2XQYG

Crystal structure of pseudorabies core fragment of glycoprotein h in complex with fab d6.3
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
216
Chain Sequence
QVQLQQPGAELVKPGASVKMSCKASGYSFTSYWMNWVKQRPGRGLEWIGRIDPSDNETHYNQDFKDKVTLTVDKSSSTVYIQLSSLTSEDSAVYYCGRLGYVYGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN H
publication title Structure of a Core Fragment of Glycoprotein H from Pseudorabies Virus in Complex with Antibody.
pubmed doi rcsb
source organism Suid herpesvirus
molecule tags Immune system/viral protein
total genus 41
structure length 216
sequence length 218
chains with identical sequence J
ec nomenclature
pdb deposition date 2010-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqyG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqyG02
5TPWL 3GK8L 4PJ5A 5I2IB 2IBZY 3MV7E 1AIFA 3VXNA 4BUHA 5BCAA 3ARTA 4ODWA 1XZ0A 4A6YA 4X5XB 4MX7A 2FEDD 3G6JE 1F3RB 5E95B 5IG7B 5C0GA 5I8KH 1LO4L 1P84K 4NGHL 4IJ3B 5ICXB 1A9BA 3WO4C 1A6VH 1BFTA 1T1ZB 2ZG2A 2BSSB 3ZDZE 5FKPA 2XFXB 3U0PA 1S7SA 2DLTA 5GRJH 3GHBH 1R3HB 3OKLB 2I9LA 5IK3A 3V0VA 4RCAA 2P5WB 1ADQL 1D5ZA 3NCEB 1A7PL 4NQVB 3WXVL 5DD5H 2VL4A 3VG0L 3RWEB 4LP5A 4PPTA 3CDCA 4MNQA 1F58L 3O11B 1ZEAL 4PP1C 1T89A 4JVUA 1P53A 3IU3B 5F9OH 2CK0H 1YEJL 4R0LA 5SWZA 3JWDL 4U3HA 1PG7H 3BQUA 4JY5L 4LVHB 5F88A 3ZDYE 2BRQA 2FJHA 4PRAA 1OLZA 3LPFA 4HIEA 1RZKC 4RMSA 3X3GL 1CGSL 2VC2H 5EC1B 4OJFH 2VLLA 2B1HL 3CZFA 3HNVH 4KKCC 3SGJA 4MQ7B 3WFCH 4U7KA 3VG9C 1EMTH 1X9QA 3ARDD 3HMXL 2F53E 4NO0B 5DJZB 3SEPA 4HC1L 4C54A 3HUJE 3MUJA 3WLBA 4NJ9L 3P9LB 1CLOL 2W91A 4MXQC 3SJVD 3S96A 4JO4L 3QNZA 4UU9B 2N7AA 3EZ8A 1JHTB 1YEEL 5JDSA 3X17A 1H9VA 3HPJA 4IDJH 1YECH 5HTSA 1JGUH 3O6FB 1T2XA 4OV6F 1K5NB 4GAJH 1OY3B 4GKZA 3PHOA 3ROOB 3ZT5A 1RJZB 3HRPA 3O3DB 1QRND 3MACH 4KROB 5HHME 2XPGA 3FQXA 1T5XA 4GUPB 3TO2B 5E08H 4MA3B 1MHEB 5AZEL 2R1YA 5FUOL 3Q5TA 4JJ5B 5MEND 1P4IH 3FFDA 2YPLE 3S36X 4D0CB 1P7KB 4PGBA 3LRGA 5B4MC 1IGJB 5FA3A 2YS4A 4AH2B 5K9KB 1DBJH 1G0DA 1FC1A 3S34H 4G6MH 4LLAA 1JGDB 3DVGA 5I1LB 1ZHNB 2EDLA 1TQCC 2D2OA 4P2RB 1CU4L 4LDEB 4GAFB 1NGXA 3UPRB 3RNKA 2CO7B 5HI3D 2OZ4L 4EOWH 4LEXL 4HFWA 4PV8B 4JKKA 5D9SB 5IVNA 4XPFL 3S3PA 3ARGA 2YRLA 3MOAL 5IHZB 4RMVA 1WGOA 5LGJA 4WUUB 5DMIL 3U30C 3TN0B 1X5IA 1KB5A 2VDNL 4H20H 5DMYA 4DVRL 4JG1L 4L3CA 1IILE 4LGSB 3WKMH 1NCCL 1U8MA 3B5HA 3WD5L 1KBGH 4PD4K 3SE4A 1ZLSH 4LCIH 4BA8A 4GMSL 1HIMH 4QEGA 3QWRD 4I18B 4XMPL 4GG6B 4NN6B 3LKPB 4G80A 1FC2D 3RWDA 3P73A 1EBAA 2Q3AA 3LS4L 3MRIA 3SKUD 4KTDH 1BBDH 4N0CC 4TQEL 2EDYA 3D48R 4N5ED 3QDJA 2OXGA 2X1QA 4M43H 1JRHL 3PHQA 3QRGH 4PJ5B 1UM6H 1QG3A 3GRWA 1JPGA 1AIFB 3VXNB 4ERSH 4ODWB 5FB8A 5T1DL 1XZ0B 3G5YA 5A3IC 4A6YB 5EPMA 2YWZA 3GJFH 4MX7B 4KXZI 5C0GB 3R8BB 2DS4A 1WIUA 1A9BB 1U93A 1WUNT 5FKPB 3JTSA 1OARL 1FVCA 1S7SB 5FAAA 4PLKC 1WZKA 3ARQA 3U0PB 2I9LB 5IK3B 3V0VB 2Z35A 1D5ZB 3JTTA 5T1LD 1RULH 5H37G 2EH8H 2CDGA 4MNQB 5C0BE 4WY7H 1BF2A 3C8KA 4M48H 4A6YL 4Z7WA 3STZA 3W2DL 2X5PA 1ND0A 4MJ4A 4LSRH 4PJIE 1S8DA 1MAKA 2ILLA 5JHDE 3GUTA 3QDMA 5CINL 4D9QD 1KJ2H 4R0LB 5SWZB 1NFIA 3BQUB 3S97C 2FHBA 5HI4C 5F88B 4RISL 5CJQL 3T3MF 2FJHB 4PRAB 1V7ML 4HIEB 2YWYA 5DJXA 1FORL 3MRHA 1UQSA 5DVKA 4AMKH 4OLYL 2VLLB 2WP3O 3CZFB 5DJ8A 2ZKHL 4JRXA 2YA0A 2NXYC 1ETZA 1I7ZA 5GJTH 4CU8A 3CX5K 1S9VA 5GRVL 4QHLA 4MJ2A 5GGSA 3MRGA 3SKJL 3WLBB 3E2HC 1NUGA 3S96B 3QNZB 1I3RA 1OP5H 1GYAA 3RWHA 1DFBL 3LV3A 5DURD 2RHEA 4Q9RH 5JDSB 4M5ZH 2X9WA 1SYSA 4N0UA 4WU7A 5BRZE 3HPJB 2PW1A 1DN2A 3RNQA 3LIZH 5CJOL 4GKZB 4Z95H 1MFEL 3PHOB 1JI1A 4FNLH 4RA3A 2FGWH 1N0LA 5GS2D 1MFCL 5IFJA 2XPGB 3FQXB 4N8VG 1T5XB 1J5OH 1SY6H 1G9ML 4XI5C 1U3ZA 5E99L 4NKQB 4OFIA 2R1YB 5F71A 4U0QB 3TJEL 5BS0E 1KN4L 3FFDB 4K7PY 1MJ8H 1OAXH 1P9MC 1QNZL 1XGYL 3N0PB 4PGBB 1LEGA 4KJWC 3MZTA 5FA3B 3EO1A 5JMRA 1NCDL 2A6KA 4NQDA 1JNJA 2VN4A 2VR9A 1F97A 3DVGB 3KPQA 3NPSB 4YNYA 5LKNA 2J8OA 4DKDC 2PTUA 2MQ0A 2XY2A 4P5KA 1NGXB 4PTUA 3VI3F 4LASL 3RNKB 4TNVK 5D7SL 4C55A 3W5NA 5IMLA 3AY4C 4HFWB 3ARGB 2IWGA 2VABA 3HMWL 2DQJH 4NJAH 5C07E 1AQDA 1ZOXA 5JHLH 5LGJB 4WUKH 2MMXA 2VB5A 2X4QA 2E8ZA 1KB5B 1AY1L 1J0YA 2E27H 3CH8A 4ORZC 4UV7L 2R2CA 3U46A 2Y07H 3RKDD 2W07A 4L3CB 4AEEA 2IPTL 1U8MB 4GXVH 4WNQA 3FTGA 2R2BA 3IDYC 1K3ZA 1D9KD 1FGVL 4HWUA 3FHQA 5CD3A 3NAAL 3ESUF 1TCRA 3IXAA 4XBGA 4PJ8C 1OTUC 2J12B 4G80B 5F6HI 3L3GA 1CBVL 5DD3H 3RWDB 2CLVA 3MCKA 3P73B 3MV11 3MRIB 4M8QA 1CGUA 1BQHA 2GTZA 5FK9A 3MOQA 1KB5L 3D2UD 4CMMA 3S37L 3P0GB 3QDJB 3D85D 3WO4B 3WBDA 2R69H 3LZFL 4WHTA 4YEEA 3PHQB 1KCUL 1BLNA 3OKOA 5LQBH 1JPGB 3TBSA 5EUOA 4JPVL 3WJLC 5FB8B 3G5YB 5IHBA 5D7KE 2GJZA 5EPMB 5AZ2H 4F57H 4QRPE 3FN0H 5ANME 5I19H 4CMHC 3UJTL 2HT4D 1U93B 2PO6C 4ELME 3JTSB 1FVCB 4XC3H 4QOKD 3RX8A 2BC4A 2DL2A 4XXDA 1FFOA 1JHLL 2Z35B 3JTTB 1EX0A 4OLVL 3GRWL 2J8UF 2X9YA 2OJEA 2PXYC 3IFNL 2CDGB 2VO5A 2R0KL 2XACC 3C8KB 4X6BA 4P3CH 4Z7WB 3STZB 5E1AA 1DJSA 1ND0B 5ALBH 3HNTH 3VG9B 1S8DB 4JFHE 3GUTB 3QDMB 3O0RH 2QQNL 4UBDC 3WSQH 1NFIB 1FFQA 3MX0A 1F4AA 5I1JH 4FFVD 5I18L 1UXSB 4PJDA 5DJXB 3MRHB 1EERB 1UQSB 2PYEA 1II4E 3VD4A 1RAMA 2H2SD 3EHBC 5DJ8B 2JJUA 3KG5A 1RZKL 1KIUA 