4F8TA

Crystal structure of the human btn3a3 ectodomain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
210
Chain Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGGGVSCIIRNSLLGLEKTASISIADPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Butyrophilin subfamily 3 member A3
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell response by CD277/Butryophilin (BTN3A)-specific antibodies
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 210
sequence length 213
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f8tA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f8tA02
3WXWH 2YPLA 5IM7B 3BI9X 4LVHB 3IXAB 4MA7L 1YY8B 5CSZA 3HAEA 5DJ0B 5BOPA 3PP4L 4BFBD 2X70A 5JXAL 4QRUA 4HZLA 4QRQA 1KLFA 4JHAL 5ICZA 2JB5H 3WFBH 1UM5H 2ATPA 5SX5H 3DBXA 2NXZC 5HGBA 2CK0L 4UINL 1C5DA 5FA4B 4OIIH 4UIMA 4U6VH 1ZA6B 5D5ME 3DO7A 2IPKB 3GGWB 1TVBB 2VQ1B 1CDYA 3BYYA 1IJ9A 1YEDA 2X4OB 3MLRL 4FHBD 1GGIH 3AM8C 1JTPA 1A4KB 1JPST 4MB4A 5FKPA 1D5BA 2Q87A 43CAB 4OD3H 4OCSH 3JWDL 1BIIB 4CDGC 5DJXA 3BDYL 4CMMB 3L95B 4HAGA 1RMFH 1A6WH 3B6SA 5ANMB 4OZGB 2CUIA 4XHJD 5I15H 4HF5H 4RGOH 2ATKB 5ABDE 3DUUA 1G9MC 2Z9TA 3VDAA 2VE6B 2SEBB 1DBAH 4QT5A 1S78C 3B9DA 1MJUL 3U48A 2VUOA 2CO6B 2ZKHH 3MRDA 5BV7C 4RFOH 4JQXA 4Q97A 4GKSA 4Z7QF 3BXNB 3D0LB 1DBBL 2ESVD 2PYFA 1D9KC 2DQDL 2FD6L 4FQ2H 4QTIL 4FTVA 4X6CB 4I13B 3W0WB 2CMRH 4LCIH 4IJ3B 4ZXBA 1V3JA 3B4NA 3IDYB 3DVNB 2V2XA 1GOFA 2XTJD 3ZSSA 4K7FB 4JZOB 1MOEA 2X10A 4ODHL 3ARGD 3P0YH 2V17L 2OI9B 3H9SD 2FJGA 4JFPB 2CLRA 4JO2L 4N8VB 5IEHA 1FORH 1I1AB 1ZV5A 2ZCLH 3VXPB 3LRGA 5JNYB 4MSWA 2F19H 4YLQT 1OM3H 2NY6C 4CGTA 1QSFD 1YUHA 5E5MA 5E9DD 3D48R 2CLVA 1GGCL 2VC2H 3BESR 3GSXA 1OAYL 2JCCA 3VG9B 1FH5H 4ELMF 1VACA 4WW1A 5C0DA 4FQ1H 4F9PA 2CXKA 2P5ED 1DQML 5C2BL 2P5WB 3L3HB 3LKRB 3DI2B 4JB9L 1TVHB 4PJ7A 4Z0XB 5HVGB 4POYA 2XQYG 4QLRA 2F54B 3S7GA 2PXYC 3G6DL 2GKIA 2OMBA 4NQEE 3RL1B 1AD9B 2BHUA 2EYRA 3BDXA 5IFHL 2DICA 3TYFB 4OCYH 1W0WA 1HEZB 2NY1B 4R3SB 4Y19A 5IQ7H 5EU6D 3Q1SL 2NY5L 1WF5A 2E7LA 3F58H 4HJJL 4PJEA 4XWOD 1KV3A 2FJFB 3QDMA 2V9QA 4DAGL 2JLLA 3P73B 5I30H 5ITFB 4HUUA 4J1UB 3BMVA 5BRZD 4BK5A 1ODAA 4G9FA 2IANA 5T33L 3FN9A 3GSUA 2EDBA 1LEGB 1BBJB 2FX7L 3MUY1 4K3HA 3VXTB 5AUMB 2IEPA 1JZ4A 3VFUA 5DD6B 2YD2A 3QZWB 2CRIA 4W68A 2V7HA 2C3GA 4H20H 1UJ3C 2DIBA 3IF1A 4NZJA 5HYFA 3R1GL 1Y6KR 2D0HA 4RX4A 3MLWL 4P2OD 5F7LB 5H2BB 2VDNH 4YPGB 1C16B 3GJFK 2R4SL 3KLHC 4JPWL 5GGUB 3ARYA 3O3DB 5FO9B 3QH3A 5HYQA 4MCYA 1DVFB 2Z4QA 4PJBB 3LKNA 3ZTJG 4ZG1A 4XCYA 4X98A 2DLIA 4PB9L 4WHDA 3UXFA 3V8OA 1L7TH 3VXOA 3OAZH 2BDNL 4F15C 1F3JB 2WP3O 2WK2A 1AC6A 4DZBA 5IKCA 3LH2L 4RGMB 1QSEA 2VLRD 3LMJH 4P23B 3SE4A 1AXSA 2JIXD 1KCVL 1T7WA 2D7QA 4OD1L 5TE7L 4QHMB 2NXZD 4G80B 1QSZA 1OP5K 1P4IH 3MCKB 5HI5C 3VGHA 1BFVH 3UZVB 1U8QA 1X5IA 2UZIL 1RU9H 5SX5K 4DGYH 1JGDA 3O0RH 1CS6A 4IRZH 2JJWA 2IH1B 3NCJH 1NCBL 5EZOH 3GUTA 4XGZA 1Z0NA 3WV0A 3QUXC 1NFDA 2R2EA 4N5EC 4P2CG 1O7SA 2GJZA 4ISVB 4OCWL 5C0CD 5I17A 4YR6B 1MELA 1ZHLB 5CHNA 2GTWA 4HIXH 3PQYD 7FABH 1UYWL 1H8SA 2C4XA 1BX2A 2Y6SC 1S78D 1UEYA 4XVSL 1X5JA 3FRPG 2WLYA 2R0LH 4ZPTB 2J1KA 3LN4A 5DQDH 4AZ8A 3DGCR 2VXSH 4YIQB 3BEWA 4LHUA 4YHOH 5BOZG 1T5WA 2F53E 5D6DC 1D9KD 3LHPL 3DSNA 2P48B 3LIZH 4AL8L 4OZHA 1KIPA 4M48L 1KLUA 4XMLL 4Y4KB 4LCCC 4PJDB 4U1HB 5EUOF 3F7YA 1MCWM 4WV1C 1Z9SA 4OKVB 5LCVL 3D85A 5K9OA 4FQXC 1OSPH 3SKMA 5F9JA 5B38G 5GS0L 2BSTB 3QPQC 3AREC 2R39A 4HWZA 5E95B 1OLZA 4PD4J 2OR9L 3I6KB 1T6VN 1D5ZA 4JQVC 3PWPD 2I25N 1JWSA 4QOKB 1J05A 3VCLA 2AV1A 4NWTH 4BQBA 5KVEL 4A6YH 1A5FH 5EC1B 1NDMA 4R7DA 5KSUA 3C08H 4WVRA 4Q58C 5HHQA 3C8KB 1XGYH 2XWJA 1RULL 1NCWH 4MQ7A 1YNTB 2XQBL 1EFXB 1ERNA 2B2XL 2XACC 3V95A 3ZE1E 1U2CA 1FCCA 1ZEAH 1BD2A 1QKZL 2FJHB 3KXFE 3MLXH 4QHKI 1BQHB 1DFBL 1MFCH 4LSRH 2QSTA 3F7VB 4OUOA 1L6ZA 1PQZA 2ICWB 2XFXA 4KHXH 4PY7A 3T1WA 5IV2A 1MCKA 4U1NB 1EGJL 1V7NH 3QCVL 4DKDC 4WFHE 5ESVA 2C4FU 2A77H 5GRUL 1G7IA 3VI4F 3L7EA 4D9RD 2B0SH 3P30L 1RIHH 1ED3B 1S7VA 2ARJA 1I1YA 1BLNA 1MCPH 3HI5H 3W0WE 1KJ2H 1VFAA 4FQPA 4GKZA 2A73A 2BERA 3C60A 3OXRB 5GSVB 3WHXB 2LAAA 3VWKC 1DBMH 3ROLA 4JAMA 2R4RL 2FYYA 4JRYB 5H37G 4KHTL 4I1NB 3HPLB 3VXSA 3Q5TA 1AI1L 1U8JA 5IVXF 1DEEB 4DK6A 4NUJA 3W5MA 4HWBL 5D6CB 1X5ZA 4K23H 1HXYA 5GZND 3KLHD 4EIGB 4IIQA 4XB7A 4PJAA 1YEHH 3BQUB 3V6FA 3Q5OA 4WW2A 3SGDI 1S3KL 1FNAA 2Q7YA 1KB5L 2OLDA 4PGDB 3E8UH 3QXUA 3CD4A 5LVEA 3A6CH 5LGHH 1FGVH 5FUZL 4RMTA 1EERB 2BXYA 1C8PA 4JPKH 1DQLH 1MHHB 3CNKA 1BHGA 3INUH 2CIKA 3FRPA 3P4OA 4XXDB 3TIDA 1PGRB 5D72H 3GJEA 3HE6C 1LO2L 5H94A 1E4XI 1CFNA 2JCCF 2BX5A 3OKLB 2V2TB 4JM2B 3RTQB 1A02N 5SX4H 1I4FB 1TIUA 4MAYA 5E8DL 2X89A 2BSSB 4RISH 4R26L 4PJ7F 3FO2A 5HI5D 5T3ZD 5FV2A 3ULUF 5CJQL 1ZHKB 5TDNA 1S5HA 4FP8L 4ZFGL 3BPLC 3EHBD 1CE6B 3RDTC 3MV9A 1GIGL 5I66A 3BKJL 3EYUL 4KDVA 3RIAF 3ET9F 3GSQA 3GMNA 3H9HB 3DMMB 3JV6A 3ARBC 1FBIH 1MJ7H 1WUNT 3IB4A 2AJYL 3QUXD 1T89A 4PV9B 2CIIA 4N5ED 4ZNEA 3CMOL 4YX2L 1IM9D 3RWDB 3SDAB 4ZUTA 1ZTXH 5I1DB 1J12A 1OCWH 3T2NL 4ZUSB 1ZVSA 3DVGB 3TPUA 2FH8A 2I9TB 3U1SL 1PG7X 3E2HB 1V3MA 2Y6SD 4DFHA 3BKCH 1JPTH 5IBUG 4ODBD 5DK0A 