1GS7A

Crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs7A02
3S8GB 2GC4C 2GC7C 1NWOA 3AG2B 2OCCB 3S3CB 3WI9A 4NB7A 1TEFA 3TU6A 1JZGA 2AANA 3FYIB 2VW4A 1ET8A 2CALA 2FT6A 4M4RB 1AG0A 1JVLA 5TK4A 2IH9A 4A2DA 3FSVA 1WA0X 1JERA 2BP8B 5I5MA 3ASNB 1CURA 2RACA 3UABA 1SNRA 1WS8A 1WA1X 2AVFA 4HHGA 3TASA 1NIFA 2ZOOA 1EHKB 2BWDA 1JZEA 4A2EA 5FC9A 3ZBMA 6PAZA 1PLCA 4M3HA 2BP0B 1NPNA 2UXTA 3JTBA 4KOCA 1NWPA 3QJRB 3CDZA 2YAPA 2I85A 2FTAA 2YQBA 1BAWA 1OCRB 5E9NA 3X1NA 2HX9A 4YSAA 1WS7A 3NSYA 1PZCA 5I6LA 3N2JA 2Q9OA 3X1EA 1MG3C 1NICA 2R7EA 1PMYA 1OE3A 1YLBB 2PPFA 4YL4A 1AZCA 3WNIA 3OMNB 3NJFA 4UAHA 4KO7A 3H4HA 1E5ZA 4YSEA 2JKWA 2W8CA 2XYBA 2PCYA 3FT0A 1KCBA 2DV6A 3C75A 3EH4B 4KOBA 1SF5A 3PPSA 4G70B 5PAZA 4DP6X 1ADWA 2CAKA 4F2FA 2FT7A 3FSZA 3FU9A 4HIPA 4F7KA 1KGYE 2AFNA 2BZ7A 4GP4B 2HX7A 2IWFA 1PLAA 2BP0A 1W8EA 1RKRA 2Y1AA 2PPDA 1CYWA 5I26A 3ABGA 1CC3A 4A67A 1W6WA 1AIZA 2I7OA 3FQYA 4AX3A 2J5WA 4DPBX 2XU9A 1GYCA 2H47C 1ASQA 1KDJA 3AW5A 5I6KA 4E9TA 3FPXA 4E9XA 1EZLA 4KNTA 1L9TA 3T6WA 3ABLB 1BQKA 2DYRB 3H4FA 3X1FA 2BO0A 4ZK8A 3IN0A 1NIEA 5AFAA 1JZJA 4GY4A 4YVUA 1AS6A 3NP4A 4HZ1A 5B7FA 1OCZB 4RH4A 4ENZA 1XB8A 2I7SA 2CBPA 3NJHA 3ZX1A 1ETJA 1NTDA 2HRHA 5ANHA 3FQ1A 3NSFA 1AANA 1PY0A 8PAZA 2PP8A 2PPEA 1E30A 1J9RA 4A2FA 1JZHA 4DP1X 4FA7B 1L9QA 3U25A 1XB3A 1GSKA 4KO5A 1AS8A 2WO3B 5B1JC 4DP7X 1HFUA 1JVOA 1GR7A 4CSZA 1ZDSA 2J55A 2JXMA 3GYRA 2H5UA 1CYXA 1L9RA 4EF3A 3SBPA 4YSCA 2YXVA 3X1GA 4E9YA 4G71B 2PP7A 2CJ3A 4G7RB 3NJLA 2YAQA 2IDUA 5I6PA 1OE1A 3PAUA 4W1TA 7PCYA 1GS6X 1TKWA 1M57B 3HEIB 3HB3B 4BDVA 1IUZA 4HAKA 1A4BA 2N0MA 1FA4A 1R1CA 3ERXA 1BYOA 1AR1B 1ID2A 1MZYA 1JXDA 1ZIAA 2W88A 4Q89A 3CDZB 3DIVA 2AZAA 3T6VA 1NIDA 2ZONA 3MBWB 1MDAA 3UAEA 3ABMB 2P80A 1L9OA 4WTQA 5A7EA 1ILSA 3EH3B 2DWTA 3ZIYA 4QKTA 2XV2A 3FU7A 3CVDA 3UAAA 1NZRA 4E9RA 4DPAX 4GXFA 3WIAA 4N8UA 1BQRA 3UACA 5D4JA 3OMIB 4UF7C 4YSOA 4QLWA 3QPKA 1BXAA 2BZCA 1E5YA 1F56A 3IE9A 3T71A 1BXUA 4YSDA 1A8ZA 1KV7A 2QPEB 2WO2B 3NSDA 1SDDA 2IAAC 1SDDB 4G7QB 1AQ8A 2ZXWB 3FSWA 4P5RA 1ASOA 4E9SA 2IDSA 3QJSB 5B1AB 3QJQB 1BEXA 2IDQA 2E86A 1PLBA 2X87A 1PCSA 3EH5B 3NJGA 4GYBA 4DP4X 4DP8X 1NINA 2FQEA 1KYAA 1N70A 2FQFA 1VLXA 2PP9A 3NJKA 1HAUA 2DWSA 5IY5B 1ET7A 2PPAA 4YSUA 1AACA 1XB6A 4L0PB 3CG8A 1V55B 4MFHA 2IH8A 1N68A 1J9QA 1X9UA 4YSQA 3FPYA 4AKPA 1XMEB 4BXVA 2BHFA 1GY1A 2NRDA 3PCYA 1IC0A 3CZUB 4AZUA 1DYZA 2QT6A 2FWLB 1JOIA 2HXAA 3QJUB 5I5JA 1L9PA 2FT8A 1PF3A 1AAJA 4YSPA 1ET5A 2B08A 3OD3A 4CSPA 3T9WA 2FQDA 1SHWA 4HCFA 2IDTA 3ABKB 4AKOA 1ILUA 2MTAA 4FAAB 3S3DB 1ZDQA 1QHQA 1JZIA 1E65A 1RCYA 1RZPA 2AZUA 1PZBA 2VM4A 3ASOB 3FYEB 2EIJB 3AY2A 4W9ZA 2ZWNA 3G5WA 4WKXA 2VN3A 3DKHA 5F7AA 1KDIA 3WKPA 7PAZA 4HHWA 1NPJA 2EINB 4E9VA 1FWXA 2GIMA 5B3SB 1IBZA 3N55A 3AG1B 3PAVA 2XXFA 3TA4D 4BWWA 4HCGA 2GHZA 3BQVA 3S8FB 3T6ZA 3IEAA 5B7EA 2EILB 4BDVB 1NDTA 2UXVA 3NYKA 1URIA 3T6XA 3NP3A 3UGEA 3X2QB 5I6MA 1J9SA 1WA2X 2QPDB 3AZUA 4HCIA 1AZNA 1OE2A 2XVBA 3QQXA 4BWUA 4E9WA 1J9TA 2OJ1A 1AZRA 4E9QA 3CVCA 3IBOA 3AG4B 3PXLA 2BW4A 3OM3B 4KNUA 1MG2C 3OQRA 5I5IA 3FQ2A 1L9SA 1M56B 2PPCA 2YAMA 3FU7B 1A3ZA 2Y69B 2UXFA 1OOWA 2FJSA 4Q8BA 3SQRA 3NJMA 2HLEB 3UADA 4DP0X 3SBRA 1GY2A 4A66A 2H3XC 1ASPA 1I53A 3KW7A 4N4YB 3L45A 2J56A 3ZDWA 1GW0A 1J5DA 1SHXA 2MRYA 4A2GA 1IBYA 3WNJA 2VSKB 1OF0A 2LLNA 5I28A 1M9WA 3DTUB 2VMJA 2YAHA 1GS7A 3FS9A 2P80D 2OV0A 4DP2X 4G72B 2VM3A 3IN2A 5PCYA 1NIAA 2BP8A 2FNWA 3CVBA 1OV8A 4KO6A 2EIMB 2CCWA 4BXSV 5AZUA 1ZIBA 4YSRA 2UX7A 2GBAA 2FQGA 3X1BA 5B1JA 5D4IA 2BWIA 1A4CA 1SF3A 3D12B 1AS7A 5EHFA 1T5KA 4DP9X 5F7BA 5LDUA 3FU8A 2YAOA 1J5CA 1E67A 3AG3B 1ZV2A 2HRGA 4PCYA 3OMAB 1TU2A 1KBWA 2YXWA 4F2EA 1JZFA 1KCWA 1BXVA 1A65A 1MZZA 1A4AA 6PCYA 1AZBA 3V9CA 4BWTA 4G7SB 1GS8A 1UATA 1BYPA 3S3BB 3NSCA 3JT2A 5TK2A 2WSDA 2R7EB 2UXGA 1NIBA 3NJIA 3MX0B 1AZUA 3WG7B 4GP8B 4NERA 4A68A 4KO9A 1X9RA 2PLTA 1SFDA 5D4HA 1V10A 2B3IA 4JKNA 9PCYA 4AKQA 1PNDA 3TBBA 3BVDB 3V9EA 1SJMA 3EHBB 4YSTA 1DZ0A 1QLEB 2CUAA 2XXGA 1JXGA 5I6OA 4HALA 1B3IA 5B1BB 4GP5B 2BW5A 3WKQA 4JHUA 2QDVA 3SBQA 2TSBA 1OCOB 1CUOA 1OCCB 2Q5BA 1JXFA 1IKOP 2XV3A 3RYMA 1KBVA 4YSSA 1FFTB 2GI0A 2GSMB 2XLLA 2VW7A 2VSMB 4NAJA 3NJNA 4PAZA 2QDWA 3KW8A 2TSAA 2IDFA 3EF4A 4P5SA 1AOZA 1WAEA 2X88A 2YAEA 2J57A 2YAFA 2XX0A 4TXVB 1PAZA 4X4KA 3GXUB 2DYSB 1PZAA 2VW6A 2XUWA 5B1KA 1ZPUA 3TBCA 4AI7A 4UANA 4BK5C 3PLYA 2XV0A 1QNIA 1RZQA 3GDCA 2UX6A 2IWKA 3H56A 1BQ5A 4KNSA 5B7MA 1HAWA 3FSAA 3NJJA 3QJVB 2HX8A 2IWEA 4DP5X 1V54B 1TEGA 2XWZA 2A3TA 2PCFA 3PAZA 4K9JA 2XX1A 1AG6A 4YVNA 2HZHA 4A2HA 4JHVA 2GB2A 2YARA 4DPCX 1PNCA 5I6NA 2JFCA 2EIKB 2DY2A 5AKRA 3QJTB 3NT0A 1W6LA 1SFHA
chains in the Genus database with same CATH superfamily
