1GS7A

Crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs7A02
2NRDA 3FU8A 1OE3A 1AS6A 2XWZA 5I6MA 4WTQA 1JZEA 1UATA 4HIPA 5F7BA 1PZBA 1KDJA 1N68A 3NP4A 2FQGA 4DP2X 1SJMA 4BDVB 1AZRA 2IH8A 1AACA 2N0MA 4BDVA 4DP1X 4YSAA 1URIA 3T6ZA 4DPAX 4KO7A 4E9TA 5E9NA 4DPCX 1FFTB 2BZCA 1DYZA 2EIMB 1V10A 3V9CA 1BAWA 3TA4D 4MFHA 3NJMA 2CUAA 3S8FB 4BXVA 2H3XC 4KO6A 2VSKB 2HZHA 3NSCA 2YAQA 1IBZA 4A2FA 2QPEB 1A4BA 2BP0A 2GB2A 1MZZA 2GHZA 4N8UA 3PLYA 4M3HA 1IUZA 1JVOA 4HCGA 1IC0A 1ZIAA 1ILSA 3NJJA 1L9TA 1L9OA 1SFHA 4NB7A 3FPXA 2YQBA 1GSKA 3EH3B 2ZXWB 1A4AA 1OV8A 1JXDA 1ET7A 2GIMA 4GY4A 4KO9A 4ZK8A 4FAAB 5B3SB 1F56A 1PMYA 1XB8A 1BXUA 1ET5A 1JZIA 3QJUB 4AKPA 1NWPA 3MX0B 1X9UA 4A67A 1BXAA 2ZONA 2VW4A 3FSVA 4HALA 2AANA 3AG3B 2UX7A 4DPBX 2VN3A 3BQVA 3SBRA 5ANHA 3D12B 5I6LA 2JKWA 4Q8BA 4BWTA 5I6OA 4F2EA 4G72B 1TKWA 3S3CB 4JHVA 2BP8B 1J5CA 1ZV2A 4YSTA 5B7FA 1SHWA 3UADA 5LDUA 1GY2A 4YL4A 2A3TA 3CDZA 4E9WA 1QLEB 1SDDB 2BP8A 3H4FA 4YVNA 2IWEA 2TSAA 3FSZA 3GXUB 5B1KA 3ERXA 3H56A 5I26A 5I5IA 3FT0A 3PPSA 2IDUA 2IWKA 2YAMA 3ASNB 4DP7X 3CZUB 5PAZA 1GS8A 4FA7B 2HLEB 5IY5B 3FYEB 3FU7B 1A3ZA 1NICA 4NERA 3WI9A 5I28A 1ID2A 5D4JA 1TEGA 4HZ1A 3QJSB 4CSZA 4K9JA 4UANA 1OCCB 2IWFA 2W8CA 1J9SA 3FSWA 3TBBA 2B3IA 1OCZB 3DTUB 1J9QA 3IEAA 2UXVA 3FPYA 2B08A 3IN2A 3HEIB 1HAWA 3T71A 3NSYA 4NAJA 2R7EA 3NYKA 3NJGA 3OMAB 1AG0A 2PP9A 2PLTA 3FYIB 1N70A 3CG8A 3RYMA 2PPAA 2PPCA 1ETJA 1NWOA 2FWLB 1AS8A 2YXVA 4QKTA 1T5KA 2XV2A 3IE9A 1KV7A 1FWXA 4BWUA 3DIVA 2IH9A 1V54B 4PCYA 4W9ZA 3AY2A 1BXVA 3QJTB 4UF7C 3S3DB 3U25A 4YSEA 1ZDQA 2BHFA 1RKRA 2DYSB 4RH4A 2IDTA 5B7EA 4M4RB 1CYWA 5I6PA 1E5YA 3ABKB 1CUOA 2PP7A 2XVBA 2UXGA 2AZUA 4GP8B 1NDTA 2HX7A 1NZRA 1DZ0A 1A8ZA 3N55A 3QPKA 4DP9X 6PAZA 1OE2A 1W6WA 1GR7A 4BWWA 4YSOA 1AG6A 5D4IA 3FSAA 3WG7B 2H5UA 4DP0X 3EH4B 2YAFA 1TEFA 1R1CA 1WS8A 5I6NA 3ZX1A 1BYPA 4F2FA 2BWIA 2YAPA 4UAHA 4E9QA 1KCWA 1HAUA 2VMJA 4GYBA 1FA4A 1L9SA 1GY1A 6PCYA 1JVLA 2FT8A 1E67A 1E30A 3KW8A 1NIFA 3QQXA 4G71B 4YSPA 3TU6A 4CSPA 2GSMB 3WNIA 1MG2C 7PAZA 2QPDB 3NJNA 2IAAC 2CJ3A 3ZDWA 2DY2A 2PCFA 2WO2B 2OJ1A 2P80A 1KBVA 4YSUA 1M57B 2XYBA 1OCOB 1XB6A 2EINB 3UAAA 1HFUA 1YLBB 2Y69B 2VW7A 1E5ZA 1L9RA 2PPDA 3PCYA 3ABLB 3T6VA 3UAEA 3L45A 3C75A 1XMEB 3QJQB 3SQRA 2CALA 4YSSA 2PCYA 4E9RA 2XV0A 2FTAA 2FT6A 1QNIA 3X1FA 4G70B 1RCYA 2I85A 1SDDA 1AS7A 3PAUA 1J9TA 2YAHA 4YSCA 2WO3B 1GS7A 1XB3A 1PAZA 3S3BB 1ADWA 4X4KA 2FT7A 1W6LA 5TK2A 2BZ7A 1KBWA 4YSRA 5AFAA 2VM3A 2BWDA 1JXGA 2GC4C 1KCBA 5B1AB 1PLAA 2GI0A 3DKHA 2LLNA 3FU7A 4A68A 2HRHA 1M56B 4A2HA 4KOCA 1PCSA 3TBCA 2XX1A 2I7SA 3NSFA 1OE1A 3EH5B 4YSDA 1KDIA 1AIZA 3X1NA 1EZLA 1VLXA 5AKRA 5EHFA 4DP8X 2BW4A 3FU9A 4DP6X 4GP4B 2CCWA 1AR1B 1B3IA 3AG1B 1A65A 1BQ5A 3QJVB 1GS6X 1WAEA 2GBAA 3SBQA 2UX6A 1ZIBA 2FQFA 3NJHA 2UXTA 1BEXA 3T9WA 1PF3A 3AW5A 3TASA 3WIAA 5I5JA 2BO0A 1WA0X 3JT2A 1JZHA 3UGEA 1L9QA 2AZAA 3CVCA 1NTDA 2OCCB 4AI7A 2Y1AA 2HX9A 1BQKA 3EF4A 2MRYA 3IN0A 2EIKB 3S8GB 2XU9A 2PPEA 1TU2A 1CURA 3NT0A 3MBWB 1NIEA 4TXVB 1PZAA 2TSBA 3OM3B 4AKQA 3NP3A 5A7EA 4P5RA 3FS9A 1AZBA 2GC7C 1JZFA 2J5WA 2ZOOA 2I7OA 1E65A 3CVBA 1ET8A 2CAKA 4A66A 2YAOA 1J9RA 3OMNB 2FNWA 4KNUA 3OQRA 2XLLA 3NJKA 5FC9A 2W88A 1PLBA 2FQDA 4G7RB 1NPNA 1M9WA 1MDAA 1I53A 1X9RA 2VM4A 3GDCA 1AZCA 2RACA 2Q9OA 3X1EA 3FQ2A 4JKNA 3NJLA 7PCYA 4KNTA 2H47C 3AG2B 1CC3A 5F7AA 2YXWA 4WKXA 2CBPA 3H4HA 2HX8A 1A4CA 1ILUA 3ABGA 1ASQA 3WKQA 1NINA 4HCIA 3ZIYA 1PNCA 3AZUA 1SF3A 3G5WA 2YAEA 2XXFA 1OCRB 4HAKA 2XXGA 2X87A 4BK5C 3PXLA 3OMIB 4Q89A 2J56A 2BP0B 2EIJB 2OV0A 1GW0A 1SHXA 2MTAA 1MG3C 2PP8A 4GXFA 1NIBA 3IBOA 2AVFA 4BXSV 9PCYA 2X88A 1AZUA 4JHUA 1ZPUA 1NIDA 5D4HA 1QHQA 1SF5A 2BW5A 4AZUA 3FQ1A 4KNSA 3N2JA 1AQ8A 2HXAA 4A2DA 2JXMA 2E86A 2WSDA 4YVUA 4E9YA 1SFDA 1GYCA 4G7QB 1OOWA 2VW6A 1AOZA 2XX0A 1J5DA 4N4YB 4PAZA 4DP4X 1WA1X 2DYRB 3EHBB 3X2QB 2FQEA 3T6XA 1PZCA 1RZPA 4E9XA 2HRGA 3FQYA 1RZQA 2VSMB 2FJSA 4HHWA 4F7KA 2YARA 2QT6A 3WNJA 2IDFA 3BVDB 3CDZB 1WA2X 3NJIA 4KO5A 5B1JC 1V55B 5B7MA 4GP5B 2QDWA 4A2GA 3UABA 1ASOA 3V9EA 4L0PB 1KYAA 2IDQA 2XV3A 4AX3A 8PAZA 3QJRB 4YSQA 1OF0A 4E9SA 3KW7A 2JFCA 5AZUA 1ZDSA 2QDVA 4E9VA 1JERA 2DWTA 1JZJA 1PNDA 1AAJA 3WKPA 3X1BA 2J55A 2EILB 4P5SA 4KOBA 4AKOA 3T6WA 1MZYA 3ASOB 1SNRA 4A2EA 5I5MA 1JZGA 1NPJA 2DV6A 3CVDA 3OD3A 4HHGA 1WS7A 3X1GA 5B1JA 3UACA 2UXFA 1PLCA 1EHKB 4W1TA 3JTBA 2R7EB 1IKOP 4G7SB 2P80D 5B1BB 3NJFA 4QLWA 3AG4B 4ENZA 2Q5BA 1IBYA 3NSDA 1JOIA 2J57A 1L9PA 3HB3B 2AFNA 3GYRA 1AZNA 2XUWA 1CYXA 1KGYE 1NIAA 1BQRA 3PAVA 5TK4A 3SBPA 1BYOA 1W8EA 2DWSA 5I6KA 5PCYA 3ABMB 1AANA 1PY0A 2IDSA 4EF3A 2PPFA 1JXFA 4HCFA 3ZBMA 1ASPA 4DP5X 2ZWNA 3PAZA
chains in the Genus database with same CATH superfamily