2UVFA 1A6PA 5JW4M 1KEML 4EN3C 1YMMB 4X7DC 2C3HA 1H3VA 2DQCH 4P3WA 2IAMC 1R3HA 3RGVC 3OMZA 1PEZA 3S35X 4LSTH 5IVZA 3P11H 3BSZH 4P3CH 2VXTL 4NN6B 3HNTL 1K8DB 5D1ZD 4XH2A 1K4DA 1PAMA 1KB9K 1C5CL 2VDOH 4OI8A 5ICYA 3FT3A 3F12A 5KTEL 2HLAA 5D7LD 4LSPL 3PWUA 1UCTA 3BX7C 5IG7A 5IJKA 4Q9QH 4DVRH 5B21A 3KVQA 2G5RA 3QPQD 3ARED 4JY5H 5JDSA 4NO2A 1CFTA 3TA3C 5JR1H 1KNOB 3QXAB 3E6FA 3QI9A 4GFTB 3RX8A 4OFPA 1XGQB 3FOLB 5FOBB 4TYUA 3MV7D 5EFIB 2AGJL 3MACL 4BZ2H 4WNQA 3KHOA 2DQIL 5ISZA 2XN9B 2WWMC 4CBPA 4NQCA 5C0FA 1KJ3L 3O41A 3WNKA 2NX5A 4J8RA 3NCMA 4U33A 3ARVA 4YEFA 5EOCL 1K3ZA 3T3MF 5ALBL 1NCNA 2IWGA 2XY2A 1E4XL 3IDMA 3KLSA 1KULA 3O2WH 3ULVL 4NRXA 3VXRA 1NFDF 1YEEH 4HW6A 5E08H 3BW9B 2P8MB 2W0PA 4HC1H 1P1ZA 3X3FL 1QP1A 5BMFH 1I1FA 4WGVB 5DUMH 5IMKA 3NIFF 1KJVB 1O7VA 5CUSL 5DVNA 4OGAC 2EE6A 4C56D 3S5LB 2DJSA 1PW3A 5KW9L 4XVJH 2X1OA 3HUJE 1AIFA 1SEQH 3EDDA 1QSVA 4V1DA 4OLYH 1D3CA 4Y2DD 1D5XB 5DRXA 2X4TB 4NPYB 3VWKD 2KBGA 3C5ZA 5DLML 4PREA 3RWEA 1R3JA 3UTSE 3LKPB 4LCYB 2E7MA 4YXHL 2DLEA 1JYXA 2XPGB 5CGTA 3DX6A 5IP4A 3FFCA 1IAKA 1YMHB 4OZHF 3DLQR 1T83C 4OLXL 1A7QL 2DLGA 5I9QC 3ZKNC 1X5YA 5T1KB 4KUZH 4NJAL 5IIEA 2A6KA 4QOKE 4URTB 2ICWJ 4OD2B 3O6FC 1HOCB 4H0GA 1Q9OA 4Z77B 1I3RB 5D2LF 1FZOB 1XGPB 2V9RA 2VABB 4LNRA 1AFVL 4GAGL 4Y89A 2FGZA 4Y5YA 4HV8B 3U7WL 1NGZB 1BPVA 1X5GA 1KENH 4Q2ZB 3L3OB 5DQJB 2J8UF 1U8IB 3GJFA 2YXFA 4POUB 1X6LA 2BC4A 4S2SB 1T21B 2A9NH 3MOAH 1AXTH 3PXJA 1F4XH 3MGOA 4XCCL 5D71H 3BVNA 4F8TA 1I7ZB 1U91A 5HDBF 4Y1AD 3F7RA 1JZ6A 2W60A 4GXUM 5EOQH 1U8OB 4LSUL 4ZQKB 4IS6A 5J56B 2AVGA 2GEEA 4HUWA 2R23A 5GGSB 4Y5VB 4S1DC 4LDEB 5TDOA 2OM5A 3EOTL 3QHFH 3QA3B 4PS4H 4NWUL 5DJ2B 3ARBD 4O2CB 1INEL 1UZ6F 4KXZI 4AENA 3CFKA 3EDKA 1HQ4A 4MMXC 4HKBB 2FR4A 3NPSB 1UWXK 3T4AA 3EYOB 4J3UA 3MV8E 4JRYE 4N0FB 2X4SB 4BFEA 2FL5B 1N26A 5F1NB 3WSQH 3V2AR 3VFRB 1I1RA 2D31B 3QWQB 1OAQH 3FMGH 5C0BD 4EN3D 3T0EC 1NANI 4ODVH 4HMEA 4LAQH 4TSAL 3RGVD 4X83A 4ZOBA 1S9XA 3RWCA 1I9RL 2X7LA 43C9A 5E4EB 2UY6A 3OR7B 2Y5TB 1CR9H 3CVIH 4JN2A 2J8HA 2WIIB 1NGQL 4WW2F 5IB3A 2CGRH 3FB7A 2ZNXA 4FQQA 3EAKA 4HD9A 1BOYA 4P2QA 1KFAL 1TETH 4WU7A 3T65A 4F7CB 1OVZA 3FO0L 3MRGB 4JJHA 3VE0A 3MLYL 5K9JH 4P46C 1IAMA 1R5WA 4KGJA 4EUPA 4HXBL 2NMSA 5I8KH 2NYYC 4Z5RB 1G9ML 3LQAC 5DR5H 3TA3D 3ZYOA 1KIQB 2E5EA 4LKCA 4M9OA 3PHQB 5JDJA 3B83A 1QBLH 1DE4B 3D5OF 3MLZL 2AK1H 1H3PH 3CCHB 4WJ5B 4FTVD 1K4CA 3U30C 4Q6YA 3GM8A 1FV1A 3REVB 4ZXBD 5BV7L 1NFIA 4XPAL 3GIZL 5DMIH 2FATL 4TSBH 1B9ZA 5FO8B 4IOSD 4S1RL 4HLZG 5HPMB 4R4BA 4M6NL 2O5XH 4XCNB 1G9NH 2BY3A 4K9EC 1P7KA 3LD8B 2H26A 4GW5B 5GISL 1WWBX 5EWIH 3E0GA 4NBYB 1MI5B 4JREC 1VPOH 4PV8B 3MNWA 2YUVA 5EUKB 2Y36L 3B8SA 2L7JA 4NDMB 4ZFZA 4KZEL 5A1AA 5FF6A 4ZSOE 1TZHB 2Z91B 2EYTA 4HX1B 1GGBL 2LFGA 2APVA 1HI6B 4ACPA 2HVJB 2P7TA 4E41A 4GMTL 4MD0A 1YMME 2DKMA 1MRFL 1DDHA 4HGWA 4MXWH 4JGMA 5GGTL 2WZPD 5I75C 2PO6C 4PLKD 5EIQA 4QRRA 3IDJA 4PRBA 1BFOB 4XP9L 1P4BH 1CK0H 1A6VH 3CDCA 4M6OL 3DV6A 3CSBA 4WUKL 5TDPA 4PRIA 4K8RC 4JFEA 4G8GA 3DARA 3O4LA 3SOBH 1OAZL 3BKYL 3QCUL 1MCJA 3RZCA 5LAXB 4JRXA 1FLRH 4HPYL 2FO4B 1TNNA 1A9BA 1U3ZA 4P99A 1QNZL 2HTKC 4WUUB 1MLCB 3QDMD 1EXUA 4NQXA 2BJMH 1OAKH 3VD3A 3PABA 3P9WB 3O6FD 3PNWA 5LXGL 1N7ML 5D7JA 2IAND 3RVWC 3UJJH 1J5OH 4K3JH 3BWAB 1S7UA 5MHSD 2QQKL 2LTQB 1G84A 4CUCA 1G7HA 4L8SB 4OV5A 1URLA 4LEXL 3SKJL 4I5BB 3QUZB 3SJVB 1GGTA 5D5MA 5E00A 2ICEB 3VD9A 9CGTA 1XF3A 2J88H 3RPIA 1JWMA 4XP4L 3B2VL 1HINH 4RX4D 2ITCB 4O9HL 5J1TC 1A0QH 4MQXC 3VGBA 2ZOKB 3HE7B 2D9CA 3MRKB 5CBEB 3EDEA 1OB1A 1TJHH 3O6LH 3ZTJH 3I02B 3ZDXE 4WI4A 1X6NA 1Z3GH 1S7RB 4S1DD 1KCSH 1MREH 4JZJA 5KG9A 3K0WA 4P59H 1DQTA 5IFJA 1NC4A 1QLEL 3GRWL 1I8MA 4I3SH 1J0HA 3SCMA 2AEQL 1ZLWK 1BQLL 3MFFB 2DQFA 2APFA 2GJJA 2JE8A 1K8IB 1FN4B 1JL8A 2P45B 4DGIH 1PYWB 1T66C 3EGSB 4G6JH 1EEZB 4Q0XL 1IQDA 3I85A 4MD5B 2HKFH 1UGNA 3L5WA 4UOJA 4F7EA 2GY7B 1KCUH 4GW1A 4O2FB 1P7QA 4P4RA 4OGXH 4PGCB 1JPFA 3N0PB 1KACB 2VLJA 4POZD 3OHXA 1VHPA 4KJWC 1JYWA 2FIRT 2X1XR 1IQWL 1N5AB 3GBML 4L8BB 1QQDA 1OPGH 4JKPL 3OKMB 2YRPA 4CMHC 4HK0B 4P46D 2HJFB 4RAVA 1JF1B 2NYYD 5CJ8A 2VL4A 3OKDA 3VH8G 2VB5A 3VFSB 4X9GA 4DQOH 4M00A 3IU3A 5FYKU 3J8F7 3HZVB 2X09A 3KAAA 4DKEH 4MCZA 1B0WA 4NQEA 4OZFB 3L5XH 1F6AB 2E6JA 3QJFA 1ZT1A 1XH3B 3TNNA 4M1GH 3DROB 2ADGB 1UKQA 1A6UL 3QDGE 4X6BB 5BCAA 4F3FB 5EH1A 3HS0B 1U8PA 1HILB 5C08B 4RGNE 2KQNA 4KAQL 3D3VD 3RGHA 4KI5C 1SY6A 4HKZA 3QIUC 1AP2A 4A6YA 5E8NB 5D93C 2Q8AH 2B8OT 4JKWA 3BD4A 4L1HA 1HHHB 3TO2B 2HG5A 1EJ6A 4P5MB 4OM0L 2R0ZL 4GRLA 1M1SA 3K4DA 2R8SH 3VA2C 4HPOH 4XNQB 2UYLB 1GOGA 2PO6D 4RAHA 1G7LA 1Q0YL 3RWJA 1G9EA 4L29A 2IFGA 4IHOA 3RL2B 4H25A 5I0ZA 2G75A 5C07D 5GS1B 4K8RD 4JGUA 3CK0L 4YFLI 4O02L 3NFNB 1R24A 1CLOL 4LKXB 3VXMD 4X80H 4U1MA 2VR9A 1EDQA 2HTKD 1S7XB 3NACL 2VAAB 3MGAA 2KKQA 3HC0B 4LU5L 2NXYC 1A9EB 2FIKB 3TH3T 4UV7H 4JHBA 1CCZA 3RVWD 3UTTE 2X4PA 4I0PC 4H1LB 4XNYL 3X12B 3WNMA 2R2BB 4GRWF 5GGQL 3THMH 2GYSA 2QSCH 2NNAA 4C54A 3MUGA 4HZAA 1LEIA 5CILL 4ODSL 4L4TB 4MZ2A 4NQTA 3MLSH 4PB0L 3VFGH 2EIZB 2O26U 4ALAH 2X4UA 4KTEL 4JFQB 3VRJA 4MQXD 3FRUB 4L3EE 5KVFH 4ZAKA 3IRPX 2NW2A 