4F8TA

Crystal structure of the human btn3a3 ectodomain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
210
Chain Sequence
b'QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGGGVSCIIRNSLLGLEKTASISIADPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Butyrophilin subfamily 3 member A3
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell response by CD277/Butryophilin (BTN3A)-specific antibodies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 210
sequence length 213
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f8tA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f8tA02
4LFHG 1A6AA 1A7OL 2COQA 4S10A 4WO4D 1CE6A 2EEDA 3LEVH 3HFML 4XCYA 1S5HA 4NRZB 1WTLA 3UPAA 15C8H 4JZNA 4MJ2A 1X44A 3SCMA 3V6OE 1KJ2L 5HHXL 4KKBD 1Q0XL 3B5HA 2LTQC 5C09A 2OK0L 1HEZA 3IU4H 2CDEA 3MGOA 4ZFFA 4P57A 3HCVB 4K23H 3U0PB 3SJVE 4P5TC 3MRFA 3NCFB 4RMSA 4NO3A 4X9HA 4RGNC 1BOGB 3IJHB 4G6ML 4XP5H 1CFQB 5IM7B 3ARSA 5H35A 4DN4L 1QEWA 2BSED 2HT4C 1KB9K 3VFNA 1CZ8L 3QRGH 3SQBA 3BPCB 2VXTL 1W8OA 1MIML 5AWNL 5I8KH 4JFYA 5IP4A 4PYGA 5ESAA 3F7YB 3PE9A 4UDUB 1RZFH 2CGRL 4NGHH 1XGTA 1WITA 5K9JH 5ID1A 5K9OB 1QYGL 4NQCA 3PJSB 2IGFH 1U8LB 4AMKL 1MFEH 2IQAA 1CL7L 4NQSB 4XVTH 4ELMB 4UV4L 4X6DA 1R5VB 2ARJB 1BMGA 2HRPL 2IPKB 1AXSA 4FQCL 2ZUXA 5CJ5A 4KMTH 2NPLX 4WHTB 3TLRA 5J1SC 4YXKL 4F7TA 2BVYA 3Q5TA 4I3SL 5GRVK 4AG4H 4K7PH 4ODSL 3CFEB 2YPLE 2W9EL 3DNKA 4OGAD 5GXBB 4XI5C 3JWOL 1BGXL 1H15B 3FO1A 4O02H 2IPTH 3PHQB 1UJ3B 5L0QB 2GSIA 4PRPB 5GIRA 3MOQA 3QHZH 2LABA 2R39A 5CIPA 3FONB 2HJLA 3O6FB 5F88A 3T0EE 1FLRH 4OCWH 1KLUA 1TVHA 4RA0C 3ZHLA 4GXUN 1K4CA 1G6RB 4GRLD 3VFRA 4DZ8A 2Y6SD 5D5ME 1N5AB 4C56B 1T80A 2HWZH 2QSTA 1Q9KA 3GUTA 3HMWH 2VXSL 4LSQL 4Y4FB 4DJMA 5JZ7C 4GG6F 3EJZD 3F6LA 3WMSA 2WBWB 3R1GL 3MRDB 4RMTA 1RIHH 3G6AB 3L7FA 2ATPB 2WWKT 3KXFD 3N50A 4KKNA 2KUTA 5TQ0H 4LPWA 4FMKA 1BD2A 5L88H 2A6DB 1ZOXA 2AABH 5HI3D 3UZEA 2FJGA 2BRQA 1IFHH 2Q8BL 3Q5OA 2FNBA 4P99A 4U0RB 5DMIH 3BVNB 5KSVB 3VXUB 3GJFB 2C5DC 1DANT 4YGVA 3CMOL 5IK3A 3V0WL 1X3DA 2OJEB 5IHZB 4FQXC 1CGWA 4FQXA 3O2WL 5BZWA 4Z7UF 5K9QG 3D39A 4UQ3B 4NJAH 2VQUA 4PY7A 1J1XH 3FB5B 5HDOA 4HUWA 4HUUB 1DN0A 3O41A 4NNXB 3SCMD 4LVHB 1DLFH 3CNKA 1T1XB 1KIRB 1T3FB 4A6YH 4OLZL 4L4VD 3ABZA 3RUGB 5CINL 3MO1A 3FB6A 5KAQG 3OTTA 5SWSB 2ZNWA 1P7QB 1LGVA 2G75B 3NGBC 3QBTB 4ETQA 4I5BA 5KZCD 3PHSA 3QUYC 4JY6A 4XCFH 5FYKD 1OW0C 3FRUA 1CTNA 1OW0A 4X4XB 2BHYA 1ZT4B 5KSAD 4XPFL 1CG9B 2HT4D 2FWOB 1IILE 3RWIA 2BFVH 3I85A 1AY1L 3K7UA 1CD1A 3QDAA 3UZQA 2V5TA 5IVXA 1LK2B 3T2NH 5DEFA 4OQTH 4HV8B 5GRYA 4P46B 2VDOL 5FOBA 5FYKH 3HR5A 3UPCA 3K8LA 4L9DA 1ZHBB 1A6WH 1MJ8L 4MXVE 3QWQB 3M17B 2V5RA 3M45A 3HNTL 3BZ4B 1B6UA 4PJEE 1P1ZB 1JTOA 3UJJH 4JPIA 4CN4A 3DUUA 4M7JH 2FZ3B 3NFNA 3QP3A 1NANH 5IG7A 5KVDH 4Y5VC 2FSEA 1TIUA 4Y5VA 1ADQA 1IZKA 1CF8L 1LD9B 5I66A 3I6KB 1NGXB 5JR1L 4XI5D 2ZP0T 3LD8B 1T5XA 3BD4A 5HGAA 3JVGC 5MI0B 1N6UA 4X7EC 4QHKJ 4YDJA 5E9DD 1NC4B 1JN6B 3P4OA 5CBEB 1ETZA 1JJUA 2EYSB 5HDQH 5JHLL 1NBZB 4OV6F 4XXCA 1F4WL 4PPTA 3UYOD 3WEXB 3T2OA 4BQCA 4X98A 1RZ8B 3G6JF 4RMUA 1JZ2A 1F58H 2YA2A 1RURH 3H9SE 3MA9H 4K8RC 5F7MC 1DUZB 5J9PB 4EUPH 3RWJA 1CD9B 1UJTA 2WZPD 3QWOA 3OWEA 4JFZL 2A0LC 4OFDA 3E6FA 3O8XB 5FGCB 4QRUB 4JFEB 2VR9A 4YHYC 2FHBA 1QLRB 5J12C 2X9WA 3K4DA 4FRWA 1F6FB 3C6LB 4NZJA 4GRMB 5INCB 1MI5D 4GKZB 2Q87A 3KPPA 3X12B 2ZUQB 2CLVB 1F4XL 3ECBB 3OJDB 3U79A 2QJDA 3MRNA 1OP5K 1OQOA 4EVNA 4LCWE 1NLBH 3SJVA 4EDWH 1PZUB 4FG6C 1DL7H 4FXKB 5C0AE 3OJVC 4X80L 3ROLA 2QKIA 1T1ZB 1P2CA 2QHRH 3X17A 3OZ9H 3EOTH 5FGBC 5FGBA 4AL8H 5CMAB 2NXZB 1KIUA 1FPTL 3UTSE 2PETA 5BVJA 1W72A 3G04B 4JVWA 2K1MA 4I0PD 3MNWB 2HMID 1G84A 2XA8L 3V0VA 5I1LB 3OAZK 1F97A 3HB3D 4YUEL 1NCBL 4JM2B 3M1BB 2CRIA 4EN3C 1N8ZB 4EN3A 1KTDB 2ED9A 3D18A 3MRRA 4NDMA 4YWGH 2E6JA 1JBJA 4OF0A 3U4BL 3UC0L 5FIEA 5IVOA 3SQOH 4X8JB 4G43B 3DURB 3SHSA 5B38G 2Q76B 4U3XA 3ZKQD 1UXWB 5HVFB 3H42L 2O5XL 3VFMA 3PWJB 4J8RA 2DMBA 4NQXA 2VL5B 3TV3L 3V6BR 1JGDA 4HIXH 2YPLA 3EYUH 4OSUL 2O93L 1KBGH 4HF5H 4K3GA 3BPOC 4O2CA 3L5IA 4Q6YA 2KQNA 3EYOB 4NO0A 3OXSB 4QOKB 3T0EC 3O45B 3MLTA 3CPLA 3VMNA 3T0EA 3TGXA 3KPMB 5HY9B 4BZ1H 2P8PB 5GGTL 1XF2B 2OM5A 4OF5A 5D5MA 2NMSA 4JFHD 4X7FC 4X5WB 4LIQL 1FCGA 2QQNL 3RWCB 1FBIH 5I15H 4OZFH 3I02A 4LSRH 1A7QL 3CGTA 4HKJA 3WN5C 4Z95H 1CDIA 3WN5A 2PR4L 1I8LC 3VE0B 1TQBB 1LQSR 2B5IB 1I8LA 3DGCR 3LN4A 4MNGE 3TPUA 5JDSB 1AGDA 3QIUC 1OGAB 1G9NC 3QIUA 3RY6C 3RY6A 1VKXB 5A43C 2JCCB 5E95B 4MA7H 3FT4A 4JANA 3L9RB 5KOMC 4NP4L 1MNUL 1C08B 2YR3A 4ZUVB 3NCJH 3VXSB 2Q3ZA 4HPYL 1QHOA 2A38A 3QI9D 4FXGA 1ZV5A 3F7VB 3QAZC 4S1QL 3MV9B 4CAGA 2P1YA 3TBTA 2A6KA 4ZTOH 4HXAL 1OWRM 3KYKH 1QRNE 1S9KC 1U36A 5DJCA 1A02N 5FK9A 2X89D 1CU4L 2X4PA 4NUJB 3BIAX 4NO5A 3QQ3A 4YR6B 4NZTL 5T5FL 3VFUA 4TPRH 3GKZA 3HC3L 5IFAL 2RIKA 2DQJL 3SJVD 1EJOH 2FIRT 4HLZG 1Q38A 3QUXC 3GBLA 3K46A 2B20A 4FG6D 3QUXA 4FQ1H 5E6ZA 4NWUL 1U8HB 5DQJA 2V5SA 2LE9A 2HT2D 1XGRA 4O58H 3MRBB 2APBA 2Z35A 1NCAL 3U30C 1QBAA 4HD9A 1E4WL 3OKNA 3VH8B 4JZOA 5DD1L 1HIML 5HYSB 5IHUH 4F3FB 4PJIB 4P59H 5IMOB 5E2VH 2OL3A 1C16A 1U92B 1XF5A 