1J9CT 4PB9H 1A25A 2YPVA 4FZEH 5A2LH 1LILA 5FUCE 3N06B 3WUWA 4P2YA 2FLBT 3PDDA 3S3CB 4BSVB 3AS1A 3WI9A 5BZDB 3IDYB 3A47A 3IT8D 1BFOB 3IU3A 5BVJB 4P2QA 3D2TA 4N0YL 1DBJH 2C1PA 1MF2L 4HWBL 1FNEA 4M4RB 4X8XA 5CSGA 4KVNH 1JVLA 2D7QA 5EOCJ 1FJ1A 1QSEB 2Y2YA 1HU8A 4UT9L 1UJ3B 1WA0X 1WITA 5EUOE 3VI4E 3QDAA 3T3PF 3MTXA 2CO6B 1J0JA 1JTOA 2B16A 1JPFB 2QHRL 5SWSB 1EERB 3UABA 4BA8A 4HHGA 3DYPA 3KPRA 2DLGA 4P07A 1FLRH 1KTLA 1VFUA 3ZBMA 4LLVA 5GRVL 3IFPA 4MQTB 4XO8A 3A6BL 1NUNB 2OMXB 4RGMC 3CC5A 2ED8A 1QACA 4JFTA 4RISL 3FQRB 2ZUQB 2KMWA 4HOXA 3AUWB 3UBXB 3U6XA 3MRFB 1UD5A 2OQJA 3OJ2C 4LKXA 2NW2B 1XMWA 2VXQA 3GMPB 3F62A 2ICWJ 4P2QB 1CL7H 5IT2H 4NAMA 1X7TA 1XH2A 4ZAKB 3H4HA 3QCVH 1XEDA 2JKWA 2W8CA 4YSEA 1UXWA 1TMCB 2IPKA 1KCBA 4JPVH 4H8WL 5HJ3B 4DP6X 1SJEB 2AJZB 1U8OB 3TH3T 1GL4B 2YGOA 4HUWA 5C9KA 2CAKA 1XF4A 4PH8A 2BVQB 1W0WA 2GFBA 1GAFH 4XNAA 4JRYA 2ZUYA 1J1PL 2IQ9H 1R3JB 4NUGL 2GITA 3QUMB 3UDWA 2X9ZA 5FYKH 1SXBA 5KN5B 2HX7A 4PYHA 1PLAA 3G6AB 4N20A 3CPLB 4F93B 1J0IA 1A5FL 5EF3A 4MJIA 4XMLH 5C0JA 3HW7A 35C8L 4U1LB 2ICEC 1AIZA 4X6CA 3NIGB 3VI4F 4CW1B 4O2FB 4HBCH 1A66A 3F12B 3LKQA 1B88A 4JREC 5KG9B 4L2YA 2WYTA 4ORGA 5DD3L 5E7BA 1JZ2A 4S0HA 4O9HH 3HHMA 3FMGH 4MD0B 5LGJB 1Z7JA 1BEYL 3I3EA 2Z1KA 5DS8B 3D3VD 5AYUH 3B4NA 2I60L 1NIEA 1ZT7A 4QTIH 3O6KH 2B8OT 1GPOL 3BYTA 3VXOB 4F7TA 1F4XH 3CZFB 2VLRA 1RHHB 2AQ3A 1IQWL 4HZ1A 4QRUA 3BUTA 4U7MA 5K9JL 4YHIA 3ZE0B 3HG1E 3HE7C 4N2HA 1UD2A 3U79A 4JY4A 3FF7A 3VG0H 4KKNA 4P46D 1S46A 5E8PA 2YGQA 1RUML 4YDIH 4JDZA 4LLVB 4FA7B 1S7XA 4G6AD 1BLNB 3GIZL 2DTMH 4LPVA 3SO3C 2A9CA 5IMMB 3MLUL 4HG4K 2PKDA 2AK1L 2JXMA 1JS4A 3SGJC 5AENA 3TBTB 5AB2A 3D87B 3RWGA 1KSRA 5C0DB 3BSHA 4KUZH 1CQKA 5DO2C 1AQDA 3TZVA 4AW7A 4D9QD 4PJFE 1HK6A 3VXME 3MRCA 1AIFB 5D1QA 4KK6D 2KDYA 4AJYV 5JTWA 1CDGA 4ODXA 4WO0A 4HS8L 3UTOA 1JGUH 2D0HA 1CLVA 1T7VA 1K85A 1PKQB 1TMQA 3C08H 4OJFH 4ZAKA 5I6PA 4AQ1B 1BGXH 5IFJA 1DR9A 4R5TA 2QADC 3G5XA 3CDFA 1U3NA 4IRZL 5FYJL 4G8GB 1EZVY 1F6LL 1GH7A 3JWNG 2AHIA 5CKGA 3HFFA 3FT2B 3DMMB 3I02A 4ZFQA 3FUIA 5IQMA 5ICZA 1EEZB 4Q89A 4OIIH 2A9DA 5C0CE 4OIFA 4BELD 1VZIA 2NXYC 3RIFF 2OZ4A 2ZONA 4IMLB 4V1DA 2ITDA 4O58L 2A9ML 4YAQB 2HN7B 4DVBB 1OKEA 5ICYA 1S9WA 1NLBL 2WLJA 1ILSA 1QEWB 3L13A 3MDJA 1J8HB 3ESOA 4U6HB 2F7IA 5AVVB 3UGUA 2H6OA 4OW6A 3CJJA 2WINA 4GW1B 2XPYA 4J2QA 2PYEB 2G2NA 1JPSL 1U8CA 3GNMH 4PPTA 5JQHC 2QSCL 3IXAA 3C5SA 3MOQA 5D4JA 5F21B 5E08H 3ISRA 3CIQA 1BXAA 4XP6L 1R9FA 2HVJA 4QHLA 3SE8L 5TE7H 1X5KA 3MLZL 5MENA 3MNZB 3V4PB 3TF4A 1UB6A 4GQQA 1FUNA 5K9OB 2PWDA 4QYAA 3FONA 4I3SH 4WI5A 3WYRA 4AV5A 4Z7IA 5JPMA 5JHDA 3K2KA 4M7LH 1PZDA 1YNLH 3NZ8B 1B2WH 1IGTA 1HC1A 2ESVE 1LP9E 4FQXD 4QWWC 1RAMA 1J87A 3LIZL 4GT0A 5DZAA 1MIEH 4K9EC 4Q97A 3KYNA 1A6UH 4P2QD 3SKOA 3N85L 2NY0C 2R0KH 4IDJL 1Q8MA 4UOZA 2GUOA 2NX5E 4CADB 2XPZA 4YJZL 4KJQC 1F6AA 5TGBA 4Z7QB 4HGMA 2B59A 4AENA 2PPAA 2NX5D 2ZCLL 4WIQA 3V4UL 4CUCA 2C7UA 2NUPB 2DQGL 1E7UA 1KTCA 1MW1A 5TE6H 2WP3T 3B9KB 3MMEB 5EZPA 1IEHA 4MMXA 1E6JL 1EO8L 2ZUTA 1A6ZA 3SQBB 3WGUB 1LO5A 4JGUA 2QLYA 1AC6A 3HCVA 4LOUC 4GXUN 1AHWC 3CV5A 5CGBA 3VWKC 4WGKA 2VH5L 4S10A 1A0QL 3I6LE 4GRWF 4APXA 1Z5LA 3CXDH 1S7VA 5BMFH 1DQIA 4BM7A 2IDTA 3L9RB 2EDXA 3C6SB 4NGHH 1FZMA 5DFVD 3PHOB 4I0PB 1HHIA 3NRPA 1H5BC 4L4TE 4U6XA 3UC0H 1KTKE 2ZWNA 2ZYIA 1I9JL 3DWTA 1QSFD 2VN3A 1MI5D 3GSUB 3DX7B 1R3KA 3FN0L 1HTYA 4R3SA 5KOMC 5DJ0A 4LOVA 4E9VA 1A4JB 1TQBB 3D52A 3HNVL 2G60H 4IGBD 2R23A 3AG1B 1MIMH 3OLEA 3MMEA 2EICA 1WT5C 4CA4A 3F7QA 5G4NA 3CVHA 4OIBA 5K9KB 2HKHH 1FIEA 4R7LA 2WZPD 1K2DB 5B7EA 3U9UB 2D2OA 1TVBB 2ZUQC 4LF3A 4LCWB 4JKPL 4LXFA 1WGOA 2FWUA 2GUOB 1R47A 1YN6B 3X3FH 1INQA 4QPEA 3I75A 4IRJC 3RZCA 3NGBB 3BQUC 5IJKC 5E4EC 3RY4A 1TNMA 4XCYB 1AZNA 1OE2A 4MAUL 4P4KD 1RZJL 1MRFH 2QPFA 1TJGL 3LZRA 4Z3HA 1KN4H 1A47A 1JP5A 2VSCA 1A1MB 1DUZB 32C2B 3MR9A 4FQLH 3SJVA 2YLKA 1JJUA 2J43A 4I9WE 4NCC1 5CEZD 3WJMA 2NXZC 1OOWA 2FJSA 4F8TA 3SQRA 4JFQB 3ULVF 5C09A 1UQSA 4I9WD 2WBJD 2MPVA 1FN4B 1I53A 1FSKB 1PQZB 5F7EL 1OF2A 4O02B 4JZNA 4UQ3B 1G7IB 3L3OB 1IFGA 3V5HB 2QKSA 3MRPB 5F7YC 3MRDB 4L37B 4LHUB 3U4EB 1H8OA 4EI5D 3WNJA 4RFEA 3FXIC 3H9SB 4RMRA 4FNPA 3H9YA 4QXVA 1JK8A 4RX4D 4WLCA 2D7MA 4JAMB 2B39A 3VYNA 1BJ1J 2DKSA 2VDNL 3GSVA 4KPHL 1P7QB 4X8JA 4FFZL 2EO7A 2FNWA 5D6DA 2FATL 4WEMB 5A2FA 2XNAA 4PJ5D 2ZSWB 4HH8A 2EEAA 2AXFA 4KX7A 2WYHA 1ES0B 1PZ5A 3L4ZA 1Q1JL 3VMOA 4EI6A 1MH5B 3APCA 5IHZA 1D5MB 1G7PB 1JWSB 1X44A 1A4CA 4Y4FC 1JWUB 1AS7A 5CR8A 5EZOL 4PVLA 4HHAA 1C16A 1S9YB 5ENWA 3TIDA 2HAZA 3W37A 1NMBH 5AAMC 2BOCA 4ERSH 1EGJA 1GCFA 3LZFH 4WUUE 5FM8A 2RCSH 1RK0A 3MLYH 4S2SB 3SGDH 3EYQC 4UDUA 4YK4C 4P2OC 1U8PB 4A6YA 2Q8BL 4IS6A 2ZWZA 1CDBA 3ULVE 1BXVA 4ODHH 5DUJA 5IMMA 3IMVA 3H3BC 1MWAL 4K8RC 4UIMB 1AGEA 1M71A 4QY8B 3Q06A 2F5AH 3ZYJA 4XO9A 1AZBA 1C5DA 1LK3L 4HUVA 2ICWA 1JHLL 2QELA 2KZ1B 1GS8A 5BNXD 4OF3A 2JKXA 1CU4L 1DSWA 1S7RA 2WSDA 5DRNA 3ILPB 5LHDA 3FTUA 1V7ML 2HFGH 2UXGA 3BSZA 3HC3H 4ONFH 4KMQA 5E1IA 2JNZA 4E0RA 2FUQA 4JFFA 2FJHB 5J1AB 3KJ6H 4M1GL 4BCXA 5K5YA 4PVMA 4LNVA 4WFGD 1QPPA 4AMKH 2B9BA 4Y9GA 3FRUB 5DJAB 3O2WL 5D2LF 3OX8A 5ALBL 1R24B 4PJGE 3CK0H 1CGTA 3IWVA 5BRZE 2XICA 1DQLH 4JHUA 3GI9L 3PWJA 1QUPA 2YSTA 5T1JA 4F8LA 4MSWA 4JB9H 3GMOB 1NUDA 3P40A 3WEAA 3AREB 4AM0B 2C8NA 4X4ZA 2Z31D 2PWEA 2F58L 3AREC 1JGEA 1P84K 1BX2B 1XR8B 3AWEA 4PAZA 4HDIA 5I19H 1ITCA 1HQ4A 1RUQL 1I9IL 1I7UA 3TO4B 