3KJ6H 3UC0H 3VG0H 3NH7L 1X5FA 4MJ6B 3UPAA 1MH5B 3HZYA 3OAUL 1CI5A 2HH0L 3DSFL 2J4WH 4HQQL 3GBNH 5SV4A 3BKML 1TJIL 3UDWC 3BJ91 3LEXA 3TH4T 3OJMB 5FHBH 2VITB 4CVXA 4EDWH 1XF4A 4QRPD 4HIJB 1C1EH 4PJIF 5DSCB 4LQFH 2WBJC 5T5FL 2J3SA 5HYSA 2X89D 1T20A 5C0GA 3OAYH 2V5MA 3MLUH 5BO1H 2F53A 1QA9B 1RZGA 3GMPB 4NZTL 5F3BA 3FB8A 4WO4B 1X7QA 4YDLC 4GSDH 3MA7B 2EIDA 5IM7A 1S8DB 3IXAA 2ZCHL 1UB6B 2DBLH 4U2YA 1ACZA 4RRPG 1CDJA 5B3JE 4M4PA 1ZGLP 2ERJB 2P1YA 3IJHA 1RUPH 4D2NA 2C3VB 4KJWD 1YZZA 4L4JA 4UQ3B 3O3AB 3RFZC 3SJVE 5FCUL 4TOYH 1S9VB 1FAIH 1ZA6A 4MB3A 4NP4H 2C5DC 2IPKA 3GGWA 1TVBA 4KK5D 2ADJB 4JY4A 1I8LA 3U36B 4ODWA 5IB2B 1SYSB 43CAA 4HEPG 4PG2A 1T1XB 4UU9B 4QEGA 5L88H 3QCTL 1F97A 3KXFA 5CZVL 3UTOA 1X4YA 4I9WE 3SE8H 1HYSC 3R8QA 3VMNA 4DCQB 5ALCH 2OL3A 3HC3H 3GKWL 5DEFA 2FZ3B 2HJKB 3F5WB 1F3DJ 5IW6B 4D94A 1JZ8A 2ZUYA 1XGTA 4RMVA 1KTRL 1MWAL 1UA6H 1L7IL 2SEBA 1QFUH 1A6ZB 3TN0B 5GRVK 1EHXA 3FTGA 3QIUD 3MRCB 4KKBC 5D1XB 3VA6A 4KC3B 4Z78B 4KZDL 4TTDC 2DQEH 4R90H 2VLMD 2M1KA 2H45A 1L9MA 2A6JB 3W0WA 4O51B 2W0KA 4WFEE 4MA7H 3U2SB 4MQTB 3PP4H 1OT1A 4K7FA 5JXAH 3K81A 3DECA 4JZOA 1IBGL 1HXMB 3FAXA 3P9MA 4JFPA 2CK0H 4P9ML 1K5NA 4N8VA 1I1AA 4LIQH 2JJSC 2H32A 4TULH 1SM3L 5T1DH 3VXPA 3MJ8B 2OSLA 5JNYA 4YE4L 3ROOA 1RZ8A 1JZ2A 4HC1A 3OKEA 3QWOB 1NC2D 2A0LC 5IHUH 5FM5M 2M8XA 3WIIH 3JWDH 3OJVC 3MOQA 5DJYA 1F4YL 3BDYH 1CGXA 3AAZA 1FVEB 3LKRA 2MSPA 3LKSA 4AMKL 4Z0XA 3LRSB 4OF0A 2E8YA 5JW3L 2F54A 1LHZA 3EFDH 2Z93B 3RL1A 1AD9A 5I8CB 4V1DD 4XPTL 1NLBL 2COQA 5JUEL 2IGFL 2N4IA 4JCMA 1HEZA 3C5ZD 3IDGB 4R3SA 4EKXA 4NN5B 1T5XB 1RURL 3VXUB 5AG8A 3PJSA 4FFZL 1YN7A 3P73A 1SEBB 5ITFA 3MJ9L 4J1UA 2DQDH 3QDJD 3C09C 4X7SL 5BW7A 5CLTA 2H6PA 3BIKA 3FAWA 4UILL 1HNGA 3QIWC 3UBXG 1F45A 5AUMA 1FFOA 4ODHH 3RU8H 4Y8AA 1MNUH 5EO1B 1FVDB 4GAJL 1EMTL 4QWWC 3ARZA 1CTOA 1A7OL 4NCDA 4ZNCD 5KVDL 3UYRL 1J8HD 4S10A 1M6OB 3AC0A 2DI9A 2HT4D 5SWZE 2IBZY 4YPGA 1C16A 5GGUA 1RJYB 3O3DA 4RZCA 1GGCH 5FO9A 2X2YA 3RVXC 3BP7A 1N64H 1P6FA 4GQ9H 1Q9LB 1QSFB 5EZIH 5DFTA 3S98A 1IRAY 4EDXA 5FKAB 4IM8A 3EO1B 3QNZB 1F3JA 3VRLF 4D0CB 3U0PA 5L6YL 2PW1B 5EDXA 3QQ3A 3DYPA 3WIHL 4NNPH 3NZ8B 5IFHH 1D6EB 4LCWE 3BAEL 4G80A 2J5LB 1CFSA 3FT4B 3Q1SH 2NY5H 3NIDE 3NCYP 5FUOL 3CGTA 4MJIB 2JJTA 1ZS8A 1M05A 4DAGH 4JO3L 1P2CB 1JTOA 1V3LA 1EX0A 3L7FA 5T33H 4U0RB 2IH1A 1F3DH 4PTUB 5J1AB 2QADD 3P4NA 4FOMA 1SVZA 35C8L 2ZUVA 4PRHD 5EORL 4ODUB 3ARFA 1HYSD 3FQNB 1Q94B 4YR6A 1CICA 1ZHLA 1EIBA 3KPQB 3UX9B 2WQRA 1DANT 4RQQB 2X44D 3RNKB 3CAFA 3KPLA 3DVIA 3R1GH 3MLWH 4XAWL 3S37X 4P2QD 3VFOA 2F5AH 1MCSA 4KKBD 4R0LC 3MBEA 4ZPTA 4YHML 1A1OA 3U4EA 3M45A 4TTDD 1MF2H 1U3YA 1F13A 4YIQA 4HMDA 5EG6C 1KN4H 3C6LC 2OJZH 4YO0B 2X1QA 4PB9H 5FYKL 3MXVL 4WFFD 3HUJA 2BDNH 4TSCL 3REWB 4D8PB 2XZCL 4OZFH 1BZ9B 4G8EB 3CX5J 4U1HA 1A7RH 1KC5H 2FH6A 4LGPB 3KHQA 3JV0A 4GG6E 4OKVA 3UTSA 2VN4A 2UZXB 1KN2H 2XA8H 4OD1H 5HYJD 4QF1B 2ILLA 2YPVH 2BSTA 4X6EA 4LLWA 4P4KC 4HEME 3SDYL 3KPPB 3VFNB 4QOKA 1UVQA 5TQ0L 4YXLL 2UUDH 2PTUA 4K9EL 2PR4L 5EC1A 5F7FA 3WKML 5AZ2H 2A0LD 3C8KA 1NCBH 3W5NA 4LLDB 2C7UB 1NQBA 2AK4E 3K8KA 1CF8H 2EDRA 4E41D 1OSZB 3HG1B 4OCWH 4QRRD 3BP6B 1Y6MR 4PJ5D 3F7VA 1NGWA 2BXZA 2ICWA 1UYWH 3FFDB 5I2IB 5L8JB 4PRID 2UWEE 4M7JL 4ERSL 2YMXL 1UG9A 4ZUVA 4U1NA 2BRRL 3RZCD 3S36L 2WWKO 2DWDB 1H15B 3B3IA 5I6XC 2FGWH 3KR3L 4RSVA 4K8RL 1WFOA 1D5IL 1MJ8L 1YYLL 2AV7B 4OB5L 2I07A 4NC1E 5BV7B 5D7JD 1NGPH 5I8EB 4M48H 4UTBL 4RBPH 4XMLH 3QIWD 3MCLL 4K3DH 4K94H 3UBXB 1A3QA 5LQBH 4H1LH 5DFVD 5GSVA 3TIEB 1P5VA 1DN0B 3WHXA 5JORA 1MIML 2LU3A 4QWWD 1I8KA 3MV8A 4JRYA 2ZG2A 5GS0H 3HPLA 3HFML 1DEEA 3NCBB 2VO5A 5C7XL 3LKOA 1AH1A 3WJLA 3ZYZA 5E8PB 3WDHA 5KVEH 5MEPA 5DGRA 5GHWH 3BQUA 1CWVA 2V2WB 4HUMB 4PGDA 2XQBH 2NY6B 4TUJB 4YC2C 5JIHA 5E2VL 1MHHA 1N3NB 2RJMA 3QNXA 4TVSa 4P9HH 3GIVB 3VWJB 1QUNA 2PETA 2AXGB 5C70A 3RWGA 1UKTA 3RTQA 2PTTB 2W38A 1NC4D 3CFDB 4KTYA 1JGVH 1PZ5A 3QQ9C 4Q6IC 1HH9A 2PXYB 4KK8C 4QXGL 2I60L 4KQ4L 2WP3T 4E42A 4U6HB 1H5BC 3A67L 4MMZC 3SCMD 4G3YH 5GRUH 3G5ZB 4AIXA 5E6IB 5B39G 3P30H 4PJGB 5EOCJ 3WHE1 2VR5A 2GTZA 4HWUA 3NIGF 1CE6A 4YHZH 1KCKA 5ELIA 5DA0B 3TBWA 3T0VA 4LVHC 5E7BA 1HCVA 5EC2B 1QRNB 3FO1B 1EPFA 3TBVB 4RNRA 3WDIA 4YHLL 4R2GC 1FL3B 3IU4L 5T1LD 3ELAT 1WTGT 3EIFA 2ESVE 1CN4A 5F7KC 3RWDA 3SDAA 2VLJD 2HFGH 3QXVA 2RIKA 4ZUSA 1DEDA 1AI1H 2XTJE 4HWBH 2XZQH 4OCRL 3GMQA 1JNHA 2FHCA 3WD5L 1PBYA 1QO3B 4ZSOA 1UJ3B 4W6XB 1AGDB 5JTWA 3DX9B 4J12A 4X4XB 1YMMA 2IH3A 4PG2C 5IR1B 4IRJC 5DMYA 3C6LD 3MV11 4GW4A 5HVFB 3I9GH 5FUZH 5IB5A 5MEND 1QSFE 3G6JB 3KG5A 3CH1B 4X5WA 5E9DE 5I1LB 1N2RA 1LO2H 2H1PH 4DN4H 5D1QB 5F6HI 5DTFB 4WGWB 3MO1B 4UMGA 1GHFL 4F15B 4KROC 4LPCA 5AG9A 3MUJA 5E8DH 1NEZG 1B0GA 4BQ6A 3JXAA 1RPQA 2NTFA 1TTUA 3L1OH 2R1XB 4P4KD 1YDPA 2DJUA 5EOTB 4FP8H 4ZFGH 3L5JA 4YDVA 1MFAH 5DRZB 1G7JB 2CPCA 3V6ZB 4N9OB 1GIGH 3UPRA 5FOBA 5EFIA 3F6IA 4FZ8L 4UDTB 4IJ3C 3OXSB 5GJSH 3IDYC 4X9IA 3WYRA 2UUDK 3QBTB 3MQIA 4GRLD 2AJYH 2OJEA 4HCRL 1F5WA 4QHUB 3ZE0E 1Z0MA 2BSRB 1GJIA 2OI9C 5LJYH 2YZ8A 3B9KB 1AE6L 4R7NB 3T2NH 2A6IA 4XP5H 4A2LA 6FABL 4FFVC 4Z9KB 5FECB 1CXKA 3D2UB 3D9AL 4UI2A 