3QJHB 1MREL 5K59E 5F1NB 3WO4C 4L3EE 1PG7W 4F7MB 4FFVC 5C3TA 5ETUA 1N4XH 2NXYB 4HGKC 3ZE0E 3V5KA 2G5BB 4YHZL 4X5XA 2F53B 3PP3K 1FIGL 1J0JA 3S88H 4PJEA 4Y1AB 2D0GA 4M02A 4J3VA 3P30L 4UILL 4F7CB 1DEEB 1OHQA 2C26A 1CD0A 1C12A 1MLBB 2ZCKH 1F6AA 3TA3B 5E4EB 1GOFA 5DQ9A 3STBA 3T3ME 3PUCA 1TZGL 3GMQA 2P4AB 2ED7A 4ORGB 1S9YB 4JDTH 2DI7A 3MLVL 4X9GA 3X3FH 2Z91A 4IDJH 4LLWA 2J4WL 4WW1B 2AP2A 2BHZA 3BT2H 4PGDB 4NO0D 4ZO9A 5D96B 2WW8A 4RGOH 3T0ED 3BGMB 5T33H 2APFA 4PLJD 4DKFH 1FZOA 4FP8H 5GRZA 3TNMA 4BQ6A 3QG6A 4I77H 1OARH 5GZOD 1GAFL 3JWDH 2EH8H 4OI8A 2EDLA 3H9SA 3H3PH 4ORZC 2EDKA 5JA8B 3DXAB 3IVKA 3O3UN 2O5ZH 3SKUD 2PTTA 4M43L 1F90H 4Z76A 2WUBH 1T7WA 1X5KA 4JQIH 3DSFL 5EO1B 5GZND 4H1LG 5F8QC 4KTYA 3ZDXF 4Y8DC 1WVZA 4KVNL 1Q9LA 4OUUB 5D8JH 5HHNB 2R0ZH 4UDTB 3WO3B 1S7SA 1U8QB 4POZC 2J1KA 3DRQB 1MJ7H 1WFTA 4ZFOA 35C8L 1CFNB 1HXMA 1FVDA 1KEGH 4JHAL 1LO0H 3VD7A 3VI4F 2V2XB 4XCEB 5DD0H 5DHXB 4RFNC 5KTEH 2O26U 3UAJC 3N9GH 3QO0B 4QHNB 1FL6B 2BERA 1KCLA 3OXRA 2NW3B 1KPVA 4LCWA 3RVVD 4JREB 4G8GD 3VRLF 4ZFGL 5C0AA 1A0QL 1INQB 5JTWA 3BMVA 5C0BB 2P7TA 5T1DL 4XMKL 3GI8H 3NMEA 1HHGA 5FHBH 5DXWA 4B53A 4UBDD 1OCWH 4LNRB 4PG9B 4Q7DA 2ZUUA 4KTEH 1QFUH 2AXFA 4JRXB 4F57L 1A7RH 1FL5A 3GSOB 3EYQD 4OGZA 3UTSA 3V4VH 5FDYA 5MENB 1UZ8B 5DI8A 4JLRB 5EUOB 1MFCL 2FATH 5DD6A 3GSWA 4S2SA 1KUMA 1RVFH 3D9AL 2P46B 1LDPL 3ZDZE 2I25N 3TCLA 5I8CA 3EO0A 4PRIE 1RJLA 4LSPH 3L7EA 3HAEG 4PJXB 4PUBL 2AVGA 1JP5A 2WUCH 1E4XL 2CJUL 5DFWH 4BELD 1QRKA 3MLSL 2CKBL 2ENYA 2VLLA 3BZFA 1TPXC 4M9OA 3LKQB 3RUGF 1B4JL 4M1DH 5J4MA 1KEML 5CWSA 4QHUA 2Y72A 1FC1A 1J5OH 5HYFA 3MRMB 2BVOA 1M71B 1WF5A 5DJXB 4QXGL 1AH1A 1I7RA 3QSKB 3B9KB 1CXLA 4MCYB 2ZJSL 4IRZL 3QNYB 3S5LB 4P2RB 4MZ2A 2HKFL 2AJUH 2HLFC 4O51A 3WHXA 3ZSSA 3VXQB 3DRTA 5F71A 5SWQB 4YAQA 2R4RH 3NIGE 2IH3A 2VH5H 4DUVA 2DS4A 1ZLWH 4QNPE 1CLOH 1D6EA 3B9AA 2NY6C 2Y36H 4YFEA 1G7LB 4QTIH 3MRKB 4JFFD 1VFMA 4APQA 1OSPH 4U1HB 4G80A 1MFDL 3U4EA 4XB8A 1IC4L 1YECL 5DHVH 5I6XC 1LEIA 3BUTA 1RZKC 3OSKA 4UAOC 3VD3A 1U8IA 4MMZC 4MNGA 3SKNA 1IGTA 3C8KA 1E6JH 2IAMD 1FFPA 4DVRL 1LO3H 3HZVB 2VE6B 3DMMD 5ISZB 4FZEL 2FIKB 1N0XH 3LQAH 2HFGH 4XCNB 4N8VA 4RMQA 1EFXA 2VLJB 5HDBE 3QDJD 2CDGA 1WIPA 5I76A 1NSNH 3BKML 5DTFB 2DOCA 5HHMD 3IDNA 4AT6B 3D87B 4FQQB 4XNXH 1W0WA 2CK0L 4ACPA 1XGYL 1CS6A 3O3EA 4X6BA 1YC7A 1QRNA 2H2SC 4LPXA 4MAYC 2DM3A 4MAYA 3MRCA 5C8JB 3D2UB 5CEXB 1VFAA 5C0JB 2X7LB 5IFJB 5DJAB 5E7BA 3GSRA 4JO3L 1MCRA 5KN5A 2OTUA 2NY3C 3V6FA 3PWUB 3FB7B 5DT1L 5I8OL 4LCWD 5DDHB 1KPUA 3KYOB 2V9TA 4HWZB 3RWEB 4WEMB 1A6VH 1R6VA 5IT2H 4TULH 3IJSA 3V7AG 2CDFB 5DHYB 2CXKA 5LAXB 2YMXH 1LO4H 4NKOB 2MPAH 1NUNB 2N7BA 3EZ8A 2EKJA 2Y5EA 1NKRA 3R0NA 2XWJB 1LE9A 3DX8B 5CSZB 5LG1A 2GJZA 2CRYA 5BMFL 2J88L 3L95A 5GRVL 1A4KB 1YEJL 3N1MC 4JAMA 4L3EA 3GMNA 1FNEA 2YSSB 1YYLH 4KK8D 1DDHA 3W82A 2EXWD 1CGTA 1N59B 1ZT1B 5E00B 5I1EH 4OFVA 1BVKA 4D0DB 1JHKL 1U6AH 1XIWD 4WRLA 3TJHC 2ICWI 1MCSA 4WDIA 2X4SB 4K94C 4IRJB 1JGUL 4PD4K 4R96B 4HIIA 1B90A 4JM2F 4K7FB 3WFHB 4F7PB 1NAKL 4I9WE 4WWID 3VJ6A 4ZAKD 4KRPC 5LQBL 2OS7A 4HCRH 2PXYB 1DBML 4NNYB 1WIUA 5E6ID 3CFJA 3OHXA 3QIBC 4R2GD 3HMXL 4Y4HC 3QIBA 4LVEA 5D7SL 4MD5B 3HE7B 2W92A 3WLWD 2H41A 4Z78A 4AYFA 2PO6C 4M6OH 3W2DH 1IAKA 5F1IA 3GJEA 2PO6A 4LHUB 1IAMA 2MFNA 3TF7C 1E6OH 3DGGA 4DGVL 3JV4A 5GS2D 3I84A 5JW4R 2R2EB 3QFJB 3PWPB 4ZUUA 4APQD 4LASL 5H37G 3FFCE 1VENA 2X4RA 1RIVL 3EKCA 1QBLH 3EYFB 3FRPG 1U95A 3GBNH 4GRWH 5J11B 5EG6C 2WINB 1U2HA 3ZT5A 3B3IA 1ZT7B 3Q6FB 5CJQH 1G7IA 5AZEL 5FB8B 3O3AA 1NGPH 2G60H 2Q7YA 4CU7A 5ICYB 1EFXD 5BV7C 2P24A 2F9BT 1UKSA 2ZOKB 1WEJL 2VLME 3GIVA 3QDMD 2DLTA 2XQBL 1NUGA 4L4TB 1JHTA 1WZKA 4PY8I 2W65A 5JMOC 1LVEA 5DSCB 4MB5A 5D1QC 4L8BA 1IL1A 1QRND 5D1QA 5ACMA 4O9HL 2JCCF 2CD0A 3FTGB 1A3RH 4X4YB 5EU4B 2EDRA 3REVB 4P2YA 3MC0A 2DWEA 1R0AH 1T1WA 2NYYC 1QSFD 3EFDH 5EBLA 3B2VL 4XMLL 3MBXL 5BQ7B 3F58H 2AJZA 4MJ5A 5D1XD 1IGJA 2DM7A 1YYMH 2CMRL 4WFFE 4XX1G 3OAYH 4YE4H 3AAZA 1U41A 4HT1L 3RTQD 4PRIA 5DD5L 3BQUB 3OPZL 2ZUYA 4HHAA 2VDNH 5AUMA 4XVUD 3I75A 4KQ4H 5GRJL 5LCVL 2P5WE 1NBVL 3AY4C 4Y4KD 1HCVA 3AY4A 2HVJA 1MCBA 3L3JB 1Q0YL 3ES6B 3KJ6H 2Z31C 3A6CH 2Y06H 3O3BB 4S1SL 4OFYA 4L3ED 3ZE2F 4GG6E 3W9EA 4QWWD 5EWIL 1LO5A 1RJZB 5GSVB 1EDQA 3Q0HA 1FRGL 1IAII 5DJ6B 1U93A 2CUMA 3LPGA 3BEVB 3DROA 4IS6B 1SEBA 4NN7C 5D71L 3TJHD 1LHZA 4ONHB 4PJIF 1YQ2A 1X5GA 2ZSWB 4M6NL 5JW5B 1EX0A 1T22B 4OGYH 3MCLL 4PJBB 1HHIB 5DFVD 3IYLW 3FOLA 4CMHB 4M8VA 5E2TL 4UV7H 4XP1L 4KRPD 4FQHB 1F11A 5KS9B 4YFLF 3BH9B 3IFPA 2VC2L 4U05A 3GMPB 2EIZB 3L3KB 1N64H 2NTSP 3QIBD 4HIHB 4Z7UE 4TNVK 2WBJB 1X6NA 4YIQA 4UNUA 3QQ9C 4U1JB 4LAJH 3KAAA 4KXZI 3TZVB 3GSXA 4XPAL 3W39A 5DR5L 3FQNB 5BRZE 4BKLB 4PG2C 4KROC 2HH0L 4PG2A 1M6OB 4KC3B 3QQ4B 3ARDD 5F7DA 4DAGH 4Q9BA 4YZFF 1JV5A 1YJDH 4M5YL 4PJAE 4WO4B 3GSNH 3FN9A 1A9EA 4MJIE 4QHLB 3KPNA 4I48B 1INEH 3P77A 4X0KB 3C09C 3SKOA 1VA9A 4FFYL 4P5MB 4JFDE 2PW2A 4EDXA 4Q2ZB 3ESVF 5A3IC 3U9UB 4MQ7B 3C5SA 2CO6B 4X6EA 1JYXA 4Q9RL 4LLDA 1ZMYA 1BHGA 5BVPL 1FE8H 1SBSH 1JYVA 2G2RA 5DUMH 1OT2A 4RAUA 4QRRE 3C08L 4PTTA 2QQKL 1R5WA 3IDUA 4PB0L 3HS0A 4ODVL 