4YEFA

Beta1 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclododextrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-activated protein kinase subunit beta-1
publication title Determinants of oligosaccharide specificity of the carbohydrate-binding modules of AMP-activated protein kinase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Sugar binding protein
total genus 12
structure length 80
sequence length 80
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yefA00
1U6AL 3QCTL 5E5UB 4C56A 2VABA 1IGYA 3MLRL 5DUPH 3UYRH 3PGCA 1F13A 3RWDB 1Z3GL 1PSKH 4JGJA 3MTRA 2EO9A 5JPMB 2BNRB 4X5WA 3QNYB 4LMQI 4PJDF 5EOTA 2GJ6A 2WINB 5KW9L 5FIEA 3LQAC 1S5IH 4HKXA 5JLZB 4ORGA 12E8H 3MBXL 4YDLC 2IMNA 3O4OC 4QCIB 3TM6A 3I9GH 1NGWA 4F2MB 3G6DL 1QFWM 1VPOL 2CLRB 3PV6A 5GZOC 5DO2C 1OM3H 3P9MB 3VWKB 2HLAA 4OCYL 1DDHB 3QIWA 5DS8A 4XXDB 2V9RA 1CDUA 1FAIH 2PW2A 4FQXC 5J9PB 2HA1A 5EUKB 1MCCA 1I8MA 2X4NB 2FHCA 4KTYA 5DK3A 1U8PA 3SCMB 3X11B 2X09A 4HIIB 3RL2A 2R56L 4WU5A 5FM5M 3QJFA 4Z0BL 1TQCB 4BUGA 4YEEA 3MRBB 2OSLB 2J8HA 2EIZB 2XA8L 3N1GC 3PUCA 4OCWL 4GRWB 3W0WE 5I76B 1NFIA 3NH7L 3QDAA 4FQQA 1HH6B 1VACB 5JW4M 4LU5H 3DX6B 1RIUH 1T83C 1U8MA 1Q9KB 3ARYA 5IESL 3ZE2F 2VH5H 4TUKL 3X13A 3RPKA 3GMOB 1QQDB 1FO0H 4XAKE 4XCCL 3ARGA 4PIRF 2YRPA 2DICA 4E41D 2QL1A 1ADQH 4JDVA 1D7FA 1T0MA 1T5XB 1PLGH 1FSKC 4MYWB 4P23B 4ZNEE 4HH8A 5GSVB 2J4WL 2XZZA 1ERNA 2VITA 5MENB 2EH7H 2YWYA 2A6IA 4JFOB 3WUWB 43C9B 1E4XI 3PWLB 5E9DE 3GRWA 3GIZH 3CVHH 4GBXB 5C0FB 1CF8H 5JXAL 1DN2A 3RBSA 4U6HA 1VFAA 4XHJC 4WHTA 5HXMA 2QTEA 4OLUL 2FX7L 4LLQB 4XMLH 4JFZL 4G8IB 1KB5H 1FVDB 4LCWB 4Q0XH 1EX0A 4OCXL 2A77L 3X12A 5SV4A 4L3CB 2YS4A 4X9HA 2IH3B 1MUJA 2HJKB 4XP9L 5MHSD 3O8XD 5LVEA 1T7YA 5F88A 5MP6L 1OW0A 1D6EB 1OAYL 4BA8A 4N8VA 2OR8A 2EH8H 