1A7QL 4OZFH 2XKSA 5D1XC 1SVBA 2VDNB 1H6TA 2GT9B 4WTXA 4LSTL 1I8KB 5E70A 5MI0B 2Z31D 3VRLF 1XF3B 3HE6D 4WI8A 2CLZA 2G60H 4AITA 3MV8B 4NQXA 3AGWA 1WWWX 5MEND 5DMYA 2WBJC 5KSAD 1MWAB 4BDVA 4YSAA 2P7TB 4KO7A 1NANI 3VRLE 4CILA 1YEEH 3OXRA 5BRPA 3O8XC 1IM9B 1N19A 2YAQA 5IBUG 5IB5B 4A2FA 5HHOD 43CAB 4WIQA 2OX5A 3Q2LA 4QXTB 1TCRB 3TBWA 5IQ9A 2NNXA 3CFCL 1FN4B 1IGYB 4UZGA 5EBWA 1A7RH 5JPMB 1ZIAA 3QYCA 2BH0A 4QRSB 2JIXD 3LKPB 3EBIA 1IKFH 3VMPA 1R3LB 1CWVA 1OAQH 4N0RA 2BNQD 1TETL 1UG9A 2JKLA 4NNPL 3RL2A 2J8UB 1JXDA 1LO4L 1ET7A 1JNHA 2OTUA 4FAAB 5BJTA 5BV7B 2ZUQC 1W0WA 4AUUA 2MCMA 3JT0A 3N0PB 1DBKH 1UM5L 1W2KT 3D25A 2XV6B 1DE4B 3HI1B 2PCPA 4JQIH 3KJ4B 1AHWB 1I9JL 5K39A 1X7QA 3AS3A 2DWDB 3B9VA 3QUML 3LHAA 1XD0A 3SDDC 3HNVL 2X0UA 2CXKA 2VDQB 3MJ6A 3C12A 2BVPB 2F18A 1YEKH 4RMSA 1D9KD 1DHKA 4N0UE 5SV3A 1UD4A 1RUKH 2NY3B 2W38A 2AQPA 4U1JA 4FQLH 4RWYL 3WN5B 3AVEA 4AWJC 4WWKC 1WEJH 5DJDA 5HYQA 4OKVB 4ZYKA 3LHPH 2FO4B 2H3NB 4LLWA 3B7SA 3KLAA 4X7SH 4U6VL 1QI5A 4DTGL 1JNJA 3BWAB 3GTVA 1OSZA 3IU4L 4DP7X 4EZMA 2H32H 4U7KA 5I66B 4WU5B 4N0UB 2XACC 2Y7NA 3X11A 5FOJA 3MYJA 4L9LB 4HUMB 4M5ZH 4FQQA 5H35A 4GBXC 5L88L 1DN0A 4KX8A 3HG1A 1F41A 2ZAGA 3QRGH 5D2NA 5FYLD 5D4JA 3ARWA 3GT6A 3VGGA 2CPCA 1OSEA 1JGVL 4UANA 1A6ZB 1A7NL 5AW7B 4RGOH 5HHME 2YK1H 5FFOA 4U6TA 3NZHL 1QFUH 2UXVA 5C08D 2ZOLA 2VWEC 1UC6A 5D71H 4GRMB 1VEOA 1AFVL 1P7QD 5GQBA 5LB1A 4MXVF 2X4OB 2XWCA 4N24A 3DYMA 3VFWA 4XI5D 5DHXB 4XXDA 3GRWL 2BC4A 2OFQA 3CG8A 2HJKA 3UIZA 2BCKA 2IO5A 4WV1A 1XSIA 3MJGX 3V0AC 5ESQA 4H20H 4OFQA 2HVKB 2VIRA 4PRPE 1TQVA 1IX2A 2P1YA 4UILL 5GRVK 1ZHKA 4Y9EA 4BQ6A 1PX8A 4YO0A 4AYMC 1U8NB 2BHFA 4C47A 2JI1A 3HI5H 3N42B 1G1OA 5ENWB 1E4JA 1E5YA 4WUKH 3VWKB 2F8OA 1DSYA 3MRHA 4YAQA 3ISWA 3RUGB 1MCEA 2F61A 3A4AA 1NZRA 2VT0A 5DUBB 2BERA 5F93C 3VWJD 5EH1A 5C3TA 4KJPD 4PRPB 4JCLA 4LOFA 5LXGH 1SJEB 4ZFFB 3ULUD 4OCYL 3APMA 2QHRH 2GJ6A 2JJWA 4KKBC 5CNHA 5SWZA 4NUJA 4PR5A 5KG9A 3WIIL 4TRPH 1J0IA 1RUML 2WWMD 2NY1D 4X6DA 4OFYA 4ZO6A 1EFXA 5DJ8B 2CO4A 4S2SB 5HP5A 3UTOA 5J11B 1VEPA 4B0MB 1ZEAH 4L4VE 4ENEC 3MKGA 5GGSA 4UTAL 4QHUA 1FVDA 1ZTXH 3PJSA 4UAHA 5JXED 1CDGA 4WJG3 5DI8A 3SYPA 4H0LC 5T3ZD 2VMJA 4MDJA 3KEHA 5B21A 5GSRB 4F92B 2G3MA 2P8PA 2D03H 3HC0B 4JM2C 1E4XI 3KPRA 3S98A 2GEQA 1HC1A 1QSED 3BUDA 3QQXA 3MO1A 2ITCB 5CZXC 2RFXB 4YSPA 4YHLH 3MUUA 1NDMA 4R8WL 4LCWE 3E38A 2PCFA 1DCEA 4APQD 2KL6A 4R90H 3II2A 4BRJA 1BM3H 4KK6D 4NO2B 3FHQA 2FECL 3NK4A 5B3NA 1LDPL 3WTUA 1P5UB 2WXLA 4UOJA 3O2WL 4P49A 2I27N 3F6LA 3Q2NA 4W9LC 3IDJA 5D5MA 4UV7H 1HFUA 5CUSL 4AMWA 5E2TH 4TVUA 3VVWA 3GMQA 2G9HB 2PPDA 2J5LB 5DJ6B 2UUDH 2Z9TA 1CL7L 4FL4C 3VW3H 1AGEB 1LK2A 4L23A 2A73B 5A2CA 4Y5YC 3QUZA 5H2BA 1YEWA 2QQKL 3P0YH 2QQNH 4Q6YA 2BLFA 3ECBA 4G6MH 4Q14A 5K9KB 3I50H 4OF0A 3OB8A 4XMXA 4Z3GA 1CFQB 2YBGA 2L7JA 4WV1C 3LIUA 2N4IA 1G7PA 3PWVA 1S4IA 1ZHBA 3P30H 4I89A 4BZ2L 4EI5B 4HPYH 1J9TA 1UQSA 4TOYH 5E4AA 1HOEA 2XIIA 4WW2A 5HI3C 3CCHB 3GPSA 5ADPH 4RQQA 4TQHA 1YYCA 4YFDB 3RJDA 2GI0A 3CVHB 3Q2CA 3D0LB 3OHMB 3U2JA 3GJFK 1ZA3A 2LU5A 2BHUA 1WUNT 3WFHA 3C2SA 3CLFL 2XX1A 2H6PB 2IANA 2VRKA 2G75A 3IDIA 4UDTA 5K9OA 1JWMA 3K71B 3B9KC 3RBGA 1NGPL 5GGSY 2YPLE 2QVFB 4XVSL 4PGDA 4LVNB 1UB5B 4ODVH 3G5VB 2CG9X 2WWOA 2AK1H 3AG1B 1A6PA 3D30A 4UUJB 1KEMH 3U9WA 1SMDA 2UV3A 3UDWC 3CX2A 5J6SA 2HTKD 5I8OH 4OY9A 3T9WA 3UPAA 5FECB 3R4DA 1TJXA 3SJVA 1BEYH 5FV1L 4NQQA 2E4TA 3EH1A 1DP0A 4AGPA 4PSPA 2D0HA 3OKOA 3SD2A 3ZE1B 2YPLB 4RFEA 3U0PA 5DO2C 2A6KA 1K6QL 4MCYB 1BQKA 4GSUA 3HVDA 5I1KL 5IHZA 3QQ4B 2NLJB 3U6XA 4FXGB 3EO9H 3T3MF 4ALAC 1NBVL 3I6LD 2RH0A 3GMMA 4NDMA 3AQZA 4KHTL 4YE4H 4HV8A 2Y1ZA 3FUMA 5C7XH 5DVOA 5F7HA 4BCXA 2UWEF 2CAKA 1QBBA 3BZFB 1S9VB 3W56A 1ZGLB 4UINH 3MLUH 5A2AA 2ORBL 2OAAA 2IBZX 2JLLA 2NZIA 3NPZB 1KTJA 2B77A 2VH5L 3T3ME 4A6YB 2DQHH 3FNKA 3T8MA 2LQRA 4RDBA 3UTSE 2WLKA 1X9RA 4Z7VF 3T04D 1OSPL 2D73A 3K0WA 4N2OA 2UWEE 3EO1B 4MKMA 1WFUA 1DQIA 3HZKB 2QSVA 4LKXA 1LHZA 4HJEA 4XBGB 2YHGA 1A1MB 1IE4A 2JTYA 2PETA 3SE9H 4CVXB 2VL5B 3H4HA 1A4CA 4D8PA 1TZIB 4JLRA 2APVA 4QKXB 4YBQC 4HOZA 2WQWA 4OIIL 4UIMB 5M95B 2VSCA 3PU7A 3EJYD 3UTSB 2P24B 5EWIL 3CE1A 4Q89A 3WFCL 2XWJB 4WW1B 3TVMD 1A6TA 1RK1A 4GRLA 4LBEA 4E0RA 5BXFB 5MEQB 1WQVT 5A43C 3FZUC 4NZTL 4R4FL 1KIQA 1MFVA 2CK0H 4M5SA 5FDWA 1IB5A 5D4HA 1M53A 5TJWK 4QT5B 2AV1A 3LQZB 2CA3A 3P4NA 4ONGL 3MXWL 1PQZB 2FLBT 4PY8I 2Z6FA 4G6AD 3T8XB 4IGBB 4AQOA 5DYFA 1K9TA 2WLMA 3VXRA 1UM4H 2HXAA 3UG5A 2YSSB 4G6JH 2AJUL 5I23A 1UD5A 2WIMA 3RZCC 4HUWA 3BH9B 3WHXA 2BIMA 3PQYA 1OOWA 4KI5D 5BW7C 2XX0A 3OGOE 4MA7L 4RSVA 5IHUH 5C0GA 3ZW3A 2DWYA 4L4TD 5TPWL 3WGVB 2FQEA 1L6ZA 1PZCA 2WUBL 2VMFA 5EA0H 5C0EB 3B2UC 2B9BA 5DJ2B 3NZ8B 4OM1H 2VZ3A 1FZKA 1CDUA 4FQIL 4YN3A 1U3HD 2DICA 4P2RE 1GZHC 3U30B 3L2NA 3BVDB 2P8LB 5IFHL 5E1GA 2FDBP 3CJJA 4NHCL 5H4YA 1D5BA 1SOXA 4X5PA 4GP5B 2NTSP 3LN4A 3FTWA 3V0HA 3A24A 4UV4L 5HYFA 3X13B 1FIEA 4GOSA 2N56A 3T09A 4LSTH 1SXCA 4NKMB 4GKLA 4OLZL 3GK8L 3QJHB 4YDNA 1OGSA 3MUJA 2E8YA 1I3GH 5EPMB 3TYGL 3AWEA 1E9OA 4KK9C 1OK0A 2Y7LA 2V5MA 4FRWA 5LGHL 4Y2DC 4L1LA 3F7YB 2WZ5A 3WIHL 3CBRA 5D7JC 3T4AA 4HMEA 4LPCA 2KLRA 2DV6A 3OD3A 3VSQA 2MHAA 3P0VL 3IGFA 4KK8C 2R0LL 4XC3L 4Q6IC 3RWGA 4Z3IA 5AVVB 3UACA 3QORA 3N41F 3TH2T 4W81A 1HWHB 2YS4A 4NQSB 3TZVD 5C0FB 3MGOA 4G7SB 2VLJB 3FH7A 4F27A 4XXWC 1DBML 3P77A 2Q5BA 3QR2A 1CTOA 3BKCL 4PV9B 3QG7L 3IFPB 4H5SB 4MDRA 5I9QB 1Z5LA 