2XQYG

Crystal structure of pseudorabies core fragment of glycoprotein h in complex with fab d6.3
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
216
Chain Sequence
QVQLQQPGAELVKPGASVKMSCKASGYSFTSYWMNWVKQRPGRGLEWIGRIDPSDNETHYNQDFKDKVTLTVDKSSSTVYIQLSSLTSEDSAVYYCGRLGYVYGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords ENVELOPE GLYCOPROTEIN H
publication title Structure of a Core Fragment of Glycoprotein H from Pseudorabies Virus in Complex with Antibody.
pubmed doi rcsb
source organism Suid herpesvirus
total genus 41
structure length 216
sequence length 218
chains with identical sequence J
ec nomenclature
pdb deposition date 2010-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqyG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqyG02
4KTDL 4CKVX 2DOCA 3QPQD 2OBGA 4L8DA 4QRPE 4BQ6A 2AK1L 3PWNA 4WVRA 4PG9A 2OQJB 2YC1B 4XVSH 2EE3A 3ILPA 4ETQB 5MHSE 3T65B 3QNYA 1BQHB 1ORQA 4LVOC 1IC7H 1RUKL 4LARH 4G6KL 4POUB 2ZZUT 3VE0A 4HBQA 2EIZB 3OKEB 4WGWB 5FB8A 4GKZA 3TC9A 1QLEH 5C0JB 1T2QL 2CD0A 2Q7YB 5HHVH 1CLOL 1CD0A 4PRNB 5EORH 4PGEB 3TJEL 2FIKA 1R3LA 4I3SL 4ZUVA 3KLSA 2OI9C 3DRQA 5E5MB 2FX9L 3GO1H 4HXBH 4HSQA 1T6WA 3U1SL 2LVEA 5JW4R 1NCAL 1I8LC 4X6DE 4TYUA 1BMGA 2YEZA 1IC5L 1IGJA 4BH7B 1N8ZA 2R0KH 1FDLL 1SQ2N 2FR4A 4S1RH 4X6BA 2I9LA 3P30H 2PO6A 4PJCE 5LCVL 5C6TL 4B41A 3VFNB 2YUZA 4I0CC 1CVRA 5HHMB 1NANH 4FZEL 1XIWA 5I1EH 4G8GB 3MQIA 2AJVL 2A73A 3VXME 5BW7A 1S9XA 1A2YA 5EOCH 1S9VB 5BV7B 3OKNA 4YJZL 5HHMD 2ZPKH 5T1LA 1DQML 2QV2A 1MNUH 4G8GD 1ETZA 4OZIE 4IRJB 2GJ6E 3QIUC 3OKLA 5EZOH 1EZVX 3MJ7B 5BJTA 5HHNA 4JKWA 5F88B 2V2TB 1JUFB 1T7XA 2H1PH 3SCMA 4PGDB 3PL6B 2YA0A 4IRJD 5IW6B 1ZGLP 1RZIA 2ZNWA 2CLVB 5IWLC 4OD1H 3FQUB 2JKXA 4LSUL 3F7RA 1KJ3H 1VENA 3VW3H 4YHNB 5FKPA 2DLFL 3PL6D 4NQSA 1I1YA 1UVQA 1J05B 4MD0B 2EYSB 1CD1B 3WUZA 1XCTA 1XR9B 5D7IF 4DEPC 1HEZB 3EFDL 4RMRA 4LRNH 5LAXA 4ODHL 3GUTA 2R4RL 1JGUL 5C0EA 4NHUB 4RGOL 3GSQA 4PRBA 3TN0C 5IVXF 3TBTA 1KPUA 3QXAA 1CTNA 2I60H 5ESAA 1ZHNA 4FQXB 1K8IA 5EIQA 4LPCA 1G0YR 3E2HC 4FQXD 3S8WA 1MVUB 3MGOB 1KLFA 2VL5B 2GKIA 4KHTH 3HB3D 4G8FA 3ZSTA 5I1KL 1JHLL 3MRMB 3QUYB 2OJEB 4G6AD 1HCVA 5J1TC 1M6OB 3I50H 5EBLA 4XBGA 1MH5A 1MFAH 1FNAA 3K2MC 4F7TB 4S1QL 1ACYH 3RP1A 3QUYD 2R39A 4Z7OF 3QDJE 1CGTA 1XGRA 1EO8H 1QSFE 2MNUA 4ISVA 3CVHA 3QG7H 2DD8H 4MA3A 4NZDA 4K3EH 4MJ4A 5FHAH 4PJIE 3K80A 4RCAA 1UWGL 3HI1A 2XKNA 3ZTNL 4GMSL 3EO0A 3FONA 3KPLA 4YGAB 5DD1L 5A16A 5ESQA 3SGKC 3WXWL 5I1DB 5SWQB 7FABH 4RFEA 4GAYB 3D48R 2Y7QB 2ITDA 5BVPH 2OP4L 1IZKA 3STZA 2R2HA 3C6SB 2Y9RT 3SQOL 5T1MB 1EIBA 2O5ZH 2V5YA 2YZ1A 4XNUH 3BT2L 5I0ZA 5DJCA 5TF1H 3QULA 1NH6A 1QBMH 3VXPA 5HHPA 3P4MA 3RVVD 2YD9A 2P47B 1FNEA 1L0XA 2YBRA 3LSOA 1Y6NR 2IQ9H 4YE4H 3WSQH 3PABA 3KPRE 2HP4A 5EB9A 1NDMB 3A67H 4DN4H 1P69B 3GSXA 2DQDH 3I02B 4ZOEA 4LSTH 4K7PH 4DGVH 5E2VL 5IESH 1CXLA 3WFHA 1I9RH 5DWUL 1FBIL 3T4YA 3BP7B 4XPGH 1A6TA 2EDLA 4GW1A 3CDGB 4JFXA 1BF8A 4X5XA 5ISZB 4LCCC 4GFTB 4GRWE 1KJ2A 2FHFA 5T3ZH 4YK4C 4DKEH 1FG2A 1PQZA 3GSUA 5D7IB 3KJ4C 3PV7A 1YEEH 5ISZD 1HHGA 3NZHL 2UWEA 3S34H 1I1AA 2V7NA 4FFVC 5KS9E 5EFIA 1IQDB 5IVXB 3G6JF 2BOBA 5E2JA 1YEHH 2WWKO 2VH5L 5JMOC 3AXLA 1S7XA 3C09C 3FFCA 4D9LL 4FFYL 5D7JB 3WMSA 1H3TA 4TVPD 2GUOB 8CGTA 3G5ZA 4NPYA 1KPRB 1JWMA 1MFEL 2J8OA 3RJQB 1NMAL 4FFZH 1M7IB 5D7JD 1YQ2A 4U1KB 4Z76A 4NO3A 4EI5C 1EJOH 4MJ5A 1IE5A 3I75B 2NXZC 3L5WB 1J1XL 4H0GA 1TZIA 3H3KA 4KWUA 4ERSH 1UH2A 4LCYB 3ULSA 2R0ZH 1R3KA 3TO4C 3TBSB 1UCBL 3B9KB 1QA9A 4KKAC 1BVKA 15C8L 5F7FA 2WIIB 5IB3A 3IDUA 1E6OL 1OSZB 4X98A 2NW2A 3B9KD 4HFUH 1IM3A 3GSVB 3MLZH 4Z7UF 2DTMH 3QZWG 2Q3AA 5HYJB 3U9PL 1U3ZA 2R1XA 4N0UA 5IT2H 4UIKH 3RZCB 3JV0A 4Y0GA 1FZOB 4JR9L 1F4WL 2WNGA 4JJ5A 3VFPB 1B4JL 2XNAA 4QRUA 5CHNA 4P9HL 5HYJD 1BOGB 3WFBH 4LU5L 1G84A 3FZUD 3RZCD 5I74B 2NNAB 5JUEL 1T21A 4UT6H 4YH6A 1ZWIA 1GPOH 1X6LA 2ZOKA 2DBLH 4MSWA 4U1NB 2VNCA 4LNRB 3L7FA 1FC1A 2UY6A 3KPMA 1D6VL 3R4DA 4OCSL 1JTTA 5KSBA 2VZTA 2ARJQ 1AO7B 1G9MC 3GNML 4NZUL 2HG5B 5I1AA 1AO7D 3CLEL 1HIML 5DO2D 3ZHLA 1SY6A 3L3IB 3QH3B 4RAUB 4HKJA 3WNLA 5I0DA 2CR6A 2NY5L 4U0RC 3DXAA 3T2NH 1WAAA 4M03A 2CK0H 3F6LA 4G42B 4KDTC 1D5ZA 4AEHH 2NW3A 2EDJA 3QQ9C 5D7SH 1OP3H 3NCYS 1LO5B 3BKCL 4IMKA 4AY0A 2AV1B 1QR1B 1NGYA 1UZ6F 3G6JB 5D5MF 2ICWB 3S9DB 3DX7B 3BH8A 4FMFA 1KELH 3RAJL 1W0VB 5D9SA 5FO7B 3T0WA 3WXVH 4IOIB 1MRFH 1X5LA 2NY4B 4P46C 5K9KA 3FO2A 1CFNA 3KPNA 1U93B 3OAUH 3A0OA 5AYUL 3EHBC 3PGFL 3VFWA 4APQB 1K3IA 3W2DH 2NY4D 2IF7A 3MACL 3QUZC 4S10A 4WFHE 1ZANH 4ORGB 4DCQB 4OKVA 4APQD 3QR2A 2VZ1A 3E6FB 1HI6B 1HQ4B 5JXAL 2CLRB 1CDGA 1OGAE 1CZ8L 1UXSA 4XCYA 5DRNB 5IHUL 1K2DA 4JFZL 1MWAH 2VKWA 3UTTA 5DD6A 4CVUA 3EYSH 3A6CL 1D5MB 4Z7UB 5MP6H 4MDJB 3PUCA 2IPUK 3RWIA 1T0MB 4WWKA 1OQOA 4OLZH 2R0WH 3H2WA 5C07A 4POZD 3FN3A 3UBXB 4WUUA 4FXGB 5D7KD 1KIPA 3DJ9A 2AV7B 3AY4C 3QUXA 4QXUH 2MPAH 2ICEB 4Q0XH 5D1XA 3F58H 1EV2E 1XF1A 4JKKA 3QYCA 3SY0B 5EC1B 2BERA 2HN7A 3IXAA 2FGWH 4HIXL 3PNWA 4JM2F 2HTLD 4YBQC 4U3CA 3GMNB 1MHCA 1A9EB 3BUYB 3CCHB 4H1LG 4K9EH 4KQ3H 1NMBL 1UXWB 1SEQH 1YY9D 1JCKA 4P9MH 5DMGC 3OB8A 2VXSL 2VIRA 4PG2C 3EZ8A 2YUWA 