4BZ1L 4XNUL 15C8L 4OLWL 3LZFL 4DFIA 1KEMH 3MODL 3F62A 3VG9C 2CDEB 4JANA 5DJAA 1KJVA 4MDIA 1X9QA 4M8VA 2A9MH 4WHYG 1R0AL 4MD4B 5HHOD 3S5LA 5LGJA 4JN1L 2VXTH 1UWEL 4OZ4B 5B39A 3M07A 1C5CH 3NGBB 4CN6A 4PGBA 1EEUA 4NPYA 4KKLC 4XVUD 3LKPA 4LCYA 4Y4HB 1T4KB 2NY1C 3HUJF 4KTDH 1YMHA 1JHTB 4HUXA 2VLRE 4X7TA 1P4LB 1ZHBA 2OP4L 4FQXB 1RZFL 1BIHA 1WISA 3QUML 4LDLB 5FM5O 5IHZB 4OD2A 1T7ZA 5KZCB 1HOCA 1U42A 3KYKH 4KWUA 2DYPA 2BCKB 1I3RA 1ZAGA 4ZAKD 2WM0A 1XGPA 1WWWX 2VABA 3MACH 4CVZB 5DJ6A 1S5IL 1JRHH 3W81A 2YK1H 2DQIH 4HV8A 1CIDA 5TJWK 4Q2ZA 3L3OA 4Z7WB 1U8IA 1LO5B 3HG1E 4MNQB 4U31A 3GMOB 4EVNB 2GJ6B 5EOCH 4S2SA 5E99L 1T21A 5ALBH 1RZKC 1EVTC 1U92B 4PG9A 1REIA 2W9LA 5L2JA 5KN5A 3BPNB 3QQ9D 4KK8D 3ULVH 5C0CE 1FGNH 3IFNH 1J8KA 2D7OA 1JJUA 2K9UA 3X3FH 3PQYE 5C0NC 1CD0A 1RZJH 2OK0L 4L9LA 3RKDC 1DVFC 3MJGX 5JHDB 1IGCL 4YHPB 5ACZB 5GGSA 4Y5VA 1KPVB 4N8CL 1BQUA 4X7EC 4XRCB 3QA3A 5IBTL 4TNWK 5KW9H 8FABA 1E4KA 3I2CH 3QDGA 1X5AA 5KS9E 5KANI 1N8ZB 4F58H 4Z7UB 3WXWL 5JIPA 2X4NB 4P23C 3SGEH 4L8CB 1HZHL 3UTQB 4JPIB 5DLMH 2VXVH 3FONB 4YXHH 3IAQA 4LLAA 1WC7B 2AJVL 5CBAB 5HGAB 2DQUL 4OLXH 2PYEB 4NKMB 1A7QH 4MJ4A 1VFUA 2FL5A 4WI3A 4XX1G 5F1NA 2JB5L 1A1NB 2HKHH 2D31A 2R15A 4QGTA 4U6VL 3T4YB 2JELH 3TZVB 2E9WA 4PY8I 2QKIB 5ETUB 1ZLUK 1AFVH 3PWPE 4ZUWB 1YQ2A 2Q86B 3CVHL 3OR7A 3FQRB 3V5KB 1GGIL 5JZ7D 3MRHB 3WUWG 4FG6C 4OCSL 1IZJA 3JWNC 2WIIA 1RJCA 5HHPA 3MRRB 5AYUH 4KROD 1AGEB 4M02A 1A6WL 2G9HA 3QSKB 2HMIC 1EHNA 3MRGA 3HE6B 5E8OB 4HF5L 4XWGH 3S4SG 3HZMA 1HHJA 1HSBA 2R56L 4XXCC 1KIQA 2IADA 2GK0B 1DBAL 3E1F1 3UTTA 4WJ5A 2V5RA 1BWWA 1CG9B 3PL6A 5JMOC 3REVA 4NHCL 1MCFA 4NWUH 4RFOL 4Q9RH 3TJHC 4LLYB 3BPLB 4MHHG 3U83A 4Y4KC 1M4KA 1INEH 3RDTB 3WN5B 5FO8A 4WWKA 1OP3K 5HPMA 2CMRL 4LCIL 1G9NC 3V4VL 1S7TA 4GW5A 1NLDH 5FXCH 4LFHD 1XEDA 4P2YA 1I1AD 4KMLB 4FFVD 3P0YL 4PIRF 4HS8L 1OAUH 3CC5B 4L3EA 3M8OL 5EUKA 2AJZB 4NDMA 1VFMA 3ALPA 1FORL 1TZHA 2Z91A 2Z31A 1K85A 4X8JB 3D18B 4DK3A 1B90A 2F19L 1OM3L 3WLWD 1JZ3A 1P53A 3LEYH 4KJQD 2P5WD 3ZHDA 2VC2L 1IT9L 5EBWA 5HSFA 1BFOA 2IAMB 1CT8B 2F54D 2B7DT 4FQ1L 3FJTA 3WXVL 4HUVB 4OF5A 1NGQH 1QBAA 2OBGA 4QRTA 3W9EA 3G5XB 3MJ7B 4KKLD 1OQOA 3H3KA 5DJDA 5LAXA 1G6RL 2NY1D 1U8NB 4LVNB 5F88A 2VZ1A 3MRIB 1ZVHA 1G9MH 1HQRB 5I1KH 3QUKA 3RWFB 4X4ME 5BS0B 5AZEL 5BQ7B 5IQ7L 1QVOB 3HI1B 2MHAA 4XP1H 1EBAA 3F58L 2W9DL 3VFWA 4LF3B 5BV7H 1LD9B 2FATH 12E8H 5I30L 5DHVB 2E27H 1G1YA 4L8SA 4XC3H 1NUGA 5L2KB 4M6NH 4I5BA 3QUZA 3SJVA 2P24B 2EE2A 2BOBA 4LL9A 3CDFA 4ETYA 1LK3L 2AKRB 2NY3B 2ITCA 1AHWC 4H20L 5GZOC 3EYSL 3HE7A 5C0ND 1GGBH 3RKDD 3JWOH 1DVFD 2ZUTA 1N6UA 3I02A 4GS7C 2VDNL 3BUYB 3N1MC 4LSQL 3GI9H 1S7RA 2WQ8A 3KWWA 1NSNL 1ZGLA 3QO1B 2B39A 3L3IB 4XP9H 4N8PA 5L8KB 3BP5B 1ULVA 4PJXE 5JOEA 1DQJB 4RIRB 3PP3H 3ZDXF 1G1CA 1OAZH 4P23D 3BKYH 1FFPA 4JM2C 3OL2A 3DUSB 1L7TL 3RTQC 4KXZH 4XBPA 1WT5C 3EO0B 1EVUA 2DLHA 4HPYH 4HIIB 5K9KB 2NW3B 3SDDB 4PGZA 3R4DA 1EHAA 1ZA3B 1QNZH 4U1JA 1QPXA 2D7MA 5KSAB 4MD5A 2O61A 2YS4A 2EKSB 3BWUC 1A3RH 5CGYC 3DETD 1N7MH 1NCAL 1P4IL 4KKAD 2QTEA 1BFVL 5I9QB 3CFBA 3DMMC 1H3GA 1RU9L 4UNUA 4DGYL 3TJEH 1BJ8A 4PGCA 4Y7MA 3VJ6A 1JGEB 4Z7WE 1MFBH 3MV7E 1C12B 3SDAC 5EZOL 4W4OC 1N5AA 4MNQE 4L8BA 2OMNA 3PWJA 3IFLL 4OCLC 5IK3B 4XP4H 3B2VH 1DL7H 4JFFB 3E2HC 2HMID 3FQXB 3IXTA 4HK0A 3ARRA 4NO3B 4HIXL 7FABL 2EC9U 5JOFA 2ENYA 5GGSY 32C2B 2OCFD 3HZVA 5JHDE 3NPZB 2J2ZA 4D3CL 2R0LL 3C5SB 1NUNB 1F6AA 4NQDB 3TJHD 3T08A 2NY0B 4AIOA 2VXSL 1XH3A 4NN6C 5IB1A 2EXYD 4Y4KD 2ADGA 5CGMA 1BEYL 1QLEH 3GRWH 4F3FA 1I1CA 2DQGH 3LIZL 1TQCB 4GG8B 1AR1C 2AEQH 3CLEH 5GIRA 1C08B 1RSFA 2FHBA 1QFPA 4YAQB 2GT9B 3H7BB 5E8NA 3BPOB 1BP3B 2PYEE 1I7RB 1WEJL 3TO2A 3C87A 3JVGA 1U58A 4NNYB 1SJVA 4QHNB 1AD0B 4RMWA 1OW0A 3S34H 2FLRT 3LSOB 4NWTL 4EJ1C 1EFXD 4XNQA 2UYLA 4IMKC 1A5FL 4LVEA 5IMOA 3WS6C 5EU3A 1KUMA 3PGDA 3FKUS 3T0EB 3C08L 1XGYL 4OF8A 2VL5B 1HK6A 4HIEA 5SWZA 2FO1A 1ZEAL 3NBNA 4OT1L 3EDJA 4ONFL 4JKPH 3ZT5A 4FNLL 3MLXL 4LKXA 5DJZB 4LSRL 2QHLA 1V05A 4CU6A 3MV01 3W9DB 3WHE0 4CNIB 3G04A 1S7XA 4U1KB 1JNLL 4KHXL 1EAPB 1RI8A 3HC0A 2GSIA 1O5DT 1NMCB 1VEPA 1ES0B 5I73B 1RHHB 4Y1AE 1SYVB 3WNPA 2B0SL 5IFAL 4H1LA 2DD8L 3DRTB 1RIHL 2AJSL 4U3CA 3SPVB 4GAYB 4LCWA 3N9GL 2YSSB 5IF0A 1IKNC 4P57B 3HI5L 1KJ2L 4JRYD 1JNJA 4TNVK 3QULA 1NFKA 2VISB 1WCBB 3SQOL 4G8IB 2HFTA 5HGDB 3CXHK 1DBML 1T0MB 5EN2B 2IC2A 3FRUA 5GZOD 2EH8H 4EQ3A 3BQUD 2Q76A 3GSNB 4BH7A 1OD7A 2R0ZH 4JREB 3MR9A 1MH5A 3Q3GB 1EK3A 3BP4A 3KPMB 2MOVA 1WIOA 1YEHL 5HHNB 3DXAB 1Q0YH 3QEQD 1YPZB 3WFDH 4Y8DC 5C0BE 3E8UL 1EH9A 5ADPL 4NRZA 3A6CL 3FB5B 5LGHL 1FGVL 5DSCA 1MJJA 4JM2D 3RTQD 1EGJA 2E3VA 4M61B 4O02H 3INUL 4V2CB 3GB7B 1CLOH 3FZUC 5CZXC 1TLKA 3QO0A 2BMKA 4IRSA 3VRIA 1QA9A 3NACH 2WUBL 4X5XA 1U3HB 1FO0L 3MA7A 3VGGA 3BHBB 3O8XC 1S8DA 4RISL 5CGYD 5BS0E 1UB6A 4M3JA 2C1PB 2W59A 3DMMD 3JBG7 4GG6A 4Z7NE 4UUJB 3S96A 4XNYH 4PPTA 3EJYC 4FFYL 4GXVL 1ZANL 5GGQH 1RIVH 4U6YB 1VKXB 3HI6H 3BZ4B 4UQ3A 3SDAD 4HDIA 3TCLA 4ODSH 1FBIL 1MJ7L 1ZT7B 5B3JF 1OLLA 4IOFC 4PB0H 4HWBA 3H0TB 3TWCH 4U6XB 2AI0H 2DWEB 4M7LH 1FIGH 1H9VA 4OQTL 4XMKL 1ND0B 3CUPB 3U36A 5IB2A 1ORSB 3G5YA 