5CCGE 4R90H 4AJWA 2RB8A 5JHAA 1CFBA 2NY0D 2WXQA 3AY2A 4JQVA 1DEEB 2CGRL 2ZE0A 3M6DA 1QFWI 2VXUL 2VSDA 4N90E 4YQXH 4E41D 4Z76A 2E6QA 5GGTL 4AV0A 3D8MA 3QUZA 3D25B 3FUNA 3SY0B 5FDYA 2IF7A 4R7LA 3ZMNA 3D69B 4JHBA 3TVMB 2UZYB 5DJDA 3AG2B 3D9AH 2WTOA 1NFDF 1CDGA 4EBQL 1DUYA 4A6YH 2Y7MA 1W0VA 2XZCL 3PPEA 1U8LA 2AW2A 4AG4L 3ESPA 4NO2B 5HHVL 5GRJH 4YSOA 2P5EE 3IE9A 1T6BX 1UA7A 1RZQA 4RGNC 1GC1C 1UT2A 3PQYA 4OFQA 1QUPA 4HSQA 2OL3L 2NNFA 5IESL 1ODUA 3CQFA 1HYSD 3Q2VA 5ISZB 1MW0A 2F9BT 4P4KB 4AC2A 4B41A 3WELA 3IEAA 1R3IL 3LSOB 3QXUA 2AV7B 2ALAA 4XB8A 5LAXB 3GLEA 4GW4A 3QUXC 3BAKA 3NJKA 1A7OL 2DD8H 4PW3A 1IM9B 5FPIA 5DC9B 2BNQB 5K9KA 1QEWA 2BMKA 3ZE2B 4LVNC 3FULA 2WXFA 2J3SA 3FT0A 3BWUC 3QJXA 3T5WA 1R33A 5J5EA 3LKQA 2MNJB 3V4UH 3QNFA 5AAMC 2Y23A 1CFQB 1OP9A 3FBQA 4A6YA 1OM3L 1F8TH 3VSVA 1HHGA 4R5VA 1WFMA 1UD2A 4JZJA 2VOTA 5K33A 5E1AA 5J6HA 2XVLA 3QIBA 3ZHDA 5EG6C 4BK4A 3KS0H 4Y9CA 5SWZB 5H37H 2OW7A 1QBAA 2EACA 5DJ2B 1IBHA 3NIGB 1NCCL 4PJ9B 1MH5A 1I8KB 3H6JA 3LXBA 3F58H 1NUDA 4R84A 4E9RA 3NJHA 3D39A 2E7MA 2XICA 1UWGH 2A6IB 1II4E 1OCCB 3D3VB 1JXJA 3GMMB 4QHKJ 3ASOB 2EXYD 3H3KA 4HVBA 3MGTA 1FFOA 4X80L 5EUOF 5INDA 4HXBH 5D7IF 5E1HB 1KEGH 4Y7OC 3C5XA 3AY4C 2DM7A 2JLLA 3TA3B 3AT9A 2C4XA 3HHSA 4WENB 4N1HB 2BHUA 2WOBA 4NCDA 1IC1A 2ZQKA 2FR4B 2X05A 1TETL 2ADYA 4TUOA 1TQUA 1NIEA 1KCUH 1YNLH 1CI5A 2ADFH 4KI5F 4WZ9A 4NQVA 5KVEH 1JZ2A 5DK0B 1YEJH 4I77L 4JO8A 3D2UD 4K15A 5A6LA 1MIML 2WXMA 1JL8A 3TBYB 4HUXB 4M7JL 1UWEH 2VDPB 4P3DA 4IOSD 4OV5A 1MRDL 3K0WA 2YPLD 3KLHD 4GAYB 4P2QB 3RPIA 1IU1A 5H37A 3BHBA 3VXOA 3LIZH 3ZO0A 3WEAA 4X8XA 5EC1A 2R0WL 1J0ZA 1G7MB 4H8HA 4O2EB 1KBPA 1UURA 1LJMA 1RZ7L 3K2IA 3E1ZA 4PGEB 3CBRA 2OP4H 1NC4D 4L37A 5F7UA 3P2DA 5I6NA 1M7IB 4I4WB 4YDIH 3E6FA 4YHOH 5JO5A 5L2KB 5DJAA 2XWBB 4OT1H 5BRZD 3VDAA 3C60B 3VSTA 1IQWL 2OS7A 2YGNA 4J3OD 4LLWB 2VC2H 3WNOA 1U8JB 4I18C 1SQ2N 4FQ2L 4XCEA 2BRRH 3LQAL 2TSAA 4JFYA 3QJOA 4O58L 2QFPA 4XNQB 1EEUA 1DJZA 1RJZA 3H4HA 4AMKH 1MJ7H 2EDWA 2XTJB 1QI5A 4XMPH 4MYPA 4ZFQA 1FYTA 2LV4A 2X9YA 1G9MH 2D3JA 5DQ9B 3U7YL 5I18L 4IBWA 4YUEH 1VAHA 2EEFA 2B77A 4P59L 5IVXB 1JF1B 4DP2X 4XBGB 3DPBB 4Z78A 4NKIH 1QBML 4MYWB 1N5AA 1ZTMA 3FKUS 5SWQB 1ACZA 3DIFB 3LIZA 3OBAA 3PWVB 4LEBA 4TVPL 1U6AH 5FYJH 5SWSA 1MLCB 1UOLA 3MA7B 2WYTA 3KH3A 1JUFA 2X4UA 2YA0A 4PP2A 1D6VH 5IEKB 5F6HJ 5DVPA 1G6VK 1MQKL 3P4OB 4XMUA 1MCWM 3FOMB 4E41E 1W6LA 3LDBB 2YXVA 1UGKA 3HCVA 2WKOA 4DGIH 2YD1A 2ZX5A 4HS8H 3OQ3B 5DHXB 1A9VA 2P1YA 3B6SA 3O9WC 1JXKA 3RVTD 3ZE2F 2ICWJ 2V2XA 4YAQB 2EINB 5DJZB 1JGVL 3A4AA 4M4PA 3I3BA 1X3DA 5FFOA 1OAUL 2DQJH 5DRWA 1IBZA 1PZBA 5HJDA 5A43C 4HJ0D 3VFWA 4PGCB 3VU2A 3HS8A 2NW2A 1WJ3A 3X14A 2VLRD 3OKEA 1CZ8L 1JPTH 2DLEA 5ITBH 1A6VL 3PGFH 3VWJD 5I1AB 4G1MA 3SCMD 1RLBA 2HH0L 1OAQH 3X2QB 3LNIA 3BX7C 1XFPA 4N0UB 5EZIL 4GKZB 1OWWA 2IGTA 3LPOA 3CN2A 1D5BB 3P3SA 5DLLA 4AYBA 5EIIA 1UZ6F 1KXQE 3D4GA 4ZXBD 4YXHL 3QZLA 2DTSA 1UM6L 2B1HH 1FL6A 2E9IA 1HL5A 2IMMA 1I9JL 1OAYL 3HNTH 1N3NA 2VT0A 3AUVA 3AXHA 1AS6A 4Z7WF 1L9TA 3ERXA 4PLJC 4HH8A 1HZHL 1IGCH 5EBMB 2RCSH 4KXZH 5KBDA 2W92A 2YXMA 2QPDB 1EZLA 1KGJA 4L5FL 4NO5B 4IEFB 5CXPA 1S7SA 1C08A 4G8EA 3S35X 3QNXA 4W9GC 5AVXB 4MQSB 2F6AA 3DIVA 1DN0A 4Q14A 3EYUL 1W16A 5BZDB 1IIIA 1U3HB 4UTBA 1Q9KB 1A2YA 1D9KC 4DPRA 3ARPA 4KUZH 2X2JA 3HTLX 4QCIA 3RE0A 1XMWA 2XN9B 1OPGL 2B2XL 2HYMA 3BPLC 4DVBB 1D5XA 3EYQC 2A9ML 4UDTA 3PWLA 5IG7B 1YUHB 4AZ8B 3Q3GB 2ILLA 3KVPA 1M71B 1USZA 1OW0C 3X3GH 1OAKL 4A68A 1KFAL 3NK3A 2HFTA 3RB7A 2BWIA 5BRQA 5FGRA 3SQOL 3UG3A 1YMMD 5IK3A 1VERA 4R7NB 3HS0C 4UWQB 3ULUE 2IDUA 3BKCH 3WXVH 1C1EL 2VQ1A 1YEGL 1XH2A 2GB2A 1ACXA 3G6JB 1QHPA 1E42A 