4QRRE 4JRXB 2BSTA 1LNUA 4GAYA 1ETZB 1I7ZB 4UINH 1S9VB 4QHLB 2JB6A 3DO7A 1W8NA 1HCFX 4EQ3A 4MVBC 5GGSB 3MRGB 3AROA 5LGHL 5AG8A 1MFAH 2A77L 5FYLE 5BV7H 1A7NL 4HJJL 4UTBL 1I3RB 3RWHB 1H3VA 3LV3B 4HJ0C 1MF2H 4A2MA 3EYQD 1SYSB 4N0UB 3GIZH 4WU7B 1T80A 1MWAA 3ZT7A 4CJ1A 2AJVH 5F1OB 4AIXA 4HG4J 2XG5A 5I73C 2PW1B 3RNQB 4JPKL 2WLYA 2Q3ZA 1P9MA 2VDMH 3LQAL 5IFJB 3SO5A 4X5LA 5FHAH 2YUVA 3N85L 2FD6L 1T2JA 1R3KA 4XCFH 3X11A 4LGRB 3QO1A 1PD6A 1TQCB 4X6DF 3NFPA 1S9XA 3U4BL 2HLFC 5LWYH 1LEGB 3AY4A 3EO1B 1JGLL 2A6KB 4NQDB 1MELA 3FQUA 4R8WH 5C71A 4GXUM 3KPQB 5E8NA 3LQZA 4XNXL 4YNYB 3U30B 2K7QA 4P5KB 3W9DA 1D3CA 4PTUB 3G5XA 1FYTA 3E0GA 2GTWA 4K3DL 3ULUH 4L8CA 4W6XB 1Q0YL 1P69B 2E6PA 5IMLB 4OKVA 2R9HD 3OZ9L 4F3FA 1NGPH 3C09C 2VABB 3VI4F 1AQDB 1WICA 4PJ8A 3RWGA 2C3VA 2NYYD 4L5FH 2DM3A 2X4QB 2ZCLH 3U46B 3OKDA 3RVVD 4NQTA 3BDBA 4FXGA 3FTGB 4QXTA 2R2BB 2XZQL 4QRUA 3I9GL 5CD3B 1OVZA 1TCRB 3IXAB 1VPOL 4P49A 4XBGB 4NFBA 2E9IA 3IT8D 5T3XL 3WJLA 3L3GB 5ADOL 3ARUA 1R5IA 2CLVB 3MCKB 4KY1H 3I6LE 2B7DT 1RJYA 3GIVA 2MQCA 4M8QB 1BQHB 2GTZB 5FK9B 3TO4D 5FDYA 4PLJC 2ZJSH 4CMMB 4CVUA 1M7DA 4KK8C 2DLFL 4WHTB 2PO6A 3WFBL 3OKOB 1MI5A 3VDBA 1DBBH 3OGOE 3TBSB 2DBLH 5EUOB 2ED7A 1JZ2A 4KRLB 4ALAH 4J3OC 2GJZB 2P8PA 2PXYA 1OGTA 3AXLA 4K8RC 4NN5C 5JA8B 5DYOA 3CXDL 5LG1A 4YK4C 4DGYL 1EHLL 5DO2D 5FOJA 3BYYA 1ORQA 1OHQA 2BC4B 4XXDB 4OKDA 1FFOB 1QP1A 3EOTL 5D1ZC 3JV0A 1OQOA 4Z7NE 5KSBE 1C16A 3EYOA 2OJEB 3G9VA 5FV2A 4PJEE 3VGFA 3WFZA 4P9HH 5DUPH 3KPRD 5E1AB 4BZ1L 1SBSL 3ETBF 2NXYB 5FKAA 2CRZA 1UKQA 2ZG3A 4QRSA 4TNWF 3PQYA 3OJMB 4ZPVA 4JQVC 4ZOCA 4DUWA 4PJDB 2OQJA 2PYEB 3QT2A 5SX4I 5KS9F 3E2HB 3IRPX 5IGXL 5SWSE 4QKXB 3OB0H 4TUJA 1T03H 1P2CA 2GEEA 1H3WM 1LNUB 2BSTB 4GAYB 3OR7A 3RBSA 4R90H 1MRFH 5ILTL 4R26L 1UADC 2JB6B 3DO7B 4OLZL 5D1XD 1IM3A 2W92A 3VXUD 4S10A 3OGCA 4JHBA 4JR9H 5IFAL 3KVQA 2HP4A 1DE4A 3LEXA 4HLJA 3K80A 3RTQC 4HPOL 3W9EA 2YPKA 3VGGA 3GJFA 2KQNA 4IBLT 4IRSD 5I1GL 5CS7A 5EA0H 5JW4N 3RGVD 1TZGH 1MWAB 4RQQA 4Z8FL 1RZ7H 2M8XA 4JFFD 1CDCA 4YLQT 3ZKSD 4Y5XC 3MNVA 15C8L 1QSED 2A1WL 4P4KC 5HYQA 5GGVH 3MR9A 3L1OH 3HHRB 1R3KB 4ZQKA 4JFDA 5GS1C 3X11B 3QO1B 2Y72A 3UX9B 2FO1A 3NFPB 5I8KL 1S9XB 2V5YA 1MWAL 2W1NA 5F1NA 3S4SG 3SE8H 1UVQA 1NH6A 1A6VL 1BD2D 4CRPA 3GMNA 4PJGF 2OMNA 1WF5A 2B39A 5L7XL 3GHBL 5CGYC 1QFUH 3FQUB 2ZSWA 5E8NB 1YJDC 3LQZB 3HAEG 5DD5L 5L2JA 4GRLD 2PYFA 4JFEA 5C0CA 3FB5A 1MSPA 3W9DB 2E9JA 3G5XB 1FYTB 2GTWB 4L8CB 3G6AA 4OKVB 3IDYB 5F9OL 4F3FB 4K3JH 1JN6A 1PG7L 1Y0LA 4HULB 4NRYA 2R15A 4PJ8B 5LCVH 3RWGB 2C3VB 4X9BA 1EDQA 1A2YA 5E56A 2HT3C 3HNVL 3OKDB 4PLOB 1RIHH 3LEYL 4OF8A 2HJLA 4FXGB 3WFCL 1EMTL 2DQCH 2OR8A 4QXTB 4OFDA 4QRUB 3FJTA 1U41A 2DI9A 4IOIA 3LH2H 1MAMH 5BV7C 4DZ8A 2VUYA 1SY6A 1R5IB 35C8L 3S3JA 1RJYB 3GIVB 2D7NA 5IFHH 3WNLA 1NMCC 2UUDH 4G3YL 2R0LH 2HKFH 1HK6A 1M7DB 1BP3B 4CMHB 1DBMH 2PO6B 4IDJL 5HGHA 1YECL 3B2VH 1MI5B 2B4CC 4PJBF 2Y9RT 4J3XA 5D1ZA 4GAJL 7CGTA 5I75C 1T4KA 1CL7H 3SDCD 3TNMA 2P8PB 2Y36L 1CE1H 1OSZA 2AABL 2PXYB 3HB3C 3MACL 1ZS8A 1OGTB 3AXLB 4BK5A 5DYOB 4F33A 1A7RH 1BM3L 3CDFA 5JTWA 3S98A 1R3IH 5E6ZA 4I8DA 5ENWA 1KXVC 1ORQB 3EDJA 1WFUA 1YMMD 4JQVA 3H7BA 1K85A 1TNNA 1IJ9A 2OR9H 3FB6A 1P4IL 5GGTA 1C16B 3EYOB 2ARJQ 1CVRA 4FA8A 1DTUA 3ZDXF 4OZHA 1EV2E 4YXKL 2CR3A 4DEPC 2HT2C 5FKAB 1Q9KA 4QRSB 3PQYB 4XNQA 4ZPVB 3WIFA 4UNUA 1QRNE 2NX5A 4ODTH 3F65A 3A6CH 4Y19E 2W38A 1KLUA 2OQJB 4HZLA 4EOWL 2FH6A 4EXKA 4LRIA 5GGSY 4G7YH 4WHYG 3GO1H 3RTQA 3SE9L 4TUJB 2Y06H 4JVPA 4XPHL 1P2CB 4X7CC 4EQ2A 1FNSH 1UT9A 3OR7B 5DD1H 2NW3A 3QPXH 3LEVH 3U83A 5CJBA 3BKYL 3QDHA 1IM3B 1HINH 1WQVT 1WTLA 5I73B 3U4AA 3OGCB 3O6LH 1NL0H 4Y5XA 5L8LB 4R4NC 1ZLSL 4Y2DC 1DQMH 1DE4B 2P44B 3LEXB 4LCIL 3REVA 5CEZE 4Z78A 4JVWA 3W9EB 6FABH 1HIML 2YPKB 4P4KA 4ONHA 1ZT7A 1XGRA 2EDHA 3GJFB 1OGAA 5GS1A 2F15A 2C26A 1XGTA 4RQQB 1IZJA 5E2VL 2NZIA 4KTDL 1T1YA 1BBDL 2VDPH 2DJSA 3MNVB 1R3LA 4O9HH 4PUBH 4M43L 3W11C 3QRGL 5HYQB 1UM6L 3V79C 4ERSL 3MR9B 3B8SA 4ZQKB 2J4WL 4JFDB 1IE5A 1S3KH 4OZGE 1EEQA 5F1NB 3OAUH 1UVQB 5L88H 3QXWA 2H8PA 4NQXA 1BGXH 2DDQH 3GMNB 3WUWA 3DETC 3C09B 4KVNH 4U6XA 1EZVX 3MFFA 2ZSWB 5LGKA 3CSBA 5L2JB 1JRHI 2PYFB 4JFEB 2EH8L 5C0CB 3FB5B 4WY7L 2ICWA 4M48L 1X5KA 2D03H 1DQQA 3BWAA 5D5MA 2V6HA 2YUZA 4IM8A 1TTFA 4PJHE 4PJ7F 3G6AB 4LSRL 3BPNC 2AW2A 1JN6B 2CUMA 3QCVH 1Y0LB 2BHZA 3I84A 4NRYB 1CGVA 4MAYC 1AGDA 1A2YB 5J12C 4AMKL 5IVXA 2ESVD 3OBAA 2DWDA 2HJLB 4JM4H 4R7DB 1EHNA 4IOIB 4PYHA 1FNGA 2C7UA 1BJ1J 3O3UN 4Q9QH 4KI5F 4DZ8B 2UYLA 2CGRH 1NFDF 4D9QE 2Q8BH 1EJ6A 3MLXH 2PN5A 4NN5B 4KI5D 4M5ZL 4YK4B 4ZUVA 5HGHB 1U3HC 4R96A 4UMGA 3D1MC 1PAMA 5BOZG 1KPVA 5D1ZB 3LIZL 1T4KB 4XWOC 4Z95L 5E5RB 3T2PA 4YDKH 1WAAF 3TNMB 4ZFFA 4U1SA 1OSZB 1ZS8B 1J5OL 1SY6L 3NPZB 1QR1A 4HT1L 4F33B 1ACZA 3WIIH 5ENWB 4K8RL 4RMTA 3UYPA 2DYPA 4XNMA 1KC5H 2YUWA 4HIIA 3H7BB 3ARRA 1FZMA 4HBQA 3FB6B 1I9JH 3S5LG 3GMOA 5JW3L 3MLWH 1OAXL 4JO1L 3MLUH 5HDOA 3FRPG 2XY1A 2OSLA 1UC6A 4YHMH 3Q3GB 4MNHA 4OZHB 5CSBA 1UWEH 4UTAH 1CQYA 3CD4A 3MA9H 3NCMA 2YPLA 3Q6GL 3SKNA 2X89A 3KHOA 4XNQB 3WIFB 2Q7NA 2NX5B 2VSDA 5C0ND 2LVEA 1PKQE 4NKIL 1KLUB 4HZLB 2YZ1A 3SGDH 4Y2DA 5C6TH 