4K3HA 4RFNC 3GJEB 1W2KT 1CS6A 2P7TA 3ARBA 1OF2B 4MNGA 2P45B 1F4YH 4FQJH 1F3DH 2W59A 5HYSB 4HDIA 2X4RB 1A7NL 2QSVA 4D2NA 3HE6B 1JNHA 3VXUE 1ZTXL 1RPQA 1RZKL 4XHQA 2BVPB 3TT3L 1XF4A 5IFAL 3B9AA 4H26A 4P2QB 3VI4F 4WEBL 5KVEH 3VXRA 5IB4A 3PWVA 3HE6D 5DJ2B 3BDXA 1NCWL 4JFDB 4J8RA 1BQUA 1N6UA 3ULVF 4OJFH 1VFAA 1I3RB 4P2QD 4FQQB 4PS4L 4HK3J 3GZKA 4WUKL 4BUHA 1I9IL 5H35A 5B22A 1T1ZA 4FA8A 4JFDD 3VD3A 4OLUL 1ADQL 1BVLB 2Z35B 1VADA 4KHXH 4J3TA 4Y2DB 3CFDB 2P8PB 4P49A 4AL8L 5F9JB 1NSNH 1K8DB 2YKLL 4XCEB 5BXFA 1XF5A 3WKML 4U0QB 1JV5A 1WIOA 3EOYG 3JWOL 4Y2DD 3OKKB 3MV9A 5EBMA 1AI1L 4LDEB 4OIBA 4XWOD 4NP4H 1LO0L 4Y5XC 1EO7A 1QSEA 5I1CL 3UC0L 1NBVL 4LDLB 2P8LA 1FL6B 2AJXH 4QCIA 2G75B 3N85H 1HHHA 4NO5B 3QCTL 2GITB 4PP2B 1TJHH 5EPMA 2EH7H 2ZKHH 1JZ2A 3ZL4H 3WEXA 4Y4KB 4LLMB 4KAQL 4PB0L 1X5AA 2VR9A 4TRPH 1FVDB 4QEGA 1DBJH 4KMTH 5IROA 4MAYC 1IILE 1KIUA 4Y4KD 2VE6B 1IKNC 4NYLB 4GMTH 1BFTA 1Q8MA 3V6FA 1RIHL 3GSWB 3IDJA 3KLAB 3WIHA 5DSCA 3SDXF 5I8KH 1I7RA 4PJDA 4U33A 3GI8L 2H8PA 3HTLX 5EZJA 1P2CB 2EXWD 4KKLC 5CS7A 3H9HB 3QPXH 2YD7A 4BK5A 1TJGH 3PP3K 3FQTA 3JWDH 3B4NA 2X2YA 2OZ4H 1L7TL 5F1OB 1MCPH 3F7YA 3VFMA 1AGFA 2C26A 2VXUL 5EC2B 2OS7A 1YEGH 1OCWH 1UWXK 3FFCE 4HIEB 4EI6B 5K9OB 4LPWA 1RURL 4HWBH 4JM2B 1S7WA 3QDMA 4C59B 5CJ5A 1F3JB 5KSUA 2O5XL 1C7SA 3B43A 4UT7L 5IMKB 1DCLA 1T3FB 4XCNB 3SDCA 4JM2D 3NVQA 1BQLH 3BVNA 3HC0B 4XP1L 3TEUA 3LEVL 4IHOB 2W65B 4WW2A 4JRXA 3QEUB 5BZWB 1XMWA 4R7DA 4UUJB 4KJYB 1RZJH 2BSSA 4J3VA 3QRFM 1GXEA 3CUPB 4BZ2L 1PLGH 5FM5M 5B38G 4L1HA 4Y4FA 3RPIA 1YMHA 3VFGL 1U8PA 5TF0A 4ODSL 5IIEB 4PJ9B 2R23A 1R5VA 2RIKA 1YEFL 4FQ1L 4XCFL 1WZLA 2W9LA 4OT1H 1WT5A 1Q0XH 2DQEL 1MJUL 2CIKA 3LS4L 4QWWC 4ZS6D 4HMCA 2JELL 4U1LB 2BVEA 4WEUD 4PJ9D 1LK3H 1FAKT 3KHQA 1W8OA 3PGCB 3BPNC 4HT1L 2VDPH 3GSNL 2CRIA 2GJJA 4AENA 4P5TA 1RIVL 2P24B 1CDBA 3KPSB 4YHYB 2VABA 1VGEH 2R2BA 3AREC 4U3HA 3IYLW 3O3UN 4HZLB 3DX8B 1VACA 3HZMA 1NCBL 3KPSD 4MJ6A 1JHKL 4PJEB 4LHUG 1DL7L 3HFML 5IQ9A 2DLTA 2ZG2A 1RFDH 4IJ3C 2ARWA 5KSBE 4X6EA 4F2MB 2ZCKL 4K55A 1CU4L 2D9QB 5FYKH 4WFED 1GJIA 3TCLB 5F71A 3OF6D 5FA3B 1UWEH 1Q1JL 4MQSB 5KANG 4DZBB 3L3HB 1PZ5B 1AQDA 2FD6L 4MAUL 3EJYD 4OGYH 2IH3B 4G43A 5A1AA 3MBXL 4JHWH 4NFDA 2ATPA 3RTQA 4L8SA 1Q94A 4XBPB 4PJBB 4NC1C 5DEZA 2BC4B 4RGMC 3DXAE 1WAAE 3H9ZA 2DI7A 1P84K 5DI8B 2GCYB 5C0FB 2H2SC 3NN8B 2XT1B 3IFPA 3BWAA 4P3CH 5CJ8A 1XCQA 3VG9B 4I48B 1HILA 3MCG1 4LSRH 4U1HB 5TQ0H 3TT1L 4LNVA 3PXHA 4Y5YA 1JI2A 4X9IA 1I4FA 3LS5L 4LVEA 1TPXB 4EDXA 5D93C 3K0WA 5HHXL 1J10A 3ARVA 5MENA 5IMOB 3CC5B 2A6KB 3H9SA 4M1DH 4QHMB 3I9GL 4P3DB 1I9EA 3VWJB 2YOCA 3TA3C 3S96B 5MI0C 3EW3B 1CICC 2HLFD 5E6IB 4HEME 3D3VB 5BO1L 2W92A 2HMIC 5H2BA 3RGVA 3MBEA 3MV11 2P5WA 1N4XH 5DDHA 1NCUA 3RQ3A 3VWJD 4K8RH 1DDHA 3UTZB 1P1ZB 2ITCB 3FRUA 5E6ID 2YD1A 3D3VD 4Y5VB 4LSVL 3V5HB 4R96B 4I4WA 2JF1A 5C9KA 4DUWA 4XNYL 1PG7L 3W39A 4M7LL 3OAYH 5CILH 1WWAX 1DBBH 4EIZC 5IBUB 3CSYB 3HS0B 1KN4H 3MODH 4A6YL 3PDOB 1CGWA 1RZGB 1NCDL 5B3JE 3BZ4A 2HT3C 2G60L 3WFEL 4IOSD 4ENED 4NKQB 1RZKC 3MNVB 2FO1A 1FH5H 4PJAB 3OG6B 4Z0BH 2IWGA 3N9GH 3GJFA 5GSVA 1BFSA 4GG8B 3ZDXE 4HGWB 5GGQL 3MRIB 3D6GA 4UILH 5CINH 3OXSB 2HT2D 4MQ7A 3EYFA 4R4ND 5CD5C 4OCYL 5GS1B 4K94H 1NAKL 5I30L 3LD8B 1F97A 3BHBA 2PTVA 1BREA 5H37G 3TFKD 1PY9A 3DX6B 3S3PA 1KG0A 1YYLL 3OKOB 5HPMA 4RWHA 1OPGL 2VISB 4I8DA 2GFBB 4YBHA 3WE6A 1H0DA 3GKWL 5CWSA 1A6ZA 2K3TA 1A9BA 1G7PB 2CK2A 2A9NH 4LQFL 3T08A 5JPMB 5D1ZB 5FGCB 2R4SH 4NKMA 4FQCH 1J1PL 5DQ9A 1UM5L 1EMTH 4HH9B 5D1ZD 1QHOA 5IGXL 2AEPL 1MCHA 3BAEH 4LF3A 4F7CA 1ZV5A 4X6DF 1AHWA 2CMRH 2FJGB 4FQPA 2XPGB 4KGLA 1P6FA 1RJCA 3BPOC 3MROB 4OTXL 5L6YL 2PCPA 3NFPB 1E4JA 3VXRE 5T5FL 3V6ZA 1KJVB 4PRHE 4XNQA 1YQVL 3LRGA 1AC6A 2WBJB 1QFUH 1U8LB 2XTJB 4KPHH 4O9HL 1ZHLB 1P4IH 3M17A 4KXZH 3Q6GL 3BWUC 4L3EB 3OKMA 2WBJD 1NFIA 2HFEA 4KK5D 2XTJD 5ENWB 1T03H 1J11A 4UTBL 3BMWA 1JIBA 4LLDB 4L3ED 2BX5A 1XGTA 4YZFE 4O2EA 5F1NA 1SJEB 4GKOA 4LRIA 4JDZB 3RU8H 4KJQC 3T3PE 3HUJE 5DUMH 1HKLH 1MVFA 1W0WA 4OZIF 2B4CL 2GI7A 2DKUA 2CIIB 5CIPA 4PJFA 1IAOB 4Z77A 3RIFK 4ODVL 4P57A 5DFVC 3ARXA 4JY4A 3X13B 3T0EA 5HY9B 3K4ZA 5I6XB 2VXQL 1KPVA 5I66A 1DN0A 4XGZA 5GZND 5BQ7A 3DUUA 3V6OA 3LN9A 1GCFA 1U58B 3GMQB 3GEWB 1GGYA 1J5OL 3TIDA 3ZKSD 1JFQH 5FECB 1W72A 2DDQL 4H8WL 4KI5C 4X7TA 5AD0A 3STBA 1IRAY 3FRPA 3O2WH 3U7AA 1S3KH 4I2XB 2IADB 4XCCL 5BCAA 2WUCL 4G8EB 4NQEA 5IHZA 3WJLC 1T80A 1MLCB 4PJDE 4YDKH 3QJHA 3HMXL 2BNUA 3SKMA 5J57B 4HCRA 4QRPB 5DEGA 5KSVB 3FT3B 3IJYB 3O3AA 2GY7B 2ARJA 1YECH 5F9DC 4YGVB 4CDGC 1IFHH 2AJ3A 4QRPD 1MLBA 1U42A 4L9LA 4R26L 5F44A 1KNOB 3CDCA 4QY8B 5I1GL 5GIRA 2EZ0C 5F1IB 2ZCLH 4UAOC 3JWDC 4R4BB 1U8QA 4X0KA 2K7QA 4NSKA 3BEWA 4JQVC 3IDIB 1UADC 5K9JH 2X4OB 1WFNA 1P7QB 4X80L 4HBCL 1HSAB 3DSFH 1DBAH 5D7LE 1FAIL 5JW4Q 5DD3H 1T22B 2FX8L 5J6GA 1ZXQA 1ZSDB 5IVZB 1NFDF 1P7QD 4NDMB 4WHTB 3SPVB 4MLIA 1A7OL 3G6DL 3T0AA 3KXFA 4RA0C 4X6DB 1HHKA 2VDRL 5DYOB 2H3NA 5KVMC 3FB7B 2EKJA 1MJ7L 4WTZA 1UCTA 3IETA 1FYTE 3AB0C 1RZJC 2E8YA 3EDKA 3MV7A 2P4AB 1FN4A 2E9IA 2VXVL 4PJCB 3SO5A 4NM8L 4LSPL 4XC3L 5EA0H 3VFTA 1T66C 2B5IC 4QF1A 5LWYL 4XVJL 2D03L 1KENL 1SBSH 