3G5XA 1V3MA 3VXTA 4JM4L 5B39A 4WY7H 3CPLA 2YPLE 4BRVA 2FYYB 1HESA 4JFDD 5FYLL 4Z77B 3FFDB 3QG6B 1Q9LA 5JOFB 1L9MA 4N26A 3B7UX 1EZVY 3KYNA 5FYKL 4F8OA 2JKWA 1LEGA 2CKBL 4PRDB 1DQVA 5A6MA 3QIUC 3VAEA 3LS5L 4XO5A 3ZUCA 4UV7L 2YSTA 4NERA 3FU7B 2ROYA 3ZKNC 3L9RB 3PV6B 3Q1SH 1DSYA 3C5SA 4KHTL 1DVFB 3SDYL 5C08B 4BDVA 4DTGL 3P0YH 1C5DA 5KS9F 5AOZA 3WI9A 2EZ0D 1RUMH 4WO0A 2XKSA 1A6TA 4LVOB 1XX9C 5B21A 3BW9A 1O9VA 4ISVA 2X9ZA 2AXFB 4QHNA 4JRXA 1Z9SB 1TTUA 5ICXB 5F8QC 3SDAD 2WIIB 1QW8A 1AS7A 1AE6L 4NAQA 4K8RL 4FLRA 3BP4B 3BYYA 4URTB 4M6ML 3PL6A 4BJLA 1RHFA 2ZXDA 4H5SA 3SE4A 3IETB 1QTPA 1CI3M 3CSFA 3HE6D 4M7ZB 2V8LA 5F3BA 4M29A 3T2LA 3MA9H 4WSGA 4G6KL 3K72B 3LN5B 3P30L 3AJ7A 3QDHA 5CN3A 3OKYA 3BW9B 4GBXA 1GZPB 3MRPA 4NKDB 4MNQA 2YPVL 4D0BA 5I1CH 4JZOA 5EU7C 4MWFB 3UO1H 2PW2A 3WYRA 4UOJA 1RURH 1HIML 2N7SA 2VLMD 3AABA 3O41B 4XVUD 5LKNA 5JLZA 1NUFA 4YE4L 5HHOB 4F27A 4HIPA 1NGYB 5LBSL 5KN5B 4HFWB 4E36A 3MOBL 4NYLB 5CILL 5JNYB 1QR4A 1SGKA 3MRPB 4OF0A 4CGUB 5FO9A 1UT1A 1XB3A 4U3SB 5DWUL 4X4YA 2IQAB 4Y4FB 5J06A 3IAGC 5EWIH 1JHTA 1QKZL 4U7SA 2UXFA 3GMOB 1K9TA 4BYHA 1NAKL 2VO5A 3SKJL 3B9VA 5D93C 4KKAD 1KB9J 2Y7QB 3FT4A 3TBTB 3FRUA 3QCUL 1JWMB 2WW8A 2R1XA 3BLBA 4H0HB 4X9FA 4MD4B 1ZLVH 5TGBB 4G9FB 5AUMA 4AYDC 2JCCF 1NMBL 1RK1A 1QUNA 2VR5A 5IW3A 2FYVA 4PAZA 5E8OA 5IV2B 2KDGA 1PZ5A 3R8BB 5A2KH 1I7TA 3L1EA 4IKKA 2DJ4A 2K45A 3LX9A 4O02L 3K6OA 3BVDB 3L5WB 4JK0D 4B7LA 3L4ZA 4ONOA 5GJSH 1X4YA 1BQLH 3OKDB 5DTFA 3WNLA 3U1QA 5E8PB 4EZKA 1EPFA 3NSFA 5FKAB 1P4LB 2X38A 5DD1H 1HH9B 2VAAB 3HN8A 4J3UA 4LSUH 5LHDA 1A0QL 1J0IA 4L9LB 3MLUL 4MNHA 4NNYA 3TZVB 2X4OB 4HYTB 2XQBL 3PAZA 1IGIL 5CFAA 1PD0A 3QCVH 2N7AA 3QJRB 4S1RH 4C59B 3RB5A 1BPVA 3DV4B 4LIQL 4OGXL 2MTPA 1HEHC 1TFPA 5JPMB 3W56A 1CTMA 4J23A 4LLVA 4Q6IA 1RZJL 4ATWA 2ICES 2RGSA 2E47A 4R4BA 5TFSH 2VR7A 3HZ3A 4OZIE 5JDSA 1PY0A 1A7RH 1YEDB 2ARJQ 3F00A 2F53D 5MEOB 4U0QB 1N8ZA 4N5ED 2FO1A 1UH3A 1JHKH 1OAXH 1P7QA 1TTBA 4FLSA 1BLNA 1SZNA 3SBRA 5ANME 4C55A 3UGXA 4HXAH 4PP1D 2ZOLB 3PHSA 1WFJA 3E38A 4RGMC 1KCLA 3Q6GL 1YMME 4AYMC 3DI3B 2DTMH 2ZD0A 3K91A 4TULL 3U4BL 1N0XH 2Z0BA 5ABAA 5EF2A 1SQMA 2A0LD 3MXVH 3LXAA 4H26A 2ZUUA 3LTVA 4PY7A 2AEWA 4BCZA 3GBDA 3QHZL 4K23H 3U6RA 4H25B 3WL9A 4CMHC 1A6WH 3V5HA 1FCGA 1RZIA 2IDSA 2E76C 3TL5A 1CDYA 4JFDE 5B3SB 1DJIA 1V5JA 1ZE3C 2CO6A 1F11A 3A4EA 4HIXH 5B3NA 4GIAA 3HAEG 3QDJA 2ZG2A 3G3LA 4Y9EA 1EHNA 1VACA 4OM1L 5DYFA 5CCJA 4GW5A 1CU4L 2FL5B 3UTOA 4K3HA 2RR3A 4ZK8A 2NY2B 2QPUA 3IGLA 3EFFA 2H1PH 3KPRD 3CFUA 1QLFB 2YAOA 1HHHA 2QR0B 1GW6A 1U8NA 4AEIL 3EYOB 4WGKA 1P84K 5D1XB 2H2SC 2ZT9C 4JY6B 5CJBA 5I6LA 2A4CA 3GUTA 1QQDB 1VLXA 1SUHA 1DBJL 5ENWB 3SPCA 5CZVL 3OKNA 2MCPH 1ET8A 2EDEA 1UADC 2IG2H 3O6LL 1EHKB 3BGFC 1CR9H 4JL1A 5FDWA 3EO0B 4LLYA 1SDYA 5KYWA 1NC2A 3M7OA 4HAFA 5E2WL 1SBSH 3CVDA 4NQSA 4UOZA 5DK2B 3KCPA 1S7QB 4PRPD 3V79C 4U4IA 4FGMA 1NCHA 3H7LA 2EDDA 2ZOKA 4OJFL 4RMRA 5L2JB 1OGAB 5DQDH 4JE4B 3EG9B 3KPMB 3U7AA 2VL5A 3ML8A 4PD4J 4NN6B 1IB5A 4ALAC 3IDJB 4ZFFB 3REVA 3DVNA 3HR6A 5CBAA 1N9PA 2GJ6A 2VLME 3AU1A 2FT8A 3ME0B 4IJTA 4JHAL 1XCQA 4O00A 3B2VH 3SGEI 1LYQA 2Z0UA 3CN0A 3O3BA 3RGBA 1ETZA 3MGAA 2VKXA 2BXYA 4L8BA 1H15B 4KO5A 2FHBA 5EZOH 3WFCH 2PPEA 3PV7A 4HWBL 1AKJD 5HDQL 2DB8A 3D2TA 4WW1B 1NLDH 1SXBA 5HGAB 2I9LB 4Q9QH 3AFLA 4K7FA 1ZAGA 5K59F 4P99A 4JM0A 3PRZA 1BYOA 4N0CC 4Z7QE 1TEYA 2NY4D 1VADB 2ESVE 3D4ZA 4WQOA 2DY2A 3PFQA 4KNQA 3U2SA 3UGEA 3MU3A 4MJHA 5T3ZD 1FFPB 2J2ZA 1AP2A 4BFBD 2KQNA 4JG1H 3FN3A 4J4PC 5EU3A 5AW2B 1SJEB 3WNJA 3QJHB 2DWSA 3WAKA 3NJIA 4JB9L 3ARGC 3C5JB 5KVDH 1HNGA 3ARFB 4YSCA 2NUPB 4PGBB 3RIAF 1JFQH 1L6XA 3MBXL 2YUXA 2I07B 