3V4PH 3RTQB 1RUQH 3FFCD 4LSDA 5HYSA 2DQJL 4NJAL 4PBVC 2YR3A 1NCBH 3ZL4H 2NW3B 2FIRT 1OWWA 2I07A 4FTVD 2E27L 3WS6C 4QWWD 1B0WA 2BXYA 4CN4A 4NBXB 1BBJA 2EE9A 5E70A 4GXVL 4Y5XB 4JE4B 3DARA 1YDPA 3REVB 1DQTA 4Z78B 1E4WH 4P4KB 4ONHB 1ZT7B 1XGRB 2YXFA 4G6AC 1OGAB 3PHSA 1F45A 3SDXE 5DD3L 5GS1B 1XGTB 1T1YB 4KMTH 5I1DA 2AS5M 3VI3E 4XP9H 1R3LB 5ECJE 2X6MA 3OV6A 1R6VA 32C2A 3BZDA 4TVPH 5LQBL 3V52H 5L8JB 4PG9A 1FE8H 2DKUA 3TF7C 4F57L 3VXSE 3FN0L 1DQJA 1QFHA 1Z9MA 1CLYH 2Q7YA 1YEKL 3STLA 5I19L 1EK3A 2EXWD 4HUMB 3CJJA 5DHXB 2H8PB 4NQXB 5EO9A 1CFNA 1W0WA 4Q6YA 4DN4H 3QPQC 5IW1A 4WW2C 5HI5C 3WUWB 1MOEA 1ZGLA 4O5LL 2XWBA 1G6VK 4U6XB 1FL6A 3MFFB 3MROA 2PW2A 3CVHH 1UA6H 4MAYA 3JWOC 5A2IH 1YZZA 4H25A 2ICWB 4BFGA 2EXYD 4M7LH 3RHWK 1DQQB 3BWAB 5D5MB 3WHXA 5ALBL 3DJ9A 2VNCA 3HNTL 3ZKQD 1N5AA 2QV2A 1GCFA 1VDGA 5C0BA 1SEQH 1I1YA 5BV7B 5I1JL 1J1PL 2LVCA 4XX1G 3VFRA 1HXMA 4GAGH 4NO0D 1AGDB 4PJIA 5JHDA 3BVNA 5IVXB 5DS8A 4UILL 1WFTA 1AH1A 4UQ2A 3GHEL 4I3SH 1NMCB 4QOKE 1GGCH 2DWDB 1ZLUK 5BVPH 2XXMB 4UINL 4YGVA 4XPAH 1FNGB 1U3HA 4YHOL 2YA1A 4CW1A 3UDWC 2UYLB 5TDPA 3B9KC 2X44D 5I75B 1C08A 4WFEE 4WEBL 1MFAL 5EOTA 5BV7L 3ZE1F 2J8UE 4RMRA 2QR0A 4FMKA 4F37K 4U6VH 1B88A 2OBGA 3HI5H 2YBRA 3GIZL 1GOFA 3T3PE 4ZUVB 4DOHE 4R96B 1MLCA 2AJVL 1FJ1A 3DX8A 3LAFA 1KPVB 3GKWL 1X5XA 3NABH 4YJZL 2B4CL 5BRZA 4APQC 4U1SB 4ZFFB 2VDML 1QR1B 5F70A 5C92A 1T22A 1AJ7H 1BIIA 4XCFL 3MJ7A 4DEPB 1IC4H 5T5FH 3HI6H 2DYPB 4XNMB 4HIIB 1FZMB 1JUFA 3GMOB 1DQLH 1OB1A 3D5OF 2XQBH 5LWYL 4P2RD 3BAEH 5JW5A 3BUTA 3MGOA 2OSLB 3IRZA 1QRKA 3DI3B 4MNHB 4C58B 3I2CH 1Z9SA 2YPLB 3SKNB 1EEYA 3WS6A 1LO0H 2XXCB 3WFEH 2LTQC 3SQOH 1CZ8H 4ZFOA 3IXTA 3S35H 1L6ZA 1LO3L 4WUUD 3UBXI 3UROR 3TN0D 4G5ZH 5I15H 1NPUA 4Y2DB 4GG6F 4QHKJ 3ULSA 1HYSC 5HYSB 1IC7L 3S88H 1KN2H 1KJMA 2YC1A 2ZUQC 4L5FL 4MA7H 3LB6D 2I07B 2ZCLL 4H0GA 4GKOA 3LVEA 2FLRT 4U31A 5J3HD 3O2WH 3P3YA 5JXED 1BBJB 4XBEH 4X6DE 3OAZK 2Z8SA 5DHVH 9CGTA 1L0QA 1YDPB 3D39A 3ALWA 2GKIA 4Y4FC 2IMNA 4CU6A 4JDTH 5ESVA 3VWKC 4MJIE 4U49A 4J6RH 4KAQH 4XVJH 4LSTH 4KY1L 5DGQA 4U4BA 3V0WH 4PJ5D 3RDTC 5I1DB 1RURL 4ZXBC 5I8OH 1U8PA 1AD9A 3BW9A 3HPLA 3ZHDA 4EI5C 4JEGB 4QHUA 32C2B 4WW2A 4NM4H 3MPCA 1DBBL 1GGBL 4PG9B 2QHRL 2D0FA 4ALAL 3E6FA 3VI4E 1O7VA 5B38G 4UT9H 4NBZB 1DQJB 3NVQA 2Q7YB 5A16A 5INCA 3STLB 1S7VA 1IGTA 5EO9B 1CFNB 1W0WB 3BPNB 4MNQD 5IW1B 4QRPA 1UM4H 1ZGLB 2XWBB 5ANMA 1FL6B 1FVDA 3MROB 2PW2B 4MAYB 4ZYKA 1A6UH 1CFTA 4ELMA 4FQXC 4TTDD 3I6KB 4H25B 5SWZD 1NDGA 3BQUD 5J12B 5GSRA 5DUPL 3EDEA 1FH5H 3HTLX 3NIGE 4NC2B 3WHXB 5B39G 5GZOD 2HTLC 1NAMH 1FIGH 1N5AB 3PP4H 5E8PA 1G9NH 1X7QA 5MP6H 5C0BB 1I1YB 2VZSA 3T4AA 3MODH 4ODUA 5JIIA 3UDWA 3AS3A 4LMQI 5H37H 3VFRB 1HXMB 4PJIB 3B9KA 2W0PA 4Q74A 5JHDB 3BVNB 5DD0H 2FNBA 5CBAA 3ILQD 5DS8B 3DVFA 4UQ2B 1T03L 1EVTC 2GT9A 1RMFH 4YHYC 4ONFH 3T8XA 4R90L 4PJXE 4YGVB 5D7IE 1U3HB 5A2FA 3QBTB 4BSVA 4CW1B 4QRQA 2JCCA 5A2JH 4JKPL 5DHYA 5TDPB 3KPRE 4QRRA 4RWYL 1C08B 5EOTB 4APQA 2QJDA 4L4VE 2QR0B 2YBRB 5E2TH 5HSFA 1TZGL 1MLCB 1T0NA 5KVEH 5EBMA 1FJ1B 3DX8B 3ULVE 3UP1A 4OSUH 4I0KA 5HY9A 3C2SA 3KYOA 2EDBA 5IB4A 5BRZB 3K2MC 8FABB 1QFWM 1JMXA 2AXHA 2M2DA 3RAJL 5GGVL 2JIXA 5KS9E 3QUMA 1T22B 1TDQA 5IROC 1BIIB 3UTQA 3MJ7B 4JFOA 1FFRA 1XF4A 1IAMA 4KFZC 3MRRA 1BZ9A 5FM8A 3WS3A 4O02H 2C4FU 5JR1H 4ZPTA 1JUFB 3QDAA 3AREC 3BZEA 1OB1B 4UB0H 4XZUA 4WEUD 5JW5B 1FNHA 5J1SC 3MGOB 1BJ8A 1RY7B 5KZCB 1RK0A 1QFUL 2DJUA 5C9JA 1CR9L 4UZGA 1TXKA 1RIVH 3D0VA 5J0BA 1MCWW 3L5XL 3EOBA 3MRBA 1EEYB 4D0BA 5CD5C 1QSEE 3ARGD 5K59F 2VSCA 4ZFOB 1HHHA 3V6FB 3IXTB 1EAJA 1FG9C 1HHIA 3RL2A 4OD1H 2X4NA 4K3JL 4G6FB 2RFXA 3ULSB 1FP5A 3TP4A 3BXNA 4Y4FA 4BUGA 2NY4C 5LCVL 1KJMB 2YC1B 3VWKA 3RA7H 3BDYL 1U36A 5CEXA 2OJZH 5FUCC 1FFNA 3HFMH 1BD2E 2DMBA 2ARJA 3RDTA 4ZXBA 1LILA 5ABDE 4EI5A 4ZFOL 3TNNA 3D39B 4Q0XH 4MGXA 1S9YA 3LH2L 3P40A 1MAML 4NUJA 5I1KH 1CG9A 4PJGE 5ESVB 3QDJD 3VGDA 4TSAH 5D72H 3K8LA 1FAIL 1AFVH 3G9AB 2FECL 2X1XR 5IFHL 1EPFA 1U8PB 2R0LL 1AD9B 3BW9B 3HPLB 1PY4A 4QHUB 2D9QB 4WW2B 1M7IA 3I6GA 4PP1D 5FGCB 3IETA 4YQXH 2IMMA 3E6FB 4XNYH 4PY7A 2A74A 2AKRA 5IEKA 4Z7WF 1CE1L 4FQXA 4FFWC 4N90E 3P11L 5A16B 5INCB 4ZAKC 2CO6B 1A7RL 3VD5A 1S7VB 1IGTB 2ZUYA 4QRPB 4ZFGH 2HFFA 3BX7C 4KKCD 5ANMB 1FVDB 5DJAA 2FBOJ 4ZYKB 1BF8A 3GBLA 3VCLA 5CP3A 5GRXG 4OIAA 4ELMB 5I1CL 1NDGB 5GSRB 2YD3A 3JWOL 4L3EE 5JORA 3DV4A 5BZDA 5DQDL 5E8PB 1AGBA 5KSBA 3ARXA 1X7QB 3O6MH 4J7RA 1MVFA 2AXJA 1VGEH 2EDXA 3T4AB 2H26A 3ORJA 4ODUB 1XT5A 3BSZH 3B9KB 3KPSA 2R56H 4PJBE 5D93C 1I3UA 2IC2A 5CBAB 3NZHL 1DLHA 5JW4R 4R97C 3C9NA 2HVKA 3JV6A 4R3SA 1YMME 2GT9B 1K6QL 5HYJE 1D6VH 1MJUH 2DMCA 3FT3A 3O4LE 1FNSL 4BH8A 1L7TH 3T8XB 3QPXL 3TWCH 2ICWJ 3V0AC 3LEVL 4BSVB 1W0VA 5SWSA 1HINL 4L8BA 4QRQB 2JCCB 5DHYB 3O6LL 4QRRB 1NL0L 1K2DA 1KYOK 3OKKA 2K9UA 4BQ9A 1IGML 4X6FA 4APQB 3QIWD 6FABL 3DXAE 3ZDXE 5GHWL 5BJTA 4ZMAT 3O8XC 1DN0A 5IROA 4JY6A 5B4MD 4OTXH 4JFPA 1T0NB 5EBMB 2VDPL 4JHAH 1A7BA 4OCYL 1BVLA 1WIPA 3TT1H 2X10A 1U58A 4KGJA 5HY9B 3BWUC 2P5EA 3AREA 3LPWA 3WFDH 1BAFH 2X1PA 3KYOB 4V1DA 4Z76A 5IB4B 1I1AC 4O9HL 4PUBL 3CVHA 2DQEH 2YMXH 3D9AL 2JIXB 3GSUA 3QUMB 4FP8H 1UFUA 