4YEFA

Beta1 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclododextrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
b'ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-activated protein kinase subunit beta-1
publication title Determinants of oligosaccharide specificity of the carbohydrate-binding modules of AMP-activated protein kinase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Sugar binding protein
total genus 12
structure length 80
sequence length 80
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yefA00
5HVGB 2UVEA 1FHGA 2CKBH 5D1QC 2EECA 3PE9A 4NO0D 3T2NH 4UT9H 3N9GL 2B5IC 2R23B 5C0GB 1LQSR 1MI5A 3L3DB 2K7PA 5JIKA 3MXVL 3JWOH 5EA0H 4JGJA 3PWPE 3X17A 3FOMB 3CZJA 4POZC 5KJRH 4FP8H 3C09C 1QZ1A 5DR5L 4LNRB 3DV6B 3H9HA 4ESKA 2NY2B 2A9MH 2FECI 4FQPA 1VACA 2LTQC 3EOAB 4XX1G 3WL9B 4WHCA 2FO4B 1CGXA 3DUSB 4D9RD 5ID1B 4YHKL 4PJDB 2ADJB 2C5DC 4NO3A 4NP4H 4JGMA 3VGAB 5C3TA 4U6VH 1BBDH 4M5YL 4OF0A 4WEMB 4KDTA 4CVZA 2J6EH 5I74C 4WGWB 3WXVH 1T2XA 1V05A 5GRZA 2FGWH 1HSAB 4P99A 2CLVB 3VFWA 5H37H 3VA6A 3BSZL 2G60H 1CQKA 2BSTA 1M7DB 3MBEB 3ZE0E 3ZO0A 1NLDH 1U8MB 3MJ8A 5EOQH 4P2OA 5BRZA 4YFDB 1KIQA 4JG0H 3D3VE 5C0JA 4OGZA 2VXQL 5EU4A 4OCMC 4M5ZL 3OKLB 3SE4A 4ZODA 3IFPA 1FFPB 3T0EA 3WHXA 3EO0A 1S7QB 2WINB 3FN3A 3MRJA 3EYOB 4F9LA 3CX2A 5F21B 5FYKH 3AY4C 4GAGH 5HPMA 1FCGA 2P5WB 2NCMA 4K71C 1O5DT 3IDIB 3Q5TA 4L3EB 2JIXA 5AWNL 4Y2DA 3DSFL 1AQDB 3UDWC 3A6OA 5INCA 3TZVB 5HSFA 1EGJH 3VD9A 3QUYD 4PJCE 4ZFGL 4TVPE 4I77L 4PBXA 4X4MA 2C3HA 4OV5B 4NRXA 2HVKB 3BEWA 3EHBD 3WKMH 5T3XD 1I8LA 1WC7B 1IVLA 2J8UA 3WHE1 1ZT7A 4X8XA 1DDHA 1BP3B 4JHWL 4M7LT 1OAQL 1R5IB 3KR3H 4WUKL 3I02B 1KF9B 3K3QA 1FL3A 3RZCD 1OM3L 5HYEA 1R3HB 3BQUA 3VD5A 5GJTL 4X6DB 2GY7B 4QRSB 4QCIA 4JY4B 5FKAB 1XGTA 1QR1B 2FL5B 3QUYC 3VGFA 2H41A 4KJQD 4QGTA 4EVNA 1U3YA 2Y1VA 4S2SA 5MEOB 5HHME 3AROA 1QLFA 1QBLH 1MVUB 2H8PA 3EHBC 1GVIA 2VOTA 3MSPA 3P4LA 3ARFD 9CGTA 5I8EA 3CIQA 3OAZK 3FO9B 1KTLA 2BP3A 2BNQD 4X9GA 2PYED 4FQXB 2X42A 4IOFD 1NBYB 4X7FC 4CVXB 1OD7A 4WIQA 4I48B 1N6QL 2OTPA 3RZCC 2NTSP 1C5DB 2I60H 2DI8A 4PUBH 3MV7E 1L7IH 1QLRB 2GITB 5GRYA 4W6YB 1I7UA 5AYUH 4KJQC 1ACYH 4G8EB 2DOCA 5KW9L 5LCVH 4KRMB 1EO8H 3GSUA 2Y7QA 1I1AD 4XPFL 3ARFC 4JFDB 1MJUH 4DTGL 1EZVX 2Y6SC 4R2GD 1AP2A 4XBEL 1PEZA 4H8WH 5I75B 1U2CA 4IOFC 4Z8FL 4RQQA 5SWSB 2ZSWB 3GMOA 2EIZB 4FNLH 2NX5D 4IOSD 1EFXD 1KFAH 2F5BL 4KDVA 4ZQKA 2XKUA 1TPXB 4BFGA 4LARL 3NZ8A 5DUPL 4NQDA 2CLZB 4QHNA 4O9HL 5D7JD 1AD9B 2JB6A 1E28A 3CFJA 3T4YA 5IR1B 4NDMA 4TPRL 1I1AC 3SPVB 3VXUA 1HXYA 4K9EC 4R2GC 1A6AB 3GMLB 3ZDYE 3O4LB 4FXKB 1IEAA 5A16A 3AMLA 4L8SA 2AW2A 1CXFA 2H32B 5IEKA 4RFNC 2A6JB 3MV8E 1CZ8L 4X99A 4S1QL 4X6CF 1LO2L 5D7JC 1AXIB 3BMWA 5DMGD 4IDLA 3QIBB 4UDTB 3DVFA 3TCLA 3TIDA 1YDPA 4QKXB 3TGXA 3B9KD 3RL2B 4RWYH 1TJHL 1S9YB 3PABA 2P8LB 5EUKB 1J1OH 1J1XL 3S36X 2VMFA 1T5XA 3VXPA 5GXBB 2NY1D 1H8NA 3LV3B 2PCPB 2NZIA 4DGIH 5DSCB 2OQJA 3H3PH 4PGJA 1FC1A 4RAHA 1RUQL 2AJXL 2W0PA 3KPOA 2OR9H 3ECBB 1NC2A 5DMGC 3QO0A 2XWJB 1F3DH 3MRMB 4D94A 1S9KC 3B2VL 3RGVA 2GJZB 4HIEB 3R1GH 1RMFL 3EOTH 5HYQA 3CDCA 3B9KC 2ICEB 4CW1B 4EOWL 3W2DH 2R1WB 2R2CA 1MWAA 5TFSL 2D0FA 3QPXL 3NCYS 2PETA 5IB5B 5FCUH 1A1OA 4R7DB 4JDTH 3CLFH 4UAOB 1F13A 1XF2A 4KTDH 2NY1C 1LK2A 4LSPL 3M17B 4L9LB 4KJYA 1CIUA 4X4YB 4PJHE 2W9LA 3KYKL 4HG4K 2ADGA 3PP4H 5C0DB 2HN7B 4U6HB 3I2CH 2OL3H 3D85B 3O0RL 4KRPB 4C59B 4XMLL 3QIUD 3DI3B 5ADOH 2QBWA 1II4E 4HIIB 5BW7C 1BOGB 2YR3A 4ODTH 5F9OL 3RDTC 5EZJB 3HUJE 1ZE3C 5CGTA 1YPZF 1U58A 4JZOB 3FJTA 2ADIA 1YMMD 2DL9A 5EZLA 4JKMA 4Y19A 2Q8BL 3RU8H 4HXBH 4ZFFB 3FHQA 4LCYA 1IGIH 2CDFA 4KHXH 3RWGA 1UKTA 4UB0L 1VGEL 3W39A 5SWQB 2HTKD 5KSBA 1URLA 3BP4A 4XAKE 3VE0A 4PLOB 2X4SA 4WUUE 4JPVH 1CLCA 2AGJH 1QFPA 2BVYA 1MHHB 3QNYA 2AVGA 4BZYA 4WU7A 5TF0A 4EQ2A 1MHPL 5E9DB 3LKSA 3V0WH 1GGBH 2ZOKB 4LP5A 4R97C 1AQKL 4JANA 2ED7A 3F12B 3OTTA 3VXRA 5BV7C 4M6OL 1WSST 4AH2A 3FQXB 1QYGH 2Q20A 4LNVA 1B2WH 5JQ6L 3IDGA 4DZ8A 1IC7H 3WJJA 2O5ZL 2GYSA 4WFHD 1NFDE 1QO3A 1SBSL 2EE9A 3VFGH 2HTKC 5E2UL 1P1ZB 2H26B 2VZOA 1DUYA 1OWRM 1C8PA 2R9HD 4EI6A 3WFCL 2VLME 1PJ9A 1IGFL 2LU4A 1OQXA 2HKFH 3RIFF 2CKBA 5CIPH 3BT2H 2M26A 1CT8A 3DNKA 3HLAA 1FVEB 1NGXB 1RZJH 1ETZB 4K2UL 3P9LB 1JHTA 4YHMH 3TVMA 1SYSA 3DRTA 3KVQA 3LPFA 3VWJB 1A3LH 3MV7B 3OB8A 2FWOB 5BVJA 4UIMA 3U7AA 4KTEL 1TTFA 5IJVA 3NFNA 1WCQA 5CBAA 2R9HC 4F33B 4ZUTB 3P4MA 2VLKE 4P5MA 5EPMA 1KGCD 2NPLX 1WBYA 3MCKA 4PJ5A 4JVWA 3CDGA 3T4AA 1F90L 3GSXB 3VXOA 3VFSA 5CILL 1WWCA 2J6EA 3ULVL 4FZ8L 4N0UB 4XP6H 3NFSL 2W9DH 2JJUA 3WMSA 3EGSA 3P30L 3IFLL 4NKOB 4MJIA 1C08A 3TO2A 3JTTA 1KLUA 5IBUG 3RVXD 3QI9B 5EU6E 3SDAD 5LXGL 1U8OA 3VRJA 2VH5L 2VABA 4LQ1A 3WDIA 2R2HB 4XPHL 1FE8H 3RWDA 4L3AA 5ADPL 1S5IH 2O61A 2JELH 1YC8A 2APWA 5KSAD 4PJBF 3HE6A 1H3UA 1RZGA 4DZBA 4PS4L 3O8XA 1YA5A 1NBVL 3OF6D 2XXMB 4U1JB 3X3GH 1UZ8A 2Y07L 4X7DC 3FB6A 3RJQB 2E7CA 5F1IB 4P46B 1KCKA 3BD3A 4IDJL 4U1SB 1H3PL 2VRAA 4NWTH 4QHKI 3BXNA 1ZGLM 1BGXL 3MV8B 3RVXC 1JV5B 4MNHA 3SDAC 2R4RL 3LEYH 2FSEB 3PQYA 3BUYB 2E5EA 2V2TB 1BMGA 3T77A 1ZHNA 4L4JA 1HI6B 2A83A 3C60A 2GTZB 