2AK4A 1KB5A 3UZEA 1YMMD 3BD5A 4HH9B 1RUQL 3NH7H 1EO5A 4WTXA 3BKCL 2EDXA 1RK0A 3DSFH 2YRZA 4HQQH 4J3OC 3ZKXC 4DCQA 1SJHA 3BKMH 4PRNA 5IESL 1TJIH 5E4EC 3C6SB 1CFQB 1YJDC 2FZ3A 2UWEA 2DQHH 5IOPA 5IW6A 1U8KB 3P11L 1HH6B 3BSZL 3F6LA 4P3CL 3K2MC 1A6ZA 1AR1D 1IAOB 2EXWC 3FN3A 1YEGH 3MRCA 4QRPB 4JJ5B 3IVKB 2CQVA 2VDOL 3RUGB 1IGMH 4Z78A 4LRNH 4NZTH 1RZ7L 1NL0L 2FNBA 4X9FA 4Q9QL 2A6JA 3MUHL 2BNQB 4JY5L 1DR9A 5ID1B 2ZCHH 2CO7B 2VLLB 3RVUD 1QTYT 3ARPA 5JR1L 4GO6B 3MRMA 2XN9D 1HXMA 3WMSA 1JGUL 1G6VK 3MRQA 2YEZB 3GO1H 2MMXA 2CKNA 4O4YL 2YPKB 4ZTPL 4MXVF 4BZ2L 4W81A 4UDUB 4KY1H 5MHSE 3MJ8A 1MUJB 1A2YA 3V5HB 3LDBB 4QXTB 3HMWH 4JFFE 5DRWA 3QWOA 4M3KB 1ONQB 1NCDH 3MPCA 3JWDC 1CD8A 3BIAX 3O2WL 5CZVH 2QR0A 4EBQL 1YEEL 3LRSA 4LNVA 4FABH 1SJXA 3GKWH 4R4FH 1JPGA 5BMFL 2Z93A 4F7TB 4NQDE 5I8CA 3O6MH 1T0NA 1JZ5A 4YXKL 4OBSA 2E8ZA 1L7IH 3IDGA 3KLAB 1T5XA 3OPZH 3U9UB 1GOHA 4I2XB 1SEQL 4OLYL 1F42A 2IPUG 4RDQG 1SEBA 1VGKB 5EULV 1CLZL 3GMRA 1AXIB 5T1KD 2O5YH 4DOHE 1I85A 1M7DB 5JPNA 1HHIB 2HVKB 3B8YA 1A14L 1QBML 2ESVA 4KUZL 3PDOB 1T04B 2LTQC 4NKIL 1FNGB 4ZOCA 3NN8A 5DHVH 1T1WB 4Y5XC 2P49B 3T0EE 3AY4C 1HWHB 4ZO9A 4S11A 1M6OA 1SM3H 1CXHA 2NY4B 4DGVH 3KPTA 4YHIB 5CZXD 5KSBB 1G0DA 1RZKL 2A9NL 2R2HB 1Q9LA 1AXTL 2DQJH 1F4XL 1QSFA 1F4YH 5E9DA 3VW3H 5FKAA 4BFIB 3ZDZE 4AMKH 3QNZA 3CXDL 5FYKE 1UKSA 2DMCA 5EOQL 4J4PC 2PW1A 3EJYD 2EDTA 2NXYB 1AGBA 4XPTH 1D6EA 2E7HA 3LKQB 5ERWA 1QZ1A 4PRPB 3VMOA 4HKXB 2AERT 3QHFL 4PS4L 3FT4A 4I0PB 4TPRL 1UEMA 4XCEA 3LCYA 2ICWI 3OKYA 1IGYA 1XCTB 4F80A 1IARB 3QUMB 2Z35B 2A83B 5ECJE 8CGTA 3ILPA 3D3VE 3NIDF 4OF6A 4PTUA 1ADQH 4I77H 5F71A 1HSAB 1R5VB 3QEUA 2VQTA 1II4E 3DYOA 4I48B 3L6FB 3FMGL 3FQNA 3GI8L 1MEXH 4C4KT 4PJFB 4F33B 3KPQA 1A4JA 1TVDA 4ODVL 1A7OH 2EDDA 4WI7A 3UPCA 4LAQL 3LAFA 1G7MB 3DXAE 3WKNA 5ESQB 1S7WB 1YPZE 2R2CA 3UYRH 5KVDH 5DEGB 3T3PF 4U3HA 1O0VA 4KRLB 3UZQA 4DEPB 1NUFA 3K4AA 1CVRA 1TNMA 1CR9L 3OKKB 2X4RA 5LKNA 2EXWD 1TZGH 2PKDA 4RFNC 4M7KH 1IAIM 1HE7A 1NPUA 2V9TA 1XZ0B 5C07E 5BVJB 3ISWA 4X9HA 2MKLC 2DS4A 2WBJB 4P2OA 4NKDB 1UJTA 1TETL 3FQUA 3M1BA 3K8MA 4PYHA 3QEHB 3VXME 3G6AA 3AXLA 4D8PA 3HNVL 5L6YH 4X0KA 1CLYH 4TNWF 2VLKB 1QBLL 2AK1L 2FX9L 1WBXB 3MNZA 4MA1C 4QF1A 4WU5B 3TVMB 4HGMA 2IPTH 3WFCL 2KPNA 2VLRA 4K07A 5FUOH 3S3PA 5I19H 2JIXA 4NFBA 4WEMB 5DD3H 4GG6F 1YQVH 1WWCA 1IEBA 1MI5D 3UO1L 5E2WH 4FXGB 2R0WL 3UMTA 3WO4C 3V52H 5IJVA 4NJ9H 1EHLL 1IZKA 3LS4H 4F2MB 3ZDYE 3JTSB 1MFEH 35C8H 1OD9A 3CVHB 3HG1A 5FDWB 1WBZB 4ZO8A 3AM8A 4GUPA 1C5BL 3BP6A 2DLFH 3QDHA 4MVBC 3V0WL 5MEQB 5I2IA 5GS1C 3IDNB 1ITBB 5C0CA 1G7PB 4XAWH 2DWDA 1H15A 1P4BL 1CK0L 5T3XH 3PQYA 2CKBB 1T80A 1CGYA 3RHWK 1WFTA 4YHMH 3SOBL 3MMEB 1Q8MA 2UWEF 3P0GB 4QRPE 4GQPH 4LQ1A 4WUUD 2MKWA 5DGQA 3RWIB 3RUGE 5EO0B 5IT2L 4K7PL 4XMPL 2YD5A 4N0YH 4OLUL 5FYKH 1VFBB 1FPTH 2IFFL 5KS9A 5I8EA 1U8MA 3DX7A 2XZCH 4K94C 4U1SB 1D9KA 2BJML 1OAKL 3BGAA 4YHNB 1A6AB 3SJVD 3QUZD 3Q48A 1F4WH 3HKFA 2JJUA 2EIBA 1AKJB 3O11A 1AQKH 2MWCA 2BNUA 4XBGA 4YXLH 4Y4FB 2PR4H 4AT6B 5ADOL 3OKOB 1KLGB 3KDMB 1IILE 3HE7D 3BN9C 3PWPA 4NC2B 3GSNH 2OTUB 5IROC 3SDXF 5GGTA 4DZ8B 2Y7QB 3G5VB 4KV5E 1A0QL 5D9SA 1Q1JL 1IKFH 3U0WH 4J4PD 4P9HC 3GIVA 4JHZA 3VWJA 1TJHL 3O6LL 4MJ2A 5E2TL 3LPFA 5I16A 2NZIA 4ERSH 3MRJA 5DD1H 1MREL 1G6RB 2PXYA 3MRNA 5T1MA 3KR3H 3G5ZA 4P59L 3X14A 4E0RB 2VDPH 4I2XE 6CGTA 5CZKA 1OTTD 4WO4C 4JFOB 2IQAB 4FFWC 4I3SL 4JFZL 4WFED 4LSSL 4UQ2A 1A6TA 4OB5H 3ZMRA 2X1WL 4EI5B 4RAUB 4KI5E 1F3RB 3FO1A 3C9NB 4DGIL 5DJ8B 1FL3A 2VDRH 4G6JL 4AJ0A 2VLME 4IDJL 4K55A 1JFQL 2ERJC 3VDBA 1DN2A 4JZNB 1KCUL 2BZDA 1FP5A 3WCYA 4APQB 1T7YA 1JF6A 25C8L 3Q6GL 5DT1H 4R97C 2GCYA 3OF6A 4BJLA 3STZA 2VN7A 1UJ3A 1UWGL 1DLFH 4NBXB 3DX9A 3EYFA 1ZSDA 3PXHA 4BH8A 1IL1A 1LGVA 1OPGL 3TO4C 5IR1A 3IETB 4X5LA 4CW1B 5KVMC 4X6FB 2FBOJ 2WINB 5FYJU 4HJGB 1FG9C 2LV4A 5JXEC 3CH1A 5E2VH 3QFJB 4PGEB 2VJXA 5JA9A 3GRWA 2ENSA 5D1QA 3MBXH 2XXCB 5J06A 5EIIB 4JDVB 5C08D 4QXGH 2R1XA 3TN0C 1JHLH 4X4MA 1QRKA 5D1XC 4XNZB 4H8WL 2AJ3B 2APBA 1G7JA 2EDQA 3V6ZA 3OBAA 4UDTA 1HHGA 1OGTA 3OXSA 2I9LB 1CD1B 3IU4H 2LQRA 3NZHH 4QHUA 4TUOB 1UXSA 3QDJE 2BOCB 2Q6WB 2BSRA 4X7FC 5EZLB 4MVBD 4PJFE 3QUXA 2R8SL 3EJJX 1JBJA 5F7DB 2GHWB 1IM9A 3WD5H 3D2UA 1T03H 2XWTB 2ADIA 5E4IA 5GRWA 5BXFA 2DQTL 2MQ0A 1NGXB 4S1SL 4G6FB 1J8HE 1DQDL 3MREB 4RWHA 5F7WC 5C0RL 5JQ6L 4MWFB 1T2QH 1OAXH 1WIUA 3X11B 3I6GB 5I8OH 4R0LB 4PJ8C 2WWKT 2H3NA 5DJCB 4PJXA 5J9PA 1SQ2N 2MJWA 4HHAA 2BHZA 4OZ4A 4UAOB 5D6DA 4NZDA 4MAUL 4EI6B 4L3CB 1YEKH 2R9HC 4UV7L 1GHFH 1NGYB 1CFBA 2X40A 3H3PH 5GS0D 4LCCA 3R06B 4NN5C 4L4TD 3DGGB 5F7UA 1TJGL 4WV1A 2VDQH 4U1LA 1JHTA 5LGKA 3ES6B 3T0AA 3ZYJA 4FQXA 3BE1H 4RDQF 1AO7B 2HRPH 4OIBA 3AREA 3LQZA 2FSEA 3HAEG 4XNMB 4JQVA 3BN9D 4XBEL 3VFGL 4NC0B 3AFLA 5FDYA 1OTSC 2BSED 3O9WC 4GBXB 4ALAL 1T1ZB 5HVWA 1UB5A 1S9YB 3T8XB 4ELMB 1JZ7A 1FL6A 4Z7WA 4OFYD 3MV7A 4G6AC 3BZFB 3KJ6L 4MNQA 3GMOA 3VG0L 4OUUB 4PP1C 4EVNA 4KDTC 4H26B 6FABH 2A6DB 1A8JH 2F74B 4PRHE 1J1XH 3ULVC 2X05A 2BVTA 5FHBL 5MERB 2W1NA 3MROB 4YQXL 3KJ4C 3MODH 1C1EL 1RZJC 3DPBA 1S9WB 4LQFL 5JHDA 4WO4D 4FFWD 3X13B 5ESAB 1T22A 4YHPA 5ACZA 