3TNMA 1R24B 3O8XD 5F9JB 4MZRA 1G7QA 1A6AA 5JIIA 2CWRA 1FZKB 1J1OH 5I66A 4B5ZA 2C3GA 1XCXA 2EDTA 3HZMA 1KTDB 4N2HA 1CL7I 2VERA 1IAKB 3JTTA 1MFAL 1QFWL 2WLIA 1KIQA 4KZ0A 1LWRA 2A83A 4NZ8A 4U05A 1DBBL 2N0MA 3GI9L 4P57A 4LVHB 5IKCA 3CVBA 1MREL 1RJCA 3QEUA 2FATH 4IOFD 4KGJA 4HUVA 4E9YA 5E70A 4HJ1A 3DDFA 4TTDD 4APQD 2F15A 1G7QB 2F53E 4MDJA 3B2UC 1BWWA 1RK0A 1HZLA 1NCGA 4WK4B 2E7BA 3F7QA 4JAMA 4JG9A 4K9EL 4LBEB 1WZLA 1EO7A 4WGVB 4LLMA 1AIFB 2XWTA 4PM1A 5E00A 1Z7JA 4Z0XA 1RPUA 5I9QC 5IZ7A 1NCNA 4LLAA 4A04A 4H8WL 1TVBB 4FG6D 2OJZL 2HRHA 3FONA 1WZ1L 3UAJD 3MJ7A 2NOYA 4JO4H 1I3VA 3FNKA 3T71A 3VFNB 3NH7H 5IR1B 1A3QA 1X5HA 5CEYA 2Q7YB 3RY6A 1EAPB 4AWJC 1AIZA 1FVCB 4N8CL 2BVTA 1I82A 4GAJL 2VZSA 4RCAA 3BIKA 2WUBH 4BQ6A 4C4UA 4BWTA 3BWUF 1ZLDA 1WFUA 4FG0A 3MLZH 1AXSB 1OD9A 1WEJL 2E59A 4FZEL 1T4KA 5IHUL 5DRZB 4HV8A 4HISA 2FWSA 3ETBF 5C09A 2Z31A 3A6CH 4LAQL 2IAMA 2WSPA 4LLQB 4W9DC 5F9WC 3KPRE 1UXSB 5LBGA 1CE1L 5K5YA 1UB5B 3HAEH 4KX7A 1QVOB 3LHAA 2DJSA 5FX3A 2B20A 1AYRA 2WUCL 3I75A 4HULB 5F7HA 3WJLC 3V52H 3NCEB 3R0MA 5EF1A 5F1NA 1TG8A 4Y9FA 5HHQA 1DP0A 5ID0A 4Z9KB 3R06A 5INCA 1T21B 2J8OA 2Y9RT 4BSWB 5IT2L 1UOKA 4F58L 3PHOB 5BVPH 1G9NH 1NBQA 4CVWA 2ITEA 1SVCP 3AC0A 4OCSL 3QA3B 4W4OC 5DSCA 3CMOH 4W4NA 3SPHA 5LNGA 2WXRA 4FQ1H 4TNVF 1AMYA 1B0RA 4IRSD 4WK2B 2PYFB 3B2MA 2AXWA 3VMPA 3QXAB 3QYNA 4X5RA 4IRJA 5HDRA 4PRPE 1A66A 1H6EA 4NP4L 4AQAA 1BVLA 5I5IA 2C5DC 3PJSA 4PJEE 4M7KL 5F1NB 3S3DB 3ARBB 4JKPL 2V6HA 4OZHB 1A1OB 1PLGL 3TS8A 4XP6H 3JSSA 5ADOH 2ADIA 2YQ2A 4XPBH 3ZSTA 4MD5B 1KZYA 4JFZL 4EN3D 3HAEA 3KYKL 2V5SA 2G4EA 1B2WL 3W9EB 3I9IA 1MHPH 4N2CA 1MAKA 2PXYD 4U1IA 4AQZA 3OMAB 4J3OG 4LPTA 1RUPH 3UZQA 3LZFH 4LSVH 1N19A 3BLKA 2G3ZA 4APXB 3H7BA 3MLVH 1TZ8A 3TM6A 2W60A 4EVNA 4GRLC 4HJGB 2FX9L 4ABVA 3IB4A 5HPOA 4CSTA 1OHZA 4ZS6D 5CSGA 2CDEB 2DQUH 2QPEB 1HK6A 2YUWA 4L23A 3MR9B 2F58L 2GK2A 2ZCHH 3FDWA 5AZEH 1IE5A 4U6YB 5E6IC 3EH3B 5BNXD 3NFSH 3RNQB 2EDMA 2EXTA 2CDFA 1L6ZA 5T3ZE 1J8HA 3HNVL 4PJBE 1EJ8A 5IFHL 1F58H 1DVSA 3S6CA 4Y5XA 4M93C 3CVHL 2C9VA 4ATTA 3T4YB 2Q7AA 1FZMA 3AWEA 1HL4A 1R3JA 1XO8A 3NJGA 3VA6A 3BQUD 5I5JA 3LRLA 1U91B 5EDSA 1FIGH 2B0SH 1RULL 4M8QA 4OZGF 1YSOA 1U8KB 1UOWA 2ZXWB 1KENL 1SYSA 2R4RH 1ZT7A 3F12B 5FB8A 5JYMA 5L6YH 4S11A 5MEQB 2AMGA 3B9AA 3DV6B 4BWWA 5FF6A 3QXWA 2A6JB 4X0NA 3BAEL 5J6GB 4DP0X 5FV1L 1MXGA 3S37L 4JQVC 3T0DA 4HDIB 1HL8A 5I8EA 3VI4F 3N43F 1JPGA 1JHLL 2VITA 1BBJB 3ZMEA 3QXTA 4POYA 5B1BB 3QUZC 4Z95H 3HZKB 5AYQA 5KYYA 4PJFE 5F70A 4XO3A 4MAUL 3U2JA 5M7QA 5TPWL 3DLQR 2A1WH 4JDVA 4RA0C 3D6GA 1RIHH 3T3ME 1B4JL 2GFBB 2VN5A 4P4KC 3HBQA 1RZFH 3ATBA 1QLRA 2WCSA 1BLIA 2IALA 3S97C 4DN4H 4HT1L 4NXKA 3VGEA 5CD5C 5IBLD 3N42F 3COOA 1WITA 2WO3B 1WBZB 1W2KT 2A99A 4EO5A 4UM9D 1A9EA 1SEQH 1T2QL 1UCBL 3QZWG 4I0PD 3MUUA 1KDJA 2Q87A 5AVYB 1GZQB 2WZ0A 2W65B 1WBXB 2XV6B 4IMKC 4RH4A 3BFOA 4M6OH 1I7ZB 1KCVH 2O4EA 1XH3A 1CFVH 4FA7B 1N6QH 4GXVL 4E41A 1AO7B 3CFMA 4NUGH 5CZRA 1IBGL 5DURD 3GSOA 4ZNCD 1N7MH 5LO7A 3D18B 4QI3A 3GFUA 4XHJC 2D31A 4WDIA 2NTSP 3L2MA 3ZT7A 3WEXB 3GXMA 2QQKL 5F88A 3D07A 4X2UA 2VW7A 4OZHF 1SYVB 2BS9A 4I48B 3QI9D 4PWGA 3JT2A 4PR5B 4RMQA 4XCCH 4Z8FH 1NKOA 1QEXA 3QQXA 4KVNH 2AQRA 4UQEA 1M42A 3MCG1 4NNXB 2ZCZA 4LFHD 3K71B 1JRHH 1LK2B 4WNJA 2ATPA 4JZJC 2WIMA 5E24E 2J88L 4R9HA 2H9GA 1J5OL 2PO6B 3QIBC 4ZYKB 3QQDB 3QUKB 4J12A 5JORA 2R56H 3QO0A 2Z9TA 1RXLA 3FU0A 4S1SL 1BEXA 3SYQA 3HI5L 3OL2A 1I8IA 3VFTB 5FUCC 2DI7A 4ACTA 1JZ6A 1L7TH 4RQQA 5BMFH 1TZGL 1XR9B 1FNHA 2QQNH 3PP4L 4FMKA 1P1ZA 5B1JA 5DJ0A 2F5BH 3HC4L 4YHYB 1GXEA 2OMWA 4JREC 3CDZA 1F3DH 2MCG1 2EYRA 3PWJB 4M7LL 2DQFB 4OFYD 4ZX4A 3EGDA 1EZUA 1UM5H 