3ZZ1A 1G9ML 1R3IL 1MRCH 3NIGF 3SOBL 3WYRA 5KSAC 3REVA 1JHKL 1RU9L 3OR6A 3QPQD 4J4PA 3HAEB 5FIEA 1JJUA 3WN5A 1U8IA 2VZUA 4ODSH 4HH9B 1F4HA 2FBOJ 1JWSB 4NZTL 5L7XH 1B0GA 1RHHB 5JDSB 5DC0A 2YK1L 5IG7B 3BIBX 3GMMB 3IVKB 5HYSB 4NKDB 1HHJB 1S7VA 1NKRA 4UNVA 1EEUA 5E24E 1TVDA 2DMCA 3BD5A 3WLBA 1QKZL 2BDNL 3GK8L 4HUMB 4P2RD 3VFMA 1FNAA 1J87A 4JY5H 1PW3A 3QPQC 1U3HD 1DQQB 3WE6A 4XRCA 2AJZB 1I9RL 5FK9A 4B5EA 4P23D 4PJHB 3EDEA 5KAQF 4NKQB 2MWCA 2ZUQB 1RZKL 3ARDB 4OZ4A 5D1ZD 2CSPA 4L8DB 1J10A 4ERSL 1DE4B 3TN0D 1GJIA 2WUCH 3UMTA 1UXSA 4UQ3A 1RIVL 2CDEB 2B4CH 3HUJB 4C56D 1U3HC 1J8HA 3GSQA 5IW6B 4GH7B 4GRLB 1Z9LA 4P23C 4KVNL 1T0NB 5JORB 4JQVC 4GMTH 2XTJE 3P4OA 2YN5A 3KJ4C 1QFUH 4EKXA 2H3NA 5D1ZC 1RK1A 1ZA6A 4K7PL 5FGBA 3HR6A 4KDWA 1UJ3B 2DLHA 1TDQA 3FQWB 2J88L 1DVFA 2LVCA 4TOYH 2HT4D 4XPBH 2ZJSH 3TN0C 2JJTA 4RMVA 3MRDA 4HS3B 3OKOB 3N06B 3DXAB 2ARWA 4ETYA 4OZGE 3EO9H 2P24A 1TLKA 3UJJL 4ZMAT 2VDKL 3H7LA 1AO7E 4BQ8A 4P5TB 4HF5L 4JDVB 1NGPH 1BD2D 4X7CC 1XFPA 2R0LH 2F8XC 5HDBF 1XGYH 2HVJB 5D1XB 4BSJA 1NC4A 2ED8A 5DK0A 2XPGA 4IJ3C 2X9XA 5MERB 1UXWA 4XWOD 5HYIA 4KKNA 1NFDB 1N0XH 2HT4C 1MCKA 1V7ML 4RRPA 1FNGB 1R5WA 2GSIB 1ADQH 3ARGA 4WTZG 4XZUB 5E2WH 2ZUTA 2R2BB 2YRZA 3B9AA 2C1OA 4Q97A 3DX7A 1S9XA 4AG4H 1GIGL 1INEH 2XZQL 4PRIA 5DJ8B 3F7RA 3QQNA 3FTGB 2NY6B 4JHAL 4NC0B 1WBZA 5F6HJ 5C07E 1JK8A 4CNIB 4LEXH 3LH2L 4FTVD 2MQ3A 2P5EA 5IMKB 4L8BB 4IMKC 4N9GB 3QXWA 3TBSB 2VZ1A 5IB4A 2CJUL 3RAJH 3UTSE 4DGYL 2HRPH 3NPSC 3FT2B 3GMRA 4WHYH 1RJYA 1CLZH 4Y4KA 3A67L 3RWCB 4ELMA 5GHWH 1PDKA 1NAMH 4MJ4A 3MGOA 4OCWL 1CLOL 2N1KA 2CO6B 1JNNL 1VADA 4U1LA 3WFZA 4Y4HA 5GGQL 1LNUA 1PKQA 1Y0LA 3GIZH 3DX8B 5EO9A 1ZHBA 1DN2A 4NCC2 1UB6B 3PWLB 1KBGL 4PV9B 4QXUH 4Z7NF 4O51B 1K8DA 4R26H 3SDYL 5HGHA 2JCCF 2DQHH 1IE5A 4MJ6A 5B39B 5B8CC 3MRHA 4A6YH 4AEIL 4TUOA 5DUBA 2XFXB 5JA9A 3ARBD 4P2QA 5BRZE 2OL3A 3ORJA 3V2AR 1QVOB 1KIRB 4P9ML 1MLCB 4YHZH 5FKPB 3HC3H 4G8GA 1YEKH 4YDIL 4OLXH 2FIKB 2J5LC 4XB7A 2XKNA 4KK6D 2XICA 1U91A 5SWZB 1ZGLP 5FYJE 4MAYA 4XXDA 5HI5D 5ISZE 2YHGA 4U1KB 2WSKA 1D5ZA 1LE9B 1D5MA 4AENA 1UACH 4Z7QF 5I9QC 4YPGA 4ODXA 5D1QA 3ARBC 2I9TB 2ILLA 4R3SA 3BYTA 2VXVL 5IHLB 4MDJB 3SGJC 3MODH 4E42A 1HILA 1FLTX 4ZUVA 4KK6C 3D2UB 2ZG1A 4EXPX 4WV1C 1PY9A 4LGPB 4MD4A 5HI5C 4HLZG 5T1LA 5IQ9B 2EH7H 4HMCA 1RD6A 3MROA 3RP1A 1OPGL 2P43B 5F7EL 4PG9B 2J8UE 5J1AA 4U1MA 3PDOB 4I5BA 2CR3A 4PYHA 1TJGH 3QHFH 4DW2L 4GBXC 5E6YA 4NO0A 2D4DA 5E2VH 4YIQB 2QEJA 5E0QA 5IJKC 1ZAGA 3H2WA 3WFEH 4Z7VB 3TJEL 1QA9A 5F7UA 4XMPH 5GSRB 5T5FH 5EB9A 4FS0A 5FF6B 3REWA 4D8PB 5EH1A 4X5LA 4G6AD 3PWJA 2ZNWA 2XI9A 1U95A 8FABA 4XBGA 4DJMA 1VPOL 5F3HA 5T33H 5J8OA 1L9NA 5CIPA 5D2LF 5C0CD 2BHYA 4OF8A 4KI1A 3WFBL 4YAQB 32C2A 4LSRL 1ZT1B 3RKDD 1JGLL 1IL1A 2CUHA 5GIRA 1GRWA 3UBXB 5EOTB 1CD0A 3V5DB 4G6AC 3VCLA 3LVEA 1WAAA 4NHUA 5HDQL 4X5XA 2Z0BA 3HA0A 3QJFA 3AY4A 3BVNA 1HHHA 4RGND 3CK0L 4WTZA 3GSNA 1LE5A 5FO9B 1F3JB 3SJVD 3ESUF 4PYGA 1LILA 4PLNC 4NJ9L 1KEML 1A4KB 4QF1B 1IGJB 2OK0L 4I3RH 3UDWA 5ALBL 3RKDC 3OJDB 1EHLH 2E7LA 4NRYA 1YNLH 2QADC 3S5LB 3SKOA 4Q9CA 1EEZA 2CXKA 1A21A 3HI1B 5IB1A 4NQDE 4AIZA 4M43H 3H9SD 5I2IA 5KVDL 2FJHA 2PTTA 3IJSB 4JPWL 4XI5D 1FG2A 1CGSH 3VXMD 1AO7B 4HGWB 4TUJA 5TE7H 5JW3H 4PBWD 2MOVA 4HKZB 2R0ZH 1CYGA 3FFCD 2IALB 1WUNT 4F8TA 2YXMA 2GK0A 3JWDC 2OR7A 4KUZH 2ADFL 4XAWH 2CK0L 3A6BL 1HHKA 1UZ6F 4KGLA 5DUMH 1I1YA 1SBBA 3QUYA 3UTPD 2ID5A 3CUPB 4OIBA 1VKXB 1IM9B 1QD0A 4EN3A 4HS8L 4UUJA 4ZD3L 1WVZA 1QSED 3KPLB 3Q6FA 4XI5C 4LVHC 3N50A 1PSKH 1P7QD 2VLRD 2W0KA 5F88A 1F97A 4OGAD 3AMKA 3ES6A 1MCEA 3QDME 3V9FA 3T04D 1T4KB 1S8DA 4F9PA 1MI5B 3W11D 1GPOL 3N0PB 3MC0A 3HC0A 3O3BA 3EYUL 4J3UA 2F19H 3FO1A 4YR6B 4KJPD 4Y89A 3FMGH 3H9HB 1VACB 5EU7E 4GG6F 2H1PL 5GZND 4R0LC 4PIRF 3ARFA 3H9ZA 3WNOA 1EUUA 4JQXC 4NO3B 4OGAC 2OZ4H 2DQEH 4OLZH 2PYEA 3BO8A 3MPCA 3W11C 5E8EA 4CVZB 1X5ZA 3K2UL 3D1MC 3VDAA 1RZ7H 5L8JB 4KJPC 1KLGA 1J0KA 4NUGL 4U1GB 5IFHH 1OSPH 3VFWB 2XOTA 2C7UA 2C4FT 1REIA 1KPRA 3MJ8B 4HJJL 4X5WA 4HWBH 1F00I 4P2OB 5BRZB 5GZNC 1I1AA 1KIQB 3I50H 4I9WD 4NM8H 5C0JB 3NAAL 5EU4B 4X7SL 1NFIA 4IRZH 3BPOB 4NO2A 3NH7H 5KOMC 3KXFD 2IH3A 1A6WH 1AIFA 2NNAB 1BJ8A 3IFPB 5EZOH 1EFXA 4OZHF 3T0EB 1WZLA 3WHXB 2HJKA 2P47B 1JZ4A 3MV9D 4FQJL 3EO0B 2DJ4A 2IADA 3MRJB 1QRND 3NFPA 3CX5J 4E41D 1YYLL 3DMMD 5D7JA 4LSTH 2NY5H 3SDCD 4KMLB 5HPMB 1EMTH 3LKPA 3C5JA 2JIXB 3N1FC 3J7HA 5GRJH 3MLVL 4Y2DB 1JPFA 5EULV 1MFBH 2ZG2A 3CAFA 3LRSA 3MTRA 5INCB 2BY2A 4RA0C 4MMZC 4HG4J 1DL7H 2HFFA 2IQAA 4NRXB 3O4OB 3BEWB 5DJZA 2C9AA 2QSVA 3MRCA 2HMID 3DMMC 2J8UB 1FGNL 1ZT7B 1DDHB 2VDRL 1FNSH 4PJXA 3SDCC 3VXRE 1Z5LA 2Q8AL 2WW8A 4KI5E 4OQTH 3KG5A 1FL3B 3BH8A 3BQUB 3KLAA 4JB9H 1EJOH 2FDBP 4UTAL 1C5BH 1ADQA 1IAKA 1TZIA 4QCIB 1XGTB 3QZWG 1KIPA 4HFUL 4KC3B 4EVNB 4S2SB 4MXQD 3D48R 4XH2A 2MSPA 1QLFB 1J18A 1O7SA 4LRNL 2H8PB 3CFCH 5FO7A 4N1CA 4BYHA 5DJDA 4XPAH 1YYML 3LKNA 3EOBA 5I8EB 4UT6H 2AQ2A 1N7MH 1KTLB 1CXIA 3RIAF 3M8OH 5C7XH 4Z7UF 2OJZL 4R7NA 3BIKA 2MPAH 5BW7A 3OKKA 4PR5A 3HNSL 3IU4H 1KB5L 5E8DH 2EZ0D 1AGBA 2I5YH 3RRQA 4IRSD 1I7UB 5FHBH 1TJIH 1J05A 1CFBA 3L3OA 3MYJA 3P73A 4WI4A 