3UTQB 4JFOB 5DMKA 3GBMH 1XF4B 5GGUA 3MRRB 1BZ9B 3WS3B 5AWNL 1YN6A 4NQDD 4ZPTB 4BELD 2LTQB 1BZQK 5B3NA 1SHMA 3BRGC 3BZEB 5L88L 4XZUB 4BKLA 1EFQA 4M03A 4H8WH 5KVGH 2DDQL 4KUZH 3L9RA 4XHJC 1RK0B 3UBXG 1T83C 5C9JB 4XC1H 5CJ8A 3D0VB 4PJ9C 2ZUQB 3VFTA 3EOBB 3MRBB 4LARH 3QUML 2YK1L 5T3XD 4D0BB 2X2YA 5JOPE 4KJYA 2X09A 4N1CA 1G9NC 1HHHB 1FRGH 4MCYA 2C1OA 1HHIB 3RL2B 4NQED 5J1AA 1UB6A 1DBKH 2X4NB 2EDRA 3I3DA 2RFXB 3GJFK 4N0CD 3BXNB 4Y4FB 3DRQA 5JMOC 1C1EH 1JK8A 3VWKB 4N0FA 5CEXB 3CGTA 1FFNB 2ARJB 4HD9A 3RDTB 4ZXBB 4JM4L 2XKNA 3WIHH 2C5DC 4L4JA 3ZSTA 5A3ID 3PWPA 4Z77A 4KK9C 4EI5B 3TNNB 4WI3A 3DLQR 1S9YB 3MRMA 4NUJB 5EUOF 5EZIH 1CG9B 2DQDH 3WHE1 2CGRL 3OG4B 2GCYA 3MGTA 4B7IA 4YDIH 2APVA 2W9DL 4OCSH 5DDHA 3M07A 4PLKD 4XBPA 5JO5A 2Q8BL 3U0WH 3MLXL 3KR3H 4QHMA 4RAHA 5I71C 4XVSL 4WCYH 4ZAKA 1FO0A 2B0SH 1T21A 1X5YA 3RX7A 4PJ7E 3SCMC 3AB0C 1IBGH 2ESVE 1M7IB 3MUGA 3I6GB 2NNAA 3IETB 1OWRM 1F2QA 3DECA 3P0YH 2JELH 4PY7B 3EDDA 4YDKL 2A74B 2AKRB 5IEKB 4FQJH 4FQXB 3NTCH 1EHXA 5HI4D 3V4VH 2A6JA 1SMAA 3OSKA 3UZEA 3ZO0A 4DN3H 4ZO6A 2HFFB 2A2QT 5ALCH 1KC5L 4PJDF 5C0DA 5DJAB 1OP5K 1MQ8A 1R24A 4KI5E 2NXYD 2WBWB 5DQJA 1IAIH 3VCLB 3MLUL 5HDQH 4Y2OA 3ZYOA 4YHML 1FAKT 3U9PH 5D2LE 5JORB 1UWEL 1NFDE 4YHYB 2EIEA 3DV4B 4UTAL 3MA9L 3HI1A 5BZDB 1HE7A 2PYED 1AGBB 3BN9C 5KSBB 3HCVA 4OZ4A 4FQQA 2H26B 4YBLC 1KT2A 3KPSB 3DUUA 1DLHB 3T0VA 5C6TL 3C9NB 2HVKB 1JPST 3JV6B 3V4PL 4R3SB 1RUQL 1WAAE 5GGVY 1NCBL 4Y19A 1OT1A 3BH9A 4M7LT 3FT3B 3ZL4L 4BH8B 5B8CC 3O8XA 1OD7A 3KYAA 4UOJA 1W0VB 4U1LA 5SWSB 4L8BB 3SDAC 4XI5D 3IU4H 2WW8A 1K2DB 4H1LG 1GXEA 3OKKB 4Y5VC 2EEDA 4M6OH 4X6FB 1I1AA 3IJSA 5EOCH 1E4WL 3N9GL 3E3QC 4AK1A 1KTDA 2QQQA 5DUMH 1KUMA 5BJTB 5IV2A 2F5BH 1DN0B 4JY6B 5GRZA 3VD7A 4CJ0A 4KJWD 3KS0J 4JFPB 1HQ4A 4KMTL 1BVLB 3C08L 5EIIA 3FFCE 1U58B 5JW4M 2P5EB 1DQDL 3AREB 5DI8A 4V1DB 5EN2A 4Z76B 3HZVA 3I02A 3CVHB 3OPZH 3MQIA 4TVPL 1T83A 3V52L 3GSUB 1I85C 4PJ9A 5DMKB 1B9ZA 2F54D 5GGUB 4EEEA 3OB8A 2VZOA 4FN0A 1YN6B 1NAMA 3ECBA 1NUFA 4YHIA 1IZKA 1J0HA 4BKLB 4LU5H 5J8OA 1TVBA 1PEZA 3L9RB 3PL6C 1FYTD 4OZGA 4ODVH 3UTZA 2NY4B 3CVHL 1LMKA 1FZOA 1UA6L 3QWRA 1HH6A 3VFTB 1RUMH 1UZ6F 1JPSL 3DOSA 2R39A 4XX1E 3CUPA 2WZPD 4F7CA 5D71H 2XKSA 4KJYB 4M7LL 6CGTA 2Y7QA 4PJ8D 3RKDC 5EO1A 1OTUD 4MCYB 3ZE0F 2C1OB 1FDLL 2YD5A 5J1AB 1UB6B 2OLDA 1T20A 5KVMC 3TC9A 4KZDH 2FX7L 1SEQL 4S2SA 3DRQB 1JVKA 1JK8B 5HVHC 4PJHA 5DA0B 4GAGL 4N0FB 2LU3A 3QZWG 4TSBH 2ZCHH 1G6RH 4I3SL 2XKNB 1JTOA 4XWGH 4L1DA 4POYA 5BVPL 1Q94A 3PWPB 4Z77B 2V9TA 1CD9B 4XPAL 1YQVH 3MRMB 3SCMA 4YHPA 4K9EC 2R1XA 5K9JL 1HNFA 1GJIA 2GCYB 5EIVA 2NLJA 4FQPA 3MGTB 2PO6D 1IAOA 5T1LA 4XPGH 4XBPB 3QISA 5JO5B 1MI5D 2HFEA 4MA1C 4QHMB 1MCKA 3SGEH 4ZAKB 4YHLL 3HI5L 3PUCA 1FO0B 1T21B 2PXYD 1V7NL 4FQCH 1RVFH 3MUGB 2ICWI 1OP3H 2NNAB 3NABL 4K3EH 4KPHH 4KKAC 5JLZA 4JJHA 2P45B 3EIFA 4UBDD 3GMMA 4F2MA 4D94A 4GFTB 2A6JB 1AJ7L 3MRQB 3J8F7 1IC4L 5T5FL 3HI6L 1FO0L 5C0DB 2E7HA 1JWMA 1R24B 1DQLL 5DQJB 2XQBL 1A0QH 1OTTC 1MEXH 5D93B 3PQYD 4L3AA 4Y1AA 4HX1A 2APTA 4R97B 3IS0X 4MVBD 3ARVA 1N6QH 4WJ5A 3I2CL 3HI1B 3S9DB 4QTIH 5B8CA 2OI9C 3HCVB 4OZ4B 4FQQB 1CZ8L 4HJ0D 3SDAA 2E9BA 3TJHC 3TYGL 3ZTNL 1KT2B 1XGUA 3A0OA 4HF5H 3DUUB 4G5ZL 4U7SA 5I15L 2JJTC 4Y5VA 1O5DT 3U7YH 1QFWH 1EGJH 1FGNH 2FB4L 4C59B 3S88L 1KN2L 3PABA 4Y19B 5DFVC 1PQZA 4XPTH 3O3BA 3O8XB 3QEUA 3EYQC 4F15C 4P2RE 3AS1A 4OIBA 1PZUB 1F4YH 3N06B 4U1LB 3O2WL 4XBEL 2AJXH 1UH3A 1EO8L 5FO8A 1FCCA 4C83A 5B3JF 1I1AB 3IJSB 1F13A 1KTDB 4JDTL 3X14A 4AYFA 1I85A 1OAUH 5IV2B 2D4FA 2HLFD 3FZUC 3MLRH 4KAQL 4WUUE 3TCXA 3LQMA 4L29B 4HG4K 3V0WL 1HQ4B 3D3VE 3GSNA 5EIIB 4YHZH 4JFDD 5DI8B 2O5YL 3SDXA 5EN2B 5L9DH 3HZVB 3I02B 4S0TD 4Z0XA 3UJJH 1AE6H 4NM4L 1YNLH 3PL6A 2ENSA 1XF1A 4GG6E 1NQBA 2ADFL 4PJ9B 5MEPA 4PBWD 2PR4H 5IB2A 2Z92A 2RBLA 4PS4H 5FGBC 2FHFA 1NAMB 3ECBB 4WFHE 2WUCH 4OQTH 2AJYL 1Z6JT 5CEZL 5CSZA 4YHIB 1UG9A 3UEZA 4JFED 5KN5A 2R4RH 1TVBB 3VXSA 3KPMA 3OQ3B 1K4DA 2X1WL 2X4PA 1LO5A 3QIUD 4OZGB 4PJ5E 3GSRA 2AJ3A 2HJKA 3UTZB 4BZYA 4OCXL 1SBBA 4YFLF 1HH6B 2CIKA 4ZSOE 3DYOA 1BFOA 1A6UL 4J3TA 1J0JA 3CUPB 4F7CB 4L4TE 4YE4H 2Y7QB 2BRRH 1VACA 1CDHA 1FH5L 3RVVC 3LD8C 3G5VA 1J0ZA 1MHPL 1NAML 1FIGL 4PRIA 3PP4L 4S11A 1T20B 1G9NL 4MNGE 4I1NB 1E4JA 4M6AA 5IJVA 4S2SB 5D70H 3MA7A 4PJHB 4KK8D 4U2YA 5HXMA 4FZEH 5F7YC 5DD0L 5DLMH 4EKXA 1YNTB 5JIHA 1AXTL 5FCUH 5I71B 4ONFL 3TO4C 4U6TA 1Q94B 5DRZA 4XTRC 4Q6IC 3SCMB 3AB0B 4YHPB 5H2BA 3LHPH 4K8RD 2R1XB 4WO4C 2NLJB 1UJ3C 5I8EA 1FVEA 1IAOB 2H45A 5T1LB 4Q7DA 3EYFA 2HFEB 4YPJA 2QSCH 1S5HA 1NBYA 5D1ZD 4WGVB 3VE0A 5E2TL 2XN9A 4MDIA 4EBQH 1SM3H 3V5KA 1E4XH 4KRNA 4KQ4L 3OB0K 4HKXA 5JLZB 4OZHF 3TEUA 3BDXA 3F58L 4PB0L 3GMMB 3QP3A 3RVWD 4F2MB 5DEZA 3TYFA 2WWMC 3K1DA 3MUY1 4OT1H 2W9EL 2C1PA 4LLQA 3CMGA 4Q97A 1AGCA 4O02L 5HVFB 2A9NH 4XP6H 1JWMB 2PCPA 4M1CC 4UB0L 4YBLB 2FO4A 1VFOA 4OGYH 4LFHG 4Y1AB 2JJTA 4HX1B 2AJSL 2NX5D 3ULVC 1HSAA 3RJQB 4WJ5B 5F7HA 1ED3A 5B8CB 4U33A 3RTQD 1ZAGA 2ZSVA 3FO2A 2F58L 5ERWA 4BQCA 2CRMA 3SDAB 1FN4A 1XGUB 4WI7A 4OD1L 4Y5VB 3RIFK 4DK6A 1IEBA 1YYMH 3FN3A 3PABB 3INUL 3ARZA 1PQZB 4JG0H 3O3BB 4G43A 2IF7A 3QEUB 3RA7L 2OJZL 