5JNYB 3C8HA 4NGHH 1SVZA 5AZEH 3RY6A 3MA7B 4MMZC 5J3HC 3VXMB 1FPTL 3QHZL 2IFGA 1CDHA 1LEGB 1EHAA 5DJ8A 1T4KB 1MEXL 2YD8A 4GOSA 4QGTA 3S35L 5ICXB 4OZIB 3EZJB 5J9PA 5JR1L 3VXMD 3BYYA 5GZOC 3ARGB 3HNVH 2IAMB 3SDDA 4BM7A 3CH8A 2R1WA 3GMRA 2H9GB 2C7UA 1BLNA 3EJZC 2J12B 1N3NB 1INDH 3ARGD 2HKHH 2IAMD 5E4IA 5BV7L 3IVKB 4WI7A 2GK2A 2XG5A 2SEBB 1Z5LA 2RB8A 1F4XL 4JLRA 5EU4B 1BGXL 1EFXA 2R0LH 4GRWF 1YC8A 1I9JH 5F7NC 3FAXA 4XT1C 3MRPB 3C2AH 4OZGF 2Y1VA 3IS0X 4RGNE 4PP1C 4DQOL 5CJOL 3BP4A 3HC4L 4F15B 5TH2A 4OV5B 3CZJA 4FP8H 5CJQL 1AE6L 2NY1C 1QG3A 1TETL 4M5YL 4HUVA 2DJSA 5EUKA 3CH1A 5JXED 5HVFB 3P77B 4HUWA 4CU8A 2HKFH 1FO0B 5T1KA 2ENYA 5FUCC 3I3BA 1NGPL 4QRRA 4C83B 5AWNH 5CUSL 3X11A 4JKLA 3IFNL 1BAFH 4XVUC 2V7HA 4OB5L 5B4MC 2BVQA 3WS3A 5MENE 2VDNL 1P4LA 2A0LD 3LKOB 1UB5B 3FFDA 4GKNA 1U3HA 1DQDL 4JHAL 1ADQA 3H9SE 1S7TB 5IHLB 3U6RB 1I85A 1KF9B 2HLAA 4LOUD 1HKFA 1CLZH 4KJPC 5L8LB 1ODAA 4LLAA 2ZOLA 4YX2L 4ZXBC 3VCLB 3O3BB 1OHQA 1QSFB 2CR3A 1UM6L 1NUFA 2IEPA 1INQA 3ES6A 4PLJC 1XH3B 3GRWH 4PJIB 2BDNH 3VA2C 3D39B 3I6GA 1A6WH 1QSFD 2W0PA 1GC1L 3U2SB 2N1KA 4IOFD 5CZXD 3O41A 5M7QA 2OSLB 3ROOB 4JQXA 2NY0C 2HJKA 3VGDA 2E6PA 3D39D 3WIFB 4WCYH 4K8RC 4QTIH 2JE8A 1J8HA 4WHDA 3EAKA 2NMSA 2E3VA 3KS0J 3QWOA 4FXKB 1YEKH 3DX9A 3V0WL 2I9TA 1U91A 4J4PD 4M7JH 1DVFA 1OTUD 1IBGL 5JDSB 1NKOA 3QI9C 4KUZL 2KDGA 1B4RA 3KLHC 1A4KA 3NFSH 3LIZH 2Z8RA 3ZDYE 4NQCA 5SWZE 3KPRB 5J7CC 3TVMC 3UPRB 4G9DB 4AJ0A 4BYHA 2Q8AL 3ARFC 1MHHA 1Y0LA 2CLZB 1BFOB 5T3XD 3S36L 3KPRD 4NRYA 2AXGB 3EDJA 2RCSL 3LRHA 3QWQB 4S1SL 5C09E 4U1IB 3QO1A 3HMWL 2PTTB 3K3QA 2ILLA 4JCMA 3ARDC 5CP3A 4GRWB 1V3JA 3G6AA 4F7PA 3BP5A 4WI3A 3TO2A 3P9LB 3CPLB 1YN6B 3LEYH 1MIEH 4OZGB 3C5JA 4R2GB 2EC9U 4X83A 4WNQB 1ZMYA 4LARL 4D0CA 2RFXB 3WBDA 4YXKL 1VKXB 3LQAL 5FDWB 2HFTA 3L3OA 3MO1B 1WEJH 4D0BB 4RZCA 5KS9B 4UQ2B 3BKYH 1S7QB 4R2GD 2QQKL 2DKSA 3ARPA 5DEFA 2A2QT 4YC2C 2AJZA 5HHVL 3CVIH 5EORL 3FQXA 2Q8BL 3TIEA 4J1UA 2X4PB 3O9WA 4GG6A 5GRUL 4LKCA 4XPAH 3RL1A 3GO1L 1SYVB 1UT9A 4HXBL 1BIHA 3JTTA 3MRCB 4AG4H 4DTGH 2XZCH 5ETUA 32C2B 4NJAH 5EIIA 5TFSH 4TVPL 1V3MA 2BNRB 3OZ9H 3MYJA 2NYYC 2IANA 3T1WA 3GSNA 4S1RL 5AYQA 4Y16B 5TDNA 1AFVH 3BJ91 3W9EA 1D5XB 3KNBA 2GTZA 4W6XB 2BNRD 3ZTJG 1R3HA 3M07A 3MJ9H 5MERA 4CN1A 4Y16D 3S98A 3D2UB 2Z93B 3MJ8B 1AGEA 5EOCL 2I27N 2PYFA 4DK6A 1ERNA 4IRSC 1O0VA 3D2UD 1V7MH 4E0RA 2O61A 1KB9K 4ZUWB 3O81A 1WCBB 5JIKA 4EN3A 2MOVA 2AJYH 3MLWH 1T1WA 1KB5B 1CYGA 3A6OA 2HH0H 3VH8A 5FA4B 1KLUB 4JRWA 4ORZC 5F89B 1EHLH 4OD1L 5EO0B 2YD4A 3CZFB 3DMMA 2QHRH 1KJ3L 3O3EA 3VW3L 1R3IH 4JRYA 4WI5A 4KK9D 3GI9L 1P9MA 3V4VL 2DLEA 3QQNA 2X4UB 4LRNL 2QSTA 3ILPB 4JHZA 3QNYB 1GHFH 3VGBA 3WDHA 1FV1A 5DMKA 5HI4D 1ORQB 4RX4A 4CNIA 5F9WC 5C0CA 3V7AE 3HNTL 5IMMA 1JNLH 5ELIA 2G9HB 2I60L 3TJHC 3U0PA 5E5RB 4JO3L 2RGSA 3DI2B 3P0YL 3T04D 2CRZA 2R56L 1UKSA 3QBTB 3OHXA 5C92A 2F8OA 4XP6H 1CFQA 4WRLA 5DJ0A 2FIKB 2QQLH 3BJLA 4PLKC 4ZUVB 4ZFOA 2GK0A 3LQZA 5GQBA 4HQQH 1NJ9A 5DD5H 1CFTA 4CMHB 1JNNL 3I50L 2YEZB 1LE9A 4XP4H 1MPAH 2VLRA 1N8ZB 2CKNA 1ACYL 5I75B 3NIDE 4NKIH 3GMLB 5D70L 3ULUE 3EYOB 1T5XA 2AI0H 1QFWI 3BMVA 5HDOA 4JFEE 2DD8L 5HDBE 1J9CT 1ZVYA 4K3EL 1QBBA 2DKMA 1XIWB 3QFJE 2DLGA 2MMXA 5IBTH 1B90A 2A73B 1S9XB 1A2YB 3MRFA 3OKNB 5T1LB 1XIWD 3N50A 2YD2A 1ETZB 5FUZH 2CXKA 3OKLB 2HJLA 1TITA 5T1LD 3THMH 5GGSB 4OCRL 3L3JA 1OGAB 4PJHA 5TF1L 1RZIB 1QBML 4YO0B 1CBVL 3C60C 3FHQA 2MFNA 2M1KA 2CQVA 2VQTA 1G9NH 4I3RH 2YHGA 1RZFH 1QBLH 1OGAD 5FKPB 2GJZA 1H9VA 1I8MA 4F37F 4NQSB 1I1YB 1UVQB 4L5FL 5LXGH 2V9TA 4NN7C 1XCTB 2YD5A 4UB0H 5D2NC 4DN4L 1FL5A 2PF6A 5LAXB 2DQDL 1UJ3C 3GUTB 4F9LC 4BSWA 4K7PL 1DUYA 4DGVL 5IESL 2V5RA 5C0EB 1HHJA 2UWEF 4TNVK 4I9WE 4YPGB 1C12A 1RHHB 1JTPA 3GSQB 4PRBB 3S37H 3MLVL 3MR9A 1JK8B 3D0VA 4N5UA 5HGBB 3QXAB 3ARSA 3NCJL 1ZHNB 2JK5A 1K8IB 1FC2D 3MA9L 1QRNA 1TJIH 4KK8D 4MZ2A 4HF5H 5FYLE 3HA0A 4WFFE 3NABH 1A7RH 5B39A 2QQNL 3TYFA 1YEEL 1ZT7A 1Q72H 5TE4L 5DT1H 5E00A 4G8FB 2OL3H 5E2WL 4HHAA 3VFVA 3GDBA 1MH5B 1FLRL 1UWXH 1JPFA 3CX2A 3O6KL 2NY7L 3MLXL 3TGXA 3OPZL 1JGLL 4QXTA 3VXUB 4QNPE 2BK8A 3CVHB 2VLKA 2APTA 4MA3B 1QPXA 2JJVA 2D7MA 3U46A 1CE1L 3FQRA 3IKCA 3VXUD 2A6JB 1VSCA 1WFUA 3HI1B 3CK0H 2XKNB 3FQNB 3EO0B 3FONB 3KPLB 2Y06H 1YNTB 2VQUA 3IDNA 3RI5F 3LKRA 1J8HE 2R0ZL 4RFEB 4RWYH 2OR8A 3HZKB 4HS6A 5HDLA 2R2HB 4HX1A 2EDRA 3MNZB 2EIDA 1RUAH 5CSGA 4O58L 5DJCB 3R8QA 5E8DL 3QULB 1DBKH 3RVWD 3BEVA 5HI5D 4KK6D 5KJRH 3VXPB 4U6HA 4XH2A 5HHPB 2VERN 1NGZA 2DTML 3PGDA 5D1QC 3GHEH 3UDWC 1J0JA 4DW2H 2YBRB 5IT2L 3LSOB 4UIKL 4FNLL 4FHBD 2DWDB 1CWVA 3PABB 5KSBF 4P5KA 3WFBL 5HDQL 2IALA 4PPTA 5HYEA 3GSXB 2EH8L 2I26N 4NO2A 1PY4A 3WFHB 3FO0L 4RMTA 5CEXA 4FQIL 3P9WB 5IV2B 1A6TB 1FIGH 1F4HA 1MHPL 3JV4B 1S78C 2OTPA 4KVNH 4GW1B 5C9JB 4UDTB 1CK0H 2H2PD 3D1MC 3K1KC 3EOTH 1KJ2B 1HINH 1BPVA 1FG2B 1PQZB 3EDFA 3EYUH 1WAAF 3FB6B 5FYJE 5FK9B 4GAJL 3CFCH 4RBPK 2OQJA 2YC1A 1HHGB 2UWEB 1P4BL 2XY2A 1I1AB 2V7NB 4HK0A 3T65A 5EFIB 1BQHA 5ILTH 4ETYA 1TQBB 4HULB 1H3GA 1MRDL 3U7YL 1LNUA 3QB7C 1S7XB 3OKEA 3WNPA 3FFCB 3C87A 2D9CA 2NXYB 3G5ZB 5ID1B 3T2NL 2CK0L 5DJ6A 2XKUA 1RULH 1OGTA 5GHWL 5BZDA 4AEHL 5HGDB 