4Z7WE 2FCBA 4YHOH 2AP2A 4KHXL 4LSRH 1W0WB 3QZWA 1XH3B 2X1WL 4LLDB 3I75A 3M17A 3W39A 4YDKL 1CDIA 3V4UL 2X4OA 4JN2B 2XWJA 5GJSL 4WU7B 5HHOA 1N5AA 3H9HA 5F70A 3VFPB 2DQEL 3QUYB 4PGDA 3HPJB 4WEUD 5ADPL 3BHBA 2UZXB 2A6JB 4F33B 4HMCA 1LMKA 1BQLH 3TA3A 1PQZB 3HC3H 3KJ4B 2DQJL 3QBTB 3SJVA 3QSKB 4R7NA 4F7MB 3J8F7 2K1MA 4ZTPH 3RWHA 2Z91B 4XBPB 2VSCA 2B20A 5E6IB 3CXDH 4OLVH 3DXAD 4G80B 3RWFA 3FT2B 3VWJC 1MCWM 3MGTB 3SOBL 3SKJH 3B9VA 2NW2A 1XEDA 2F5BH 4UNUA 3TBTA 2JK5A 2PETA 3RWCA 4D9QE 2OL3L 1H5BB 3BZ4A 4P9ML 1YMMA 4LHUG 4E0RA 2B0SH 4RFNC 4Y89A 1HOCA 1MFBL 4CU8A 5EBWA 4JHAL 3QHTC 4J8RB 2QJDA 1QFWL 3TJHC 2VL4A 4BFBD 1CD9B 4J6RH 2DWEB 1J8HB 1C1EL 1C12A 1RHFA 3OKNB 4BKLB 1WISA 5F21B 1QBAA 5D2NC 3WS3A 5MERA 1YY8B 1ETZA 3EJZC 3GNML 3GSWA 4HXBL 2GJZB 3FFCA 3QQ9D 4GRWE 1MCWW 4LDLB 3R1GL 2F15A 4NKDA 1GGCH 1Q8MA 3QDMB 3QNXA 2DM4A 5TF1L 3D69B 3QG6A 1UT9A 1MREH 4IRJB 1RZIB 4P3CL 5F1IA 1CU4L 4M93B 3GHBL 4WW2B 1H3GA 1S7WA 3MROA 4TSAH 2WWMD 4YXKL 4NYLB 3HNVH 1RUKH 1ZWIB 4XBGA 4L5FH 2J3SA 5L0QB 4XHQA 2R1YB 1PEZA 4KRLB 4WFEE 1YQ2A 1WFTA 4JQXC 5GS0H 1NEZA 1JGVL 1HHJA 3ALXA 4ZFOL 1MIEL 4WFGD 2W9DL 4PV9A 2D7QA 5JDJA 1H15A 2BRRL 4HIXH 5CD3B 1E4KC 4PY8I 2Q7YA 1GGBH 3IU3B 1TITA 4L8CA 4L3EA 2NTFA 2XICA 3LV3B 5FDYA 1KEGL 4ISVB 2C3HA 1BMGA 1SEQL 3KPPB 1A4KB 1X7QB 3CMGA 5INDB 4N0UA 3C5ZD 3CX5J 4PG9A 1DBBH 2PTUA 3KDMA 3WJLA 3MLVH 2GSIA 1Z9MA 5DFTA 3EDKA 1AFVH 1GH7A 1X9QA 4Z0XB 4H8WH 3JWOH 5IM7B 3V5HA 4BSWA 1F45A 5J56B 4JPKH 2KL6A 4LHQB 3P2TA 5IB3A 4U33A 1ITBB 3SGKA 1N8ZA 4HCRA 4JM2C 5B39A 5EO0A 1V7MH 3PGFL 4PJ7B 4OJFH 3E2HB 1QPPA 4X4YA 1BVLA 2EZ0C 1J1OH 4K94L 1SEBB 4OIAA 4U6VH 3CH1A 4QKXB 5H94B 2H1PL 1UM6H 25C8L 1HQ4B 3U46A 2XZCH 2NY4C 4NO0B 3MLWH 2DBLL 2ZOLB 5FYLL 4DEPB 4JFHE 5GIRB 1UWXK 2CJUH 3ULSA 1JI2A 2EDNA 2FLRT 2XG4A 3FZUD 