3QHFH 4GKNA 5FM5M 4P4KD 4OF7A 3MLVL 2AVGA 1OGAD 1F6AA 1VADA 5FO8B 4C83B 1EJOH 3TBYA 3HC3H 1JYWA 3RVXD 1SJHA 3X14B 3NIFF 4LSPH 2DBJA 2QEJA 4MS8C 5JZ7C 1AFVL 1QSFA 5FGBA 1E27B 3GSNB 5CGYD 3QJHA 3GMQA 4OD2A 1F11A 1LK2A 1PVHA 5K59E 3VGAC 4MJIA 3UZQA 3QFDA 3SDXB 3PXHA 4Z0XB 3PL6B 1NANH 1U6AH 4YQXL 5CSGA 5MEPB 2GK2A 4XNYL 5IB2B 3QXDA 4CADA 1CIUA 3DVIA 4ZUWA 2ADJA 5D5MF 4OGXH 4OLUH 4RDQG 1FCGA 3BD3A 4JY4A 2NW2A 5CSZB 1ZHLA 3GSNL 3QDJE 5KN5B 2FECI 1N0XH 3VXSB 3KPMB 4FQ1H 1K4DB 4U0RC 4LDOB 5CGTA 2X4PB 2HT3D 1LO5B 5FYJE 4ZFGL 2B8OT 4JQXC 3GSRB 5J9PA 2AJ3B 2HJKB 2UUDK 2VXSH 5HVHB 5IVXF 2CIKB 4NP4H 1BFOB 5C6PB 4YXLH 2EDOA 4GQPH 4XNZC 1H3PL 4ZFZA 1VACB 3G5VB 1AO7A 3TO4A 1SMOA 4PRIB 4AIZA 4Q6IA 2YN5A 3O6ML 5IJVB 1QBMH 1RZFH 3MA7B 4M7ZC 4NZTH 4WO4A 4PLNC 3QCUH 3BSZL 1UJ3A 5T1KA 1TJIH 3UJIH 3IJYA 4MA1B 1D6VL 4PRPA 2CLRA 2XWJA 5DRZB 3TWCL 3F62A 2CUIA 4M4PA 5H2BB 3EYVA 2NY0C 4EIGB 1OD9A 3BKJH 1ERNA 5I8EB 4KUCD 4J3VA 1FVEB 3SDCC 4PJXA 5D7IA 2AK4A 3EYFB 1H15A 4G6KH 1S5HB 1NBYB 1YUHA 1H3TA 3QQ4A 3VE0B 2Q1EA 3KPRA 1CI5A 2XN9B 2E3VA 4MDIB 4OTXL 4MXVE 3L3JA 4PGEA 5F9DC 5FYKH 3CVIH 4JHAL 1DL7H 4L4VA 3V5KB 4JO2H 3TT1L 2HT2D 3WFDL 1BAFL 1W8OA 4HKXB 5HGBA 2DQEL 3HE7C 2DYPD 1P7QA 2V5SA 2YMXL 43CAA 3TYFB 4MQSB 3QHZL 4FP8L 4U1GC 2R2HA 2C1PB 4LLQB 3GBML 3BH8A 3S4SA 4N0UE 2R1WA 2BDNH 1AGCB 2IBGA 2OI9B 1CF8H 4OCLC 5F9JA 5GRUH 4UOW0 1CDJA 2PCPB 4GW4A 5KAQF 1BOGA 2FO4B 1N5YH 4H8WL 5KVGL 4GRWH 4YUEH 2X89D 3HAEA 1HSAB 2YD2A 4RAUA 1ED3B 3DO3A 4R4ND 5TQ0H 3I50H 4Y2DD 4LARL 1MUJA 4F15B 4MDJA 5GXBB 2ZSVB 3FO2B 5ERWB 4JB9H 1FN4B 1FRGL 3HC4L 4F58H 1KJ3L 5C2BH 1Q1JH 4MA8H 1OAKH 1JI2A 3P9WB 1RZIA 1UJTA 2IFFH 1DBKL 4JRYA 5CKGA 1DUZA 1ZTXH 5JIKA 5B21A 4ODSH 1C1EL 1IEBB 1R3JA 1CICC 2HRPL 3NFSL 3OL2A 4G43B 2OK0L 4GXUN 2FDBP 4GKNB 1C8PA 1M6OA 3W11D 3AMKA 4DVBA 3UTOA 1F6AB 1VADB 3BEVA 3TBYB 4ELKA 1VENA 4NQCD 1FLRH 3EKCA 1SJHB 5T3XE 2UWEE 3NGBC 5HGAA 5EORH 5J13C 4GRMA 4LSQH 4HLZH 4YDIL 1QSFB 4NQEE 3WMSA 1E6JH 3TH3T 3DETD 3KR3L 5JIPA 3QJHB 3GMQB 4OD2B 1F11B 1LK2B 4MJIB 3QFDB 2B0SL 5BO1L 4OD3L 4TOYH 1CFQA 4IOFC 4X7DC 4KU1A 1TITA 1HILA 3MO1A 5K9OA 5J4MA 4LIQE 4JQXA 3THMH 5GQBA 1VESA 2JELL 3QXDB 4CADB 4FQJL 4ZUWB 2ADJB 4XAWH 1KGCE 4WTXA 1VEOA 4JY4B 2NW2B 4LMQE 2RB8A 1ZHLB 3LD8B 1T2QH 5EU6E 5C09E 5KVDL 3RGHA 3VFGL 1MREH 5J9PB 1CXLA 4PJIF 2IADA 3QQ3A 3S37X 3H0TA 1IAIL 2CH8A 4HFUH 3VXMD 4HCRH 5HDQL 2VDRL 1C5CL 5C0BD 4HUVA 1KTKE 4ZFZB 3M1BA 1AO7B 3TO4B 1U8KA 4AIZB 2ZNWA 3DX6A 4Q6IB 3V6OC 2OP4H 4WHDA 4WO4B 4L3EA 5FM4A 1EVUA 4ZUTA 1OAZH 1UJ3B 1HKFA 2ZWLT 5T1KB 2D4DA 1KV3A 1U3HD 3SDCA 4LHQB 4LCWA 5FHBH 2UY6A 3IJYB 5EWIH 2NXZC 1I7TA 2CLRB 4PRPB 2XWJB 4XWOD 5D6CA 4MAUH 2G9HA 2X4UA 4AEHH 3B3IA 1VCAA 3EYVB 5EIQA 4E9LA 5HYJA 4JN1H 1H8OA 3IU4L 4KZEL 3O4LA 4PJDE 5F72S 2OX5A 3A6OA 4PJXB 2EC9U 4MXWL 1K9TA 2DMKA 5EOQL 1JZ7A 5D7IB 2AK4B 4ORGA 1H15B 3HE7A 5EOCL 5IKCA 2YXMA 4KDWA 4C56A 2LAAA 5DUML 3T2OA 3QQ4B 1ZK9A 3SGDI 2HJFA 3KPRB 2F5BL 3TBWA 3FB7A 4OQTA 3D18A 3QJFA 3L3JB 4PGEB 1HDMA 4L4VB 1Y6KR 3DXAA 3ARFC 3ABZA 5I1AA 1HQRA 3CFJA 3UYRH 2BY0A 1CLZL 5HGBB 2Z31C 3OPZL 1P7QB 43CAB 5MEOA 4HWBH 1PG7W 2R2HB 3A6BH 3QXTA 3BH8B 3S4SB 2R1WB 4M61A 5KZCD 1D5MA 1BX2A 1MCWM 5F9JB 3U7WH 3C5ZD 4GW4B 1FIEA 5KSAC 4LU5L 3P4LA 4LLDA 4FQLH 4WU5A 3AU1A 1QFOA 3HAEB 3RI5F 4OF6A 4PY8I 2GQHA 4W68A 2NCMA 3UC0H 1GC1H 4RAUB 3M17A 3VRJA 1CICA 1RUML 2ZOKA 4FRWA 1MUJB 3ULVL 4G6FD 5D71L 4MDJB 3BP4A 4QWWC 1INDH 1MCLA 5F7WC 1LK3H 3IVKA 3L7FA 1YPZA 4OCRH 1B3JA 1I8KA 5IBTH 1RZIB 2FYYA 4JRYB 2F54E 5BMFH 1DUZB 4KZDL 3SN6N 4CGTA 1R3JB 1RD6A 1IQWL 4MJ6A 4P2OC 3D39D 4J1UA 1M6OB 3EZJB 2WLZA 4QO1A 1KNOA 3V5DA 5C2UB 3B9DA 4N5UA 4DVBB 4PYGA 5IHLB 3VGAB 4WW2F 3BEVB 1QD0A 1X5JA 4ELKB 1KLGA 3T0EE 3WNKA 3P30L 5HGAB 3V9FA 4Y7MA 1ZVYA 4GRMB 2HKHL 1D6EA 2WUBH 5HI5D 4XPGL 4GW5A 1TZHA 3FAXA 4LLVA 4ZS7H 5DTFA 5DVNA 3GI9H 1XF2A 3CX2A 5I1EH 3ZE0E 1CFQB 4GMTL 5FEBA 4FQCL 4U0RB 3S3SA 1RVFL 3MO1B 1HILB 1AI1L 3IDJA 5K9OB 4K3EL 4ELMF 1F3DJ 2ZUWA 4KPHL 5D7KD 4QRPD 5EU7E 1KCVH 1U92A 1WCQA 4I5BA 2RIKA 2ESVA 4XNZB 2ZUTA 1P84J 1BFSA 3S5LA 2EO1A 2APBA 2HWZH 3FRPA 3V6OA 5EB9A 1MI5E 4M7ZB 3PDGA 2IADB 3QQ3B 3H0TB 1A0QL 3RPKA 4LQFH 1NMAH 4R4BB 4HUVB 4JHWL 3M1BB 3RY4A 3B9KD 1U8KB 4QTIL 2HFGH 3DX6B 4WENB 4ODHL 5IMKA 1QLEH 2EIZA 2JCCF 4OF0A 4L3EB 5D2LA 1U8JA 2NY0B 3QG6A 4DGIH 4F7MA 1J12A 4FZ8H 4ZUTB 4HF5L 3UPCA 4RFOH 1OF2A 3SDCB 3QEGH 3CZJA 4LCWB 2QQKH 3BEWA 4KKNA 3H7LA 1EGJL 1FGNL 2G5RA 5EUKA 5LBSH 3QO0A 4QRRD 1I7TB 4XPTL 4OBSA 3MSPA 5D6CB 2G9HB 2X4UB 4S1RH 2L0DA 3B3IB 1F4YL 1K8IA 5C3TA 3FOLA 5IVOA 2AJXL 5HYJB 3O4LB 3ARFA 4MHHI 5HHXH 12E8H 4JLRA 4ORGB 2Z31A 3HE7B 2KQMA 5IKCB 4ZTOH 2OTUA 2R2EA 4C56B 5K9QI 4XP5L 1OAUL 2HJFB 4U1GB 3TBWB 3MLRL 3FB7B 3OAYH 4I4WA 2GIYA 4LPVA 3QJFB 1RZGA 1HDMB 2I5YH 3GSXA 5C0AE 2JIXD 5ESQA 1Z5LA 3DXAB 3QXUA 5DGRA 1TJHH 5I1AB 1HQRB 1PLGH 4G8IA 5KSAA 3OKNA 3UJJL 1AE6L 1WIOA 2IAMC 1YNLL 1IKFH 1J0KA 5MEOB 1CDYA 1N3NA 3RY6C 4OFYA 1KLFA 3ZE2F 4M61B 1D5MB 1HYSD 1BX2B 4OQTL 5DJDA 3OMZA 5GS3A 5CHNA 2R8SH 2AQ3A 2HH0H 1H8NA 3QR2A 4LLDB 4WU5B 3AU1B 3MBXL 5E0QA 3X3FH 4JZOA 1REIA 4MQXC 