4QO1A 4MXQC 2AK4E 1H3WM 2EDEA 3GSUB 4O5LH 2Y7QB 3GGWA 5F7LB 1MCWW 1NAMA 5I1LA 4PJ5E 4F80A 1AP2B 3T3ME 1FYHB 2V5RA 5F9AC 3TWCH 3QIUA 4RQQB 4X6DF 4OCSL 3GMOB 1J8KA 1UM6H 1I9JL 3HC4H 4K8RD 3VI4F 4MJIE 4OQ1A 4ZQKB 3UO1L 2B1AH 5ANMA 1JRHH 4N8VA 2EZ0C 3NZ8B 1F2QA 1HZHL 3MLSL 4NQDB 4QHNB 4A6YA 3JV6A 1YMMA 3SGDH 2BSRA 2JB6B 1E28B 1QRKA 3CFJB 1KEGH 3T4YB 5KANG 4NDMB 2EH8L 4LBEA 3VXUB 1HXYB 5JTWA 4OGXH 3BE1L 3FCTA 1IEAB 4MGXA 4O2EA 3E8UH 3WO4C 5A16B 1S7UA 1QSFD 1GC1L 4L8SB 4OLVL 4KXZI 4K8RC 5IEKB 4K94L 5BMFH 2VDNL 5LQBH 3PGFH 5I1IH 4X99B 5FYKE 1AR2A 2QQNL 5JW4Q 3O6LL 1ZTXL 1IGTA 2XG4A 4GQ9H 3TCLB 5EORH 3TIDB 1YDPB 1E6OL 4BELD 2NY0C 1RUAH 5DRXA 3PABB 3ZHLA 2DL2A 1Z9OA 5CEZD 3DX9B 4D2NA 5L0QB 5CLWA 4F15B 1VA9A 3BWUC 1Y6NR 1T5XB 3VXPB 4YDKH 3WUZA 1CN4A 2X4NA 5IBTL 1YECH 2OQJB 3HI5L 1MY5A 4NHCL 2YD7A 4WW2B 2CRIA 2I9LA 4Y8DC 5CZXD 3KPOB 1NCWH 1NC2B 3TV3H 3QO0B 2YD4A 1WQVT 1KC5L 3RGVB 5HYQB 2FLBT 5DD1H 4TSBH 2HH0H 4NZUH 4OFDA 4AEHH 1L7TL 1MWAB 2E9BA 3RY4A 1UKSA 1A1OB 4WDIA 5EBLA 1D5IH 4D9LH 1XF2B 2QKIA 2Q87A 3QCTH 5D7SL 4KJYB 3TT3L 2DBLL 5LWYH 4L8CA 4LSDA 1Q1JL 3GHEL 3TBYA 5CZXC 2F15A 2ICWI 1BAFL 3EDJA 2ARJQ 5E5UB 1KG0A 3RVWD 1AD0A 3L7FA 3JUYA 2VUOA 2GAZA 3CVIL 4X6FA 3B9DA 3QWQB 1FZJA 1JPST 1U58B 1KCSH 5T1DH 3MBED 1TVHA 2MNUA 4WU5A 2ADIB 3WD5H 3SDAA 5EZLB 3QZWA 4Y19B 3TC9A 1OAZL 1OARL 3L5IA 1E4WL 1UADC 4LCYB 1Z3GH 3OSKA 2V2XA 3VDBA 2GHWB 2HFEA 2CDFB 3RWGB 1O7VA 3RVWC 5EU3A 1KB9K 5C0IA 3ULUE 3VGBA 3VXSD 3VFUA 3W39B 3OF6A 1SJXA 5I8KH 1CBVL 1AJ7H 5FGSA 4I4WA 1MEXL 5KSBB 1DSFL 3BP4B 3VE0B 4YDJA 2X4SB 1U8NA 3FO2A 3MBEC 1MCIA 4FXLA 1IJ9A 3ZE0F 4WU7B 3T8XA 3P0YH 3LKSB 1LP9E 4JANB 2NXYB 5DVNA 3UPCA 2EDXA 5IROA 3VXRB 3MUHL 4AH2B 5B3JE 1AE6H 3LDBB 1E0OB 5H35A 3IFOA 3IDGB 3MLUL 4DZ8B 4LL9A 4NWUH 1QLEL 4LCCC 5BVPH 2UZIL 4HWNA 1BM3H 1QO3B 4LKXA 3U36A 4ALAL 4QXGL 5HJ3B 4F7EA 3F7YA 5IM7A 1A6UH 5BXFA 1DUYB 4HCRH 1MFCH 4KUCF 4EI6B 4TSCH 2IC2A 2J7LA 1FL5A 2W9EH 4ACPA 2CKBB 2P48B 1BFSA 1JBJA 4OV6F 1CT8B 1BFOA 3HLAB 4G7YH 1JHTB 3TVMB 1SYSB 4DKAA 1F4XH 3DRTB 3QRGH 4P2RA 4PP2A 1S7TA 2X6MA 4PJCF 3Q2CA 3WO3B 2DQJL 1U3HA 1FLRL 5BVJB 4UIMB 2D2OA 5IJVB 3NFNB 4P23A 5CBAB 3VJ6A 4DVRL 3P4MB 4ODVL 2E6QA 3MRKA 4FQXD 3RY6C 4P5MB 5EPMB 3CXDH 4FMFA 1PG7H 4ELME 1WBYB 3MCKB 2I25N 5D1ZA 1CD8A 2OZ4A 4PJ5B 3CDGB 3T4AB 3VD7A 1JZ5A 1HH9A 1QTYT 2APVA 4LSQL 1HN1A 1AKJD 3VFSB 3HNTL 3VXOB 1PKQE 4HH8A 1MCBA 1RVFH 1N4XH 2HG5A 2Y72A 3TN0A 4JDZA 3EGSB 4BK4A 1J86A 1T7XA 1ZOXA 3C5SA 1C08B 4MJIB 4M1GH 3TO2B 4BSWA 2IGFH 3JTTB 4C56A 1KLUB 5F8RC 5KAQG 3INUH 1D7FA 4WFGD 1U8OB 3VRJB 1JPTL 2VABB 4X0KA 1MJ7H 2EKJA 1QQDA 1X9QA 4U31A 1A6PA 3FT3A 2A9NL 3RWDB 4LDLB 1OT1A 1MCNA 4FQXC 4XMKH 2O61B 2VL5B 1MAMH 1HXMA 4DZBB 1J11A 3HE6B 1RZGB 4K55A 3O8XB 2C4FU 4Q9QL 4G8GE 1X44A 5EG6C 3TPUB 3OAUH 2YD6A 4PBVC 4RAUA 3TBTA 3WXWH 2DLGA 5TE6H 1UZ8B 3SN6N 3FB6B 5F97E 2EDLA 2AV7A 4GS7C 3ET9F 3EZJB 4LPVA 1FH5L 3BXNB 4MNHB 2IEPA 1WK0A 5D96B 3PQYB 5IKCA 3UJTH 3WHE0 2RB8A 5EA0L 3T77B 1ZHNB 2R4SL 5KJRL 1BD2A 2A83B 4FP8L 4ZNEA 1P69B 1QFWH 3CMOH 3O3UN 2EDKA 2A77H 5M7QA 3REVB 3LZFH 3OR6B 4JG1H 5L8LB 4IMKA 5SV3A 1TPXC 4JFQA 1J1PH 4X6EA 1FJ1A 3WN5B 5KVGH 1X7QA 2DM3A 1NDMA 1U8IB 5IB3A 3FN0H 5DT1L 3DETD 1B0GB 4NP4L 4DEPC 3QEUA 4H26A 2VAJA 1BBDL 1B0RA 1WZ1H 1BEYL 2WANA 4RAVA 1S7VB 3NACL 1G0XA 1QFOA 4OQTA 4RCAA 5HHNA 5CD3A 1J0ZA 3ELAT 3PWPD 3WLBB 4AM0A 1CFVL 2VR5A 1VEMA 3VFMB 2IH1A 3NIDE 3F7QA 4ENED 4HS6A 1EO7A 4XBPA 3WE6B 4XRCB 2MQ0A 2I26N 2PN5A 3EYQD 5B8CA 1G6VK 3DETC 3JV4A 3IDNA 4ZO7A 4UV4H 1ZLVK 1ZVYA 5I71B 3HMXH 5E6IB 4OZ4B 3V4PH 3GFUA 2C4XA 1UB5A 4PJBA 1UM4H 3IKCA 3U7WL 1B4JH 2PUQT 3G6JE 1UXSB 4UQ3B 3AS1A 4ENEC 5F89A 1J8HB 1MSPA 4K8RH 3GSQB 1N0LA 2FD6L 1QSVA 1LO3H 1IT9L 3EYQC 4U0RB 2W91A 3TYFA 3D3VD 3P4OB 5GJSL 1D5BA 2EXYD 3ARBA 2H3NB 1BFVL 1RK1B 1ZA6B 4YPJA 3U0TA 3RPKA 1I8IA 4LDOB 1DVFB 4L9DA 3QULA 5HGGS 5J11B 1KSRA 1UM5H 2BY3A 3O2VH 2XQBH 3MRDB 3EYFB 4WV1A 3RKPA 3NN8A 2FHFA 4KUCD 1CTOA 3LHPL 2P24B 3IGAA 2WQ8A 4Q6IA 3NTCL 3OKDA 4ZO9A 4FABL 1KPVA 4UIKH 5IGXH 3KR3L 4JLRA 4WTXA 1DEEA 3OXRA 4ZOEA 2VDQH 5ID0A 2FATL 1CR9H 2EXYC 2IFGA 1FAIH 1Z2KA 5IJKA 5DFVD 1P5VA 1NC4B 5DK0B 2XPGB 3HUJF 1MFDH 1JMZA 1UXWB 3D5OF 5CEZH 1QBLL 4TVPD 5JHDE 1T2QH 2JK5A 2AABL 4YXLH 2FX9L 4HXAL 1ZXQA 2C1OB 1FVDA 3DX7B 5D71H 5IBUB 1S9XB 5E8PA 2DQFA 1XAUA 3Q6GH 4PRIB 2I60L 3P4NA 4U3CA 3L7EA 1WBZB 3Q5YA 1JK8B 3FT4A 3LOWA 5AYUL 1JGDA 2P5EB 5I19L 1ACYL 5DFVC 1VFUA 2R56H 5I1HH 5LCVL 3E6FA 4UT7H 3UJIL 5L2JA 2NXZD 1EEYA 5HHMD 4RGMB 1AXTH 1JZ3A 3OG4B 1AGCA 3MLYH 4UMGA 5IB4B 4LVNC 1ZLWK 1KULA 2IBGA 1HWGB 3GMRB 4MD5A 1B6UA 1RJYB 5JXAL 5C0CA 2VQUA 4FNLL 3U4BH 4XP1H 4ELMB 1KFAL 3SE8L 3MGOB 4U1LB 1WICA 4Y4HB 1LNUB 1PKQB 1Y0LB 3MV7D 5EO9B 1ZHBB 5H94B 5ETUA 5IHUH 5CEYA 3KPNA 1K8DB 3O3AA 2NXZC 1MCOH 5HGHB 3FRPG 4MJ6B 3ZSSA 3K2MC 1CICD 3MRHB 3ROLA 2C1PB 5DUBB 5MI0B 1ZEAH 4P2QB 2AJYL 3FO0H 2OL3B 1A14L 4OM0H 3QDJE 3SJVA 1K4CA 2IBZX 1A7OH 3ZKMD 4G8GB 5I73C 1MCCA 4K23H 4YHPA 2A1WH 2XKNB 4ODBD 4LQFH 3WIIH 3SE9L 4OAWA 1U91B 2EEDA 4MAYB 4XXDB 1FO0L 2ZZUT 1D5ZB 3H9SA 1D5MB 1HE7A 1K3IA 4RWYL 