4PJ8D 4WNQA 3TBVA 1NPUA 4HX1B 2HAZA 4LSVL 3FB8B 4U1LA 2WWMC 1FYHB 3S98A 4YXHL 3S9DB 3LMJH 1II4E 1K9TA 2EDJA 4Y89A 3VWKC 2EE3A 1BZ7B 3SGDH 3VWKA 4ZNCD 3DX7A 1J88A 1KCRL 4XPHL 1FNSH 2AV7A 2WV3A 5JXEC 2A83B 4M7KL 1DBJH 5JQ6L 1T20A 3F5WB 4WEBH 4P3WA 3NFPB 5F7EL 2I26N 4JPVL 4IHOB 2IF7A 3ZTNH 4P3DA 1IGYB 5IB3A 4MNHA 1MEXL 4RIRA 4B41A 2R9HD 3LRSB 3UTPD 1CQYA 3WS3A 4HXBH 4YO0A 3F6IA 3WNLA 5CHNB 2J6EH 3RRQA 2XZQL 3NA4A 5IF0A 5GISL 2F19L 4ZDHA 1KF9B 3WXWL 3VXNA 4HW6A 2DQDH 3I50L 1FZMB 2DQUL 1JIBA 2AJSL 4ZG1A 3PWVB 4IEFB 4LLMA 3RL2A 5C2BH 3IAPA 1RK1B 3C5ZC 3G6JE 3C5ZA 4N0CD 4WU7A 3DV4B 4YQXH 2AJYH 4FOMA 2E7MA 1MJJA 3P9LA 1U91B 4KRNA 2D7TH 5E2UL 4OM1H 4L9LC 4UTBL 4XBEH 3V4UH 2LU7A 3DVIA 4LBEA 1EBAA 4L9LA 3MA7B 3A67L 3IS0X 4XTRC 2CPCA 5EC1B 1A6UH 1VESA 4DFIA 1NMAH 1J1PL 3U36B 1EJ6A 3GSUB 3BISA 5J3HD 5HPMA 1CDHA 5CJOH 2BDNH 2B7DT 2Y7QA 5C07E 1BM3L 3OR6A 4LRIC 2HG5A 3GRWL 3MUGA 4L3AA 4LRIA 3FFCA 2R69H 2XKNB 4MLSA 2EYRB 5I19H 1QFWH 1RI8A 3CUPA 5E0QA 3CU7A 1WZ1H 1CICC 3P9WB 1CICA 1MWAB 1JI1A 4M7ZB 1MCLA 5IV2B 3GBMH 1BLNA 1TETL 1XT5A 3PWNA 5JOPE 4G8IA 4P2OD 2ENSA 2XXCB 1KPRA 3N85L 4FHBD 3VG0H 2Z9TA 1A7PL 5DVLA 2L4OA 3WFDL 2V9QA 4GAJH 2OP4H 4GG8A 1HYSC 2XNAA 3OQ3B 4LKXB 2E6PA 3R8BB 1RZ7H 5ITBH 4L4VB 5I71B 3QULA 4M61B 2ZCHL 1FYTE 1V05A 5E6YA 5E99H 5C6TL 1KCSH 5L2JB 2E9JA 5KZCB 1JF1B 4OLYH 4M8QA 1HQ4B 2BMKB 5GGQH 1BF2A 5KSAB 3KG5A 1TENA 4BFEA 5C7XL 1FG9C 5ALBL 1DUYA 1PVHA 1AGFA 1QVOA 1UWGH 1XGUA 2X4OB 4XNMB 3BEWA 4U1SA 5FKAA 5DJYB 1AGCB 1IAOB 1HINL 1AO7E 4JGMA 4XVJH 1IEBA 1V3LA 4JPWH 4JKLA 1A1MA 3T8XA 4RWYL 4YX2H 2P5WA 3O2DA 4LSUH 3L3IA 1YEKL 2DB8A 1UGNA 1FNLA 3U1SL 2Q3AA 1FV1A 1HHKB 4GG6A 1A5FL 5D1ZD 1L9MA 3B83A 1JPSH 1T2XA 2NQCA 4N90E 1GZQB 4S11A 2J5LB 4AH2B 1AR1C 1I8MB 1KYOJ 4JO1L 1BEYH 43C9B 1D9KD 2ATKB 3UX9B 1KSRA 1HSBB 3IT8D 5EFIB 3OKOA 3QUZC 3OKEB 4LLAA 4MAUH 5EOCJ 1PQZA 1I75A 3QUZA 1ZS8B 1YQVH 2WLYA 3C5ZD 4S0TD 5EZOH 3VGAC 4EUPB 2BNQE 2HTLD 4I9WD 1YY8A 5E9DB 1PZ5A 2HJLB 5JUEL 3ZT6A 3GEWB 4KJWD 3JTTA 4M7LH 1JWSA 3KNBB 1MY5A 3HC0A 1IGCL 5C0RL 2I5YL 3AMLA 1YMME 3RP1A 3WFCH 4XTRD 3JZ7A 4Z7UA 5F89A 1F6LL 3PNWA 4QTHA 5EO0A 4N0YL 5CKGA 1AI1H 3B9VA 4LCUB 3T4YA 5IGXL 1I4FB 3RWDA 2DDQH 3O11B 5BRZA 2BSRA 2C3VB 1UADC 1QFHA 4N0UB 3UDWC 4DEPC 2FBJH 4TVPE 4NC2B 3UDWA 5B38A 1S9WA 4OD1L 4OD2B 4PJAA 4LARH 1DBBH 1DFBL 2ADJA 5C0CD 3O6ML 4MJIA 4UNTA 5K33A 4ZXBC 4G5ZH 4MA1B 1OPGH 4ZXBA 4JFDA 1P4IH 1MI5B 2ADGA 1L0YA 1OAYH 1XGQB 4JM4H 4NYLA 3GM8A 4WV1C 5BJTA 1WK0A 2ICEA 3VGEA 1YMHB 4WV1A 1NMCB 3RAJH 1J10A 2LVCA 1EVTC 4JEGB 4UQ2B 1U42A 2GT9B 2VXTH 3CH8A 2NY5L 3ZYIA 4QRRA 2VLMD 5HYQB 5ACZB 5DQDL 1F4YL 4OFKA 3S5LG 2DQEL 5LXGL 3ARPA 3MLUH 3SY0B 5LWYH 1X4ZA 3SKJL 4YHOH 5IKCA 1N5YL 3ULUF 2DYPA 1J18A 1JFQL 4XWOD 4HPOH 5IJKC 4PJ9B 5IJKA 1ORQA 1N7ML 5CILH 1J0IA 4M93C 4R7NB 4NM4H 2F8OA 4I0PB 3IXTA 3T0AA 2M1KA 1UZ6E 2YN3A 1CFVH 3EOAB 3LB6C 5IMMB 4WFHD 1FDLL 4LEOB 3D0VA 2DQTH 2R0WH 3NTCL 4QRPD 4Y7MA 3KYNB 2NY2C 5F9OL 1CWVA 2OR8A 3UZVB 3RFZC 3WL9B 2FX8L 3LH2L 4ELME 3PV6B 3PIQA 2A9NH 4PJFE 4HWEH 2LVEA 1MUJB 1EAPB 3BHBA 2FO4B 2V2TA 4X6CF 2BY0A 2YD9A 5DEGA 1KB5A 4UTAL 2F5AL 1A3LH 5IESH 2HJFB 3PGCA 4BSWA 2P5WD 1T21A 4HUXB 1IGFH 1UACH 5E1AA 4RRPG 1K8DB 1S7UA 4OZFB 5E8DH 3S35L 4HK0A 4LP4A 3CXDL 4JPIB 3G6JA 3QR2A 2VDQL 2VDKL 1GOHA 4PRPE 5D7LD 1GVIA 2Q8AL 3WDIA 1P4LB 5JORA 3DWTA 3W11D 4JFPB 4D9LH 3QCVH 4OIIL 5IEKB 5M95B 4JHWL 1E4KC 3F65A 3TBWB 3QCUL 3MV11 1E4KA 3V7AE 3QNXB 4C56E 3S3JA 1Q9WB 2DTML 4KK5D 5JXAL 2RHEA 1VPOH 5FO9A 1KG0A 2VXVH 3LS4H 2FJHA 4P4RA 1KCUH 5C07A 2YD5A 3MV01 3RWGA 3WDJA 4P9HL 3TIDB 5ADPL 2A77L 1A6ZB 4GBXD 1VEOA 3VXUE 1XFPA 3HLAA 4KUCD 5BRZD 1KNOA 4E5XB 1UM4H 3KPOB 3QI9B 5CEYA 4ELKA 1JWUB 1AQDA 4RDQF 1ZLWK 1I3RA 3RZCD 1DJSA 4MJID 1BQHB 3LSOB 5I17A 3LIZH 1A4JB 4U1KB 1KFAL 1IM3A 5B4MC 1A9BB 4ZXBD 3STLA 32C2B 5EU3B 4HK3J 1IGIH 2W0FA 1X7QB 4JJ5B 4W4NA 4FQJH 3AXLB 2YZ1A 1L4IA 4X8XA 5JO5A 1UA6H 1CDGA 1SY6A 3ILPA 1FYTA 4U1GC 1MAKA 1B3JA 5D93C 1F2QA 4QRRD 2E3VA 2V2WA 4RZCA 3LEVL 1FO0L 4GKSA 5DRNA 4PRDB 5SWSE 15C8L 3GO1H 4MA8H 4UT6H 2PCPA 4WWKB 3LN9A 4AK1A 3N0PB 4YHIB 2EIEA 4HBCH 3IU4L 3PDDA 4OKDA 3MNZA 5GGTA 4K23L 1QLFA 4AENB 3CSGA 1K6QH 1S5IH 4MDJB 1AO7A 4R7DA 3GMRB 3MREB 3WDHA 4XP5L 4XH2A 1RPQA 1H3GA 4YHLH 3MJGX 3SDDC 3QRGL 3SDDA 5HDLA 1T6VN 2NY2D 4NPYB 5I8KL 3OR7B 5IMKA 4TTGA 3NIFE 1T83C 4EOWH 3MROB 2MCPH 4L4JA 1RZFL 1G9MH 4NGHL 1T83A 1VFUA 1T0PB 5K9JL 3BD3A 4J3TA 4HKBB 2ZG1A 2NTFA 3VFOA 3P0VH 1MFEL 4J4PD 5I1DA 4XVTL 3BWAB 4PR5B 3R0MA 3TBSA 3S36X 4K8RH 5TDNB 3L6FB 1QP1A 2Q1EA 4KMTL 3H0TA 3CXHK 5DJ0B 5KW9H 3ARVA 3CFKA 1ZVSB 4MD0A 4PJGB 3WIFB 2BNQA 3F12B 1CFSB 4Y2DD 3HG1B 1PX4A 4AG4L 4K7PL 1YUHB 4GAYB 1HWHB 5EBMA 4XX1E 2R0LH 5C0GA 1YMMA 1PW3A 3SOBH 2W0KA 1ZWIA 3HAEA 1ZKAA 5IBLC 5JW4M 4O02L 5FOJA 2IPTL 4D3CH 1HH9A 3ILQC 4PGJA 3QHZL 1B0GA 1PSKH 1FLRL 3LKRA 3MODH 3I6LE 2GJ6B 4OCWL 3H7BB 5C07D 3NOIA 5FDWB 1TVBA 3OKLA 1N2RB 2CR6A 5AYQA 3TBYA 4TUOA 2HWZL 3HMWL 5E7FA 3BRDA 2C3XA 2CIIB 3NCEB 5FGCE 3BP4B 4JFEE 1MCDA 1GGYA 1RIHL 1W72H 4NRZA 2YUVA 4KZEH 3Q1SH 2WIIB 1EEQA 5EOCH 5TQ0L 