3RWCA 1EJ6A 3ABZA 2VDKL 3FFCD 3F12A 2NXYD 2UZXB 3VXNA 2QBWA 1CGSL 1K4CA 5E5MA 5L2KA 2IANE 2X09A 4YXHL 1NEUA 4OZFH 1DLHA 3E3QC 3ZKXB 4UOW0 4OD3H 3ULSB 2IFFH 3NAAH 1R3KB 2NY6B 4BH7A 3SKJL 4D9QE 4DGYH 2EDXA 4HUKB 3UROR 4ODXA 2CDGB 1BVKB 2JTDA 3RWJA 4DVRH 1JRHI 4X8XA 3OAUL 5EU6E 2EDQA 3MRRA 2NY6D 3HC3L 3K2UH 4YHML 4X98B 2NW2B 4F33A 2QKIB 2CUIA 4LLQA 5GISH 5B3JF 4NZJA 3ARWA 4UMGA 3WDIA 4RMVA 4JJ5B 5E2TH 4QRUB 5CHNB 4C4KO 4L8CB 4KKBD 4IRJA 5DO2C 3MLUH 1T21B 4LDOB 3PF2A 1ITBB 5F88A 3O2VH 2V2TA 3I6LE 4MSWB 4CDHA 3PL6A 4LCCA 2W0FB 5C2UB 5MP6L 1G0DA 3L7FB 3ZKMD 3GBMH 4OLZL 3D18A 4GRLC 5KSBB 4LPVA 3W5NA 5D72H 2F5AL 1TIUA 5I18H 3IXTB 4M48L 5EIVA 5GGRY 4N0RA 2MPAL 3F58L 4V1DE 4O02L 5CEYB 3LZFH 1VFMA 1I7ZB 5EULV 5I1AB 1AQKL 1XGPB 4NHUA 1IVLA 4TULH 3MRLA 2GYSA 5I1LA 4K9EL 4NHCH 4FQXA 1MHEA 4OFVA 3DXAB 1CQKA 1MF2H 5A2FA 5L9DL 2J5LC 4LP4A 4FRWA 5BMFH 1DANU 2EO1A 3MGOA 1TCRB 3DXAD 4P4KB 2OM5A 2ADFL 3QQ3A 2VLRE 4FQJL 3BPLB 3G08B 4DVBA 2V9QA 4X4YB 2OJEA 3W11D 3BH8B 1M6OA 4P4KD 4KZDH 2V5TA 2VZ3A 4F7TA 5D9SB 4U2YA 3MRJA 1IEBA 5SV4A 3KPNB 4ZAKC 5IB5B 3BQUC 2ICCA 2QSCH 4R8WH 3K81A 1CLYH 3INUH 1VEOA 2NR6D 3W81A 4JM4L 3KPQB 4OKVB 4Z7WA 1QFOA 2Y23A 4KHXL 4X9FA 4GO6B 3UBXG 5I1DA 4NZRL 4PJHE 5JQ6L 5BS0A 4JN1H 4XCYB 4PGJA 1J88A 2Y7QA 1K2DB 1TVHB 2LFGA 5DD6B 2IPTH 1DEEA 1HHIB 1RUPL 4Y88A 2XTLA 1V7NH 2B0SH 5E8OA 3RWIB 1E4WH 2AJXL 2ZG3A 1CE6A 3VGFA 2XIDA 4KTEL 2MCPH 1TJHL 4AEEA 4ZNEA 2EH7L 2ZKHL 4PRPE 1YA5A 2Z91A 2Z4QB 3QUXB 5CLWA 5FFLA 5FYKU 3VWKA 3QAZC 4WDIA 5CFHA 1XEDA 3MOAL 4GBXC 4PRAA 3ZO0A 1Z6JT 4HW6A 2IQAA 1FG9C 2QEJA 3NPZB 1S9YB 3DTXA 3E8UH 3QUXD 2HN7B 1CI5A 3IXAB 1WZKA 4YFLF 2FB4H 3BP7A 1X5ZA 4XNZC 1ZLUH 1ZA6A 1MHCB 2FATH 3LOWA 3JUYA 4OLVL 5ISZA 2GIYA 4OFYA 1L7IL 1MAML 2VIRB 1G7IA 3LDBB 2XN9E 3GSRA 5FDYA 1AGCB 1TJGL 2OZ4L 2P7TB 3UJTH 5F7HA 1MCPL 4MNGB 5FAAA 5I8EA 3NGBB 4FQLL 1YEGL 4OZFB 1OCWL 4KRPB 2C3GA 4PUBH 4HWBL 1JNHB 4HK3N 4X6CA 4RDQG 2VLKE 5IW1B 1XF4B 2APVA 3BIKA 4H26B 4KRPD 3OAZK 3HZVB 3VXRB 2GUOA 5DUBA 1WTGT 3QUZA 5CSZB 3RIFF 3K74B 1MCWW 3QRGL 43CAA 1A02N 2EEBA 1VFAB 1M7IA 2UVFA 3VXRD 5H35B 5AAWA 1T1ZB 3LH2H 4F58H 4ONOA 1YEIL 1H15A 1PLGL 3I75A 3PWPE 1VADB 1LDPL 3TYGH 4P2CG 4LPYA 1A21A 1X4ZA 2V17H 1KFAH 4LCYA 4Y8AA 2HVKA 5BXFB 4HLZG 3TBSA 4OT1L 1XF5B 1Q0XL 3SE8H 3B9KA 1RIUH 1U95A 1MCBA 1QFHA 1YY8B 3VDAA 4CGTA 1OSZA 1D5BB 2C3VB 3OJDA 2PW2B 2VDPL 3GSVA 5HYJA 4HWEH 3U30B 1JE6A 1SJHA 4W4OC 4GH7B 4OCWL 1FZOA 1U2CA 4JREC 2MHAB 1BOGA 1L6ZA 5E4EB 2OXHA 4WGVB 3MUGB 3E0GA 5GRXG 2PTUA 1UH3A 4DKFH 5CBAB 1NBQA 3V6FB 4YWGL 5FYKL 3W0WA 3IDJB 4OLWH 2XWTA 2WBWB 1I3GH 5DSCB 1UWEL 4LSSH 4WO4B 1I7RB 4PJDB 3DV6A 2W1NA 1NAMH 5EZJB 2I25N 4KJWC 4X6FB 5C0BE 2J8UE 1BF2A 3SE3C 4TTGA 3P9MB 5LBSH 5JW5B 3BESR 4HD9A 1ZE3C 4WO4D 3FQTB 2F54A 3QIBB 1LP9A 2VDQH 1CDCA 3RKDC 2IMNA 3VFMB 1AGFB 3FL7A 2HTKC 4ZD3H 3ORJA 1HCFX 1KJMB 5CEZE 1G6RH 3QIBD 1S7WB 3QDMB 5E99H 3L3IA 5KSUB 4XPTH 1WJ3A 6FABL 1RHFA 2VLME 2DMKA 1YJDC 3SDCB 1YNKL 3QDMD 1BD2E 4YQXL 4PREA 2MQCA 2X9YA 3EFFA 4HG4K 1MREH 4G42A 5LKNA 3ULVC 4WW2B 5L2KE 1P7KB 3ARRA 5JO5B 3SDCD 4R7DB 1IGIL 1LO5A 4QOKE 4OZHA 1QR1A 4UINH 2J4WL 5ITBH 1N6QL 4Y4FB 3DX7A 1U8PB 3CXHJ 3OMZA 4M1DL 2R23B 1FYTB 2W38A 1R5VB 4NUJB 2X4SA 5HYQA 4B50A 3A6BL 4MQXC 3L9RA 4IOIA 3IAGC 4Y4FD 2CIKB 4E9LA 4PBVC 1U93A 1FYTD 3FQWA 4C54A 1DBML 4APQA 3BN9D 4BK4A 3M1BB 4W6WB 2CGRH 3UP1A 3AM8C 4AENB 4P5TB 5E5UB 1NCNA 5CILL 4MAYA 1IGMH 5IEKB 3AMKA 4G7YH 2X1PA 5ERWA 1HI6A 3LMJH 1IKNA 1VACB 2XZAL 43C9A 2CLRA 4Z0XA 4P5TD 3V4PH 1KN4L 5FHBH 3MODL 3AMLA 4MJ6B 2ZJSH 4M8QA 1F11B 3BXNA 2BJMH 5IQ9B 4X6EB 3BH9A 4MDJA 1FH5L 2D4DA 3RDTC 2YMXL 3ROLA 1H8SA 5MEQA 1JHTA 1WZ1H 3PHOB 4MJIA 3CSBA 5GGVL 4GQ9H 5CINL 1T0NA 1AQDB 3VG9C 4LAJH 4K94L 3E1F1 2ICEA 4YHKL 3BZFB 4JZJC 4Y1AA 2VSDA 4RGNB 2ATPB 3DBXA 3RTQB 1Q94B 1CF8L 1AKJA 3Q5TA 2GTWA 4G6JH 3LPWA 2HLFC 1L0QA 4RGND 4F8TA 2A9NL 2NTFA 3RHWK 5HSFA 3RTQD 1A9EA 3BUYA 3CCHA 4XPHH 3IFPB 3BWAB 1UXWA 2R4SL 1F2QA 1HILB 1CTOA 3O4OC 3BAEL 1MSPA 2IC2A 2R69H 1I4FB 1OF2A 4UTAH 4S1DD 1C08A 4EDXB 3VRLE 4PJXE 3B2UC 4XMKH 3ZT6A 5TE7H 5HYSA 5MENB 1VFOA 2EEDA 4GSDH 5KTEL 5F3BA 3H9SB 2PXYB 2Z31C 5IBUG 4PJFF 3MJ6A 5ALCL 5MEND 4LVHC 4NRZA 1FO0L 2FIRT 2XV6B 4JQIH 4RQQA 5DJ2A 3NTCL 2JJTC 3H9SD 5H2BB 5IOPA 3MBEB 4ZTPH 2PXYD 2P5WB 3C8DA 4WI6A 3FMGL 5DDHB 1Y6KR 4Q58C 5ID0A 4Z7WE 4MCZA 1I3RA 3FRUB 1T7ZA 1J7VR 3HI6L 1UH4A 3C08L 2H45A 3BE1H 3MBED 4I4WB 3NACL 2P5WD 5BS0E 1S9WA 1HKLL 1Q9KB 5HI3D 1J0YA 4UV7H 4Y2DA 1PG7X 2VAAA 4L29B 1KTRL 2P8PA 2PNDA 5DVKA 3M8OL 3ULUH 3DO7B 1E6JH 1F6LL 5F9JA 1K8DA 1FP5A 3QIWC 4R3SA 3U4BH 2XWBB 3BZ4B 3OKKA 1AP2A 3LKNA 4N5ED 1A3LH 1A7QL 4WV1B 5C6PB 1MI5A 5DR5H 2MTPA 1FL6A 5F8QC 1FE8H 1JFQL 1KEMH 3MOBH 5GSVB 4NO5A 3DETC 5SWZB 1OARL 2AAVA 3WO3B 3AVEA 2F8VA 4Y4KA 3WN5B 5HYIA 5LVEA 3J7HA 3TZVC 3GSOB 3BHBB 3GBNL 3FO1B 3GIZH 1FVDA 5E94B 1FSKC 3T2OA 1KG0B 4OUOA 5SWZD 2I5YH 2FO4A 5C7XH 2GY5A 1PKQE 3WE6B 5FM5O 5C8JA 3SKUD 3BGMA 5CWSB 1LMKA 3GSWA 4EZMA 1IGFH 5IW3A 5GJSH 3D0LB 1IAKB 1UACL 4NKMB 4EUPH 3S4SA 1IFHL 3VXQA 3BD3A 2AXJA 3QCUL 2EDNA 4I0PA 2X44D 3O6LH 4LF3B 3UAJC 5IBLC 