4AENB 5DK2A 3QXDA 1CICC 4NFDA 3VXMA 3I6KA 4LMQE 4YPGB 4ODXB 2YWZA 2Z92A 1DBAH 5D1QB 1FNHA 3EJYD 4O02L 3ABZA 3FFCA 4R3SB 4RMQA 3EDDA 3DHJA 4E42B 1HILB 1YEIL 5D2NA 4ZUVB 4DGIL 2YPKA 4OF3A 3H3PL 5DMIL 4PGZA 3HMWL 3CFDA 4OLYH 5ESQA 5IESH 4MD4B 2OR9L 1N8ZA 3X3FL 4HIXH 2E3VA 5KS9F 5T1LB 3WFDH 3R1GL 2YZ8A 3EOTL 3MROB 4DK3A 5IFAH 1LDPH 2LTQB 1ORQA 2DB8A 3W2DL 1QSEA 4N1HB 5J1AB 4U1MB 4I5BB 1U6AL 1P7QA 2VLRA 5DGQA 4PJXE 2APBA 1FBIL 2LV4A 3U7YH 3GSVA 3GSWA 3EJYC 3LN5A 2Q86A 4NO0B 3RNQA 1QA9B 4IBLT 5I74B 4PGCA 1DZBA 5DA0B 3PNWA 2WZPD 4DQOH 4OUUA 3REWB 4HCRA 2ZCLH 3PWJB 1U95B 3K4ZA 4YXHL 4UDUA 8FABB 4XBGB 5F3HB 4NO5A 5CIPB 5BJTA 5GS1C 1OP5K 3CCHA 5ADOL 5E08H 1KCRH 5J9PA 4PJAE 4ODTL 3GB7A 4XVTL 1IGML 1NSNH 3QSKB 3QP3A 5L6YH 2IBBA 4ORZC 32C2B 3RBGA 3MRBA 1IL1B 2ZCKL 2YBRA 3P77A 4ONOA 4HXBL 4Y5YC 2JJWA 2X9YA 1KYOJ 3VXNA 3VCLB 4DUVA 4DUXA 3IDJA 4NHUB 4X5XB 4G80A 3QJFB 3BVNB 4XB8A 4XVJL 1HHHB 5KN5A 2G9HA 5F7YC 3GSNB 5F72S 4DFHA 1LE5B 2GY5A 4M7ZC 4K71B 3L6FA 2OP4H 1AC0A 1AHWC 3D39D 4NT6A 1E6JH 2Q7YA 4JPVL 2AGJL 2OX5A 5BO1H 3KXFA 2ERJC 5JQHC 2YKLL 4NRYB 4PTUA 3V0WL 1BLNA 1GGBL 3SKOB 3GM8A 2ITCA 2MTPA 1IAOA 3BOVA 4LCWE 1EEZB 3NPZB 5ANME 4AIZB 5IB1B 3ISWA 5I2IB 2FJHB 2IAMD 2PTTB 3T0WA 2V2WA 1FG2B 1YMME 1B2WL 4GSDL 4E41A 4H20L 4TUJB 3DMMA 5HY9A 2XXCB 5FHAH 2VTFA 4WJ5A 5ACMA 4NQVA 3HZVA 1O0VA 4Z6AT 2B8OT 1FNLA 2GK0B 4EZMA 1JNHA 3O2DH 3FZUD 5FYLD 4LP4A 4WHTA 2WLZA 3MUY1 4WUUD 1FYTD 1HHKB 2VXTL 1I1YB 3QUYB 1JHLL 2V7NA 3BT2L 1PQZA 2X9WA 4UUJB 2IAMC 3Q6FB 4LU5H 3UTTD 1FORL 4NN6B 5D2LA 4ZPTA 3FRPA 5F88B 3ES6B 3MJ9A 1HNGA 1JPSH 1EJ6A 1S8DB 4KWUA 4Z78A 1KTKE 4U0QB 1N64H 4HWEL 3MRFA 3HC0B 1S5HA 3O3BB 4YUEH 3FZUC 5HHPA 3FQRA 3FO1B 4OZGF 2R29H 3V6FA 4XNXL 3HZMA 2VISA 1FZOA 1X5JA 3GSNL 3H3KA 4QRQA 1L0YA 1NCCH 2KBGA 5JDJA 4XP6L 4GMSL 1T5WA 2W9DL 3ARFB 5IB2A 1CXHA 3Q1SH 2APXA 1H3VA 4N9OB 1MCRA 2BNQB 3SDDD 2PYEB 2XZAL 3BO8B 4J7RA 5E8EB 4O2CA 1A7PH 3SE3C 1HIML 5IIEA 5J7CC 4Y5VC 5D70H 1FE8L 1KLGB 1S5IL 5FECA 4IRSA 2JELL 2C7UB 2RBLA 3BHBA 5CJBA 5DJ0A 2AV1A 2VLKD 2B1HH 1KPRB 3HMXA 3WEXA 2XY2A 4X5WB 4OD3H 5LGJA 15C8L 1I1AB 1I9IH 2AJSL 3AB0B 4HPOL 4LIQE 4LSVH 4MLSA 4JFFD 1D3CA 1UVQA 4R2GB 1NFIB 3GI9H 4MZ3A 1WIUA 4NO2B 3SDDC 1R0AL 2IH3B 1KJMA 3MREA 1AIFB 5EU6D 4UILH 4ZXBA 3EFDH 1EFXB 2HJKB 5T3XL 2GT9A 4RFNB 3MRIA 3QG7H 2IADB 1RJLA 3NFPB 5HGDA 5D7JB 3BKMH 1VERA 3PUCA 5D5ME 5BCAA 2QTEA 1Q38A 2UVFA 1V3MA 3WS6C 3HCVA 3LKPB 3C5JB 4J8RA 1HDMA 2AJVL 4G9DA 4OZFH 1JPFB 3MFGB 1ACZA 3LRSB 4U1NA 3PXJA 2ORBH 1DFBL 4H88L 4GXUM 4KV5E 4U6XA 1RURL 2HFFB 2IQAB 4Y1AD 5DJZB 4OM1L 4CDGC 3MRCB 3T0BA 5EZIL 1EAJA 4JHZA 2XV6B 4PJXB 1Z5LB 1X5XA 4WW1A 3B9KB 3KHOA 3ARWA 3BH8B 1C16A 3KLAB 4YFEA 4MCZA 3O6FD 1IAKB 2UYLA 1TZIB 3MR9A 3V8OA 2NY1B 4LCIL 1KIPB 4XH2B 2EDYA 1TVBA 2ZP0T 3IYLW 2R69H 2AI0L 4K9EL 3SKJL 5FO7B 5DJDB 5HBBA 3BJ91 1A7NH 2AEWA 3LKNB 3EOBB 2G5BA 3VGGA 5DC9B 2EC8A 4YHOH 3C2AL 4HZLA 4QHKJ 5M95B 3LD8C 3GBMH 1NCDH 3V4VL 4R7NB 3BIKB 2BHZA 4FMKA 3ZLQC 6CGTA 1LD9A 3OKKB 1A0QL 4PR5B 1EZVY 4ZTOL 4GMTL 1KLFA 3O6FC 4OZHA 1AGBB 4PB9H 2BNRD 3LCYA 1J05B 3MYJB 3L3OB 3P73B 2CH8A 1P84J 2J8UF 5LBSH 3GGWB 1Q9LA 3KLDA 4XPBL 5JA8B 2BVEA 2ZJSL 1NAMB 3V6BR 5I1LB 5CS7A 4RA3A 3R8BB 4BUHA 5FUOL 1IC5H 4BZ1H 4XCYA 3QIUB 3SKUD 1J12A 5CSBA 5GS0D 4RZCA 3RVUD 3U0WL 1R3KA 3V4UH 5ANMB 4N8VB 2R0LL 1JTOA 2XTJD 5TQ2L 3JV6B 4A6YB 4AY0A 1YMMB 2AKRA 2BSRB 2EE6A 4ZSOB 4YHYB 1LO0H 5DEFA 1ADQL 1QBMH 2GKIA 3J8F7 3TT1L 3FCTB 5E2WL 4LCCA 4O2EB 1S7UB 3VXSA 3EYSH 5DQDH 4QXTA 5TDPA 5GS0C 5DTFA 1IGCH 3RVUC 1AO7D 1ITCA 1INEL 1MFEH 2YPVH 3S88L 2XIDA 4S1RL 2XTJC 3OB0K 5AAMA 4GFTB 5T1KD 1KJVA 4RISL 1IGTB 2OXGA 4U1HA 5DWUH 1BD2E 4ZNEE 5DYOA 2ZPKH 3H0TA 5ITFA 2XZCL 2Y36L 3RVVD 5I1EH 5DRXB 4BA8A 1YEGH 4FXGA 5IQ7H 3U2SA 3DWTA 2FJFA 4Z7UA 1IKFH 1ROWA 2GIYA 1HHGA 3QUXD 1CLZL 4NCDA 3G6DH 2X4NB 4XC1H 5K9QI 3T65A 5GHWL 2ARJA 4PJ7A 1NAML 5GGVL 3JXAA 1JFQL 4AMKH 2I9LB 5C07D 3RY6A 4RMRA 4TSAL 4JKPH 1DQJA 2CPCA 4CUCA 4R9HA 4QXUL 3MA9H 3RVVC 3T0XA 1QSZA 2IMNA 3T3PF 1JI2A 5DD3L 3V6OE 4WDIB 1J88A 5EBLB 3UTSD 1IKNC 5F7HA 2NQCA 3S35X 5DXWA 2QKIB 3QUXC 3UPAA 5BV7L 4PGBA 4L8CB 3GJEA 4YHZL 5C6PB 3HC3L 3TBYB 4OLXL 4OZFG 4Z0XA 4XNUL 4ZOAA 3ARVA 4HQQL 4X80H 5KBNC 4XP5H 4KY1H 1RFDL 1KG0B 4NUJA 1AD0B 3L7FB 4K3DH 3OPZH 1AKJA 1TETH 5CP3H 1YMHA 1MOEA 1LO4H 1G9EA 2GAZB 4PJ8D 4X6FB 1FZJB 3MV11 3MLXH 1P4LA 1N2RA 4AZ8A 4WU5B 2OTWA 3BKYL 2L7UA 3SDAB 3T2OA 3QXUA 1MHCA 3QZWB 3G5VA 4L29A 3MODL 3SGEI 5CJXC 1INDL 3MJGX 4TQEL 1A5FH 2V2XB 4U7MA 2IPTH 2HFEB 3NIGE 2DQDH 5EU3B 5C0IB 2HYMA 5FYJD 3VFUB 5ISZD 3FL7A 2VC2H 4XT1C 1I85C 5SX5K 4PRDB 2V17L 3KHQA 4I4WB 5FYLH 4PJ8C 1P6FA 3QUMH 3DARA 1MCDA 5GGTH 4YDJB 1ONQA 3QHFL 1U8NB 3FO2B 4H0IA 3PF2A 2X4OA 5CJOH 3FN9A 3TNNA 2D03H 3T8XB 5E2VL 4Z95L 4KMQA 3GKZA 1TENA 3BUTA 5B4MD 1JGUH 4G7VH 3DSNA 3BPOC 4AEEA 5H35B 3IFOB 3O2DA 5J12C 2OBGA 3GDBA 5H2BA 2WIMA 1EEQA 2DM2A 4MAUH 4LKXB 3U36B 4G6KL 2RQ8A 5IM7B 3F7YB 4F7EB 5BXFB 1EH9A 2DWEA 4KQ4H 1FL5B 3C87A 4RMWA 4WTWA 4YBLC 3TYGL 5JW4N 4WI9A 5GRUH 5B4MC 4LF3A 1BFOB 3PGCA 3PWPA 4FQIH 3I9GL 3NABH 3FB7A 4AYFA 2R1XA 