2AEQL 4IGBB 4MWFA 2R0LL 3A4AA 3GMNB 1HHGB 4TXVB 4FNQA 1AJ7H 4X4KA 1W8NA 4Y2DC 1XR8A 5AYQA 5EPMA 1SJEA 4HEMA 3CQQA 3IFLL 3CFDA 4LCWD 2YRZA 5T1MB 4UBDC 1TVHA 3LRSA 5H35B 4GSDL 4BFRA 1XZ0B 4HUUB 1NAML 2E9WA 2AC0A 4JQVC 1B4TA 5KAQG 3OAZH 3QQ4A 4NWUL 2HPTA 4KFMA 5EZIL 1L7IH 3HE7A 5TDNA 4JPIA 5I1DB 1NPUA 5CEXB 4YIQB 3MUGB 3ZYZA 2AJUL 4QT5A 2APFA 3QH3A 4PJGF 3OB0K 2BNRB 5H37H 5H37G 3RIFK 4HIIB 3L5XL 3HE7D 4ZSOA 2NZ1A 3CN2A 3IRZA 3PGFH 4N25A 3NCJL 5GZOA 4M61B 4PRNA 2GJZB 4IBYA 4NWTL 3WXWH 5EIQA 1KCRL 2F53B 4K8RD 3TU6A 3S35L 4NLHA 3GPEA 3VXPB 3H6AA 4Y5VA 2ZQKA 4ZT1A 1NLDH 2HKFH 1FNEB 2IH9A 4M4RA 1ZSDB 2VQUA 3H55A 4LHUD 5DO8A 5I1AA 1CLZH 3ZLQC 3TYFA 2WWKT 1IGYB 3C9NB 4AV4A 4X6DB 4OZGE 1ETA1 4H20L 4GXVH 3C60C 4XPHL 3PP3K 5DI8A 2L7EA 1Q4NX 4BD4A 4DCQB 2EJ1A 1KG0A 1EHKB 4RMQA 1N64L 2BWDA 3MV7B 4MXVE 4XAWL 4HS6A 4LSTL 1NQBA 2AXJA 4K71B 2UXTA 3JTBA 4PCSA 1NWPA 1ZHNA 2X12A 5HGDB 4PJ5B 3MCLL 1BAFH 1JI1A 3UMTA 4Z0XA 2YQBA 3E8UL 3V6ZB 3VRIB 5E9NA 5AVUB 1KV3A 4XNYH 3KHQA 4QJ4B 2IBBA 2X3AA 3T0EA 4M7JL 5E9AA 4PRHD 5C08D 3EYFB 4JFHE 2A4ZA 1MG3C 3WJLA 1CGVA 3U30B 1KIRB 3HE6A 4PRHE 3AS0A 3K7UA 3QDGB 5G2NA 4C57C 2X6CA 3BP7B 4ODBD 1H15B 3C6LA 1MFCL 4ZRGA 1DO5A 3PPSA 2L7UA 1MJUL 3B2DC 1BMWA 1L5GA 2XN2A 4EZMA 1MREL 4KTYA 4LMQE 1RHFA 4WW2A 1M1SA 4RBPH 3VXSB 3G08A 4NRYB 5D4QA 3TN0C 5IHUH 2BZ7A 4G9DA 1LD9B 2P8MB 5D7JC 1WC7A 2WKLA 2ZP8A 4XCCL 3D7PA 2WXHA 1TZHA 1P69B 2G3XA 4IOSD 3CHPA 4N9GB 1UQSB 4NENA 5CJBA 4GUPB 1TO5A 3T77B 4JFZL 2RQEA 2CPCA 1HE7A 1JPTH 5AKTA 1LO3H 2VABA 4A6YL 2ZG3A 4HEPA 5AVWB 2NQDA 3ZTJH 5KSAD 1ASQA 4ADJA 5IUCA 4GQ9L 3BVUA 2C9XA 4R90L 1F58L 2HTKC 2VDRB 3SIKA 5E6ZA 2YKLL 4M7ZC 5IOPA 4YO0A 3CSYA 2B1AH 5F7KC 5HHXL 3GB7B 1E4JA 4Q2ZA 3RUGF 3OC5A 3RIAF 3N42F 3WNPA 4DUXA 4QRPD 4UIKH 3FO2A 2FX8H 4HEPG 3FCSA 3HPLA 3QIUB 1PFOA 5A1AA 1KLFB 1S7QA 3F7VA 4HIHB 5DHVA 3TOPA 3PL6B 4FNUA 2PXYB 4BFBD 1ORQA 4NBYB 2O5YH 5I71C 5TF0A 2R56L 1RXLA 4N0UA 1JCVA 3DVIA 3GHEH 4ZD3L 4KO5A 2B1HL 3FB6A 5DD0H 4DP7X 4XVOA 3BAIA 3NTCH 1PU0A 5DTFB 2J55A 3MU3A 1DP0A 2C3XA 2VAJA 4M9OA 1OK8A 3W2DL 1K8IA 3MLXH 3N1GC 1NFAA 4KTDH 5DSCA 3VH8B 3G9AB 1BZEA 3EO1B 2BHYA 5HI5D 1DVSA 3NSXA 2QQKH 4QEGA 4GG6A 3IE4A 4DJMA 3QO1A 2IGTA 5F0LB 1XEUA 2YFOA 2AF2A 1SVBA 3P54A 3B1UA 3HNSH 5KYXB 3N50A 2EACA 3ZR5A 2NY1C 4J2XA 3HI1A 4KRNA 2J7LA 1BYOA 1A7OH 1IL1A 3VX0A 1IQDA 4PWIA 4L4JA 1B9KA 1SJVA 1VCAA 2J6WA 3GK8L 4N2NA 5DEFA 1NKRA 4UINL 1JHKH 4NO0A 4TUKH 5F1IA 1U8LA 4S1DC 1X5IA 4JQIH 3Q6FA 5GRYA 3SDAB 4DKFH 1JDAA 4M5SA 1R3IL 4JRWA 2WIIA 1CDHA 3VI4A 2P80A 1HHHB 4PTTA 2JVUA 4C4UA 2X10A 4U3HA 1OVZA 1H6UA 3R1GL 3DRQA 2IMMA 4GI8A 3IB4A 4QRAA 2CK0H 4XVUC 3ZN6A 1NCTA 4HFWA 2J1ZA 1DJYA 4GXFA 4IIZA 3TFBA 5KBMA 4OFVA 2OM5A 4YSOA 1AR1C 5C07E 2DL9A 2VZUA 4FL4B 4CC4A 2BNQE 3NRQA 4BZ1A 3NSDA 3WIFB 3GLDA 4TSAL 3FK3A 4L3AA 4H8VA 4P5TB 1UH3A 2F7PA 4G7QB 5KVDL 4XMUA 3DUSB 4PLKC 1QRNE 3NRFA 5EV7A 4JDTL 4JHWL 2A9NL 3MKGA 3T0VA 4JGNA 1NOLA 2WO4A 5FGSA 1PLBA 4KKQA 3MAWA 1EAOA 2WINB 5DF0A 2NQ3A 2FQEA 3K71B 3UG3A 1RZFH 4G5ZH 3AMKA 5L4JA 1DQVA 3KH3A 4GSUA 3OHXA 4PD4J 5ESVB 4Y5YB 5IMKA 1DEDA 3ULUF 3CN4A 5IIEA 4PS4H 5BZZA 3GZKA 5A43C 2XRAL 4TUJA 5DD1L 5CF3A 2ZKMX 2PXYC 1RUAH 1YJDC 5T5FL 4FF9A 1KYUA 3RVXC 1A7NL 1IGJB 4JPWH 4WEBH 1DYZA 3H7BB 4YBLC 1GGUA 3QJUB 4N2MA 4XX1G 1JZ4A 3LDBC 4OKVA 1AAJA 4QCIB 4R26H 3JWNE 3QJXA 2YPLD 3D07A 5KSAB 4X7FC 3T04D 5IVXB 3GS4A 3R7QA 4S1SL 5E9DA 1QHQA 2VDLH 2BLFA 4ELMF 5FYLE 4X6DA 3JXAA 3NA9H 2P46B 3AWFA 5KS9F 1PDKB 2ZAHA 2OTWB 2W80C 1YY9C 4Y2DA 1S4IA 4Q2ZB 1CTMA 2DIAA 5FYLD 5GS3A 1CXFA 5GGVH 3STZB 1RZGA 1YEHL 2DB8A 1BLNA 2JI1A 1CXKA 4M43H 2A1WL 2CLVB 3ZTDC 3II1A 3WIHA 4QHMB 2ZIDA 4OZIE 4KVNL 1S7TB 4OIAA 3L3HA 3TPUB 4DQOH 1OIOA 4KHXL 3AB0C 1A9EB 2ZNWA 3F7LA 4OFQA 1U3ZA 4F8OA 2EILB 2QHRH 4XWOC 5DQJA 4NENB 1INEL 4F7CB 5D6DC 3NYKA 3BQUA 3WY1A 1ZE3C 3KPSB 3MJGX 2X05A 3SDDA 1N4XL 5K39B 4HJJL 3VXMA 5I6MA 1IIIA 2C9SA 4RMWA 4LLDB 2QPDB 3AZUA 1JD9A 2HVKA 3CZFA 5K9QG 4E9QA 4HMEA 3UO1L 4JPKL 2VXVL 4PJXA 5AVYB 4D0CB 2Z65C 1Z3GL 4NN6C 2VKWA 1J0ZA 4MA7H 1ZV9A 4XPTL 1WP6A 1M7IA 2Y5EA 3MV8B 2C4FU 3ZDZF 4OUUB 5E1AA 3V4VA 4O2FA 2UZYA 2HLEB 4LEEA 4OCLC 4XP5H 4JPVL 4CVZA 2AGJL 3DV4A 1NEZG 1ASPA 3ARBD 3HS9A 3ZO9A 4XOBA 3ZDWA 1H5BA 4FXTA 2Z4TA 3VB9A 3V52H 2AK4A 4AQAA 1ERNA 5HGDA 1VSCA 1NC2D 1ZV5A 3JT0A 2DTSA 3DRTB 3WFCL 3ZDXE 4MX7B 2H2SD 3H2QA 5F97E 3LKSA 3RGVC 4IOIA 5I0ZA 2YAHA 4EKXA 2MFNA 4KRLB 1YEEL 3KWWB 4XCEB 2CLRB 3VFWB 4XMVA 4DEPB 3OR6B 2Z9TA 3KE0A 3EGSB 2K3HA 4NQVB 4X7TA 3FRUA 2W60B 4U1GB 2IFGA 1DBML 1TYEB 5KSUB 1T66D 4JL1A 3QSKB 1IT9L 3HBZA 4HX1A 5EU4A 1CFSB 4S0SD 4NPYB 1T4WA 2IALA 4N5EC 5EU7E 3UJTL 1SQ2N 4H0LC 1PKOA 3O6MH 2MSPA 4UOQA 5EHFA 5ACZA 4PJ8B 4ZPTA 2CIKA 2WAHA 1O6SA 5LDUA 4ETYA 3JV4B 3CFJB 4NKMB 4DKDC 3O9WD 2WUBL 1PZ3A 4PJHA 3VG0L 1HXYA 1XWVA 5F2FA 4QXTA 4LLUA 1YEWA 3RVWC 1AXSB 4LPYA 1HL8A 1RUMH 1KCWA 2NZ9D 2WUCH 4IS6B 4WNSA 3BZ4A 1A65A 2AXGB 3KWWA 4XCEA 1A6AB 1ZLWK 1Z9LA 3ATFA 2DTML 3EJYC 3IKKA 4Z77A 4JRXD 2BOBA 4G7VH 1WEJL 4K8RH 4MCMA 