2VYRE 2H6PA 3HAEH 4HMDA 3UYOD 5C08E 4HLJA 4Y2OA 3F8UB 2NY3B 2PCPB 3TA3A 3V6ZB 1CICA 3DSFL 4XNQB 1DBAL 2VL4A 2AK4A 4D8PA 3HR5B 5FYLH 1LO3L 1ZLSH 1YZZA 2NY3D 3LB6C 3MRHB 3M17B 1T3FA 4XCNA 5DGQA 5EUOE 2E27H 4BFEA 2J2ZA 3F5WA 2XRAH 4E5XB 3KWWA 2W65A 1NFIB 4PY8J 1AR1C 4I3GA 3LRSA 1XGQA 5BZWA 3VG0H 3MFGB 3MRBA 1PDKA 1XGTB 5F1NB 4KJYA 4O2EB 3V5KA 3QNXA 4HPYH 3VGEA 5TQ2H 5IKCA 2V2XB 4JFQA 4PJFB 5CIPB 5EA0L 3TNNA 3UYPA 4PJ9A 5IIEA 3DVFA 4Z77B 1MWAA 4P57B 5AZEL 3T0EB 2NQCA 1WSST 4U1LA 4F57L 1DN0B 1XAUA 2HT4C 4G7VL 5F7KC 3I84A 3TIDB 1Y18A 2VAJA 3T0ED 5ADOL 5JQHC 1W72B 2J88H 4C57C 1OAQL 5AD0B 1WIUA 3HNVL 1PYWB 2P24A 6CGTA 3WFDL 4YHOH 1FVCA 1U92A 4HZLA 4PRDA 2HKHL 3W0WE 3MLRH 4NQEB 5IHZB 3OF6A 4PJEA 2VWEC 3CXDH 3QJHB 5FOJA 4UQ3A 4FTVE 2A9ML 2BNUB 2OMNA 4G5ZH 1JYVA 3SKMB 2R0LL 4HIIA 2CPCA 4NQED 1A14H 2FEEI 5DEGB 5FUOH 1INEH 5AZ2H 2F54E 2ARJB 4KI1A 2A74B 1KB5L 1PZ5A 1MY5A 2A6IB 5C1MB 4Z7VE 4MDIB 1NLBL 3ALWA 2IH3A 4R4FH 3UXFA 1PGRB 3RVUD 5HHQB 4LCIH 4JO4L 3CU7A 4X0KB 3BEWB 2IGFH 2IH1B 4TTDC 4YR6B 2NZIA 1OM3H 4XB7A 1KCKA 4XBPA 4JFHE 4FQ2H 1B0WA 5EDXA 5DD0H 3UMTA 5J6GB 4NQDE 1REIA 5DI8A 4EOWH 3NN8A 1U8OA 5FYJH 5E9DA 5KOMC 5FCSH 4UBDD 4OZHE 2QSQA 2Q86A 5F93C 5DK0A 2Q20A 3KXFB 1M71B 5E0QA 1HHKB 2DM7A 2H3NB 4MXQC 2WWMC 5KVFH 2ZUQB 5EBGA 3PIQA 3IETB 1T83C 3KPPA 4OKDA 1KV3A 4DAGL 3K7UA 3KXFD 3MV7B 1FN4B 2EIEA 4U1JB 1QYGH 2A6KA 1I8IB 3UZVB 2ED9A 4QHMA 4LEOA 4P3DA 3VWJA 3MV7D 3S96A 2EIBA 2BDNL 1DFBL 1MOEA 3QFJB 1A6WL 5E95B 5E6IA 5GSRB 4CW1B 3KS0H 2LTQC 2RAMA 4EJ1C 4DN3H 1C5CL 1SMOA 4OZ4A 5DJ8B 3NIGE 3QFJD 4WCYL 2FL5A 3F62A 4Y5VA 4EBQH 5J9PB 3QUMH 4B5EA 3B8SA 4TUJB 3IFLH 2EDBA 4TNVF 2R1WB 1S7VA 3GMRB 3WJLA 4OBRA 4M7JL 1G7JB 3CSYA 1DQQB 2CKBH 2N4IA 1Z0NA 5ALBH 3O8XC 3MRQB 4MJIE 1A6PA 1Z5LB 4JLRB 1Z9MA 4IMLA 1EFXB 3TF7C 3IS1X 4PJAA 2ED8A 1IGTA 4GG8A 4Y1AE 2BHUA 3MRIA 1EFXD 2OZ4A 3OXSA 2ID5A 3HAEB 4O5LL 5GS1A 3LPGA 3RWHA 1Z9OA 3BP4B 4F8QA 3OKOA 4HWBA 2F5BL 4BELD 3IDGA 4I9WD 2DQJH 2GFBA 3OR6A 3TP4A 4HUVB 5EUKB 5ADPL 4ZO6A 4Y8DC 4ELME 4IDJL 4GG6F 3LEYL 1MIEL 2BNQA 5JPMA 1FJ1A 1QHPA 1RZ7H 4IBLT 5D1ZA 3IKKA 4Z7NE 5FYLD 4WFFD 2Y6SD 2V7HB 1OP5H 4M4PA 3WS3B 4YBLB 5IP4A 3FFDB 1C1EH 5DK3A 1U3HB 2AJUL 2WZPD 2HLAB 3CVIL 4J4PC 3RVTD 3RWGA 3RIAF 2ZOLB 3DROA 3L1OL 3FO9B 1KJVA 1U3HD 1EEZA 2EECA 2AEIT 4UNTA 1INQB 1RVFL 3ES6B 4U6YB 2WBJA 5JW4M 4RIRA 5F72S 1KYOJ 3WLWC 1KCSH 3O2DH 4GS7B 5F1SA 3V5DA 2Y5TA 5LGHL 5K59E 3BPCA 1SM3L 1ZHLA 4NJAL 4L3EA 3U48A 1JYNA 3LKSA 3O41B 3EYQC 4NNYB 2MJWA 5ENWA 1AFVL 2E7BA 1BECA 2GEEA 4NWTH 2YZ8A 4LLDA 1J8HB 2PYEE 4KRLB 4JDZA 1N5AA 2XACC 3CVHL 5DQDL 4R97B 4KV5E 1U91B 2X41A 2I9TB 4JB9H 5E08H 1J8HD 5T1DH 4NN6C 3HZYA 4F80A 3IFOB 1TTGA 4LLYA 2JJUA 5F6IB 1D3CA 1IAII 1MI5E 3T2QA 3MRDA 4OCNC 5KW9L 5D71H 1Q0YH 4Z7QF 3X13A 5HY9A 1N7MH 1OSPH 5CJXC 4M02A 3GMQA 3D87B 5DMJB 5GJTH 4XP5H 1VPOH 5FECA 4XZUA 2ED7A 3BKJH 3DLQR 4NC1E 2HH0L 1CGVA 1KT2B 1S7RB 1IZJA 1MHHB 1Y0LB 3C9NA 4YHLH 3V2AR 2QHRL 1KGCE 3E6HA 4F7EA 4NRYB 3HR6A 1R3IL 4PJ8C 3WLBA 2A83A 2DQHH 1PAMA 4JDTH 4NOFA 5CZVH 4G8EA 3QO1B 3MV01 1MLCA 1FNLA 1NLDH 5ICYA 5I19L 3G6AB 2P5EA 3MC0A 4DGIH 5J13B 3TO2B 1GHFL 2VC2H 4J3UA 4L4TE 4QRPA 5C2BL 3FT3A 3IJYA 1FFNA 5AEAA 5GGTH 3PWJB 4YGVA 5D96B 3VI3E 1U8KA 5FYJD 5I1IH 4NT6A 2OXGA 2W60B 5INDA 2AJZB 1CDJA 1KJ2L 4XP6L 1LO2L 3TIEB 4I18C 3MLPA 3IDIA 1FZMA 4FOMA 2D0HA 3O9WB 2X4OA 3QEQE 4LKCB 4V2BA 3N1GC 2L7JA 3RL1B 2D0GA 3L5XL 1QTYT 4ODUA 4P99A 2IG2H 1ZSDA 5ETUB 3O9WD 4QHUB 4LFHD 5IJVB 5EIIB 4WHTA 4XP4L 1MPAL 4ODTH 4M7ZC 3MYJB 1FFRA 3FN0H 2IANB 4F9PA 5I9QB 4OCXH 5TDNB 2AI0L 3W9EB 3KNBB 3UTPE 1WFOA 2GTZB 1CQYA 3IRPX 4M43H 1R3HB 4MWFA 2IAND 5MERB 4PJHF 3ZE1E 2F58H 4PJCA 3R0NA 5TJWK 1KC5H 1AGEB 3BIAX 1NCTA 4D9QD 2WP3T 1IL1A 4XBEH 5JNYA 1WUNT 1FFQA 3O6FC 2ERJC 4E0RB 4LAQH 2O61B 5BOPA 5JTWA 3VXMA 2PR4H 1RD6A 3PQYA 1EX0A 2AJSL 1I1CA 1T1WB 1WISA 1T4KA 3THML 3L3KB 5ICXA 4KKCC 3CMOH 2GJ6A 5KVGH 4FABH 2IAMA 3DMMB 1G9NL 3O3EB 4X5LA 1RZFL 3PDGA 3RUGE 1N3NA 2VLJE 1RAMA 1KLGB 4OGXH 3QHTC 3DMMD 4MZ3A 2UVEA 4UB0L 4ACPA 3IVKA 3R1GL 5J12C 1KBGH 2WINB 1MFNA 3I6LD 1F02I 4G6MH 5I8OL 4O51A 5DMKB 4N0YH 4XWGL 3V79C 1OTSD 3BUTA 5J89A 3TCXA 4X7FC 4W4NA 2LV4A 1IKFL 4RFOL 1TNNA 5L8KB 1PBYA 3SDYH 4I0KA 1TJIL 1CD9B 4Z8FH 1LO4H 4HF5L 2F74B 4XI5C 1F8TL 4ZQKB 5DA0B 4QXGH 2PO6C 1F13A 3ILQC 3NABL 3OHXB 3VD4A 1ES0A 2XI9A 2XQBH 1Q72L 5CGMA 5TPWL 4ZFOB 4M6NL 1XIWC 2PW1B 4N8VA 3ARYA 1NJ9B 4CJ0A 3V52H 5KN5A 3S3SA 5J11B 1LE9B 1QQDB 1BWMA 4C83A 1N0XL 4U6VL 2VLRB 3RX8A 2QTEA 4TNWK 5EU5B 2BSTA 4NWUH 1QFWH 4OGAC 1T5XB 3CGTA 5GRVK 5CEZH 2XWJA 3LKOA 3PP4L 4HC1H 3U6RA 2DMBA 2VLRD 4GLRI 3UJIH 2EXYC 3OAZH 4N0CD 2C3XA 3SCMC 1RUML 1JZ6A 3LEXA 3QDJA 1CVSC 2DS4A 3VCLA 3O3BA 1QSFA 4XVTH 1L6XA 2L4OA 3VXSA 4EVNA 2OX5A 5EH1A 3MRFB 2Y06L 4KI5E 1H5BC 4PJIA 4MQTB 3SDAC 2K1MA 3LHPH 1Z2KA 4HJ0C 4XTRC 5TGBA 3MUY1 3ROOA 4OSUH 1A64A 4GUPA 1G7HB 1RUAL 3WIFA 4MXWL 3L3JB 4AMKH 4PJHB 5HPOA 1GGIL 2DN7A 3RVXD 3P40A 3ZYJA 2ZUTA 4LSQL 3IDXH 4YDIH 4LCWE 4DW2L 2GJZB 2N56A 1I8MB 3FT2A 5EOTA 4MVBC 2IJ0C 4YDVB 5JDSA 2FWOA 4ALAL 3HN3A 4LVOB 4CRPA 4I77L 4PRPB 4O2CA 