2FGWL 4AEFA 1TETH 2OYLA 3ECQA 5ALBH 3T2QA 4Z7WF 3MBWA 2ZKWA 4WEBH 2EUVA 1BQRA 3SBPA 4RMQA 3AXLA 1R24A 1UA6L 2ZYRA 1ZVNA 4M8QB 2BX5A 3HMXL 5ESAA 3ABMB 3O2DA 3WLBB 4EF3A 3IETA 4JRXA 5LGYA 2ETWA 2ZWNA 2OR7A 5D7SH 2EXWC 1O6TA 2JKSA 4RVBA 5EZPA 1G7QA 4LSQL 4R26L 2H0PA 4XHJD 3VXTA 4BH7B 4Z7WE 4WTQA 2VABB 4JFXB 4NYLA 5GS3A 3HNVH 3O3UN 4JN1H 3WUWA 1T1WB 1PZBA 1MLCB 3A22A 1KJ3L 2AP2A 1X5GA 1Q9KA 2APFA 2QVTA 2OXHA 1I7TB 3L81A 3PUUA 3LZOA 1Q9OB 2XY2A 4MNGE 1CXFA 3LOWA 2MKWA 3KJ6H 1GCYA 3GBNL 3OC5A 1OAUH 5E9NA 4JFUA 1NUNB 4DPCX 4ANKA 1E4HA 4RBPH 3AQYA 5D8JH 3OKEA 4DTGH 1OZUA 1A4JB 3IU4H 1BHGA 4JDTH 3DK0A 4FHBD 2EABA 4HIXH 4DFIA 2D7OA 3FXIC 1YYMH 4MNGB 4Y0GA 5C0AD 3QARA 5L88H 5DVNA 3PLYA 2V2TA 3N40F 4ZTPL 1BVLA 1HT6A 5KJ7E 1N5YL 3UTZA 4NQDE 2WK2A 2XZAL 3RVWD 1AXSB 2DLHA 4MMYB 4P5KA 3ZZLA 3ZTCC 3GDBA 1JDCA 1FORH 1GSKA 1G94A 1DQTA 3FAXA 1T20A 1N3NB 1WYJA 3QEUA 1CXLA 1HHKA 3DO7B 4YBHA 2C34A 1BXUA 3ORJA 4I0PD 1G9HA 1JTOA 4JGJA 1ZVSA 3HPLA 3V10A 2OJEA 5E9DA 1OP3K 4M1CC 4NQDB 4JGMA 3EYSH 4FZ8L 3GRWH 2FATL 1JF1A 3MNMA 1MNUH 1FFQA 3TO4B 1HYSC 3VYPA 5JZ7C 3D12B 4WHYG 5ICYB 5F3HB 1BJ1J 3CN1A 2A4ZA 3BI9X 3MV9A 3G04A 1HL5A 5EF1A 3TPUB 1S7VA 5B4MC 3WFZA 2VAAA 4JHVA 2HWZH 4DETA 1ZKAA 4YSTA 5H94B 5CILH 1TQSA 2GK0A 4FQXC 4ZQKA 2A74A 2EE2A 5B1KA 3GXUB 3AREC 1F4AA 2IWKA 5AL8A 4Y19A 2CUMA 4UNUA 5DJ0A 1HH9A 4W6YB 4X6CA 4PTTA 4EO5A 4I5BB 1U95B 3PP4L 3HNSL 1MHEB 5C2BL 3H9SA 5IVNA 1EAQA 3NJVA 1Z3RA 3BIAX 2FYYA 5EZJA 5T1DL 3SKJH 2EDOA 4ZX6A 5KBLA 3WIIH 1ACZA 4MX7B 5I28A 2D7TH 1XXFC 3GSNA 3ARBB 4JR9H 1DQMH 3MTRA 4Q4IA 5F97E 4K9JA 1YEJH 2H0FA 5KYXA 4WFHD 5DD1L 2JV6A 2CLVA 2DM7A 4NRYA 5CLXA 4NCC2 1EXGA 4QOKD 1T04A 2ZSWB 2ALAA 2VJ8A 3U4BH 4JRYE 3EOTL 2E6QA 2YC1A 3NSYA 4UT7H 3OMAB 3FL7A 2XZQL 1B4TA 2NY7H 3CVHH 4MB5A 5DZJA 3FYIB 4X6FB 7CGTA 4NO3A 2J2ZA 3MCLL 3OF6A 1MJUL 2PPAA 3SO3B 1YNLH 4S10A 2YRZA 2XIBA 4F8QA 2WZ6A 5ISZD 3L5IA 2XV2A 3IE9A 4Y4HD 5E6SB 2FWOB 2FX7H 3C5XA 4PJHE 3MACL 1BQLH 1BXVA 4QCIB 4R5XA 1BX2B 3EOAB 5BMFL 2TRHA 1LDPH 4H26A 3KWWB 2VXUH 5C0JB 3LZQA 2FB4L 2QELA 4KK5C 2F15A 4IBVA 3QXDA 3PWLA 2HX7A 1TVHA 5DHVH 1HXKA 5DC2A 3C5JB 5BUAA 2XN0A 1CDBA 1CL7H 2WVSA 1U2HA 3AT9A 3IDGA 4PJHB 1FV1B 4KKRA 1JGUH 2LTQB 1CE6B 1P9MA 1MCCA 3MJ9H 1IM3D 5K93A 1WC7A 2P5ED 3OWRA 1FLRL 3QXAA 3V0WH 3MNVA 4YFEA 2GAZB 5SX4I 1K4CA 2LE9A 1DQQA 3MODL 2D3JA 2G3NA 2W0PA 3TA3A 4F2ME 3MU3A 4ESKA 5HY9A 2Y25A 2BMKA 2VN7A 4OCXH 1Z9LA 4FQHA 2V2WB 2O6DA 1HDMA 2LU7A 1GY1A 1JPTL 5FHBH 4A6YH 4O51B 2R1XA 3O6KL 2W9DH 1AQDB 5GS2D 5I0WA 4JANB 2UVEA 4G71B 3LVTA 4JZJC 4LZKA 3GS4A 4F2MB 4WF7A 5FLVA 4P2OC 2ODHA 3ESNA 4HJ0D 4LARL 3FBKA 3OKKA 4JDZB 3SGKA 3L4CA 4GIAA 3UZVB 4NN6C 4DGWC 4PVNA 2NSMA 3QNZB 4Z0BL 2AITA 5JDJA 3BP7A 4NQCE 4XCNB 4YSUA 3EXLA 1M57B 4L3AA 1RURL 2WLIA 1NMBL 4PTUA 3CN3A 3EOBA 3QEQB 3WS3B 4XT1C 3C60A 3ARGD 4NO0D 3QIBD 4TS6A 2QSQA 3NOIA 1T80A 2EC8A 4FFVC 2ED8A 1VERA 4JQXC 3W9DA 3T0ED 1IGML 3PCYA 4E41E 4Z7NF 4YH6A 2LABA 2C9UA 1PSKL 2AABL 2AQ3A 4HKZA 4PJEA 4E5XA 5DD6B 5KSBA 4W9IC 2JCCF 1SOKA 4AENB 3K2UL 2E76C 2WWKO 1NBVH 1IQDA 1SDDA 4Z7NE 5HVHC 1GVIA 5E5MB 1T3FB 3VSUA 3TN0C 1T2QL 1G84A 4E41B 5IBLD 3OJDB 4FNLH 4F24A 4B5EA 3NMEA 4P4RB 3UTPD 1U8JB 35C8H 3EDEA 3KLHC 2PYEA 3SODB 1XF2A 1JXGA 3OR7A 2JCCE 3VFVB 2ORBH 3VFUA 2GY7B 1OOAA 4YPGB 1IVTA 1D2PA 1XSKA 5GZNA 4OLVL 5IMOB 4LLMB 3OG6B 1A4KB 5LNEA 1E42A 3VFSA 3WFDL 3TBCA 2J88L 4YLBA 1P1ZB 4C56A 2GTZA 4X99B 3OKDA 3GKWL 2ICWB 4GW1A 3QO1A 2H2SD 2KKQA 3FB5A 2L0DA 1T1YA 3CSGA 1QQDB 1YN7A 2WLHA 3V4LA 4K3JH 1MVUB 3BD5A 3SQOL 4TNEA 5IIEA 1F6AB 1W8NA 2FJFA 1A65A 4JY4B 1LTXA 2ERJC 2PNDA 3ARXA 3QJVB 5AVXB 3UPRB 3A4DA 4PRHE 5GGQL 2A9BA 1NCNA 4OIIH 4OZ4A 3IRPX 3SE6A 3EXJA 4PLKD 3IGAA 5DT1H 4PJ5A 2OMTB 1TYRA 2O5ZL 3BGMB 3GXDA 3P73A 4HSAC 2WNXA 5I0YA 1PYWB 3A6BL 3MPCA 4AG4L 1ZHNA 2EE0A 1AXIB 2WTPA 4M7ZB 5F9OH 1JZ8A 1JYVA 4FYTA 1AP2B 4MJ5A 2BNRA 3KPLB 5DQJA 3MREB 3SE8L 4A7SA 2X40A 4PRHB 4M4RA 1CURA 4GO6B 4OZGB 4XPHH 3MXWH 4HG4J 1KXHA 2OMBA 3NP3A 2XVLA 4AQEA 4Q2ZB 1M7DB 1FGNL 2LR4A 2ESVA 3O3BB 2I7OA 1VACB 2BVOB 5F96H 3NCJL 4KBPA 1AGCB 3Q6FB 4JPWL 4MA7H 3U9PH 4MKTA 2AJXH 2W88A 2X4PB 3ME0B 2EUZA 3GLZA 4AE0A 3EJZD 4P59H 4K3DL 5I1AA 4OQ1A 2WUBH 4NC1C 2DLGA 3X1EA 1HILA 1R3KA 3E1F1 3RTLA 1NCTA 3TGXA 2WBWB 3PWJA 2AXFA 4FQIH 4P23A 4Z76A 4MZRA 1VHPA 2PXYC 2M83A 5HYJA 2HT3D 5AZEH 4ZO7A 3OGCB 5CJBA 3OC8A 5JYLA 3POCA 2GQHA 4PIBA 3V9FA 5HYSA 2KZKA 2WZAA 1NLDL 2MWCA 1XR9B 5CGMA 2ZOKB 2LV4A 4HUXA 4A7QA 3BYYA 1MJ7L 4OLZH 3GK8H 5AW9B 4MHHI 4BFBD 1ZD6A 2D0FA 1Y18A 2FHBA 1E4XL 4FLRA 1I1YB 4D7BA 3TEWA 3WIHH 4I1RA 1A3RH 5JHDE 1BM7A 5A2KH 3P0VH 4NQEB 4XC3H 2R0LH 3ZTJG 4Y5VB 2EDQA 1O7VA 5C0IB 4MNQE 3O3AB 3QNXA 1A9BB 3EGDA 5I1CL 3CWGA 1H5BB 3GINA 3H0TB 4KJWD 4ZO8A 3BIKA 1RI8A 1IVLA 2WSDA 1DBMH 3DX6B 4I2XE 5DMGC 4LLYB 4Y4FC 2G4GA 1UA3A 5DEGA 3U0TA 5JHDB 3EHBB 5FB8A 1TLKA 4DKEL 1P69B 3EO0B 1NBQA 2PW1A 3O6FA 2HSIA 2GJZA 1CTMA 2VXVL 5IG7A 2FJUB 3FQRB 1R0AL 1TKWB 2GJ6D 5SWZD 1CBVL 2XHNA 4G6FB 3IMBA 4H1LB 3H85A 3SDXE 3MFGB 2K4WA 