2XQYG

Crystal structure of pseudorabies core fragment of glycoprotein h in complex with fab d6.3
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
216
Chain Sequence
QVQLQQPGAELVKPGASVKMSCKASGYSFTSYWMNWVKQRPGRGLEWIGRIDPSDNETHYNQDFKDKVTLTVDKSSSTVYIQLSSLTSEDSAVYYCGRLGYVYGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Core Fragment of Glycoprotein H from Pseudorabies Virus in Complex with Antibody.
pubmed doi rcsb
source organism Suid herpesvirus
molecule tags Immune system/viral protein
molecule keywords ENVELOPE GLYCOPROTEIN H
total genus 41
structure length 216
sequence length 218
chains with identical sequence J
ec nomenclature
pdb deposition date 2010-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqyG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqyG02
5C07A 3QIUD 3EDDA 4L5FH 1MF2L 2YD8A 3MV01 3BXNA 4LLVB 1MHHA 5MEOA 3H9ZA 5HVGB 3T0VA 1T7YA 1A2YB 3GIZH 1EGJA 4IHOB 3AU1B 1P84K 3GBML 3HZYB 5HGDA 3VXOB 2AJSL 3F65A 5DC0A 5A2FA 5CINH 4CW1B 4Q0XL 4LCWA 1MFBH 1I85C 5HHVH 4DGVH 1DBAH 1XF2B 4OLEA 2BVPB 1T1ZB 4I3SL 4JR9L 4EUPH 2XY2A 3VFWA 1A1MA 5SX5H 3U48A 2EIZB 4GBXB 1BP3B 2CRZA 4C56A 4F58H 4D0CB 2HG5B 4JQVC 4XPBL 3FRUB 5DMKB 5MERA 1JVKA 5JQ6H 1TPXC 1EHAA 1FL3A 1T21B 3T2PA 3GI8L 1EZVY 3D0VA 4TUKH 4V1DA 1EEYA 1NCBL 4LHUA 4EIZC 3TYFB 4RCAA 5FGRA 2WNGA 3LHPH 3WFDH 3UTTB 2R0ZH 5FM5O 3THMH 5ACZA 3VE0A 2FECL 2WBJB 3LRSB 1B2WH 4OM0L 4WO4C 5AEAA 3UCRA 5I30L 1MOEA 1B0GA 1Q94A 1XGRA 1HKLH 2LABA 1IEBA 2C3HA 1WWCA 4Y4HA 1A4JA 4JO3H 1PYWB 2FEDD 5I8CB 4PV9B 5EA0H 1I1YA 2RCSH 4RBPK 2RGSA 3KXFB 4NO0A 3T0BA 2YRZA 5LQBL 3EDKA 2H1PL 3VXRB 1ZT1A 5D1XB 4TTDD 4X9IA 5FV2A 4WI7A 1L7IL 3D2UA 1NFKA 3Q5TA 3QH3B 3VWKA 4Z7UE 5D9SA 3QUZD 2BSRA 1A8JH 3VFRA 2HFEB 5EBLB 1PG7H 4KROD 4TN9A 5SX4H 1FLRL 2YPLD 5IR1A 4GXVH 1DSFL 5BXFB 3I6GA 4OT1L 3TC9A 3QNZA 3KJ4B 4NJAH 2XG5A 4X83A 4RX4A 4YHKL 3SJVD 1CFSA 1KPVB 2BNUB 2P8MB 3PGFL 1KJ2B 3NIDE 4I2XE 4KI1A 1L7TH 4ETQA 3BGFB 1GZPA 1A47A 4TUOA 4UT6L 1QBML 3GEWB 1N5AA 3UJTH 1AO7B 3X12A 2F54B 4HIHB 1HHHB 4JPVL 4HIIB 4IRZL 1XIWC 1C7TA 5EC2A 4N9GA 43CAB 1MCNA 3UTZB 4PJBF 2EH8H 1RUAL 2AKRA 4JO1L 1YY9D 4NRZA 4LPYA 2NY7H 1UCTA 4U1JB 5DHVB 1Q8MA 1P5UA 3UBXG 2J8OA 4NC1E 4OLUH 4U6HB 5EBMB 4GS7B 3DX6A 3U9PH 2XA8H 4HX1A 4RMTA 2RHEA 5F3BA 3E0GA 4OGAC 3A6OA 4XNQA 5IFHH 4K7PX 1HCVA 2AJZA 1Z3GH 3BZFB 3PIQA 4WGWB 3S35X 4IMLB 3U36B 5EWIL 1LO0H 5DD6A 2NPLX 1T5XA 3HRPA 1X4YA 2MHAB 3JWNC 3CLEL 3SQOL 3VH8B 3ILQD 5JIPA 3T04D 1PJ9A 4I0PA 4Z7UA 1YMHA 1LNUA 3JV6A 3MRRB 1BM3L 1FRGH 4HS8H 3TZVA 1A3QA 2ICES 3T2NL 3RWIA 2EXWD 1WVZA 2PXYA 1WAAA 5J1SC 1O7SA 1XGYH 4Z77B 4ZD3H 1OAUH 4JG1L 5KANI 4FFWD 3K1DA 3BZDA 4P9HH 1LEGB 3FFDA 2ICWB 5D5MA 5I8OL 4HC1L 4JKPH 4RMUA 5TQ0L 1QYGL 1C8PA 3HKFA 2YK1L 3U4BH 5IESH 1XGUB 4ZXBD 3MRMB 3UC0H 4FQIL 2I25N 2ZKHH 3MOBL 1QPXA 4JDTL 1JBJA 2NY6D 3M8OH 4OCSL 5D2LB 4U33A 4ZFGL 4HWNA 1NMBH 2CSPA 1KBGH 4LSPL 3QWOA 2OSLB 3DX7B 4EI5B 3C5ZB 4J1UB 4J4PD 1OB1B 1LEIA 4Y1AA 3P4MA 4ISVA 4KY1H 1NFIB 2Q3AA 2FJHA 3MJ7A 2Q20A 5HYQB 3QI9C 1E6OL 1UB6B 1M71B 1W0YT 3GHEH 1AGBB 3VXTB 2DQDL 1BWMA 3KLHC 1OCWH 1VGEH 1D5IH 4FQHA 2Q1EA 1RZKC 3UPRB 4KMLB 1ZA6A 1NFDA 1SM3H 3KYNA 1JPTL 3NCEB 5I8EA 4S1SL 1JNHA 3QIWC 2HWZL 1QLRB 1T89A 2X42A 2G60L 2HVKA 3BIBX 4HAFA 1F00I 1OP9A 5TQ2H 3HZMA 3MLRL 3T65A 4YBLB 4E41A 4GQPH 1NAMB 4JGUA 3DO7B 2BXYA 2P8PB 4XWOC 3FQRA 4L8BB 4YJZL 1CFNB 5D1ZA 5D1QA 5E2UH 3SDCD 1U8MA 5T3XE 4MZ3A 3NCYP 4ODVH 5BW7C 2M26A 2XKNB 4Z95L 5GSVA 4FXGB 3OKYA 3ESUF 3VFGH 4Q6IA 5KOMC 5DLML 2BJMH 3P0VH 4XC3H 1F8TL 1YZZA 1OAZL 1W72A 4XPTL 1JYNA 4YXKH 3GBMH 4YBQC 5ISZE 3QXDB 1ZVSB 5HHOE 3VRJA 2P5ED 4HH9B 1E4XL 3MBXL 5D6DA 3H8NA 3PWVA 5EU3B 1BEYL 4Y19D 3HE6A 3UTSD 1OAYL 4NGHH 5TE4H 2MPAL 3GO1H 1AY1H 3TJHD 1A5FL 2OM5A 4M1DH 4O02L 3ALPA 4FOMA 4Y16A 1BZQK 4HKZA 3DV4A 4HIXH 2Z8WC 1VFMA 5BZWA 1T4KB 1LGVA 4M7ZB 4ZFZA 3QEHA 4U1GC 3WKMH 1MFCL 3DV6A 1JIBA 5JLZA 3G5ZA 1BVLB 3H9HA 3VGAC 3LSOA 1XIWB 3NFNB 1AGCB 1NMAL 4MDJB 4O2CB 5D7LB 3MNZA 2J5LB 4UV7L 4UOJA 3ZYZA 4F3FB 5DFVC 1FG2A 1S7QB 4GXUM 5HGBB 2NX5E 3ZT7A 3F58L 2FLBT 2XN9A 4PGJA 3RKDC 2CMRL 3LV3B 4KPHH 1S7RB 3ARBB 1T66D 3LIZL 1BZ9A 1VEOA 3PL6D 3VRIB 1PFCA 3IDYB 4MHHI 1K5NA 1FE8L 4F7CB 4YNYA 2VXSH 2JIXA 3UAJD 1R5VB 5FGSA 5I0ZA 3GB7A 2F8XC 2IPTL 4M6OH 4NQDE 5SWSD 3MODH 3V4UL 4X6DF 4KUZL 4XPAL 3NCYS 4ZUSA 1P7QB 3LKNA 2BSED 2Y06H 2NX5A 3B2VL 5GS2D 5JPNB 5CBEA 4R8WL 2AW2A 43C9A 5CUSL 3W2DL 3OJVC 3AY4A 2PTTA 1FP5A 5D2LE 2D2OA 3JWOL 4H1LA 3DBXA 2A6IA 4JFDB 5A2KH 1E4KA 2V2XA 1KXQE 3G08B 1LE9B 5GJTL 3L3IB 3O9WA 3WNNA 4WNQB 2DYPA 1VPOL 1ED3B 4DZ8A 1HNFA 3BN3B 4Z7WB 3SE9L 3BHBA 4P2OA 2YHGA 1IAOA 5ESAB 5D7JC 4P5TA 5HPMA 4MWFA 5GZNC 2HA1A 4X8JB 1ZGLA 1IM9A 5AZEH 4PUBH 4UQ2A 2IAMD 1NLBL 7CGTA 3WN5B 3QHZL 4GMTH 1EEUA 2VLKD 3CU1A 4JFXA 1TJGH 1J7VR 4M7JL 1PGRB 4BZ1L 4ELME 4HFWB 4LKXA 2EE6A 5FO7A 1U8OB 1CXLA 2WMPA 1G7LA 4JFQA 1YEEH 4UOW1 5HYSA 4O2FB 5HGGS 2CDFA 1EGJH 3S4SB 5J12B 1YEHL 4K94H 4LMQI 4ZD3L 4PRDB 4FRWA 2YZ8A 3IRZA 4OFYA 5FA4A 1MQ8A 2HTKC 5HHMD 2QHRL 4LSSH 3BE1L 1T3FB 4JRXA 4H25B 5E0QA 1EVUA 4PRNB 1QHPA 3V4UH 5HGHA 3RGVC 