5D8JH 4BSWB 3QDGE 3T3ME 3KPRA 1HHJB 1I3VA 3NA9H 1C12B 2EE6A 3MR9B 3SGEH 4KVNL 4PRPD 2MCG1 25C8H 1W0YT 1EEYB 2AXGA 1JZ4A 1U6AL 4XMLH 1HINL 3QCVH 1UA6H 5B39B 1G0XA 2BNQE 2CUHA 3TYFB 3CFCL 1YPZE 5E00B 3TBVA 1PFCA 1IGYB 4YDLC 3UPAA 1PSKH 4RRPA 5ILTL 4HHAB 3RWFB 3VFVB 2FYYA 2G5RA 1VFUA 4WNQA 4M9OA 1H3PL 3O3DB 4HPOH 4M5ZH 5F7EH 5FDWA 3DIFA 1JPFB 2C4FU 4D0BA 4JFPB 2ORBL 5KS9A 1D9KC 1YMMA 5F7LB 1S7QA 4QXTB 4M93C 1RULL 2D31A 2VLKB 5MEPB 1MIML 3PXJA 3DGGA 5GRJH 3NBNA 1C5BH 4BZ1H 4JFFA 3FQRB 3IKCB 4KTDH 2VLKD 5FOBB 2IPUG 5JZ7C 1SYVA 2AK1H 1HYRC 1V3KA 3IU3B 1F6FB 3LKRB 32C2A 5FO8A 3T0BA 4QTHA 2E7MA 1B0GB 2JIXA 4DGYL 4HX1B 4Y16A 1RUKH 4G6KH 1OAZH 3OAYK 5F21B 3S37X 1MFDL 3RWDA 1XGYH 3K2UL 3BEVB 4XH2B 1T2QH 5M95B 3BDYL 4CMMB 3D2UA 2W9EL 1BX2B 1GZQB 4JKMA 1OD9A 5CMAA 1G7MA 1CLOH 3UZEA 4DEPB 3PHSA 1ZA3A 5GGUA 3BSZH 1UJ3A 1JF1A 4P5KB 4F9LA 2IALB 3WHE1 3ZE2E 4ZUWA 4MA1C 3TN0B 1NCAH 3MLUL 4OCLC 1A0QL 1IC5H 1I1AC 5HJ3A 5GRYA 2ZUXA 5CEXB 1TQBC 5FA4A 3TN0D 1F42A 2EICA 5EO0A 5LCVH 5IVOA 4ZYKA 3GBML 2APBA 5C6TH 5FUCE 5D72L 2P5EE 4AYFA 2WLZA 4BFBD 4PD4J 2EEAA 5I18L 1G9MH 4FZEH 2BY1A 2A77L 4M62L 4PLOB 2AJVH 2X4UA 1K9TA 5C0BB 2J8UB 3KPTA 4PJGE 4HK0B 1ZT1A 1CL7I 2ICWI 4W81A 2QHLA 1IGCL 4TULL 4KMQA 5EOCJ 5C0BD 1LNUB 2G9HA 1F6AA 3VRLF 3ZE0F 3WIHL 4M6AA 1JWSA 5DJ6B 1OGTB 1OP9A 4NNXA 2AABL 3FT4A 5BZDB 5HD8C 3RWCB 2CDEA 5SX4H 4LEXH 5CEZD 1PVHA 3F12B 5B8CC 3MJGX 2DLFH 3VXNB 3B9EA 4WWID 3GRWA 4CJ1A 1K4CB 1UZ8B 5EBWB 1OTTC 1CN4A 1TZGH 4JY6B 5L2KB 1NL0H 4XHJC 3N06B 3EFDH 1DLHB 4ODHH 4Z7WF 4KZDL 2X4TB 2KPNA 2LU4A 1JGUH 5L2KD 4XC1L 3QSKB 3T4AB 3WKNA 1JRHH 1AIFB 3GMLA 4ODXB 3EYOA 3RWJB 3MRRB 1K4DB 5I17A 4F33B 2QSCL 3LVEA 4HIJA 3O11A 3MRGB 5E1AB 3INUL 3EYVA 4LLQB 2B1AH 4WI9A 5CD3B 2RBLA 4X7SL 1DEDA 4JDVA 3PQYE 4Z95L 5DLMH 3UBXI 4JPVL 2CJUL 4JJHA 5I1KH 3AFLA 4HKBB 2X1OA 4JN1L 2BMKA 5J4MA 2YSSA 5DJXA 1KCVH 1FFOB 2IPTL 5GGSA 2BXZA 5F9AC 2AEQL 1OGAA 1V7NL 3SKOA 4LCCB 2H32H 2LQRA 4YO0A 4YK4B 1E4WL 1T5WA 3KHOA 5FF6A 3KJ4B 3MLYL 4OF3A 2E9WA 3Q5YA 3BGFB 3D18B 4RMSA 3RHWF 4NN5C 1A6UL 1VGKB 2AKRA 1I1FA 2RHEA 4ZOCA 3BD5A 4ONGL 1UWGH 1X5GA 2VDOL 3ZTNH 4GMSH 1QLRB 3NCCB 2OR9L 4IMKC 5DD1H 2E6QA 3DWTA 3WXWH 3KYKH 3E8UL 2WLYA 4FFVD 3C09B 1R3JB 4YPGA 3WNNA 1RHHA 4H1LH 1G7LA 2FB4L 3MRLB 1RY7B 3DYPA 4HFWA 1JK8A 5I1LB 5HGBA 2NX5E 4X6CF 3RA7L 1MHEB 2ICWJ 3H9YA 1IEAA 2FATL 1NCCL 2FHBA 1XF3A 4NBXB 5C71A 5EO9A 1T7VA 1GRWA 4GKSA 1EK3A 2D7QA 2NXZB 4EIGB 3QQ3B 1E4XI 4NQUA 1VB9A 1YN7A 4DVBB 2EC9T 4TN9A 3FB5A 3LN4A 2VB5A 4PUBL 3TO4B 2NXZD 4WJ5B 3MV8A 2WWKT 1JGVL 2FCBA 4RAHA 1N2RB 1TMCB 5KVDH 4JZOA 4J6RH 5GS0C 4HGKC 4FFWC 1E0OB 1GH7A 4TSCL 5E2VH 2YUXA 3MRJB 1IEBB 3TO4D 1LILA 1AGDA 2ADIA 4FG6C 5DS8B 3VXUA 3QO0A 4KKAD 2GSGA 3VXSE 4QO1A 2C4XA 3MJ9A 2EYTA 3QHFH 4F7MB 1A6AA 2BY0A 1YNLL 5F7DA 4UIMA 4F58L 2A6JA 4WWKC 1MCNA 4ZOBA 3FQNA 4Z7WB 3TYGL 1YNTA 3G5YB 3ARQA 2APXA 5EOQH 3NZHH 2V17L 4NRXA 3QQ4A 5BS0B 1Z0MA 2HVJB 5D1XC 3WNMA 1GGBL 3HZKA 2YD3A 3MNZA 4C56A 1DEEB 3VRIB 1RZ8A 3X3GL 3NIFE 4D9LH 5BS0D 4FFYH 5E8OB 1TTUA 3OQ3B 5DFWH 1JBJA 1CE6B 1MFEH 2ZG1A 4HWEL 4HIHA 3KVQA 2FBJL 3IDMA 4J3WA 4PRIA 2DWDA 2Z91B 1CXEA 5IFHL 3VJ6A 3VWKB 4U7KA 2UZIL 4WDIB 4Q6IC 1FORL 3KYNA 3PDDA 1MCKA 4PRAB 3ARBC 3B83A 1LP9F 1J1XH 1D5IL 1UM4L 2IQAB 4JEGB 3P11L 3HG1A 3DTXB 4DKFL 5KSAC 4ZOAA 3VWKD 4Q7DA 5HVGB 1CG9A 4OZFG 3NPSC 4U0RB 4FS0A 4OLWL 3B8YA 3GK8L 5HHME 1CFSA 1ZA6B 5IV2A 3WUWA 3JV4A 15C8H 4G8GE 5C9JA 4UDTA 3I3DA 1UEYA 2D2OA 3MXWH 1UYWH 3QA3B 4HV8B 1E6OH 2ZUWA 4HUUA 4JFYA 1G7IB 4K23L 5LBSL 3FB6A 3GSRB 3U9PH 5FK9A 4YHIB 3QQ9D 3VFRA 3S7GA 1H3UA 2ZSWA 4QRSA 5I8EB 2EDKA 4OFYD 3C2SA 2DAVA 4XX1E 4ZD3L 4OZHF 4P9HH 1O5DT 3SKNA 1YMME 4LU5H 4P46B 3JV6A 5FGRA 4X6CB 2AP2A 1ND0A 4PJ7A 3Q6FA 5C08B 4CVXB 3BIKB 3VDCA 5C0RH 4ZAKA 3I2CH 3BQUA 1VA9A 4JFFE 4P46D 5DUBB 5ACLA 5ID1A 3QUZB 3F7VA 1MREL 1S5HA 2UY7A 5HGDA 5C08D 43CAB 1D6VH 4OCSH 1R0AL 3EHBD 5DVMA 5EUOB 4R90H 3DHJA 3NA4A 1LQSR 3DUSA 3QUZD 1IC4H 4UINL 1H15B 4PGZA 3WO4B 1F2XK 5DHYA 2G2RA 3GNMH 1D6EA 4NZUH 5C6WH 2A6DA 1I8KA 3G04B 4D3CL 3CLFL 2HVKB 3CLEH 1ZLVH 5AG9A 4TOYL 3ESVF 2CDGA 4LASH 1AD0A 1A3RH 5JOPE 5D2NE 1U95B 2VLLA 2VITA 3OJDB 2QKIA 5FV1L 4JZNB 4JAMA 4AQ1B 1SJHB 3TNMA 4HAFA 4GBXA 3VGAB 4G7YL 1MCQA 4L8CA 4NC2B 3V4PL 5FHBL 4LIQE 2ZJSL 4PD4K 1EBPA 4Q9RL 3RAJH 2BJML 4PBXA 5IJKC 2X05A 1NEZB 2J8HA 2P49B 5I73C 3W0WB 2FX7L 2W0FA 5C0DB 2XWTB 1KN2H 4YBQD 1YDPB 3UTSE 3SE9H 3CX5J 4FTVB 4RFNB 5AYUH 3DV6B 4KDVA 1WTLA 3FKUS 3PGFH 1LEIB 1RK0A 5DMGD 1F58L 5JLZA 3W0WD 1W72L 3MACH 3IXTA 1EPFA 3TLRA 5DHVH 1H3XA 2F54B 4H0HB 1LP9B 2PKDA 4FTVD 1QSVA 4GXVH 2OL3A 3KYMA 5CEYA 4Z7VB 1AY1L 1I7ZA 2F54D 4G6JL 1HZHL 1CZ8H 3BD4A 1XGPA 3TESA 4WFGD 4H5SB 3ZHDA 2IBBA 4WTXA 5F1KC 3A6CH 4XPHL 5L2JB 4HCRL 2VDLH 1VERA 4PREB 3DHMA 2IPKB 3EFFB 4AEIL 3U0TA 1RQ5A 4NQDB 4B7LA 5LGJA 4JFHD 4WENB 1TCRA 1MCJA 4P4KA 4OZHB 1NGQH 2BP3A 4XAKD 5K59F 4NQXB 3G08A 4NQDD 3QG6B 1TQCB 4X4YA 2YWYA 3JV5A 5DVOA 3SBWA 3DO3A 4UOJA 4JGMA 1MCEA 4QHKJ 1EO5A 4RDQF 2X4SB 5HYQB 1TENA 4Y5XB 3L9RB 3DOSA 4WW1B 4HIXH 5FEBA 2FZ3B 4JQIL 1MCWM 3FQWB 4KV5F 4W4OA 5IB5A 1A3QA 1BIIA 