2JQMA 5TQ0H 1KB3A 3AXHA 1I1AC 2JMRA 5HVGB 2MNUA 4QOKB 3ESMA 2ITEA 2AEOA 4Z7NF 4GP8B 1X7QB 4N8VB 3LN9A 3CQFA 3QJFB 1X9RA 4UTBA 5MEPA 2DMHA 3QFJE 1LWRA 3PJNA 4LOUD 3P73B 6FABL 3LXAA 2ERJB 3PS6A 4I9XA 3D9AH 4CN4A 3GSVB 4QJ5B 3QFJD 5C2BH 2F18A 1SUHA 5F93C 4ZBJA 2NSQA 3WHE1 1QSED 1CUOA 3EBGA 3F8UB 1CJYA 1BOYA 1XXDC 4LSDA 3VSUA 4N2KA 3SODB 4KMTL 4LLDA 1J5OL 1XZWA 5GS1C 3CBJB 4NAJA 4NQDB 4PTUA 4YPGB 3GSWA 2RA1A 1OF2B 4O02A 3DX1A 4O58H 5T1LA 4ZNEA 5EC2B 4N24A 4DKTA 4QXUL 2Q3AA 2H2SC 1I7RB 5J9PB 2Y07H 2ZOKB 5AB0A 2NNRA 3QQ3B 2V2WB 3MYJA 1TQCC 5DJ6B 3ZTCC 3GNML 5B1KA 5DRNB 4EQ2A 1D5ZA 1ACXA 4TNWF 4XP6H 4KVCL 1XH3A 1QTYT 2XV0A 3V0VB 3KPSD 5DHDA 1C5DB 3LZLA 1ZGLM 2WANA 3HPJB 1SM3H 3QEUA 4R97B 4PRPE 4QY8A 5SWZE 3L54A 4JDEA 3RKPA 4AY0A 4F7EA 5A6MA 3RZCD 5HYQB 1ZVSA 1OALA 1L0XA 1NGPH 2EH7H 3U7YL 3KPSE 3WDIA 4BSWA 4JMXA 4YVNA 4XB8A 3L3GB 4J28A 1EAQA 4PRPD 4X98A 4FTVD 2YARA 4TTGA 3B9DA 1DBAL 1J1XH 3QG7H 2DY2A 5EN2A 3EO9L 1X9LA 1A6UL 3CVHB 1C7TA 5JHMA 3OB8A 2HLAA 4NI6A 5CZVL 2H0PA 2RFXB 5FOBB 1PY9A 3ARBB 3MLWH 2IANA 4HIJA 1BJ1H 3NCXA 1TO4A 5DYOB 2DQGH 5AW8B 4UNTA 5CIPH 5L2KE 2JK5B 1KCKA 2BP8B 5D1ZI 1NC2B 2HWZH 1HHIB 3D3VB 3I50H 4JO1L 1CURA 1BPLB 1SNRA 1WS8A 4XRCB 1DSFH 2CXKA 1JIBA 1THAA 2DWDB 5TE4H 4DESA 3K6OA 2X53A 1JK8B 3QRGH 6PAZA 4P59H 3E2HC 3LQAL 1YNKH 3HB3C 4ZMWA 4X5WB 5E2WL 3D8MA 3IMWA 5IMOB 1JSYA 1RV6X 2J1KA 5ACLA 5DUMH 2H45A 4UUJA 2NT1A 5L2JB 3CTTA 4P46B 1E5CA 3DLQR 2D9CA 4LASH 4J5VA 4OD1H 1WS7A 1IFRA 4DZBB 5LG1A 5D7IF 1U3HD 3VH8G 3FN0H 1BV8A 2W65B 4WUUA 1PMYA 2LV4A 4NBXB 3N6YA 3T4YB 4JPSA 4XVUD 5D96B 4F7MA 4S1RL 5DC2A 3ECBB 5AVSB 3UYPA 1AQMA 3QUXD 4PJDF 1QMUA 3PJSA 2JCCE 3T3ME 2KPWA 3RPIB 3BO8B 2OLDA 3K0YA 3QUXC 1EAJA 3H2WA 3RWCB 1RKRA 3X3FL 5J89A 5GHWL 2YUZA 1T89C 3BH8B 4OZGF 4NO0B 3BSGA 4Y1AB 4DVRL 1U8QB 2DH3A 3QNXB 4JE0A 4G8GD 4LDLB 3IBEA 2OJEA 1RZJH 2WV3A 3C5ZD 3LVTA 1MRFL 1KN4L 4W9GC 1C08B 1EZLA 1KY7A 1OTUD 4JN2A 5GS2H 5BRZA 4X5QA 3NFSL 4HXAL 4PUBL 5F0JB 4ZK8A 4UAOB 2YWYA 2K9FB 1H3TA 1UKQA 4M02A 2MCMA 5L2KA 3S35X 3QFJB 4UAOC 5EBLB 5ICYB 3WTXA 3G6DH 1SN2A 3MFGB 4M6AA 3DARA 4YR6A 4DVBA 3HZVA 4X5WA 5I1KH 2JELL 1N67A 2FGWH 4A38A 3O2DH 1VERA 4YWGL 3SZ6A 1F3DH 2XC8A 4LVEA 2UWEB 4UQAA 1JV2B 3IJ9A 4POYA 2C26A 4ZI8A 3LHPL 5MERA 1A6PA 5DRXA 5C0BA 4AQEA 3CFMA 4K3GA 4FNSA 4MJ5B 1T0PB 2XWEA 1DCLA 4R9HA 2VDNH 1WCBA 5J6GA 3VMNA 5JR1H 4KPHH 3QFGA 4G9FA 4FQXB 2BY2A 4NRZA 5A16B 2YPKA 5SX5H 2OI9B 4WHYG 4BH8B 4KITB 4WFFE 4E9YA 1HZLA 2O5XL 4ODSL 2P45B 2YN5A 4QRBA 3K3QA 2XPGB 4XWGH 1KXQE 1LP9B 1U8MB 4Z7UE 2DQTH 1B4JL 1F13A 1U8HB 4WFFD 1JTPA 1AD9A 4NC1C 2B4CH 4UQIM 2A6JB 3W5MA 1EXUB 3LQZA 1ZCRA 1JRHI 2WOBA 3HC4H 3HEIB 2Y9RT 4LAJH 1P9MA 4DPRA 2GJJA 1R5WB 2EAEA 4FTVB 3BQUD 4UILH 4N8PA 5EEUA 3MA7B 2AV1B 2MTPA 3NABL 3OKLB 2NY3C 1JXDA 1SEBA 2W88A 3VG9C 1I85A 1KN2L 2F54E 2ODIA 2AJYL 2N7SA 3DIVA 4L3ED 4JMNA 3KYOB 3IJSA 4FYSA 4NCDA 2XFXB 4MXQD 4QUOA 1G6RB 4AGNA 4MCYA 2UVFA 1B3JA 4HGWB 3NFPB 2EEFA 4ZTEA 3ML9A 5J57B 4KNQA 4OY9A 7CGTA 2DWTA 1XX9C 3VVWA 3AVEA 4NNYB 1UA6H 5I0VA 5BQ7B 5HVHC 2QGEA 4E9RA 5C6TL 1QSFB 2VJ0A 3OMIB 4HKZA 1RJCA 1E5YA 1XH0A 4Y1SA 4YAQA 1HIMH 5BVPH 2ZNXA 2DIBA 1EGJH 1YY8B 3DHMA 1DQLL 2R15A 1YMME 4KJPD 5DHYA 3R06B 1ZWIA 2ZXWB 2IGFL 3B2MA 4HMDA 4BUQA 3V6ZA 3DJTA 1ASOA 2V17H 2X28A 5T33L 2N01B 5F7HA 2V7HB 1CDIA 3QJQB 4QRRB 3W38A 4ONHB 2D9QB 1JAEA 3EH5B 4GYBA 5F7UA 4UZUA 1BQLL 2R2HA 2NXZB 1QTPA 2YFNA 1BBJB 1KLGB 1WV7T 3JVFC 3I6GA 4ICWA 4KDWA 2R1XB 3OKMA 1HAUA 2BY3A 1FI8C 4G8AC 1G1YA 1AIFA 5D1QB 2WLHA 1OAUL 1GYAA 1CFMA 4MD5B 4UM8B 3SDXE 4JFEE 2AEIT 3UTTD 3ARZA 2Q8AH 4JS7A 2JXMB 1THCA 2NRDA 2VQ1A 4GSDH 2YA1A 2GJZA 5IHHA 2FECL 1CFQA 1BZOA 3QQNA 2FT8A 3CMOH 1KYFA 5F0MB 3ABKB 2KL6A 3QPXH 3QVAA 2ORBH 2IALB 2VM4A 5AOIA 2X2UA 2R0WL 3ARGA 4EI5B 2EIJB 3THMH 5GZND 3RAJH 3BC9A 1ZPLA 1Z0NA 3DKHA 4KQ4L 4X0KB 3WKPA 1D5BA 4BKSC 4NZUL 4UTCA 2R39A 43C9B 1MN4A 2M26A 3HS8A 2FO8A 4PJBB 5INCB 5IBLD 1XCTB 1T1XB 2ZX9A 4MD0A 3QJHA 4IHOB 3BAEH 4UCFA 4Y4FB 2C9AA 2OYKA 1JHTB 1AGFB 1MNUL 2AEPL 1AP2B 1I85C 4ANUA 3T6ZA 4QRRA 4UTAL 1GA2A 1ODUA 2V7HA 3ZRFC 4DK3A 5D7SL 4ZUSA 1H5BB 1NANH 3JV6A 5LXGH 1OW0A 3VWKD 3ULVH 1DVFA 4A1RA 3SPIA 4WI8A 1OANA 3FB7B 4WCYL 5L7XL 4Y4HA 1FZOA 2VJXA 4G8EA 5E1AB 3MCLH 2O93L 3EBAA 4Z7OB 3FU6A 4N85A 3L48A 4JRYB 1WD9A 4YHLH 5D7LA 1WTLA 2XQYK 4MDJA 1W72L 3SCMC 3AU1A 2JIXA 3WS6C 1PEZA 4F33A 1FNFA 1IGCH 5FM5M 5DUPL 3R7RA 4KXDA 3NK3A 4X6EA 5ES4B 2B20A 2DBLL 3QJZA 3MGTB 5F1NA 5DJAA 3MCKB 2NW2A 4G6KH 3S2CA 1W72B 2C34A 2H3XC 2PWHA 4Q4IA 3ZMEA 3MLSH 3BQUB 4X9HA 2EC9U 3OXRA 1U6AH 1WJ3A 3HAEB 1WIOA 1GW0A 3KPNB 5T5NG 3OKKB 4GPVA 2MRYA 3OKLA 1S9VA 4GKLA 1MCNA 4A2MA 5BXFB 4XCCH 1X5GA 3NIFE 3DTUB 1S7TA 4MMZB 1EBPA 4OZFH 1UT9A 4JFYB 4KRMB 5EO0A 1C5BH 1KTLB 4YR6B 3TBSA 1NFDB 4B6ZA 5FB8B 2P80D 1WIUA 5AAWC 5IB2B 3QWNA 1CT8A 1BVNT 2D31A 4B9ZA 3ATEA 2DJSA 1HZHH 4CNIA 5JHAA 3KR3H 1MFDL 4HD9A 3QWRD 4B9YA 5BRZB 3QEQE 3HKFA 4ELMA 2OTWA 2C3VB 5T8IA 1I3RB 3S3JA 4OM0L 5DJ8B 3REWA 3M46A 4NUPA 3T1FB 2FQGA 3RU8L 2XQYA 5E9DB 