4PJ8B 1MF2H 4O2EB 4XPHH 5F9AC 4N8PA 1R3LA 1CWVA 1EUTA 4ELKB 3ZDXF 5LGHL 1NC4D 5BV7H 1X6NA 4L1HA 4G8FB 4KROC 1UFUA 4GJTB 4GXUM 2Z8WC 1RZ8B 1N64H 1W8NA 2BXZA 4KHTL 2DLFH 4PV8B 5GRJL 1RY7B 1AQKH 3NCYP 1T1WA 4X0KB 3OJ2C 5FHAH 3OX8A 1KN4H 1G1YA 3BKJH 4YR6A 1A7PH 3ZTJH 1UJ3A 4RISL 3ULUF 3U4EA 5I18H 3VXNB 4U1LA 1JHLH 3PGCB 1RZJL 4NM8H 4TUJA 2VDOH 1LO2L 1QR1A 3PWUA 1J8HE 3NOIA 1K4DA 2FHBA 4KK6C 4R90H 4HKBB 1CDBA 3LSOA 4MLIA 5EOCJ 1EGJA 1AC6A 1C7TA 2EDDA 2XTJC 2GTZA 2XWTB 4PJ5E 5GGSA 2OBGA 2ADGA 3AS1A 2OX5A 3FRPA 3BKMH 4MSWA 2HLFD 5M95B 2AXFB 4JKWA 2NR6C 4KAQL 4FQHA 4Q9QL 5DK2B 3K7UA 3PV6B 4U7KA 3G5YA 3ZE2E 2IANB 5HHMD 3QUKA 1IC1A 4NRZB 4YGVB 5A3ID 2D7NA 3BPNB 2FD6H 5J0BA 2GI7A 2FATL 4QT5B 3VD9A 3BZDA 1NGYB 3LDBB 2LQRA 1B6DA 3CFEA 4HIJB 3E6HB 2EDBA 4GFTB 3GRWH 3G5ZA 5CEXB 2OJEB 2EDHA 3E1F1 5CLTA 3OV6A 1QUNA 1V5JA 4HBCL 4QWWD 5GRUL 3P4NA 2G60L 1BREA 3GFUA 5TDPA 5FDWA 3SO3B 1FVEB 3B9KA 3VDAA 4U7MA 3W11D 5D70H 1I8IA 3OGCA 2N56A 4TUOA 1T3FB 3PWNB 1YEFH 5TDNB 3DNKA 4HJGB 4HPOL 4R7DA 5F7WC 4TQEL 5LG1A 1YPZA 2P24B 4OM0L 1ZE3C 2D7TL 3C2SA 3QUZC 4JDVB 3KPSA 2Y7QA 4QOKA 4NFBA 3BDYH 3BO8A 3H2WA 2V17H 3TV3L 1JUFA 2ATKA 3RY5A 2QHRH 1MWAB 1YJDH 5IB4B 1BIIB 1H3TA 2NY1B 4EOWL 4R8WH 1GZQA 3OKKA 2DTMH 4FQCL 3QEUA 3PQYA 1RUQL 4JEGB 4RAUA 3QIUB 1DSFH 3MRFA 1D9KD 4J7RA 1S7TB 1IBGH 4I0CC 4Y5YC 3OZ9H 4L4TD 3C6LB 5EBLA 1JTTA 1JF1B 3SGEI 1TZIB 3EOYG 1S9WA 2JJWA 3ULUH 5IROC 3AY4A 1G9MH 3GUTA 2JJSA 1OB1B 2NX5A 4OGZA 1U41A 3IB4A 5SWZA 2ARJB 2DM3A 2QQKL 2QSCH 1X5AA 1U8HA 5BMFH 3I6KB 4YPGA 4XVUD 5LBSH 5B21A 4F7PB 5I73B 4I0PA 3NFSH 4YFEA 1UZ8A 3DMMC 1C5BL 3QEQB 2BERA 4Y16A 2YPKA 3DYOA 4WW1B 1QNZL 4GRLC 1WCBA 2ED9A 3F7YB 3S8WA 3Q5OA 1BQSA 4M6AA 4CMHB 3GKWL 5EOQL 3QEHB 5FOBB 5ANMB 5F9WB 5BZDA 3HR6A 4H25A 3JUYA 1LE9A 2D2OA 1UCBH 