5I9QB 5DRZB 3VG9B 5CGYC 5AAMA 2VZ3A 3VA6A 5L88L 2AABL 4G8GB 3V8OA 1IFHL 3HCVA 3RIFK 3SDXB 3U0PA 2I27N 3KDMB 1MFBH 3FO9B 2P5ED 5B4MD 4YUEH 3IDMB 1BOGA 3IJHA 1CFQA 5IM7A 2FR4B 4HK3N 2GFBB 3BPCA 1JMXA 3D69B 4YDVB 3RPIB 4NJAL 3BDYH 1MVUB 5DQJB 3F7YA 1J1XL 4UDUA 4HIJB 1I8KB 1DLFL 5C9JB 3BDXA 1SQ2N 4YNYB 5K9OA 2QBWA 3PJSA 5T3XD 2H2PC 4A6YL 1U8LA 2W60B 4YGAB 4OD3H 2QV2A 1TITA 2QR0B 4NQSA 4FN0A 4JPKH 4ELMA 1R5VA 2ARJA 2QL1A 2I60H 4PJFA 5F7UA 2IPKA 1AO7D 4ISVB 2OL3B 2D9CA 4JY4B 4XCFL 4WHTA 3SBWC 3LVEA 1JUFB 4L8DB 1IM9B 1KTRL 3NFSH 3SBWA 1TMCB 3SDDD 3O9WD 5IBUB 5T3XH 3U83A 2BFVL 3VCLB 1J9CT 3CFEA 3QPQC 1KJ3H 1HDMB 1JMZA 1F13A 3CFDB 3RHWK 3T2NL 2ICWJ 4OQTL 1H15A 4K3HA 1UJ3C 5L0QC 3PHQA 3OAYK 1A7QH 1UJ3A 4PRPA 5FYKL 2KZ1B 2XZCH 3O6FC 1I3GH 3FONA 4QOKE 1C7SA 3O6FA 1A6WL 4U3CA 3HKFA 4GMTH 4UZGA 5AAWA 4HUVB 3VRIB 3LKOB 5SX4I 3ET9F 4LLUB 5HGDB 4YXLH 2LAGB 4X6DF 1G6RA 4JFFB 5MEQB 2NR6C 3LN5B 3UJJL 1N5AA 5C70A 2XIDA 2VXQH 2GSGB 3LQMA 4Y4FC 4C56A 3CSYB 4Y4FA 2BNQD 2BSTB 5BW7A 1QTYT 3UPRB 4NC1E 4DCQB 5KVDL 3MRDA 3VD9A 1K5NA 3G6AA 1XGPB 2ATPA 2IAMB 5I74B 3DMMB 2DWDB 2A6DA 4HJGB 4RBPH 3U48A 4OM0H 4GW1B 4U0RC 1TVDA 2JCCE 3QDJB 3BVNA 3ILQD 4JRYD 3VXUA 5KSVA 3GJFA 4URTB 2Y23A 3DI3B 4R97B 1M4KA 4N68A 4XZUB 1V8HA 5HHMB 5HDQL 1BECA 2X44D 3BKYH 5ICXB 1U8OB 3VXSE 2DQJH 3OMZA 2OJEA 5IHZA 1F58L 1RURL 4Y8AA 3MA9L 1HXMB 4UQ3A 5EOTB 1V3MA 5D2LB 1C5CH 3FB5A 4LVHC 3FQUB 4HUUA 4NNXA 3LKSB 1T1XA 3GNMH 1RZIB 1KIRA 1T3FA 3LHPH 3RUGA 4YLQT 5T3ZE 5SWSA 4KTDH 3T0WA 4PJ5E 1P7QA 2XWBB 2G75A 1KN2H 3IDIB 1WSST 4S1DC 3RBSA 4X4XA 5CS7A 1ZT4A 4ZSOB 3S36H 3T04D 1CG9A 4HEME 3G5ZB 4NCC1 1NLBL 2FWOA 4EDWL 1DL7L 3R8QA 3FRPA 1Q9OB 2CK2A 4MLIA 1LK2A 2FGWH 1RHHB 2QHRL 5ENWB 4PJIE 1W2KT 2QSCH 4HV8A 4P46C 2FEDD 4KDVA 4P46A 3EOTL 3DETC 3MV7B 5E8OB 4AL8L 1I85C 1MAMH 1I85A 1ZHBA 3NCYS 3M17A 5F7YC 4LCCB 1XIWB 2F53E 3BZ4A 5GGSB 1P1ZA 3TO2B 4Y1AE 4YBLB 1YY9C 2YD1A 2VDRH 2FZ3A 3D3VD 4JRWA 3U7WH 4K2UH 4YWGL 3D25B 4ZAKB 3PXHA 1MCOH 1FJ1B 1LD9A 2R8SL 3I6KA 5E6IB 4OKVB 3MXVH 4R2GB 1NGXA 5EU6D 4W70A 3EZJB 3LD8C 2IWGA 3U0TB 5MI0C 4GRWB 3MRIB 1QFOA 1NC4A 4GUPB 2VLKE 1WZLA 4HIXL 1JN6A 5CBEA 3EYUL 2EYSA 1GGIH 1Y6NR 4HF5L 1NBZA 1LEGB 4APQB 3WEXA 5BZDB 4C56D 8CGTA 2FD6H 1RZ8A 3EJYD 1Z9OA 1U8IB 4WW2B 3DXAE 1DUZA 4X4ME 3UJTH 1T66D 5J9PA 4XHJD 3RBGA 4BZ1L 1CE1L 1RK0B 3ROOB 4WTZG 5E8EA 5I15L 3ISWA 1FBIL 3O8XC 1EHXA 1F45A 3CVHB 4EXKA 4LSRL 3O8XA 4QRUA 4JFEA 1EFXB 4Z95L 3VXUD 1QLRA 3C6LC 2FBOJ 3C6LA 4R4NC 4I1NB 4GRMA 5INCA 3HC4H 3BSZH 1X5JA 3QDMB 4NIKB 4OZIB 4G6AC 5L9DL 4RNRB 4GKZA 3TM6A 1DVFB 2ZUQC 4OQ1A 3X12A 4XCCH 4MWFB 2CLVA 3ECBA 3CC5B 3OJDA 4WGVB 4HZAA 5J57B 8FABB 4KHTH 5F9JB 1QRNB 4MA7L 2ZUWA 4R3SB 1MFCH 2A9MH 1CVSC 1DCLA 4KKLC 4OZHB 4FXKA 4KJPC 4M3KB 1RSFA 4NKIL 1T1ZA 5C0BE 1NKOA 1JZ4A 4G9DB 5GJTH 5EUKB 2NXZC 1QSFB 5CMAA 1JPFB 2VABB 4JRXE 4EUPG 5D1XB 3HZYB 4ZTOL 4H8WL 4E42B 3G04A 4MQXC 5TJWK 5MENE 5EUOE 4KKAC 3DSNA 1U8KA 4LSSH 5SWSD 3RTQB 3HNSH 1KELH 1P7QD 3MNWA 5LGKA 1MIEH 1OM3H 5I1LA 5TGBB 4JM2C 1NCUA 3V2AR 4JM2A 3M1BA 4S1DD 4NKQB 1N8ZA 4PJXE 3L5XH 1KTDA 4UT7H 4WHCA 1QG3A 4TPRL 4IOFD 4Z9KB 2J7LA 3NVQA 4Y4KB 1EJOL 2AXGB 4FQ1L 2E7LC 1GZPB 4IRSB 4X8JA 3KLHC 2E7LA 1EGJH 4G43A 3DURA 2Q76A 4O58L 1UXWA 4P46D 1D5IH 1FNGB 3GMLB 1ZANH 1BOYA 3LRGA 3PWJA 2AEPH 2VL5A 3K1KC 3K80A 1XCQB 4M5ZH 5IHUL 4P59L 4IM8A 1QUNA 3IXAB 3Q6GH 5EN2B 4Q9QH 3UTOA 4P2RE 4Z7QF 1NCCH 4ZPVB 4DW2H 4HIIB 5JDJA 1YY9D 3EYOA 3OXSA 4QOKA 3O45A 1N4XL 3SE3C 4F8TA 1C5DB 1KJVB 3SE3A 2Q86B 3KPMA 4G6KH 5HY9A 3S88L 2P8PA 2EDYA 3WUZA 1XF2A 4LAQH 4X5WA 3ARYA 3RWCA 1X5XA 2ZCKL 4NC1C 1HNFA 3A6OA 2X42A 3REWB 2B5IC 3VE0A 1NC4D 5HI4D 1TZIB 3DUHA 3FZUD 5IVZB 5JDSA 4W6YB 2YD6A 4JDTL 5I16B 1OGAA 4R90H 3X3FL 3IU3B 3NA9H 3ARDB 4IDJL 1VKXA 2R2CA 2JCCA 5ISZE 2KBGA 2X4RB 3BT2L 4JB9H 1NGYB 5HI5C 3C2SA 3L9RA 5BO1H 4RGOL 2VLJE 3DHMA 3C9NB 5T33L 1C08A 5FXCH 2BOCB 2YBRB 4DKFL 4FP8L 4ZUVA 3VXSA 4I77L 1S7QB 1OARL 1C7TA 1EZVX 5J89A 5GSRB 3G9AB 5D5MF 5I8OH 3F7VA 2ID5A 3JWDL 3MV9A 3JSSA 3DUSB 3WNPA 3H3PL 5JW3H 4IJ3B 2O5ZL 4P23D 1F90L 4OZFG 1Q94B 4NUJA 2WUBL 1NDGB 4JQIL 4TQEH 4G6AD 4L8CB 4H0GA 2D7MA 4PJ8B 4YR6A 2E8ZA 2ADFH 3EO1A 5C08B 5D8JL 4BSVB 5EPMB 2R0ZL 2OX5A 4LQ1A 4PJ5A 1MJ7L 4NKMB 1V7MH 5BMFH 1KEGL 2OJZH 1LO0L 1U8HA 5DD0L 5KTEL 1HH6B 2CSPA 2FX9H 3MRBA 2BOBB 4I3GA 2HP4A 3N9GL 4TYUA 4QT5B 3ULVH 2C4FU 2BY3A 4D9QD 3VH8A 2CO7B 2HLAB 3LPWA 1UXSB 5IWLC 3UBXB 4MQXD 4CU6A 5IWLA 3GI8L 5I18H 1H5BB 4PJIA 4F3FA 3SDXF 5IMOA 2F5BH 5FHBL 1SMAA 1OCWL 1U92A 3CSBA 3MCG1 3QJHA 1WAAE 4KTEL 1QFUL 5F1NA 2VL4A 1A7RL 2NXYC 5CP3A 4F7MA 3V4VL 2R4SH 3MYJB 4M00A 2FATL 2G5BA 4NFCA 2F53A 1IGMH 3QEUB 1WCBA 1MJUH 2EDOA 2XQYK 4PB9H 4Y1AA 4HULB 1FZKB 1HKFA 4LSPL 4F7CA 1DEEA 1G7PB 1WLHA 2V7NB 1FSKB 5E4EC 1MLBA 3TA3C 2WUCL 4B7LA 4XNUH 3TA3A 1QHPA 1ZAGA 2CIKB 1QACA 4K55A 4U6HB 4ORGA 4LHJB 1S9YA 3JUZA 3TH4T 3T3PF 3P4NB 4M1DL 1ORSB 2XZAH 2E5EA 2YRLA 5D96C 1J5OL 4WW1A 4BQ8A 4PGDA 3UMTA 5IB2B 5GS3A 1QBMH 3BGMA 3NH7H 3MNVB 5ID0B 4MXVF 5EOQH 5KANI 1ES0B 3WLBB 4NN5B 3DVNB 4YFLI 2AJUL 2D31A 4PLKC 1DQMH 3PWPE 5DLMH 5FYJU 