4B41A 5B3JE 3M17B 2W0FA 3VRJB 3MYZA 1CICB 4R2GC 2ZOKB 3MLTA 4JFDE 1PEWA 4P2OA 1PSKH 3Q5OA 5ITFA 3QHTC 1GGYA 4Z5RA 3BP4B 4Y4FD 5I16A 2BRRL 2VAJA 3IVKB 3L7FB 3VWKD 1YPZB 1QR4A 2DI7A 1I8KB 2FYYB 2VWEC 3RDTD 4POZC 2L7JA 5D70L 2Q8AL 3NGBB 4CL7A 4X9HA 5J13B 4FZEL 4EI5D 3VW3L 4LOUD 4MJ6B 4J1UB 3QCTL 5DLML 3WKNA 2BXZA 4DQOH 4M1DH 5AYUH 4KTEL 2APXA 1KCKA 1KNOB 5C0IA 3V5DB 3NMEA 1ZV5A 1F6FB 2EDTA 4WI2A 2IG2L 5ISZA 4P5TC 4DUVA 3LKSA 1MIMH 3F8UB 3TV3L 3ALPA 1KLGB 2ED9A 4PD4J 3WN5C 2Y4SA 5F7DA 2DI8A 2N7BA 4J3UA 2AK1H 3IYLW 4B7LA 4NHCH 4PJCE 1AR1C 1A02N 5IHUL 1D6EB 1U2CA 2NY1C 4NKOA 4P5MA 1PG7X 1LDSA 2QSCL 3OX8A 1JTTA 2MFNA 4GW5B 1A6AA 1TZHB 1W2KT 1ULVA 4G8GE 4LLVB 5DTFB 2I60H 4WTZG 5F7FA 1XF2B 3RU8H 4FQXD 3K4ZA 1M7XA 3VFPA 3T0XA 3IDJB 1SM3L 2GHWB 1E4XL 2FBJL 3H9HA 2HTLD 2W59A 2Q76A 1AKJA 1PW3A 1U92B 3JUZA 2QQLL 4I5BB 2ESVB 2IQ9H 4M5YH 5DEGA 5D96C 1F90H 4Z7NF 5KSBF 3U36A 5IESH 4CDGC 3S5LB 2AJUH 2DQIL 2AP2A 2A9NL 1OT2A 2WIIA 5H8DA 43C9A 2QSVA 4I3RH 3HLAA 1GC1C 1QLRA 3LRHA 3IAQA 1QO3A 1ZKAA 5E4IA 5IT2H 2NY2D 5I0DA 2LAGB 4YHKH 2NXZB 3KPSD 2D7PA 5TH2A 5IMKB 2EIZB 4LRNH 2OL3H 2H2PC 4LPCA 5D2LB 1U8JB 3QG6B 4F7MB 5JUEH 5L2KA 4R7NA 1YEFH 1OF2B 1ZANH 3BEWB 3ZLQC 1F8TH 4OZHE 5EUKB 1YYML 3QO0B 5D7LA 2AJZA 4TVPD 4JG0L 4A2LA 1A5FH 1FPTH 3QHFL 2Y23A 2VR5A 3DTXA 1EHAA 5E6YA 1K8IB 3FOLB 2CK2A 2NX5E 2VXUH 3ARFB 1FQ9C 4NRZA 4JLRB 1EJOL 3HC3L 2Z31B 1I3GL 2IAMA 3QXAA 4R6UA 3V95A 4HUKB 1R0AH 2IJ0C 2JK5A 3IFLH 1MIEL 2OTUB 2R2EB 3ZTJH 3NZ8A 5DT1H 4LSPL 3RY6A 2P5ED 3ARED 1KXTB 4V1DD 5HGGS 4I4WB 1RZGB 1LDPL 3AUVA 1A14L 2B20A 3GSXB 5ESQB 5CJ5A 1Z5LB 2A6IA 3MMEA 1G7QA 4G8IB 5KSAB 3F7VA 3OKNB 5CD5D 3WNOA 1TVHA 1TETL 5B38A 3D3VA 4HCRA 1N3NB 1NCWL 1U6AL 4MQTB 3CU1A 5F7KC 1IC5L 3VGBA 4NWTH 4JDVA 2NY4D 5DJDB 3C6LC 5CHNB 1N64H 1N0XL 4JZOB 1TMCB 1OTSC 2VXSL 3BO8A 3L3IA 2W0FB 4ZNEA 2YUXA 2IH1A 3BE1H 3U79A 3MLTB 4N8CH 5B39A 3NIFE 4P2OB 1T66C 5ITFB 4Z5RB 1CGTA 1XF3A 5I16B 4CVXA 3RRQA 1TTGA 4ZSOA 4P5TA 4L4TA 2BFVH 4XP1L 1MCOH 1QBML 1QHPA 4Y4KC 3RVTC 3WN5A 4NZTL 4G42A 3NACL 3NCYP 3PWPD 5FGSA 1TJIL 3UJIL 4KK5C 4MNGA 5ELIA 5HHOE 5C0IB 5D5ME 2UV3A 2GK0A 1OAYH 5ISZB 4P3DA 4K3HA 3LKSB 4X8XA 2BSRA 4EJ1C 4FFWD 2J88H 1B6DA 5F7DB 2V17L 4ZAKD 3BKJL 2FZ3A 4DKEL 5TFSH 2JF1A 1YA5A 4ONGH 2AEIT 1MPAH 4NKOB 5IVXE 4FG6C 4L9LC 5KOMC 4P5MB 3OX8B 3EYUL 3EW3B 1A6AB 5F6HJ 2RJMA 4YWGH 4GBXC 5FYKL 3VFPB 3CVIL 1DL7L 4S1QH 3H9HB 1GZPA 3GSWA 4GRWB 1UEMA 2Q76B 1AKJB 2GI7A 3FN9A 3DYPA 5DEGB 5E6IC 1XMWA 1HH9A 1X5HA 2AERT 3U36B 5IOPA 4ZNCD 4M6MH 3G08A 1CF8L 2WIIB 3HE6C 43C9B 1EIBA 2EIDA 5C08A 4DTGH 3HLAB 4OCWH 4CAGA 1N5YL 1QLRB 1QBLH 1QO3B 4YUEL 1NCAH 2EDEA 3T0BA 1LWRA 4OZIA 1P4BH 3LQAC 4FS0A 4P59H 2P8LA 3I50L 2CXKA 5TH2B 5TQ0L 3ULUE 3W0WE 1X5FA 4Y19D 5C2BL 1Q1JL 4MA8L 5L2KB 1OAKL 4R7NB 3O8XD 2IFFL 4LAQH 1ZTXL 3V7AG 4DFIA 3QIWC 4MHHG 4ODSL 3T65A 1V05A 5D7LB 4D2NA 2AJZB 1DANU 5J56B 5GISH 4ODBD 2P49B 1I1AD 3DTXB 5K9QG 4WWKC 1I7RA 5SV3A 5FFLA 1D5XA 3CSGA 5CEZD 5CZVH 4NRZB 5JDJA 2FJFA 1G1YA 1G7IA 4LDLB 1FLRL 2IAMB 3QXAB 1LEIA 4O2EA 2KUTA 5EORL 2JK5B 5ITBH 3NZ8B 4LSQL 2ZUSA 2DM2A 1BEYH 1ITCA 1E6JL 3AC0A 4XHJD 2A6IB 4DKFH 3MMEB 4PJ9D 2ED8A 1G7QB 2A0LC 3F7VB 4TOYL 4OZGF 4RGOH 1TVHB 5B38B 3D3VB 4OZFH 4U6YA 5T3ZH 3THML 4MWFA 4KRMB 2R29H 1C12A 2FATL 3RP1A 3MCG1 4R2GB 5CIPH 4GLRH 5DF0A 4JDVB 4NQCE 1L9NA 1T2QL 1U8LA 2FRGP 3JUYA 1MREL 4PJHF 3R1GH 2H3NA 4TRPH 4Y4KA 1F42A 3BO8B 3L3IB 3L3KA 2IH1B 4KK9D 4HCRL 5B39B 4I77H 1XF3B 2FH8A 1W72A 4CVXB 2YN3A 3EO9H 4QTHA 4OB5H 4ZSOB 4P5TB 4X9GA 4P46C 4UOW1 3MJGX 4L4TB 2OP4L 3K2UH 4NCC1 4DW2L 3WN5B 2I25N 4G42B 1LP9A 2MCPL 1ACYH 3TFKC 4GS7C 2YOCA 4P99A 2WMPA 4XB8A 4J2XA 3SCMD 4MNGB 5FHBL 4U3XA 2NY1B 4YDLC 1QQDA 4L9LA 1IAII 5EWIL 4CVZA 3PDOA 2YKLH 4M8VA 4H88L 2GK0B 1FSKC 4P3DB 3RWIA 3LSOA 2BSRB 4AEHL 3VXME 1E4KC 4GBXA 2MJWA 4XNUH 1M4KA 4JN1L 2XTLA 2FZ3B 3DX9A 2B1AH 5E8DH 2O5ZH 3EJYC 3ZKNC 1JWSA 1WWBX 4HSQA 5E6IA 4X6CE 5D96B 2FGZA 1UXSA 3HC0A 1IGIH 4M7JL 3JSSA 4LHJB 1GZPB 3GSWB 4X83A 5CJXC 3CMOH 3HE6A 3JZ7A 3UYRL 3BN9D 3RJDA 4Z7OF 3VMPA 3NCCB 5DEFA 1HH9B 4HV8A 3H3PH 5IOPB 4Y1AD 5TQ2H 1L9MA 3CFDA 3G08B 3IDNA 3HZMA 3U7WL 4F9PC 5C08B 5DMJB 3UBXA 1ZT4A 1EBPA 1A6ZA 2BERA 4B0MM 2D7MA 5I6XC 4FQLL 3R4DA 5E00A 1F4XH 5GS0C 3B9EA 3QH3A 3SDAD 3UC0L 1GC1L 3QIWA 4FFZH 4OLEA 5E2WH 3ZMRA 4OZIB 4KK6C 4CN6A 2P8LB 1NFKA 4NNPH 1FNFA 3NCFB 4YDJA 3UYOD 4LSSL 3DMMC 1MCPH 4WWKA 3N1MC 1BVKA 1CD0A 4OCRL 5IBTL 3UTSA 1G0XA 5DVLA 2HAZA 5F44A 1HOCA 3T65B 4KMLB 5FECA 5IW6A 5GJSL 3GGWA 1U3YA 4X80L 3EFDL 4HEPG 2X40A 5J06A 5HPOA 1I7RB 1KB9K 3SDXF 1PZ5A 2HN7A 1D5XB 2DQUH 4QNPE 2FJFB 2EC8A 2Z91A 1G7IB 1Z2KA 5E7BA 1LEIB 4O2EB 3REWA 3BP5A 1Q9LA 4XCCH 1UWGH 4NUGH 2WUBL 4XXCC 3DNKA 3PL6D 2BJMH 3QYCA 2UWEA 1KELH 4U7MA 4ZS7L 2R0ZL 3GI9L 5I1EL 4NQEA 3D39E 4U6YB 5F7EL 4MWFB 1L4IA 4JGMA 1C12B 3VXSD 5ETUA 3T0EC 5SX4H 1Y6NR 1XH3A 2OL3A 1CVSC 1U8LB 1VSCA 5EG6C 2H32H 3DI2B 3SGEI 4P46A 2A9ML 2HWZL 4JPIA 1QOKA 1A6TA 2H3NB 4Y4KB 5FGCE 1A22B 2L4OA 3ELAT 1JNNH 3U1SH 4PRID 3L3KB 5EU6A 2YD6A 1NMAL 2K1MA 3SDYL 5C09A 4UT7H 2QADC 3LKRA 5TE6H 4KRPD 4NHUA 1W72B 3GKZA 1OP3K 