2PPFA 5CJOL 4RA3A 3TV3L 5IHZA 2WD0A 3GGWB 2OKMA 1NBYA 4UYQA 5T1KB 4BCYA 4S0TD 3JV6A 1T04A 4PRAA 5E99L 5E9DD 3GS4A 4KRMB 4D8PA 3IXAB 4LDCA 4CVZB 2AJSH 3OAYH 3WU1A 3RWIA 5IIEB 4XX1E 1YC8A 2ALWA 4UIMA 4X7CC 5KYUA 4U6VH 4ZFOL 4LOUC 5B1AB 1DQQB 3K4AA 2CGZA 5DZNA 3UDWA 1TMCB 3VFGL 3X17A 1XSOA 1SEBB 3DYMA 4MJ2A 4D9RD 4JFQA 5HYQA 2UYLB 4U1NB 4ETQA 5GRUH 2P8LB 3ELQA 1E28A 1XIWB 3DRQA 4FTDA 2OTWB 1KIPA 4UM8B 3V0JA 3CXDL 2F54B 2NTFA 4Y19B 4J3OH 1MEXH 3H42H 3KJ4C 4LOFA 2K6WA 2E7LC 1NGQH 1E4XH 1A3LH 1E2ZA 2O26U 4FYSA 2W9DL 3QUML 4JRWA 5A2IH 3DETC 1NL0L 4JRLA 3OKMA 2IMNA 4WFED 1N64L 5SV4A 2VJ0A 4ZPTA 2DMKA 2RH0A 1ZVNA 5DEJA 3UPAA 3D2UA 6PAZA 3ZE0B 2DJUA 1PJ9A 5AQ0A 5F7KC 1CPUA 1TQBB 3NA9L 1H19A 4OF3A 5C0CE 5C9JA 4KQ4H 4ZUTA 2FNWA 2YPLA 2FZ3B 3LN9A 5HYJB 3WIFB 2F7PA 5JXEA 3DX2A 3LDBC 4OQTL 5FA3A 4NO0D 5HHPA 4QHUA 3VWKB 3FXIC 5D1ZB 5I16A 5BQ7A 4BSJA 2PR4L 3UERA 3TH4T 1JNJA 3L5HA 3EDKA 5AW1B 4P5SA 5E4EB 3ABLB 5E4AA 3BDYH 2WQRA 3QQ3B 2Y6SC 5BRZA 2PP8A 3T77A 4PG2A 4AQEA 3VI3E 5C7XH 2XBTA 2WLLA 4FQLL 3WFEL 2NY3B 4Y5VA 2DI9A 4XN7A 1FE8H 1I9IL 3QHFL 8FABB 4FQIL 1JWSA 3L7FA 3LKOB 1J0KA 2YEVB 4XWGL 2KMWA 1WCBA 5CGYD 1A6PA 4FNQA 3IJSA 5F2FA 1PZUB 4KFMA 3UBXG 2D0HA 5CM1A 3V5DA 4XP9H 3HFMH 3BD5A 2Y5EA 3VH8B 4DAGL 1P4IH 3CUPB 1DQJB 1JERA 3F7YA 5F7YC 1QFWM 3NDYE 1S6NA 2A9DA 2K3TA 4NAJA 4KKNA 4Q58C 4HPOH 5ALBL 5AW5B 5KANG 5CF3A 2I60H 3BI9X 3K2MC 4UTAL 3WIIH 3W9DB 1E9PA 3RUGE 3B3BA 3MNWA 1XEUA 2WQAA 4PJGE 2V2TA 3CQQA 1VKXB 3NGBC 1OF0A 3HHMA 3OPZL 3FQUB 5ITFB 2HG5B 2VZTA 3C9NB 3P9MB 2FX7H 4M6NH 1X4ZA 1W8OA 1J9SA 4RAUB 1AC0A 4RMVA 3CVCA 3NCCB 1QASA 3ZYJA 4IW4C 5I1IH 4S1DD 1OL0A 1THAA 1ZANH 2IQ9L 5EBWA 1K4CB 3SE3A 1KN2L 1ZS2A 2EADA 1PZ3A 4NRZA 3CXHK 3QE5A 1JAEA 3GTVA 3B7RL 4NP9A 4ZMWA 4XOEA 2PUQT 1MNUL 2QL1A 4JKMA 2VLRA 4TKWA 4YLQT 2XWDA 3B4NA 2OCCB 5KJRL 4JR9H 4X0KA 4CAGA 3VWJA 3SCMA 1I8UA 1OTTC 1V05A 3DOSB 4IIQA 2W81C 4KZDH 1XGQA 5EORL 2QVTA 5EU6D 4Z3FA 5KSVB 3PJLA 3A21A 3S48A 1YDPB 5D2NA 2BHYA 2RFXA 3VVWA 1IEHA 2OMTB 4TRPL 4FN0A 1P69B 4O2CA 3H9ZA 4Z3IA 4P0DA 4CW1A 4ZXBA 3NCYS 1ILSA 4LHUD 2BIIA 1J0HA 5FV2A 2ZYRA 2DQGL 3P11H 2OMUA 2EDRA 1NANH 4G8FA 5KVFL 2UX6A 3BD3A 3QZWA 1QLEL 4FFYH 4MA8L 4NKOB 5EFIA 5BZWA 4ZX6A 1N0LA 2LU5A 5C0EB 1IO4C 1HHIB 3D85B 3F2LA 5DJ6B 5KZCD 2EVIA 2C3VB 2QELA 2D7MA 4HJJL 5HHNA 4YBQC 4NFDA 1JNHA 5E9DE 3UTPD 5I0VA 5FOBA 1D5ZA 1U8MB 4PCSA 4XVTH 3O0RL 5E51A 4ZTOH 3FQXB 4HLEA 4GRMA 4O5LH 3HMWH 4E9WA 3T0VA 3UEQA 4X9YA 1FJ1B 1T6VN 3NEOA 2H3NA 1P9MA 4KX9A 4TLKA 1P5UA 2IXQB 3QULB 1KZQA 2X4RA 1E6JL 4X83A 1XSIA 5DMIL 2L3BA 4OZIA 4E42A 5IHLB 5HDBB 4HH9B 2X4QA 1ND0A 4G7YL 1WSST 5HSFA 4AYGA 4OJYA 1BX2A 2WVSA 3PXHA 3SJVB 2CD0A 4JY5H 3RU8L 3V0EA 4PJ8D 4U0RC 5ANMA 1DQDH 4KUCD 3SDCB 3DTXA 2AK4B 3TESA 2JI3A 4FFYA 5IB1A 3RA7H 4FULA 1YMMA 4G1EA 1TNNA 1JZ8A 1XQ4A 5EH1A 4WFEE 1M56B 1QA9A 2OA9A 1P4BH 2X1QA 3L5JA 3ZGIA 3D08A 5BXFB 2X28A 3CIQA 3QFJD 4ONGL 2C1PA 2VH5H 3CFCL 2G30A 1HXYA 3V6BR 1UXLA 4GY4A 4PY8J 4C83B 1VEPA 1ZMYA 2VR9A 4HGWA 2ENQA 4Y1AD 4XC1H 1TTRA 5HI4C 4HD9A 1K5NA 5DMJB 5J56B 3SE4C 1XGYL 1TEGA 1S8DB 3MRJB 1ZXKA 4MCZA 1I7UA 4P2RD 3VFSA 4TSBH 3VXSB 4G3YH 1HINH 3MOQA 4R83A 4GBXC 3RL1B 4GMTH 1BVNP 2DQTH 1TQSA 4MRBA 4F80A 2X6VA 2CMRH 4GRWH 5H4YA 4Y4FC 4HZAA 1T6WA 2J71A 3NCWA 4R2GB 5EO9B 1AJ7H 1NJ9B 3QP3A 4M7LT 1MCFA 4LL4A 3O2WH 3ABKB 1FL3B 3T0AA 1RZKL 3QPQD 4Q0XH 5AL0A 1UZ8A 1AZZC 2OX5A 4LO9A 1M1SA 3QNYB 4FI8A 2DIEA 1H3GA 5JTWA 3T0EB 5EBLB 3V5KB 3S35L 1X44A 3SDAA 4AYFB 3LN4A 2G3NA 2GUOA 2XY2A 2NZIA 5GRVK 1G9HA 1SXNA 3V4VL 3TO4A 3IFPA 5DA4A 3O2DL 3HE6A 3NACH 5EUOE 5EEXA 4P23D 5J3HD 4YPGA 4YSUA 4LOEA 3DO4A 3UYPB 