1FNFA 3C5ZC 4ODWA 4ZUSB 1MQKH 1AD9B 1MCIA 3TBYA 4UV7L 3KPQA 2WUBL 2DL2A 4MAYB 2C3HA 1A7PH 3VMPA 5ERWB 4GAFB 4OM0L 43C9B 4KRMB 1E6JL 2Q76B 4Z0XB 3NCMA 2HRPH 1A7NH 1JL8A 4M8QB 4M1CC 5C70A 4MAYD 1TVHA 3BXNB 1ZTXH 5FM4A 1RZKH 3FB8B 5C0NC 4L8SC 5GS3A 2APFA 3TT3H 2J6EL 1HHIA 1A3LL 1BFVH 1F3DJ 4WEBH 3BH9B 4M7KL 5DR5L 3KGRA 3G5VB 3ROLB 5MEQB 1JHTB 1FE8L 3SE3A 1ZT4B 4MJIB 2YR3A 4IIQC 4PS4H 2W9DL 4WUKH 1T0NB 1I9IH 4KKLD 2Z4QA 5H37H 5C0GB 1JZ5A 5E7FA 4OLUH 3SJVE 4MJID 5T3ZD 4Y1AB 3GIZL 2YXFA 3X3FH 4Y5YC 1AJ7L 3N1MC 1EAPA 1RU9H 3DBXB 2B20A 1YEDB 5F96L 1S9YA 1AKJB 4AL8H 2GTWB 1RMFL 4Y1AD 4NC0B 4PGBA 3WKMH 2NTFB 3DURB 1AI1H 1GIGL 1AKJD 2HA1A 4XMPL 4ELMB 5I1CH 3E3QE 5FV2A 3RGVC 3JBG7 3WD5H 3MBEC 5B38B 1AGCA 3O6LL 3QCTH 3GMOB 3MV8E 3W9DA 1C08B 2OTWA 1IARB 1G1CA 3RFZC 4PFEA 2YN3A 4KAQH 5FYJU 4OZFA 2HAZA 1GOFA 1B2WH 3T09A 1OW0C 5F3BB 1OB1B 3K46A 3GB7A 5FYLL 5IW1A 5J0BA 3O4LE 4PB9L 3HZVA 4NRZB 2FJFA 1RIHH 4RQQB 4PRHA 3BPNB 4LL9A 5IOPB 2E7HA 4QWWD 2XRAL 3ZE1F 5CSZA 3RY4A 4CU7A 1AO7E 5ID0B 4BH8A 1CIUA 4MCZB 3GI8H 1EFQA 3VG0L 3U0WH 1TLKA 1R24A 2FBOJ 4KY1L 1Z3GH 3AREB 5F3HA 4DUXA 1S9WB 4HPYL 2DQGH 2R29H 5TQ2L 1JTOA 4K2UL 3UTQB 4LHUB 2VAAB 3ARED 1ZEAH 4C56E 3ARUA 3PWLB 4V2CB 4IJ3B 3HUJA 4R3SB 1RURH 4N1HB 1WZMA 1JP5A 1LEKA 5T33L 4LHUD 1O7SA 4UT7H 2X1QA 2DYPA 1AP2B 5E8PA 3LKNB 4PJEF 4PRIE 1MI5B 2CDFB 1IQWL 1WK0A 1YY8A 4I1NB 4XP1H 2C3VA 1D5BA 3ZKNC 2CO6B 2PW2A 4LLUA 4CADA 3G6JE 4JZJA 4QXWA 4BKLA 5DHVB 1BJ1J 1MI5D 4YHOL 3HG1E 3T8XB 1JMXA 3BGAA 2MHAA 4BZ2H 1CIDA 4CN4A 4KH2A 3VFGH 1FRGH 2EDDA 3MUGA 1AHWC 3HI5H 2FO4B 4ODSH 2AGJL 3CXDL 5CBAA 5J1AA 4FQ1H 4UT9L 5C8JB 2O5YH 3BGMB 4U31A 3MXVH 3V0VA 4PJBF 2DQEH 1MJUH 2JELH 5FUOL 1KGCD 1INEL 1CXFA 4WO4A 5AZ2L 2R2EA 4RAVB 2H2SD 3AUVA 3S4SB 3VXQB 4X6FA 4HT1H 5F9OL 5D93B 3BKMH 3P9MA 4I0PB 5JW5A 4R4FL 1U8IB 3V95A 5CGYC 3QIBA 1F4AA 1RIVH 2H6PB 4L4JA 1KCUH 5IHBA 2LU3A 4PJ7E 1L4IA 2Z31A 4LRIC 1OM3L 1ZVSA 4I0PD 1KJMA 3TA3B 5JORA 4FQ2L 5MI0B 1BP3B 5DTFA 1CICB 4P9HC 4D8PB 1NCBH 2AK4B 5FCUH 5D7KE 2JJTA 5DD0L 1JHKH 2NZ9C 1ZLWK 1DL7H 3Q3GA 1I7UA 3HNSH 2JB5L 3CJJA 3TA3D 3QEQB 5FYJL 1CICD 2ZCKH 4PTUA 1CU4H 2AK4D 3F5WB 4XPFL 4W68A 3DVIA 5D7LA 1N0LA 4QRTB 3KWWB 5SV3A 3T0EC 2HMID 1Q1JH 1DANT 4ZG1A 1P7KA 3LRSB 1XGQB 5JO5A 5KVFL 3QEQD 4KI5F 4KUCD 3V6OC 5HBBA 3ZYIA 3MRBB 2QADC 5KBNC 3V5KB 2FD6H 3QNXB 2J1KA 1PW3A 1CXHA 3QIWA 5IKCB 1QYGL 1AXTL 4JFQB 3TNNB 1FYTA 3FRPG 4L8BA 4NUJA 1MWAB 1IAIM 3IRZA 3WCYA 2HT3D 4DN3L 1WC7A 2NY5C 3M1BA 3P4NB 1Y18B 4EBQL 3V0AC 3VRJB 4PJAF 3TZVA 5C0AE 3VXTB 3IFLL 2UV3A 4XRCA 3NH7H 1FVCB 1WWWX 1OT2A 1CLCA 1U92B 5IEKA 2I07B 4F3FA 5CD5D 4QHLB 4L9LC 4K3DL 1J87A 2CRMA 4PRDB 3UO1H 1EHXA 1PX3A 4CL7A 5ALBL 4ZUUA 1F11A 1BZ9A 4JFDE 1X4XA 4NIKB 5A2LH 4UQ3B 3I9GH 2VLJB 2ZUSA 4G80A 4HIIB 3U4EA 1UZ6E 3PJSA 5D5ME 3PHOA 5BOZG 5DMIL 4D9RE 1II4E 5JIIA 2VLJD 3OX8B 4H20H 1JPTH 1OAUH 4CAGA 1JZ7A 4LSVH 1T04A 3GMPB 3BPOB 4KZEH 3U7WH 3BZFA 1NMCB 4AK1A 2XA8L 1PG7H 4P2OC 3QUKA 4R0LC 4WTZG 2DQJL 4A6YH 3HPJB 1NCDH 2R8SL 1RZ7L 5DJDA 1U8OB 3IJHA 5E9DB 3GFUA 5IM7A 2Q86B 5DK0B 4URTB 5HVHB 1SYSA 3CDYA 5E9DD 3CNKA 5GGQH 1CGYA 3PIQB 3KPPB 4LLVB 4IRZL 4KJQD 5I30H 4P59L 3SDDC 3DRTA 3FTGA 1UB6A 4UNVA 2APWA 2PXYA 1MCDA 1OPGH 4ZFOL 2BSRB 1KCSL 4LEOB 2A1WH 1YC7A 1JN6A 4ONFH 5FKAB 1N5YH 4OZ4B 4TPRL 1XFPA 4HKZA 1FCCA 2HRLA 4P4RB 4NWTL 4KC3B 5TDPA 2FL5B 2O93L 1J1PH 4MLSA 1UM5H 3REWB 4WI4A 4KI5D 1Q9KA 3ZE2F 5IGXH 2AEPH 1S7VB 1X5FA 3MMEA 5E08L 4L29A 2C1PA 2E8ZA 5I1HH 1Q9OA 3DO7A 5L6YH 1YYMH 2DWEB 5T5FH 2XWBA 1TNMA 1Q0YL 1YQVH 2QR0A 5DRXB 1ZHBA 4K7PY 5DA4A 1N7ML 4BFGA 1OSPL 3QXDA 4BFIA 4IMLB 4O9HH 4WV1A 1BBJB 3Q6GH 5GJTL 3NZ8B 4XP5L 1VPOL 4ZO7A 1IGTB 3BKJL 3DI3B 1QKZH 1OAKL 4HKXB 4UAOB 3DV4B 5SWZA 4WHYH 3WN5A 1QP1A 1DSFH 4BSVA 2R9HC 3GSOA 3RWHB 3FO1A 3DSNA 3F6IA 4OD2A 5E94A 2EZ0D 4JDTL 1U3HC 4RMQA 1G6RA 1I85C 3ULVE 3IDGB 3OR6B 1U8JB 5E03A 1RJYA 2VC2L 3VFSA 5C09A 2DIAA 5CGTA 2DQIL 2BNQB 1FJ1B 2VXQH 3D0LA 1IAKA 5E6YA 3JWOC 3ECBB 5IQ7L 5GGTL 1FZKB 2GT9A 1C8PA 5IB2A 3AB0B 1B6DA 2YS4A 2BNQD 3L5HA 4MA7H 5I8CB 1KULA 2DDQH 4H8WH 4K3JL 5I1IL 2CSPA 3G5XB 3VA6A 4K7FB 2OTUB 5IK3B 3RWGB 2B5IB 3OB0H 4U1SB 4DKDC 3DROB 4XCCH 1HXMA 4O2FA 1RJZA 1KXTB 1EEZB 1MRCH 1TTFA 5L88H 3DYMA 3HR5A 4RIRB 4PJCF 1DVFC 1W8NA 3V5DB 2Y5TB 3HMXH 4NZTH 3BPCB 3MRHA 4ODTL 3LKSB 3TV3H 4OF5A 4E5XA 1LD9B 5J3HD 3MLTA 1E4KA 3RJDA 4NBYB 4HWNA 4OIIL 4OCMC 3C8KA 3ISWA 4M43L 1N5AB 2DM3A 4R26H 5GZOD 1EAJA 2F58L 4JPWH 3SDXE 2V2XA 1KC5L 3BI9X 3HZYB 1IAIH 4LLYB 3EJZD 1QFPA 2HJFA 4XBEL 3MRDB 4HBCH 1QACA 1DE4A 4LAQL 1FAIH 3HRPA 2EDWA 1NPUA 1X5JA 4U49A 3Q1SL 4J12A 3WL9B 5DUPL 4J2XA 4GAGH 4XZUB 5FYKD 1A7OH 3G6DH 3H6JA 1PYWA 1BM3H 3C9NB 3E6HB 4F7EB 3WLBB 2NY1B 3OJVC 4ODBD 2A83B 4MS8C 3EGSA 2P8MB 4M4RA 4OGXL 2VXVH 3D3VE 1T89A 1VEMA 1ZLUK 4XC3H 2LAGB 5ICYB 4A2MA 2NY1D 1NFDA 1XF2A 2P5EB 2D03H 4G9FE 4G6ML 2WP3O 2QL1A 4LFHG 1NUGA 5A3ID 2JB6B 2WK2A 1FFNB 2VZVA 1FPTH 2A74A 2P5ED 3UYRH 4U7SA 2A6IA 4PJGB 2VDML 4MMXC 1U8KB 1R6VA 4MDIA 4XVUD 5B4MD 4NT6B 4PJ5E 5HHQA 5INDB 2M2DA 4NBZB 4XPBL 5MHSD 4R7NA 3O0RH 2IH1A 4YR6A 4KJPD 1FZMB 3MREB 2MSPA 4ZDHA 