3D25A 3RL1A 5IBLC 2KPNA 4QTHB 4D9RD 1QLEL 5EU7C 1HSBA 4X9FA 1E4KA 2M1KA 1LP9B 4DGIL 4JHZA 1IM9A 4RFOL 2AGJL 1D5IL 3QEGL 2QQKL 1FBIH 3KLHC 1QQDB 2DTML 3CLFH 4L9LB 3B8YA 5LBSL 3H9SA 4CVZB 3PDOB 4NO3B 4K7PH 5FYJL 4KKAD 3RWIB 1W72L 3LSOB 5DRXA 4J12A 2BZDA 3VMOA 5JA9A 4H1LA 4GBXB 2AI0L 4CKVX 3X12A 5CJXA 4KJPC 5L8KB 3T3PF 2XN9D 4KDVA 4WFED 1F6LL 1TTUA 3DX9B 3MXWH 4LHUG 1I8LC 3EJJX 1I9RH 4ZTOL 1JWSB 1K4CA 5E6IB 3BZFA 5EZOH 1YY9C 1MHCA 1QFWI 3HC0B 1OTTD 3VWJC 3LN5A 1BFVH 1JMZA 3R06A 1GHFH 1WEJL 2I5YL 3E8UH 4RFEA 1NGQL 1U0QA 1WZMA 2EEAA 2JCCE 3HE6B 4JGJA 4F9PA 3NFNA 3WDJA 3Q0HA 3SHSA 3HA0A 4JKMA 2LU7A 5DEFB 5J6GA 3TJHD 5HHQA 4HV8B 2A6DA 4HIJA 4X7SL 3CFDB 2UY7A 3IDNB 4JFQA 3DMMA 3HZMB 3IGAA 2JJVA 2R8SL 3T09A 3UBXB 3L5IA 5DFVD 1ZT4B 4S1SH 1A7PH 1JTPA 1A6ZB 2HH0L 1XGQA 1RFDH 1ZWIA 1Q9WA 4LLMA 5E00B 3X3FL 4B53A 1F58H 1KIQA 3QH3B 1ZEAH 3QIWB 4PGJA 2BVOA 2HMIC 2BMKA 3PGFH 1PSKL 2MCG1 4YDJB 3PGCA 4JY5H 2WBJC 4WWKB 1BVKB 4Y8DC 3UTSB 1NBZA 3FZUD 3X3GH 1HOCB 2WIMA 4L1HA 2B1HH 3QZWA 4JGUA 5FECB 1H3GA 5IW6B 3CIQA 3GGWB 2DOCA 3CXHK 2LABA 1SYVA 1NJ9A 2F54A 1UGNA 3QIBC 4HKZA 4XXCA 5FOBA 4HC1H 5AYUL 3H9ZA 4P0DA 5HHVH 1ZHKA 3ZE2E 3GM8A 5KG9A 1J8HD 1PZ5B 5FYJU 2HN7B 1QSFD 3L3OA 4NJ9H 2Z91B 2W60A 3REWB 3BP5B 4NHCL 5IIEA 1YEEH 3MOBH 4MJID 1P5VA 3I85A 1Q9LB 4AG4H 2F9BT 4Y16C 3JXAA 3T0EA 2UWEB 1L7IH 1YEHL 2I60L 1NGZA 3RU8L 2PUQT 5EO0A 4NQEB 3EJZD 5ICYA 1BMGA 3QIUC 1WTGT 1MCIA 3SBWC 1X4XA 3RVUC 3DGGA 5ETUB 5FUOH 2IQ9L 4M5YL 1XH3B 2DQTH 3G6DL 1F90L 2OL3B 5IESL 1T0PB 4P46B 1PX4A 3NIGF 4JPIB 1A6TB 4YBQC 2W0LA 1AO7D 4NZDA 2HLAA 5EU6B 1T04A 4XTRD 4GS7B 5IT2L 5C09B 1E4XI 1RUPH 3WO3B 1KPUA 3LKRB 2AV7A 4NHUB 4NWUH 4WO4D 4YHKL 4YDLB 3FQTA 1KEGL 3D25B 3LKOA 3RL1B 3QUYC 5T1KD 1FSKB 4LEXH 3HR6A 4LIQL 1CGYA 4LRNL 1ZLVH 5D8JL 1HSBB 2OL3L 2MHAA 1B0RA 3MOAH 4XP4H 5C0EA 4PRPD 1IQDA 5JUEL 3IDMA 4PJXF 5D7IF 1IM9B 1YEFL 2VDNH 3EO0A 1I8LA 1F8TL 4ENEC 3BJ91 1J88A 2EECA 3H9SB 1X5LA 2M26A 4S1DC 1LGVA 2FL5A 1A5FL 3SOBL 3VWJA 1SVZA 1WC7A 4B50A 5DRXB 2XTJC 2AK4D 1YN7A 4H1LB 1P7HL 4GMSH 1WLHA 4XMPH 2WWMD 3X12B 5AAWA 2VXUL 4OZFA 3KPSE 2JJWA 5J7CC 3ULVF 1FZKA 4L4VD 3RVWC 5CIPA 1R0AL 4TQEH 1K4CB 3IFLL 5GGRA 3BZFB 4TNVF 5DT1L 4M1CD 1MHCB 1FLTX 1HI6A 3FT4A 5EU3A 3LN5B 4H5SA 3R06B 1GPOH 1P7QD 1I4FA 4RFEB 5EFIA 3LRSA 3ULVD 4LSVH 2CIIA 3NFNB 4TVPE 4PIRF 3SPVA 5I6XB 1XR9A 2XZAL 5C0AA 5J6GB 2EIBA 5HHQB 1VGKA 1DR9A 1RUAL 1V3LA 1JWUA 4I9WD 2A6DB 4HIJB 3BESR 4NWTL 1OARH 3MRCA 3FO0H 4JFQB 5BZWA 3DMMB 2QHLA 2WBJA 1J05A 3IGAB 1ZLWH 1N64L 3VXPA 4XCEA 1XGQB 1Z3GH 2P5EE 1ZWIB 1Q9WB 4V1DE 4LLMB 2VLKA 4QXGH 1KIQB 4Z7QF 3MV8A 3W2DH 4TN9A 4LSUH 2BVOB 3BE1L 4JRYD 4YX2H 2BMKB 5GS0L 5F3HA 5I30H 1BQLL 1NANI 3RZWA 5FA4A 3N1PC 4PRHE 5HHNA 3PGCB 4ESKA 2Z93A 4M62H 4OI9A 3KAAA 1MFBH 4AQOA 1EO5A 1RIUH 1NBZB 4MS8D 5JZ7D 3WE6A 1IGYA 1MCOL 3QZWB 1N6UA 3RVXC 5KTEH 1KJ2A 3ME0A 3LN4A 1SYVB 1NJ9B 2F54B 4HKZB 5FOBB 5FUCE 4Y16A 5GRJL 1ZHKB 2OS7A 3TIEA 5KG9B 1MFDH 1OAYL 2KDGA 1WBXA 3L3OB 4OFVA 2MNUA 2W60B 2CSPA 3QIUA 5K93A 5IIEB 3SBWA 1ORSA 4DGVH 3G04A 1MPAL 2CK0L 3CC5A 2A73A 3T0EB 1HXYA 3DBXA 4YIQA 1NGZB 3KYNA 4PJCA 5IB1A 3PWPE 2NR6C 5EO0B 2J1KA 2VC2L 4YWGL 4M3JA 5ICYB 4OJFL 2ATPA 4S1QL 3PG2A 3QFJA 4JAMA 2DLIA 4G8GA 3KPOA 3QI9C 1G7LA 2BX5A 4P48A 4R7DA 3DGGB 2ZUUA 4TULH 4BK4A 3JV5A 1VEPA 2Y5TA 4N90D 3I75A 4CUCA 5K33A 2QADB 3RBGA 1TVDA 3TJEH 5SX5H 2LQRA 1Z9LA 3QUYA 1TENA 3BPOC 1NMBH 3TPKA 1NCDH 3ROLA 2AQ2A 3VA6A 4DTGL 3WJJC 2HLAB 1T04B 1NCAL 2SEBA 4DJMA 1KPUB 3U9UA 3WNNA 1JGUL 2AV7B 2ICEA 4L3ED 4NOBA 3FQTB 2NY0D 1KXQE 3V7AE 4YR6A 3LKOB 5DR5H 2VUOA 1P4BL 3C8HA 4X9IA 4LCWD 4RBPH 1Q0XH 1UXWA 2MHAB 1B0RB 4JDZA 5C0EB 1IQDB 3KXFA 3IDMB 5E08L 2YD4A 4LAQL 2HVJA 4UV7H 3EO0B 4IOSD 5HYJD 3HS0A 3TT3H 5F7NC 1Y6MR 3O4LD 4OV5A 2N4IA 4LL9A 2FL5B 1BWMA 3VWJB 1WC7B 1FGVH 5KSVA 1YN7B 3HE7D 2BY2A 1DBJL 4C56D 3Q3GA 4XPBH 2BNRA 2NZ9C 1GH7A 3VXQA 3S34L 4G6ML 2JLLA 4OZFB 1NKRA 1CBVH 4KMQA 4QYOA 2EYTA 2BCKA 2ITDA 5HGDA 3ULUC 1FZKB 3S7GA 3DXAD 2VZUA 5CIPB 2YPVH 5GGRB 1RPQA 5ITBL 3K46A 5EU3B 5HHPA 1HI6B 3FT4B 2EEBA 4UUJA 2C3WA 4H5SB 4F9LC 5M94B 3WHE0 4NPYA 1I4FB 4RZCA 5EFIB 3LRSB 1NCNA 2H32A 1QZ1A 5TE4H 2CIIB 3GM0A 3SPVB 5DC4B 2Z9TA 5FCSH 4RGOL 1XR9B 1Q72H 5D6DC 5T3ZL 5C0AB 4H20L 2Z0BA 4WVRA 1VGKB 5E8EA 5C1MB 3WKML 1OL0A 1JIBA 1JWUB 2R29L 1DLFH 3R0MA 1CFSA 3P0VH 1KBGL 4S0SD 3MRCB 5IVZA 1YPZF 5BZWB 3QEHA 2WBJB 1J05B 5TDOA 1QEWA 1JHLH 3VXPB 1CICD 4XCEB 1X5ZA 5H35A 1CDBA 2VOTA 2VLKB 4ZS6C 4F7TA 3MV8B 3R1GL 4TRPL 1JZ4A 4P3WA 5D4QA 4M1GH 4ONOA 5F3HB 4I77L 5GGQH 5FA4B 5HHNB 4KVCH 3MV9D 3QIBB 4W4OC 2Z93B 5JOPD 3BRFA 3HNSH 4K23H 3EO9L 4DAGH 3O45A 4OB5L 3WE6B 4OIIH 1SVCP 1IGYB 4YGAB 3K2UL 5DRNA 3DVNA 1G7JA 1UM5H 4E5XA 3I3BA 4CVWA 1KJ2B 3WLWD 1H5BC 3LN4B 4IOFD 3DSNA 4Y16B 3OKMA 4M4RA 3TIEB 2YKLL 1JPTH 1HHGA 25C8H 1WBXB 4P9HC 1RULL 2A77H 1A7NH 2VDQH 3UTPD 4HJJH 4UTBH 1RI8A 5HHOA 4XNUL 3UTTA 1E0OB 3QIUB 1ORSB 3QI9A 3G04B 4RRPG 3RPIA 2B1AL 1KJ2L 2ITCA 2A73B 3CC5B 2VR4A 1HXYB 3DBXB 2CKBH 4YIQB 3KYNB 4PJCB 5IB1B 4IEFB 5GZNC 3IDUA 1Z9OA 4WI6A 3RUGA 2ATPB 3QFJB 4KTYA 4G9FA 3CMOL 3N85H 1J10A 4JAMB 1FL5A 