3ZN6A 2ATPB 3J7HA 4MDIA 4OFYD 1FO0A 4JPKL 3TS8A 1XF4B 4J8RA 1EFXD 2AK4B 5D6CA 3VFMB 4R26H 3BC9A 2XV3A 3QP3A 4Z7AA 4PFEA 4X7TB 2PTTB 5AVWB 2ZXAA 3S34H 4M3KB 4D8OA 3JTTA 4MGXA 3IJEA 1R3HB 2GI7A 2MNJB 5T3XE 1GJWA 1KTLB 2Z7UA 3WLWC 4OCSH 4KOBA 1THCA 4ZUVA 1CD1B 4G8GE 3SDXB 4JG1H 2X44D 1OARL 1DJIA 3KPRD 3MRFB 2A83A 3GBNH 2QGBA 2DLIA 5E7BA 5GGTA 3ZR5A 1P84J 3HNTL 1QLRB 2ZOWA 5B22A 4PS8A 5EF0A 5FA4B 3DX9B 5MP6L 2DQTL 1SYVA 1ULVA 5HGDB 3VH8B 1OP9A 4KTYA 1RZKH 1TTCA 2BFVL 3MJ8A 5IHWA 3FHAA 1IKOP 3JSSA 5M7QA 1F3DH 4PBWD 5F72S 1D5IL 4R96A 1NCCH 2HN7A 3QQDB 1N5YH 1QO3A 2VR9A 2XZAH 5SX5K 3GIVB 1GIGH 4PG2A 1KLUA 3PY9A 5BRZA 1HCFX 3FQUA 1M1SA 2HLAB 2I07A 5BVPL 3WTTA 3K1DA 4L3EA 4LEOA 3QUZD 1Z9SA 3CFNA 3VTMA 4ZUTA 4IIQA 4ZW8A 3L3OA 4BBWA 3V4VA 3TBYB 4HS8L 3MLWH 3VX1A 1V3KA 4QJ5B 4R84A 4WU7B 3KLSA 4ELMA 5KYYB 4FZ8H 5KYWA 3OLGA 1GGUA 2FATH 2J1KA 1KENL 1T66C 3NABL 4PRBB 5AWNH 2MIZA 1EMTL 1AGBA 4I3SL 3MLSL 3FU5A 4O2FA 4UQIM 3KM2A 2D0GA 4GKSA 2FQGA 4Q56A 5CJOH 5I1GH 4G9FA 3L5WA 4LF3B 1ADQL 1E43A 1EANA 1M6OB 2PWHA 4Z5RB 2JMRA 2CMRL 5DSCB 2P3YA 1TENA 1FCCA 4X4YA 3V0FA 3TTYA 5IVXB 3QDGE 3FONA 4XO4A 4AVJA 4XR8C 2MFNA 3CQQA 3FB8B 2IAND 3GXFA 4OLXL 3UG4A 5E6YA 4F20A 4R97C 4NOFA 3PRZA 1JGEB 3LS4H 3NJMA 1BVNT 3S8FB 4BXVA 1NEZA 4KO6A 1W15A 1DSFL 3HNSH 5D1XA 1KPUA 3OB0K 4CNIB 3HFMH 3QNYB 5T1DH 2X4NA 3T77B 1E8YA 2FL5A 1IC0A 2FSEB 1NKOA 3KDMB 1IC5L 1HESA 1VIWA 3GRBA 1AD9A 2VDOB 5EU5A 3FPXA 4PJFE 1S2EA 3SJVD 1KJ2A 2WBJA 5FYJE 5LCVL 3CK0L 4EI6A 5J4MA 2IOIA 3CFDA 3U2SA 4Q0XL 5KSVA 1AD0B 3JWNC 3OHXC 2NY2B 1MSPA 2R4RH 2CJUL 2CDGB 1QFHA 4PV1C 4DVBA 4AKPA 1VFAA 1W0VB 2Y07H 1AI1L 2RQEA 4HALA 2H4EA 3DMMC 3MCLH 3RL1A 1MJUH 1N64H 4Y89A 4DPBX 4PJFB 2NNFA 2F7RA 3KGSA 4OZHF 1NCBL 3ATBA 3P1VA 4XVTL 1LGVA 5D7EA 1S78C 4Y7OC 4GAYB 2DQDL 4XVUC 1A7BA 4B9FA 3ZHFA 5MENE 2WAQA 3F65A 1U8QA 3DPDA 4XPAH 5BMFH 1NC2A 3FQXA 4XN9A 4F3FB 1VKXB 3ILQC 4XMLL 4X9YA 4UMGA 1P4UA 4TUUA 4KFZC 2IWEA 2C3VB 2BOLA 4FMKA 3QC5X 4XGZB 3EGSA 2O26U 3HCVB 3HE6B 5F1IA 4IK6A 4LLQA 1M3IA 3HUJA 4DEPB 5DQ9B 1GS8A 3GGWB 5DJZA 5FAAA 5IESL 1E5CA 1H8LA 4YDVA 4AMKL 3RHWK 5MENB 2OTWB 3TO2B 3KLDA 5KSAB 3Q01A 5CEYA 1AGDB 4H8WH 4OW6A 5DJAB 3E9UA 3FCUB 2NR6A 5TGBB 1OO2A 3QJSB 3OAYH 2X4SB 4OLUL 5ALCL 4TUOB 5C7ZA 4QYOA 3GHEH 3LIZA 1E4KC 1CD9B 4DGIL 1KXQA 2V5SA 1AY1H 3DTUB 4GRLD 2Y9RT 4WWKA 1TJGH 5DDHB 2XPYA 4X42A 3O4OB 1AIFA 2EKSB 5FFLA 4HOXA 5HHOB 4GSDL 1HHGB 2BVQB 4JDEB 4QI3A 3VGAB 4HUUA 3N40P 5I76A 2BSEA 4F7MB 5JHBA 5KBKA 3I84A 1GAFH 2JIXB 1MJ8L 3O6KH 1ROWA 3WEBA 2BNQB 2L7EA 3CMGA 4OZFA 3NRPA 3VXRD 4GBXA 3HI6L 3P3SA 4KUCD 4NZFA 1MJJB 4RCAA 5DK2A 2WGNB 5EZIL 4NPKA 3HS0C 2DQCL 3OR6A 4Z0BH 3PQYD 5J13C 3LZPA 3IAPA 1MCPL 5C2UB 5DCCA 2DYSB 5B7EA 4BA0A 5AYUH 3MRMA 1KXTB 1GTNA 1HZHH 3FT2A 1NMBH 2FR4B 1P2CA 4QO1A 4YL9A 4D2NA 4G80B 2HMID 2KUTA 4L8SB 5ITBL 5DZNA 5JO5A 1SDAB 2VR4A 5AD0A 1JTTA 1IGMH 4X5WB 4KVCH 1GA2A 3OKYA 4POZC 4LPUA 1D9KB 3FMGH 4OLEA 2OLDA 3VGBA 1CU4L 1ICTA 1L6XA 2XYCA 1UOVA 1NGXB 2ZX6A 4N2GA 4YGVB 3K80A 3VNYA 5F2FA 4ZZKA 2AEIT 4YHIB 1CFTB 5L7XL 3BGFB 4KKCC 5FYLE 5KVFL 2ZX5A 3LRMA 2QPFA 3Q6GL 2W5PA 4WSKA 2FBRA 4WLCA 5BPPA 3WTXA 2NX5E 5JNYA 3LN5B 3ZX1A 2IQ9H 4Q58C 4WK2B 2ISDA 4NQUA 2HFFB 4J1UA 4FABL 1UD2A 4I18B 4QHKJ 2NT1A 2ZYSA 4IIZA 2HKHL 2HG0A 4MQ7A 1UURA 5DYOB 3BSGA 1OTTC 2J1WA 2MQCA 3FOLA 4OLVH 1YCSA 4Y9CA 4ZX5A 2DBJA 2HB0A 1E67A 1KBGL 4JQIA 4XH2A 3WFDH 4ZMZA 3L9BA 5T5NF 2J88H 4PPTA 1OM3L 3QORD 1T1XA 3T1FB 3PGDA 3VXPB 4MA8H 2C8NA 4JKPL 2VOTA 3GKWH 4PMEA 4TUKH 4CSPA 5H37A 3C09B 3K4ZA 3ESUF 5C08B 4HS3A 1Y07A 1RVFL 2C9SA 4GT0A 1KG0B 3WUWG 1P7QB 1FC1A 3GM8A 2NXZD 2WO2B 2EE9A 3IJ8A 3M8OL 4NUQA 5FX3A 5KVFE 3VB8A 2OJZL 1UWGL 4D94A 1L0XA 3SE4C 4WI0B 5LGKA 4OSUL 1KC5L 4J3WA 3BKYL 1D6VH 2WJ5A 5ERWB 3W37A 1UYWH 2Y69B 1E5ZA 2R23B 3TPKA 3T6VA 3P2TA 3N85H 3L45A 3INOA 2DMKA 2R39A 4JM2A 3DOHA 1X5ZA 4JRXD 3QJQB 1MCNA 1CG9B 4JB9H 5I1IH 4WSJA 2O5YH 2PCYA 4LLDB 3SE8H 3TTSA 2B1HL 4XCCL 2J4WH 1AMXA 1OTUD 3QAZB 2D2OA 5AB9A 1AS7A 2M2DA 1WFTA 4U1KA 1C12A 3UC0H 1FGNH 4PB0H 3WSQL 5LDSA 5DU7A 5I17B 1DBAL 2IMNA 4G1EA 4JFYA 2D31A 4JAMA 4LQ1A 4TTDC 1MWAL 1NA8A 4JVWA 1YNKH 3R0NA 2OYMA 2VQTA 2ZP9A 3NSXA 1CIUA 1P4BH 5G5DB 3P9LA 4JPWH 4NSKB 2NYYD 4JHWL 1QSFE 3SDCA 4JO2L 3NSFA 4EN2A 2HVJB 3GRGA 4K3DH 2F8XC 3GPEA 2P28B 2J7LA 3ML9A 1J9CT 2O61B 3EJCA 2NXYC 3L95A 1J05A 4J3BA 5DK0A 3FU9A 4S1SL 4DP6X 2CCWA 2P5WA 1B0GB 4EDXA 2R1YB 5ABDE 4NXKA 4XX1G 3M86A 1WAEA 2GBAA 3NFNA 1QSEB 2XBDA 1QSFB 4MJIE 1MFDL 1BEXA 1NGWB 1PF3A 2R0ZH 3BN3B 1NAKH 2F19H 3CBJB 1MJ7H 3NCYS 4P07A 4J3OD 2RIKA 5CJXA 3TP4A 4X8JA 1EBPA 3UERA 3IAGC 4OQTA 1HL4A 3DTDA 5EU7E 4APQB 2OW7A 3CFMA 3GMNB 1EEUA 1EDYA 1Q38A 3WU1A 3RIAF 3QZPA 4JPIA 4LBAA 1H3TA 1LWJA 1SUJA 2APWA 3B9KA 1RZIA 3IVKA 4M7KL 3RX5A 1RH8A 1DZBA 3MV9D 4D9RD 4D0CB 1AZBA 1YNTA 5I1CH 5T3XH 5F1NA 4R5VA 5HGAB 1OB1A 4GUCA 4KHXL 3MNZB 5JORA 4HKXB 2JK5B 4HPHA 3LVEA 5IFAL 4Y19D 2HG5A 5ACZB 4DKEH 1NFDA 1G7IB 1IMHC 2VXVH 3PDDA 3H9SD 2NSXA 4H25B 1R0AH 2ZPKH 5KBNC 2Y1YA 5ESVA 1QLFA 