5I6XB 4KRPB 1ZWIA 3MLUL 5BO1L 3OB0K 2EICA 2ZOLB 4JN1H 3NAAL 4XPHH 1TXKA 4YHYC 3B9VA 4HGKC 5DHYB 3T77B 4I18C 2X4NA 5E5UB 4L8CA 3O6KH 2F58H 4KPHL 3TBSA 1XFPA 1A7PL 2X1PA 3TPKA 2DBLL 3MRLA 1LDPL 3GSOA 1PD6A 1F2QA 3FO9B 2J5LC 5KS9F 4PJCF 4NCC2 2PYEA 3VWKA 1RUPL 4TNVF 1NKRA 1KPRB 5FA3A 1A1NA 2OP4H 4WIQA 1RZFH 3QUMH 3IYLW 1CU4H 2H41A 5HYJE 4HFUL 2WAHA 2ZG1A 3T4YA 2DOCA 3TZVA 4N9GB 5ETUA 1S5IH 4ZUWA 4R4NC 3CLFH 1LWRA 2FCBA 2Q86A 5JXED 3FQRA 4G43B 3MRHA 1SJEB 1NKOA 3BPCA 5L88L 4YC2B 3EOAB 1CYGA 5E99H 3U7YH 1AGEA 4OJFL 3HE6A 3BRDA 3HC3L 1YJDL 4AH2A 3PG2A 4YBQC 4B53A 3TN0D 4PJ5E 1GPOL 5D1XD 3U0TB 4C55A 2OK0H 1FO0B 3S3JA 5BJTA 3L3DB 3HLAB 3M17A 1BFSA 3STLB 3ULSA 4Y1AA 1HIML 3QISA 1YN6B 5JO5A 4N8CH 3PWVB 4Y16C 5IBTH 3T0BA 4XZUB 1U8LA 4I4WB 1JV5A 4LLYA 4EXKA 1C7TA 2IALB 3RDTA 3B5TA 3WN5A 1G7QB 4N1EA 4QRSB 1HZHH 2ZPKH 3HRZB 3ARBA 4R2GB 2AJVH 1BVKB 1WAAF 3UJTL 2DQUH 4PLOB 5I76B 1H0DB 1QLRA 5IMMB 3ZE2E 4YK4B 2VUYA 5JA8B 4LIQL 4TVPL 4G9DB 4TULL 5T1DL 4X8JA 5DFWH 3CPLA 3D18A 4LEOB 3I75B 2XKSA 3RZWA 3QG6B 4LLMB 1FDLH 4PJ8D 3DTXB 3CVHH 5C0BA 4EN3A 5DI8B 2IAMA 5IHUL 3RGVA 4IRJB 1CT8A 5D7IE 3WIIL 3QFJE 3MLPA 3LV3B 5F3HB 1MWAA 4PRDB 2R9HD 1YEIL 4OZIB 5IMLA 3EJZC 5EUOB 3EFDL 3BH9A 1UCBL 3U79A 2CKBH 4HIHB 2R56H 3MRIA 4N1HB 1HQRA 2D9QB 3VXUD 4KROB 2YPLB 3RWFA 4Z7VF 3A0OA 5BS0A 5BQ7A 4ZFOL 5CEZL 1PSKH 4YFDB 2X70B 4KJPC 4QRUB 3EYVB 4LF3A 4NHCH 5DUPL 4QRQB 4U7KA 3TA3A 1OTSD 2W92A 2HYMA 1WK0A 5DHVA 5ICZB 4F37K 5CEXA 3DBXB 4LMQI 1KXQE 3V4VH 1C5DB 2P24A 3NFSL 5HY9A 4PP1D 4UIMB 4Z6AT 1UH4A 1VGEL 3DO7B 1BGXL 3UTPD 3RU8L 2XY1A 1MNUL 1N5YH 4HS8H 4JRWA 3ULVD 3ARDC 3M8OH 2JK5B 3SBWC 1D5BB 2H2PC 2VLJE 1JMXA 5JMRA 2P8LB 1OHQA 4OCNC 2V5TA 5DJXB 3JWOC 5DO2C 2G60L 3BUYA 3OZ9H 4HBQA 1NBZA 3FN0H 1UQSB 1RIUH 1IT9H 4EZMA 5I1HH 1IFHL 3L3IA 4DN3H 2OXGA 3DUUB 4GQ9L 1N64L 1F00I 1DQJA 4RIRA 4E5XA 4XPFH 3WXVH 4UT9L 3VWJC 5EZIL 2QQLL 5J13B 2PN5A 4NO5A 1CDIA 4FMKA 2I27N 5L0QC 5MENE 3EO0A 3MRDB 1G6RH 2VQUA 4HIIA 2NW3A 3MX0A 4YWGL 4GKSB 4PJXF 5TGBA 4NNPL 2IMMA 1ZA3A 4K71B 5EU4A 4LHUG 4MJID 4C59B 3V79C 5E6IC 5IVNA 3MJ9A 3CFJB 4XT1C 1D6VL 4WHTA 4C58B 5AZEH 1BFTA 5IVXB 5FB8A 4PLNC 3W2DH 4AEFA 1T83A 4NT6A 2W9DH 3I3BA 4KK9C 4R4ND 3PHSA 3O6FA 1JNNH 3RJQB 3W39B 2EDWA 4NZRH 1JGEA 1A47A 2CLRB 3PGFL 4ELME 5IEHB 3B5HA 2MTPA 3B2UD 1QFHA 2OQJA 3GNML 4OFIA 4MSWB 1EO7A 3P4LA 3CDGB 1UXWB 3QT2A 1K2DB 1YUHB 3DVFA 1LK3H 4JFFA 2CLVB 4N0UE 4UB0H 5JOPD 2JCCB 3KYNA 4Z7WF 4NO3A 4YBQD 3EYSH 4WW1B 5HHMB 5SWQA 1Q9KB 5E56A 1MAJA 1MSPA 32C2A 4Z8FL 4PJ7B 4LSQH 1R3KB 4MA3A 2F5AL 3NOIA 1KTLB 5FYJL 1NSNH 4U2ZA 3QPXH 1I9JL 4NQDA 5EU5B 3WIHA 1MF2L 4KI1A 4D9LH 2EYRB 1QEWA 1KN4L 5CLWA 1EO8H 5F72S 2OJZL 5L8LB 3BT2H 4Y19B 4HJ0C 5D1QC 2XTLA 2PNDA 2DN7A 2Z8VC 5HHOE 1JWUA 4BQ9A 2H8PB 3RX5A 1JHKH 2YOCA 1A7RL 1KC5L 3E3QC 4HUUB 4YAQA 3H7BA 3GSRB 1KN2L 2XA8L 3QYCA 5EPMB 2YPVL 1NCAH 2GQHA 4NNYA 1AD0A 1PLGH 2BVPB 4MS8C 2EECA 1J7VR 2PW2B 5KVGH 2V7HB 2DIAA 2K7PA 3HG1D 5FV1L 5AZ2L 3T0EA 3HR5A 3IF1B 5DC9B 3ZT6A 1CZ8L 1ACYH 1J18A 2EDFA 2VL5A 2W91A 5CJBA 4DUVA 3V0AC 1WQVT 3RVTC 1CF8L 3B9KC 4NRYA 3F7QA 2XXMB 3IFLH 2WV3A 3MOBH 4OCXH 5GRYA 1E4WH 1BM3H 3IKKA 3EJZD 5DJZA 4NYLB 1WBYB 2CXGA 5HYQB 4MCYB 2Z4QB 4PP2B 3W9DA 4CNIA 3LKNB 4LPUA 4X98B 1CE1L 1CXIA 2GUOB 3OJDA 3LN5A 4P3DA 4P46A 3OTTA 4YBLB 3ZYIA 2R1WA 4BELD 4KJPD 2FGWL 4D3CH 1SYVA 4DZBB 2HN7A 4ZUUA 1QSEB 1CDHA 4WFGD 3SPVA 4GAYA 1U2HA 1BEYH 3NGBC 4PGJA 3K1KC 4OKDA 1NGPL 3O2DH 2XWBA 2EDNA 4Y4HC 1U8QB 4HSQA 4K3DL 4K94L 2RCSH 5LQBL 2VISA 1WCBA 4G8IA 4F7MA 4YBHA 1E27A 1JGDB 5HGDA 3ABZA 3N06B 1KT2A 1Q72H 3D3VA 1WICA 1D5MB 4XC1H 1WEJH 2H2PD 2CRZA 3RY4A 1R3IH 1JN6B 4NN7C 4XGZB 3TC9A 5DO2D 4LPXA 2R2EB 2NY6D 2GJZB 3Q3GA 3SO3C 5I17B 5GHWL 3KPMA 3OX8B 5CKAA 5CHNB 1VESA 4YFLF 3DXAA 1YPZA 5D7SH 4W70A 1UZ8A 3P9LB 1IGIL 3VWJD 2PO6A 3DX8B 4OT1H 4ONFH 1NAKH 1UM6L 4M61A 1CD9B 4FNLH 4X4ZA 3AB0C 3BPNC 4OZIE 4JFDB 2PXYD 5C07A 4P9HL 2VWEC 5F1SA 3BEWB 4LHUB 5ANME 5EUOE 1P6AB 4OZGE 1JNLH 1A3LH 4HG4K 5E6ID 1KIRB 1CXEA 2N1KA 5IBLC 1JGVL 5JPMB 3VXMA 1QFWM 5C6WH 1Y0LB 4OZHB 1KIPB 4JKMA 3EW3B 4G3YL 2C1PA 1QRND 4YJZL 5IFAH 4KK9D 2DD8H 4JLRB 4LPWA 3D85B 5C0EB 2AJSH 5K9OB 4YHZL 4N68A 1T1YA 2N7BA 1GGYA 5D2LB 3N9GH 5F9JB 2VDKL 1VKXA 4HWZB 4X6CE 4K3EH 5EBGA 1ZT7A 1AGCA 1JWSB 4U3XA 1J05B 4Z7NF 3H0TA 2J8UB 3SQOH 5K59E 4PBXA 4U6XA 3FT2A 2G5BA 5I1GL 1NDMB 2V7NB 3OF6D 5E1HB 5KSUB 1DUYB 2ZCKL 5J6HA 1AR2A 2HFGL 4F7PB 5HHQB 3NCFB 2XWJB 4ORZC 3TZVC 1BD2B 2XZQL 1AHWB 1FSKB 1EBPA 4MLSA 3AUVA 3RIFK 1MQKH 1JRHI 2XFXB 1IGJB 4GS7B 3I6LE 2W65B 5ADPH 2YD7A 5IV2B 3I9GL 5GRZA 4HJ0D 5D1QD 1HH6A 1XF2B 2F5BL 1KTDA 3QEQB 2ZSVB 4N90E 2P5WE 3L7EB 4TTGA 2XA3A 4U1IB 4QRPA 2H1PL 4JJ5A 4DN4L 2VXUL 3IVKA 2F54E 2XI9A 3RUGA 5I1JH 2WUBH 3P2TA 4KK6C 2BVOA 5CWSB 3OAZK 1S7VB 2YD1A 1FO0H 1BLNB 2CUHA 3AROA 4LASH 1VFAB 3L1OL 4GKZB 4JY6A 2VLLA 5IVXE 3C60B 2X9XA 3CZFA 1MFAL 5EA0L 4U6TA 4FFYH 1U8HB 2FLBT 4XP6L 4GXVH 1ZANH 4CKVX 4JAMB 3WN5C 2MQ3A 1MCDA 4NUGL 2YPKA 3UJIL 5GJSL 4NUJB 4UDUA 2VAJA 2ZNWA 3RVTD 3B9KD 3U46B 4PJEF 2FWOA 3BH8B 3SGEI 5AAWA 1MUJA 3V5HA 4R96A 