5FEBA 1UFUA 3V0WL 1IGTA 3CDYA 3UC0L 3T1WA 4FZ8L 2F5AH 4G6KL 1M1SA 4JFOB 2GIYA 4JEGB 2KQNA 3A6BH 2C3XA 4J2XA 3KPRD 1AFVL 4J3WA 2F19L 3ROLB 3AB0C 5HYFA 1HH9B 2CUHA 4EUPB 1MELA 4NQED 5DJXA 1KENH 3C6LB 1CQKA 5FCUL 5MP6H 3W11D 1X5FA 4TNWF 5C0IB 1N2RA 3K2MC 2ZUUA 1J1OL 2MPAH 3GO1L 5IBLD 4PJ7A 1OAYH 5TE4L 1AR1C 2EO1A 1ITCA 4MD4A 4XP4H 3DGCR 2IPKA 3T0XA 3VXSA 3QFJD 2X1XR 5BS0E 3BO8B 1BQUA 5F88B 4YAQA 2VLLA 3GBNL 3DSFL 5CGTA 4R6UA 4XVTL 2CKNA 2XXCB 1KIPA 2IANB 1A9EA 5EU4B 5FM5M 4M4RA 4OGAD 3U4EB 2R8SH 1P4BH 4I77H 4IMKC 3H9SB 4HCRH 2AXJA 2ESVE 4XI5C 2FZ3A 4P3WA 3O8XA 5J89A 1EHLH 5C0CA 2EDEA 1YDPB 5F9OH 1TCRA 4P5MB 5CIPH 3B5HA 4UIKH 5FUCC 1E27A 5ISZA 5FKPA 1XCTA 4YFLI 4XH2B 2GEEA 5CMAA 1BD2D 3LQZA 1D5XA 3T0AA 1T1YA 4KKAC 2MJWA 3GJEA 3PGFH 2CRIA 3OKNA 1B4RA 3IDXL 1P4IL 1WCQA 1ZLUH 1OF2A 3C6LD 3CPLB 4PJFB 4NPYB 5M94B 5IP4A 4LHQB 4P4RB 4AG4H 4HQQL 1JNLL 1TXKA 1Q0XL 5J13C 5IV2A 3R0NA 2D3VA 4WI9A 4WJ5A 1UXWB 1MPAL 4MNQD 5FYKH 3SDXF 4MAUL 1BBDH 1VADA 3MJ9A 3OKKB 4NKIH 5IVNA 3O3DA 1M05A 2R4SH 1FO0L 4MS8D 4L8CB 3D25A 4AYFA 3PWNB 2O5ZH 5D7JD 1HI6A 5DJAA 3HPJB 1JWMB 1NCAH 3MQIA 2BVOA 3JTTB 1RULH 3ZE2F 4NHCH 2XQBH 1IGCL 2ED9A 4PLJC 2OL3B 4Q9CA 2VB5A 2Z35A 5F21B 1S7TB 2FSEB 3MRFA 1TJIL 4GLRH 1GHFL 4OCWH 3QQ3B 3QEQB 1CIUA 5JHDD 5LGJB 5I75B 1CGXA 3SKNA 2WZPD 2XKSA 2VLRB 2OJEA 4DW2H 5H37H 1L0XA 1Z0MA 3SKJH 1VKXA 4Z7OF 4XP1L 1NGZA 5E8OB 3TCLB 1ZLUK 4TVPE 1CLCA 5T3ZH 4D3CH 4XPFL 4LIQE 5EO0A 1XH3A 1T1WB 4F7TA 3N9GH 4D0BA 3MBEB 1HZHL 1LO4L 4CVUA 3GSQB 5CSGA 1R24B 4WV1A 4OZIE 2EIEA 4RGMC 2F58L 3EGSA 2V9TA 5CJ8A 5HHOB 3NFSL 5F93C 3MNWA 2OQJB 2V5SA 2EEAA 1G7HA 2VDRL 3VMNA 3BGMA 2DKSA 1FFPB 4CN1A 4XRCB 3OKLB 2D7PA 2APTA 5T3XH 3IDMA 4RNRA 5BRZE 5AUMB 4IRJA 4EI5C 1Q9KB 1AFVH 3BQUC 1I7ZA 4EVNA 1NEZG 4PJCE 4YC2B 4ZO6A 1IC5H 5F7HA 2ICEA 2R39A 1K4DB 1U8LA 1BD2B 2JELH 4RSVA 2EYSB 4JRWA 3PE9A 1KCVH 4LCWE 1DANT 1DL7H 5FKAB 5E8EA 3GGWB 1QACA 4BH8B 1OTTD 3C8KB 4RFEA 2R0WL 1TVDA 1JN6A 1H5BC 3BZEB 2H2SD 4IEFB 4GSDL 2I9LB 3VJ6A 5IIEA 3ES6B 4LOUD 3NZ8A 5F9JA 4R0LB 1XIWD 2PO6A 4QXTB 5ALBL 3GJFH 1V7NL 2E9BA 2GHWB 5IVXB 5IVZA 1BMGA 4YWGH 5SV4A 1ND0A 1P2CB 3IJYA 4DFHA 4EQ3A 3GSNL 5F3HA 4G6KH 4JN2B 4QGTA 2YPLB 3TJEL 3MO1A 1A7OH 4LFHG 5DD3H 4BSVB 2FEEI 1K85A 3TN0D 1WBYA 4NKMA 3V6FB 3ZT6A 3P30L 1JPFA 4QRPA 4U0RC 3U0PA 4FXLA 4XP1H 4Z7VF 4Q9RL 3LN5B 3DXAE 2AXFB 2ZUXA 2VL5B 3HUJF 2A77H 3WKNA 3DIFA 5ADOL 2A1WH 2QADC 5IMKB 1PDKA 2IMNA 5JA9A 3H42H 1IZJA 5CWSB 1MQKH 2F5BH 4YHLH 5IW6B 1PAMA 5IUSA 5BZDB 2XZAL 1AD0A 1ACZA 3IDGB 4ZS6C 4LVHB 1F90H 4KK5D 5HYEA 2XRAL 2NLJA 4P5TC 1NMCB 4MMXC 3UTTE 5CJBA 1DBJH 2X4RA 3WBDA 1YYLH 4ELMB 1UB5A 4MAYC 3CX2A 3F7PC 4KHTL 5C6PB 2V7NA 4JRYE 4X99A 4YIQB 3SJVA 1D5ZA 1SJHB 4X6CB 3HI1A 3T2QA 4ZYKB 3RJQB 2CLZA 4RIRA 5BQ7A 3RTQA 3V5HA 1CK0L 1AIFB 1ZANH 3T0EE 2V5TA 1A21A 1TFHA 3QDAA 3L3HA 1DBML 2IAMB 3V79C 1QEWB 2BVQB 3DMMC 1H15A 4PJHE 2P5EE 4WGVB 1OW0C 5EU5B 3WLWD 4NHUB 3C8HA 3KYKL 5CSZA 3O3BA 3OKOB 5IQ9A 1J0JA 1CQYA 4NJ9H 3NIGF 3HRZA 1CE6A 2BOBB 1EAPB 3KPNA 3N50A 4UI2A 1XGPA 3BP4A 3CGTA 4LARL 5DJ8B 4HUKB 5ANME 1S7VA 1UH2A 1ZS8A 1P6AB 4PJEE 3B3IA 5EBWB 1WC7B 2D7TL 2R69L 4FQ2L 1FIGL 4OGYH 5DRWB 4GKZB 1A1OB 4AMKH 5IBLC 3TNNB 4M43H 3P40A 4XZUA 1VESA 1MLBA 4JAMB 3X11A 4RAUB 4MXVF 4PJ5E 4OZIA 1P4LB 4PJHA 1UT9A 3VFOB 3TZVD 4L9DA 5C08E 1FVDA 3WEXB 3RWCA 1HQ4B 4L4TB 4HK3J 4A6YH 4NYLB 2ZJSL 5KN5B 4Q9RH 3UTPE 3TO4D 3PDGA 1XGTA 4P9HC 1CG9A 3MCKB 3SDXA 2UWEF 1QLEH 4Y8AA 2EH8L 5DQDL 1PKQA 5L7XH 3RKPA 5DJZA 4PJAE 3P77A 1CDHA 2NY4D 1H3XA 1Y18A 3U7YL 5GGSA 4OM1L 2H9GB 4FQXD 2IALB 5D6CB 3CCHA 1CGVA 4I1NB 4S2SA 4WW1B 3WJJA 3O6FD 4Y5YB 3QIUB 2PUQT 1CL7L 1BLNA 3L3DB 5F7DB 1JFQL 3KDMA 4XBGA 1XGQB 2APVA 3FQXA 3V9FA 1OL0A 3C08H 4PFEA 4O58L 2HJFA 4PJIA 3RHWF 5BCAA 5LWYH 5HJ3A 2IH3A 3WIHH 1U8KB 4G42B 3MC0A 5I2IB 1RHFA 4V2CB 2ZUVA 1JP5A 3NGBB 4OCNC 5C0JB 3T8XB 3KR3H 3KWWA 4MNGB 1QSZA 3QXAA 4I9WD 3O4OC 2Z4QA 4CMHC 1MIEH 5T5FH 2HKFH 5F72S 1WBXA 2I5YL 5DQ9A 1YJDH 5DR5H 4EUPG 4CN4A 1MHCB 3KPTA 4LRIC 5F7NC 1LE5A 4JHZA 1T89C 3ZKNC 3WIHA 4RA3A 1A6WH 4TSAL 2VDRH 3AS0A 4NKIL 3B9VA 4FQQA 4OZFH 5DDHA 4PD4J 4U05A 5GGRY 3I85A 5D1ZD 3MYJA 2R1XA 4G8GA 4JFYB 1YPZE 5ETUA 4N5UA 4YDVA 1IL1B 3FONB 3HCVB 1A0QH 1KV3A 5FOBA 5IHBA 1MY5A 1KBGL 2ZKHL 1IAIL 4HLJA 1EVTC 1U6AH 4YDJA 3T3MF 2VABA 4Q9QL 3WLWC 1SEQH 3EOTH 3C09B 2JCCF 4OLZL 4RA0C 3LB6C 1I7RA 5E2WH 4EI6A 2MTPA 1MHEB 4GS7C 1KXVC 2COQA 3GMLB 2ARJQ 3CH1B 3HAEB 2VH5L 2VR4A 4Y4KC 5EORL 1S7WA 3GSUA 4BZ2L 5I76A 5C2UB 5I1AA 4PB0H 4DK3A 4NKOB 3DHMA 1QVOA 4AQ1B 4LCYA 1TQBC 4JJ5A 4XI5D 5DZNA 3MRHB 3QQ9D 4F57L 4C55A 3X14A 2DD8L 2JJSC 5DJCB 5GRJH 5IBTH 3F6LA 1XCQB 4ZAKB 5ITBH 3KPSE 4UMGA 2GUOA 3DUSA 4MJ2A 1PKOA 1VEMA 4GW5A 4LPVA 1A5FH 2LFGA 5I1GH 2OBGA 3LKQB 3TV3H 2ERJB 3L9RB 2E7LC 2P47B 4H88H 2OTUB 3HUJA 1FFRA 2A6KB 1TCMA 2X89A 3RVVC 4B0MM 3MGTA 4QHLA 1JCKA 4FXKA 3QPQD 4JPVH 4C4KT 3IFPA 2ZSVB 3FZUC 1KIQA 4JRYD 1KTLB 5FK9A 3HLAA 1OAZH 4X5WB 4F37F 1SBSL 2ARJA 2QR0A 2OJZL 2QSQA 3VG9B 4UU9A 2HP4A 4AH2A 4P49A 3IU3B 4Z0BL 3VCLA 3MXWL 3RJDA 1CGUA 2ITDA 2JJTA 4N8VG 5MEND 4FFVC 3KPPB 3C60C 1T2QH 2CUMA 