4PRNA 2J8OA 1A64A 5BVJA 4JG1L 2PW1B 4FQ1H 3UTSD 4XC3L 5ERWB 3TIEB 3I50L 5AUMA 2F8VA 4PJCB 1TZHA 4JY4A 4LSPH 4JHWH 3BZFA 4MMXC 2DL9A 1YMMB 1H3PL 3PHOA 4NQCA 4JKMA 2IH1A 3DVNA 1PZUB 3DIFA 4FFZH 5E99L 5DD3L 5E8NA 1EBPA 1MPAH 1AD9B 2QQLH 3B2VL 3WIFB 3OTTA 1IGIH 5E4EB 5GS0C 3NABH 5JW5A 2W60B 5E1AA 1IKFH 1KLUA 1SJEA 3HB3C 4G9FD 5KVFL 1MCQA 1R3KA 3N1MC 3D2UA 2B4CH 4WUUD 5SX4H 4LGPB 3HRZA 2AJ3A 1KYOK 5SX5K 2J1KA 1CBVL 2E7LC 3MLZL 2FO4B 3K4ZA 4WTWA 4JFFD 1IAIM 1BJ8A 1QZ1A 1U8OA 3U9UB 3U7WH 4IHOA 3ILQD 4P5TA 3QH3B 4KGJA 3HI5H 4Y2DA 1VSCA 4XZUB 5MEQB 2HVKB 1RJZB 1YEJL 2QSQA 5JIPA 3JV6A 3UTTA 3U0WH 5FF6B 4KVCH 4UUJB 1QVOB 4PS4H 4GAGL 4G3YL 4KJYA 5D7JA 4H8WC 3VWJA 3JWOC 5HGDB 1KJVA 3T04D 5HD8D 2EDFA 5C6PB 5DFVC 5C07B 2FB4H 2E7HA 3O3AA 4PJ9D 4AEEA 1TIUA 4OIIH 4F9PC 1IGMH 1DUYB 4N0FA 2IBZX 3DTXB 2VZSA 1BBJA 3P30L 3S7GA 2FRGP 1YPZF 5CLWA 1KYOJ 5FCUH 1BBDL 4CJ1A 1S8DA 4OTXH 2PO6C 3F12A 2L0DA 5CZVH 4N0UB 4F7CB 4JO3L 2BFVH 3TZVB 2UZYB 4PG9B 3BYYA 4LNRB 3C8HA 2CKBA 3ARFD 1LGVA 3AGVA 4L9LB 4HUXA 4NQEA 5J3HD 3L3HA 3VJ6A 2RQ8A 1VKXB 3O6FD 2ZCLH 3JV4A 3FB7A 1HXMA 2DQCL 5DC9B 3ZL4L 4S1SL 3T4AB 5IB3B 4OLWL 3ESUF 1EJOH 3CD4A 1XIWB 4HF5L 4OCRL 3QEQE 3HFMH 3EYUH 3SE9L 4I9WE 1B2WH 1S3KH 4P2QD 4PGBA 1NLDH 3MUGA 2C1PB 3LEXA 2Z4QB 1A1MA 2W0FA 3IDXL 4QRRD 1XCTB 1BECA 4JQXA 5GGTA 3S34H 3ECBA 4XH2B 3SJVE 4YAQB 3O3EB 5ANME 2ZP0T 1F90L 1D5ZB 1I1YA 1TNMA 2XI9A 1CFBA 4GRMB 4Z95L 3P4MA 3SGEH 1KUMA 1E4KA 1R3LB 4FABH 1EGJH 3IGAA 3LD8B 3O4LD 3O6LL 3O6ML 3B5TA 1OARH 1GVIA 4R4NC 5C08A 5I1GL 2EYSB 3ZDYE 5LAXA 1HQRB 1Q0XH 1LDSA 4X8JB 2X2YA 2P45B 1XGQB 4PJCE 1NLBL 3TJEL 4LKXA 1YMME 3JVGA 1K8DA 4PLKD 5C0BB 5IJVB 4HC1L 4YR6B 2AJXH 1E28B 3U4EB 1Q9LB 3V4PH 2A74B 4ZPTB 1JZ4A 1S5HB 4JKLA 3F62A 3NGBC 4AL8L 2DQFA 3P0VL 4LFHG 3MA7B 3O41A 1FZJA 3HZMB 