4NM4L 4PLJD 3TH3T 2D7NA 4ODUB 4C58B 2NY0B 1F4XH 1BGXH 2BVTA 4PJIF 4RSVA 1BOYA 1F90L 4NWUL 4K71C 1M71A 1PD6A 2NLJA 5T5NF 1J8KA 4EN3C 1T1XA 2NY0D 5CEZL 3U79A 5I1JH 4K8RD 3UJIL 4DQOH 1M1SA 4MWFB 1P5VA 4HUXA 1UEMA 3PHQA 5CJOH 4B7IA 3VH8G 4U1JA 3QI9B 1I8IA 4JFEA 3L95A 4Y4HC 3ARTA 1IM9A 1IL1B 2Y4SA 3ME0A 5CJXA 2ZUVA 1P9MC 3P0GB 2J6EA 3QFJA 5GSRA 3LHPL 3QI9D 3TVMB 4Q6YA 2GHWB 3OGCA 4CW1A 2DM2A 4DZ8A 4ELKB 1NGPH 3PQYB 4YDJA 4OSUL 2X10A 3ARFB 2AS5M 2ESVE 3IFNH 3TVMD 4OB5H 1K5NA 2GJ6B 5CP7B 3H42L 3QEGH 3PQYD 4CN6A 2R2CA 4RNRA 4TUJA 3ARFD 1E28A 1PKOA 1JWUA 4YDIL 1G7JA 1DQQA 2XTJE 2E9BA 2GJ6D 1WBYA 3VXOA 4YX2H 2D4FA 4P23C 5LQBH 1T1YB 9CGTA 1F45A 3MRQA 2FLRT 4GW5B 5DQJB 1KIQA 5D4QA 5D8JL 4O51B 2EDTA 4YIQA 3RRQA 3QWRA 1BEYH 4EUPA 1HDMA 4YC2B 4LIQH 25C8L 4CVZA 4OI9A 3HAEA 2MQ3A 1TDQA 4FMKA 1A1MB 1M05A 5KS9F 1X3DA 2YPLA 3QCVL 2NX5B 1UA6L 2OK0L 3SO3C 1GGCH 1ES0B 3V0WH 5C86A 1FNGA 4HMEA 1YUHA 1IBGH 3N1PC 3JVGA 2YXMA 4N8VB 1B3JA 3CFBA 2NX5D 4OM1L 5KN5B 3M45A 3EOAB 3MZGB 3MUJA 4HPOL 2AXFA 4M5ZL 5F7EL 4JGJA 1CDYA 1FVEA 2XKSA 2BSTB 1MJJA 2NYYD 4KMLB 4GLRH 4O4YL 2XWJB 4OFIA 2F9BT 2Q8AH 4YEFA 2B7DT 1C5BL 2RCSH 3LEXB 5GGRA 3QDJB 4IRSB 2OJZL 4S1SH 4EVNB 3O6FA 3VXSB 3FO9A 1WFTA 3HMWH 4U6YA 5EZLA 1DUZA 4ZS7L 4FZ8H 3H3PH 3QDJD 1CR9L 1WGOA 4IRSD 1FLTX 1RUQL 3VXSD 2J3SA 1ZKAA 5TGBB 4H25A 4X7DC 1FZJB 4NNYA 4GUPB 4YXKH 1OAZL 3LQAH 3WJJC 2VWEE 1XGYL 4M1GH 1SJXA 4U1MA 3P73A 3ZT7A 4NOBA 1UENA 3C6LA 2QQKH 2X6MA 5CBEA 3IFOA 3FT2B 1X5XA 2Q8BH 5EOTB 3BSZL 3BZEB 2FWOB 1A5FL 3GHBH 5GRUH 4ZUTA 3HE7C 5B39G 1F00I 4PYHA 5F9WB 3NFNB 3KR3L 2KH2B 3OR7B 4O2CB 5D6DA 4TVPH 4KQ4H 3DVNA 3NCFB 1WVZA 1NGXA 1S7RA 1KT2A 3DECA 1NGWB 1GYAA 3TJHD 1EERB 1G9ML 4Q2ZA 2B4CC 2VKXA 2E7LA 3WFZA 4HS3A 3LKQA 3BW9B 1KSRA 3TBVB 4XVSL 4PLKD 4B53A 2CUMA 1CFVH 2FYYB 3QXVA 1IC7L 1EUTA 3PWJA 4S2SB 3DIFB 2Q87A 2FECI 1R5WA 1QLEL 1YMMB 2ZSVA 5IMLA 2D31B 2B8OT 2YK1H 4H8WC 1AGBA 2W60A 3DGGB 2L7UA 4LEXL 4NFBA 3MCLH 1B0RA 3B2VH 1WWCA 2Y36H 4P0DA 1YMMD 1HYSC 4JFFB 4PV8B 5HYFA 1H5BA 1RJLB 3SDAA 3GI9H 1ORSA 3V4VH 4J7RA 2BCKA 1TZGL 1ZGLA 4OQTH 1NL0L 3AS0A 5ECJE 3F7PC 2HFFB 4JFFD 2NY2C 1EVTC 5IJVA 4QHUA 5FO8B 2DQUH 4NKOA 4QTHB 2R0KL 3MUHL 2JIXB 1JRHL 3C60B 5CAYB 3P30L 3MGTA 3IDYC 3HNTH 3QUMA 3H7BA 3RWDB 4WIQA 1DQJA 2HWZH 2JIXD 4JO3H 3C60D 3P0YH 1DR9A 4HEPG 3TWCH 4JG0H 2R56H 3QPQC 4NN7B 2B1AL 5I1EL 2CKBA 5CMAB 1G7MB 4LVNC 5EU6A 5D2NB 1ZA3B 5GGUB 4UU9A 3T2PA 3WNOA 1UJ3B 1JF1B 2ZPKL 5DLML 2XZQH 1MNUL 5JOPD 3VD7A 1QLFA 1JNNH 5EZOL 1KCVL 2P1YA 2C1OA 5HJ3B 3V7MA 2DLIA 2J7LA 2Y07H 3L3KA 1BQHG 2H1PL 1SJVA 3P3YA 5D70H 1QNZH 4ZYKB 3ZKQD 3D25A 4ONHB 1NFDE 4YFEA 4Z5RB 2VZSA 1KLGA 1OQXA 3D39E 3UTSB 2XQYK 1A6VH 3ZT5A 2FNBA 3V6BR 5IF0A 2WINA 4HUMB 1CL7H 1NUDA 1ULVA 2M26A 1ZT1B 3UTSD 3KYKL 4N90E 3QFDB 5IR1A 5IB1B 1D9KA 4V1DA 3CSGA 4I5BA 1E27A 2YPKA 1TFHA 1N64H 1F6AB 2AERT 4OCRH 5DURB 1JPGA 5HXMA 3QJFB 4XXDB 5I15H 1JWSB 2F74A 5F7UA 4HUNB 5DF0A 4NNXB 1CBVH 3FT4B 2ZP0T 4P2RA 4ZQKA 2CDEB 2QQQA 3UZQA 2KKQA 3EDEA 5DURD 1X4YA 2FLBT 4KHTL 1HXYA 4L5FH 3O2DA 2PW1A 5T3XE 2WQ8A 3IJSA 5GXBB 5BV7C 1O7VA 1BZ7B 1QQDA 3L3DB 1MFAL 5KVDL 4J6RL 1HQRA 1ZAGA 5EU5A 4JKPH 4IRJC 5EO1A 1EO8L 3MLVH 4NNPH 5D1QB 3OBAA 3NCJH 3C5SB 1ED3B 3QG7L 3QHFL 2KZ1B 3MA9H 3RL2A 5FHAL 1EVUA 3L3GA 5I17B 4M8VA 3PL6C 4OUUB 4HIJB 3O11B 3EYVB 5D1QD 4OF6A 3N1FC 3SOBH 2OMBA 5EG6C 2QQNH 2WBKA 4OZGE 5DJZB 3BGFC 2IBZY 1PEZA 4JDVB 4LHJB 5TE4H 5EOQL 1K6QH 1WICA 7FABL 5E2WH 2BMKB 2YSSB 5BVPL 1J0IA 4FQHA 5DJXB 1G7QA 1SEBB 2O5ZL 1FLRH 1G7HA 1TXKA 4XNUL 3ZZ1A 4WFHD 3SKOB 3O6KH 2NY7H 2H26A 3MLXH 5GGVY 1T5WB 1JGLH 3OPZH 4NO0A 5FF6B 1S78D 3MFFA 4FQXC 3UCRA 1UG9A 2X89A 2IQ9L 4YE4L 1CE1H 4PY7A 3WSQL 3HB3C 4YDVA 2AKRB 1I1FB 1I7TB 3OL2A 2BFVH 3LN5B 4U6XB 2F19H 5D2LA 4MNQA 3A67L 2BNRE 4G6AC 3RZWA 4PRPA 3QDAA 4LSTL 2FHCA 5SX5K 5FO9A 4JN2A 3SJVB 5GGTA 2DQFA 5GS2H 3QUYC 4QKXB 1I9RL 1GC1C 2YPLE 1G7LB 4HFWB 2WMPA 4XPGL 1JPSH 4IDLA 2DRUA 2NPLX 3SGEI 4PJ7F 4O58H 5C0IB 3SJVD 1IEAB 3MXWL 1EEYA 1UYWL 5E8DH 5B8CA 4PGCB 5ANME 1XF3B 2O26U 5EO9B 5T3ZL 4DKEL 3GGWA 1BJMA 4QLRA 4GKSB 1JPST 4WU5A 1E4XH 3KJ6H 5AAMA 4FNLH 5KOVC 1I8LA 1IGYA 1YN7B 3S34L 5F8RC 2XN9A 3FB5B 3LN4B 5HDQH 2D7PA 3RWFA 3MV8B 1YEHL 3REVB 2EH8H 4NKDA 4JZOB 3O3DA 4YPJA 3SEPA 4LPTA 5C0RL 4JFPA 3FO0H 1AGDB 2ADIB 3I2CL 3MV8D 2EYRB 4FQIH 2XY1A 3QO0B 2GSGB 1MHPH 2YA2A 1ZLWH 2EYTB 4FFZL 5MEPA 3MTRA 3O4LB 3RVVC 1A6AB 2V9RA 5F7DB 4R90L 5IEHB 3P0VH 4UIMB 3JWNC 3VU2A 1EJOL 1IC4L 5FOBA 5HHOA 3O4LD 4GAJH 3JTSA 3QIUA 3IU3A 5MEOA 1WITA 4GW4A 4ZFFA 4ERSL 2BRRH 4HLZH 4JPKH 4NRXB 1P4BH 4WEMB 3QQ4B 3VWKC 4QYOA 1TVBB 3PWPA 1B0GA 4EQ3A 3L6FB 5IWLA 1UGNA 4LASL 4UNUA 4C56B 1MRDH 3VMOA 1A3RL 3U7YH 4HXAH 1RZ8B 3RY5A 3LQAC 4GRLB 1S7UA 1S8DB 4HFUL 4ZTOH 3MLZL 4HGMA 5GHWH 3WIIH 4CMMA 4C56D 3V4UH 1BX2A 1GZQA 2V2WA 4HIHB 3IDMB 5KAQF 2VDKH 4PRIB 3X12A 4GRLD 4WI2A 3S88H 4C4KT 4Q97A 2MKWA 3VJ6B 1CGSH 1P84J 4XNMB 1UQSA 3KYNB 4PRID 4DFHA 3TN0A 4YXHH 3HG1B 3MX0A 1K3ZA 4UT6L 1GPOL 1CG9B 5AUMA 4YFLI 3CFKA 3SKJH 2DBLL 1WBXA 3NCEB 4OI7A 1CFSB 3WUWB 1YEJH 1KN2L 2J5LB 3S5LB 5ICZB 3HG1D 2LABA 3SE9L 2XG4A 3HC3H