3EUUA 5DD6A 4P2RB 4PP2B 1S7TB 1U8JA 1A4JA 1U3HB 3O4OC 1CCZA 2VZVA 4PJIF 2YC1A 1I8LC 4HMEA 3VFTA 4P23B 3VJ6B 4NNPH 4G9FE 1RIHH 1C1EH 3MRKB 4I3RL 3D6GA 3KJ4B 1KACB 4KI5F 5DD0H 3DRQA 4PG2A 5D1ZB 4U33A 1HH9B 1NMAH 4M43L 5FO8A 2K9UA 3V52L 3MJ7A 1N26A 2HG5B 1ED3A 4HUUA 3TN0B 4JDZB 5JW3L 4Q6YA 1GAFH 3C5SB 4BSWB 1CD1A 2R0ZL 4C56B 4OGYL 4OSUH 2QSQA 2D7TH 1M1SA 3VG0L 4KAQH 4X0KB 1TQBC 2JLLA 1QQDB 1U41A 4KUZL 3FT3B 3VFVA 2GJ6D 5DVMA 4RGNE 3D3VA 2QSCH 3F65A 3I75A 4DAGH 1JNLL 4HPYL 5C0FA 3SJVE 1HXMB 5ICZA 3A0OA 1DBMH 1IGYA 1A7QH 1OCWH 4Q9RL 2G75A 2FX8H 3OKMA 3K80A 1F3RB 2RCSL 4IJ3B 3TBTB 2EO9A 2CGRL 1QBAA 3ZDXE 4ZUUA 1U2HA 5HYSG 1PSKL 2AV7B 1ZLSH 1IC4H 3H9SE 1FRGL 1DP0A 1QPXA 1V8HA 5IKCB 4LKCA 2Z31D 2QJDA 3QXAA 3T3MF 5FA3A 4DCQA 3FFCE 1BD2B 4TN9A 1H8OA 4OZFA 2C26A 2ZUWA 3DVGA 2KL6A 2CRYA 5D2NE 1CD9B 3KGRA 5GGUA 3AU1A 4H1LH 4JFQB 4X6EB 2CUIA 1FJ1B 1X7QB 5I1KH 4PJCA 1BVZA 1NDMB 5IB3B 1E4XL 4NFBA 3RNKA 3UTPE 3UTOA 5KVFL 1HEZA 1LEKA 3QEUB 3IKKA 5I1CL 1TITA 2DQEL 4H26B 4M8VA 3QDMD 1B0RB 2VLRE 3BRFA 2Z31C 4KPHL 4RAVB 5HHNB 4LEOA 4N0CD 5CD3B 4FFZH 4XXCC 4TNWK 3HZYA 1I1FA 4AM0B 4RFOH 4O00A 3E2HC 1OSPL 3U30C 4S1SH 5GRXG 2ZG3A 2IH1B 1R5VA 4P49A 4NQSA 4HS6B 4Z7NE 4HLJA 4OIAA 2ZNXA 4XBPB 3CFEA 4WO4D 5AZ2H 5DJXA 3I50L 3VD4A 5B8CB 3B8SA 3QNZA 2X1XR 3JV4B 3IDNB 5CSGA 2WWKT 3GM0A 4FQLH 5IMMA 2K1MA 2DD8L 2AEIT 3S97C 1A6WL 2DYPD 4U3HA 5HPOA 5LJYH 2VE6A 4G6FD 5DHYA 1UB5B 4N0CC 4PJBB 2AXHA 3IKCB 2O93L 4JFYA 2FBJH 5L0QC 2YUXA 4F15C 2J5LB 3ALPA 2YMXL 5F89B 3GIVA 4QTIL 4XCEB 5GS0H 1NGQL 4YDLC 5EU7C 4WO4C 1EMTL 3FQNA 2OCFD 1PKOA 3TIEA 4KROD 4J3SA 4GAJH 1CICA 3TYFB 2BY1A 1MFBL 5I9QB 1U8PA 1D5BB 1AFVH 3ARBB 3U0TB 4I9WE 3ARSA 3HS0A 5E8NB 1I8IB 3U48A 3QULB 2BK8A 3BPCA 1RUPH 4L1HA 4WV1B 3IETA 1GGCL 1MAKA 3NN8B 4UTBL 3LSOA 3OWEA 4CU8A 3ZYJA 3IGAB 4NIKB 3OKDB 3BN3B 1KPVB 4JLRB 4E41E 2OSLA 2JB5L 1U8HA 3OG6B 4KROC 5A43C 1DEEB 4RDQF 3OXRB 4JB9L 5JMOC 1ZLWH 5ID0B 3K81A 2F5AH 4ZAKA 1BQHA 4OTXH 5ACLA 1HKLH 4IRJD 5GPRA 4E5XA 2IANE 2DTSA 5DJ2A 2JK5B 4XPAL 4DKEL 4P9HH 2GCYA 5DLMH 1QP1A 3UP1A 3O2WH 2FX7H 5JW5A 1JZ2A 3M8OL 1FVDB 5D2LE 3QR2A 5GS1A 5E8PB 2DQFB 3IXTA 4KI5D 2VDOH 2MPAL 5C2BH 4NN7B 5F7DA 3P4NB 3L7EB 3IU4L 3QJHA 3FT4B 3ULUF 2I5YL 1UKQA 1GGTA 2RJMA 1Q0XL 5FHBL 3VXQA 1JGDB 2HFGH 5T3ZE 2D3VA 4IRJC 3E6FB 4JFZL 4FFYL 3FHAA 3S96A 5L2JB 3F7PC 4O5LL 1EEYB 2OM5A 1AGCB 4Y5YA 2Q1EA 4M9OA 3ULSA 2OYPA 1LP9F 5AUMA 4QEGA 4MD5B 2FO1A 3TWCL 3U9UA 5F1OB 4WVRA 5C0CB 1IQDA 1UM6L 2JJSA 3LDBC 3X12A 5B3JF 4KI5C 7FABH 3TVMD 4QRTA 4EQ3A 2J2ZA 3N1MC 1FDLH 1AHWA 3K4AA 3NCJH 1JRHL 1ZA3A 4HGMA 3QDGA 5GS2D 5ETUB 3DX6A 5D9SA 5CEYB 3CC5A 4HIHA 1G6RH 3KPNB 3O3AB 3HI6H 2AK4D 3OMZA 5F7MC 4Z0BL 2DIBA 2GQHA 3ROLB 4K3JH 3OR7A 4WCYL 4PJ5D 3MLPA 4OLWH 3E8UL 4RGNB 3U0PA 4H1LG 3TVMC 3SJVB 5BMFL 1C12A 2IMMA 5CP3A 3D39A 3QEGH 4YHPB 3BJLA 2EDFA 4OAWB 1RPQA 1YZZA 5IEHA 2BY0A 2OXHA 3CSYA 2P8PA 1CG9A 1G0YR 5D93C 3ZE1E 3H9SB 1MQKH 2IAMA 4R4BA 3WIFA 4X83A 5DK2B 3QXDB 4LVHB 1AC6A 3VXMB 3I6KB 4ELMF 4W70A 2Z92B 4P3CL 1KXTB 2Z35A 3M1BA 3FFCB 1DLFH 2HKHH 4YDKL 1YJDH 5HD8D 1BQLL 4NGHH 5JUEL 5D2NB 1YECL 3SCMD 2YPKB 3CPLA 5DF0A 5I15H 2YPLE 2AP2A 3CFDB 3QUMA 5ESQB 4WUUA 1FYTA 4OD2A 1N8ZB 3TV3L 1CVRA 5GS3A 3RHWK 3GMNA 1ORQB 4HWZA 3C60D 1QSEB 4A2LA 3UTTA 1UH2A 4M62L 1P7QB 2VLRB 1NGWA 2BSSA 4CJ0A 4F57H 2JKXA 5B21A 3GSVB 3GSWB 3PHSA 4D9LL 3LN5B 5E03A 2Q86B 3RNQB 5CKAA 4JFEE 5HD8C 3KYAA 5CEZE 4N68A 5JPNA 3WUWG 3SCMC 1XF4A 2AJUL 4PGCB 4Y5VA 3N9GH 4O58H 3PNWB 4OUUB 5DFTA 3MXVH 4MQXD 4LOUC 1OQOA 4NO5B 5D6CA 1OW0C 3VRLE 5BJTB 3JWDL 2XY1A 4XCFL 3C60C 3CCHB 25C8L 4HUVA 5DR5H 5GGRY 5J9PB 5I8OH 3GB7B 4HEPG 4OT1L 1KCSL 5T1DL 4GOSA 5K9OA 3SDDA 1A7RH 3WD5L 2YBRB 4YHKH 4MCYA 3P77B 4PGDA 2APFA 1OLLA 4UBDD 4YC2C 5DMJB 3VXNB 2D31A 3U6RA 2L4OA 3IDJB 1XGRA 4MQXC 4G80B 2VLKA 5KN5B 2G9HB 3WS6A 1AJ7L 5BZWA 3BSZH 3L6FB 4BFEA 3DROA 1BREA 4JFFA 4KK9D 4NT6B 2DDQL 3NIDF 2Q7YB 1F6FB 3KXFB 3LIZH 2OLDA 4RBPK 3BESR 5E99H 3P0YL 4PTUB 1BLNB 4QHLA 1B90A 2ITCB 1IAOB 5EU6A 5C0BD 3RZWA 3MV9B 4M5ZH 4UBDC 5KS9A 2V2WB 3RI5F 3IDYC 1QRNB 2VB5A 1YEJH 4E41B 4B0MM 3DMMB 5HY9B 4NWUL 4WJ5B 1CLYH 1DVFD 4GRWH 4NQVB 3HZVB 3BGFC 3ULUD 4KMTL 4YXKH 1CQYA 4Z77A 3RUGA 4JHBA 4HGKC 1A6UL 1Q8MA 2ZUXA 3G6JF 1ZWIA 2YN3A 5KOVC 4KK9C 1JNHB 1MFCL 1SJVA 3VXSE 4WHTB 4L3CA 1HHIA 2VDMH 3CSGA 1SM3H 2W9EL 4M8QA 1WF5A 2EDRA 2BOCA 1FFQA 2ICWJ 2RIKA 2V7NB 5C0RH 1PQZB 4KVCL 4Y1AA 5F3BA 3T1FA 4G7YL 1OY3B 3MMEA 4YH6A 4JQIL 5D2LB 4ZPTB 4H8WC 1DEDA 3QRGL 5C6TH 4ZFGH 4I77H 1DVFC 2W07A 3ULUC 4Z78B 5JMRA 1DCLA 4H1LA 3MRFB 4Z7UE 3H7BA 1S5HB 1OTTD 3KNBA 3ARGD 5HHPB 3FQRB 1EIBA 3QUZD 5D7LD 7CGTA 1OAQH 1NMBL 3O6FA 3V6FB 1WEJL 4WUKH 3CXDL 1PG7L 3HZMB 2VISB 1FZOB 4PJ7E 3EJJX 4QRQB 1OM3H 5GJTH 5TF1H 2HJLA 1RVFL 1LGVA 5L9DL 1N4XL 1T5WB 5IB2B 2F58H 3S3SA 4Y5XC 4ZOBA 4M1GL 4OF6A 1MNUH 1KJ3L 3INUL 1VHPA 3MOBL 2E6JA 4O2CB 1MJ7L 1OTTC 3ARGC 1G9MC 5EU5A 5IIEB 1G0DA 3SO5A 2PO6D 5FECB 4KXZH 2BNRA 3DLQR 4IRSB 4XMKL 3PGDA 3BHBB 4Y4KD 2NY4D 1MELA 3VW3L 1FL6A 3WEXB 5LGJB 3HPLA 4Y4HD 5TE6L 3UZEA 1KCUL 3V6ZA 4OLEA 4XPGL 1UVQB 4RGOL 3KPRA 