1IAMA 4FMKA 1BJ1H 3DUUA 4P57B 2R69H 4XNYH 2CLZB 3GJFA 5EZOH 2X4PB 5GGSB 3L3DA 2X4QB 2ADGB 5IB5B 4MA7L 5T1DH 2QQNL 1RV6X 3ESVF 2YMXH 1FJ1A 3RZCD 3NZ8A 3MRIB 1KT2A 1EFQA 1DBKH 1IAIL 3MJ7B 2B39A 3F7VA 2NXZB 2H2SD 2NNAA 1ZLWK 1KIQA 4J1UA 5D96B 3W5NA 1ULVA 5DWUH 3LEVH 3MO1A 1XGTB 1EEYB 5D1XB 3V5DA 3QUMB 3H7BA 5JTWA 2I9LB 3VFOB 4MXQC 1ZANL 5DJYB 1KTRL 5C07E 3T0EA 3P4NB 1EFXB 3KPOA 3EAKA 4L3EE 1OAXH 1BFOB 2Q8BH 1HSBB 4AZ8A 1T7XA 4TUOB 5K9JH 3G04B 4MCZB 3FQTB 4Q2ZA 1KIRB 4WI8A 4FXLA 2BVUA 4R7DB 5FHBL 4UBDC 4N0UE 4IJ3C 1G7PB 1N59A 4LSQH 1ND0A 4NM4L 4OLEA 4QXGH 1LO4L 4QOKB 3X14B 4D9LH 1A3LL 1W8OA 5GRYA 6CGTA 4RRPG 3RWGA 3W0WD 2H3NB 1X3DA 4NP4L 4YDLB 3O4OB 3TH2T 1S7VB 3BZEA 2JIXD 5EH1A 5GS3A 1CFNA 4BQCA 1UQSB 1GHFL 1VGKA 1MJJA 1GXEA 3MNZA 1X5KA 3QP3A 1A6AA 4FZ8L 1ZA3B 1MCJA 1WEJL 3VGHA 1KPRB 4XAKD 3S88H 3PF2A 1IE5A 4ZUVB 1QOKA 1JWSB 4FQXB 5TQ0H 5J7CC 3NCJH 4XWOD 3X3FH 4LAQL 3V7AG 4XB7A 1JNNL 4HV8B 3DX7B 1MRFL 2DQGL 2P5EB 4TSBL 4KQ3L 4YBLC 4C55A 1GAFH 4GAFB 4MXVE 2NY0D 4Z7OE 5E9DD 5J1AA 3JTTA 3UBXA 4AG4H 1OY3B 3PWVA 3RVWC 4OZ4B 5HYSG 1BZ9A 3DX9B 3QUXC 2JJTC 1A8JH 3DARA 2XT1B 4O02L 5BRZB 4M6NH 1R3JB 1CT8B 4OI8A 1P84J 1A47A 4ZUSB 2R2HB 1S9XA 5ID0A 1FSKB 1K8IA 4ETQA 3NIFE 4P2OC 1QLRA 4PBVC 2HAZA 4GAJL 3HNSL 3DX8A 3HE6D 4PRIA 4H25B 2E9BA 5FO7B 3STLA 4GW5A 3TBVB 3QWRD 3F58L 1LE9B 5FKPB 1ZT4B 1JHTB 4DTGH 2VLLA 5E2UH 4KXZI 3NIDF 4ALAH 1N2RB 2QQQA 3MBEB 3IFLH 4JM4H 5IBLD 3PL6A 4ZOBA 3OKYA 4QHUA 4JY4B 4KKAC 4OZGA 4K3JL 3WLWD 5GGRY 1CZ8H 1IGTB 4ONGL 3O9WA 3U0PB 5HVHC 3UPRB 2IH1B 5E2TL 2MCPL 5I1LA 3PABB 4UINL 2JB5H 2ZCHL 4ZXBA 5KS9A 5CGMA 3WXVL 4Z6AT 1R5WB 1UYWH 5T3XH 3LB6D 3WIIL 3GEWB 3DMMA 1QFUH 4U0RC 1SJEB 3BD3A 1ZLSH 3U6RA 1VENA 1IARB 3AU1A 3CH8A 4CVWA 1NGQH 4HGWA 4LLVA 5CKGA 3HRZB 4D9QD 1QSVA 1U3HC 4LIQL 