4G8GB 3KPOB 3WJJA 1G7LB 1BPVA 1ZVSA 5GJTL 4Y0GA 2Y5TB 5KVFH 3I75B 4UI2A 1MJ7H 1WZLA 3H3PL 3U4BH 4X8JA 4KC3B 3QUYB 2Y6SC 3TGXA 5D2LF 3ROLB 1JGLH 3IFPA 2NXZD 4KDTC 2YD7A 4UV4H 4Q9RL 1X6LA 2VH5H 4HK3J 5M95B 2NY6C 4XNXH 1K8DA 2IQAA 3LN9A 2SEBB 1FG2A 3U9UB 2ICEB 1WV7T 5E2WL 4YR6B 3H9YA 3P9MA 3VRLF 3OZ9H 5CZXD 4F8TA 4NNPL 2V5TA 2XTJB 3LKQA 4FNLL 4KQ3H 1UXWB 2FGWL 4JDZB 3WEXA 5IB5A 3KXFB 1I7UA 2HVJB 3VD3A 2ZOLA 4Y1AE 4OCMC 3W0WA 3HS0B 4Z7OE 3ARFD 5CFHA 4OV5B 4I0CC 5CILH 1BJ1H 1MJ8L 5KSVB 4F9LA 2Z31D 5DC0A 3GSQA 5GPRA 2BNRB 3VXQB 5CBEA 5ADOH 4YC2C 1FFPA 1N59A 4QYOB 2EYTB 2BCKB 2ITDB 4IMLA 5HGDB 5ICZA 4E41A 5D6DA 1HWGB 3E3QE 3L5JA 3S35X 5HHPB 1MLBA 5KSAD 4UUJB 4U1NA 1UWGL 4NUGL 4XCCL 2PKDA 4NPYB 4RZCB 2BJML 3C60D 2H32B 3TH4T 4OFYD 3C5ZC 5JHLL 1KFAH 4WUKL 2OMBA 2Y07L 5T5NG 5E8EB 3UPAA 3ZKXC 5DSCA 1VHPA 1JZ8A 3CXDH 1CFSB 1RU9H 5DVOA 5AEAA 3CFCH 3L7EA 5IVZB 5FM5O 4W4OA 3QEHB 4IDLA 5TDOB 4NBYB 4OGAC 3IAPA 1QEWB 5AYQA 1U91B 4P2OD 5H35B 3OJ2C 2EO9A 4F7TB 3QSKB 1YEDA 5FDWA 4NQCA 4BZ1H 3U1SL 1JNNL 4ETQA 3FHAA 5E5MA 3CPLA 2R69L 1XR8A 1H5BA 4UT7L 2BK8A 4ZDHA 5LXGH 1CGXA 2F8XC 3MRNA 3O45B 5FV1L 5AZ2L 3TA3C 5IGXH 1JZ5A 5DRNB 3DVNB 1G7JB 5FYKD 4E5XB 1UCBH 4JM2C 5E9DE 5ISZD 1E6OH 3PE9A 1TZIA 4R26H 2CLZA 3OKMB 1BREA 4XC3L 3MGAA 4BH7A 1HHGB 3TZVD 4PRIE 1IL1A 4GRWF 3I6KA 4HPOH 3FONA 5HHOB 2I27N 5AG9A 3UTTB 1RZ8A 4P3CL 4YH6A 5I1GH 2BY3A 3QWQB 4OLXH 5TE7H 2EDDA 2WNGA 3QI9B 4W4NA 3WNMA 3MXWL 3RPIB 3VXMA 1NC4A 4D9RE 2ITCB 3O0RL 1WT5C 3WSQL 1GL4B 2D0HA 1AKJD 15C8H 1BFVL 1GHFL 3BPOB 1TQBC 3RUGB 1ZE3C 3NCYS 3E8UL 2NPLX 4G9FB 3TBTA 5A2LH 1FL5B 4KDTA 4X6CA 1ZVSB 3KGRA 2A38A 1MWAH 4BQBA 4X8JB 2XN9E 4WW1A 4HUUA 2X9XA 5L7XH 4X4XA 3BD5A 3FMGH 1F02I 3IFPB 3D69A 2WANA 4PRNA 2FWOA 4S1SL 1MF2L 4P2QE 1RFDL 3F7PC 3KYMA 1K8DB 2IQAB 4U2ZA 3C6SA 2V5MA 3OAYK 1FG2B 2WQRA 5ID1A 1JHKH 1CLCA 1TNMA 2I9TA 5L2KD 2V7HA 4DKAA 4HHAA 1QA9A 1R5WA 3P9MB 3PGFL 1J8KA 3LKQB 1KOAA 2EE6A 8FABA 1A1MA 5D7LD 4TUKH 5FHAL 5IB5B 3WEXB 4X6EA 1I7UB 2IANA 2ZOLB 4RMWA 1NKOA 3KJ6H 4QLRA 3W0WB 3SDDC 3LEYH 3WXWH 4PJFA 1EFXA 4W6YB 5GGRY 2IAMD 5HHVL 3GSQB 5CBEB 1OW0C 2UZYB 4R8WL 3C5ZA 3DURA 3Q2CA 3FQRA 1FFPB 1N59B 35C8H 3PP3K 1PFCA 1PGRB 4KV5F 4IMLB 1KYOJ 3VXRA 5ICZB 4E41B 1DBAH 4G3YH 4FQIH 3V6FA 1IFHH 3MOBL 1MLBB 2ERJC 3ULUL 1UKTA 4U1NB 2H6PA 4AG4L 1U95A 2WBKA 3JWNC 5E8OA 4J4PC 3D3VD 3CAFA 4MQXD 1NGPL 2MKLC 1AXSA 1L7IL 2IFGA 3I3EA 1ZGLM 4R2GD 4HBCH 2YSSA 2E7CA 2Y36H 4HLZG 3QB7C 2AABH 4LLUA 2BVPA 1LEKA 3BI9X 5DSCB 1BM3H 1J8HE 1IEHA 1QSFE 1MRCH 3L7EB 4WFHD 4POZD 1TLKA 2RAMA 3J7HA 5EULV 4HUWA 2DQTL 1N2RA 3GB7B 5F6IC 1GIGH 3L5WA 4CU7A 1P5UA 2DLHA 4O51A 1IARB 3TA3A 1Y18A 1YEDB 4YXKH 5FDWB 4NQCB 4ETQB 2WINA 5HD8D 1KIRA 2ZJSL 4JM2A 5EBWA 5DZOA 3IS1X 3N50A 4P5TD 5E5MB 3CPLB 4LOUC 4L4TD 1XR8B 1H5BB 3H42H 1RUPL 4ZDHB 4NWUL 5C7XH 2E6QA 2DBLL 1AR1D 3MRNB 2NY1D 4NM8H 3SE9H 4XP4L 4XPHH 4PRBA 1HHJA 1NC2A 5C0FA 1TZIB 2NY7H 2CLZB 3BKYH 1HN1A 1WT5A 4RGNE 1I9IH 4BH7B 1AO7E 5LJYH 2F19H 1IL1B 1I3VA 3T2NH 2XG4A 3HG1A 3FONB 4U1JA 1IMHC 1F2XK 1RZ8B 4P9HL 2Z4QA 3HN3A 2V9RA 1I75A 2G60H 3VXMB 2DF3A 1NC4B 5E2VH 2X1OA 2OYPA 4GQ9H 4PRPE 3OJDA 4IRZH 1QSVA 4HXAH 1GPOL 2MSPA 1V3JA 4U6HA 4JFZH 3TBTB 4LSVL 2VQUA 4N1EA 4X6CB 1UKSA 2J4WH 2NY6B 5ACLA 1MRFL 3B5TA 3O6KH 5IW3A 1BWWA 2AK4E 2H2PD 2NY2C 5JXAH 4OZIF 5C08D 1NCUA 5IQ7H 4JR9L 4FXKA 4WW1B 4HUUB 1G0YR 4X4XB 4J8RA 3FO0L 3TM6A 2RR3A 3D69B 4HMDA 4PRNB 3KPLA 2FWOB 2O93L 3TVMC 5EA0L 1Z3GL 3KYMB 1JF6A 3KLSA 2BVYA 3C6SB 4QXGL 1RZ7L 5ID1B 2I9TB 3SDDA 3C87A 2V7HB 4LSUL 1MCQA 2ZUXA 1QA9B 1R5WB 4HHAB 4YX2L 2J2ZA 3ZYIA 5I30L 1Q8MA 2PF6A 4LKCA 4BJLA 4M62L 1A1MB 4PB9H 1MFBL 1RIUL 3BMVA 4X6EB 1T1XA 2QKIA 1OW0A 3L1OL 3H3BC 1A6WH 5E1HB 4YC2B 2IANB 4I9WE 4MSWA 5IEHA 5I9QC 3VGEA 2FLBT 5CWSA 4PJFB 3LKNA 1MH5A 1EFXB 5KTEL 3EYSH 3SE8L 2CKBA 1GOGA 4J4PA 2DQGH 1CXKA 1F3JA 5F8QC 3FO9A 4NIKB 5H94A 4LLWA 2E6JA 3ZYJA 1MFDL 3C5ZB 2X05A 4L8SC 3DURB 3FQRB 1IKNC 2GW5A 4ZO7A 4JRYE 4PP2A 3MNWA 2ZG1A 3VFMA 3VXRB 5A2KH 3RHWF 3MLYH 3C6LD 3ZKXB 4Z7QE 4DGVL 2H6PB 1U95B 4WTZA 5E8OB 3SKOA 1OTSD 4PRDA 1AXSB 3Q48A 4EDXA 2YSSB 1T66D 4DUXA 4LLUB 3TLRA 2BVPB 1LEKB 4P2YA 3BYTA 1RIHL 3QUZC 4HT1H 2DQCL 2JKXA 1OM3H 4K8RH 3VFSA 4TULL 4G8FA 4Y4KD 5D7JD 1JNLH 3RVTD 4I0PC 4HUWB 1N2RB 3MJ9H 5C0RH 3L5WB 5JW3H 3S36H 4JO1H 4O51B 4KK5D 1NMBL 5CGMA 2CR6A 5FYJD 3TA3B 1LP9F 1Y18B 1CTNA 2BHYA 4F37F 3N1FC 2WINB 2HKFL 1KIRB 4JM2B 5EBWB 1DBML 3Q6GH 1I1RA 1MCSA 4M7KH 2F5AH 4TNWK 3ARBC 3B2VL 2I24N 1OSPH 2CDFA 1H3XA 5DR5L 4NKIH 5BVJA 1CL7L 3UAJC 2GJ6A 1Q0XL 4FG6D 1XAUA 5GGTH 1TIUA 3CFBA 1V3KA 4PRBB 1HHJB 1NC2B 5C0FB 4OLWH 1R3IL 4GBXD 3N1GC 2Z8RA 3TT3L 4XCNA 3ZZ1A 1VFBA 2OR9L 2YD8A 4J23A 4J3SA 5GIRA 1TQBB 3HG1B 4U1JB 2FX9H 2R4SH 4XPBL 5E6ID 1BQSA 4X4ME 2Z4QB 2NTSP 2XIDA 4MXVF 1NGYA 4OFPA 5C9KA 2QBWA 4NT6A 4LCWE 3HE6D 2DQHH 2YPVL 4I3GA 4ODTL 1J1XH 3A6CL 2V5RA 4LGPB 3OJDB 5I17A 3ZHKA 4X4ZA 1AQKH 4UDUA 3BP6A 4G7YL 4Q9BA 3GO1L 2Y06L 4U6HB 5TE4L 4Y4HC 3TVMA 5EDXA 5DD1L 5DJYA 4WRLA 1OPGH 1N8ZA 1Q72L 1VFUA 2E8YA 2PNDA 5CP7A 1MCCA 2ADGA 1YEKH 4C56E 3VFNA 3NCJH 1DLFL 4FXKB 3P0VL 1DQML 4UT6H