4MQTB 2BNQB 3SDAB 1KJ3H 4ZS6D 5I6XB 5EO1B 1QRNB 1T7ZA 1CXHA 3O9WC 1NLDH 1Q9OB 1YEFH 4R7DA 5F71A 4N90E 4XC3L 2I07B 5D2NB 3PV6B 3MLYL 1MCCA 3QR2A 5FFLA 2YUVA 1Q1JH 1UWGH 1KB5L 1OAXH 4JB9H 3C5ZD 2IQAA 3BKML 4P5TD 3B8SA 3X13A 5J11B 3OR6B 4HUXB 3T0ED 4XVJH 4ZO9A 4LCUB 4GXVL 2VWEE 1QG3A 2IJ0C 5TF1H 5I71B 5IVXE 4NRXA 3MROA 5D71L 5KG9A 4X4ME 3H42L 2DLTA 2EDLA 3BPLC 3ULUD 2JK5B 2HFGH 5K9OB 1INEL 3EYOA 1RIVL 4JKLA 1C5CL 3W9DB 1YNLH 4GRMA 3CFBB 4PJGE 4TOYL 3IJHB 4LSTL 4NN7C 3TBWA 4OCSH 3UTQA 1I3RA 1VGEL 2XZAH 2Y1VA 5BV7H 5IJKC 1SVCP 3DTXB 4H0HB 4XXDA 5FECB 1KCRL 5H2BB 3IDNA 4LCCC 2ZCLH 1N6VA 4U6YB 1DVFB 4NQTA 2WQ8A 4BUHA 1JGDB 2Q8BL 1OTUD 1A14H 3DI3B 5I1EL 2BHUA 2A38A 4TPRH 5J6GA 4IS6B 1D5MB 1R3IH 4X6CE 4LSVL 3TA3B 1INDL 1JMZA 3RWHA 1BPVA 1YEDB 5TDPB 5BRZD 3SY0B 1I8LC 3NMEA 3LN4B 1NUNB 2DIAA 3ZLQC 3QRFM 4RMSA 4XNZB 1SJEB 4ZPTA 5B8CB 1NUFA 3AREB 4OF8A 2FHBA 2HLFD 2QTEA 5E5MA 2BVTA 4Z7NF 3HE6C 5JW4N 4AENB 5D93B 4UDTB 3LMJH 5TDOB 1OD9A 2VXTL 4NCC1 3UTSB 3K2UH 5TE7H 3CSPA 2B5IB 5T1KA 1G9NH 5BMFH 5DVKA 1MWAA 5I17B 1N64L 2YA2A 5L8JB 1CZ8H 2XTJD 3K4DA 1CFQB 4HKJB 2R1YB 1ONQA 4JPIA 4ZUUA 4DKDC 1NDMA 5BS0B 5ICYA 2I5YH 4OUUB 4JPKH 3C09C 3MLWH 2PW1A 5D7IE 3RWFB 1R5IA 3VI3E 3QDJE 2P8LA 1SHMA 4JHAH 4NDMB 1I1CA 3TP4A 1IT9H 2WUCL 4X98A 4YXHL 4C56D 2Q76A 4QY8A 3K80A 1UXSB 2UY6A 5EOQL 4V1DE 2KDGA 3ARWA 3QDGE 5MEQB 3UPCA 1X9QA 3IETA 3O81A 4HK0B 3K81A 4WEMB 3MCLH 5HY9A 5JNYA 4LF3B 5J3HC 2RIKA 3VFVA 1RZ8A 4B7LA 4N8VA 3VXQA 5IG7A 3K8KA 1KGCD 4QEGA 3KHOA 3IJSB 2Z8VC 1XF5A 3PDOA 3ARDB 2VJXA 3QEUB 2GAZB 4XVTH 1YMMD 2W9LA 4L8SB 3QG6A 1YEEL 4MMZC 5H94A 3SE9H 1QBLL 3UBXA 1DQTA 4S11A 2UZIH 1HHIA 3AB0B 5DO2C 1VFAB 2ITCA 1E4WH 4PRIA 2WLZA 1BIHA 1CICA 4MNQA 4X4ZA 1UM5H 4XC1L 4FQLL 4XPGL 5TE6L 3NFPA 2AEPH 1CLZH 1WTGT 3TT1L 5JDSA 2LAGB 3TIEB 2NTSP 4JFDD 4GG8A 1D9KB 3WFDL 4ZNEA 1TTGA 3AM8A 3VFTB 4I3RL 2J2ZA 1AXSB 5JHDE 4AEEA 4PJXB 5DR5L 1BREA 4CDGC 2DIJA 2R0KH 3LVEA 2DBLL 4WUUB 1F3JA 1T66C 3IXTA 4HV8A 3FHAA 3MACL 4JRXE 3V5DB 1C08A 2QHRH 4M8QA 4HMCA 2ZSWA 1RZKL 1K6QL 3KPMB 2AV1A 2HFTA 1A0QL 2GSGB 5DK2B 3CFIC 3HE7D 3RP1A 3OZ9H 1LO5A 1KJ3L 2GK0B 4G3YH 4XNYH 2VIRA 3HAEG 4NQDD 5SWSE 4E5XB 5K9JH 2N56A 1R0AL 2E9JA 4LSTH 5KSBA 3GMOA 1UH3A 3RWJB 2I60L 4P5KB 3C2AL 5EFIB 5FYKU 5CJXA 4OCMC 3E3QC 5EOCJ 4LLDB 3GBLA 1ZOXA 1KT2B 2AJUH 4WHTB 1S5HA 1MI5E 4R3SB 3VMOA 3GMPA 4IDLA 1U9KA 3FQNA 1R3JB 3ZHLA 1JF1B 1B4JL 3RA7H 1N8ZB 4EQ2A 4UT9H 4NUJA 1S8DA 4PR5B 2AXGB 3ZKXC 2HWZH 3MA9L 3Q48A 4ZTOL 1ORSB 2BX5A 3CSYA 5T1DH 1FZKA 1I9IL 4MD0B 2VLME 2W38A 2JLLA 2EDHA 3WSQL 4S1QL 1JYVA 1ZWIA 1L0QA 4MCYB 1PY4A 4BA8A 1BQHA 4WO4B 1YMMB 3ZDYE 2XA3A 4P23B 5GISH 4X5XA 4LLYB 4P2RA 4XPFH 5J1TC 3HNTL 4LCIH 1B6UA 4URTB 4M9OA 3MLZH 3F7VA 1DLHA 1EJOL 2YEZA 5L2KE 4H88L 3NZHL 1M7DB 4TQEH 4KI5D 4DWHA 2Q6WA 1MVUB 4PRHA 3N1FC 1FVCB 1QQDA 4BQ9A 1L7IH 3GM0A 3KGRA 3QCVL 3MLXL 5JXAH 4ZO7A 1W0VB 1IT9L 1OHQA 4NO5A 3JUZA 2I27N 3VWJA 4POZC 1VGKB 3H9SD 1PEWA 1NCDH 5ID1B 5D4QA 2OZ4H 3P4OB 4AIZA 5EZLA 1LDPL 3WFBL 5ADPH 1UJ3B 2Y23A 4HGWB 4HHAB 4XHJD 2X7LA 5BVJB 5KSAD 3K3QA 5F7MC 5DVMA 5GGTL 1T7WA 2PCPA 3FCTB 2F53A 4GJTB 4NC1C 4NQCE 3SDDB 1F11B 3TBSB 4ZAKD 5C9JA 1KCVL 3DRTB 3QWQB 4KY1L 5IBUB 1L4IA 4U0RB 2ZPKH 3V8OA 3TZVC 4Y88A 2CDEB 4Z7NE 3MUHL 1B4JH 3RA7L 3L1OL 4UT7H 1E4JA 1YN7B 4H1LH 5B22A 3IS0X 1G6VK 1MWAH 2J88H 4ZDHB 5IFAH 2H3NB 5KVDL 4M1GH 4P0DA 2P46B 1MJ7L 4U1LA 4IBLT 1QRND 3BH9A 5EZJA 4LCCB 3VMPA 1I9IH 4YK4B 2V2TA 2EC9U 2YK1H 3U4BL 4A2LA 1N64H 2UZXB 2FHFA 3FO2B 2A1WL 4C56E 2YA0A 4UIKL 3SKUD 1Q0YH 4L8DB 1RUAH 4LRNL 1IGYA 4Z8FL 5DFTA 4H8WC 5JW5A 3HE6D 3I02A 2VISA 2G75B 4HSQA 3CXDH 4GW1B 4HGKC 5BJTB 4X4XA 1IEAB 2E7MA 1J0IA 1OP3H 5FO8A 1T0NA 5F7UA 4HUWB 3U46B 1E28B 4YDKH 5IB1A 1X5GA 4S0TD 4S0SD 1MH5B 5E8DL 1IC7H 4TYUA 4PJDB 4U1NA 2ICWI 1OOAA 3TBTB 3RWGA 1EFXA 2P5WE 3OB8A 1MAML 2D0FA 3O45A 4XP4L 2HTLC 3GSVB 4YHIA 5GRZA 2VOTA 5ITFB 3H2WA 4M93B 4MNQE 4O00A 1R3LB 5HVFB 3PWPA 5EA0L 4XTRD 3RDTB 3KPOA 3D87B 2A6JB 3MYZA 1KN4L 2WWKT 2DOCA 1FORH 2GITB 3QJHA 3HNVH 5H35A 3IGAB 5CKAA 2PXYC 5E2VH 2X1WL 5DYOA 4I48A 1CTNA 1GC1C 5AG8A 4L4VD 1AHWC 5L0QB 1E6OH 3TO4A 2J8UF 5JHDA 4MJ4A 1MCEA 1CDIA 1XF4B 3B4NA 4JDZA 4N8CH 5E99H 5C0DB 2K3TA 3ESVF 2NX5D 3OWEA 1QSFA 5JA8B 2ESVD 3FN0L 1HCFX 4GRWE 3QO1A 1J8HE 2B4CL 3CMOL 4FTVA 1UKSA 4OTXH 1YUHA 2GTZA 4WHDA 4RFNC 5I15H 5DVNA 4NO0D 1C5DA 2APBA 3D69B 5C07B 2W1NA 1IE5A 3QEGH 3BXNB 3QULA 4JY6B 4NNPL 1A2YA 3TH4T 3CDFA 4IHOA 4FQJL 2C4FU 3VXOA 3C6LC 4NQXB 1G7QB 4OFPA 1I3GH 2J6EH 1S5IL 1NGYA 2E5EA 1XF2A 1FH5L 2AJYL 4Y5XC 2BVPA 1T1ZA 3A6CH 5A2JH 4HZLB 1A1MB 2EDDA 4JQIH 2V7HB 1I8MB 5IQ7H 2EIZA 4GBXA 3U6RB 4C56B 2VUOA 2NXYD 2HG5A 2MNUA 4P2OC 4QRUB 1M4KA 3QDGD 1XF3A 5DMKA 2AK1H 4YHPA 2XNAA 1T21A 3TGXA 3D0VB 2Q86A 4ETYA 1TJIH 1ZLWH 4V1DB 1KTDA 4K8RL 1EEYB 5C3TA 4EXKA 3O2VL 4X0KA 1FVEA 5I19H 4U6TA 5AG9A 2APWA 2M8XA 4POYA 2AI0L 2E6PA 3VE0B 5ACZB 5BV7B 2EYTA 3S34L 3LRSA 2MSPA 3SEPA 4APQC 4YEFA 1B0GB 1Q94B 1GGCL 1XGRB 4J3TA 5IEHB 2BSTB 1MJ8L 1IEBB 3UJJL 3DPBA 3UTOA 5D70L 3BKYL 1A4JB 5D72L 2DTML 3RVUD 5A43C 1PYWA 4TVPL 5I8CA 1CD9B 1MCRA 2AVGA 4YHOH 