1UCBL 4YHLH 3K8MA 5IOPA 1KJMB 2X2YA 3MREB 3WO4B 1AY1H 4XPFH 5J1TC 4DTGH 1PG7W 4ZXBB 1FGVH 4MQSB 4XBEH 1P9MA 2GT9B 4M48H 1UQSA 1BIIA 4YJZL 1VEOA 3MRIB 4QHUA 3WUWA 4Z8FH 2V9RA 4RFEA 1QFWL 5C0AD 4WFGE 1RJLB 3WNLA 5HGDB 1WCBA 3MJ9L 3OJ2C 2A77L 2NY4C 4Y4KC 1W2KT 4JG1L 4X7TA 1OOAA 4LARH 5DUPH 4HT1H 3HCVB 3MA7A 2D0HA 2DMKA 4Y4HC 4J8RB 4X6BA 1T89C 1ZVSA 1HDMB 1X4YA 4G9DB 1M4KA 1W0VA 4LLYA 5IWLC 4P48A 4U1NB 5J6GA 1XCQA 4TPRH 3QCVH 2BSED 4OZGA 2DQGH 2LU3A 1WZ1L 1RUKH 4U6XB 1AGFA 4KHTL 1DBKL 4Q9BA 4YQXH 1TNMA 1VFAA 3AAZA 5T1KA 3RWIA 2ITDA 4WW1B 1CZ8H 2V9TA 2RR3A 2BRRH 4S1QH 1LMKA 1PLGH 1H3TA 3F7VA 5A3ID 1C16B 1JP5A 2R8SL 3RBSA 1MY7A 1VDGA 4MCZB 5T1LD 2UYLB 3MR9B 1UFUA 3L9RA 1XEDA 1T3FA 3HMXL 3BRGC 1OAYL 3QUXA 1PGRB 2P1YA 1BQUA 1UWXH 1TVBB 1UM4L 1J1XH 4WWKD 1NBQA 4PLKD 5C07A 2G5BB 4HZLB 5DS8A 4OIIH 2DN7A 1RUQH 4POUB 3U79A 1LO3L 4UQ2A 3STZA 4XNYH 5A3IC 1LD9B 5JOFA 1DQMH 4OB5L 1RMFH 4JY6A 3UTSA 4OZHB 2MKLC 5GS2H 4JO4L 4TNVK 1D6VL 5C71A 5TFSH 2OR8A 3CXHK 4PJXF 4XHQA 4J6RL 2YD5A 2WWMD 2PR4L 5CJQH 1Q9LB 4F8QA 3N85L 5CJXA 4PLKC 4HBCH 4JCLA 2WUBH 3OB0H 4XCYB 1I85A 4UIKL 1G6RA 1DBJL 4RZCB 4PJ8A 3O0RH 1R3KB 4XMLH 4HUWA 2VDQL 3PXHA 4ZUSA 1CR9L 4HUKB 1QFHA 5J57B 2AKRB 4B7IA 4PJAF 1RZJC 2YOCA 3D87B 3F6IA 2WWMC 4I3GA 4YFLF 5DEFB 2OS7A 2NY7L 2Q8BH 1G9NC 1CFTA 3B9EA 4LCCB 5K9JL 4EDWL 3VXSB 5E1AA 4QXTB 5ISZA 5TDPB 3MBXL 5DTFB 2CLRA 2D7NA 1X3DA 3Q6GL 4NQEE 4UB0H 3MX0A 2FCBA 1Y6MR 4MWFA 4NNYA 4CGTA 1KJVB 4U1HB 1EHNA 2R56L 1U9KA 2H6PA 4X9BA 4ZO6A 2HLAA 4UT7L 5DYOB 3H0TB 5ITFB 1CGYA 1AXTL 2V5SA 1MHPH 1K85A 1MHEA 1FV1A 4FXGB 4AT6A 5JHDD 1AR1D 3U2SB 2E7LC 1AQKH 2FJFB 4Q0XL 4Z7UB 1Y18A 2ESVD 5DVOA 1HHGB 4EN3D 1LEGA 4F37K 5B38G 3U46A 5JQ6H 1SMAA 3GBLA 2LQRA 3U4BL 3T65B 2ARJB 3QIWD 4PJ7B 2O5ZH 1T1XA 1SBSH 1CIDA 1JF1A 5E2UH 2J1KA 1DQJB 5IHUL 2PNDA 3G5YA 2WBJD 3WFCH 1VFOA 1G7PA 1IGFH 1ND0A 1F3DJ 4CAGA 5AG8A 2BMKA 2VDPH 4EDXA 4MDIA 2ICCA 2NR6D 2XWTA 4KU1A 4EN3C 1ZEAL 4JRYA 4K2UH 4BJLA 3P3YA 4NZRL 3D0VA 4NN6C 3QIWC 4PGBB 3VI3E 3GJEB 5JNYA 4QGYA 4K23L 4Z0XB 5JHLL 2A1WL 5DFWH 4G6JL 4F9PC 3LKQA 4KTEH 3UAJD 1HYRC 2EYRA 4NUJB 2WBJC 5JR1L 4LDEB 1AKJB 2VNCA 3TPKA 3P0GB 5JIIA 1P4LB 2NR6C 3SGKC 4GS7B 5CILH 1N2RB 2OTWB 3ULVH 3NFSH 1MHCB 2D9QB 3G5VB 4L29B 1KELL 2VQTA 4BFIA 4HKJA 3QDJD 2GJ6A 3HZKA 3MFFA 3BKJL 5IVXE 6FABH 2VN7A 2PXYD 5LXGH 2VH5H 3UAJC 1QHOA 4HIXL 8CGTA 3ULUH 1TZGH 3WFDL 3RWFA 4EXKA 5ADPH 4MLIA 3MCLH 5IFAL 1LDPL 1ZSDA 2P8MA 3FQTA 4IMLA 3MLRH 4OKDA 1GOGA 1ONQB 1NBVH 2X4OB 1XR9A 4DEPB 2I07A 4LLVA 4D3CL 3TNNB 2Y07H 1ULVA 4JZJC 3AB0C 1YEHH 2B0SL 4IDJH 2Z31A 3LN9A 1YQVL 5HYJE 1H3PH 5CCKH 1CFNA 4I0KA 1I3RA 4Z7WA 1QPPA 1BGXH 3QH3A 3VMNA 2FJGA 2PXYC 4XXCA 4DQOL 3ZSTA 1A9EA 1I3GL 2ZCLL 2B4CC 5H2BB 1JGVL 5C0EA 5F6IC 1YN7A 3I3DA 1G9MH 1R3IH 5E08L 5KZCD 1JHKH 1RU9H 1DN0A 1NSNL 2YSSA 2DWEB 5L6YL 5D5MF 5EOCL 4DK6A 3IS1X 2WBWB 5DI8A 2ZUYA 3QDMA 5FM5M 4GG8A 4LF3B 4UZGA 3VDCA 3PGCB 3VWKD 5H37G 4G5ZH 3ZT7A 1XCTA 2YK1H 3PWPB 5MEPA 3FB7B 2R1XB 5DD6B 4M1DL 1U8JB 4KV5F 1BOYA 4EIZC 1A4JB 1QKZH 1Z9MA 2YC1B 4D0DA 2OMNA 2BDNH 3GK8H 4WO4A 5J89A 3VFTB 2EE2A 4F3FA 4R4FH 2OP4L 4GUPA 5J1SC 2RFXA 4ONFH 5ESVA 4OZIA 2XRAH 3DRQB 2DYPA 1J5OL 2R2EA 3T0DA 2A6KA 1YUHA 4PFEA 3VWKC 3BDXA 5FO8B 2VKXA 4M02A 3QDGE 1RZKH 3AS0A 3MJ7B 1ED3B 4HUUB 5INDA 3V5KA 1RZ8A 4JPKH 1CD1B 5TDOA 1ZV5A 3ARED 3OBAA 2NW3A 2WIIA 5B38A 3P9MA 1RIVH 3VFVB 2N7BA 4MNQA 2UWEF 3D3VB 1C5CL 1J7VR 3I75B 5C0FB 4L3EA 1HQ4A 3N1GC 5ICZB 1IGYB 4KVNH 2DJUA 4LVEA 5DC4B 2G75B 3D39E 3OKMB 1SEQH 1WIPA 4LCWD 3ILPA 4DN3H 1FZKA 3GKWH 4F2MA 4DN4H 4ZUUB 4LU5L 4K7PH 3AXLA 3MLWL 2N56A 2J88H 5MP6L 4PD4J 3AREC 4HULB 4LKCB 2E9IA 3QXAB 2H9GA 3WBDA 4YUEL 5FA3B 4DCQB 5DD5H 2IFFL 1UJTA 5E1HB 2R29L 3UJJH 3QIUC 4OZFB 3OZ9L 3DVGB 4YDVA 4HF5H 1X6LA 5GGUB 3AU1B 5KTEL 4IRJA 3BDYL 5FYLE 1MRFL 1NCCL 1FYTE 4PJCB 4JY4A 2BVQA 5IVOA 3NA9L 4JO2L 3TO4D 4LVNB 4PJIA 3RNKB 1EUTA 4RDQG 1HEZB 1LEKB 2V7HA 4XNZC 2ZKHL 1FN4A 3WIHA 1V7MH 1D9KD 2VXUH 3UTTE 3OQ3B 5HHVH 4YHYC 5IW1A 4LEOB 2ICWA 5D70L 1JI1A 4BQBA 1SY6L 3HZYB 1I1FB 3ZDZE 2XQYK 3BMVA 1JTPA 3VD3A 1GIGH 2XZQH 1R5VB 1KXVC 2B1HL 1OD9A 1YEEL 4NQSB 4S1DD 3CFEB 2NXZB 3GBNL 1IARB 5HHMB 3VA2C 3LH2H 5DJXB 2ZUUA 3K0WA 5FGRA 3TO4C 3WFHA 4LSVL 2F53D 4PRPE 3L5XL 3QNZB 3GI9L 4FQ2L 5IMMB 3ARRA 1UG9A 2VXSL 3MNWA 2VE6B 3I3EA 3LB6D 4UILL 5DHYB 3GJFK 3FB5A 5KANI 1OVZA 5CJ8A 5I73B 4Q7DA 1G9NH 2DLFH 4I18A 2VLLA 3F8UB 1IBGL 3GIVB 3NCMA 4OCWH 1CLOH 5SX4I 1JNNH 1KT2A 4NKIH 1T20A 4S1DC 2Z8WC 1EO5A 3FQNB 2AK4A 3TIEB 2YWYA 1AI1L 1CICB 1E4XI 1VB9A 4MQ7A 4M7JL 1KBGH 1ZT4A 2HTLD 1MFNA 1U8PB 2FB4H 3SDYH 5I66A 2ORBL 4RRPG 2IWGA 3LB6C 4HK0A 4JFFE 3HS0B 4AEIH 4TVPL 2EDHA 1BF2A 2X1WL 1V3LA 2OI9C 1ZANH 3S3JA 4JPIA 3S3PA 3BPCB 2AJ3A 3IETB 3LSOB 4P9MH 1MCPL 5KS9E 4YDIH 4MA3A 2BX5A 2OSLB 1I7TA 1U8HB 5F9JA 3PDDA 3U4EA 2JTDA 2AQ1A 3UTZA 5E2TL 2X1OA 1XMWA 4ZAKB 4N8CH 3RUGE 1OP3K 1BQHB 4MJ2A 5C9JA 1GOFA 1GGUA 4E5XB 3IB4A 4L4VA 3SCMA 5DJ2B 4V1DD 5C92A 2GCYB 4PB0H 3QO1A 4TTGA 4YHOL 4Y1AE 4CJ1A 5JW5B 1OW0A 1J0IA 5GS1B 2LABA 1NCDL 3IXTB 1MUJA 5F7DB 1WFNA 5D6DA 2CDGA 3QJHB 5HHXH 