4F57L 3QZMA 5HI3C 3DRTA 1J12A 2FWLB 2B8OT 2E6JA 1RHHB 1U8HB 3HBZA 3OKLB 4LRNL 1OCWL 3FC8A 3T65A 4L9LC 4Z7VB 4HWEL 1BQKA 2JSFA 2WAQA 4EKXA 2XWRA 3BEVA 3O45A 1CDBA 1KNOA 4UCFA 2VMFA 4YK4C 4FZ8H 2E74C 3LV3A 2CZNA 2VSMB 3BSZL 2BK8A 3GBLA 3FS9A 4G2AA 3SDDB 4JO1H 4BA0A 2ZCLH 5FECB 5IVNA 1QBBA 2YAMA 3UH8A 2F19L 1CD9B 5E6RB 2ZNXA 3WG7B 1WP6A 3RJOA 3VFPB 4LCCB 4YLCA 4FQHB 3U9UA 2XQ0A 4PCTA 3WHXA 3CTTA 1AMXA 2AJVL 3O4LB 4LGRB 4MA1B 4S1QH 4X6DF 4QXGL 3FTZA 1CL7L 3CWGA 2ZPKL 4I87A 1YEEH 4XPFH 4KMQA 2CR6A 5ESVB 4AGMA 3CHPA 4OBRA 1HCZA 4Q6IC 3LH8A 3US1A 1BA9A 2VDQL 5F7EH 3IVKA 4DH2A 1T0NB 4JFEE 3F5WA 4HIEA 3VGAB 3KL0A 2YBGA 4FDWA 5F0JB 1MUJB 4AVKA 4HQQL 1OAZH 1ERNA 2YXFA 1OLLA 1RJLA 5IFJB 1SLWA 5GXBB 1T4WA 3FT9A 1GAFL 5C0GA 3FO0L 1FNSH 4PRNA 3EOYG 3O6KL 4HEPG 1S7UA 3IAPA 1EXUA 4KTEL 2OMYA 3UTPE 1G7JB 4KO7A 4RIRA 2O61B 2X89D 1F3JA 1E7UA 1H6FA 2BSCA 2A6KA 4B9CA 1J8KA 3JXAA 2DWEB 2NYYC 5IFAL 4L1SA 4O4YL 2CRMA 1S78C 4FERA 4R97C 1X9QA 4LF3B 2HLAB 1X6LA 3WIAA 3ULVC 3ARSA 2H8PB 4LSPL 1BZEA 1AQMA 4KKPA 4BXSV 2W07B 1MW3A 2CIKA 2F53A 4FFVD 3T8XB 2I32A 3ALPA 1BFTA 4PN6A 4U1MA 3S4SG 4YFEA 3QH3A 1FL5B 5DEGA 1PX3A 5EU5B 2BOBA 4IU2A 1YPZE 1HI6B 2HFEA 3GSXA 3PP3H 1MDAA 2G9KA 4Y2DB 1OD7A 2VDRL 1X5IA 2X1OA 3CV5A 4FQQA 4M3KB 4V33A 4BKTC 1DQLH 1P84J 3JZ7A 4NGHL 4QIRA 2ZKHL 3FN0L 3VFOA 4XCFH 2FEDD 1KXVC 1ML0A 3ZRFC 3DO7A 5IMKA 2ZXEB 2L04A 3IJHA 3PDDA 2XA3A 3GM8A 4ZRGA 4Y1AE 2WJ7A 1IBDA 3ECVA 3W0WB 4FEMA 1NAMH 4LSQH 4KK9D 4XX1G 3VO0A 4Z7WE 2NY6C 2CU9A 3E8VA 3L48A 4P2RE 3NQKA 4U31A 4NRYB 1UD4A 2XV0A 1XGPA 4L4VB 4TQEL 2QMKA 5C0BB 1LP9E 4KZEH 3DO7B 5FUOL 3KPRA 3RWEB 4CMMB 3ZDYE 4JE0A 3X11B 4DQAA 5JHLH 1R17A 3FMGL 4DK6A 1MSPA 5JW5B 2DYRB 1JDDA 4JM2A 3MRDB 5KVMC 3GSNH 1AR1C 4PJXF 1HZKA 1HKLH 4DKFH 1CXKA 4XCNA 4DF9A 1UYWL 4PJCF 4OAWB 1MFBL 2EIMB 2R1YB 3FUIA 5AZ2H 3BKYL 4N2DA 4KJQD 1X5JA 3P4NB 3TT1H 2IPUG 3HLAB 1CICB 3GHEH 2HTLC 2RQEA 4PJEA 1NAMA 4JM2B 1HEZA 2QSVA 3ARFC 1M05B 2CBMA 3C09C 4AEEA 5T3ZH 1TIUA 4XP5H 2GW5A 1Q0XL 2X9XA 1NGWA 5E0FA 2AAAA 4N2IA 2W9EH 3KPSD 2DWDB 2KH2B 3DDGA 3GYRA 5JHLA 5DI8A 2ZP0T 5GS1A 5EEUA 4ODSL 4PS7A 3B8SA 4ILDA 2CAKA 5HHME 2BY0A 4MHHG 3BC9A 4RZCB 2VXVL 4MMZA 3QORB 4F91B 1R75A 1R4XA 3I9GL 3SBQA 3IFOA 4OKVA 2WGXA 5DK3A 2OMVA 3MXWH 4KKLC 2J12B 1GYUA 1A7PH 1G4MA 3FPXA 3CXFA 3QJQB 3VXMB 3IFNL 1I8AA 1JIBA 2AXGA 3FL7A 1TQVA 3FTSA 1ASOA 1ZOXA 2MFNA 1T1ZA 3VYPA 4R3SA 3GS0A 1A1MA 3CFBB 2YLHA 4XO8A 1A6ZA 1YEFH 4PJBA 2F1EA 3CFKA 1QWNA 4P06A 4NO3A 3GJFB 1T66C 4AITA 4BA8A 2IGFL 3TWCH 1I31A 2AQQA 3T09A 1H3XA 1FO0B 2F68X 3F7RA 3WEBA 4PPTA 3TYFA 4PV9B 3X12A 2CLVA 3VGBA 2AQPA 2H47C 3V4PH 1ZA6B 1TZIA 2Y22A 4UILH 2JI2A 1LDSA 3O8XA 4CSSA 5FO8A 1IAIH 2GIMA 2QGEA 1QRND 3BZ5A 4NQXB 3MLYH 4PCKA 3UABA 3WOVA 1EHLH 4GQ9L 4KTYA 4XPGL 3MJ8A 5TH2B 3RY6C 4LCWB 2Y2WA 2YJLA 5KSAD 1Q0YH 4IBUA 3SY6A 1R3LB 2H0JA 3UTQA 2AQTA 1NUGA 4XI5C 1WPCA 3UP6A 4BFIA 4HWZA 2HFFB 3HUJB 2Q8BH 4APQA 2HT4D 4RDBA 4OQ1A 2XZQL 1BG9A 4MMYB 5IB2A 4UT9H 4PJFA 4QR7A 1BOGA 3H9SA 2R29L 2WINA 3TXAA 4OSUH 4PS4H 3N40P 4F1ZA 2GTZA 3VQ2C 2Z31C 2FWOA 2EDJA 5D7LB 3HG1D 2NXYD 3H1ZA 4KFZC 1MWAH 4YHPB 4IHBA 3MJ9L 2H5UA 2HLFC 2DQEL 3I50L 2OK0L 3V4PA 3UAJA 5D1ZI 2OR9H 1FLRH 5HY9B 3L54A 3QDMB 4EKJA 3NCJH 2QPSA 2APXA 2R1WB 5KYNA 1E67A 1X6NA 4LGPB 2WXOA 1MW2A 3KR3L 2E6PA 3KJ6H 3POHA 5CR1A 2X70A 3DVGB 3EFOA 2EUWA 2EO7A 4G7SB 3H2PA 3CSGA 5CP3H 3WN6A 3ALXA 4IRJC 5F7NC 4I88A 4R4FL 1NSNL 4LCVA 2YBRA 1LO4L 5JW3L 1BFSA 1Z9OA 3WTSA 3GJFK 4PIRF 4AIOA 1TU2B 4Y8DC 1J5DA 3DHUA 2K4AA 3T8MA 2J57A 4KVCH 1KTLA 1JZEA 2VN3A 5LB1A 3WUWB 4QOKE 5DFAA 5CLZA 4GXUM 3VXPB 1DCEA 3GXTA 5EUKB 1INDL 1UFGA 