4W4OC 5C2BL 3KXFA 4NO0B 4GFTB 1AH1A 4JRXD 2J12B 1P9MA 4PRIE 2X4QB 5GGVL 3IKCB 2MQCA 3GRWA 4KDTC 3QH3A 4MNHB 4Y19E 3VWKB 5D9SB 1GSMA 4HJ0C 2VZUA 1FLTX 2BSRB 3ILPB 5I1JH 5IR1B 2VSDA 3I6GB 3U7WL 3V0WH 2FO4B 3ZDXF 4QCIB 4RMVA 1MIEL 4QRRB 1YPZF 4TQEL 1C12A 3W11C 2P8MA 3HG1A 2EDXA 1KJ2A 4PGDB 2DMBA 4ETQB 1TMCB 1VEPA 2Y6SC 1DCLA 4TUOB 4LSDA 4OFDA 5F7EL 5C3LD 1AO7A 3X12B 2F54A 3ARGB 2XZQL 3CIQA 2N7BA 5EC2B 5JPMA 3QUYB 43CAA 1UQSA 3EUUA 2P49B 1T83A 3RUGF 2GW5A 3V4VH 1W2KT 3DX9B 4E41D 3MUY1 3WHXA 4YX2H 1RMFH 1IGIL 3WFBH 4Y16C 2BNRE 4OZGE 4KI5E 4M5ZH 4S1DC 4X6BA 5IFAL 4PD4K 3DX6B 4Y1AD 2B0SL 4HX1B 3ZKSD 3PP3H 5F3BB 4G6FD 4GOSA 1Z6JT 4XNQB 1DEEB 2YBRB 1LO3H 3EZJB 2NY1D 4E0RB 4F7EA 3U36A 5DD6B 4POZD 2W9EH 4JY5L 1T5XB 1HDMA 1HXMA 2AEQL 1OT2A 2QQKL 4ELMF 2UV3A 2FL5A 5DJ0B 4I0PB 1YJDL 1YMHB 4Z7UB 3ULUH 3JV6B 3MRRA 5KSAC 1CLYH 1FZOA 2VR9A 3TZVB 4O9HH 5E5RB 3EJYC 4QHNB 2Z9TA 3RWIB 4L4TD 4JO4H 2PXYB 3DVFA 3SDDC 1ZTXL 4Z77A 2BNRB 2WUBL 4OZGB 5ILTH 1YJDC 3H3BC 4HWBH 1ZGLP 2WWMD 1OM3H 5HBBA 1WFTA 3O6KH 4JJHA 1HYSC 3FB8B 1LEGA 4PJAF 3RL2A 1JNJA 3WNKA 3FFDB 3BPCA 5D5MB 1MJ8H 1S78C 4M48L 3A67L 4BQCA 4MVBC 2GFBB 1TLKA 1XGUA 5TJWK 4OAWB 4KVCL 1U93B 4YFEA 5CEZE 1IC1A 1H3PL 4JE4B 2IPTH 2A74A 4KUCD 5IMLA 4JFFB 2DLGA 1C1EH 5LXGL 4PS4L 3KPLB 1DVFD 3DYOA 3QWOB 2OSLA 3V7AG 1KN2H 3DX7A 2ZNWA 3C5ZA 3MLUL 1OB1A 1LEIB 4Y1AB 3P4MB 3WN5C 2K7QA 1NFIA 1JTOA 2MWCA 4KJWC 4ORGB 2FJHB 4X6FA 4PJEF 1M71A 4N5ED 1AGBA 3VXTA 1CWVA 1FNHA 4LQFH 4P23C 1NEZA 1NCUA 3LS4H 4Y16D 4FQHB 3QJFA 1CU4H 3DUUA 1ZA6B 1NFDB 5HI4D 3KYNB 4K7FA 1HYRC 3LRGA 3HN3A 1JNHB 1FNSL 4OD1L 1QLRA 1FHGA 2IANE 5F8QC 4ZO8A 1T5WA 3BESR 1IBGL 4JN1L 3FN9A 1JRHL 5FYJL 5D5ME 4JFDE 3RVUC 4K23L 5GPRA 3HZMB 4GAGL 3T65B 4QRSA 5T3ZL 4OCXH 4G8FA 1A3LL 4NZRH 3CAFA 2P8PA 3FQRB 4OGZA 5HSFA 1B3JA 5D1QB 5I1CL 3BRFA 4OCYL 2R1WA 4LARH 5C08D 1REIA 2KZWA 3CFJB 5B39A 2VR5A 4IIQA 1TPXB 5GSVB 5C2BH 5HYJB 5DJ2A 4NWUL 2H1PH 1OAUL 2ZOKB 1BFTA 4WCYH 3QEQD 4LQ1A 3DVIA 5DMJB 3NPSB 4G9FB 4KUZH 4U1HA 4XP9H 4KZDL 3RGVD 2CH8A 4JO4L 3VGAB 2D9CA 3QXDA 1ZVSA 3VRJB 4LEXL 5F8RC 3TWCH 1JZ6A 1WZ1L 4PY8I 1QHOA 4Y0GA 5FYJD 4HH8A 3IYLW 1YEIH 2AJ3B 3FO0L 3GKZA 3HUJE 4Y16B 4ZS7H 4H5SA 4Z7QF 1HHGA 3SE4C 5KVGH 4NO2A 4Z7VE 1MJJB 5BZWB 1T4KA 4ZFZB 1GRWA 3MBED 4KHXL 3DV6B 2FYYB 3SE3C 5JLZB 1CGYA 2XOTA 3G5ZB 5DUMH 2APFA 3LSOB 1XIWA 2PO6D 4YGVB 5F44A 1IM3A 1X5IA 1AGCA 2VXUH 3KG5A 5D7LA 1IGIH 3MNZB 4F3FA 1FG2B 1S7QA 3ARXA 3G6JB 5JXEA 5HGBA 2BFVL 5KBNC 4PP1C 2XN9B 1PZ5B 2JJVA 5EDXA 4LSVH 1AGFA 2O5YH 5DGRA 1JGUH 4GKNA 5DI8B 4Y8DC 1JTPA 4KI5F 4DKEH 5I8KL 4YNYB 1G9NC 4MLIA 1FAIL 2QQKH 4HIJB 3WYRA 3RUGE 1RAMA 4LKCB 1N0XL 2X9WA 3GB7B 4JREB 5I1JL 1HSBB 1ADQA 5JTWA 4HWBL 2WUBH 1P7QA 2PYFB 3LKNB 4MCZB 1OM3L 1NC2D 2IAMC 3RU8L 1R5WA 5JPNA 3RVXD 1UYWH 4RGMB 1V5JA 1N0LA 3I9GL 43C9B 2PTTB 2O93L 4JPKL 4PRAA 4PJ9B 3DBXB 4PJDE 4U4BA 3BSZH 3JSSA 3NAAH 4JFDA 4XAWH 5ID0B 1I9RH 3G08A 5EBGA 1LE9A 5ESVA 3O9WB 1UH4A 1ZT4A 1DL7L 1OTSD 1ED3A 1KJVA 4LVNC 4DZ8B 4Z7WA 5I6XC 5J11C 1IAOB 4P2QE 4HBCH 3P73B 3Q6FB 4UILH 5HPMB 4MWFB 3AGVA 4G9FD 3B9KB 4X8JA 1LVEA 4ZODA 3S5LG 3TO2B 1ZGLB 3RFZC 2B0SH 2CO7B 1FORL 5D7KD 3D39B 2GCYB 3DMMD 3WN5A 2B39A 2G2RB 4NNYA 5HI5D 3S36H 2IBBA 2GJ6B 1RULL 1NGPH 4Z7OE 5C6TL 3ROOB 3E6FA 4U1SA 3VXSD 4ZNEE 3DRQB 3M17A 1T7VA 4HFWA 4LKXB 5E99L 1B6DA 1U8OA 4PRPA 4UIMB 4Y5XB 3U30B 4I5BB 4JFEE 1G7LB 4JFQB 3BKYH 3WL9B 3W0WB 4O2FA 3S4SA 2C7UB 4YBLC 4PRDA 5IM7B 4P57B 4ZOEA 1YQ2A 2FBJH 4QF1A 1T6WA 4MNGE 4YHKH 2P5EB 2XZZA 2GJJA 1T3FA 4JRXB 2HMID 5TQ0H 3WCYA 3H3PL 4PRNA 5HGHB 1IGTB 2BY3A 5SWZA 4HJ0D 3SDXE 5F7KC 4UB0H 4DN3L 3Q6GH 2E7HA 2FRGP 6FABH 1VCAA 1HH9A 2FWOB 4EUPA 1CU4L 1BQLH 1EO5A 1UWXH 3NIDF 5DMIL 2QEJA 3C6LA 3MGOB 3ARFB 3H3KA 3TWCL 1IJ9A 3BQUB 5C0IA 1GIGL 1N2RB 4ODSH 1HHKB 5HHPA 2HTLD 4FQXA 4UV4L 1A7PH 4PJ7B 2DJSA 2GJ6D 2HT3C 1J05B 3U82B 1OCWL 4MD4B 2W91A 1RZIB 4DOHB 3GHEL 1NKRA 1DBBH 3HI5H 5BO1H 3T0DA 5JXAL 3VXSB 3RNKB 3BO8A 3VG0H 3IDJA 3UYPA 3FB5B 4FFVD 3WUWA 3WMSA 2YN5A 4L4TE 4MA8L 3F12A 4OLZH 5FYLE 5C8JA 3DYPA 3OJMB 3QWRA 2FIKB 4OSUH 4U1GB 1KIPB 2DQEL 4XB8A 3SDCC 4JFHD 5EU4A 3U4EA 5CD5C 3WFHA 4DUWA 4GMSL 1ZT7A 4K23H 3H9SA 1JZ3A 4PJ5A 1QSEA 4IRJC 2FZ3B 4OF0A 1GXEA 3RY5A 2WIMA 3BWAB 1RPQA 5IT2H 3JV0A 1YDPA 3X3GH 4WW2A 3O6ML 2ADFL 4S1QH 3HA0A 5FKPB 1XCTB 5LBSL 3GNML 4P4KC 3LQZB 2ZUWA 1D5XB 3MV8B 2R0LL 4IOSD 2CGRL 1KC5H 3UDWC 3GJEB 4IOFC 3VD7A 1LEKA 5B21A 1OF2B 1HOCA 2UYLB 3CPLA 4G8GD 4GAJH 1EUTA 2V9QA 3KYMA 4G6FB 4IJ3B 4NPYA 4PJFA 5GISL 2FX8H 5I75C 4J12A 4F33B 5I0DA 3SGEI 3NABH 5AYQA 3OAZH 4MQ7B 1KB9J 3SGDH 1E6JL 1X5AA 3OKKA 2Y36L 4YR6A 3O3DB 3SGJA 3U0TA 4L8CA 4HS6A 1TZGL 4AQOA 3D25B 1MCPH 2RBLA 3O2DL 3PWNA 1V3LA 4OLXH 5I1HH 4LDOB 3MLXH 1IAIH 3IDYC 1SJXA 5INCA 3R0MA 4CGTA 1T0MA 5GGTA 2QJDA 4M62L 4P4KD 2XN9E 1NCWL 5EZOH 4LMQE 4AEHH 1X5KA 1WFOA 1NL0L 3MV9E 3QQ3A 3WDIA 1WT5C 5LGJA 2YD9A 4Y1AE 2V9RA 1CXIA 4DUVA 2VLRA 5F6HI 1JF6A 2X10A 3GSWA 3IFNL 2OJEB 4YPJA 3QP3A 3ARFD 5E2UL 2GQHA 3QQ9C 1NGZB 4PG9A 5E8OA 1EX0A 3TCLA 2ZCHH 4I0KA 3MRLA 2HT2D 1KLUA 4MA8H 3MA9H 4ZTOH 4Y2DB 3G5VB 4LLMA 2IC2A 5D7SH 1T1WA 4R8WH 