4R96A 4PB9L 3V5HB 3VXQB 3BFOA 3NCEB 1EGJA 3HR5B 4YEEA 5ITBL 4W4OC 4MA8L 3RWEA 5LAXA 1IRAY 5LBSL 4JKWA 3IU3B 3S96B 3IRPX 3MUJA 4OCLC 4Y5YB 1AGEA 3EW3B 3ULSB 1GC1C 3O6KL 5AUMB 3TJEH 4Z7OF 4P59H 5IROC 4K94C 4CMHC 1K2DA 5FEBA 4CN6A 3U9UB 3ARUA 2X4TA 3WSQH 1IQDB 5C0DA 3X12B 1W72H 2CK2A 5FCSH 3R0NA 4M7ZB 4BZ2L 2WLYA 4QRTB 2YRLA 1OL0A 1VPOH 1AHWB 2O5XL 1ZA3B 4LSSL 3QDGB 3WFBH 2X44D 2ERJB 1BOGA 3DX6B 2O5YH 5D9SB 4U7SA 4HIHB 3TA3A 2BNRE 4JZOA 4LSRH 4OKVA 1DBBL 1JGLH 5CBEA 1FPTL 1QBML 1WZMA 3OR7B 5I30L 4WI3A 1NPUA 2Z8SA 1JWUA 3U0PB 4J3WA 5F93C 2DAVA 2W0LA 1IQWH 3KPRE 1IGCL 1C12B 1MFEL 5C0ND 5J6HA 3D39B 1JYXA 3CK0H 4C58B 2KUTA 5HVHC 4QRRE 5IEHB 3CSYB 2P8PB 1CG9B 3C8DA 1V3JA 4GLRI 4Z76A 1CK0H 4NJ9H 1KEMH 1XR8A 2YZ1A 1TZHA 5C0BA 2ZPKL 2OK0H 1N5AA 2IAMB 3UROR 4R4BB 5I1EL 3WIFB 2GUOA 5KSUA 1YEGL 4N0FA 1FSKC 2HJFA 5CAYB 1IAIL 3GHBL 1RSFA 2J4WH 2Z35B 2DQTH 1LWRA 3M1BB 5KVDH 2X41A 2A74A 5EO0A 5DJ6A 1I8MA 2A6IA 5C0NC 3CPLB 4RNRA 4NSKA 3QUMB 3T2QA 4WUUB 1FYTB 4OD2B 1CL7I 4TRPH 4P4KD 4PREA 1ODAA 5I18H 1RULL 2ADFH 1LP9A 3GMNB 4B41A 2CK0H 3MA9L 4XWGL 1N6VA 3A6BH 4HWZB 3KPSE 3UTTB 3S37L 1T04B 2BSSB 4QOKE 4I2XA 4E0RA 4Y5XA 4ZD3H 2VDLL 3GRWH 5EBWA 1Q94A 3ZDXF 5JPNB 2B7DT 3PJSA 1XF4B 1V7NL 4Y5VB 3QUZA 5D7LA 2BJML 1GPOH 4P4KC 2NY5C 4X80L 3LS4H 4RX4D 1P7HL 4APQD 3EYUH 2R0KL 1TTGA 4RBPH 1EX0A 5D6CB 3LRGA 2K3TA 5E5MA 5F7WC 4MXVE 1TETL 4HUVB 4F58H 3O11A 5F1NA 2J3SA 1NLBH 4YE4L 1RZIA 2H1PH 5K9OB 3SDDB 5JLZA 4XWOC 3OAYK 1ZGLA 4N0UA 4C57C 4JM4L 4MCYB 3BP6A 4DGVL 4PGDB 1X5AA 2PO6A 4Y16D 2D31B 3U6RB 3K2UH 4KFZC 1XGRB 3NCCB 4APQC 2VLKB 4FQ1H 5EO1A 1OAUL 2FNBA 5HVFB 4NUGH 3IDMA 3MRGA 5BZWB 3DROB 3QUML 1T89A 4JFFB 3LQAC 4LLUA 3V6OC 1LHZA 5IWLA 4HJJH 1RY7B 1S7RA 2NMSA 4LHUD 3NAAH 4M7LH 4X7SH 5EU6B 1NCAL 1JGUL 5AEAA 4G7VL 1NQBA 3LEVL 4YHNA 5KS9B 3B5GA 1JCKA 4Y16C 3OXSA 5C0AA 2DTML 5D72L 3VFPA 1YEDA 3C6LD 4UNUA 4KTYA 4BSVA 3DUUA 3THML 1JTTA 1RIUH 1ITBB 1HI6A 5TJWK 5DK3A 4Z77B 3RUGB 5K59F 1YYLH 1ZWIB 1WGOA 3MO1A 3P11L 1MCSA 2QQLL 4L3CB 1HHIB 4M8QB 3ZYOA 3CJJA 5J0BA 4K3EL 2BOCB 1BJMA 5GRUL 3QAZB 5DZLA 4F7TA 4Y1AB 3RWHA 3T1FB 5FGCE 5F3BB 1GGIL 1U8KA 4NOFA 3MMEB 1F11A 3C6LC 1QHPA 4LASL 3C8KA 2C3XA 1U93A 1GHFH 2BVTA 5FA4A 1F58H 3LD8B 4H1LB 3OL2A 1FGNH 3H7BB 3KNBB 5F7FA 4BH7A 4OFKA 2Q8AH 1RIHL 4I3SL 2SEBA 3O6FB 4Q6IC 3IJYA 5IUSA 1VSCA 5DD0L 5IMOA 3S98A 1GOHA 3DYOA 3ZL4L 4UTAH 3QWOA 4Y4FD 2HJLB 3D9AH 4WWKA 4Y7MA 5F9DC 3X14A 4HFUH 1NGYA 3QNXA 1JZ8A 3ZKXB 4LRNH 3HRPA 4OSUL 1NUNB 3S35L 5DRWA 1YYMH 4NJAL 5EU5B 4BQ6A 1FG9C 3QB7C 4KZEL 4JRYE 5KSVA 2BNRB 4G9FD 3PGDB 2P49B 1UA6L 4NM4H 2OJZH 1RK0A 4URTB 1F45A 1OCWL 5I1JL 3HNSH 4NN7C 1FL6B 4IIQA 3SQOL 5JORA 1KB5H 4N5ED 3TBWA 2OTUA 4Y4FC 3U9PH 4LIQH 3HPLB 4WEBL 4WFFE 3QA3A 5ELIA 4OFVA 3V6ZB 3GO1L 3G6JA 1X5GA 4QYOA 5IOPB 1IC4L 4OI9A 1KTRL 2FEEL 3MLZL 4KKAD 5A2KH 1JNJA 5HI3D 1MH5A 4XNMA 4K7PY 1UQSB 1BIIB 5DJYA 1GGYA 4I0PD 4QHUB 3WUWB 4RFEB 4OCSH 4NRZA 4O4YL 1I9JH 1WCBB 2XTJB 1UT9A 3F62A 4JFHE 3WNKA 5AYQA 2GJ6E 4X7TB 5DJCA 3S8WA 2Z8VC 1OLZA 3QQ3A 4N5EC 3MA7B 3N1QC 1HZHH 3MLSH 3T08A 4X6BB 1ZVSB 3LN4A 3JV5A 3B83A 4JR9L 4MNGA 4LLYB 1W0VB 3UYPA 1HSBA 4QNPE 5J6GB 2EH8H 3K8LA 4NKMA 1XCQB 1RZFL 4OZGB 4KKAC 1EBPA 1U42A 5HI3C 2CR6A 1UGNA 4FFZL 1GC1H 1AGFB 4RGNC 1B9ZA 5IHBA 3QT2A 4GRWE 1VFAB 4K94H 1F4YL 3AAZB 5T1KB 1H0DA 1VESA 2ITDB 4Z7WE 4N90D 1I4FA 3VFNA 1XF5A 1BQSA 3O6LH 1P53A 3ARXA 3F7VB 1OB1A 3T3PE 4WHYG 5JHDA 3HRZA 3IJHB 3ZE1F 2ESVA 5ENWA 3L9RB 3EDKA 1A9BA 1T3FB 3QUXB 3QIWA 5TPWH 2FBJL 3SO3C 5C07B 3MACL 3SGEH 1NJ9A 4PJDE 5D2NC 4NHCH 5DS8B 4N8VG 2WBJA 3PWVA 3R06A 3L1OL 5D8JL 3KPTA 4M9PA 3STZB 1J0JA 3DI2B 2XN9A 5JOFB 4JY6B 3UTSB 3T09A 3SGKA 1NFKA 35C8L 2XA8H 1S3KH 3BKCH 1L7TH 4Q58C 1F4AA 3WKNA 3RVTD 1PZ5A 4JN1L 2F74A 4OZIE 1W72A 1ZHLA 3TT3H 2DBLH 3WLWD 4GKOA 3FQUA 2WBKA 1MLCA 1WTGT 5HI4D 4JM2F 1Q1JH 2QHRL 2BNUA 1G6RB 1BAFH 3IFNL 4E9LA 3DGGA 3KYOA 4PJ8B 3PP3K 4H0HB 1DQDH 4HUWB 2BSTB 4ZUSB 2F5AL 4I1NB 3MRNA 1LE9A 3VRLF 3TJHD 3B5HA 3QFJD 3CVIH 4YGVA 3D0LA 4JZJA 1HKLL 3BGAA 1CE1L 3RQ3A 3GUTA 3RVTC 1WLHA 4MNQE 1KNOA 3MGTA 3QDJA 4L3EE 2X89D 1UENA 3C2SA 2PXYA 3BZDA 3KLSA 3WLWC 5J12B 1OAZH 1CFTB 1OARH 3O2WL 5HI4C 3UZQA 4P57A 5E1AB 5ISZB 4WGVB 1T80A 2CLRB 2VDOL 4WY7L 4FZEL 1XF3A 2EDTA 1PFCA 1MCWM 5IQ9A 2BERA 1IC1A 4MWFB 1CBVH 3TJHC 4NNYB 4PG9A 1JYNA 4YBLB 1DSFH 2HFGL 2EDBA 4UINL 2H6PB 4MB5A 2KPNA 1UEYA 5KVEL 2IAND 2W92A 1MHEB 1FV1B 4AT6B 3OAZH 4OLUH 1Y18B 5E56A 5A2FA 1LEGB 1MCQA 3U46B 1XIWD 2A73A 4PJIE 3MLUH 7FABL 4UU9A 3U1SL 1M7IA 2MCPL 3L3GA 1I8KA 3I6LD 2P44B 1XGUA 3DURA 1FDLL 1T1XB 3ZTNL 5FB8A 4ALAH 4Z18A 4QXGH 1C7SA 1JF1B 3BH9A 4FQCH 2V5YA 1QNZL 3G5YB 4CL7A 3GRWA 5T3ZD 1SEBA 1G7PB 3VWKA 1ND0B 3QEHA 4NC2B 1U92A 5ALCL 4YBHA 2BMKB 3LQAH 5J3HD 4PV8A 5K9QG 2AXGA 4EDXB 2Q6WA 4MDIB 1P7KA 2XWTB 4AK1A 3VG9C 4JRYB 1XIWC 1T0MA 3RA7L 2DQUL 1NAKH 3D0VB 2ICES 1TQBB 2HMIC 3SBWC 5JNYB 3OKYA 4PJAA 4KH2A 1Q9OA 4OCXL 1UWEL 3LKQB 5FYJL 2EYRB 3QHZH 2DICA 4DVRH 1EPFA 1VCAA 1A64A 1LK3L 1CXKA 4OD1L 3BZ4A 5J3HC 1KN4H 4PJ7F 4LSQH 2H2SD 4QRPD 3W0WD 5EIVA 3OJMB 3AREA 2HKHL 4JREC 5I1GH 4BFIB 