1DDTA 4N0FA 2NW3B 4Y2LA 4TL4A 5JYMA 4BELD 4KKZA 4NP4H 5LQBL 3ZSSA 1WBZB 3SDAC 2Z8WC 4PJCA 2G0KA 3MCKA 3VE0A 4OCMC 3G6AB 3APNA 1CDIA 2Q3AA 3ZYZA 3CNKA 4IRZL 2IF7A 5KBPA 3NCMA 3PWPE 3PXLA 2IV9A 5DUJA 5EB9A 1OL0A 4PJ9C 3ZK0A 2EIJB 2ENPA 4PP2A 1M3JA 1GW0A 4QRUA 2CR0A 2B5IC 3FUJA 1NIBA 3BHBB 1KBPA 3NCCB 4GRWB 2A0LC 4HLJA 3OF6D 4TNVK 2YD2A 4BUQA 4P4KC 3INUL 4GG8A 3CSPA 1ZV5A 4HP5A 3ARVA 3I6LE 2DQTH 4K07A 2WCSA 1JK9B 3VD7A 4KXAA 4B9IA 4OTXL 1SXZA 1RZ8A 3BH4A 3IXAB 1MIML 4QRFA 5LBSL 3ZKNC 4FA8A 4J2XA 3T08A 4CA4A 1GGCH 3D3VA 4TLUA 3UROR 5F8RC 1ZS8A 1XQ4A 3U0WH 1ZJBA 2NCMA 4D0BA 4DP4X 1WF5A 2W1NA 3STLB 2VDOH 4M6NL 2VZVA 3DRTA 4RAUB 2HRGA 2NTFA 3U7WL 1OW0C 3SO5A 3T8VA 5BVPH 5E6IB 5ID1A 4X4XB 3RDTB 4F7KA 4HS8H 2I60L 5EC1A 5EOTB 3V0VA 3WNJA 1GL4B 2CDFA 4PJ7F 2L7QA 4N9GB 4WFFD 3ILPB 4RIRB 4F93B 3V9EA 5AUMA 4AX3A 3MI6A 3TA3D 3LEYH 3ULAB 3Q0HA 1EMTH 1QZ1A 3DYPA 1XEUA 3MLSH 1U92B 3O11B 5FYJH 3RZCA 1ETZB 3WKPA 4Z3TA 2C1PA 2OYKA 4LP4A 5BW7A 2X3BA 5D1QE 1ADQH 2AEWA 4KXDA 4PGEB 2CMRH 4KXBA 1WDAA 1ZK9A 3AAZB 4M48H 5HHNB 1WAAA 2UYLB 4P48A 2YMXL 5JOFB 2Q6WA 4WFED 3M6DA 2QTVA 2W91A 3EG9B 2XQYK 1RZFL 1S7TA 2R51A 3KYOA 3I02B 2MTPA 4PJIE 3VFNA 3CHQA 2UXFA 1KUMA 4EI0A 3QHZL 4LLUA 5KN5A 1S46A 4CC4A 5BS0A 3IXTA 3TVMB 4F8LA 4M6OL 1DSFH 3FO9B 2Y7QB 4X5XA 4KRPC 5ID0A 2MCPH 3HLKA 1D5ZA 1SLXA 2J44A 3FQNB 5D1ZI 2BY3A 5C6TH 2H41A 3QDHA 3BWZA 4U7SA 5IB4A 1IC5H 2CU9A 4IJ3B 1CZ8H 1LEKA 3W9EA 5CEZL 1CFVL 4PJIB 5LCVH 5JW5A 4Y2DA 1S7XB 1NIAA 2VDLL 3FCGA 1TLMA 1HKLH 1NLBH 3AXHA 4IMLB 3MBEA 3JQOB 3UXFA 5GGUB 3VXMA 4DP5X 3I3DA 4CN4A 1AO7A 4UCFA 1AI1H 4L4TB 4WGKA 1U6AH 4PRNB 3V5HA 1EZSA 1ZSDA 1HH6A 2A9AA 4EDWH 2CO7B 2AVGA 2XFGB 1NCBH 4WK4B 5JQ6L 3DVNA 3BAYA 3Q06A 5B8CC 1E8WA 2PYED 3HIZA 3M1BA 2IADA 4DP2X 3RFZB 2A9CA 1U8HA 1U3HB 1XF3A 3FFCA 5GZND 3MV8A 4ZUUA 1W72L 1O5PA 2N0MA 4K73A 1LD9B 1WWCA 4DIXA 4AQAB 1C08B 2V7HA 4C56D 2FWSA 4EIBA 4X80H 4OJDH 4MFHA 2FCBA 2YLKA 1U8PA 1X5XA 1WK0A 3V55A 1IAIH 4OFDA 3NSCA 4LCCB 4OM0H 4LP5A 5HJ3B 3UO8B 5C3IA 1JDAA 3ZRSA 2DIEA 2IXQB 2ZX9A 5IF0A 5IB5A 4YBLB 4BSWA 1VEMA 1AR1D 4HMDA 4ZMPA 3IWVA 4GB9A 4G6KH 4PJ5D 4OLUH 5ALCH 3WJMB 1HSAB 1FN4A 1M7IB 4G59C 5DRZA 4QRSA 5D93C 3RAJH 3LKPA 3W2DH 4KO9A 4FTVE 3BP5B 1XGTA 2XFXA 1U8IB 3D07A 5E51A 1VENA 3TZVB 1F56A 2WM0A 3MRDB 3JTSB 2P26A 3EAKA 5F0LB 4Q97A 1TZHB 2BNRD 4AL8H 1NWPA 4P3DA 1P4LB 5GGRB 2VKWA 5FYLH 1U21A 3W0WE 4Z7QF 1MJ8H 3W81A 4QHMB 3CFTA 1V5JA 1GYAA 2ESVD 3LKSA 1Y0LB 5DLML 1QKZL 4GKNB 3TNMA 2BIOA 1G1CA 1AHMA 4P5TC 2IEPA 3RA7H 1M9SA 5DZ9A 1MCPH 1N10A 1TJIL 2BOCB 4F7TA 1EO5A 1RV6X 4XNYL 4MAUL 1ND0B 3W0WB 5F6HI 3GI9H 5CIPB 1YDPB 1WFJA 1JWUB 4OKVA 4BZ1H 2ICWJ 4ODWB 1R47A 1WO2A 1JK8A 2CO2A 4F8TA 4P23D 4HC1H 5F1KC 1UH2A 1CU4H 3BWAA 4OJAA 1I1FA 1NFIB 3C5ZC 5C0AE 4WTWA 1C7TA 1W9XA 3C6LB 1CLZH 5L7XH 2JLPA 4L9LA 5KVFH 3HC3L 3MGTB 1TEGA 2MSPA 4IRJC 3FB7B 4FFZH 4OIAA 4S1QL 4XZUA 3Q6GH 2BZDA 5I8KL 3CVIL 1QTYT 5AKSA 4P05A 1KB9K 3LSOA 4IHOB 1N0LA 4KX9A 5TDNB 3FH5A 5DZLA 3BPOB 3JWDH 3B7UX 4FQXA 3IN2A 4PY7A 1KLFB 2BVEA 5FUZH 5C0AB 3CFJB 1GOGA 3TT3H 3AREA 3LN9A 2M8XA 3KYKL 4GRMA 4X0KB 3GXMA 4H0HB 2PP9A 2E75C 3Q1SL 3UAJC 3MN8A 2X4QB 4F7EA 4IU2B 3B5HA 1KBGH 5ETUA 4HBCL 4U1HB 2LVCA 2CRZA 3WGUB 1WIUA 1BA9A 1TQUA 3B8YA 3BW9A 2V7NB 2Q0ZX 1O7SA 2ED9A 4I0PB 2AV7B 1KN2L 1ZDQA 5JA9A 3KR3L 1TU2B 3UYPB 3L3HB 5K33A 2RHEA 1U8NA 3FCSB 3CU7A 5E99L 3DX8A 4OSUH 1KC5H 3O6FD 1WP6A 2DMHA 2Q7YB 1JFQL 5IMKA 3T0XA 1W6WA 1KMGA 3OX8A 2W07B 2VISA 1UCBL 4JDVB 2OMWA 4PRPA 3HHSA 1EEQA 5CBAA 1MHHB 4D9QD 4DP0X 1IE5A 3I3BA 1N0XH 3P11L 1HCVA 3B7YA 1S7SB 4UT9H 4UB0L 4RFNC 1MHCA 3AACA 5JPNB 4YXHL 5CCKL 4M7LL 5I6NA 4BFIB 4BH8B 4R7DB 4FJZA 4XNQB 4I85A 4QOKE 3RTQC 5EU3B 2R2EB 1JP5A 1PDKB 3GJFB 3MLZL 3VDCA 2GJJA 2C9AA 1D6EA 1HIML 3D51A 4BFKA 4TF4A 2WXKA 3QXWA 1JPFB 1SMOA 5ES4B 4LEEA 4JHWH 2A9MH 5GSRA 1NIFA 1ZHLA 4WWPA 1I9EA 5D7HA 1LO0H 2DF3A 3GRWA 3OAZH 5ISZE 4JEGB 1Z7JA 2VR7A 3ROLB 1MG2C 4ZOAA 4HIHB 4QOKB 4X8XA 4DKAA 2J1YA 4L4VA 1Z9OA 4IJTA 4ZUSA 1ZY9A 3FDWA 2B2XL 4N0CD 2D4FA 4FFYL 5BRZD 2WPGA 1EDQA 2Y2WA 3IDMA 1QFPA 1R3JB 1GJIA 1MFDH 4P5MB 1P5UA 5ISZB 4L3ED 3HN3A 1F18A 1PCXA 4Y4HB 3EFFB 1X44A 3ABLB 4XWGL 3UAEA 3QQNA 4XMWA 5DJXB 4E36A 1AH1A 2VDPL 3C75A 5C71A 1ETB1 3U4AA 4XCEA 4LCWA 5DJ6A 4PWJA 1AGEA 2IBBA 4JZJA 4HWZB 2GY5A 4A55A 3CPLA 3WL9B 2FT6A 1ED3B 3QFDA 4KROD 1RCYA 5GS0L 1A47A 4LHUA 4R2GD 1QVOB 1CFQA 5GJSH 3ZTDC 2ICEC 3CDFA 3X12B 4EI5A 2QFRA 2EDKA 2F8IA 1K2DB 4EEEA 2BZ7A 3BJLA 3FOMB 4UTAA 3L3IB 2BWDA 2F53E 1H9VA 1SN5A 4W9KC 4N2EA 3DKHA 2J25A 5J3HC 4KHXH 1IM3B 5FXCH 2P5EB 3MJ7B 4IBUA 5DFAA 3EFOB 3CVHA 4B5ZA 1ACYL 2IJ0C 4OUUA 2KYIA 4HISA 3DX7A 4ETQB 1AIZA 5E8EB 5D1XD 1JHTA 1N8ZB 3GJEA 3BUYB 3WXWL 2XKNA 2JB6A 2YA2A 2F53B 2OP4H 3ES6A 4KU1A 1RIUL 2A77L 5SX4H 2UUDK 2Z93B 3MGAA 3UG3A 1BQ5A 1UZGA 2O6EA 1QOKA 2WBJD 3V8OA 1SEBB 4ZS6D 4H0GA 1PD1A 5EOCL 3BKMH 3K6FA 5DS8A 1BCIA 3VVVA 2CD0A 1TTFA 3SY6A 1SJXA 4GIPD 4KX7A 1GYWA 4UT6H 4X6EA 3MRIA 1LE9B 2AZAA 5DHVA 4WVRA 3C8KA 4QRRA 3MA9L 3NRQA 2AERT 