3R8BB 2DDQH 1A7RL 4JFZL 5L8KB 3IFLH 3WS6A 5AD0B 2WWMC 4XGZA 5EO9A 2DLFH 4MJID 2GI7A 4ODUA 4O58H 4WV1B 1MJ7H 4YDIL 5EUOB 3D0LA 4BJLA 3MNWB 4CN6A 3RAJH 1G7HB 4PLOB 4H20L 3JWOH 4BZYA 5L2KA 1U95A 5FF6B 4KTDL 4XXCC 5ACLA 2W60B 3IDMB 4RNRB 2DI8A 4U3CA 2E8YA 5C09E 4GG6F 3VFMB 1N4XL 3W9EA 4PUBL 4UZGA 2DF3A 1F2XK 2DWEA 3MNVB 4KXZI 3LKOA 2ICEB 1K4DA 1IQDA 1KCRH 1U8IB 4RMRA 1I7UA 1PZUB 2EYSA 5L6YL 5TFSL 3TN0C 1FNGB 2WIIA 3CZFA 2Q7YA 5E8EB 3GGWA 4BH8A 3V95A 3C8KA 3EJJX 1OWRM 3MFFB 1S7SB 1P1ZB 5ADPL 2CD0A 3LEYL 1JRHH 1MLCA 3BDXA 1BFVH 2I9LA 3VJ6B 4CJ1A 5IIEB 4APQB 4L9LB 3O6FC 2J5LC 2FIRT 3DVNB 1QFWL 5E9DD 1MREH 5TF0A 1OAQL 1EO8H 4S1RL 5IVXA 1U58A 1J1PL 4GBXD 4FQ1L 3PJSB 3CSGA 3IAQA 3Q1SH 1D3CA 1T6VN 2IPUG 5ALCH 5F3HB 1RJCA 2GYSA 1ZSDA 4XT1C 3MO1B 3D6GA 4L1DA 2O61A 4GMTL 4BFEA 4BSVA 5LJYH 5IW1B 1NBZA 3S3JA 1BQSA 4Z76B 1WBYB 4H8WL 4N8CL 2J8HA 4DVBB 5KOVC 1JPFB 4LASL 4QRPB 1YEFL 5K93A 1RFDH 3I75B 5I1DB 5IT2L 5T33H 4FFZH 1D5BB 3ARFC 3LN5A 5DQJB 2ATKB 1FCGA 2Y07L 4OJFL 5GS0L 3RU8H 4F9PA 2CR6A 3G9VA 4YXLL 4AMKL 5DQDH 5D93C 1KC5L 4LSQL 5IKCB 1YYML 5BZDA 5D7JB 1UENA 3LS5H 3QCUH 4O5LL 3IDGA 5E8NB 3U30C 4RZCA 3QDMB 5HDBF 1A6VH 5IB4B 2LQRA 3MJGX 3QQNA 4OQTH 3OJ2C 1NSNL 3I6KB 4AZ8A 2JIXD 1UB5B 4KKNA 4HMEA 2V7NB 1LD9B 1EUUA 3ZSTA 1OLZA 1SJHA 4X6CA 2X70B 4JM4L 2CLZB 4RIRB 5BQ7B 1NGXA 4J6RH 1NBVL 3AAZA 4FNLL 2FR4B 3ULVL 1AXTL 2EEBA 4DW2L 1J5OH 3VXMA 3L3HB 1A6TA 2XYCA 1QEWA 1G7JA 4LOUC 4NN7B 1R3KA 1H15B 3L6FB 2BNQE 4K94L 5EU5A 3F7YB 4Z8FH 1YEHH 3O4LE 1QFWH 5F1SA 2XXMB 1V05A 1JTTA 5CSZB 2P43B 1T83C 2AEPL 3D48R 5IQ9B 4WU5B 1F4WH 3UTSE 4B41A 3LEYH 4LHUG 2BOBA 4AY0A 3LH2L 4EN3B 3T77A 1XR9A 1ZHLB 4X6EA 2C5DC 3BP4B 3MV11 5HHOD 3U79A 4YDLB 1S7VB 4JFFD 2OL3H 1VDGA 4WI5A 4EBQH 3B3IB 5EBWA 4BFBD 1DLFL 4MQSB 3GMRA 5DRWA 2PW2A 5KSVA 2FGWH 1WEJH 5HHNA 4JAMA 2X6MA 5D7IF 3H9SE 3X11B 1QR1A 4RAUA 1Q0XH 4OZIB 3OJDB 3GMQB 4K7PH 2XTJC 3RWCB 3OHXB 1FH5H 2AJYH 3PHSA 1TIUA 4L4TA 1UWEH 5KN5A 3D3VD 1XGTB 4OLWL 4XNUL 3BH8B 1CG9B 1UJTA 4NOBA 5GJSH 2VDPH 2CJUH 5K9KB 5IFJB 3IDIB 1EDQA 1P84J 2H32B 4RISH 5C09A 2XY1A 1PKQB 5DJZB 3P4NA 3P0YH 4PRID 3HI6L 1MY7A 4YHOL 5F1KC 4BK5A 2H9GA 4GKOA 2UY7A 2IALA 5D6CA 4RGND 4P9MH 4S2SB 4L3CA 5C0AB 4WW1A 3SGJC 3WDJA 4Y5YA 1NDGB 4I77L 1F4XL 1BLNB 4HWEL 4QXGL 3L3DA 1K8DA 3KDMB 4XBGB 1XGQA 3FQXB 1FJ1B 1G9NL 3S96A 4MJIE 4KKLD 4HK3N 4PJIB 2HJFB 5EU6E 3V0VA 5JO5A 5HJ3B 2VLKB 4R0LC 3VU2A 2FD6L 2X89D 4NRYA 3S7GA 2EEDA 5J13B 4G8IA 5CIPB 4NQEA 3PNWB 5C0JA 4X9FA 3KWWB 3MLWL 4MNGA 2VKXA 2NZ9C 4ODXA 2Z4QB 2FCBA 2B1AL 5E56A 2LE9A 1C1EL 5D2NC 4GAJL 3A6CL 5LXGH 5EC1A 1JZ7A 1WBXB 1CLZL 1AE6H 4G9DA 4PJGF 3RVXC 5IQ7L 5DQ9B 1IEHA 4JHWH 5EIVA 5SWQB 3JWOC 1FO0B 4QTHB 4YC2C 1LE5B 3BDBA 3NN8B 2X1OA 4PJBE 1CF8H 4PJXF 1KELL 4PRHE 4C57C 2DQCH 3GRWL 4N68A 4NQDA 3RDTC 5SX5K 5L9DH 1INQB 2DS4A 3C60D 4IRZH 4Y4KB 4YO0B 1Y6NR 5DD5L 4GQ9H 4JFYA 4JDTH 4KDTA 5ETUB 4Y4FC 1IL1A 3FONA 3HCVA 3RI5K 3B5GA 5FOBB 1IGCH 2FATL 3NCFB 3STBA 4W4OA 1NGWB 3MLSH 3BP7A 5JOFA 4X9GA 3NFSH 4YDJB 3EYVB 5TFSH 2UUDK 4LGPB 1PLGL 4NBYB 4ZPVA 4WUUD 2XPGB 1NCBH 4L3AA 4EI6B 2BVYA 1PVHA 1U3HD 2X9XA 4JO3L 3GMLA 1OTUC 2OXGA 3FL7A 4PJ8A 5GSRA 4KUCF 5FGCE 1RZJH 1I4FA 5C6WH 3SQOH 2P5WB 3VGEA 3O2DA 5I76B 4OIBA 1HKLL 1JZ4A 4NKOA 4LGRB 3QUKB 5GHWL 3ARGD 5T3ZE 1A6ZB 2NY5L 2BOCA 4MVBD 4JJ5B 5GZOD 1AQKH 4KKCD 4LBEB 1RJLA 3WUZA 3MRHA 3B6SA 4RGNB 4NZJA 3X14B 4K7PY 5FYKL 5TF1L 1D6EA 5JXED 4M6OL 2FD6H 3EOAA 1CLOL 4AL8H 4NZRL 3FMGH 4WVRA 2XTLA 1RMFL 4QYOA 4XNYL 3GK8H 2OTUA 3SQBA 2A6KA 1VHPA 3HMXL 3M07A 1FFNB 1MFEL 4WEBH 3RZWA 4UT6H 2Z92B 3MGTB 2XFXB 3VFUB 5JORB 3KLHD 4QHLB 1TVBB 3QXUA 3PGCA 4QOKE 2NY4B 1MI5D 1M7IA 1VACB 2ZSVA 3BYYA 3R8QA 1MNUH 3D18A 1KTLA 3ULVH 3HLAB 1FBIH 2OS7A 1TTUA 2ARJB 1UA6L 1DDHB 4QNPF 1AO7D 2HTKD 3V6OC 4F9PC 5HYJE 4UU9B 2ZCLL 2CLVA 4ZUWA 2P7TB 3TPUA 1BIIA 4TRPL 3IU3A 4GAGH 3VXME 2XACC 5GJSL 3VCLB 3WD5L 4BFIB 1H3UA 1RURH 3BJLA 1MRFL 5E08H 3QIBD 4JZOA 1IKFL 2BNQA 2AJVH 3S34H 5CEZH 3SDAA 5KTEL 3V4PL 3QUXB 3IFNH 5GGSY 1MFAH 5DRZB 5EO1A 3BPNB 1F42A 3TJHC 3SBWC 3L3OB 5JMRA 1QRNA 4UT7L 1X3DA 1B88A 4RDQG 3AS2A 4YFDB 4R7DB 4OIAA 5LGHL 3PV6A 1N0XH 2VLJB 5JW4R 5I1KL 2FLRT 1DQLL 4YZFF 1OSZA 3H0TA 4BZ2H 1AR1D 1CL7I 4OCLC 3KNBA 5ALCL 2IQAB 1X5LA 2XT1B 1JE6A 2D9QB 4DKEL 1YY9C 3LH2H 4LCUA 1UYWL 4NRXB 4HDIB 3WJLC 4ZFOA 1P6FA 2O5YL 3G6AB 5DLMH 2W59A 3P11H 3EFFB 3O0RL 4U0QB 2JK5A 1AKJA 3OAUL 5E6IB 5HGAB 5HI3D 3O4OB 5K9OA 4HJJH 2RB8A 2GJZA 3W9DA 4MX7B 4TVSa 3CFBA 3T4AB 3IJHA 1JUFA 1TTFA 5LCVL 3TBWB 1QLEL 3UTQB 1I8IA 1PBYA 3NCJL 2X4OA 1KCKA 4XXCA 1RHHA 8FABB 2PR4H 5FECA 5CGYC 1N6QL 5H2BA 5JIKA 4LRIA 3GKWL 5I18H 4WEUD 4U6YA 1DVFA 1PSKH 1JGDA 1UACH 4OQTL 2OMNA 3U7YH 4RQQB 4IS6A 1D5MA 2NY3D 4L3EB 5A2LH 3LB6D 1HILB 4PGCB 3RWHB 5TDPA 3SY0A 3RX8A 2WQRA 1MCOL 4WTZG 4Y5VA 4L3EE 5E8PA 3T2OA 1M7XA 2NQCA 3ZYOA 1SJEA 4ZPTB 5TGBB 3QHZH 3AREA 5B8CA 5GGUB 5EUKA 4ELKA 2OI9C 3ZT5A 4CVXB 1R3HB 5E5MB 5C0CE 4HKBA 1FV1A 1NAKH 4NJ9L 2QQLL 4HUUA 4AENA 5TE6H 4NUGH 5GZND 4FTVD 3S5LB 3MOAH 2EDNA 4OF5A 1C5BL 2DN7A 3IXAA 2L7UA 5T1KB 5GRVL 2YSSA 4OGYL 3AROA 5I17A 1K4CA 2IH1A 1IGMH 