4F5CE 1MWAA 3CAFA 3O2VL 1FA4A 4FXKA 4WUUD 4IBVA 1MY7A 3TPKA 5AWNH 5JMOC 2G5BB 1BZ8A 4WFFD 3MHZA 1JNNH 3NFPA 1U8QB 3S4SA 1F18A 3HZYA 4ABWA 1OQXA 4O51B 5F44A 4ZD3L 3HE7D 3R18A 1L9PA 1G9NC 2P5WD 3I85A 1J1PL 4IRSA 5CWSA 5GSRA 4N0YL 2CSPA 2XN1A 1FPTL 1FFNB 3VGDA 4PJDE 3LHPL 3T04D 1A25A 1VGEL 4RGND 3F8UB 3FO9A 3IMVA 2YRPA 2EIJB 5CP3A 5LGHH 1E8YA 2VUOA 4ZNEE 5GJTH 3C6LB 4BHUA 4A2EA 5TTRA 3QUXD 3B5GA 3DHPA 3KPSE 1F1DA 2JIXD 4K9JA 4EN3A 1RZGB 2NY1C 2ZUQC 4WWID 4LEXH 1NFIA 3SPVB 3KGTA 5DJ8A 5IJCC 4UDUA 1JNLL 3HR5B 3PWPE 1H9DA 2EO1A 1XR8A 4Q6YA 5JQ6H 2PXYA 3ATDA 3UJJL 4Z7NE 1CUOA 4KK5C 1KEMH 3CLEL 2J5LB 4ZTPL 2ATAA 5GS0D 1JGUH 3KXFB 3HBGA 3UIZA 3O3AA 4LSSH 3UC0L 3MRFB 3GF8A 4NM8H 3NCYP 4HIIA 4JG5A 4DVRH 4XNMA 3VG9C 1HH6B 1R5VA 4LU5H 2P49B 1CLOL 2QKIA 4XP4H 2WKOF 1OARH 4QRTB 4FP8H 2ZAIA 5H2BA 1EHXA 2HX9A 1AFVL 1IL1A 2LOEA 1OZTG 2VUKA 3L5XH 2VXQA 3DROA 3IDIB 3IJYB 3L3JA 3OGOE 4G70B 5DFVD 3S8FB 4P2OB 2EDNA 3GQFA 4WCYL 1KPRB 5EIVA 3DJRA 1MLBA 4LLDA 4QF1A 5J57B 3BH9B 1A22B 2QADB 2OCJA 4PB0H 3GS7A 2FIKA 2Z7ZA 4PFEA 4PJHA 1HHJB 2XWZA 1GYCA 3FFCB 3TNNA 2NUTA 3QXVA 2Q2EB 4GSXA 4DGYL 4XP1H 5D71H 3QVAA 2UZIH 5KG9A 4E9QA 1C16A 1QRNE 2VDMH 4MNGE 4WVRA 2J56A 2J1WA 2CLRB 3DK0A 4KJPC 4V1DB 2ENSA 2Z65C 4M4RB 2QT6A 2Z64C 3D48R 5BZXA 1RU9H 2NY0C 4BM7A 2LABA 5AOIA 1VEOA 4ZS7H 2A9AA 3INUH 3UTSB 4WU7A 4XHQA 2AK1H 4JGUA 2X6BA 5DT1L 1R3KA 4PJHB 3WO3B 2Z7UA 5DZLA 2OZNA 1AGCA 3LEYH 3F01A 3QS3A 4HGMA 4B9PA 4LPCA 1S9YB 4L0ZA 4CVXB 1A7BA 3L9BA 5C71A 5EA0H 2X3CA 1ZEAH 3PXLA 1R5WA 3E7JA 2X44D 3DX7B 1I1FB 3TTYA 4ICXA 4OJDH 3MV8D 3GB7A 4K94H 4JQIH 3UCQA 2BZDA 3HG1E 1X7QB 4Y4HA 4F24A 1XV8A 1AZVA 4LHUG 2EH7L 3TLRA 3WBDA 2YMOA 3UZVA 2KZKA 4UM9A 3OKKB 3BP6B 5AKVA 1TLKA 2B1OA 3RUGA 4I0PA 4JX0A 2A6DA 4UB0H 4PRHD 2LHAA 2WBJD 3MBWB 5HJ3A 4K3DL 1HYSC 1FH2A 1I9RL 1SNRA 3HB3D 4WJ5B 4RAVA 1RPKA 2BINA 4PJIE 1I1AB 5CP7A 2Y7LA 5GGVY 1BAFH 2MPVA 3DUUB 3FCSB 3G04A 5FK9A 5B1JC 1F1AA 2A2QT 3T6QC 3BOVA 3DBXA 1SLVA 3MOAL 4IBLT 4ZQKB 3L3DA 4AJVA 4F8TA 3B3IB 5B38B 5I1DA 1W72B 5IMOA 3QSKB 2OXHA 4XMKL 5C0AD 1KCRL 3QI9A 5I6XC 4NQTA 2N0KA 1OOAA 2EVJA 2D7OA 1Y0LB 2ZXAA 3RZCB 2DMHA 4ZW5A 4C56D 3VG0L 1OB1B 3N04A 2WTRA 3LPFA 4JQIA 9PCYA 2BDNL 2ITCB 1ORQB 25C8L 2FBJH 4F15C 4WUUE 3N9GH 3O9WD 5EC2A 1URLA 4RISH 2JB5H 4WFFE 3GNML 1F90L 1S9XB 2C7UB 5E03A 1JXFA 1I1YB 1QOKA 1ZT1B 1BQHA 4HU8A 2BOCA 2V9QA 2OMBA 2XIIA 5D5MA 2P5WE 2O5ZH 3NESA 4ODXB 5HGHA 1VHPA 4N85A 3GRGA 4JRYB 4HX1A 2A74B 3L4CA 3LVEA 2BZCA 5DR5H 3M86A 3K74B 3K5RA 3GEWB 3GMNB 2AJXH 1L5GB 1HL9A 4RGNE 5DS8B 2RJMA 4KPHH 2WNXA 4U6XB 4R96A 1RK7A 4KTDL 4OFYA 3C12A 1FQ9C 2YOCA 3FAWA 1QNZH 1NIAA 1JWUB 4YGVA 3S8GB 3HPLB 5E9DA 4KHXL 4XNUL 1NQBA 3KL3A 5BVJA 4J8RB 3CHXA 3NJMA 2CKNA 2WMPA 4XCYB 1KTKE 3BGAA 2BIMA 1QR1B 1PG7L 4S2SA 3HJEA 5F0LB 1KJMA 5BS0B 4NSKA 3KLHC 1INEL 4AQ1A 2O6DA 1R9FA 5JXEC 3O6FD 1PQZB 2XA8H 1LO0H 1AZBA 3ZDXB 2EEBA 1I8MB 3L81A 4FQCL 3VD0A 4L8CA 1KMGA 3RNKA 1OT1A 4UNVA 1KGYE 3US9A 4TXVB 5AVVB 4CL7A 2UVFA 3BXNA 2IH3A 3BUDA 4MD0A 3TJHC 2PP9A 2HX7A 4PG2C 5DVMA 5G2NA 5C2UB 5LDSA 1YZZA 1J9RA 3QGVA 4JPVL 3TN0B 5LDUA 3BD4A 3L2LA 4J3OC 1FFQA 1LGVA 3FJTA 4X5WB 3PHAA 3MRCA 2B39A 4Y5VC 2WLJA 1JF6A 1WZKA 3P02A 1TF4A 5IROD 2GCYA 1ZGLB 1FZOB 1A4AA 2QJDA 3L3GB 4L4TD 2ZG1A 1BFVL 3G5ZA 1IGML 3AREB 3CFQA 4U3CA 3DXAD 2GSGA 4R7DB 5DHMC 4EZLA 2X2HA 3JV0A 1KLGA 3VJ6A 3X1BA 2BSSA 4NNPH 2G4GA 3KLDA 5FGCE 3UPCA 5I17B 4NO0A 3RPBA 3LKNB 1PY9A 1GGIL 4OLYL 3T3PB 4X6FA 3ABMB 4M6AA 4S10A 2I69A 1CD1B 1ID5I 3LRSB 1YN6B 2DQIL 3M1BA 2UXGA 3GO1L 2VISB 4QLRA 1KPUB 2Z93B 3STLA 5IB3B 1TXKA 1YC7A 3CZFA 1D7BA 4X98A 4FXGB 5DRXA 4L3AA 