3F7LA 2XWTA 4NNXB 4BM7A 5D70L 1FE8L 2BIIA 2HT4C 3INUH 3MJ9A 4DHLA 2DKSA 3ARGB 4NO0B 3QIBB 4TUJB 1IGIH 1EXUA 1OF2A 4OTXH 3FF8A 4MQSB 4XP4L 5F9JA 2ZP8A 3U79A 2WXHA 5EBMB 1INQA 2MJWA 1X5KA 1LEIB 3TL5A 3CVBA 3QUXC 1ET8A 2EEFA 1NC2D 4JRWA 3UTPE 5IFJB 1SY6L 3PGFH 3U46A 4DUXA 2AQQA 3DV6A 3LKOB 3QAQA 3CSBA 1T7VA 1ZANL 2OI9C 2OZ4H 1X5AA 4B9JA 1RD6A 2YN3A 1I53A 2CLZB 5GGVH 4NQXB 5DEZA 2JKIS 3KJ4C 4KNTA 4OZFG 4PJGF 2YKKA 1C5CL 2NR6D 2DQFA 5J8OA 1HOCA 2WN3A 2HX8A 4OB5L 2CR6A 3V6OC 1AKPA 1U9KA 2QVMA 3OXRB 3VG0L 4Z7OE 1DDHA 3F2LA 4MS8C 4NKOB 4RAVA 3U36A 5I2IA 2N3JA 2CHZA 5JLZA 4WWKD 4HAGA 3E6HA 4W9FC 4N5UA 1XZWA 3ZR6A 3WN5C 3UTSA 1MFAL 2WKGA 2QQQA 4K2UL 1FSKC 3DK2A 2OX5B 4K94L 3LZRA 2UWEA 3TBWB 2AXHA 4QHNA 5IQ9B 2BSED 2APTA 5EBWB 3NRFA 4B3EA 5A6IA 3AJ7A 2J72A 5MEQA 2ICES 2G5UA 4HGKC 3B2MA 3RL2B 4Z7OB 3NAAL 2V8MA 5BJTB 2OTUB 1JNHB 3Q8BA 2PXYA 4S1DD 1UZ6F 4Z7VA 3QHZH 1NCWL 4JO3H 2IPUK 3D25B 1G7MA 4IGBA 2PCPB 2P46B 1MY7A 1X7QB 4HK0B 5K39B 4KPHH 2R29H 2AEPL 1N59A 3FCBA 3CV5A 4ONFH 4QR7A 3QFJA 1TZOA 1UZ6E 3K6OA 4NFDA 5DUML 4KKAC 1JI1A 3REWB 1I1AC 4V2CB 2BNUA 4D9LL 3OWEA 3KHOA 2R0KL 4LEXL 1WAPA 1FGVL 4BIKA 3WKML 1UM6H 3R1GH 3HG1E 5DJ2A 3MR9A 3NZ8A 2IBZY 5H37G 3IMSA 5DJDB 3EIFA 3NCFB 2AJSH 4ZTEA 4TYUA 3KLAB 4JHZA 2X1QA 5DR5L 4AYEC 2EAEA 2ZTBA 3B7RL 2V5RA 1OSZB 2IWGA 4J28A 2OMVA 5D1QC 4KZDL 5FCUH 4P8QA 5JQ6H 4E9VA 4HXAL 3S5LA 5F0JB 3X11B 1Z0MA 3MYJB 5LAPA 5B38A 2D7MA 3X17A 4FQQB 5H35B 1DJWA 3THML 1DN0B 3HG1B 1X4YA 5D2NB 2R59A 3RKDC 5EPMA 4DKTA 1B4JL 4P2RA 3ZTNH 2Q76A 4ZMLA 4LSSH 1MFNA 4MJ4A 4WCYL 3PJNA 2BSCA 4KKBD 1S3KL 4M5TA 3FRUA 5CIPH 4XNZB 1AQMA 4HGMA 1I3RA 1F42A 1E7UA 2J1XA 4NPYA 4PWGA 3OAUH 4P99A 1RZGA 4FYRA 2NNCA 4A7TA 1JBJA 3VFWB 4ENED 3AG4B 3GNMH 4XXDB 15C8H 1S7WA 4UTBL 2BC4B 3LNGA 2HJKB 2BCKB 4WV1B 5ESQB 2BY0A 4NWTL 2F6AA 3B1UA 4N2IA 2YUZA 4JM2D 1UXSA 4B9ZA 1LWHA 2NUPB 4K3EL 4YO0B 4WKZB 2XZCH 1J1XL 1XIWC 5CZXD 1IV8A 4QHPA 4ERSL 3U6RB 3FN9A 2QR0A 5AOJA 5E0FA 3MRHB 2OMYA 1BOGA 3BIBX 3O81A 4M8QA 4S0HA 1T2XA 4JFVA 5ADOL 1E9PA 3L9YA 3BAJA 4ZZFA 1NM9A 1OE3A 3ARZA 5I6MA 4L0YA 3OJVC 3RX8A 2CNYA 1RFDH 4WSGA 3KXFA 1HNFA 2W94A 3D09A 2GJ6B 3OKLA 5SWZB 1BFVL 1SJMA 1XGYH 4NUJB 3MV7E 1T1WA 4NP9A 4PR5B 3RP1A 5KG9B 2O72A 1TJIH 5LHDA 3SPVA 4X6DB 3ARSA 5E2UL 5AW8B 4XNYH 2DBLL 3SDCD 4KKNA 1EFXB 3DI3B 4DOHE 3D7PA 3I9GL 2Y7SA 3LRSA 3WIHA 5DRWA 5GGSB 3RY4A 2KQNA 4QHUB 3TA4D 4HQQL 5I8EA 1L7TH 1FVDB 3PJSB 4Z7WA 5ICXA 4ZAKB 3VI3E 5DI8B 1WLHA 4MDJB 1T0OA 2P5WD 1SBSH 3E2HB 4LFHG 2GHZA 4FKHA 3KPRB 4FFWC 1RMFL 3GQFA 5HI3D 3QZNA 3I6GA 4KJYA 4NUGL 3MO1B 1XH3A 4S1QH 1A9VA 4X2UA 4MASA 2CCLA 3TBVA 5I8KH 3RGBA 3CVIH 1NDMB 3DX0A 4J6RL 3EJSA 4JO1L 3QJOA 4U6XA 2CNZA 3SN6N 4OGAC 4R7XA 3VI3B 1J1PH 3CH1A 1BD2A 2PCFB 2W59A 2E5EA 5SV4A 1PD6A 2IC2A 2QV4A 1ET5A 4NXSA 1QEXA 3HMXA 4WHYH 1X9UA 2B0SH 5K1JA 1XVSA 2Y72A 3B9KD 3IDJB 5D5MB 1ZLSL 2FH6A 4F1ZA 3VD1A 4W9CC 2H8PA 4HBCH 2O6FA 3GMQB 3FBQA 3E6FA 1LK2B 2J20A 2JKWA 3EUUA 3LQAL 4MA1B 4BWTA 3QUZB 1V7ML 4RBPK 5H2BB 2FBJL 3W82A 3D06A 3EJUA 5I74C 3TCXA 2Z8SA 3ECBB 3WTWA 2K9UA 1KN2H 3QG6B 3KR3H 3TPUA 4FXTA 4AMXA 3PWVB 2G9KA 5E99H 4E9WA 1ZHBB 3P9WB 4RFOL 2R9HC 2TSAA 4BQ9A 3OHXA 1SJVA 4WW2B 5HI5C 3D69A 1HWWA 3BCFA 2YAMA 4NI6A 3HR5A 2G5BA 2HLEB 5CR1A 4WI6A 3T65B 3HFFA 1G87A 3DMMA 4LL1A 4O4YL 1QUNA 5IGXH 5GS1B 2K78A 4MCNA 1OEZW 1J7VR 2IANB 4UB0H 2DMCA 1AXTL 3BN9C 2IWFA 1X9LA 3UTTA 2G75B 3SJVE 3IDIB 3ARBA 4BHUI 4YXHH 4U0RC 4JREC 3S97C 1JWMB 5K9OB 3I3EA 3KWTA 5HHQB 1EK3A 1S9YA 4ODXA 2B08A 4FDWA 2VDML 3BPNB 4PGDB 1BFTA 1OSYA 3MLZH 4H7VA 5FO8A 1MCBA 2X6AA 2R7EA 4A37A 2ZSWA 1HIMH 3HZ3A 5C97A 1ZJAA 1XDTT 3Q44A 1BZ8A 3D18A 1ETJA 3SJVB 4N2AA 4YBQD 2B1OA 3D3VD 4DUWA 4ATWA 1FNLA 3OKOB 3WTVA 4RFEB 3U0PB 2A6KB 1I4FA 3LNHA 2B4CL 4QLRA 3UBFA 5IHZB 3PIQB 2VQ1A 3IGKA 5FYKE 4HIQA 4JRYA 2DD8L 4FFYH 2J6EH 3NIDE 3GMMB 3ABKB 3NTCL 3O3EA 4L2LA 4NDMB 3FZUD 4UBDC 4B9KC 3WAJA 4JHAH 1FH5H 4HV8B 4FLSA 1NDTA 2P43B 1FZJA 1OZTG 1DZ0A 3VSVA 4XMKL 4ANXA 3APDA 4XWGH 5FO9A 1CE1L 4HSQA 3Q9QA 4XC1H 4YSOA 2VDPH 5IT2L 4J3VA 3OKNA 3IDNA 2EE6A 3ILEA 1HI6A 4L48A 3OSKA 4N90D 3F12A 1PZUB 1CLCA 2E9GA 1MLBA 3NIDB 2ATKA 5SWSA 3FTXA 2YAFA 2IQAB 3RZCD 3HS0A 3G7TA 5E00A 4N28A 1GC1L 1IAIM 4KXCA 2E27H 2FLRT 3GF8A 2AI0H 2PYFB 3ULVL 3GUFA 1FYHB 4F1SA 3WMQA 4D8PB 4JLRB 1HQRA 5F7MC 3T2NH 5CFHA 1BF8A 3H3PL 4H8PA 2P5PA 3QYNA 4WI9A 1F3RB 4H13C 2KZBA 2VLLB 2A6DA 2JI3A 2IPKA 2L8AA 1A6TB 1RK1B 4GRLB 4LBEB 3EFDH 4XBEL 4OI9A 5EOQL 3RWFA 4E0RB 5K9JL 3L1EA 1U8CA 3RGVC 4CN1A 4PP1C 1KIQB 3ULVF 5FDWB 4FNQA 1IAKA 1RIUH 2A77H 2HLFC 1KBVA 3QNZA 4U3SA 3F83A 4O5LL 1G9EA 2AV1B 3P4NB 1T6BX 2W0FA 4KK9D 2M1KA 4LU5L 2F2HA 2C9QA 3F04A 4IBTA 4Y2DD 3VXRB 4KY1H 4M7JH 3SKMA 4JFHE 3KLKA 1UACH 2XT1B 2C26A 4PRAA 3ULVE 3S6CA 4OFPA 4HUWB 3MBED 3TURA 3WHXB 2LLLA 3PQYB 3QZBA 3VXMD 1GGIL 1LMKA 1AO7D 4XPFL 5C0GB 1KZYA 5FGRA 3NJXA 1I9RL 4J4PA 3KYAA 4OVVA 2RQ8A 4XBMA 1WUZA 4NQCA 4WEUD 3HAEH 5DJCA 1LEGA 3FB6A 3MUGA 3QUYC 1TNMA 1FZKB 3L4XA 4YNYB 3EYQC 4XP4H 3S3BB 2EXTA 4EBQL 4JNXA 