5C86A 3BEVA 3ZKND 1CFQA 2R1YA 1ONQB 4JPIB 1RK0B 2HKFL 5BS0A 5ICYB 3BISA 1E4XH 4G3YL 5D2LF 2R4RH 2CKBH 2NNAA 4AJ0A 4CRPA 2PW1B 5IB3A 3RWFA 1JZ5A 2EXYC 4ODWB 4CVZA 2EKJA 4Y2OA 4K3DH 1NKOA 1TETL 3B8YA 3MRIA 4D9QE 2J4WH 2DBLH 4O5LH 1AQDA 4QY8B 1UXSA 2NY6C 4UTBL 1JNLH 3ALXA 5ESQA 1X5YA 4MDIB 2ED8A 4TOYH 5GJTH 2VDQL 4JY4A 2DM4A 3IETB 4M61B 3LKSB 1KB5A 2Q87A 5MENB 1NSNH 1JL8A 4UUJA 3VXPB 2V5RA 3VFVB 3BT2L 4N8VB 3VXQB 5IG7B 1JWSB 3UO1H 3V6BR 2D0GA 3IJSA 3PHQB 2ZP0T 1XF5B 5CINL 3PDOB 3QEUA 2GAZA 1A22B 4L8SA 2CXKA 4K9EC 5H94B 3UBXB 3JTSB 2X4NA 3NPSC 4XCCL 3STZB 1X5HA 1FSKB 1MUJB 4UV7H 1KPRB 1RZ7L 5CP3H 3SBWA 4X7EC 1NGPL 2DIBA 1CICB 3LRHA 4KK8D 3FT4A 3SDAC 3WXVL 3MLTB 4RWHA 3ZL4H 1G0DA 3SE8H 1NH6A 3QEQE 3NFPB 2VXSL 4FABL 5JDSB 3DI2B 1A7QL 1FE8H 2DD8H 5IBTL 1D9KA 1L9NA 1NAKL 1YC8A 4OCRH 3KJ6H 5KVMC 2G5RA 1ZA3B 3RIFF 3LD8B 4WWKC 1JPSL 1IAKB 5E6YA 3RNQB 3CDCA 1BBJA 5F6IC 5KS9F 3QYCA 2YXFA 3C9NB 4LU5H 3KXFE 1HXYA 1HZHH 5CZXD 2V17L 1EJOH 4OD2A 3O0RH 4QHKJ 2ZOLB 3FJTA 4M8QB 4OD3H 4NZTL 3S37L 3OAUH 4Y4HD 3OKEB 2DQCL 1EEQA 3E3QE 1QSFE 5DK2A 3DXAA 1MCIA 1N26A 2UWEA 4O02H 1MHPH 3JVGC 3UYRL 1YPZB 5CBAB 5EOCL 1LO5B 3JUYA 4NJAL 3C5SB 1WIUA 3BKJL 3OXSB 3SO3C 2VIRB 5JZ7D 2K7PA 3AMKA 3SGKA 1CXFA 1DN2A 4JZNB 5KSBB 4XCEB 4P5KA 3X17A 5BRZB 4X9BA 2R4SL 4LLDA 3OV6A 4WHTA 4OLXL 2DMCA 1S5HB 4R3SA 5F7EH 3GFUA 1Z9LA 1WLHA 3PQYB 2X05A 5J56B 4N0UA 1E6JH 3V7AE 5DS8A 5JW4Q 3UZVB 2EE9A 3HC4H 5JHLH 3MV7E 3DO3A 2CIIB 3BT2H 4TULH 1S8DB 5K9QI 3NVQA 2GTWA 1J8KA 3N85H 1XF1A 1A3RH 4XVUC 4N1CA 3NH7L 3CSYB 3ZE0E 1TNMA 3CLFH 5A1AA 3KPSD 5I1KH 1HK6A 1JPGB 4MCYA 4X6DB 5KSUA 2GSIB 4WO4A 2OXHA 3LMJL 3UDWA 5GRUL 1U2HA 3O6MH 3ZZ1A 1BJ8A 4XP6H 5FUOL 4I18B 5FYLL 2EDFA 4P2RB 4PLKC 2F8VA 1Z5LA 3FFCA 1UVQA 3ZDZF 4PJBB 2H6PB 1DLHB 1ETZA 1M7DA 5B4MD 3PWPD 4HJJL 5HDBE 1UACL 2ZUTA 2WP3T 4YXHH 1U42A 5HI5C 2Y9RT 1MVUA 1AGEB 2AQ2A 2LAAA 1FVCA 3N1MC 4P9HL 4GW4B 3VGFA 4LVOC 3S37H 4NO5B 2YS4A 3WHE0 5E6IC 3PQYD 5ID1A 3KYAA 2Z0BA 4M6NH 4R90L 3P4OA 4PBVC 4AIZB 5EZLB 4FS0A 4TSCL 3MSPA 2PKDA 3DETD 1UJ3A 4HGWA 4HHAA 2X7LB 3BRGC 3BWUC 3CX5K 5BVJA 4JO1H 4H20H 3WO4C 4OV5B 1CD1A 4ZXBA 3FCTA 1QSFD 2PCPB 2NW2B 4OZFA 1IC5L 5CFHA 1JMXA 2F53B 1VA9A 2W9DH 3HC3H 3LKRA 5HHMB 1QA9B 3HTLX 3W5NA 4J23A 4LEOA 4X4MA 3JWDH 3Q5YA 3ULVE 5IFHL 2YPVH 4HMDA 4NFDA 1N6UA 1XGYL 1YN7A 2DRUA 4OTXL 2BRRH 2RJMA 3T3PF 2FGZA 4EN3D 4YH6A 5GRWA 2NY5H 2QHLA 3ZE2E 2H3NA 1RUMH 5H8DA 4GAYB 5C92A 3D5OF 1NFDE 4P2CG 5EZIH 3HR5A 2J7LA 1QKZH 4P48A 4LCCA 3RUGB 4MA1B 2M2DA 5DURB 5BW7A 4GBXC 2LU7A 4PJ5D 1ZHNB 3GMMB 2D7MA 3MGAA 1BHGA 4RAHA 1J0HA 3QUZC 4L8DA 3C8DA 2BY1A 3FT2A 5JW5B 4LSUH 2YWYA 2R69H 4GG6E 2G75A 3S9DB 4GW1A 5BJTA 3NTCL 4X4XB 1G1YA 4OI7A 5FO8B 1T0NB 2WP3O 3MCLL 1BQLL 3I3BA 1WF5A 4KC3B 2YD7A 5DEZA 3RZCC 3WIIH 4QHUA 5IB1B 4W6YB 2W07A 1DTUA 2IAND 1CT8B 4Z7UF 4YHZL 5TH2B 3SO3B 1H5BA 4KK9C 3RWGB 1EFXB 2IGFL 2UZYB 2RR3A 2EECA 3O45B 3WXVH 2Z8SA 4PYGA 3OMZA 5ITFA 3EO9L 1CXEA 1U8HB 4O2EA 2XWTB 5CEZL 5KTEH 1R3LA 4OF3A 3PWPB 3RDTA 4XCCH 4K2UH 3KPOB 3BUYA 2AJXL 2A6JA 3MPCA 3WXWH 2GITA 4UNTA 4XMKL 2APXA 3QJHB 2BSSA 4HBQA 5H35B 3PQYE 1WBZA 4DEPC 3WIFA 2NY3B 4I48B 2Z31A 2ZG3A 1G9EA 3P0YL 5GS3A 3D3VA 4PRPE 3QFDA 5D96B 4ONFL 1NGQL 5C0AE 4M1CC 5DEFA 1BOYA 2O5XH 1XF4A 3WFCL 1RUPH 4JDZB 4OLYL 3I2CH 3OQ3B 1A3RL 1S7UB 3CC5B 5DVLA 3M8OL 2HRPL 5ELIA 5DD0L 2P24B 1QSFB 4BSWA 3QUML 1LHZA 1U0QA 3HNSH 1PEZA 1IBGH 2X4SB 4JN1H 3PWUB 3EW3B 3X3FH 1K6QH 1RSFA 4LP5A 3BPOC 4EN3C 4F15B 1IGJB 3E8UH 1BJ1J 3AFLA 5B3NA 3T0EB 3QULB 3V52H 4JY6A 1CGSH 1KCSH 2R0KL 4Q74A 3EKCA 4DZBA 4NQXA 2YD4A 1G7QA 4PGZA 5HPOA 4M6MH 4APQD 4MJIA 1FN4A 1NGYB 3O3EB 2OL3L 4R9HA 4MAYD 4OZ4B 4FQIH 4HZLA 1BZ7A 2J3SA 2V7HA 1I8MA 1FGNL 4IRSC 2V2WA 2XICA 3U6RA 4QRUA 3O11A 3K8MA 3VH8G 5SWSA 1XF3B 4N0CC 1IC4L 4YHPB 3RBSA 4MQXD 4PV8B 2XNAB 4OBSA 4XP5L 5KZCD 3F58H 3VD9A 2E9WA 2Q86B 1NL0H 4PP2A 1KTDB 1OVZA 4W6XB 1NC2B 4PJIF 4X0KB 1FVEB 1U36A 2A73A 4XAWL 5L88H 3DECA 2GT9B 1YEIL 1CIDA 5CKGA 5I66A 1VPOH 2EYTB 3OAYH 5FYJU 1NBVH 1Y6MR 1KIRB 5B3JE 5IMMB 4TULL 4XNZC 1NQBA 1JI2A 5IEHA 2BSTA 3L3GB 5DA0B 5FHAL 4XP9L 4KZDH 4MA3B 4NZUH 4FA8A 3L3JA 1UCBH 4K9EH 3OF6A 5F1IA 1CLYL 4XBEH 2X4QA 3T2NH 3IKCA 1EMTL 1F4XH 4MNHA 1CF8L 3GHBL 4H0GA 4K7PL 4PG2A 3ILPA 5DF0A 3OG4B 4LVNB 1MCQA 3BP5A 3BPNC 1F45A 1MIML 3QDME 2FO4A 3HNTH 2F58H 4LCIL 2H8PA 3LAFA 3GNMH 4QCIA 3IF1A 1F8TH 4QRRA 1C12B 2DMKA 4HEME 3MRJB 1EGJL 3HG1B 4IMKA 4PGDA 1UJ3C 3I3DA 5J8OA 3QZWG 2XRAH 5C71A 4PTTB 3ARGA 1MEXH 3QCVH 4X6DE 5JPMB 3QUYA 1UQSB 1KELH 3WE6B 5E4IA 3RPIA 5C0NC 3EJZC 1G6RB 4U1MA 5IK3B 3W5MA 2AAVA 3DX9A 1QR4A 3LKPA 3S8WA 3WHXB 5LGKA 4G5ZH 4R2GB 4X80H 3V6ZA 2FB4H 3F62A 4ODTH 4X6BB 3H7BA 1ZHBB 1CXKA 2X09A 5GS0D 1DEEA 2YBRA 3MRPA 1RZFL 2ILLA 3RPKA 4F7EB 4E0RA 1A7PL 3ARDD 1JFQH 4LGSB 1HDMB 1HXMB 1UEYA 2VN7A 2XV6B 3ZTNL 1I1AD 1CDUA 2FL5B 5DJ0A 3K74B 4KQ4L 4U31A 1FZOB 3ARZA 4PGEB 1F5WA 4ZUVA 2VH5H 2VITA 3CH8A 5HVHC 4QHNA 5EPMB 1XZ0A 4ZOCA 3CFCL 2BNRA 4OZGA 5E6ID 3MACH 1JK8A 3FB8A 2MFNA 2Y5TB 3RL2B 3QIBA 3BPCB 5F7FA 2MKWA 4TVPD 4IOIA 5D8JH 3IU4L 5ERWB 2YN3A 5EB9A 4HCRL 2GFBA 5C08A 4OAWA 