3OHXB 2IDTA 4ODHL 3RX8A 2GBUA 4KJWC 1M3JA 3RY4A 4CRPA 4WHTB 2VR6A 5BUGA 3JWDH 4W6WB 4G8GB 3EJQA 4OD3H 1IGTB 3F85A 3Q48A 3QDGB 3OSVA 4GI6A 3QIUD 3QXDA 1CDCA 1QSFD 3AADB 4PWHA 2FK9A 3EH5B 4A7TA 5E2TH 3RVTC 2Y1YA 3KLSA 3ZKND 3CN1A 4ZPVA 1RMFH 5KUKA 3B8YA 2F2HA 4W6YB 3SE3C 1TJHH 3CXHJ 1XL6A 3ORJA 5DRXB 4HJ0C 3MV7B 3TCLA 3RFZB 1R46A 2BIOA 2NXZB 1Q9WB 3D4YA 1NCWH 1FVDA 1C5CL 2Z92A 5JA8B 1XMEB 3LYRA 1NPJA 5T1DL 5J4MA 4IIQC 4NN7C 2G60L 2YEZB 1NBZB 1CF8H 4CU6A 5TE6L 4F9PA 3FUFA 4PRHE 4NT6A 4UQBA 1S9WA 3ARZA 4LQFL 5D2NC 5CR8A 3I02B 1AVAA 2JXMB 2EABA 3H3PH 3IPBA 3LXUX 4PJ5D 4ZXBC 1KC5L 5FO7B 3LKPB 3RWDA 4HETA 1ZPUA 2LW3A 1URIA 3UAFA 4ZMPA 5DO8A 5I73B 3CG8A 1DN2A 1Y18B 1X5ZA 1M6OA 4LSTH 1KLFA 3GXDA 4OZGE 4AM0A 2W59A 4HZLB 4PTUA 5C0AE 4TUJB 1W0WA 3APFA 3BH8B 3QR2A 1DQKA 5JHDE 2I9TA 2DDQL 4PTTB 2YD0A 5I15H 3RIFF 3PIQB 4BZ1H 1GW0A 3OXRA 1S7XA 4IBTA 5F7DB 1G6RB 1XF4B 1AQDB 2JB6A 3I3DA 2IFFL 3GMQB 3RWCA 4UQ3A 2FWUA 1TTCA 5EU6A 5KJ4A 3SDCC 1S7RA 4J3VA 4R26L 2WHVA 2VIRB 3BPOB 3GMPA 1P9MC 1O6TA 1G7IB 2XG4A 1P5UC 2LLGA 1MCCA 1BZDA 4AVIA 4XBPA 1NGZA 2QKSA 3WKML 2UY7B 5E5MB 1E40A 2BNRD 2X4NB 1S7VA 5MEPB 4LHUA 4U1GB 3T8VA 1Z3GL 4NRXB 4LHQB 5IEHB 4GKNA 1A1NA 2QMJA 4HBCL 1L9OA 1AD0B 3FQTA 4JG0H 3FTGB 3BP5A 4P5RA 3HFFA 2EYSB 5F6IC 3T4AB 1MVUB 2GEQA 4HKXA 4Z7UB 3MRNA 1VF5C 4JVUA 3EW3B 1N4XL 1ONQA 8PAZA 4ENZA 4NEHB 3EO9L 5BV7B 2CHNA 2ITDB 3CJJA 4BFKA 2YPKA 2C1OB 3AAZB 4BZ1A 1UC6A 2QFRA 3QAZB 3U6XS 1JK9A 4WI7A 4ANXA 3GMRA 1J87A 4HK0B 4P4RB 8CGTA 4RZKA 4NHCH 4LASH 3L45A 3F83A 3PGCA 4J6RL 5CJQL 3UPRB 3MNZB 4JQXA 1QYGH 2QVMA 3QR1A 4RGOH 5J0BA 3DGCR 5I76B 5LQBL 1KB5L 3NIDF 1EZSA 4W9JC 4QJ5B 1XWVA 1P5VA 2J8UE 1H6UA 3T0EC 2EC9T 2WXPA 3O3DA 4PJ8A 4H1LB 4JZNA 4K55A 5F96L 4ZFZA 2JTYA 4P8QA 5E1GA 5FW7A 4J27A 3L95B 1NLBL 3OLGA 4X8GA 5F8RC 3BUYA 1PNDA 1YPZA 3SPIA 3MTRA 2IWEA 1G7PA 1PKQA 2N56A 4L4TE 2PYED 4IU3A 5KW9L 4N87A 3LQZB 3CZEA 4AG4H 1CFTA 3WN5A 1G1YA 3Q9QA 5SX4H 1G0XA 2JVUA 3QFJA 4IDLA 4OY9A 1YJDH 2XZZA 4OLUL 4TLUA 1ZV9A 4TNWF 3SDAC 4BH7B 4YDLB 4GG8B 1UXWA 4HKJB 2DKMA 5T8IA 4Y1AA 5KVGE 3O81A 5AB1A 2BY2A 3TO4C 3HEIB 4OFVA 5KBKA 2R2HA 3HE6C 4LSRH 3Q06A 3VTTA 4Q9RH 1FCCA 1MRFL 4IK7A 4I3RL 4P2RA 3KDMA 2NY5L 5I1EL 4YHIB 1ZVSB 1C8QA 2JK5A 1CFNB 3MDJA 1YQVL 3L4WA 3OAWA 4RWYL 2GI7A 1JG9A 2E8YA 2FCBA 2BVQB 3NMEA 4JY4B 4OD1L 1BP3B 1ZLUK 3L7EA 2XHNA 5HVHB 4JW3A 4P9HL 4YJZL 4XVUC 1K4DB 3PE9A 3GMLB 3EJZD 3VNZA 3ZL1A 2FO4B 4DZBA 1YAIA 3ZN6A 1FV1B 4QTHA 4ZJ9A 2ZJSL 2G75B 2YQ3A 2FTAA 3BJLA 3U1SL 1LE5A 4KKAC 4HPHA 3T2NL 3GZKA 4OGZA 3PNRB 3ROOB 2X0WA 2W94A 3OXSA 4NAMA 4H2CA 5ADPH 4NQUA 1XBRA 2ID5A 1OP5K 2KZ1B 3QUYB 1FG2B 3JV4B 1IEBB 2Q3ZA 1NDGA 4DHLA 4PJ5E 4E9LA 3EXJA 5EOQH 4DUXA 4F3FA 3GSQB 1XDTT 2MQGA 3MLSL 3V55A 2ORBL 5LLIC 4KZCA 5A2LH 1G87A 2OL3B 4Y4KD 3TC9A 1TETH 2P42B 1EGJH 4QHMA 2BWQA 2EIZB 3G5VA 3IWVA 4HA1A 5FWQA 4CN1A 4WI0A 2FBOJ 35C8L 2GIYA 5EU7E 1IC4L 3S5LG 3OC8A 4N0RA 3EADA 4FLHA 4X4XA 5GRXG 3SO3C 4PI0A 4BFGA 4D0CB 2YD6A 3EJSA 2G0LA 2FGZA 5MI0C 2XXMB 4G6AC 1CG9A 5KSBA 2TAAA 3MJGX 1TTFA 3L1OH 3MRLA 1LXMA 1G94A 1JN6B 3QARA 2WCPA 1JBJA 3MO1A 1GGBH 2IDCA 4DP8X 2BLFA 4F7EA 3QPKA 1E27A 4KXZI 4OFKA 3A47A 3BCDA 4IIZA 3WTXA 1I75A 1SF3A 2FGWL 5EZJB 4GFTB 4EQ2A 5A2BA 1WTLA 1NGPL 1A02N 4HCRH 2HJFA 3S3JA 2JCWA 3FF8A 4YHNB 5ESQB 2SEBB 3DSFH 5DLML 2NW3B 3V6FB 3LQAH 4FI6A 5MERA 2EIBA 1IGJB 2BNUB 1EO8H 4N0CD 1F4HA 4Z5RA 4XTRD 2HUEA 5GPRA 2HG0A 3CLWA 3KWVA 5DD5H 1EGJA 3OZ9H 3MZGB 1LM8V 5I18H 2EEXA 5FFGA 4P59H 2X89A 3IKCA 4YHZL 5LWYH 1YMHA 3UJIL 1CXFA 2A0LC 2V3FA 1P2CB 3ARGD 1JYXA 4GG6E 4FQJL 2FSEB 3D5OF 2KBGA 2GT9B 1BDYA 3CDFA 5JXAL 5J1AB 4R7VA 