3T0DA 1HCFX 5I2IB 2ARJQ 4YDIH 3DXAA 4X4MA 2R4RL 5ACLA 1OY3B 2VAJA 4U2ZA 2VH5L 1I9RH 5IROC 1CLOL 5IROA 2Y36L 2HA1A 5EO1A 3VI3E 2EXYC 4QTIL 2Y07H 3MBED 1NGWB 4P2OB 3QRFM 4OUUA 1TZHB 1IAIH 5HHNA 3X14B 4JY5H 4UDTA 1U8QA 2AJXH 3ARRA 3DRQA 3E2HB 4H25B 1CFNA 3VXMD 2VOTA 3QEGH 3JUYA 2CKNA 1FNAA 1E6JL 2V2XA 4XCEA 4WI9A 1MRCH 3VXSD 2V7HB 1LO3L 2O5YH 4PGBB 2EO9A 4L4TE 5DGRA 3QO0A 4QHNA 1X9QA 1FL6A 4JREC 4MS8C 2NW3A 1N0XL 4HSQA 3VD4A 2HFGL 3Q2CA 2F54D 3IB4A 1INQA 2P49B 5C0BA 1NSNL 1EA9C 4PG9A 3IFNH 4XNXL 2AQ2A 3WFZA 2EO1A 2VDPH 4JRXA 3MJ9A 3GSOA 1TJGH 5DURB 2ILLA 1D7FA 5MENA 1UZ8A 1XF3B 5CZKA 4JLRA 5EUOA 4KXZH 1R3JB 4ZS6C 4GSDH 4PJ5D 3RVTC 1AD0B 1YC8A 2W0PA 5FYJH 3W9DB 3LEYH 4PJXA 1RUMH 3QH3B 4MA3B 4HFUH 2CRMA 1EBPA 3CLEH 2XZZA 1XR8B 4CRPA 1E4JA 3QFDB 5J13B 3LKQA 3PWLB 4TNWF 2ZCLL 3GRWA 4LK4A 1EEYB 4TULL 4IIQB 5IT2L 4U6YB 5D1ZB 3ESUF 1I7UB 3NCBB 3L5WB 2IBZX 5ECJE 5C86A 3KHOA 3ZTJH 2YMXL 2MPAL 1OF2B 3MRMA 1M71A 2NXYD 5DJXA 4NQUA 1D9KB 3B9KC 4MCYA 3B9KA 3QNYA 3IKCB 4Y1AD 3S5LA 2DQGH 4P2RA 5I30H 2X4TB 3VXQA 4ZMAT 1YYLL 5SWQA 3TA3D 1D5BB 3K81A 2OYPA 4R4FH 4Z7NF 1KJ2B 4WFGD 4P5TB 1RMFH 4ZS7H 5ESVB 4PJBE 1AJ7H 4H26B 2XPGB 1U6AL 5DR5H 5FECB 4LBEB 1G7LA 3MRKA 5KS9E 2V5YA 3NIDF 1J1OH 2D2OA 3AC0A 2R29H 4U1HA 2NY7H 5KVEH 2FO1A 4TSAH 5IHBA 2MTPA 2YS4A 3ZKMC 2VLKD 1OP5H 4FFYH 1MHHB 1TJIH 4LF3B 1K3IA 1YEHH 1NCWH 4ZO8A 2GTWB 3HZVA 2VE6A 5ISZA 1OSZB 2FIKA 4KK6C 5C0CB 3X3GH 4XCNA 2WAHA 2VLJA 5L8JB 3W2DL 4M6OL 2FH8A 3DBXB 3ARGD 4J23A 4KRMB 4K9EH 4YJZL 1XH3B 5GS0H 5DTFA 1E6OL 4RRPA 3GIZH 4AT6A 4JFXB 4FQQA 4HG4K 2JJVA 2MWCA 4UUJB 4YBQD 1QLEH 3WD5H 3LDBB 5IB4B 4KPHH 1IRAY 4W6WB 4Y5XB 2JJUA 4XC1H 1QBLL 4YXHH 5C8JA 3D2UA 3GBNL 1DQQB 2VZUA 5CEXA 4E0RB 5C0JA 2X7LA 4HUNB 5BS0D 5IFJA 3JV6B 5DJAA 4QCIB 3K2UH 1MCJA 1MF2H 2XNAB 3PWUA 4KAQH 1ERNA 3FB7A 5CJQL 1F00I 1NGPL 2G60L 4JDVA 5DDHA 1JRHL 3KYOA 4HWZA 3RWEA 5MP6H 5C0FB 5ABDE 4DK6A 4F7EB 4FZ8H 3TPKA 3IDXH 4OZIF 3UEZA 2CDFA 5DHYA 4ZNEE 3G5YB 5LAXA 4QRPB 1HHJB 4NKOA 5FO7B 2B0SL 3QUMH 4Y16D 2XWJA 3GB7B 3DX8A 1E28B 4OCNC 5CSZA 2XTJD 4XVSH 1A3RL 1H3PH 2VIRB 1A4KA 5ILTH 5DEZA 1WAAA 3H7LA 1AD9B 1NAML 5E70A 1R0AL 3EFDL 1GGTA 2FRGP 2G5RA 3QG7H 2PYFB 1N59A 1ZT1A 3F58L 5E00A 4CVZB 1JNLH 4DTGH 1AKJD 4KHXH 4D0DA 3F8UB 1YYML 3OJ2C 4YE4L 2BJMH 2YD7A 4E41B 4M1GH 3MMEB 4DOHE 5F44A 2B1AH 4YHKH 2X4SA 3VMPA 3MLXH 4IRJA 3NN8B 5C9KA 1MCPL 4KJYB 4R96A 5D2NB 5L2KB 2ZG3A 2VDNL 4J6RH 5D7LB 4K7FA 4KQ4L 4ENED 2BY1A 5T1MB 4LDEB 3WFHA 4F7PA 1JRHI 1JWMB 2PXYC 1IC5H 1OOAA 1TJHH 2WIMA 4QLRA 3KJ6L 2PXYA 3ELAT 4NNYA 3OKMB 4LOUD 4UIKH 3A6CL 3GMMB 4WUKH 5K59F 3HE7C 1AXIB 4MD5A 3HE7A 3UXFA 1RZJC 3RKPA 3ZE0F 4LHUA 3H9HB 1AR2A 3QUYB 4AEIH 3K1DA 2XN9D 2R2EA 1U8JB 3QFJA 3PWPA 3CIQA 3G6DH 3PNWB 1LDSA 1UM6H 4OGYL 3BKCH 4GBXB 3EYFA 1XR9B 5J11C 4LLQB 2JELH 1C5BL 4KVCL 4UV7L 2MSPA 2WINA 4U49A 2AEIT 5K9KB 1ZT7A 3Q6FA 4F2MB 4LL9A 5FB8A 2DD8H 2B4CC 1N64L 4U2YA 2GHWB 3RZCB 4MJIB 5I0ZA 4KK6D 5ICYA 3BJLA 4DGYH 2VLJD 3ZHDA 4HEPG 4FNLH 1KGCE 4BUGA 2ZOKA 1ZLSH 2XXMB 1U8MB 4L4TA 4ODWB 2F8XC 5DSCA 3OJMB 4DAGL 1VADB 1I1FB 2MQCA 4UNVA 2OR9H 1YJDL 4L4VE 3GSNL 1MRFH 3O2DH 2DL9A 3FTGA 4KQ3H 1INEL 1UB5A 5E2WH 3MGTB 2YC1B 4X4YA 1DP0A 2ICCA 3MOAH 5EU4A 5D9SB 3REVA 4PIRF 3VXPB 5LGJB 1S78D 3O0RH 5FYKE 1VGKB 1XCTB 3MLRH 5BQ7A 5DA4A 4DQOH 3TYGH 1BFTA 3ZLQC 1FE8L 1EUTA 1SBSL 1BZ9B 1KLGB 1B0RB 4OLVH 5DUML 3IFLH 3BQUC 3BQUA 4NBYB 1CVRA 4KZDH 3RWFB 5EU7E 4PLOB 2RFXB 3RZWA 1FFNB 3S6CA 2H1PH 1NFDB 4LMQI 3L3JA 3ES6A 3BUYA 4F37F 3O3BA 1SBBA 1A1OB 1FNSL 3L3DB 5F1SA 2IFFH 3ARZA 1DBJL 1UEMA 5T5NG 4WEBL 1RJZA 4FQPA 5GSVA 1T2QH 4NRXB 4OLWH 3KLAB 1QSEB 3EGSA 4LVOB 1LE5B 5DJ6A 3ZTNL 4CW1B 3BEVA 4M6AA 4IS6A 4N5EC 3ZDZF 2PYEE 1IGCH 3T4AB 4DZBB 3CSPA 4ONHA 4IRJD 3H9YA 5EORH 2ZSWA 4HXBL 5JW5A 4Y2DB 2J6EL 4Q97A 1T22A 4PJDB 4K3DH 4PJBA 1HHIA 4CMHC 5E9DE 4XAKD 4PV9B 4XNZB 2DQDL 5EBGA 2JTDA 4FQHA 2PXYD 5KS9A 4K7PY 3V5HB 2YA1A 1RIUH 3BH9A 1Y6KR 4PGCB 2HT3C 2EIZA 3GMPA 3L3KA 3MRHB 5FV2A 4AQOA 5C2BL 2WBJC 4YQXL 4HIHA 2AJYL 4F58H 5AEAA 2WBJA 1GPOH 4GXVH 4EIZC 5B39B 4U1JA 1N3NB 2D7TL 3TZVC 4KGLA 3P73B 3GMOB 3TZVA 1AXTH 3FQNA 4BKLA 4XBEL 3V4UL 4LKCB 4N0UE 3QQ4A 4KK9D 3N06B 4WO4C 1A6UL 4WO4A 4MSWB 1NMAL 4Z0XB 4QHLA 3GZKA 4I48A 3HLAB 3NIGF 4X0KA 1F4YH 3N1PC 5TFSH 4P5MA 4QNPF 5CJOL 3TVMD 3KLDA 1MI5E 2BDNL 3LEXB 4KKBC 5LKNA 4Q2ZA 3U9UA 1TXKA 1AQDB 5DC0A 4MQ7A 3ARUA 1ZVYA 2R69L 1BAFH 5D70H 2PNDA 1QFWL 5I19L 4O5LH 2CRZA 3IAGC 1WZ1L 4J3UA 2OMNA 4OIAA 2P5EB 4X9IA 4RISL 3AU1B 2E9WA 3GBML 2GYSA 4QRQB 1VACB 3MLYH 4HX1A 3FB8A 3VG0L 4L5FH 3FOMB 4NC0B 3T1FB 5DZNA 5HDBF 1FG2B 5CKAA 5LGHH 5DRNB 4CADB 4GAJL 2OP4L 1BZ7A 1EMTH 3HA0A 4ZNEA 1YZZA 2A83A 4UU9B 4OCMC 5D6CB 4OJFH 1YEGH 1MHCB 3F5WA 4H20H 1PBYA 1RZ7L 5ITBL 3NFPA 2H32H 4W68A 1K85A 4IHOA 2B2XH 1UQSB 4CMMB 1IGYA 5E99L 2XYCA 1KCSL 2VMFA 2HYMA 5FUZH 3VWJD 1MCQA 1YEEH 1NBYB 1JZ6A 2C7UB 4OLYL 5I8EB 3LRSA 4H1LB 1P6AB 1B88A 5GGQL 2IPUK 5CHNA 3U7YH 2YN5A 1SM3H 3CK0H 3O9WB 3VXTB 3VW3H 1UWGL 4OGAC 2IH1B 4P4KD 5J6HB 1FZMA 4JCMA 4KKCD 3T2PA 3PWVA 2IMMA 1RK1A 4XVJL 4WUUE 3T0BA 3QAZB 4JPWL 