3UAFA 3PNWA 1D5MA 1G7PA 1S7WB 3B7RL 4PGEB 1DEEA 3UAJD 3V5DB 1L6XA 4H8UA 1P5UB 3QQ9D 3VE0B 1HSAA 2NT0A 3T3PB 3FULA 3W0WB 5C0FB 1FVDB 2ZZUT 5EO1A 5L8JB 5DRXB 1H3VA 2OMYA 4QRRD 3IDGA 3N1PC 5AW5B 3VFGH 5FCSH 1P7QA 3GLEA 4N1EA 1NCDL 3FU0A 4NHUB 3A4EA 3OC8A 1YN7A 4P9ML 2DQFA 3WUZA 2NXZD 5B1CA 4CBZA 1X3DA 3PWPD 4WI0A 2ZSVA 5D6CB 3K6SA 3ECBA 5GGRA 5K1JA 3WN5B 2ATPB 3BD4A 4F15C 1OGAA 4Q4EA 4PRID 3ZZLA 4FJZA 3ZPDA 1JGLL 3GMLB 1CZ8L 4KTDL 2VKXA 2C9VA 3AQXA 1RZ8B 2X4TA 2DLHA 3NIFF 1N8ZB 1P7HL 1KGIA 5D1QE 2WQRA 4V1DE 1M9SA 1GZPA 4U1JB 3OXSB 2NNAA 5IB5A 2WQVA 3WXVL 4JQXC 2XQBL 1M7DB 3LKOA 3BZDA 3CIAA 1NANI 1O5DT 3FQNA 2F53D 2W94A 5I75B 4V1DD 2W38A 5CCKH 1T21B 4R4ND 3HJ0A 4W4NA 1LEKB 3E6FB 3MRIB 2HFTA 1EUUA 5FR3A 3AU0A 4QHKJ 2QGCA 4NHUA 4WRLA 2K9UA 5E5RB 1E4XI 4J1UB 5CLXA 1CL7I 2B15A 4Y9CA 1OSZA 2VSMB 1PZ2A 3HFMH 4JFXB 2NY4C 2E59A 4OFYD 1UURA 4JQIL 3PJSB 3EOBA 3UBFA 1WBZB 3QIBD 3BUBA 3D69B 1AOZA 1KJMB 2J57A 1LP9A 4HV8B 5DRWA 2UZIL 4CDHA 2DQEH 1HN1A 2JJTC 3L2MA 4XPGL 4PJBE 2WMPB 2YA2A 3BDXA 5E5MB 4FD0A 3IPEA 3WMQA 2XUWA 3IDMA 3CU1A 1KJ2H 3TBCA 1TEYA 2VO8A 3MFFB 1CFVL 2CDFB 4XP4H 2WBJC 2XIIA 2MJWA 4TSAH 1FDLL 3QJVB 3QEUB 3EBIA 1TEGA 1YMHB 2A3TA 4ZS7L 5FGBA 3HRZA 1X4ZA 3JTSA 1L6ZA 1QLFB 2GABA 3QG6A 2FJFA 3QORC 5IMLB 2ESVA 4K7PH 1QI4A 3C6SA 5IROC 4Z7OE 1SDAB 4PJDB 1UM5H 4N1HB 1IC7H 4ZMAT 4K7PY 1RZFL 5HD8D 2AV7B 3ZKQD 2NY0B 4PRIA 1IU1A 3BZFA 1UOLA 4FP8H 5EG6C 3I3DA 2EXWC 5JHBA 2DLFH 3FYIB 4G1EA 3GSWB 5FYKU 2DQIL 5CZXD 1A1OB 2G5BB 4P3CH 1VFBA 4XH2B 2X4PA 1BVKA 1UYWH 4V11A 1AFVH 3RNQB 2HTKD 4ZMVA 1G5AA 4UQCA 3FH5A 4L3FA 2NR6A 3TASA 1OTSD 3NAAL 2CDEA 4UT9A 2YC1B 1EK3A 3K6NA 3IS0X 5FC9A 2QVIA 3MLVH 4PJBF 1M3IA 1HSBB 1U8JB 1SN5A 2IEPA 3IF1A 1JVKA 4NT6A 4PP1D 1ZLVK 5KYNA 2WLLA 5JW4R 2I85A 1IGTB 1P0SE 1ZTXE 1JCKA 3V9FA 2WZPA 5KSAC 5GS2D 5I9QC 3OKDB 1SLUA 4N0CD 3ZRSA 5B38A 1LE9B 3TL5A 4AXWA 2V5RA 2FEJA 2F8IA 4YL4A 1M53A 3MBED 4PJBA 1I1AA 3VM7A 3B2PA 4WNJA 5D2LB 4UZGA 4YHPB 4OLUL 3U0WH 5DS2A 5KYYA 2CKNA 4FQCL 2J6EH 3SPCA 4A7QA 5KJ7E 3EJCA 2HJLA 2DV6A 1EHNA 2MQGA 3FT0A 1BCIA 3HHSB 3VA6A 3F04A 2XZQH 4GBXA 4KU1A 4NLAA 2RB8A 4YZWA 1BD2B 4C59B 3UYRL 1YVLA 4XXDA 3MRLA 3GMRB 4Y16B 1AXSA 4LLUB 3VA2C 1NGQH 4ODVL 3PE9A 2Z0BA 3EGXA 4OT1H 5J1TC 5FLUA 5I1EH 4B9KC 2VT0A 4M1DL 2CHXA 2ENSA 1WBXA 4GBXD 1ZLWH 3WN5A 3L9YA 1CC3A 4EKJA 2VLJD 1LO2L 3RWIA 4FX5A 1W6WA 3DGGA 2I7OA 3ROOA 5I1GL 1ACYH 1X5ZA 1NGWA 2IBZX 3HG0A 2DEYX 4PJEF 8FABB 3WLWD 3FT2A 2VLJE 3LPWA 1XHHA 4HU8A 3IDNB 1I1YA 2PO6C 4RDQF 1BG9A 4Z18A 3KWVA 2AQSA 2P5EE 3DECA 5AZ2L 2R29H 4Q9RL 2GY7B 3VRIA 1G87A 4TOYH 5IR1B 2GYSA 2JTDA 2ZAGA 3JWOL 4J7RA 4YDKH 2P5ED 3K2MC 4Y5XB 1JUFA 1R46A 2LU3A 4HS6B 3BKYL 3IU4H 4LK4A 5B7FA 4FXKA 4N5ED 2C3VA 4IJ3C 3KS0H 4HEME 3ZX1A 1XGZA 5ANHA 2ZKHH 1TU2B 2PCFB 1H8LA 1F42A 1J9RA 4HJEA 3T3MF 2VXTL 3V4VL 4MLSA 3CBRA 1GSKA 1XT5A 3MRKA 2OCFD 4E5XB 3V0VA 5J12B 4X6FA 2LTQC 4PJ8A 2ZCHH 5E8PB 1L9RA 4EF3A 2WQ8A 4O5LH 2FEDD 1DBMH 4N68A 1HKLL 3Q8FA 3BN3B 4NPYA 4C56E 4K5OA 4AV0A 1EA9C 2K8MA 1GKOA 3BVTA 3L6FA 5IG7A 5GGTH 4XPFL 3G5ZB 2PP7A 3ECWA 3AADB 1NFKA 3K46A 1KJ3L 3V0FA 3IRPX 1MCIA 1NCNA 4B97A 4OFKA 3EDFA 3CFBB 2D3NA 2I69A 3AAZA 1QTSA 2WUBH 2RQ8A 2Z93A 1DFBL 4IKJA 4PJ7B 5CUSL 1DTUA 3D0LA 3KCPA 3L5JA 4XNZB 3GO1H 4QRTB 4ILDA 3MA7A 2AJ3B 3IDUA 1HE8A 5IBLC 1MZYA 3S88L 2EC9T 1R3HB 2ITFA 2BVOA 2VR3A 2XWBA 5F96L 3UAJC 3NZHH 3VW3L 3WO4C 4FZEL 1QFUH 2DYPB 1DO6A 5KN5A 4MVBD 1DANT 4MWFB 1X6NA 4XN7A 2HT2D 2FK9A 1X5JA 1SY6H 1YNTA 3KLLA 3VI3F 1XTMA 5ADOH 1HEHC 1MF2H 5I1LB 3VXNA 1GHFH 5IVXE 3QJHB 4IHOA 4CN6A 1AE6L 4QLWA 3EZ8A 3KLKA 5IVXA 4L4VA 3GRWH 1F56A 2IO5A 5IJBC 3T71A 3FOMB 4AGPA 1E4KA 2JSFA 5FYLL 1WCBB 1ZHKA 1NCUA 3GMPA 3BOVA 3QDJB 1A3QA 3MO1B 4A7GA 4M9PA 1TITA 1RIVL 3PWVB 1HI6A 2AXWA 2HJFA 3GSNH 1YNTF 3MRBA 4NQCE 1D2OA 1XBDA 2AJVH 3C87A 4MB1A 3ES6B 3CVIL 5IFHH 4XOCA 3D6GA 1OP5K 3D18B 1E3XA 1NC4D 1P5VA 3ARRA 1NCBL 2DQJL 1TQBC 4U2YA 4DP4X 4L8BB 2V8LA 4EN3B 4FHBD 3DROB 1JGVH 2FQFA 1KLUB 4V2CB 4FQJH 1CL7L 5IT2L 4P2QE 4YSUA 1E40A 1TTFA 2CHWA 2D8KA 4Y2DB 3RWJA 5BQDA 3A21A 3QRLA 2D03H 1U8NA 4I18C 4KVCH 3RLSA 1NDGA 1MRCL 2NW3A 1EFXB 1IAIH 2C9PA 4OZFB 4Y1AA 4GKNA 3OHMB 4MX7A 3MV8E 5DD5H 5MEOA 2ZJSH 3HZYB 2HFFA 3LKPB 4FAAB 2MTAA 3S3DB 1CD9B 4AQAB 2JQZA 5I0XA 2AZUA 1JWMA 1IGJA 4L8SA 2AP2A 1J1XL 4NQSB 3EFFB 1PSKH 4W9ZA 4ZX3A 2AXFB 2GIXA 4TUJB 2SEBA 2E9IA 3FMGL 2VDPL 1LE5A 3BH4A 3EDEA 1FSKC 5C9JA 1RLWA 4D8OA 4QTIL 1FG2A 4MXVF 2YGVA 4FQ1H 3PAVA 5E6IC 1MCQA 3LYRA 1DBBL 3VCLA 4XBPA 3SYOA 3BP4A 2OCJA 3ZUNC 3S8FB 1UACH 3CFEB 3HG1B 5IV2B 4BKTC 2XTJD 1GGIL 1G6VK 3PJLA 3WNOA 4U3SB 3T6XA 2TRYA 4U3XA 5CILH 3B7YA 1KJVB 1I75A 2FO4A 2IAMC 3IS1X 3QZNA 4LBEA 5DUML 5IBUG 4LFHD 4HK3J 5DHVH 3DXAA 2AK1H 1A9EA 1E5UI 1IAMA 1QBBA 2OJ1A 2XG5B 4KKCC 4BWUA 4ZFOB 1P6WA 1PTZA 4ZXBB 1ZK5A 3DXAE 4KVPA 4KUZL 5SX5K 1VKXA 2XVLA 3MR9B 4L1BA 4PHZA 4KNUA 4I2XE 2L04A 2VLKD 2K7QA 3DO3A 1T5WA 5I5IA 1WFOA 3OWRA 5IW3A 1L9SA 4FYTA 5DGQA 2Y69B 1AD9B 1T6VN 4I3RH 1JGUL 2NY6D 2XVKA 4LLYB 1AZZC 5HI4D 