1U93A 5KJRH 1DQQB 2WK2A 3ARDC 5MHSD 1QD0A 2A74B 5IMLB 4JFFA 3HMWL 4LLAA 2HFGL 5FUZL 2YXMA 1FYTE 2CKBB 1DEDA 1MFBL 5HHVL 5EUOE 3KPLA 3O41A 4KRLB 2FJFA 2EE2A 1NLBH 4P3CH 3WXWL 3RBGA 2AK4E 5KSBE 5J9PA 4L3ED 4XPBH 4LHUD 3FO0H 4ORGA 5C6TH 2ADGB 4WW2C 4X6FB 4DQOL 3P9LA 4Z5RA 2KH2B 4FZEL 3VGBA 1MCHA 5D7IB 1MAJA 4XPHL 3PWLA 4IRSB 4PPTA 1U3ZA 1IMHC 1GYAA 2F15A 1NEZB 5IOPA 4NKDA 4DGVL 4E9LA 2DQJL 3QJFB 3HC4L 4GKSA 3DUUB 1OGTA 3NA9L 1VB9A 5C09D 4K7FB 1I3UA 4HBCL 5DMGC 1P7QD 3GDBA 1T5WB 1II4E 3PXHA 2AV7A 4Q6YA 2VXQH 4GLRI 1NAMH 3T3PE 5C07E 1R6VA 1LP9F 4QRSB 4KJYA 4G8FB 1GGIL 2DL9A 1EO8L 4S1RH 5DRNA 2OP4L 2MOVA 2D7NA 4QOKB 2R1WB 1FC2D 5E9DE 4F7PA 4D8PB 3CFJA 2VZ3A 4U49A 2WLYA 5B39B 4IIQB 5HYJA 5DJ2B 3JBG7 2ZOKA 5I15L 2ADJB 3ULVC 1DP0A 3OBAA 5MI0B 4UBDD 4G9FA 3K7UA 4U1HB 1AE6L 1EXUB 2WBJD 4KDVA 3PF2A 5CAYB 4Y7MA 3MMEB 1S9VB 1CE1H 1WCBA 1Q9WA 5D2NE 2R56H 5KS9E 1A7RH 2YKLH 2YMXH 3T1FB 1HQRA 2AJ3A 3QNYA 5DJDB 1MCBA 3BOVA 3W0WE 3OR7B 1SEBA 4H5SB 3QO0A 5DJYA 1HHGB 1S7XA 1CFVH 3QIBC 4NC2B 4NO2B 1MJJA 2XTJB 3L5WB 3EHBC 3NPZB 5IHUL 3HMWH 4M5ZL 4P3DB 4KROB 3WNOA 2FYYA 4KJWD 2OI9B 4GG6B 2BCKB 4WIQA 2E8ZA 1MCJA 4YGVA 1IM3B 2LU4A 4UQ3A 4NQEE 5KAQF 2PYED 5L88L 3SKJL 4P2QA 4OV6F 4LAQH 4WFEE 1M6OA 2FH8A 3G6JA 1KCUH 5C0BD 1U92A 1N6QH 3TVMB 4TPRL 4R4FH 1PZ5A 5LAXA 3BKCL 4ZMAT 2R23A 1AGFB 3VG0L 4PYHA 4Y5YC 3I50H 4GKNB 5DI8A 4MQXC 1P4BL 3IDUA 5ENWA 2D4FA 2EXWC 1Z9SA 3S97C 2C3WA 8CGTA 4JB9L 4IRSD 4HIJA 1T2XA 2Y25A 5IHLB 3ETBF 1ZEAH 1LO0L 4LKCA 4P99A 1J0YA 4PRPD 1H3GA 1LILA 5KW9H 3GIZL 3CVHB 2W0KA 3DX8A 1HSBA 1FL5A 2KBGA 2PYFA 1HHJA 4MCZA 4NWUH 1A6WL 4TSAH 2QSCH 1R5WB 4P46A 4TVPH 1QZ1A 5F96L 3WIIL 4HWUA 4BQ6A 1B0WA 1HWGB 3BVNB 4MXQD 2XQYK 4PRAB 4NQCB 4MGXA 3GMNA 3O2DH 3VFSA 4PJ9A 1ES0B 4JM2F 3REWB 1JV5B 4XMPH 1KPUA 1IVLA 1Y0LB 5ID0A 1OQOA 4YFLF 2F19H 5ESVB 1UC6A 4KFZC 1U8PA 1ZT4B 1CDCA 3O8XC 2YD1A 1KJVB 1IAMA 1QSED 1W72L 2B2XL 2HN7B 2JJTC 5DMGD 4CU6A 3P73A 3Q6FA 4ODTL 3B9KA 3TO2A 1FC1A 3ZKMC 2VQ1B 3L7EA 3L7FA 3D39A 2GCYA 4JM4H 3LPGA 5CP3A 3BW9B 4QTIL 2G2RA 4NNYB 1GGBH 2YC1B 3BN9D 2GJ6A 5CD3A 2P42B 4F8QA 4M62H 1RZJL 4Q2ZB 3RGHA 5FYJH 2IQ9L 3ROOA 1SMAA 3T0WA 3MRDB 2NTFA 3E6FB 4U1SB 4RAVA 4D9RE 1GH7A 3DRQA 2VE6A 1UCBL 3M17B 4RGOL 1LMKA 4DCQA 5KS9B 1NLDL 5GGVH 1OSPH 4PRPB 4UIMA 4Y5XA 2RAMA 5FDWA 4Z7VB 4I5BA 3O4LB 4MJ5A 4GMSH 2UUDH 1RI8A 3WL9A 3W0WA 4KZEH 2JB5H 2W0FB 1KCUL 1FZJA 4XVSL 5I30H 1O0VA 5DWUL 4ZUTA 2C7UA 5IM7A 4P57A 5LCVH 5T3XL 4QF1B 1DUZA 3KJ6L 2P5EA 4OZGF 1CGTA 4TUJA 2VERN 2XG4A 1OAQH 3MLRH 4LVHC 1K3ZA 4C4KO 2AK4B 1X5JA 5SWZB 1U3JA 4HF5L 3B83A 4WWKA 4HIEB 5ANMA 3QXVA 3V8CA 4M7KL 2FWOA 5K33A 3UPAA 2CXGA 3S35L 1G6RL 3MGOA 4PTUA 5A3ID 3ARFA 2Z8RA 3BQUA 3AMLA 4JFPA 2QSCL 1HHKA 5HHPB 5C7XH 3M1BB 4FQXB 1X7QB 4V2BA 1MREL 1R3IL 3LOWA 1J05A 4YZFE 1AC0A 1LO3L 1RZIA 3F5WA 3SHSA 4N8PA 5JOPD 1DBJL 3GI8H 3RNKA 1KNOB 3OKMA 2VNCA 4TSBH 1BAFH 3IDJB 3C2AH 3G04A 4XCNA 1GC1L 3FB5A 3WUWB 3BFOA 1G84A 4IOFD 3BUTA 3F12B 3AM8C 5C8JB 2KUTA 1YQVH 3LDBC 4V1DD 2FIKA 3VGGA 1IGFL 1U8JB 3GJFA 3WFHB 5GS0C 1ZT7B 2DLFL 3DWTA 3C5JB 1YN6B 4PJ5B 2QBWA 4R4FL 1QSEB 2CKBL 4J8RA 1FYTB 3QDJD 5E7BA 4KWUA 1YNTA 3DNKA 3BWAA 1LP9A 3NBNA 4HXBH 4WW2B 1B90A 3CLFL 5BVPL 1WEJL 4JLRA 2VN4A 3B9KC 1N5YH 5CZVL 1BVKB 3QPXL 3C08L 4ZSOB 4N0FA 3MV8A 4WHYG 2VL4A 3NH7H 5JW3L 3MR9A 1LEKB 2X4UB 1BX2B 2DM3A 3D2UD 3ET9F 1HOCB 2UYLA 4HT1H 4CU8A 5FYLH 3KYMB 3VWKD 5ADOH 1KN2L 3PGDB 4F33A 3SKOA 4LL9A 3PL6B 1JGEA 2VDOL 1FSKC 4PJGB 4JREC 4HF5H 2R56L 1TITA 4CU7A 4F7MB 4MQ7A 2YD5A 1BQHG 2YMXL 2YKLL 1G7IA 5E9DA 4M7ZC 1SQ2N 4WRLA 4Y4FA 4YR6B 3BX7C 3U0TB 1WV7T 4J6RL 1DLFH 1IM9D 4HS6B 3MBXH 3BKJH 3WFZA 4K8RC 5EU7E 5INCB 1T0MB 1BVZA 4JHBA 5GRYA 2NY7L 3FT3A 7FABH 1BGXH 4GRWF 4J4PC 5EOCH 4G7VL 3PABB 2AK4D 1ZXQA 5F1NA 4NN6B 4OZHF 4N90D 5IB2B 3LIZH 4NWTH 4QRQB 2ZG1A 1FAKT 3QHFL 1C16A 3GSWB 3OTTA 1FAIH 2GJ6E 4KQ4H 3WLBB 4M4PA 3PP3K 4JQXC 5I1CH 2VWEC 35C8H 4PG9B 2VKWA 3CFKA 4NNXB 3CLEH 5MENE 3CUPA 3BZ4B 1G1CA 2NXZB 3MRLB 4PJFE 1H3WM 2VXVH 1OSPL 3KS0H 1KLUB 5AZ2L 1KEML 1LO2H 2J88L 3N9GL 4Y2DA 3G5VA 4LLMB 5CJQL 2BFVH 5HHQA 3B2UD 3SN6N 5AD0A 2A9NH 3GRWH 4XGZB 1KJ2L 3FOLB 5EO9B 1BECA 1NC4B 1DE4B 4M1DL 4PBWD 1CFTA 3PL6C 1T7XA 3QPXH 3CMOH 4ODUB 1S78D 1FIGH 4X5LA 25C8L 2DQTL 2YPLE 3BEWA 4NCC2 4CAGA 5EUOA 1I9RL 3D0LB 4HXBL 4NM8H 1SY6L 4HWZB 5L2KB 1YY8A 1U95B 5FF6A 2W60A 1GJIA 2BERA 5ICXB 1CICC 3OPZH 3VFMA 3W9EB 1FL6A 4BELD 3QFJA 3VW3H 4CMMB 2DWEB 3RZCD 5K9QG 3EOTL 3MNVA 3LKOB 1IQDB 1U8IA 4TRPH 5E8DH 1V7MH 1I7UB 4GRLA 4POUB 3BD3A 1FNGA 2WIIB 3CZFB 2Q7YB 5E95B 2YR3A 4H26B 5AWNL 3MFFA 1S7SA 4F2MA 1P1ZA 4KKCC 3DURA 4KQ3L 2CDGB 1WFNA 5I16A 5HHXH 1MLCB 4APQA 2HJKB 4L9LA 2FX9H 3O8XD 3DVNA 3TT1H 2IEPA 2G60H 2Z91A 2J6EA 4ONGH 3U1SH 3HNVL 1CD0A 1U58B 3TYGH 5FM4A 5IEKB 3PJSA 2FJGA 2VMFA 1HSAB 3E1F1 4DEPB 1ZSDB 2XZCL 2N4IA 4KAQH 2O61B 5J7CC 5IW1A 3HPLA 5DUBB 1NBZB 2HKHL 4Z76A 3KPSA 2VXVL 3MRBB 4DVBA 3SKMB 1CDYA 1OGAB 5I1DA 3I75A 5KW9L 4YK4C 3W2DH 1D5BA 5DQJA 1AY1L 1TJHL 3RL1A 2ATKA 2DDQL 4S1DD 4CVWA 3W82A 1EV2E 2LTQC 3MV7A 1KTKE 3T08A 1FFOB 1Z9OA 3IAGC 5D7LD 3EFDL 2PYEB 1FGNH 3TVMC 3EO9H 