4FI6A 1DQJA 3FFCD 4IKLA 3WHE0 1ZE3H 3MV8D 5E5MA 2FSDA 5KVGL 4M7LT 3S4SA 3SE4A 3POHA 1SY6H 3QXUA 2GC4C 1EPFA 3BFQG 3LN4B 3Q8FA 2WYZA 3RWDA 1WH0A 4YXLH 1M56B 1EHXA 5C0CE 2OXGA 1ZANH 4W68A 4PWFA 2HPTA 4YPGA 1K8IB 2APSA 2Y3AA 4HS6A 2EXWD 3EH2A 3WDHA 1KDIA 1P1ZA 5TDPA 2DI9A 4WGVB 2ICWA 3RNQA 3NPSC 5GS0C 2YLHA 1DVQA 4XODA 1MVUA 1JRHI 2MHAB 3CHRA 2JCCA 2W60B 1GS6X 1ZA6A 2DEWX 3BXNA 3GXIA 3P2BA 1F6AA 4JY4A 2DM2A 3L4VA 3QORB 2CWRA 1OGAA 1AQKL 4L8CA 2A1WL 1YEFL 5KSUA 5AB2A 1YY9C 3NCBB 3ZT5A 2NY0C 1KCRH 2X5PA 1GMIA 4CN6A 3P77B 4L1TA 2QGCA 2NXZB 2OCCB 1LO3L 3CDYA 3K4DA 3L54A 3QCTL 1YEGL 1Z5LB 1J8SA 2HX9A 4S1RH 5FUOH 4AW4A 4YZWA 1PYWA 2EIKB 3NIGE 5LAXA 2N7AA 1SMAA 1CFNA 2H7WA 1NBZA 4PJDF 3FRPA 4Z3EA 4CMHC 5I18L 3MBWB 5DXWA 1H0DA 3MREA 1MVFA 3AXLB 3X3FL 1R24B 4ZS7L 3D1MC 3FS9A 4WTZA 5ESAB 2GC7C 3IETB 1E65A 1TZAA 1UWEL 4JRXB 1J48A 1T0PB 4Q2ZA 4IBZA 2C5DC 2VUKA 2NY3D 4PJDE 4F5CA 3VXTB 5DRXA 1I3VA 2LFEA 2LLGA 3NIGB 3OQRA 1AGCA 3MV01 3VGEA 1ETA1 1VA9A 2KERA 2X09A 3WUWB 2JQMA 2VM4A 1Q9KB 3FC8A 4M1CD 3ME0A 2OXHB 4F9LC 1FGVH 5DGQA 3NJLA 1P53A 3SE3A 2WNWA 1SQMA 3BKJL 4DK3A 4YWGL 4M5YH 3Q1EA 3VXOB 2ADJA 1J8RA 3OKEB 5C07E 2ENJA 2IOMA 3O6LH 2XTJC 1ZE3C 1FBIL 3H42L 4FQXD 2XQ0A 4X98A 4FTDA 1XR9A 3ARED 2D9QB 1S8DA 2V2TB 1INEH 1NGZB 1BVLB 5E9DE 3UTZB 3ZTJH 3MROA 4HLEA 1IO4C 4OCWL 2QZQA 4P5KB 1ZPUA 2COQA 3LZNA 4JL1A 5C07B 4XPGL 4ACTA 1S3KH 3H9ZA 1FNAA 3QZLA 2FEDC 5HHMD 1L3NA 5I1JL 3QEUB 4R7VA 1HHKB 3MV9E 4D9RE 1JZ6A 3E8VA 2WZ0A 3SDAA 4XX1E 2XN1A 4RMWA 1ZVSB 2VL4A 3HPLB 3H6JA 2QFPA 2OJEB 2DQIL 5FK9A 5E9DB 1FRGL 3UBHA 1X5YA 3GMOA 2F74A 1FFRA 4PJ9A 1R3IL 3KDPB 4MMZC 4HF5L 5I16A 2C3HA 3Q3GA 4XB8A 4NWTH 2FJHA 4K94C 1LK3L 1E2ZA 3T0VA 3VI4F 1XGRB 3MV9B 3G04B 1K85A 4I3RH 4K3EH 2EC9T 3ROOA 1S7VB 4LPVA 1A8JH 4PRPD 4MNQA 1IL1A 1J1XH 1N18A 2XA8L 4YJZL 1IBHA 1OANA 2G2PA 2WSKA 3MXVL 3SO3C 5B1JC 2GK0B 4AYDC 3BDYL 2B1AL 4ZQKB 4I2XA 3W38A 3B56A 4CBPA 4Y19B 3VI4E 1GGYA 5DJ0B 1HH9B 2ZX8A 4PTTB 3RILA 3VFMA 4IOFC 1AAJA 2BJML 3RY6A 5KBMA 3V0GA 4FQJH 4XCFH 1QZNA 4FZEL 4OU3A 1BFVH 2FYYB 5EZJB 4PSRA 5H8DA 3FUKA 2VXSH 5IMLA 1Z2KA 3EYFA 1CT8A 2WN2A 2FX8H 4ZW5A 4P9HL 1YRKA 3I9GH 5GRZA 1WHPA 1CXEA 2CLVB 2YKLL 2DKMA 4NRYB 4HQQH 2CO1A 1H19A 2V9TA 3A67H 4L4VD 4ETYA 3RU8L 1F4WH 1PLCA 3ZDZF 1IBFA 2YC1B 3H9HA 3NH7L 4ZMTA 1UD8A 4NO3B 2EC9U 5CWSB 2J2ZB 4PJXF 2O5XH 2Q20A 3QJZA 3QRBA 3E3QE 4G8GA 1J8KA 5DMIL 3E8UL 2EDXA 3WV0A 4OZIF 1CYXA 5M94B 3OAWA 4ZTOL 1JZ5A 3PAVA 1MXGA 3RVUC 4LCWD 3TM6A 5PCYA 1A3LL 4KKQA 4PJXE 5IB1A 2R15A 4H26B 1UEMA 1JYNA 3CFQA 4IS6A 4WFFE 2GSIA 4OZIE 4R6UA 3TXAA 4LHUD 3QXDB 3ARDC 2QKIC 3KEDA 3PWLB 4QY8A 1AS6A 4DN3L 5J57B 3U83A 4WU7A 4G7VH 5CINH 4FI7A 1TOXA 4FG6C 4EI5D 5GZOC 2O6CA 3BRFA 5IBTH 2XOTA 3IDGB 1ZXQA 3LQAH 4Z9KB 3WUZA 1V7MH 2FBJH 4RA0C 4FFVD 3NCWA 1IC7H 1WC7B 4CU8A 1M6OA 3QXAB 3MNVB 1VFMA 4OFIA 4PVMA 1K4CB 1DLFL 1EIBA 2Z4QA 1DQQB 2EIMB 4GPVA 4RFOH 3TA3B 3F01A 4AE1A 5JQIB 5F7EL 4FXKC 5J12B 2V8LA 5HY9B 4QWWC 2BMKB 1XL4A 4WO4C 2A2QT 3TJPA 1WPCA 1WBXA 1U8OA 1IBZA 3FUNA 1A4BA 2BP0A 3QZWA 1HE8A 2CIKB 1AYRA 2GB2A 3H6AA 3N04A 5D4QA 1ZXKA 5CEXA 4N8UA 2NYKA 3QCVH 5FYKH 2R1XB 5CBEA 3HG0A 4CNIA 1CGXA 5E5UB 5B8CA 5IV2A 3NJJA 3KLHD 3QDGA 1AXTH 3WHE1 3KPSE 2OK0H 4N87A 2IVFC 4JFZL 32C2A 4DPRA 4MAZA 3LNIA 4QRRD 2VDMH 3BP7B 4OCLC 4GXVH 2VR5A 5KSBE 2WLIB 1G4RA 4PTUB 3EOBB 3S2CA 2JB5L 1MNNA 2GG1A 3C60B 1SEQH 1XR8A 2CDGA 3W9DB 2MQ3A 4ZXBB 5EIQA 1PLGH 4ZOBA 4AEHH 2XWRA 1YMME 2PYEE 1WD8A 1A2YA 4F2EA 4HKZB 3CHPA 4M1GL 5KSBB 4ZRGA 4I88A 1ADQA 4ONHB 4GEJA 3F3HA 4IW4C 3REVA 1Q1JL 3IM1A 1IQDB 1SDDB 3RZWA 5DVMA 1JV2A 3FSZA 3ERXA 3RBSA 3C5SB 4RMTA 1RPQA 1J86A 4EJ1C 3MRRA 1C9SA 4XGZA 4XP6H 1YMMB 2PYEB 1CE1H 3OR7B 1NBYA 2MOGA 4L3CA 1YYLH 3VFUB 2P42B 5EDSA 3HB3C 2DTSA 3GGWA 4MQTB 5J9PA 3HW7A 4ATTA 3VFSB 3LV3A 2OTWA 1PZDA 4HZ1A 2OL3L 2GTZB 3L5HA 4C56B 2P9RA 1EGJH 2YBRA 3LQAC 1NCOA 4PJ5E 5FHAH 1S9XA 1A5FH 3OKDB 2NSQA 4GW1B 3AROA 3QO1B 4HUVA 2EVJA 5HGGS 2Y36L 3FB5B 3UTSD 1T1YB 5E03A 2X6BA 4OZHA 1Z9NA 4G43A 2BY2A 5EN3A 3S48A 1NBCA 3ULVH 5LCVA 5IIEB 5EIIG 1QPPA 5JIQA 3RPBA 2FJFB 3TT1H 1N6QL 4H88H 2ARWA 2ZSVA 5KVEL 2V9RA 5FR3A 4P9MH 2ADFL 1DO6A 1EEZA 1MREL 4KDTC 4OZ4B 3ZQWA 5AOIA 2BVYA 4JFOB 4JDEA 1TQWA 2PXYD 2GJRA 4PJ5B 2H3KA 4GW5A 3GMPA 2FWLB 5AOZA 3OTTA 1HINL 1XZ0A 2ESVE 3GSRA 3P73B 3ECWA 3D4ZA 4IGBD 2VZOA 1OAXL 1FWXA 1XCXA 3IKCA 1ZHNB 2C9PA 4IRJA 1W80A 4M1DL 4PCYA 2MNUA 4W9EC 5B38G 3S5LG 1MJJA 1L4IA 3QFJD 4MJ5B 3LH2L 3BT2H 5DQJB 3MLXL 1E6OH 4AYFA 4M4RB 4FP8L 3W5NA 4LASL 1TFPA 4HX1A 4LU5H 5CFAA 2IFGA 2AZUA 4AQEB 4NJ9L 4M02A 2FR4A 4OGXL 4Y1TA 5MEOA 1QFWH 3HOGA 2ESVB 3LPPA 3OAYK 1TTAA 3RNKA 5HYJE 2R8SL 1W0YT 4Y8AA 3UAJA 3AS2A 3OZLA 3ETBF 1GGIH 1ZLDA 4U1SA 3FSAA 4XPFH 1CB4A 1I9RH 5KYUA 4YHIA 5I1AB 5D1ZC 1C5BL 4EZKA 4XPTL 1H5BC 1RUPL 5DMGD 1HILB 1KULA 1R3KB 2IPTL 2B4CC 3PWJB 4EBQH 2AXFB 4FF9A 4P23B 3L2LA 4PJ8C 4UQBA 2BWIA 1GMEA 1QUPA 4K3GA 4NZDA 1F4YL 3KBPA 4KQ4L 2F5AL 5HYJB 1JZ7A 4LK4A 3V0DA 4HJJL 3LEVL 3L3GA 4P2RD 4KKLC 1FFOA 1OIOA 1TZGH 