4QXTA 2AQ1A 3JV4B 3FHQA 1MQ8A 3V6FB 1DUZB 4OQTH 3D2UD 4XMKH 4WW2B 1SMOA 4XP5L 3FCTB 4XTRC 1E28B 1VERA 3AU1B 3QAZC 1RUQH 4P5TC 2AQ2A 4MJ5B 2CIKB 2RBLA 3P4OB 1NBYB 3DI3B 4LGSB 5IESH 2D03H 2R1YA 5GGRB 1U3JA 4F7TA 3D69A 3HB3C 4YGAB 4MAYB 4PJBE 4HKJA 2A9ML 3O4OB 4KGLA 3L3GB 3KLAA 5TQ2H 1IAII 3WUZA 4Y4HD 4GKNA 5TDNB 3U9UA 4MDJB 2B20A 4I2XA 3SGJC 3CIQA 4HS6B 4LVNC 3PWNA 4PTTB 4AEIL 5HDQH 3TH2T 1RZ7H 1VGKA 3MV9B 1NL0H 4KDWA 1U95A 5H35B 4FQXD 5B38B 1M7DA 5KZCD 1U41A 3QIUA 3JV6B 1HHIA 2HVKA 4I0KA 4KTDL 2WBWB 1VFOA 2CIIB 3PDOA 1T04A 4HCRA 1FYTB 3DOSA 4BQ8A 1SBSH 1JGUH 4GLRI 3KYKL 3V0VB 1NAML 1TTFA 4O4YH 5AWNL 4MNQD 4ZTPH 4CDHA 5E70A 4DVBB 1JRHL 2GJ6D 2YK1L 2XICA 4ELKB 3HNSL 4NGHH 3MNVB 2NY3C 2GSGB 1V8HA 5C9KA 4YHIA 3FL7A 5J4MA 3EOBA 1RJZB 4NQVA 1R3LB 5JHDD 1CGVA 4BSWA 4BFIA 1EJOH 4EBQH 1FGNL 3IFNL 1NC2A 4XH2B 1K4DB 3JSSA 3SKOB 2IF7A 3GSWA 2QJDA 1RZJL 5ICYB 3F12B 3MSPA 2VZVA 4ZFFA 5B4MC 1TQBB 1WFNA 3T2PA 4M9PA 5IG7B 5INDB 1GCFA 5I0DA 1IVLA 1E6JH 3LS5L 4YXKH 3ZDZF 2ARJQ 5BVPL 4HKXA 4I0PA 4EUPG 3I2CL 2DM2A 1NBVL 1CFTB 3SDDC 4F58L 3QI9B 1S7QA 1XCTA 2PYED 3QUMA 4PJDE 1CLZH 3GHEL 5KSVA 3QFDA 2VXVL 2A83A 5KSAC 4YDJA 4P2RB 4FQIH 3T3ME 4BSVA 4PJHB 4WNQB 5ISZB 1A14H 4TN9A 1BREA 5FIEA 4NQCB 3TZVD 2VIRA 5I71C 1QBMH 1YECH 4M4RA 4NKIH 1FLTX 3QDJA 4I48A 5F1IB 2HKHL 2NX5B 4J8RB 3L3JB 2VDLH 4JM4H 4PJFA 4OV6F 1KSRA 2JELL 3L9RA 3UBXI 1G7MA 3QXDB 3IDMB 5ESQA 1S7WA 1EFQA 3X3GH 3Q2CA 1VEOA 5EBMB 4NRXB 3UDWA 2HT3C 3WBDA 3OKKA 1KYOJ 1P1ZB 3HE6D 5IHBA 1J8HA 1IAIL 5CP7A 3GHBH 5AD0A 1YPZF 1XZ0A 4JFDE 3TFKC 5BVJA 1RZKH 4KK6D 2WBJA 2Y5EA 3RX7A 5AYUL 1MPAH 3SKUD 3U4BH 3RVVC 3ULUH 4JR9L 3CXDH 4XWGL 1LO3H 5B8CC 2MQCA 1FVCA 3ECBB 5LBSL 2NY0C 4JFXB 4ZPVB 3O8XB 1F58L 3RDTD 4PREB 4KMTH 1WBXA 5IGXH 4WU5A 3RAJH 3FFCB 1IAKB 1I3GL 1TQCC 4TPRH 4Q9RL 3QWRD 1ORQA 5E94B 1WV7T 2E9JA 2J8UE 3TGXA 3BPOC 4AIZA 1NLDL 2V6HA 5DZLA 5F9WB 1GZQB 2Y23A 4LNRB 2XRAL 3CH8A 1FL5A 2BK8A 5J11B 1BOGB 4NNXA 5IBUB 1OAUL 4X6DB 3CVHA 3GJFB 4XB8A 1WBZA 1QR1B 3GI8H 5DDHB 2BC4B 1F2XK 2IAMD 4PRHA 5MEQA 3HB3D 3ZDYF 3LEYL 3IDNA 3ZKXB 3HPJB 1JE6A 2EO9A 1RHFA 2W60B 5F9DC 3QEQE 4PJAF 3P4MA 3WEXB 3MRBA 1UZ6E 2EO1A 4IS6B 4H88L 4QY8B 1V7MH 3RWIA 4HUWB 4PD4K 3J7HA 5BS0D 3TESA 1NMCC 1GAFH 2OYPA 2VKWA 1VFBA 5I73C 1WZ1L 2D2OA 3P3YA 1DSFH 3CFKB 3HNVH 5I1KL 4U1SA 4RMUA 2FR4B 4QNPE 3TV3L 4YHNA 4YDIH 4PJ9C 3T4AB 2FX9H 1A6AA 4XP1L 5L2KD 5ENWA 3WFCH 1XR9B 12E8L 2AXJA 2E27L 1A1MB 2WWMD 4Y0GA 2QEJA 4XC3L 2YXMA 3UO1H 5HYJA 2NY3D 3HZKA 1J0ZA 2X5PA 2VRAA 2R0WH 5FK9A 2JJSA 1F8TL 2ORBL 3QIBC 4WI8A 1WZKA 3NCCB 5I1EH 3KDMA 4UNTA 2YD6A 3QQ4A 4ETQB 4U7SA 3UAJC 1EHLH 2OTUA 2QBWA 2Y7QA 3G5VA 3AS3A 1LP9B 4PLJC 4IOIA 3GFUA 1C5BH 3WL9A 4LP5A 3ZLQC 3JWOL 4FQQB 2EE9A 4UT7H 3V0WH 5B4MD 2VZTA 1KXVC 1XF5B 1N4XH 3GI9L 4WU7B 4OGAD 4GKOA 4BA8A 4KV5F 3VE0B 1T6WA 1G6RA 5ILTL 4PJ5A 5ID0A 3FQWA 2ZJSL 3KPNA 4GRWB 2V5YA 5IQ9A 3SDDD 3VFPB 4NFDA 1LK2B 1KCRL 5KBNC 4UV4L 4KQ3H 4ZFOB 2IQAA 5IT2H 1U3HC 4K7PH 4XMPH 5KSAD 4OLUH 1NFIB 4AG4H 3KYMB 2IFFH 3C9NA 5CSGA 4WDIB 1J0YA 5DJ8A 4ZYKB 3ZKND 5ITBL 4R4BB 1FRGH 2FEEI 2EKJA 1A3RL 5GRXG 4M43H 3ARUA 4JZNA 3CU1A 4F37F 3QIWA 3PV6B 1PJ9A 3MLVH 1LNUA 3TJEL 3CMGA 5DURB 3T0DA 1JK8A 2HT3D 2XN9E 4Y5XB 4ZFZB 1TMCB 4RWYH 4JFFD 1FNFA 4LDOB 1MFBL 5ADOH 2Q3ZA 4PJIB 1WZLA 4MD0B 3TFKD 1F11A 1N6VA 4HGWB 4CW1A 1BVLB 4D0DB 4G42B 1DL7L 1ROWA 3ILQC 4X6FA 5TE6H 2CDGA 4PRBB 3RVVD 1F4AA 3KPOB 1K3IA 3EZ8A 4FS0A 1Q1JH 5D7IA 2L7UA 3DV6B 3QFJA 4PGEA 4JFEB 1DLHB 4G8GB 3O4LB 3IJSB 3VFVA 4ONGH 4NQDD 5L7XL 2NY0D 4CU7A 1PG7L 2X9WA 5E2TH 5FYLL 4JRXB 5FUCC 4JDVA 5FGSA 1A9BB 3VD7A 4NQXB 2ZWLT 3V5DB 3S35L 2AEIT 3PABB 1FZKB 4HWEL 4OM1H 2DQGL 2AJ3A 4WWID 5MP6H 2FECI 5F7HA 1PDKA 4JFZH 3MYZA 4LSSH 3CLEL 5GPRA 4P2RE 3GMMB 1CD1A 3CZJA 2MCPH 1G7HB 4PJHE 1QHOA 1CQKA 4P49A 4FQLL 3BZEB 4IDJH 4F9LC 1JFQH 2NCMA 5CJXC 2ZSWA 5E00B 2M2DA 5D8JH 1DBKL 5CMAB 3T0ED 1GSMA 1XF3B 3S34L 1JWMB 4LRIC 3KNBB 5T1LA 25C8H 3Q6GH 3KPRD 3FOMB 3LDBC 5INCB 5JW4N 5T3XD 3HCVA 2NY2C 4FQHA 1UWGH 1NGXA 2ZG3A 4KKCC 2DI8A 5CIPB 5F93C 2EE3A 2YZ1A 3SE9H 2OZ4L 1FG2A 3PHOB 4M7ZC 4MWFA 2LVCA 4JZJB 1LEKA 4RFNB 5KG9B 5FYKD 3X11A 3I6GA 4R0LA 2AEWA 3D0VB 5DJCA 2CR3A 4M5YL 1NMAH 5HHVL 3C6LA 4L3CA 4PBWD 3L3KA 2D4FA 5MENA 4PJ9D 4WEBH 3O3EA 3VFTB 2FEEL 1VADB 4M5ZH 1NCUA 5HYSG 4XPBH 3A6BL 2DQFB 5CCKL 2XYCA 2CDFA 3ES6A 1IQDB 5HI3C 4MA1B 4JEGB 4H8WH 4F7EB 2B4CH 3CFCH 2D7NA 4JG0L 3V9FA 3N1FC 1T3FB 4P4KA 5J1SC 4JVWA 4PUBL 1P7QB 1WIPA 3UAJD 5FGRA 1CVSC 4D0BA 3NVQA 1JPFB 5M94B 5DUBB 1AY1H 3T8XA 1S9YA 3WO4B 4ELMA 1BF8A 3OHXB 1AC0A 2EH8L 4X6DE 5FOJA 4DUXA 2K3TA 4HS3A 4IDLA 1MHPH 3DXAD 1NJ9A 4DTGH 4MB5A 4J3WA 4N0UA 1P9MC 2NY4C 4NO0B 3WFDL 1LO0H 5TF1L 2DQTH 4EXPX 5MERA 5LWYL 3LEVH 3IU3B 4S1SH 1S9WA 1DQDH 5C0RH 5JQ6H 1ZKAA 2XQYK 3X13A 5ESAA 1U3HD 1RFDH 4WI6A 3U6RB 4NQEB 1FFQA 3BO8B 1W0VA 5AEAA 2FECL 1X5LA 2MFNA 3QJFB 1ZT1B 5DK2A 2ZOLA 3TNNB 3OWEA 2L0DA 4WI5A 4MAUH 4GH7B 2LE9A 2FEDC 3V6OC 1U8PB 3BGMA 4PRAB 1NCTA 5HHOA 2QL1A 1KJ2A 2AXFB 2XKNA 3G08A 2OXHA 3E6HB 1AP2B 1TJGH 3W82A 1KPRA 1RUKH 1RIVL 1ZHNB 2HG5B 3HI6L 5C09B 