1GC1C 3DV4A 4YX2L 1CCZA 1GOGA 4LSUL 1U91A 3MZGB 1NC2D 4YH6A 2L7JA 1F3JB 5FA3B 1P7KB 4L8SB 1I3VA 2Y6SC 1UH4A 3MA7A 5E5RB 4JFHE 1KENH 1JPSL 3EJZC 2V17H 3V4PH 1YNTB 5EC1A 3RU8H 1CXFA 4LLYB 1O7SA 5BOPA 3U36A 3GSUA 1BEYL 2DKSA 2VWEE 5B3JF 2MOVA 2QQLL 4X9FA 5HI3C 1B9ZA 3RVWC 4NFDA 2XOTA 4MAUL 1HN1A 5GRUH 1UC6A 2XKNA 4HKZB 1YQVL 2OTPA 4JRYB 1TTFA 1M7DB 2EYRA 2Y4SA 3DHJA 5EZOL 3U30B 2E7BA 4R0LB 3UBXG 4C57C 4DFHA 4CVXB 1SY6H 4M7ZC 1MWAA 3TZVD 1OLLA 4GH7B 5IV2A 3BKJH 5KAQF 3TBYB 4BM7A 4QO1A 3WFCL 3HNVH 3GKWH 5C0ND 4RSVA 3B8YA 4HJJH 1AI1L 7CGTA 4M3JA 5A2JH 3ZYOA 1FO0H 2DDQL 4NQVB 3BPLC 3SCMC 4G6JL 4JZJB 1XAUA 2FBJL 4WTWA 1Z2KA 4LKXA 5I71C 4LARL 1DBBL 4L4VA 5KG9B 2H3NB 4M61A 4HWUA 4G5ZL 1OPGL 1U8NB 1P4IL 5L2JA 1EXUB 1OAYL 4JM4L 1JF1A 4XNQB 4O2EB 4MJ6B 1HQ4A 2BMKA 5KSAC 3GFUA 4RMWA 4IBLT 1R5IB 2E8YA 3DV6B 5KSAA 2UWEB 3RAJL 1RY7B 5LJYH 4UINH 1GSMA 3ARQA 3EHBD 2XWTB 3BW9B 5F6IB 2RJMA 1LNUB 5CGTA 2X4OA 4XNMA 5DJYA 2YD3A 1AGCA 1IAOA 1RULH 2GUOB 1UYWH 3MLUL 5LWYL 4Z7QE 3TN0D 4HC1H 4YHOL 3AS0A 4D8PB 3HRPA 4HPOL 4Q6IB 5CILL 2HVKB 4NM4L 1I1AD 4PJFB 2LU4A 1NCTA 1HHKA 5EC2B 1CFVL 2LFGA 5DMGC 3SDYH 3S4SB 3T09A 4WEUD 1GZQA 3D3VB 4LLVB 2DQTL 4AH2A 2R0WL 3MOBL 1I8MA 5ANMB 2OSLB 1Z5LB 1EVUA 5EIIB 4MZ3A 4HGWB 43C9A 1JCKA 4WI6A 2ATKA 1HSBA 1WFOA 2A9NL 2BVEA 3IDJB 4HWEL 5EFIA 4OF7A 5EU6B 5KSUB 3OKEA 4TVPH 1NEZB 1F3RB 1ZS8A 4WI2A 1JL8A 1A3LL 1H8NA 1SEQH 2N56A 4PJGE 5IESL 4EUPA 5E9DA 1IGFL 3HG1E 1UACL 4DKAA 1SJHB 1JGVH 4GW5B 4H0HB 4JKKA 3QXAB 5CUSH 2X1PA 3KNBA 5DD3H 5E8DL 3ALWA 3ZYJA 3V5DB 1JNNH 1N0LA 3KPTA 1TTUA 3PG2A 3TNNB 4G9FD 4LCUA 1K5NB 1I4FA 3H2WA 1J0ZA 1AHWB 1U3HB 3O11A 2C3VA 4NRYB 1CLZH 3RJQB 4EBQH 4D9LL 2GJ6E 4N0UA 4UOW1 3QCVL 2Q6WB 5DMKB 2YA0A 4NCDA 2R1WB 4OD2A 4GW4B 3RVWD 2A1WH 4JKPH 3AM8C 1VEMA 1LEKB 2NW2B 3AM8A 4MA1C 1VPOL 1QOKA 3FQXB 2VXVL 3LS4L 1MI5A 2KKQA 1KXQE 1KCUL 1XGQA 5E5MB 1NMCC 3K0WA 1YMHA 1OTSD 4NHCH 2CKBB 4UQ2A 2GT9A 4G8GE 1J0KA 4QEGA 5SX4H 3ETBF 4WCYH 1KGCD 3SDXE 5HYQA 5ACZA 1WC7B 4OCSH 1KLFA 3FQTB 4OFPA 2P8MB 3ZMRA 2JKXA 1UM4L 3SY0A 4FA8A 2PUQT 4KUCF 3FAXA 1UB6B 4PJ9C 4PP2B 2NLJB 4I4WB 2ZUSA 4U33A 5TQ2H 2X4UB 2WMPA 4PJ9A 2A6JB 3VFVB 2JB6B 4PJAF 3LIZL 1YPZB 1G0YR 4I0PC 4R7NA 2HMIC 4I0PA 3C60B 3HB3C 3EOAA 4XAWH 1IGIL 5IMMA 3SE9H 2VLRD 5I1JH 4J7RA 3PGDB 4FQJL 4LEOA 5FYLD 3D0LB 4G8FB 1UH2A 5TE6H 1UA6L 5E4IA 3KYNA 3T65B 1Z9MA 4ETYA 3T3PE 3WL9A 1F3DJ 3PV6A 1T0MB 3SGEI 3VU2A 4PP1D 3P4MB 3GO1L 1MUJA 1EAPA 4MA8L 4UT6L 5LBSH 2FO4A 1G6RH 3S34H 4HBCL 5HHQB 3AREB 2HJFA 1FP5A 4HUXA 4AEEA 5FYLH 3FCTB 3QXUA 4ALAH 1AP2B 3IDYB 3UCRA 4CGTA 1K8DA 1K6QL 1S5IL 5DJZB 2BSSB 3BN9D 2EE9A 4OZFA 2DJSA 3WKNA 4WUUA 1EEZB 3QIWD 3H3KA 1Q72L 1U8PB 5DMGD 4KI5E 4YHLL 3BZEB 1R3KB 4XP9H 1JZ7A 4YDLB 1P4LA 3GK8H 3ALPA 1NFDF 2YRZA 2DF3A 2PYED 2DMKA 4JFPA 3HPLB 1NGZB 4MNQD 5IEKA 1PAMA 4EOWL 2MCPL 3ZL4H 4JFFE 1BX2B 1G9ML 3TBWA 4MX7B 4AIXA 5HGHB 5GGUB 5SWZD 3QNXA 1Q9WA 2ICWB 3RVXD 1BQLH 3FN0H 3P0VL 2VWEC 2OI9B 4YHNB 1CLYH 4XXCC 4K8RL 4D0BB 3INUH 5GGVH 4TRPH 5KW9L 1A21A 4NQTA 3TIDA 1A6ZA 4O00A 2IALB 4TTDC 3QDJE 3P11H 4FQIH 3A6BH 3L5JA 4NT6B 4HIEB 4PJDF 5EBWB 4E5XA 1CXIA 1RJYB 2CXGA 2FYYB 2R0LL 3KPOA 5HHME 3QI9C 2C3WA 2C4FT 5E8EB 3QI9A 2YPVH 3SOBL 5CSBA 1JWUA 2HFTA 5D6DC 5D6DA 4D3CL 5E8NB 1BQHA 3LSOA 1A4JA 1CD8A 4P23B 3EYSH 4U1KA 2X2YA 5CD3B 3RWHB 1ACYH 2X89A 3V6OC 1PSKL 1A9BA 3MODL 3V6OA 32C2A 5EU3A 4OT1L 1TQCB 5D2LE 5CD5C 1X7QA 4JJ5A 3AXLA 4QKXB 1YN7B 1IT9H 2GQHA 2Z8VC 3HHRB 4HJ0D 1XEDA 4HS6B 5A40E 1W72L 4PRDA 2HT2C 3RY4A 5L7XH 4WWKC 4KZEL 3Q1SL 4WWKA 5EOCL 1FFRA 2AK4D 5TPWH 4Y4HB 4YHIA 4PJ9D 4ZSOE 3JBG7 4AENA 4WJ5B 1U8KB 4BZ2H 4MDJA 1MFBL 5ERWB 3QHFH 7FABH 1ZEAH 3GMRA 3MREA 3BIBX 2H9GB 3S97C 2D7NA 3MJ8B 2NY1D 3MV7E 1KJMB 4Z7NE 1VFBB 4PJ7B 5HYJD 5F1KC 4NPYA 5C6WH 3OR7A 2E7CA 4KGJA 1YEDB 1P4BL 1PG7X 3BDYL 4OLUH 2R8SH 1CIDA 3NIDE 5I1KL 5HYIA 4ESKA 3MROA 3FFDB 3HI1B 2GAZB 2EDTA 4Z7OE 4HWBH 1ZGLM 5AZ2H 4HKBA 1G7QB 1U58B 3GHBH 5JA9A 3PHOB 2DLGA 4OD3L 3BWAA 4JPKL 4PR5A 1ZHKB 3JWDC 4QGTA 2I60L 4P2QE 3HR6A 3RNKB 5TDNA 3L6FA 5DUBB 5DJ0A 1B6DA 4WUUD 3WJLC 3BYYA 1ZVSA 4PJGA 3WIFA 3WJLA 1A64A 1O7VA 2AK1H 3F12A 1CFSA 3NFSL 1FFOB 3HG1A 4GRWE 4PLJC 4NNPL 4D94A 5MHSE 5T3XL 4XP6H 1YUHA 4GAYA 1HNGA 1KJ3L 1CE1H 5GZOC 2JK5B 2CUIA 1X5AA 3VGDA 3AS3A 4PJHB 2YPKB 4OI9A 2HKHH 2XZCL 1DE4B 3U6RB 1NDMB 1I3GL 5IR1B 2VR4A 2ICES 4GMTL 4H0IA 5L9DH 5GZNC 2GJ6A 1RHFA 3H7BA 4YXLL 2GY5A 5FDWA 2P44B 1N2RA 2DQIH 1CTOA 2KZWA 3MBEB 2EC8A 2VXQL 1R3HB 1W0YT 5ALCH 2CIIA 3VXMB 3BP4A 5TH2B 4NKIH 3CXHJ 2HJKB 4TTDD 3BDBA 2H45A 1MCFA 2VXUH 2JLLA 3TO4D 2WIIA 3OB0K 3QDME 5I9QC 2Z31B 3VG9C 4OZIE 5DRZA 3RVVC 4G8GA 4OM0L 1QSZA 1GHFL 1FORH 2XACC 4H8WH 2F54B 4CKVX 4Z0BH 2ESVD 3SDXA 3KDMA 4OGXH 4OZHE 4UBDC 4FFZL 3FO9A 2F74B 1PD6A 3BKYL 5IB5B 3IDMA 3EYQC 2J8UB 5CD5D 2FR4A 4TUJB 1QSFE 4PJCB 3EO1B 2GFBA 2FLBT 1ND0B 3L1OH 4PJ5B 3D69A 4YDVA 3ZKND 3RPIA 3NBNA 1MVUA 1C5CL 2YD8A 2R23B 5CP7B 1N6QH 4N1CA 4HIJA 4WWKD 5HD8D 1I8KA 3RX5A 5C9JA 3IRPX 3GNML 4G7YH 4YNYA 3LHPL 2W60A 3TP4A 5B39G 2QR0A 3OKDB 3U2SB 4KTDL 1SMOA 1I9IH 1KN2L 4ISVA 4JY4A 