1MQ8A 2WZ5A 2BSRA 4ONFH 2JQAA 5JOPD 3P9LB 5C0IB 1MQKH 1MHHA 4H13C 1IT9L 4XVSL 2XWEA 4QYOB 1PDKA 3OWRA 5GZND 1UB6B 3SOBH 1JGLH 1P4UA 1TR7A 1T0MB 1RERA 1O5DT 4GAGH 43CAB 1LQSR 3JQOB 4WAFA 3L4XA 2PYEE 3U48A 1INQB 1J18A 1Q0EA 4ZUWA 1BGXL 5BUAA 4YDVA 4JM2C 3IGFA 5EHFA 2R2BA 2EDKA 4ALAL 2AJ3B 4WWKB 4N2FA 3U0PB 2MJWA 4ABUA 3M45A 3OAZK 1A6VH 4XN2A 3SKOA 5DEZA 1VFAB 2XFXA 3R4RA 3L17A 3V9FA 4NQDB 3QQNA 2ZWKA 4RRPM 5EZLA 4E0RA 5DD0L 5AKRA 4NC1C 4H4NA 3ZZLA 5KJ7E 5HGDB 1VGKB 4N0FB 2FH8A 4Z7AA 3CX5K 4X7SH 2HVJA 3APCA 2FLRT 2YHGA 1M2VA 1X5AA 3IF1B 1YYLL 2BSTA 2H26A 2ICEA 2DL2A 5E08L 4GKSB 1NCAL 5D96B 3ILPB 5E0QA 2YSSB 4WO4A 1TPXB 2XC8A 5HGGS 3RVVD 4F5CA 2H1LM 4LARH 2VLJE 1NEUA 3O3EB 2QEJA 3BO8B 5GS1C 3QZPA 1RVFH 4OF8A 4RMTA 1FN4B 3CFDB 2E86A 4MMZC 3N44F 5F9OH 3L3OB 1BF8A 5GISL 4DN3L 1QHOA 1SN2A 2E4TA 1XZ0A 3VD3A 4OIIH 3UBFA 3EYSH 3HKFA 3MLPA 4DJMA 2WP3O 2FNBA 3DX6B 5IW6A 4NN5B 4NZDA 1OTSC 4R7XA 3SBPA 4DO6A 4Q97A 5IM7A 1MFUA 5B8CB 3KL5A 1X9RA 1OPGH 2O5XL 4X6CA 3UG5A 3TEWA 3EOBB 2KLTA 2NY4C 4ZNEA 4HUKB 5FW6A 4HS3A 3RG1C 3VRJA 3VD2A 4ODTL 2UX7A 3D12B 4HHAB 1N8OE 1HHKA 2VWEC 3E6HA 5EDXA 4DFHA 3ZW3A 1OAKH 3Q8BA 5I75B 2LE9A 3EGXA 4E5XG 3SQOH 1AC6A 2ATKA 3M17A 1RY7B 3JVFC 1IQDB 4M1CC 3CIAA 3CDGB 5JPNA 1C1EH 5I1GH 1IZKA 1NC4B 4PMEA 4DGUA 2E27H 5CD3B 3ROLB 5LGJB 3SB3A 2BY1A 3FRPG 2YAHA 5H35A 2OMZB 5KSUB 3O8XC 4LKXA 2DQ6A 1LO2H 2Y07L 2ZF8A 3TH3T 4OV6F 5JMRA 5HVWA 1FYHB 2GBAA 3FH5A 4EF3A 4UT6L 1CMOA 7PCYA 1UACH 2IGLA 3D05A 3ZKXC 3ZBMA 2HAZA 2V3DA 2EEAA 2IANB 2EICA 5D9SB 4ORGA 1BVKA 3IS1X 1QBLL 2B4CC 1KBGH 4L8DB 4NOBA 4IOFC 5SX5K 3BAYA 2GPZA 3MV01 4TTDC 4M61B 4APQC 3VXRD 1UVQA 1DBKL 3KGUA 3QNZB 4PGZA 5KBMA 1ETJA 2WVVA 3MX0A 3CHQA 2OQJB 3RJQB 4M3HA 4RFNB 3S34H 3RDTB 5D6CB 1AGBA 2V7NA 3SODB 1QATA 3GXUB 3VD1A 4ZUSA 1ZHBB 5AFAA 2F7RA 4XN1A 5M94B 2F08A 1EJFA 4FG6C 1KYFA 4DP1X 1UUNA 3TWYA 1QRNA 2Z6FA 3FQNA 4MNGA 3UAJC 4IYKA 3H0TB 1PMYA 4JFOA 1C5BH 1VZGA 5KSAA 2VZ1A 4EI5B 3ILQC 4I3SH 1OXYA 1FHGA 4Q52A 4LLUA 3VXQB 5LN8A 5JIPA 2XQYG 3I6KB 1KULA 4MA3A 5B22A 2EE2A 5JOPE 3TVMD 4GJTB 2BPBA 4YBHA 2WZ6A 3W3BA 2VL4A 2X6UA 4OM0H 1XGUA 1E3ZA 3ARQA 3U4KA 4NZUL 5L7XL 1N59B 4GNKB 1E7VA 4X4KA 3P77B 4NENB 3RTLA 3HG1A 4HPYH 1J0JA 1WBYB 5LBSH 5LCVH 4CN6A 2CKBB 1LMIA 2ED7A 3OGCA 1A4KA 4YBLC 1CLCA 3KBPA 4MKMA 2V17L 2VMCA 5DWUH 4FXKC 3KWUA 5AW3B 4QY8A 1HEJC 4P4KD 3AG4B 3E3QC 1H3UA 5KUMA 5J7CC 5L88L 1WFTA 4PJIA 1JD7A 1LK3H 1SM3H 4OF7A 1EXHA 2AVGA 2G2RA 2JJWA 4IRSC 3FF7A 1GC1H 2XN0A 1NMBH 1RIUL 2WXLA 2Z4QB 1IM9D 3AROA 4WIQA 2VSKB 2WWMD 3MLTB 3QJTB 2BNQD 3K2UL 4PJAE 4RAHA 1HXMB 3RBSA 1UATA 2VW4A 1JCKA 1K8IA 5JW4Q 2X4SA 3R1GH 2J5LC 2G9HA 3ARDB 1BJMA 4NI6A 1YECH 2H3XC 1H6TA 3C08L 3FUHA 3EBAA 3MRKB 1IJ9A 3P4MB 2PCFB 3UJTL 1MCIA 4K3EH 4WI6A 3VRIA 1KGUA 1DJHA 3NEEA 1IGFH 2AEOA 4GSDH 3QEQB 3G6AB 4ZSOA 5AYUL 1FNLA 5LBSA 4EN3C 5SWZD 1H8SA 5LCVA 4WUUA 3GK8H 4D9LH 2X4PB 5A7EA 5GS0H 5KEZA 2PXYC 4PJ9D 1IGIH 3GKWL 3AGVA 3WY3A 1NEZA 1WISA 1ORSB 3HJ0A 1M9SA 2ADGA 3HE7A 4LIQH 4RMUA 3P1VA 4UQ2A 3VXNB 4ELKB 3O11A 4DZ8A 5D72L 2HJKB 4EZJA 2ZTBA 3P0VH 1B9ZA 3D3VD 1Q9OA 2FECI 32C2B 4J3OF 3VQMA 1SMDA 2NSMA 1RZJH 3U9WA 3V9EA 3NCXA 3WFBL 2I5YL 1OQOA 2VLKE 3H2QA 3VD5A 3ZHNA 3N85H 2QADC 4Q8BA 2QKIC 4ZS6C 3MCKA 4MJ5A 1GL4B 3TA3D 3FSZA 2RA1A 3HKZA 2BVOA 5T1LB 4HEME 3PNWA 3S36H 2BCKB 4FNLH 5CSZA 3MV9B 4PRIB 1Z5LB 5GHWL 5GGRB 1IKFH 2JIXA 4JFDB 2R0LH 3IN0A 1DVQA 3Q6GH 1MG3C 1NMAL 4JDEB 2EC9U 4FL4C 3REWA 4JDZB 3A67L 4P2QD 2UV3A 4K7PH 3SDXE 3DHJA 3U4BH 4NJ9L 5AB0A 5D2LB 4P5TB 5DZAA 4JHZA 3GSUA 1G84A 1ROCA 3KPQB 1DJSA 3QHZH 3I9AA 4HUWB 3QUHA 4O02B 5E8NB 3RHWK 4L48A 2BC4B 4U49A