3GHPA 4O9HH 4PLNC 3QJFA 4NJAL 5DYOA 5I8CA 3T0AA 2DQ6A 3VMNA 4HUXB 1WWAX 3S8WA 5L2KA 4DK6A 3ALXA 4JZNA 5LVEA 2NX5A 4V2BA 3NJNA 2QSCL 4Z7UF 2PTUA 4OD1H 2WWNA 1PEZA 2OJ1A 1JZDC 4L2YA 4U1LA 5BUGA 3WLWD 5DFVC 5I15H 1GC1C 1JPSL 4GXUM 4QRTB 1E4WH 3ULVC 3L2MA 3LKNA 3EGDB 2C9VA 3Q7JA 4Z7UE 5INDB 2A1WH 1UD6A 1YEFH 3WJLC 3BIKB 1MCOL 2ARJA 4M6AA 5ERWA 2OZNA 5GSVA 3QCTH 2WMPA 4JFPA 1YEGH 4D9QE 4KAQL 3ZTEA 3APFA 4RISL 1OLZA 3B9AA 5FB8B 3G6JE 4TSAL 1HN1A 2PW1B 3UAFA 5I18H 4FFZA 1CFSA 5IG7B 4XO9A 5IB2B 5DRNA 2XWXA 3X3FH 4K71B 4PU2A 4ZS7H 1S3RA 1IKNC 1PAZA 5L8LB 4AK2A 3TFKC 1W6LA 1E8XA 3BDXA 1OK8A 3DO4A 2HTLC 3N44B 4MDIB 1FO0B 1TEYA 2SODB 3QNFA 5D6CB 3FU7A 4AT6A 2KLSA 3GXPA 2YGQA 2F68X 2Y2YA 3VDAA 4A7GF 3G6JB 4PJAF 3ZMRA 3JTTB 4B95C 5JW3L 4NSKA 5F9WB 1WWBX 1E8ZA 4GFXA 1AR2A 2CO6A 4ZUVB 1EZLA 3D2TA 1T66D 3AUWB 2HRLA 4QGYA 3CGTA 1JN6A 3U48A 4EOWL 4FOMA 2A83B 3G6DL 2O61A 1ZVYA 1WZLA 4LIQL 3DGCR 1F13A 4PJAE 2O5NA 1WZMA 1SYVB 4NC2B 1X9QA 2BIQA 1B0GA 3PWUA 3RWGB 1EA9C 4PVLA 3OV6A 1CLYL 3MJ8B 1QSFA 3H42H 4WI7A 1BD2D 5I19H 1A6VL 3JWNG 4PBVC 4MNHA 5JR1L 4FN0A 5DWPA 3MRQA 4WWOA 4R96B 5FOBA 3CVCA 4MJHA 4DAGL 2QADC 5BO1H 3MBXH 4PD4J 1QO3B 5EEZA 4OCWH 5I0VA 3D85A 1P7KA 4JFWA 1KLUB 4JFEA 4K3HA 3S5ZA 1RPKA 3FQUB 3GMNA 2I07B 3IPBA 4PJBF 5IW3A 2H26A 3H2QA 5D2LF 3D0VA 1Z9SB 4MJIA 4G9FE 1UZ8A 2OULB 4GW4A 1FC2D 4IIQB 3L3OB 4Y1AE 3V4VB 1T6WA 2CO3A 4OF7A 3GBEA 4ELMB 2HFGH 3OMNB 5JMRA 4YXKL 3MRGA 2E9BA 2Q2EB 5CZVL 5KYWB 3Q2VA 5ECJE 4AJ0A 2EQDA 1CLOH 2XLLA 5HGAA 3M7FB 5K9QG 1AGBB 1UUSA 5D2LE 3MNZA 4O2FB 4B7IA 4NFCA 4R2GB 4GKSB 1CR9H 2HRPL 3GSWA 3HBPA 4HKXA 1IQWH 1LK3H 2YXFA 3L5WB 3QDJA 1I7ZA 4G9FB 4NN5B 3DMMD 4NLHA 3V5DA 4Y1SA 1ZTMA 2XA8H 1YECL 4X4YB 2WOBA 3BGAA 2WO4A 3FONB 3S37L 3MXVH 1S78D 4J3SA 5F7AA 1HYRC 3LEXA 4JUSA 3QUKB 3WNMA 3UTTD 3ZIYA 4HCIA 3ARBD 1B2YA 1N67A 2H9GA 2HKFL 3FT4A 3LY6A 1WBZA 3QUXA 1NEZB 3BLBA 4BFFA 3GHBL 4DJMA 1ZK5A 5IQ7L 1K3ZA 1D7BA 1YJDL 4H2AA 2X9XA 3ARFC 5CSZA 2BJMH 1MFEL 2OV0A 5D1XB 2J1ZA 1KPUB 4LSUL 1IGFL 1KWKA 2XBTA 1MG3C 3B6SA 2BSSA 2FL5B 4LAQH 4M9PA 5J6GB 3A5VA 2Z31C 2G4EA 4P9HH 1GGTA 1AD9B 3BHBA 5EU5B 1HSBA 1KJ2B 2WBJB 1JCKA 3RIFF 2YKLH 3D8MA 2K9FB 4XNUL 2RJMA 4BGDA 3CFDB 2A38A 2HJLA 2XG4A 5KSAC 5KSVB 3RU8H 2OSLB 1DBBL 3N2JA 4I9WE 4RLDA 3V6OA 3MRBA 3DROA 1IFHL 4A2DA 2XJKA 3PWPA 2JXMA 4JO4L 3BRDA 4DVBB 4UU9A 3O8XB 3EW3B 1VFAB 4JRYD 3NFSH 3RL1B 5D6DC 3QK0A 2NNRA 3K8KA 4PAZA 1QP1A 5GRJL 3US1A 1MCQA 4JG5A 3BDBA 2IGFH 3TIDB 2SEBA 1XL6A 5DS1A 3T6XA 1T4WA 4NGHL 1R5IB 3SCMC 2FJSA 2R2BA 1U8QB 5TQ2H 4W9JC 1NC2B 3FQXB 2VC2L 5GRWA 2FUQA 5E6IA 3P4MB 1WA2X 5SWSD 2JKTM 3RDTA 2ZUQB 1KB5H 5EOTA 4A2GA 3EGSB 5KTEL 3FN0H 2CGRL 1KXQE 2IDQA 2R56H 3ATEA 5F1IB 2IG2H 3HUJB 5DJZB 3S37X 3KWXA 3U7YL 5TTRA 3BVNA 3NIFF 1WTLA 4YDVB 1EAJA 3B2VL 2ID5A 4AZ8A 8CGTA 4ZMOA 5CEYB 3KPNB 2QEJA 4JFQA 4U0QB 1ETZA 4Q9RL 3DPBA 3QA3A 4GG6F 3VQMA 1I1AA 4DEWA 4POZD 2P44B 5A2BA 5F6IC 3CHOA 4KTDH 2VITA 4NI3A 5FYJU 4QYOB 4J12A 4D3CL 1G7JA 2ZCZA 3H2PA 5F7EH 4KKCD 4WWKB 1WS7A 1NCAL 2BCMA 3K5SA 5TF1L 4C4UA 4NAQA 5IJKA 1AIFB 1JV5A 3BP6B 1D7DA 3QJXA 2VR8A 2E9IA 2ZUYA 1JRHL 5LBSA 4HUUB 3GLEA 4XNDA 3JV4A 4CU6A 5A40E 3ZL1A 5I76B 1V3LA 1VGEH 2UZIH 3TF7C 2E6PA 5D1QA 2FIRT 2VWEE 2OMZA 1EQWA 3S4SG 4K7PL 2J57A 2WBXA 1FAIH 4PJ7A 2EYSB 4OZFB 1U33A 5K59E 4GBXB 3LS5L 5FO2A 2EP6A 5DK2B 1QI3A 4MS6A 4N6RB 4F58L 4RA3A 1DBJH 5BZXA 3WFEH 2BRQA 4P9HC 5I71C 4JY5L 3MRMB 2IDSA 4J4PD 1IIIA 3FT2B 1JXFA 1P2CB 3R8QA 4IMLA 4K15A 4TVPL 4NQCD 3I9PA 5JO5B 2NRDA 3NA9H 1HXYA 2G2RA 5AD0B 4ES8A 2Q10A 1UATA 3UJJH 3SD5A 4W4OA 3MRPA 4WWID 5CP7A 2KDYA 4XI5C 4CGUB 4UIKL 3GB7B 1X4ZA 4MAYA 4OGYL 2W81C 4F15C 1U8KA 4NFBA 2IGLA 3HN8A 5F7LB 5JNYB 1T22B 4Q74A 1XIWA 4G3YH 4YHKL 5CU9A 3V8CA 4H40A 4J1UB 1CMOA 5KS9E 1IC4L 3IDUA 1CDCA 3L48A 2HT2C 1NCDL 4MQ7B 1MQKH 4MXQD 3P0GB 2CGYA 4X9IA 1DVTA 3V95A 4XOEA 5IVZA 4PUBL 3FOLB 4WTZG 4LCCA 4XCYB 4TVPE 3FUEA 1IUZA 2Y2TA 1TQBC 4XH2B 4JVUA 3VWJC 1J1OL 2OL3H 4KJPC 5EBLA 3PGDB 2R29A 1OGAD 2XVGA 4CMMA 1R5VA 5CMAA 1A4AA 4HS3B 2E4FA 5KS9B 4LHQB 1NSNL 3WJMA 4BRVA 4AVHA 2VMDA 5FWQA 1LQBC 1N4XH 4LRIC 1LVEA 4K7PX 3DSNA 4UYQA 1E27A 2NY1C 2WLLA 1DQKA 5DLLA 3VYOA 2BIPA 2CCVA 4ODHH 4N8CL 4B96A 2WVUA 1T89C 3MRDA 5JOPE 4FD0A 2NXYD 3NUKA 3N0AA 2CKBL 2X9WA 4G5ZL 1KGXA 2KBGA 1G0DA 2CA4A 4M62L 4RMRA 4UWQB 1O9ZA 4PI0A 1BBDH 1Q4NX 4LSVH 3ELAT 4QDGA 3S5YA 3K72A 4AQZA 4JM2B 1F86A 2K4AA 3M46A 4JJ5A 4M1DH 3P4OA 4FTVA 3KGRA 1LO2L 2W65A 2XDHA 2JJTC 4GMSH 4G7YH 5LWYL 1ZAGA 1MPAH 3QDME 1W72A 6TAAA 1KTBA 1DFBH 4U1KB 5HSFA 4I77L 1I9IL 1NH6A 4NJ9H 4N2LA 1C12B 3L1OH 3PPSA 3W0WA 2IBGA 2ENSA 3LH8A 4APQC 4G1EB 3NA4A 4JFYB 2D31B 3CZUB 3IJ9A 4JAMB 4M3JA 4BCZA 1N12A 4BUHA 3FYEB 2P5WE 2APXA 4K8RH 2HA1A 3P9LB 3GS0A 3AXIA 3F6IA 4FL4B 4PI2A 4H4NA 1C1EH 3C6LA 3BWUF 4Y5YB 2GJPA 3BAEL 4XPTH 1KCVL 1C16A 2F7OA 4AGLA 3MGTA 3MLRH 5KWYC 5HDQH 4FHKA 3L95B 3PGCA 1J05B 4TPRL 4KQ4H 1P4IH 2F5AH 4KV5F 3ZDYB 4E42B 5EO1A 4HSCX 3MDJA 1N8OE 2P5WB 4HJJH 4EDXB 4JKLA 3NFNB 2ZQKA 4I1NB 4KMQA 1KCKA </