5H37H 1U93A 3PGCA 4XBEH 4LIQE 4TVPE 1MFDH 1ETZA 3TWCL 3GMLA 2AI0L 5DA4A 3ARGC 2VOTA 4M7LL 3ILQD 3UCRA 4AM0A 1FIGL 5DS8B 1MI5E 3RWJB 4L29B 1BQSA 4LFHG 1CXLA 5E8EB 4LBEA 1LP9E 4N8VG 4GMSH 5D4QA 4WCYH 1BZQK 1R24B 4U1MB 5F7MC 4DEPC 4GXUN 2OX5A 5F21B 3DV4A 4PR5B 1RY7B 2J6EL 2YR3A 2DQHL 4YQXH 3U0TA 1FO0A 3P77B 2MNUA 4Q6IA 4UZGA 1GVIA 2A1WH 3L3DA 3HLAA 3STLA 1YN6A 5TE4H 1H5BA 3QHTC 1FZJA 2BNQD 3PWVA 1PKOA 2QHRL 5CEZE 1YEGL 5IB4B 2BNRD 2AABH 4XZUA 1IGML 1KBGH 2B1HL 1WVZA 3DURA 3MGTA 3NAAH 1TCRB 1T66D 4I4WA 4LRNL 3K2UH 4Z76B 2IALA 4ZS6C 2NNAB 4WUUE 1G7QA 3MUGB 4QRSA 5C0IB 4CADB 5IW1B 1OARL 4KPHH 1YY8A 1A7PH 3HRZA 5DJ0A 1MCEA 3TVMC 1LDPH 1BVKA 3H8NA 2X4UB 1TTGA 3VRJB 2F8OA 4OQTA 5IMMA 3GO1L 4HFUH 4KKCD 2E7CA 3VGEA 5FA4A 4KY1L 4R97B 2ZZUT 4LLQB 4PJIE 3V8CA 2VQ1A 2QQNL 5GQBA 3HMWL 3ZE2F 4C4KO 3QZWG 2HLFC 3GJFH 3LEXB 2X4OA 2GFBB 1A4KA 3VH8B 3TO4B 4IRJA 1JUFB 5D5MF 1NCDL 3ARWA 3RIFF 1BIIA 2DM3A 3LV3A 5F3HA 4CMMA 3L95A 1WCQA 5CD3B 4OZIA 4OJFH 4FABL 5ANMA 5EUOA 1YJDH 2F53B 4R4FL 1RVFH 4OZGA 5D7IF 2ATKA 3FB8B 4HIHA 4U1GC 5JW5B 1GPOH 4W6YB 3O6ML 3WFZA 1TFHA 5HI3D 4I8DA 2BVEA 2VE6A 2Y06L 5J12B 3BOVA 1HIMH 3OPZL 4KI5D 1J0KA 1CGSH 1OP5H 3EYVA 2KL6A 1KXTB 2X42A 4QCIB 3SDCB 3IJHB 3BXNA 3D0LA 2O5YL 4P0DA 5HJ3B 4X6CA 3DJ9A 4M6AA 1M7IB 3UTZB 1FJ1B 3QEGH 5CINL 4UT6H 4M62L 4MA8H 4MHHI 3DVNA 2DL2A 2DTSA 1EUUA 1B4RA 5FGCB 3D39D 3UJTH 1B6UA 3MC0A 4JY4B 4ODWB 2DIJA 2NY4D 2JK5A 2I5YH 4Y4FC 4TVPH 2P8LA 3KXFB 3NCEB 4LPYA 4DGVL 3VMPA 2OL3B 3CU7A 1GL4B 1UQSA 5DEFB 1QR4A 5FYJE 3RA7H 4XAKE 1XGTB 3IAPA 2DQJL 2FEDD 3IJYB 2NXYD 4WHCA 3C8HA 3VW3L 2P5WA 4PJ8B 1YEIH 3L3HA 1TVHA 3H9YA 4PRPD 3FTGB 3ZKQD 3U82B 4LMQE 3ZL4H 4I0PD 4JFYB 4EUPH 1UCBH 4GRWH 1RZIB 4B5EA 1J87A 3CFJA 3TYFA 4G7YL 2VH5H 5IVXA 5CEZH 4HH8A 5C08E 4EI5C 2FJFA 5DUPH 3I50L 3AMKA 3P9MB 1KB9J 4Q74A 3W39A 3QG7H 3OJ2C 1K5NB 1NAMB 4G6KL 3NFSH 3ESVF 2H32B 1LEGA 1ADQL 1BBJA 3O9WB 4I77L 1JGLL 2OSLB 1VGEH 1BGXH 3NA4A 3ROOB 4U49A 3VXTA 3CDGA 1UXWA 4APQC 1RZ8B 2UV3A 1K2DA 1OGAB 1QLFB 1CDUA 1ZE3C 3LY6A 3OKEB 5DD6A 1MEXL 3QZWA 5I1CH 3KGRA 3VFMB 1Q9KA 4JPVL 5DJYB 4L3AA 3AAZB 2E9BA 2WBJD 2G60H 5H2BA 3LKSB 1MAML 1R3KA 1RQ5A 4JHWL 5FGBC 1BQHG 1TZGL 1KTLA 4M7KL 1IFHH 3KJ4B 5EU5A 1DVFA 4PJBA 4ZS6D 3QJHB 4UT9H 2QQLH 4WTZG 2VLKD 3EUUA 3OAYK 2YD8A 1VENA 3TVMD 4QXUH 3RY6C 2Y72A 2H8PA 4YHYB 1CL7H 3NCYS 3PJSB 1CLYL 1T2JA 1YN7B 2P46B 4I18B 4MZ3A 4R8WH 4YWGH 4P23A 2W9EH 3T2QA 4RA3A 1QFWI 3GSRA 2UY7A 1D6VH 5EPMA 4QHMA 4XNZC 2H6PB 3BIKB 2IPTL 5DXWA 5C09E 3MCKA 3MRPB 5I19L 4XPGL 4L4TE 1FFOB 2BVPA 5DD3L 1YQVL 5E2WL 2Q7NA 3N1QC 1NDGB 2PW2A 2HLFD 2XZAH 1WITA 5SV3A 3V52L 3PGFH 4HK3J 1B6DA 3WNNA 4NJ9L 3GNMH 3LS4L 2XG5A 5EBLB 1MFEL 1IEHA 5GZNC 3VD4A 3VDCA 4RZCB 4ISVA 3VRLE 4NYLA 1WBYA 3PDDA 3BP7B 2DLFL 4L9DA 4PP2A 1DANU 3RY5A 5CIPH 1U36A 4EDXB 2GUOA 3VXNB 4Z8FH 5T3XL 2H2SC 3U0PB 5FYJH 4XXCA 1RAMA 5M7QA 3QQ3B 4J6RL 5DD5H 1XR8B 1I9JH 4UAOC 3AMLA 5C3TA 3IGAB 2R29H 1FNLA 3SHSA 1GXEA 4N0YL 1CFSB 5HGGS 2LU7A 1FPTL 4Y16B 3IFOB 2Z92B 1ZS8B 1M05B 4Y4KA 4NZUH 4PJDA 5CD5C 1AKJD 3EHBC 3N85H 4HLZH 5E2JA 4B0MM 3L7FB 3FB6B 4JE4B 1D5MA 4Y4FD 1F4WL 1JN6A 1FFRA 3I6KA 3P4NB 2IBGA 1AQKL 1CLCA 2VTFA 3ARFB 2O93L 4GBXC 2OR8A 1UM4L 1CICB 3OX8A 1I3UA 1RD6A 3SE3C 2CUMA 1I75A 2YUZA 4MX7B 1CZ8H 3GSNL 3P9LA 1YNTA 3KPLB 1EFXA 5TH2B 1R6VA 4G7VH 3P0VL 3DX8A 2FJHA 3TBTB 3VFOB 4BYHA 1MLBB 3BIBX 3U0WL 1IKFL 3V4PL 1BQHA 1VCAA 3MBEB 4JFDA 1A1OB 3U4EB 2WLZA 3AS1A 3KPSB 2X6MA 1CE1H 3ZE1F 1F6FB 5JLZB 3QRGL 1KIRA 5JPMA 4WTZA 2ED9A 5DD1L 4GT7A 1QFWL 3HUJB 1Y0LA 4OZIF 1FZMB 3QXWA 5D1ZC 4EI5D 4KRPC 4OAWB 4OZGF 2VDPL 3UTSB 4JLRA 4G8FB 3K46A 5C0EA 1ED3A 5A16B 5D2LA 1XIWB 4IBLT 1VA9A 4X6EB 4LLWB 1J1PL 1HCFX 2AW2A 1SY6H 4FZEH 1HKLL 1UVQB 3ORJA 1BBDH 2J8UA 2VDRL 3OXRA 5DMKB 4APQD 3TT1L 4OFKA 5FGCE 2GY5A 2E7BA 2V7NA 2R69H 2PTVA 1DUYA 4X6CF 4F7PA 4W4NA 2BY1A 5C86A 5DT1L 5K59F 3RWHB 3AS0A 5D6CA 1AHWA 4H5SB 3ARDB 3WNLA 5IWLC 1DLFL 1NGWB 1KF9B 3RVXD 1EUTA 4UBDC 3QFJD 1IGJA 1EZVY 2W65A 1IGIH 4ZUVB 2C3WA 1GC1H 2C4FT 1XF2A 3B3IB 1UM6H 3W11C 3QEQA 1X3DA 3SGKC 2ZSVA 4XXDA 2Q8BH 2QLVB 4U1IA 2V2TA 3OKLA 4JM2A 5CWSA 3MBXL 1WGOA 1WT5A 5L0QB 1I4FA 2I07B 1OF2B 1A21A 2BSSA 3S5LG 5D2NC 1JHLL 1ZHKA 5C71A 1HYRC 1MIEL 3LPWA 4Y2DC 2X41A 5CP3H 3VXUE 1U8HA 5JORB 1I8KB 3MV8B 2P8PB 2VDKH 3NA9H 5I1IH 5J7CC 3H9HA 3DMMA 3LKOB 3U46A 5D70H 3BH8A 5MEPB 4PV9A 2AQ3A 3JV4A 4MNGB 5I1GH 3NZHL 1F02I 1DUZA 1OGAE 2ZCKH 4W4OA 5I1DA 2O5ZH 2CD0A 4YK4C 1XGRB 3DVGA 2DLTA 3FCTA 1ITCA 2HFFB 2I9TA 3K7UA 4JG1H 1E28A 3AU1A 3UTPE 4G6FD 3AVEA 4ZD3L 1KEGH 1J0JA 1T03L 4MJ5A 2H2SD 1PFCA 3QNXB 1NBYA 5GS2H 3ULVE 3RWGB 5GGRA 3QUYB 3NIGE 1PZ5B 1T2QL 1OAXL 4HXAL 1HH9B 5BZDB 5I8OL 2UZYB 3L3GA 4E42B 2F5BH 1IGFL 1K8DA 4MDJA 5J6GB 4HS6A 2W0FB 4PTTA 5A3IC 2M26A 2VXUH 2GTZB 5CD5D 1YEKL 4PJBF 3TF7C 3TBWB 4LAJH 1J88A 2XNAB 3GK8L 3HTLX 5H35A 5B38A 1AO7D 3H3PL 2X4QB 1A7NL 1UWXH 4RNRB 2VDQL 3MXWH 1KNOA 5EA0H 4MJIE 3QXAA 4GBXD 3BE1L 1FYTA 2HRPL 4XP6H 5DVLA 1XGQA 3FOLA 4BSJA 3V0VA 1SBBA 4NUGH 3UJIH 4DVBA 1J9CT 3GMQB 1JNHB 4IMKA 2XN9A 3WS6A 4ELKA 4K2UL 3UYOD 4ZSOB