2E9IA 3MRLB 2H26B 4MQTB 1JUFA 4L8DA 5DS8B 1IM9A 3P3YA 1RFDH 3S36L 4XMPH 1HI6B 3B9EA 2UWEF 3MFFB 3VCLA 1YN6B 1WCBB 1HDMA 2D03H 2FGWL 3CFDA 2QSCL 1UZ6F 1LP9B 2BRRH 4K3JH 3MLWL 2ITDB 3B6SB 3N1FC 2R1XB 2MKLC 1MAML 3QA3B 1LILA 4HUVA 4Q9CA 1A7NH 3QZWB 3LKOA 3VRIA 4LLUA 5B3NA 5HGDA 3LQAC 2AV1B 4ELMF 4NUGH 2VDLH 2D9QB 4JFFA 4OCYH 2PN5A 4PJFF 3LN5A 5MEQA 1T1YB 2GSGA 3CSYA 2VDRL 3VFPB 2BSTA 3HG1D 2VERN 2VLKB 3UPRA 3U7WL 4K2UL 4DCQA 1F3DH 3HE6D 2IAMC 1XGPA 2IAMA 1MCOL 2MQ3A 4YEFA 3HZMB 4MHHI 5F8RC 4LGPB 5F96H 3U4AA 5SV4A 5INDB 3DMMC 4Y19B 3MXVL 3DMMA 2DWDA 1GGUA 2D31B 4HJGA 3VGGA 5IEHB 4GW1A 4MCZB 4ZPTB 2IANB 3QDJA 4M48H 4R97C 2XI9A 5GGSY 3ARGB 4TSBH 5T3ZH 3MRGA 4XZUA 5JPMB 1BF8A 2GJ6D 1GGIL 4O2FB 3C8DA 1C1EH 3BO8B 5ICXA 1U8OA 3U0WH 5EIVA 3KR3H 4DGIH 1NH6A 1P69B 2FD6L 2MCG1 5HHOB 3ZE1E 4FQ2H 1FZJB 5BS0B 3QEQB 2BNUB 3UJTL 2WBKA 5EOTA 4ODTH 5D2LA 4XC3H 2GTZB 3FQUA 3LKSA 3QUMB 1OD7A 3RDTD 2CUHA 1RZIA 2VKXA 1OAXH 2JIXD 1OAUH 1DQLL 3KPSE 1MFNA 1S7TB 1PG7H 5JMRA 5C08E 4NQED 5CP3H 3O2VH 3VA2C 1ZGLB 3DYPA 4QGYA 1CK0H 2XWBA 3HC4L 3BSZL 3IDIA 4XCCL 4ZQKB 2JF1A 2NNAB 3C5JB 4KHTL 4ZSOA 4ZO7A 4Y16B 2FB4H 1J05B 1RUPH 3G5ZA 2A9ML 4S0SD 2XTJB 3MV8D 2OMBA 3KWWB 1Q9OA 1RJCA 1RHHA 5ENWA 5E5UB 5GJTL 4KK8C 5GQBA 3UTPE 2EXWC 3MV7A 5E8OA 4NZRL 3OX8B 4HCRA 1AKJB 1I7TA 4LCCC 1XIWC 3RA7H 4KUZH 4LCCA 1XIWA 1ZHNB 4LSSL 3HZKB 3HNSL 4OAWB 1KELL 5GGSA 3TO2A 1MIEL 1OM3L 4YBLC 1R24B 2HTKD 4LQFL 5DVMA 3NABH 5IW6B 2Y9RT 4PBVC 1O5DT 2B1HH 3KYAA 3L5XL 4UT7L 5GGRB 1IM9D 4PRNB 5CEZD 4ZAKC 5I1CH 3D25A 4UB0H 25C8H 4ZAKA 5DZOA 5DVOA 1FJ1A 5E6IC 5IQ9B 1X4YA 4R2GC 1WBZB 5E6IA 3KPRD 4OKVA 1EGJL 3P40A 5C0EB 4ODXB 3WLWC 4KI5D 5A1AA 3U0TA 3MUJA 1D5IL 3QWRA 1DBAH 1ZANL 2MNUA 2AEPL 3MRIA 1O0VA 4GUPA 4M5ZL 4U1MB 1HYRC 5MEOB 1CDCA 4P9ML 5CEZH 1HSAB 4R8WH 1KC5H 1ZLVK 1SJVA 1LEGA 3NIFF 3Q6GL 2XN9B 3X11B 1TTGA 4APQC 4Q9QL 2XA3A 3WBDA 2VKWA 1NCCL 5BZDA 4RMRA 4DW2L 4MVBD 3WE6B 5CBAB 4WW2C 3NAAH 3D5OF 3KGRA 2ITCB 4WW2A 4NSKB 4X99B 4G6KL 4W6XB 4HQQH 2WK2A 1RK0A 2HFEB 4LAQL 1FGVH 2FECI 4JO4H 3ROOA 1FL3B 2EYTB 5K93A 4QXUH 2APWA 1ULVA 3WS6C 1CQKA 3CFIC 3CVHA 4CU8A 3WS6A 3MJ9H 5HVHB 1U2CA 5EZIH 3FMGH 2I24N 3BGAA 4OZIA 3QDMA 2XY2A 3V52H 4RNRA 1DVFA 4R90L 1RD6A 3S4SG 4MWFA 4AY0A 3CC5A 3EYVB 3NA9L 8FABA 5F9JA 2B8OT 3WFEH 3QXVA 4R3SA 4JB9L 2OBGA 3EDKA 4OZHA 5BO1L 2D7OA 4ERSH 4JE4B 4G9DA 2VSDA 3VXRB 2BY2A 3SO3B 1NEZG 4N8CH 5EUKA 1QSFA 3U46B 2WQ8A 5CAYB 1JPFA 2VABA 4JDVB 5D1XC 5CFHA 5D1XA 3HZYA 4E42A 3PABB 3EIFA 5JW3L 2QEJA 3RTQC 2AAVA 2ZCLH 3FJTA 2UUDK 3OG6B 3RTQA 3P0YH 5DJ8B 1CIUA 3V8CA 4TQEL 1K2DB 2J8HA 3WXVH 5TGBA 4XT1C 5J56B 43CAB 2BVPB 2EDHA 4XVUC 2VZSA 4V2CB 2NX5E 3BE1H 1QSVA 2ADFL 1QZ1A 1DQJB 3CDGB 4Y4KC 3HI6H 4C83B 4Y4KA 1OT1A 4D9RD 2AQ1A 2WQRA 2QADD 3FKUS 1V7ML 3CD4A 2AXGA 1F8TH 2OJZL 4IRSC 3BP7B 1JYWA 1VB9A 1GZPA 4IRSA 4R6UA 3G08B 2FX9L 4QWWC 2PW1B 2IPUG 1FNGA 3GMLA 3MV7D 5JNYB 4GQ9H 5A16B 2ZG2A 3ULVL 4K94L 3F7RA 4AIZB 1XCQA 4X7DC 2JB5H 5B3JE 3QDGB 5I18L 2RAMA 2F5BL 5EN2A 3IXAA 2VB5A 1QQDB 5JIPA 1G7JB 4ZPVA 4TOYH 3V79C 5DFVC 2D4DA 5SX5H 5J1AB 2R4SL 1C5DA 1KJVA 2Q86A 1IGML 2OXGA 4P2QD 4PJ7F 3TJEH 1MJUL 4PB9L 3LKNB 5KVGH 1BFVH 1S7XB 3QWRD 1M05A 4XNUL 5BOZG 1P5UA 3O4LB 3REWA 5MHSD 4KI1A 1MCEA 1TZIA 4JR9H 4DK3A 3KHQA 5IVZA 4ODHL 1RUAL 4AM0B 6FABH 5I16A 4S1RL 3ARDC 4LRNH 5DMJB 2XZAL 3IU3A 1TLKA 3ARDA 3WKMH 4CDHA 1EO7A 5C0CE 1NGYA 2PTUA 3W5MA 1M1SA 3C9NA 1QBML 3NH7L 2BOCA 1NMBH 3TIEB 3TVMB 2YBRA 3BJ91 5BV7L 1H8OA 5EOQL 5JLZB 1G7HA 1S7QA 4HS3B 4PRBB 1IQWH 1DTUA 3QB7C 4HUKB 5GSRA 3B2UD 4GLRH 1JRHH 1DQML 3DUSA 4YHMH 2R2HB 5DLML 2APXA 3WNMA 2A73B 5JQHC 5TE4H 1X5YA 2Z92B 4YDIL 4ZUSB 3D48R 1I9RL 1Q94A 2X4NB 5HSFA 1NDGA 1D5ZB 1A2YB 1DVFD 1OTTD 4PJ8C 4L8CA 4LPTA 1G7MB 1T89C 2Y07L 4PJ8A 4X7TB 3S37X 2AS5M 2H32B 1I1RA 1T89A 5F6HJ 2B0SH 3UTTB 4Z7WB 3MGAA 2LQRA 3MRPB 5C08A 2IQ9H 1IAIL 4BSVA 5EPMA 4JY5L 4FABH 2AJXL 4NKMA 1UB5B 3IF1B 4NM8H 3QEGL 4K71B 1M7IB 2J6EA 1MRCL 1HH6A 1NAMH 2BOBA 2O5YL 2UZIH 1VSCA 2ADIB 5TDPB 4WFHE 5A2KH 1H0DB 2J8OA 4QT5A 4QRPE 3UTZB 2F15A 2HLAA 1UXSA 1H5BC 5T1KD 3UBXA 1H5BA 2R9HC 3VWJB 2IFGA 5C0IB 2R0KH 3IFNL 2GCYB 5CGMA 2EZ0C 3KJ4B 2NZ9D 4F80A 2VDPL 1MCPH 3OF6D 4NHUB 4NN6B 5D7KD 1TJGL 1GXEA 1BVLB 2J8UF 4C58B 1W8NA 4UIMB 3MYJA 4HH9B 4NQDD 4PJCF 1WV7T 4GSDL 4P4KB 3QEUA 1RZJH 3BUYB 2C1PB 3CH1B 5KVFH 2EIBA 3EOBB 5FYJL 3LEYL 3O6LH 4F33B 1FZKA 1AQKH 4IRSD 2XY1A 3LZFH 4E41E 4WHDA 4OCXH 2DBLH 4N0CC 1G7PA 5ITFB 1RUML 2V7NA 5GPRA 4HFUL 5D2NE 3CLEL 2OZ4H 2CIKA 1NC2B 1WUNT 1JTTA 5L2KE 5D7LE 3EGSB 4KRLB 4U6HA 4H88H 4LCIH 5F9AC 1UKQA 3P4NA 3TYFB 1ORSA 5JHDD 3ULUH 4IOIB 4B0MM 2IBGA 2HFFB 4KJQD 5IB2A 2B4CH 1C5BH 4KVCH 3PQYB 5J3HC 1F4AA 3MNVA 5ID0A 4G3YH 5FUCE 4EI5D 4BQ9A 2VQ1B 1ES0A 2IG2H 4NN5C 2DQGL 3RVUC 3WLBA 5I30L 3DVNA 3LV3B 3P0GB 1I3UA 4BA8A 1FO0B 3GI9H 5I2IA 1FAIH 1A7BA 4R4FL 4ZS7L 1RMFL 5D7JD 1AJ7L 1I7ZB 4JCLA 1VHPA 1P5VA 5H94B 4P2OC 1LO2H 1GCFA 1J1OL 4P2OA 1NGWA 2R29L 5GRWA 3MACH 3GJFK 2NY7L 5KVEL 2FJFB 2VDML 3MRJB 1TZHA 3H6JA 4TSAL 3IETB 3X14A 3E2HC 1JF5A 4H25A 1MH5B 3QDHA 3VDCA 1T2JA 1TJIL 5I1IH 1YEHL 