4HKJB 1S7XA 2GJ6B 3DUHA 3HZKB 3MFFB 5I15L 4S10A 3HNVH 1ZVHA 1OAKL 4MS8D 1WV7T 5EWIL 5A40E 3KDMA 1YEFL 4PRAA 4DFIA 4OCRL 3O4LE 4ZXBD 2LFGA 3KJ6H 2A9NH 3RWFB 3ALXA 4HFWA 2AK1L 1Q0YL 4LCWA 1ZSDB 4N0YL 1NCNA 2P8MB 3FQTB 4IMLB 1GZQA 4IRSC 4FQHA 4Q9QH 4F57L 3DTXA 4ONGL 3OX8A 1A22B 1XR9B 2I07B 4LLVB 3ZKND 4YWGH 1CDYA 1A3RL 4GRWB 2Z31B 4M93C 1HNFA 4UV7L 1CFNB 1HCFX 1FH5H 1U8QA 1I3RB 4Z7WB 4JEGB 1T4KA 3QH3B 3RPIA 2FJGB 4O58L 4IHOA 4MS8C 1GZPA 1A9EB 2YPLD 3E2HB 4JGUA 3U30B 5C0EB 4ZXBC 3WS3A 4L4VE 1YN7B 1TFHA 2R4SH 4YR6A 3MRRA 1K9TA 4JRXA 5HXMA 1QR4A 3F5WA 4GAYA 5I8OL 3TO4A 1DN0B 5HHOD 2YSSB 1NCBL 4JO3H 4DVBA 3FONA 1VFBA 3ZKNC 1VENA 4POYA 1D9KA 5DI8B 1A7RL 3QDMB 3KPQA 3K7UA 4GG8B 3P9WB 5DT1H 4JFED 4YZFF 1D6EA 1GCFA 4AL8H 3ILQD 1XCTB 4JM2D 5MEPB 1BEYH 2COQA 3NACH 3C9NA 3B5TA 2EDDA 1S9WA 4YHIA 4D0DB 4YDLB 3UXFA 2YD8A 1CFVH 2YXFA 4WO4B 1PG7X 5MHSD 4F3FB 4GUPB 2F53A 3EDFA 1K8IA 2RFXB 2ATKA 3KLHD 5ESVB 1HK6A 1JN6A 3LIZL 3HPJA 4OZIB 2DYPB 5E99L 2R2EB 5J56B 4G6FB 2A6KB 1YUHB 2VN4A 3CVHH 3ILQC 4JM2C 2YUWA 1X5FA 2NNAA 3JUZA 3V5KB 5INDB 1YEJL 1KCVL 1RZ8B 1LK2B 1A6VH 5TDOB 3JWNC 3K1KC 3NZHL 2VZTA 3MV01 3U7WH 1CLYL 2NW3B 4ZTPL 4J3OC 4YXKL 2ADGB 2AXFA 2WIIB 5B38B 1MRDL 3P9MB 2Y06L 4G3YH 1E4KA 1KB5A 1T21A 4KROB 3KLHC 4MNQB 2D4FA 3CLEL 2FD6H 2VDML 1NEZG 1SM3L 3V79C 1IT9H 1HQ4B 4AIXA 2E27H 1QEWA 5C0RL 2IG2L 3W9EA 5GJSH 3ILPB 2DKSA 2P4AB 1FZKB 4F2MB 1BFVH 3AXLB 1NANI 1FZMA 3ARQA 3ULVE 2FHBA 5C0BE 4CADA 5C6TL 5DVKA 2B20A 5EUOF 4R90L 3S6CA 5E9DE 5D5MA 5ERWA 5CINL 1HINL 2H9GB 3DGCR 5T5NF 3LHPH 4MYWB 5EIQA 3NTCH 1U0QA 3O3EA 4FABH 4PJEA 4YDVB 4DKFL 2X1PA 4M4PA 4W4OA 4IRJB 5IVZA 5LGHL 2FATH 3GJFH 5TF1L 2ZSVA 2W59A 3QNYB 2BVQB 4IM8A 3DOSA 3PG2A 4V1DA 4PJIB 3RIFK 4Z5RA 2F58L 3P2TA 2CRMA 4X4ZA 2V7HB 1FN4B 2Z91A 1MNUL 4I13B 3K1DA 1MWAL 3I6GA 3IDXL 4BQ9A 3BISA 2AABH 5A2IH 5IW1B 4X9IA 2Y6SD 3V8CA 2FX9H 4HXAH 4I2XE 2ICWB 3H9YA 3NGBC 4L5FL 4G43A 4LHUG 3MZTA 3QEQA 4MJ5A 5D7LE 1A7BA 3GMQA 1DQLH 5I19H 3WFHB 2BFVL 1WBXA 2MKWA 2MFNA 3UJIH 4YHLL 4OJFH 1YC7A 4XPTH 1T83C 5C86A 1AY1L 2UWEA 3CSBA 3MNWB 1CDCA 3AC0A 1EFQA 1FGVL 3FB5B 4ZNCD 1UYWL 4M48L 5JXAH 1W0WA 4N0UE 3WDHA 4I18B 3ZYIA 2VLLB 1MFAL 4OBRA 2AEPL 5TGBA 2XACC 3SE8H 1XH3A 1OP3H 1CDBA 3ZMRA 2AAVA 2DIJA 1FIGH 1KT2B 1MLBA 5D93B 1T20B 4HT1L 2DQIL 2AK4B 1OGAA 2R39A 4MQ7B 5CUSL 1ZT4B 1UC6A 4C83A 5I66B 5BQ7A 3QCVL 1NCUA 5JOPE 4HK0B 2DQGL 4ODHH 1RUKL 1DJSA 1H5BA 2AJYH 5E4EB 3SKMA 4JPIB 1A14H 2APTA 3WIHL 4Y88A 4HAFA 1F4WL 2AJ3B 4YQXL 1F2XK 4M6ML 3VI3F 3MUZ1 4MA3B 2QL1A 1VEPA 2BRRL 2ED9A 4HWBA 5C0AE 3SE9H 1PLGL 5B3NA 1I7TB 1SJHA 1WT5A 5F9JB 3WNMA 1FO0H 3IAQA 3U4EB 3UTZB 5JIPA 2BC4A 1E27A 4C54A 4HX1A 1HOCA 1NL0L 2VKWA 5C9JB 3DX9A 4OI7A 5F96L 2VIRA 4M4RA 4L4VB 4P4RA 1T1ZA 4UOW0 3SCMB 4O02H 3CFKA 2CKBL 3LPWA 1A1MA 3T2NL 4UT9L 5CSZA 1G7QA 2UV3A 3O9WD 4P4KA 1YEIH 3QO1B 4MB3A 1GYAA 3JWOL 5DMIH 4OIIL 4WW2A 3HMWH 5IVXF 3C60B 4XNYL 4HV8A 2Q76A 3CX5K 3X3FH 1MUJB 4PTTA 1DQML 2CDGB 3LEXA 4R96B 2WQRA 3ARZA 3JVGC 2A9ML 3MOAH 5T3ZH 4HZAA 4S0TD 1NEZA 3RWEB 1U6AH 5LAXB 3RDTD 4LCUA 1FBIH 4JCMA 5CJQL 4L1DA 2VZSA 4HBCL 1AGEB 4U7KA 4U6VL 4YC2B 3O9WC 3C5ZD 2BVUA 4RX4A 2WUBL 4APQA 2J6EL 4PJ9A 4S0SD 5JO5A 5C09D 1CF8H 1K2DB 3EO1A 5C70A 2FZ3A 2VO5A 3WXVL 2X4TB 4U6YA 4MXWH 5IBLD 2FGWL 4PY7A 1V5JA 4YXHH 5CWSA 2VQ1A 2WM0A 2G60L 4WI5A 5ECJE 2XNAA 2XQYG 3V6OA 1NLDL 4O2FA 4EBQH 4XVTH 2H2PD 5EOQL 1IGMH 5FK9B 43CAA 3TA3B 4JG0L 3PHQA 4KRNA 2YD3A 4OKVB 5IT2H 5CBEB 4Y16A 3IDYB 4QT5A 5IFJA 2ZCKH 3C5ZC 1A6ZA 1PAMA 1JWUB 2R0WH 3SEPA 4OBSA 5IBLC 3BGFB 4HSQA 4XGZA 1BWMA 4U05A 4XVJH 5J6HB 1IM3A 5FYKL 4GAGL 3QQ4A 2H2PC 4Z76B 3DXAE 4LHUA 1XR8B 4HUXA 1TZHB 1A1NA 5C0BB 1N5AB 5MEND 5HDLA 3IF1A 5EC2A 2GUOB 2YKLH 5KSUB 4N0FB 4PG2C 1EGJL 2HJFB 3C6LA 3O41A 2A74B 2A6DA 4MNGE 12E8H 5EO0B 1T1WA 4GSDH 5DJ6B 1I8MB 1HH6A 4H20H 3WKML 2A6IB 2NZ9D 1XF1A 3OKNA 3QQ9D 4RNRB 1KENH 4NSKB 4NQED 1FCCA 5IF0A 5L88H 5HJ3A 5T1MA 4PREB 1UH3A 5IV2A 3OAYH 4WI6A 3OHXA 1LP9B 1VGKA 1G7LA 2HRLA 5F1KC 2VXTH 2VDPL 1JHLH 4I2XB 4E0RB 4Y5XB 5DHVH 3RFZC 4WFED 3BZFA 5EBWB 5H8DA 1Q94B 5I17A 4NQUA 3C08H 1FORH 1CE6A 1R5WB 3LKRA 2IPKA 2AQ3A 3CZFA 3JTSA 3DBXA 2NZ9C 3PJSB 5GISH 3S4SG 5JZ7D 3ARGB 3CH8A 3QQ9C 2ESVE 2DLTA 1I3VA 5HVWA 3QUZB 5D7LB 1K6QH 2Y23A 3IS0X 3S36H 4HWEH 2D7QA 4D9QE 3FRUA 5E5MB 2VAAA 3DO3A 4PUBL 2ZCHH 4Y4FA 1L7IL 3O11B 4XNXH 3V7AG 5F1NB 2PW1A 3GSNH 4UNTA 2G2RA 4EI5A 5DQ9A 1RZIB 4MSWA 1IAII 3QXVA 5JLZB 1ZGLB 1EO8L 1TCMA 4J3XA 2XN9E 4GMSH 1MCLA 1R6VA 5JZ7C 3BP6B 1MJUL 1U3JA 2XZAH 4H8WL 4P5KA 6FABL 2PO6B 4W6XB 4NQTA 3IRZA 4G9FA 3PL6D 4CDHA 5IK3A 3AUVA 4Y4KB 2NY4B 1HIMH 3ULUL 1TZGL 2W65A 1JWMA 2OMBA 5EO1B 4TUKH 3I84A 3MCLL 3IDMB 3MRGB 5FDWA 1VADB 3ZDZF 2VL5A 3CVHA 3MLRL 1EK3A 2E7HA 5BOPA 3ZT5A 1MIMH 4D0BA 4LLUB 5EC1A 3TPUA 1CDUA 1H8SA 1JF6A 4NFCA 2A38A 4ONHA 1S7RB 15C8H 5SWZE 2AJSH 4HPOH 5F71A 4MVBD 3D69A 3BI9X 1YEHL 3GNMH 5CCKL 1MQ8A 4YHNB 1ES0A 1R0AH 2NY3D 4TUOB 3Q0HA 2WMPA 4I0PA 4KJWD 3OXSB 5C0AB 4KKCD 3PL6C 3VFPB 1YEDB 1ZKAA 4HD9A 4BSVB 5T3XH 4BQCA 3DUUB 3GSOA 4GKSA 4FRWA 3MO1B 2DF3A 5FM8A 1CWVA 5DQJA 4AQ1B