5AKVA 1CD1B 3DOSA 5D7JD 2WVVB 1BGXL 1VF5C 2JLPA 1ZTXH 4QOKD 4NAQA 1CDJA 2YR3A 1RQ5A 1EWHA 4DN3L 3WJJA 5F9OL 1O7VA 4F37F 4P9HH 3F6JA 4TM9A 3HZ3A 5F3HB 2F8XC 2J25A 2GJPA 1IGML 2BNQA 3VGDA 1IZKA 4QCIA 1G1KA 5I66A 2CO3A 1FG9C 3BUPA 2DYPD 3O81A 2FLMA 4DVRH 4ZFGL 2VC2H 2OV0A 1T83A 1U42A 1QKZL 1CI5A 4R4FH 5JW5A 1XH3B 3ZUCA 2K78A 3FT3A 5TQ2L 1KEMH 2AKRA 2BVYA 1NGYA 4N0UE 4I18B 5AZUA 4LCCA 4MBOA 4OSUH 1O75A 4HWEL 4M3KB 4KJYA 3HZVB 2BRRL 1EMTL 2QBWA 5EIIA 2FX9L 4TVPH 1NM9A 1A6VH 3QB7C 4HUMB 1IE5A 2F2HA 5I1KL 3MLZH 4KKLC 2H26B 3ECVA 3GXNA 4MXWL 3FCBA 4OU3A 2ZAIA 1MCPH 5CJXC 4A37A 2WLIB 3F01A 3KL3A 4NIKB 3ZKMD 3OAYH 3OLIA 4CAGA 2CKBB 2MPAH 4ABUA 5IUSA 4RSYA 2UUDH 1OSYA 2FBJH 2DJMA 1XGYH 1BMGA 4EN3D 2COQA 4ZNCD 4X6CE 1A4AA 5FW6A 1H15A 1YUHA 3TJEL 3DX8A 2A74C 3LSOB 2B59B 4WKZB 2JB6B 5BV7B 1UATA 2HVBA 3F00A 4H0HB 4YN3A 4JFDA 2XN9A 3VFSA 4NDMB 4Y2DD 3RB5A 1RLBA 4B53A 2KH2B 5E8OB 3WG7B 4Q0XL 2FYVA 2DICA 4ODSH 3TXAA 3W9EB 1GTNA 4LEBA 3T0EC 3TIEA 4WI4A 3BVDB 1F4YL 4X99A 1XTLA 4JFDD 5CP7A 3KLHD 3TH4T 2D7TH 2FECI 4IBQA 5JHDB 2B4CL 2GTQA 3FUKA 2EUZA 5KBNC 3TLRA 3HC4L 1AY1L 3QEQA 3WE6B 4HUXB 2NY7L 5L4IA 1BPVA 1NDGB 4LKCB 4EPSA 1V5JA 1FV1A 1IAOA 4MNHA 4TNEA 3ARGD 3H6JA 4I1RA 4KI1A 5DJDB 2ZXBA 4UUJB 4BKLB 2RALA 1ML0A 5ISZA 4IK6A 3KW8A 4L4TB 5ETUA 3P9WB 4AEHH 3TWCH 3W11D 3OPZL 5AWNL 3K8MA 2NMSA 4F3FB 2YAFA 2HRPL 3SKNB 3O4LE 3QDGA 3GBEA 1MCFA 4FULA 4JY5L 3V6FA 3D3VA 4XMWA 3N40F 1UA6L 4U1NB 4LSPL 4PW3A 4JX0A 4ZQKB 4BGLA 5KVFL 1ZXQA 3Q5YA 3GS7A 1U8KA 3LMJH 3O4LD 3D18A 1YEGL 4JM4L 5KEZA 1I31A 1T89A 2G9HA 2P8LB 3HI5L 3MUGA 4CGTA 2WXOA 3EGSA 4LOFA 1ED3B 3ESNA 2EZ0C 3ARBA 4UANA 5DTFA 4XI5C 4HPYH 2HJFB 2QGBA 3MRJA 4LCWE 1FL3A 4OZ4B 1NSNH 3PWVA 4EJ1C 1LLAA 4R8WH 3FSAA 3ATAA 2HJKA 5KVEL 4WWKC 3QUXB 1OB1B 4IJTA 1K8DA 4B41A 3I6KA 5GRJH 3PHSA 2YQ3A 3C8DA 3VXQB 1TTBA 2V17L 1IMHC 4XTRC 1KGXA 3MNVB 5DJXB 5C0AD 4TF4A 3ZDYF 3FBKA 1FZJB 1TT6A 1D5IH 2OULB 3NT0A 5D70L 1HHGA 2EO9A 5FECB 4ZDHB 5CCGE 5D1XC 1TZAA 2XA3A 4JKWA 3VTMA 2LLLA 3P30L 4KBPA 3CN1A 3PP4L 5F3BA 1TJHL 5IOKA 5F1KC 5I2IB 4HIIA 4YHNA 2GK0B 5LQBL 3AREA 4AM0A 3UL4A 1E9PB 3OGCA 5EEVA 2ZCZA 4NN7B 2YUXA 4LAQH 3T0XA 1UWFA 2A0LD 5EO9B 4PJAB 1KXHA 1NEZB 3VYPA 1NPNA 4KRPC 4KOCA 1JRHH 1SVCP 1T03L 1HHJA 2NNCA 4PJHE 5JQ6L 4ZUVB 3E1ZA 4LLAA 4TUOA 2FTAA 3UTPD 2C7FA 4XNQB 2BS8A 5E2UH 2HX9A 4OQTH 3RAJL 4P5MB 2YMOA 4H88H 1S6NA 4OZHF 4PIRF 5C09D 2HB0A 3QIWA 4XP9H 3QEGH 3WO4B 2BSRB 2V9QA 4ALAL 2UWEE 5E8EB 3HE6B 3P2BA 2BSSA 2OZ4L 4NZUH 4G2AA 2WPGA 3I9IA 3QIUC 3MRNA 3B3IA 1NEUA 1Y6MR 5C09E 2XYBA 2PCYA 4JFHD 4BHUA 3C75A 4X6BB 4TL4A 3S6CA 5PAZA 4LSSH 3GD1C 4ERSL 4C54A 3DSFL 5GS0L 1J8SA 1P4LB 4K3DL 4A6YB 5CP3H 4MZIA 4RGNE 2K6YA 1UEYA 4OGYL 1E90A 2GJ6E 1L9MA 5LXGL 3LRGA 4RETB 3L4YA 5H4YA 4YDJA 1I1CA 3DJZA 1KFAL 1OB1A 4OKVB 2XZAL 1XR9A 1BFSA 2NR6D 1JHLH 1G6RL 5EF1A 4ICXA 2PW2B 4X9IA 1CU4H 1U8NB 4N90E 3MKKA 4RVBA 5I6KA 1K5WA 1GSMA 3D2UA 1N2RB 1RVFH 4KXBA 1DLHA 2XQYG 2Y4SA 5JQIB 2NR6C 4L3EB 1L9TA 1QBLH 3NIDB 4MJ4A 1IGCL 3H4FA 5DUPH 4OM1L 3FQWB 4FXGB 2ZF9A 2RAMA 1S9KC 2DKMA 3D48R 1CS6A 2GW5A 1VDGA 4A55A 1TCRB 4G8FA 4G6KL 5J3HD 4X7CC 1CI3M 3CK0L 2J4WL 2EDQA 4L3EA 1NGXB 4ZUVA 4UIMA 5EZLA 4JB9L 3ZDYB 1MAML 4BFJA 1Z9SB 3NSFA 4JPIB 3FTZA 8PAZA 1JV5A 2OXGA 2F15A 1DZBA 4AITA 2F58H 4DP1X 3WE6A 4PRPA 4HZLA 1MLBA 4DKEL 5LG6A 3ARSA 4JM2A 2GJRA 4G42A 5D2LA 1QATA 5LGYA 1EDYA 1HZHL 3ZZQA 4NKIL 1JL8A 1FZKB 2VXSL 2ADYA 5F6IC 3UXFA 2J6EA 1CICC 4LRIC 1P4LA 2B0SH 4OM0H 2X6MA 2WGNB 1AO7B 3HUJB 2ATKB 3A0OA 1YNTB 5EF0A 1DVXA 4Z7VB 3I9AA 3DV4B 3DVNA 5D5MA 2H6UA 3GMNA 1U30A 1L7TH 2VXQH 4NT6B 2Q6WA 3B3IB 2YOCA 4N2BA 3QNFA 2OX5A 5KBKA 2QSQA 2YWZA 1GS6X 4WKZA 2HG0A 1M57B 5HHVH 5HHMB 5E0FA 1NAMH 1WFMA 2XWBB 1OEZW 5IJVB 1A3RH 1REIA 2WZ0A 2KZWA 3EJYD 3JWDH 5E8NA 4EOWL 2VN4A 1NMCC 3FFCB 1BG1A 2DRUA 1HOCA 7FABL 3LPPA 2YHGA 3BW9B 2YD6A 3DA0A 5T1KB 1K8DB 1WLHA 2AJUH 2V3DA 5LUMA 2CO2A 1FAIL 3RWHA 4APQC 4M3JA 1RJLB 1IBBA 5L6YH 2DQCH 1NA8A 5K1NA 5KYWA 5HDOA 4RA3A 1JGLH 4GKSB 3A5VA 2V5TA 1R4XA 3D25B 4XC1H 2FJHA 5AOMA 1KTRL 1CGSH 2IPTH 4DOHE 4NM4L 5IQ7L 1NZRA 2OMUA 4QO1A 3S36L 1UT2A 1NGYB 1BQRA 2FJFB 2MKLC 3QPKA 3VD1A 3GIVA 5ETUB 3JWNC 4RAVB 3QULB 2E6PA 2KDGA 2W0KA 1LO5B 2BNQD 1E4WL 1RPKA 1GYUA 1E9OA 1QWHA 1PY4A 2CA3A 5KYUA 1BAFL 4WEEA 3BAKA 2Z4QA 4XNYL 2MQ0A 1XL6A 25C8H 3HPLB 3NZSA 3N44B 1NUGA 5ENWB 1XGUA 2CU9A 1JNJA 1YYCA 2HJKB 3QUZB 2EYSA 3CZSA 5EOCH 4CADA 1OAZH 3K1DA 3NJKA 3ZW3A 2UZIH 4AM0Q 2AQ1A 2WYZA 5D8JH 5CP3A 2X4OA 3UZEA 1G1CA 2Y22A 5I0WA 2VDPB 3RWDB 3JV5A 4OF5A 3KLAA 3SQOL 5KZCB 3PCYA 5F9AC 1IC0A 3LSOA 3PHOA 5ESVA 3LJ3A 5JIQA 3UMNA 4GMTL 4NBZB 4R7NB 4KTGA 1FDLH 1Q72H 3E3QC 5E7FA 1JTTA 2VLJA 1G9MH 3FN3A 2OL3H 4APXB 1M2VB 4CDGC 5AYTA 1UXSB 1JNLH 1UH4A 4MMZC 5CJQL 4EBQL 5DMKB 1WWWX 5BPPA 1RFDL 2Y25A 4BFIB 2BIOA 3O3UN 3D51A 1F58H 2Y24A 2VE6B 5E95B 1BA9A 1XV8A 2I9TA 4HHWA 4IKLA 1UUNA 5F9WB 4TQEL 1FG2B 2E76C 2YA0A 2K70A 1H6FA 2BVEA 3WJMB 4GAYA 5B3SB 5HHXH 1CGXA 3OL2A 3ULAB 3QAQA 1HXMA 4I0KA 4QRQB 1NMCB 1YY9D 