5FM8A 1NCWL 2V7HA 5DYOB 2RGSA 4PGBA 2NY4D 1P84J 4PRAB 3X3GL 3E8UL 3UO1L 4GXUM 4BH8B 2OTWB 3VD5A 4IOSD 4TSCL 3DX9B 2GI7A 1HWGB 4BFIB 4K9EL 5GS0L 3FL7A 3GIZL 5DO2D 1BP3B 2C3GA 1IVLA 1QLEL 3G9VA 3WD5L 4KPHL 4PRHD 1I1YB 1PLGH 3KPSD 3I6GB 5FM5M 4JJHA 5FA4B 5C08D 1XF3A 4XC1L 1UENA 1R3JA 1I9EA 3PP4H 1AD0A 4ZD3H 2G9HB 3K4AA 3W9DA 2OQJB 3W0WB 3K2UL 1MRDH 3TN0B 1MF2L 4MJ4A 4KAQL 3PL6B 3QH3A 3EJJX 4MA3A 1ZSDB 3E3QE 3WIHA 3MR9B 1XR8A 5J13C 5DRXB 2J3SA 3QFDA 1NFDE 1JPTH 5MP6L 1I1AB 3PWLA 4RA3A 4IIQC 1EEYA 1Z3GH 3C2AH 4IIQA 5D1ZC 4U6YA 4FZ8L 5D1ZA 4CN1A 5IW1B 2JJTA 3IDXL 4BH7B 1I7UA 3NACH 2P47B 3L5WA 2EZ0D 3B5TA 1OF2A 2EC9U 3QUML 2VZOA 2DLFH 1D9KC 3NZHH 1D9KA 5DWUH 4XVSL 1QSEE 4WFEE 5EUOF 5T1LB 4DOHB 1H3PL 3IKCA 3ZDYE 1WBYB 5C6PB 5ILTL 4P3CH 3OAUH 2X4TA 2ZWLT 3SE8H 4BQBA 2HTLC 4PJXF 1B2WH 3BZDA 2ERJB 1D5BA 3QG7L 5D72H 1T6WA 1EIBA 3G5XB 4KJWC 5DRWB 3RGVB 1JNLL 1KJ2A 1UWXK 4P5TA 4KHXL 4PJDE 5ESVA 4DTGL 3ME0A 3ARFD 5BCAA 4H26A 2XPGA 5FECA 2BJML 3L3GB 3EBAA 4M1GL 3OKKB 4YPJA 4U1NB 2B1AL 4YHKL 1H8SA 3MLXL 1HKLH 1DLHB 4M62H 4J6RL 1EHAA 4G9FB 1HE7A 4WU5B 3S37H 3ZTJG 1MHHA 4LF3A 1IC5L 4LCYB 1TJHL 4YK4B 4JFQB 4RWHA 2GTWA 4UIKL 1DSFH 4GKNB 3RVUD 5K9QI 3QXTA 4WUKL 1OSZA 5EZJB 5JW4Q 5C0CA 4DWHA 3PDOB 3DOSA 3DBXA 2DLHA 2DQHH 1XH3A 4RISH 4V1DE 2VSCA 1PFCA 2HRLA 2Z8RA 4JFXA 3LDBC 4UUJA 1XF4B 3D85D 4A6YB 5DK0B 1FIEA 5IB4A 4AEIL 4Y5XC 5IBTL 4Y5XA 1NFKA 3VFTB 3HI5H 4UT9H 3G6DL 4XB7A 1UM6L 4GS7B 1XZ0B 3BKCL 1SVCP 4E0RA 1DQQA 2JELL 2H8PB 3JV6A 1QA9B 4OF8A 5IOPB 4QCIA 4HWNA 2P5EE 1PX3A 4XWOC 1JNJA 1JGLL 1FNHA 2DD8L 1DQTA 3MQIA 2QQQA 5HXMA 3TFKD 2SEBB 3JWOC 4DGYL 4Z8FH 5C0FA 3QZWG 4UI2A 4FNLL 3QO1B 4F7EA 1ZLSL 1HHHB 4OZ4B 4OV5B 1WWBX 3R06B 1MQKH 2L7UA 4XBPB 2VLRB 2ORBH 4LEXH 4XNYH 3G5YA 4QRPA 1HHJA 1SJXA 5FO7A 1MHPH 4ZODA 5DURD 5T3XE 2UY6A 2OR9L 3ALXA 3GB7A 1E28A 4HG4J 1BPVA 1MRFL 1CL7I 1GC1H 3O2DL 4FQLH 1YEIH 4KQ3L 5E2WL 5F9DC 2VIRA 3MOAL 4LIQE 1T7VA 3EO9H 3IRZA 4IDLA 3O0RL 1AD9A 3KYMB 2NX5D 2Q7NA 1OGTB 4HUMB 3MLRL 2NY0D 2PYFA 3CCHB 4CVZA 4DQOL 1EHLH 5DC4B 4PS4H 4EI6B 3TYGL 1T0NB 3UTQB 5B21A 3SDCD 5FYKU 3QXDB 4OLVL 3IFLL 4E41A 3MMEA 4YPGB 2Z93B 1K4DB 3SDAD 4C54A 3CVIH 4KZDL 3QIWB 4IMLB 5B8CB 5D2NC 2ZUVA 3NN8A 5JOFB 1F02I 2NZIA 4KJYA 5D2NA 2DLEA 5L2KA 4D0CB 5D7LA 5T1MA 3NCMA 2H1PL 4HFWB 2ZSVB 2VYRE 5F7LB 4I0KA 3DYOA 4MDIB 3W11C 1JWMA 3V95A 1UWEH 2PYEB 2QQLH 3WFBL 4MNQB 1J8HB 1MWAH 2P8LB 3OKMA 3I9GH 1YDPB 5C1MB 5C09D 4HZLB 3GMMA 3KPQB 5SWZB 1A14H 1WAAF 2IFFL 1DQDH 4GAFB 4KK5C 5FUCC 1T2QL 4OLWL 3H9HA 4P5TD 5IIEB 1QNZH 3QJFB 2UYLB 2VJXA 4N1HB 3BRGC 3QUYA 3SE4C 4HBQA 3CDCA 4N8PA 4RGND 3SE4A 3DPBA 1U8JA 1P53A 1CXEA 1L7TH 3FO0H 5EORL 4UOJA 3STZB 4GBXC 5FF6B 4J3WA 4GBXA 4JRYE 4RAHA 1XR9A 2DQCH 4K3DL 3K3QA 4LLQA 2ZOLB 5E94B 2XTLA 1L7IH 4G6JH 1DN2A 3N1QC 4AJ0A 4OLEA 5K9KA 1RIUL 4F2MA 1G0XA 5CJ8A 4M03A 4NQCD 3RZCC 3UJIH 4R26H 3RZCA 3F7QA 5F72S 4F58L 4J3XA 1GPOL 5F3HB 1LK3H 4GXVL 2P45B 4OF6A 1NBQA 1AXTL 5FUOH 1U8MA 4ODWA 1Y0LB 2X1XR 3IFOB 3FQWB 1VADA 1I1FA 5AG8A 3FT2B 4JHZA 5F7FA 3QUKB 2X1WL 3MGTA 2AEWA 2YC1A 5D9SA 4ZTPH 1A6PA 1FH5H 5TFSL 2MMXA 1PGRB 2AK4B 3VXPA 5LGJA 5I73B 3VI3F 2BNRB 1UM5H 1VGKA 1XCTA 2IMNA 2YXFA 1AGBB 2UWEE 3JVGA 1BAFL 5FGSA 1WWWX 4OZGB 5D70L 4O5LL 4WHYH 1Z6JT 1BZ9A 1KLGA 1B0RA 1G9MC 2MHAB 4W4OC 4X83A 1KIPB 4W4OA 4U6VH 3E3QC 1KN4H 3RWFA 1FQ9C 2BCKB 2QSVA 5AD0B 2YXMA 2RFXA 3MLYL 2NY1B 3MOBH 3BP6B 5JZ7D 4F15B 1FFNA 5HYJB 4L5FL 1KB5L 1NFDA 1WWCA 5J6GB 2X9XA 5FGRA 4BFGA 3E1F1 4Z7WF 1T4KB 5D7IB 5CIPH 5LGHL 2C4XA 2DTSA 4DN3H 4QF1B 4GMSH 1A1OA 3BP5B 1EMTL 1BD2D 1W0VB 5IB1B 3L3DA 4OJFL 1YEGL 1ZTXH 4H20L 4XBGB 3D3VE 5MEPB 4J4PC 4NRXA 4YC2C 4LVOC 5I1GL 1MELA 3KLAA 4J4PA 1QSEA 5ANME 1LE5A 2B2XL 4CW1A 3RL1B 5HHVH 3LRHA 1ZGLP 5F7WC 4E41D 3T4AA 5FUZL 4DZBA 1YEEL 4WUUB 5EU6E 1FNFA 4Y2DC 1DEDA 1YEFH 4Y2DA 3U7YL 5L2KD 1D6VH 3BPNB 1SM3L 4FQXD 2K7QA 2DIBA 3CK0L 4PJDA 5FM4A 3KPLB 1LMKA 1OP9A 2YKLH 2EICA 1G0DA 3D39D 5DJ2B 3VW3L 4XNZC 4ONFH 4PV9A 3QXWA 1D5XB 3V5HA 1ZA6B 2I9LB 3C6SA 1S8DB 4PGCA 4U6TA 5CCKH 3MRHA 3KVQA 2KPNA 3K8MA 2OXHA 1CBVH 3Q3GB 1V7NH 5B39A 1N3NA 4YFDB 3SGEH 4NO2B 3P73A 3GMOA 4LU5H 1AIFB 1CFTB 4LKCA 3QUYD 1KENL 1A8JH 1FHGA 3FQRB 2V17L 3V4PL 1G1CA 3RU8L 1CDBA 4MSWA 3WNKA 4Z0XA 5HHPB 4G6FD 4V1DA 4XPTH 4PJBF 5FHAH 3TO4B 1Z0NA 3LEXA 4HMEA 5DK2B 4P5KB 1RV6X 5KS9F 5GRUL 5C3LD 2ESVB 1ZA3B 3ZHKA 1KV3A 4TVSa 3MUZ1 1QPPA 1RU9H 4X6FB 1SY6L 1D5MA 2OLDA 2P5EA 4DUWA 3LKPB 3AU1A 5TDOB 3BKJL 4QRQA 4CBPA 3TEUA 5L6YH 1VACA 1F2XK 3HNVL 3GKWL 1ZHLB 3FOMA 4XRCB 2RB8A 3T1FA 1EH9A 4HJJL 3R4DA 1FG2A 1EK3A 1YPZE 4CADA 4TUKH 4M1CC 2EH7H 4UU9A 5D6CA 1MHCA 1HXYB 1Y18A 1CXHA 4QXWA 2AI0H 5ICZB 1V3JA 1UQSA 2R2BB 4CMMA 5IMLB 1ADQH 2Q20A 3WNOA 1NBYA 2BVQB 3MJ7B 2C7UA 5I8EA 4H1LA 2AXJA 4L3CB 1Q72H 1OAKH 3BH8A 3LOWA 3BIKB 4RQQB 4UINL 3O9WC 4CL7A 3O9WA 3VXTA 1F42A 4K8RD 1A1NB 5FKPB 3BESR 1S7VB 2IH1A 5J6HA 3AS2A 1CR9H 1RULL 1UYWL 2Y5TA 1JNHB 1IZJA 4HC1L 2A0LD 3QYCA 5DJDB 5HGGS 4DVBB 4ZYKB 2C1OB 4QRTA 1QSED 3VDBA 1MVFA 3PXJA 4WFED 1F3JA 1PY9A 5FA3A 1PKQB 2F58H 1OP3K 4L8SC 5IFHH 1P7KA 4L8SA 3K4ZA