4YHMH 4NCDA 1EMTH 2NY1C 4XPAH 5IKCA 5D7JA 4R2GD 2VRAA 1BAFL 1U3YA 2DQHH 5E8NA 1CFVL 3RGVB 1XAUA 4RZCB 1LDPH 3QDMA 4OF7A 2NZIA 4PJXE 4UILL 5IB4A 1PY9A 1PSKL 3LPWA 5L2JA 2VLJE 1CGSL 3UTTD 4Y19A 3I6KA 3EYFB 3MUGB 4LNRA 3AY4C 4YBHA 1ZLSL 1LD9A 4L9LC 5GGTH 4W70A 2AQ3A 2X70A 4G7YH 1AHWA 4K2UL 5LGHH 1NGXB 3AAZB 2FR4A 3FAWA 5A16B 4K3GA 3VXMB 4G6AD 4U1KB 1A6TB 4NT6B 1G7JB 4QRPE 1A4KA 4Z9KB 5EWIH 1R3KB 2FNBA 3L6FA 4N0CD 3F7YA 4HFUH 1QFWM 1HINH 1SY6A 4WU5A 5I1GL 2BK8A 3UJJH 2J8UA 4G8GE 3H9YA 3CVIL 4M6ML 5C70A 4EN3A 3T77B 4XVSH 1XR9B 1ZHLA 2HAZA 4X6EB 1QBAA 1FZMB 3BKMH 4HPOL 4GUPB 4NBZB 5A3IC 4HLZG 3GMRB 3X3FL 5CSBA 2PW2B 5KSVB 5HHNB 3IT8D 1MFEH 4JM2B 1NBYB 4IRJD 3KAAA 3HNSL 4KK6C 4M8VA 1QR1B 1QBMH 4ZOAA 3WD5H 3OJDA 3MOBH 1GIGH 3GMQA 4I3SH 4JR9H 4Z78B 4YLQT 1F3DJ 3OHXA 5E1AB 1WQVT 3IU4H 1CR9H 4IDJH 1YNLL 1J0KA 3KYOA 3VXRD 3BH8A 1PG7W 3ARBC 2G5BA 4NC0B 1G9MC 5IFJA 5K9KA 3IDIA 5C09B 2H32A 3C60A 1CVSC 4MAUH 1J88A 1I8LA 1DUYB 3P4NB 2BC4B 5EZOL 4NIKB 1XR8B 1LP9E 1YEJL 1J86A 1D7FA 1OLLA 1B0RB 5GHWH 3PHOA 4L3CB 5C0AA 4OLYH 3RY6C 2AI0H 1NDGA 2HRPH 3UTPD 4H1LG 1F2QA 4F15C 1K8DB 5I73C 3E6HA 3VGHA 2VDNH 1FJ1A 4NKQB 3S96B 2C4FT 3RDTD 1RZFH 4J3UA 5JO5B 3V0VB 2DTMH 2ID5A 2VLKA 5D70H 1GPOH 4KROC 4NRYB 1TZHA 2D31B 2KZ1B 4G8IB 5CIPA 1A7NH 4NQEB 2HVJB 4PJ8D 3TESA 3PNWA 3TA3C 5KJRL 2CGRH 4JM2D 3GK8L 2R0LH 1MCOH 4ODXB 3KLDA 4FQLH 1RIHL 4NBXB 4XPGH 3BIKB 3RAJL 1Z9MA 5EC1B 4ZNCD 3QIWA 4RFOL 4G9DB 5DEGB 3U7WH 5J3HD 32C2A 2HFFA 1P7KA 5SWQA 2LU3A 4XNXH 5GGVY 1QO3B 4QTHA 1FO0A 2EDOA 5CJOH 4HD9A 1WIPA 2VZSA 3NN8A 3QG7L 4YPGA 4KH2A 4NO3B 1QSEE 2ZZUT 4IJ3C 3CFDA 4KK8C 3SDAD 1BOGB 3U0WL 4NQDB 1OP5K 1INQA 1KFAL 1NJ9B 4JDVB 5I18L 1U8NA 3OKDA 5AWNH 1JHLH 5FGCB 4Y4KA 4YO0A 3DGGA 3H6JA 3EDJA 1ZV5A 1YYMH 1FLRH 3FO1B 3HMXA 2R9HC 1MCWM 2AEIT 4YEEA 3VW3L 1H8NA 1NGWA 3I6LE 2B8OT 4W6WB 1UKTA 4D9QD 1SBSH 5INDB 2EDKA 2XKUA 3BP7B 5JOFB 3EYVA 3RTQD 3CMGA 2Q8AL 1I1FB 3DROB 5I71C 4E42B 4ZPVB 3IB4A 2XPGA 1GGTA 4K55A 3DOSA 4X80L 2KQMA 2YPKA 3GSOB 4X7TB 1QNZH 2OK0H 1N7MH 4KRPD 5CEZD 3QXTA 4PJ8B 5GSRB 4PB0L 1I4FB 4OFVA 2PF6A 2P5WA 2C3VA 5IJVB 2ZNXA 3GSNB 3QUKA 3MJ9L 5D7LE 4LCWD 3K4AA 1A6ZA 4JKWA 2BOCB 5CJXC 1RFDL 3VDBA 1Q1JL 1UWGL 2VXTH 5FUZH 5ILTL 1ZTXH 2CPCA 4LBEA 3BP6B 3UJIH 3C6SB 3P9WB 1RJLB 3EOBA 2MKLC 3B6SB 4OFIA 3EDFA 1DBMH 1S9YB 1JJUA 2WBWB 3TH2T 3OGOE 4I13B 4JM2C 4DAGH 4XVUD 4FP8L 2ADIB 1D6EB 4BYHA 2DQFA 1HEZA 3EOAB 3B43A 4MJ6B 5E2TL 5FHBH 3OZ9L 5MEPA 4QYOB 1QLFB 5JUEL 1NC4D 2ATPA 1ULVA 3LEVL 4MA7H 3BYTA 4XCYA 1FFNA 2Z92A 2XFXA 3VFUA 5JORA 2MQ0A 1TVBA 2DQHL 5CEYA 3PGCB 5DHYB 1VACA 1M7IB 3D18B 1J8HB 4GRWB 4GAFB 5I1LB 5CJOL 1L7TL 2HT3D 3MRCA 1DDHA 2X4PA 3B9AA 2CLVB 4ZUWB 2P7TA 4P2RD 3U2SA 4JVWA 4OLWH 3TPUB 2DQDH 3O6FA 4MD5A 4A6YB 1BIIB 5T5NG 4BFIA 2QQLH 3RY4A 5I1EH 4JZOB 1IKNC 4KHXH 1BJ1H 1DANU 4NQSA 3QUXA 3OGCB 2ED7A 1QBBA 5DRZA 3L3OA 2VDLL 4PJ8C 3P0GB 1WFUA 1WJ3A 1J5OL 4RX4D 5FV1L 4K3EL 3BRDA 1T20B 4JPWH 4PJIE 5EU6B 2VLJA 4M7JH 5L2KD 1OSZB 4WFHE 3H0TB 2NR6D 3MRQB 2QKIB 4DKFL 9CGTA 4EIGB 3KNBB 1H3TA 2PO6C 2VZTA 5DSCA 3U9UA 2AABH 4HC1H 4JKPL 4PIRF 3B9KD 2OR8A 2M1KA 1G7MA 3CFCH 3ABZA 3EBAA 4GRLC 3QISA 4HDIA 4ZFOB 5EOTB 3G6AA 2EDWA 2OX5A 3EFFA 5E6ZA 2Y06L 1AKJB 5HGAA 5E6IA 2ARWA 2Q3ZA 1NPUA 1EZVX 3VXUB 1HKFA 3WS6C 5T3ZD 1ORQA 3H3PH 3SDYL 2GJZB 2ZWLT 4QWWD 1J8HD 4ZTPH 4MX7A 3MLZL 1OGAD 1N3NB 4MYWB 3T4AA 2VAAB 1JUFB 2OCFD 2D4DA 1I8KB 4I3GA 1QYGH 4OB5L 2CUIA 2AS5M 1I8IB 2X4OB 1I3VA 4KXZH 4MA7L 1RHHB 8FABA 2C4XA 2JTDA 4LLWB 4OQTA 4HIXL 1AP2A 2FB4L 4QXUH 5GS1A 2ZUQC 5MHSE 1T22A 2NW3B 3LS4L 1RUQH 3SGEH 3BDYL 5CILL 3S3PA 3WJJC 3TLRA 2PXYD 5T1DL 1FNEA 5JQHC 3N1GC 4RQQA 1VFBB 3SGDI 4L3EA 4G80B 1HILA 4R96A 4PGCA 4X4YB 3REVB 1F4HA 2XI9A 4OCRL 4KRPC 3VDAA 5KVDH 1BWWA 4KK9D 4Y5VB 5E8PB 3G5YB 4OI9A 4PGBB 1QP1A 2VYRE 5TGBA 3DSFH 4FMKA 5GGUA 4GRWH 5EUKB 4ELKB 1I9EA 4CVXA 4N1EA 1R3HA 4RBPH 2JCCB 4TNVF 5A40E 1FV1B 3KR3L 4HKBB 4HUUB 5FO9B 5FB8B 3ZL4L 3SCMC 3L3KB 2DQEH 3S5LA 3VGDA 1ZANL 2A6DA 3SOBH 4PJAB 3IXAB 3QIUC 1T03L 2JCCE 1T1XA 2OP4H 5I1IH 3VD4A 3HB3C 2YSSB 2HLAA 3MRNB 1BD2E 1K4CB 2IH1B 3R4DA 4XPTH 3BEVB 3X3GL 4C59B 5JXEC 4FTVE 1RK0A 4RWYL 1XMWA 4X7SH 1F4YL 3CVHH 3TT3L 2DLHA 2QV2A 3P3YA 4QRRE 3D9AH 3B5TA 2NNAB 5C0EA 5IB3B 2WUCH 1UZ8B 5CEXA 1FPTL 4ODWA 4FG6D 1G7PB 2H26B 2F74B 4CVZB 4L4VA 1WTLA 1QKZL 3MRIB 5EU6D 4FMFA 2PYEE 1AQDB 2X4TB 4XNUH 1SYVB 3QDJA 5ESQB 1DR9A 2R2CA 4MDIA 5F96H 3TNMB 4JY4B 4M61A 3LKSA 3O6LL 1KB5B 1U91A 5IROC 3TBYA 5MENA 4UUJB 3VXPA 1IC4H 1YMME 1JWSA 3LDBB 3HC3L 4XMKH 1NFDF 5D1QD 2VDOH 3PHQA 2Z93A 1F6AA 1S3KH 1ZE3C 1BFOA 4WO4D 5D96C 1MFNA 2LV4A 1JPST 2X4NB 3JTSA 4U7MA 3STZA 4G6JL 4TSCH 1YECL 1MUJA 2CIKA 1KPRA 4WFGE 2IGFH 3LHPL 3CXHJ 5JHLL 4XP6L 5FUOH 3FT4B 1YNKH 4TTDC 3MLTA 4FQXC 2L0DA 3L1OH 4YHNB 1ITBB 2D7QA 1EBAA 3QNXB 4HUVA 1KYOK 3VRLF 4CNIA 2FGWL 1KXTB 5DJ6B 2EC9T 1IGFH 5GXBB 3KYKH 3W81A 4CADA 1ZA3A 1V8HA 1IQWL 4PB9H 1A6AA 3FOMA 1IAKA 3RNQA 3N1QC 1IKNA 2YA1A 3ISWA 4G6ML 1BBJB 3C9NA 3G6DL 1LQSR 3NACH 4Z18A 3ELAT 5BVPH 3SDCB 1RQ5A 3ECBB 5L9DL 1HXYB 2DQUL 5C0FA 1DQML 4OD2B 3T4YA 1X5ZA 1KG0B 2ZOLA 3LEVH