1UYWL 3POCA 5H94B 2BZDA 3E9UA 2X4UA 3L5HA 4N2CA 4NP4L 2CSPA 1RUPH 4WWKA 5IEKA 3OAUH 4NDMA 3GMMA 1WE5A 4A04A 3NAAH 4LCUB 4L48A 3E6HA 1HSBA 1U8JA 4FFYH 1CXEA 1XGUB 2O5YL 1P5UA 4G43A 1YN6A 2YEZA 1MAJA 4YX2L 3V5DA 5KBDA 3W0WD 1VHPA 3D5OF 1K5NB 4PB0H 5F3FA 1T4KB 1U3HC 2R2EB 4RMVA 3B7UX 4GKZB 4E9WA 4WU7A 1AO7D 3KPLA 3A3YB 3MRCB 5GGVY 1N19A 3ECQA 3RWJB 3Q9PA 2QQKL 4R0LA 3VX1A 5C0DA 3BCDA 4L9DA 4J4PA 3CDGA 3FQ2A 4W9LC 4AVIA 3FW6A 4PRIB 2HRLA 3C5XA 1GTFA 2XT1B 2H4EA 4YXKH 1PKQE 4OLVL 1BFVL 1GY2A 3FT9A 1F1DA 2XIDA 2XZQL 2Z31C 4L8BA 1UZ6E 3M8OH 4B0MB 1ZHLB 3W11C 4I0PA 2J56A 3FFDB 4Q6IA 3Q6GL 3KDPB 1KYOK 4LBEB 3PUUA 2YD7A 1RU9H 1FLRL 1KIQB 2VSKB 3LKRB 2VAAA 4NYLA 4UV4H 3FZUC 5I1DA 1KFGA 2KS0A 3GK8H 4OZFG 4ZXBC 1RJLA 2PETA 1JGIA 4FI6A 5CLWA 1RHHA 2EH8H 1T5XB 3DUUB 1KGCE 2YPLA 3LD8C 2QKIA 3RL1B 1CTOA 2P26A 3MJ9A 3HC0B 5BJTA 4PW4A 1Z6JT 3HMXL 3LNFA 2NDFA 2PYED 1KGWA 1G5GA 3VXNB 4PJIF 2CK0L 1ETZB 2Z92B 5EF2A 1QA9A 2ZYSA 3QIBB 3VFRB 5HXMA 1Z32X 4PJ9B 3DI2B 4CJ0A 1TVDA 2OTUA 4GLRH 4H8WH 1YG9A 2J5LB 3BT2H 5TFSH 4PI0A 1J5CA 1KXVA 1GAFL 4MRCA 2DM3A 1OSZB 1MVUA 3UJJL 4PCYA 2HRGA 4PJCB 5CWSA 1HCZA 4NUGH 5AOKA 4DGIH 4FLSA 5FYKL 5FDYA 2VXUL 1E5BA 1PJ9A 1VCBC 2XG5A 2P52A 3RDTB 4MDRA 1MZZA 4JGMA 4JM2B 2P28B 1ACZA 4KX8A 2HH0H 35C8H 4Q74A 3RWEA 2XWXA 3TV8A 4X5XA 3SDDD 1IKFL 2ZXDA 3CVHL 2GT9B 2G0LA 4KI5C 2ZUSA 1XL4A 1S7SB 2NX5B 3NA4A 3MJ6A 4G6FD 5ABZA 4JK0D 4PREB 1EV2E 2HG5B 4FLRA 3K2IA 3WKMH 4NRYA 2NY2C 3IWUA 5BOPA 5JPNC 1G7MA 1HKLH 3B9KD 2W92A 3VD4A 1BEYH 4U1HA 3H2PA 4E42A 2OTPA 3OZ9L 4LVOC 4XN5A 4WFEE 4XNUL 1DVTA 4ODTH 4JBSA 1UB5A 1VENA 1WICA 3B9KC 4YSTA 3WMPA 3RTLA 1JXGA 1LHZA 2VDMB 5B1BB 1VACB 1CDUA 2FB4H 4QTHA 2K4AA 4JCLA 1DFBH 3PL6C 2TSBA 1DLHB 1O7SA 1H6EA 4I77H 2JI2A 3GO1L 4I0PD 5K59E 1EO5A 3TVMB 1I9EA 1NAKL 2A83A 4S1SH 4Z0XB 3MRBB 4YSSA 1FFTB 1N5YL 1MY7A 1BVNP 1G0YR 4B9FA 2QDWA 2PW1B 5FK9A 1B90A 1W0WB 4Y4KD 3WE1A 3SE9L 1GOHA 2EABA 4Y5XA 1FHNA 1QFUL 1KCUL 4W9EC 2OBGA 2R2HB 3WV0A 2CNYA 4YLQT 4XNXH 4R4BB 4L3CB 4JN1L 4PP1C 5DC4B 5DJ8A 4RZKA 2DYSB 3VXTB 4F5CE 1QPXA 2OQJB 5DEGB 2VJ8A 3LEVL 3PNRB 3C08L 1QYGL 4BK5C 3X3GL 3BWSA 4O02H 1G7QA 4CMHB 4OBSA 1NBZB 3RPBA 1INEH 2RTTA 4D0DA 2IWEA 4ZSOB 1MFEL 1S7UB 5IEHB 1WBXB 4PG9B 2YJLA 2D3VA 5D7IB 2Z35B 3CVIH 1ROCA 2R2CA 2HKAA 3KCPB 3C09C 2CJTA 3BIKB 3FOLA 3KPRB 4LCVA 3PGDB 4M48L 1HHJB 5DHXB 4EIBA 4MS8D 4L5FH 1VJSA 4QRUB 1I7ZA 1W6LA 4GBXB 3HIZA 3S8GB 1LDSA 3WEXA 4J3VA 4DUVA 4JFQA 4HLEA 4HGWA 1ZT7B 3U6RB 4MCYB 5H35A 1TEFA 2AANA 2EEXA 3T0AA 3CSPA 3VNYA 1T1WA 3BESR 4N2IA 4L8SC 5GGUB 3WEMA 4ELME 5I2IA 1N6QL 4ORGB 2D03L 4OLEA 4Y19D 5DK3A 5KS9E 3GKZA 1ONQA 3MOAL 3SE8H 3LKQB 4CGUB 4HJ0C 1P1ZB 1XCWA 5FFOA 3FAWA 2ZOOA 3VQ2C 3N44F 3WFCH 1HQ4B 3B37A 5FPIA 1GIGL 1P7QD 4LBAA 3FQTB 3N0AA 1SBBA 3NSJA 4XBGA 4ZW3A 5KSBA 4KK8C 1K2DA 3TT1H 2VNCA 3I6KB 4QXGL 1OTTD 3MOBL 3N85H 1PZCA 4UOJA 4JFSA 3N2JA 4NXKA 4PJ9D 3PU7A 2FR4A 2EIZB 4J3OD 3WELA 1TETH 3B9VA 3MRJB 4NNXA 4CVXB 3P0VH 1OGTA 1ZSHA 1U3JA 4N2GA 1A1NB 1OZTG 3O6ML 5JOFB 2YO3A 4ZOEA 5MEQB 3V0IA 3EH4B 1SF5A 2AMUA 5TE6L 1EVTC 1IZJA 3FSZA 2A4CA 3TO2B 2J21A 4ELKB 4LDOB 1BMZA 2DIEA 3V6OE 5FYKD 5FA4B 3CC5B 3GHBH 4PJFB 3ILQD 3LDBB 2NYYC 3FB5B 1E4KC 4KAQH 2XQ0A 4U7KA 2G5UA 2ICWB 1SEQH 4HVBA 5FYKE 4LCYB 1HH6A 4B50A 1KOAA 1Y0LA 5DJYA 5T1DH 1I8MA 4K8RL 1BF2A 2H47C 3SPJA 2VDOB 2V5YA 4R0LB 3DVGA 3UJIH 3UC0L 3K6DA 1HEZB 1PS3A 1TQWA 1RK0B 3G6JF 1BQKA 2NCMA 1I1FA 1YPZB 4GQPH 1MHHB 1LDPL 3QJOA 3K5RA 4GY4A 3KM2A 4YVUA 3J2PA 5C70A 2BVPB 1J1OH 2CM6A 2RHEA 4OZHE 3WMSA 5B38B 4PFEA 3EJRA 3B2XA 4MVBC 3FHAA 3BAWA 3SKOB 3DOIA 3G04A 5C3TA 3U36A 1BLIA 1HNFA 4LP8A 2P8PA 1KTDA 1ETJA 1NTDA 1J8HE 4FQ2L 3JWNH 4FFTA 4KWUA 2WQAA 4GG8B 3FQ1A 1N0XH 2RD0A 4NKQB 2V2TA 4QHNB 5J1SC 3O2VH 1H0DB 4GSQA 4KKRA 4N26A 5D72L 5I74B 1A4KA 4XMPL 4DGVH 4D94A 1MKFA 2KLTA 4ZFGH 2VC2L 5B1JC 3CZGA 1WFTA 1KYDA 3H1ZA 5F9JA 4WHTA 1UB6B 5FDWB 4Y9BA 2NOYA 4LARH 1TZIB 1G9NL 4E41A 2YRLA 4OI8A 2WLIA 3BDYL 1WVZA 3QI9B 3SBPA 5MP6L 3TP4A 2C5DC 2QQNL 3BWZA 4PN6A 4E41E 4ETQB 4MGXA 4YUEH 4B95C 5DMGD 2L7JA 4HWEH 2ROXA 3NCBB 1LXMA 1P84J 1RZ8A 1P2CA 2JCWA 2X4TB 4DTGL 1EMTH 5HDBF 5DMKA 4E41D 5B8CC 2ZKYA 1ITBB 2NYYD 1XGTA 1OGAB 1TKWA 3CN3A 4MXWH 3NH7H 1RZKC 4M8RA 1SM3L 1MWAA 5IVZA 3ZY7A 4BDVA 4NO2B 1LE9A 3QE5A 3LZQA 1A1MA 4HETA 4NZDA 3HMWL 1CVRA 5DC0A 4ONOA 5CKAA 5HPMA 1UD3A 4QGYA 1P4IH 1ID2A 2GTZB 4RAUA 2E7BA 4PVNA 5C0AA 2FBJL 2IV8A 1MCOL 3KYKL 4XCYA 2WVTA 3S48A 1EFXD 3QG7L 2GCYA 4GJTB 2OXHB 4N2EA 1NIDA 2CJUH 1KGUA 4RCAA 1P7KA 3WD5L 1MWOA 3D85B 3EYUH 5M95B 3Q3GA 1R5VB 2H8PB 3EFDL 4K3EL 2CR0A 3U2JA 1WZLA 3OR7B 2VMDA 5I5RA 3BWAB 4ZFZA 4UT7L 1Q1JH 3U46A 4ELMB 1ZT1A 4UF7C 4BE6A 4JJOA 1FIGH 1RH8A 2HWZL 4BSWB 4OZGB 4AWJC 4R3SB 3DYMA 2IOIA 4MJ5A 1AY1H 5BZWA 4YGVB 3T0WA 3QULA 1CQYA 3TONA 4B0MM 4LP5A 4EI5C 1QVOA 1YNKL 2NY7H 5B39A 5E2TH 3I2CH 5GGSB 1GRWA 3BPOC 4ZO6A 5LAPA 1KPVB 1YMMD 5E56A 2CBQA 3SOTA 4MCNA 3WHXA 3PGCB 4ZO8A 1XSIA 5HP5A 3MNWA 4Y7MA 1NINA 4HWZA 1HXKA 2VDQB 3TWCL 1D3CA 3OPZH 2XN0A 3P4OB 3ZKSD 4W9DC 2F1AA 2HRPH 4K5PA 1OGTB 2PP9A 5IV2A 2X0WA 1BVZA 3CFEA 3DPBB 3IDIA 5IZ7A 3GMQA 4L0PB 3CLEH 2WJ5A 4P04A 1DJXA 1E2WA 3EH1A 1HOCB 1M05A 3TBWA 4G82A 2DLIA 4P06A 3DGDA 1JG9A 1B0GA 2J1XA 1OGPA 1JZ6A 4PVBA 3FQTA 3IJ8A 4MD4B 4W9CC 3OKEB 1MCWM 4EIZC 5D1ZA 5D7JB 1PF3A 4WTZA 2B08A 2O6CA 3LNDA 3T9WA 4JFXA 3CH8A 5GRJL 3EOAA 2WKOA 2YGNA 5MEPB 5LVEA 3FYEB 3QHFL 2KQNA 4PW9A 4PJFF 4F1ZA 4IK7A 4J6IA 5EU6D 1NUFA 3LKNB 5JPMB 3GXDA 2BVQA 2GFBB 3M1CA 4PJEB 5I19L 1EO7A 3CLFH 4QOKA 3DIFB 3U0TA 3M17B 4X83A 3NFSH 5EIVA 3EW3B 3BHBA 4QRPB 1TQTA 5HYFA 1T0NB 2E8ZA 2Q20A 3N5AA 3N55A 3T2QA 4EZLA 3A6CL 5L0QB 1KNOB 2EKSA 3H3PH 3I9PA 3IFLH 2N4IA 2Q76B 1T1YB 5DUBA 5BW7A 1LEIB 3MXVH 2YGPA 4MA8L 1A22B 2F68X 3FQRA 5DHEA 1MEXL 1XF3A 4CRPA 3QIWC 1QEWA 1HXYB 1IJ9A 1I3VA 4HXBL 5SWZA 1S9WB 1Q9KB 5E8DH 1DBKL 1NCWL 3A24A 2Z35A 4D7BA 1OTUC 5BS0A 1QBAA 4NWUH 1QRKA 3DUHA 1URIA 2ODHA 1I1AD 4XHQA 4I5BA 1WIPA 2X4RA 4AVJA 4Z7WF 4Y88A 5D6CA 4JREB 3VM5A 1W2KT 5FYJE 1UJTA 3BT0A 5ICZB 1CGYA 4FQHA 4EUPB 2FIKB 2PMZA 4ZUWB 1E3FA 1SXSA 1TPXB 3UPCA 2JE8A 5T3XD 3UIYA 3V6BR 3PFQA 5HHQA 4K7FA 2V5MA 4XGZB 4ALAH 1G9NC 3QEGL 2C1PB 2FUTA 3BKJH 1IEBB 4NWTH 1PIFA 4XO5A 3BYYA 3WXWL 2OZ4H 3H0TA 3IJEB 5JW3H 1IC4H 5DA0B 3S35H 4XN2A 3BEWA 1CG9B 1XR9B 5HDQH 3WUWB 3LKSB 5FUOH 4BFNA 3FT4B 2PW1A 1IAKA 2V3EA 5CIPB 3WFHB 3L7EB 4GXVL 3PHQB 4UU9B 4PS8A 3S96A 5IW6B 3ROLA 4GRLA 3S34L 1ZWIB 1S5HA 1ZA3A 2WQXA 3SD5A 1QWNA 1M9WA 3FQXB 1KFAH 1RPUA 2UZXA 4JQXA 4IIQC 4X6BA 5FB8A 3N42B 3C8HA 4JFYA 4P46C 5EO0B 3CXHK 4JGJA 1G6RH 3L5IA 4JKLA 1S9VB 1I4FA 2ZPKL 4N86A 2DM2A 3MUJA 3OB0H 1UGKA 3QQ3A 3SY0B 3WL9A 4OM1H 4P48A 1HESA 3IGAB 3VFPA 3QDME 1O9WA 1WQVT 3QEQD 5B1JA 8CGTA 4LQFH 1W0YT 5ILTH 3ULUD 2ADFL 3D12B 4PRBB 5E4OA 3GFUA 3QR1A 4P5TD 3U2SB 1MJUH 4IDLA 5F7BA 1EGJL 4NN6B 3SCMA 1E67A 1PW3A 4X5XB 3BMWA 1ZV2A 4IEFA 3A67H 1MAMH 3K5SA 4HGKC 1MHEB 1KBWA 3BJ91 1QRNB 2Q3ZA 3DOHA 2ICEA 4N6RB 4M7KL 3F12A 3QNZB 4ZAKC 3TC9A 3FO0L 6CGTA 2X09A 3FB7A 2LFEA 4JO4L 3WLBB 1BQLH 4MJIB 5FXCH 1EPFA 1XF2A 2A6JA 2X6BA 2PTTA 3SGKA 3BSZL 3HHRB 3C5ZC 4PJ9A 5HHOD 2EUVA 2GITB 3L3IA 1NIBA 3NJIA 1GGBL 1IAKB 5CIPA 1SYSB 2YKLH 1AZUA 1CXLA 2KQMA 1BQHA 4LZKA 1ADQA 3MNVA 1KB5L 2WQSA 3VQLA 1YCSA 2Q3XA 5HHOE 2KC0A 1IE4A 3T8XA 5KBPA 1YA5A 1IGFL 3GRBA 1CG9A 1CE6B 2N7AA 5B3JE 3WY3A 4AEFA 4ZMOA 4OGXL 4UT6H 5E23A 4XNDA 5IFAL 3FB8B 4G6JL 4UIKL 3V0GA 2YUVA 5FK9B 1DE4A 2YPLB 4PG2A 3OKNA 1EZUA 3X12B 4B96A 1KT2A 1Z9MA 3IDNA 3KPOB 1OCOB 2D7PA 4EOWH 2Y6SD 2BWQA 1CYGA 3EYQD 3GSOA 4L4VE 4TV3A 1QPKA 7FABH 4ANVA 1M6OB 5SWSD 3TCTA 3AMLA 1IBDA 3JV4A 4NKMA 4NS0A 2DMBA 4YL9A 3THML 5AVRB 3VJ6B 5H2BB 4UBDD 3B1TA 2WSPA 4P5SA 5CJXA 4B7LA 4F3FA 4BK5A 5KSVB 1F3DJ 3T1WA 1JPFA 1SOKA 4LRNL 3BFOA 4MQ7B 1IVLA 5IJCC 2YD5A 2A6DA 2FD6L 1LO0L 5CM1A 4JFEA 3BD5A 4UWQB 4FQPA 1MNUH 3CZLA 3J07A 3O3AA 3KPLB 3HS0B 1RY7B 5HDRA 4AYEC 5DDHA 4GUQA 1I1AB 3TVMC 4BZ2H 4ZAKD 3KPMA 5DFAA 2P7TA 2IOOA 4YXLH 1E9QB 1ND0A 4Y4HD 2GUYA 3TT3L 4QGTA 3WENA 2VUKA 4PRHA 4U4IA 3LKNA 5AAPA 1JF1B 4WCYH 2Z7YA 2MHAA 43CAB 3ULUL 1PZSA 2A6IB 1R5WA 5AALA 5BO1H 5I6NA 1V3LA 1D6EB 3VFMB 2PWGA 2IQAB 1D9KB 4YHLL 4WWID 4N2OA 4OGZA 4WSJA 2F1EA 3FUNA 2DQ6A 4A63A 4X7SL 5B22A 3OKEA 2VQ4A 4MXQC 1RZJC 3DX0A 4NRXA 3V4VB 2NY5C 3VFSB 3P4MA 3R1GH 3V0WL 4Z95H 4NB7A 4RMBA 4LPTA 4U05A 2DBLH 5CXPA 5GIRB 2C3GA 3CFQA 2VZOA 1S8DA 3BJLA 4I4WA 4IOSA 4AQ8A 1FNLA 2Y7QA 5INDA 3LRKA 1G7JB 3GXPA 5IGXL 5HYSA 4H1LA 3HI1B 4ZMXA 2AVFA 4P0DA 5F9DC 1NCOA 1Q72L 2UZPA 5MEND 2Y5TB 1G9ML 4DEUA 4FABH 3IXTA 2XTJC 1NKOA 2VRQA 3FUFA 3BD3A 5ID1B 3PV6A 3HZMA 5JO5B 1PD0A 3FQUB 4XXCC 5CJQH 2WZ6A 1WISA 4KXZH 1DQQB 3BXNB 2HMID 1OCRB 1PD6A 5D7LE 3ZTJG 3L3HB 1QFWI 3CFNA 4X4YB 2EADA 5E6ID 1D7FA 4X5LA 4M00A 3VD5A 4G5ZL 4JFOA 1RK1B 5T3XL 3MQIA 2AEWA 1RZGB 1FVCA 5I30H 2NTFB 4KO7A 1U8HA 2X4SA 2E75C 4MJ6B 2WM0A 1BAGA 5I66B 4QDGA 1BJ8A 5E5MA 4AYID 1GZQA 3V4PL 1VGEH 4GW4B 4A7UA 4WU7B 5T5FH 2OJEB 3ME0A 1ZGLP 4HV8A 3OAUL 4KQ3H 1R5VA 3KJ4C 3O6FB 2BP0A 1CIUA 3RNKB 1F2XK 2R69L 2P5WA 3F7YB 2FBRA 5HHMD 1F11B 3P4NA 4PRAA 4DGYH 1NMAL 2OMWB 2OXHA 2YD8A 1CD1A 3F84A 4Q6YA 5I18H 3V0JA 2Z8RA 4X80L 2X4UB 3GIVB 1GYCA 3LQMA 1JDDA 4MNGB 4ZUTB 1Q9WA 1VESA 4E9TA 3FPXA 4U6YA 3C60A 4N3TA 4H40A 5CINL 4XVTL 1NDMA 1MHCA 4F7PA 3I85A 3UPRA 5IHWA 3ARTA 1M7UA 1T04A 1TUPA 5A2JH 5EBLA 3QR0A 1UADC 5F8RC 4LHJB 4OLVH 4DZBA 1GZPB 4U1JA 4XXCA 1MJ8L 5D9SA 3ARXA 5J6HA 2AXHA 4U3SA 3NQIA 4YK4B 2IBZY 4N2FA 4R7VA 5EH1A 5L2JA 4IU3B 3Q6GH 2Y6SC 4TKWA 3CNKA 5HYSB 4ATTA 2R51A 1U4FA 3HG1A 1KXVC 4GLRI 5D7KD 4QHPA 4HBQA 1OT1A 5AZEL 3ZT5A 1YEFH 3AT9A 1E30A 1ADQH 1JZHA 1NBVH 1P53A 4HFUH 2K6WA 4FXGC 5D7KE 4FNLL 3W3BA 1JNHB 3KEDA 4RGMB 1D7BA 3C2AH 4D8PB 5ESQA 1SQMA 4JPKH 4GOSA 3HMXH 4P4KA 3VXRE 3OJDA 3KPPB 3V6OA 3EYFA 3MRQA 4MA7L 3PABB 3HUJA 4RFOL 3BDBA 3VFOA 5CMAB 3I74A 3QUZD 2HFEB 4OFDA 4PJ5A 5FEBA 3RVVD 1CCZA 5DJ2A 2EQDA 2XN9E 4YEEA 3W9DB 1U21A 1JXKA 2FEEI 3KYMB 2W9EL 5DR5H 5TFSL 2BOBB 3DHUA 3GKWH 3BWUF 2BY1A 4KZCA 2Z4QB 5ITFA 4PRPB 3RIAK 4HJGA 2B4CC 3V52L 1LYQA 2AXGA