4EBQH 1UM5L 3ZKMD 2FYYA 4NRXA 4OF7A 4M7ZC 2FJGA 4UAOC 3HZYA 4NBYB 3VWKD 5CMAB 1TETL 2CDFB 3WHXB 4M1CD 4PG2A 3UBXI 1UKQA 1U8KA 2X9XA 3PWPB 3RNKA 1I3VA 1QYGL 4FFWD 5SWSA 4G8GA 2R29H 3SCMD 4JPVL 2DQTL 3OKLB 1A6ZB 4JFPB 3D25A 1MH5B 5CP7A 4K7FA 5D72L 3CFJB 1J87A 4JGUA 4QOKE 2BY0A 4MVBC 3KXFB 1U3ZA 1YEDA 5C0EA 4UTBL 5IFAL 1T7ZA 2Q6WA 2GITB 3PV7A 1DQQB 5KSVB 4TOYH 1ED3A 2XRAL 4YXLH 4YHKL 3HR5B 2WP3O 1TVHA 2YR3A 3PQYE 1DBJL 5C0IA 5DD0L 2BVYA 4OZIA 5L8JB 4RFNB 1KBGL 2CO6B 5F7FA 5T5FH 1GYAA 5EUOA 4KRMB 1NGXB 3BPLC 2AS5M 1S9VA 1AGBB 2VQUA 3R06B 2OR9H 4LK4A 5GGTH 4MAYA 5JW3L 3L3IB 4QXUL 2ZJSH 2G75B 4X9IA 4WFED 2PCPB 2CKBB 5D2NB 3MUHL 5TE4L 5GZNC 2MNUA 4HUKB 2P5EE 5C0AA 1KPUB 1MVFA 1CGVA 3BXNA 5SWZE 2YA0A 2CUMA 2ICWB 3IRPX 5D1ZC 3LKOA 4O51A 2ICWJ 3TYFB 1NCWH 2UZIH 5KSBB 3ZKQD 5ESAB 4LQ1A 2PUQT 3GSRB 5EORH 3RY6A 2JCCB 1J18A 4DGIH 4F7TB 3QRFM 3KYKH 4JDTH 5E6ZA 1I7ZA 2VDKL 4YHZH 1CE6A 1P1ZA 3AM8A 5HYQA 4HIHA 4ZD3L 2WWKO 4JFYA 1NCBL 2DMBA 3KJ6H 5HJ3A 4PB0H 3HG1B 1HZHH 2VLKA 2P48B 1M7IB 4NKOA 3SDCB 4TTGA 5SWQA 3RHWF 4KK8D 5KG9A 2ADFL 5HI5D 3P73A 3MV9A 3D3VD 3FCTA 4GW1A 2HJFA 5CSZA 3MACL 1JK8A 2VDML 5HGHB 3F7QA 1I1YB 1J0JA 3SQBA 2BJML 1ZSDB 2CUHA 2N1KA 3IGAB 5IR1B 4R2GC 4TNVF 4Q7DA 2AI0L 4BELD 2GW5A 3G6JA 3RY4A 3KLAB 5IKCA 1G6RH 1LK3L 3ZMRA 2PTTA 2PO6A 3KLSA 4LPYA 1LDPH 1NEUA 3CU7A 4ODVL 3QUYD 3QA3B 2CLVA 4P2CG 4IOFD 4YWGL 1FZOA 2X5PA 2F58H 4N8CH 2Z35A 2Y4SA 4L4VB 3UJJH 3WSQH 2DDQL 1WF5A 3I2CL 4AIXA 4EDWH 2YXFA 3TO4A 5HPOA 4PRAB 2NTSP 2FZ3A 3MRPB 3VRIB 3UJIH 3U1SL 4Z9KB 1P4LB 2QKIA 4JM2B 1IC4H 3RA7L 1MI5A 3T1FB 4HHAB 1BD2A 1UWGL 5JOFB 4I4WB 5CEYB 4DGYH 2OTUB 1IM9A 2WUBH 4IIQA 1RIVH 1MJ7H 1A9EA 2O61A 2NY4B 3L5WA 1JGLL 4OZGF 3HZKB 3L9RB 3NA9L 4JPWL 3TLRA 3VCLB 2E3VA 4LSVL 1FGVL 2OLDA 4XMKL 3LN4A 3QHFH 3GSXB 3HI1B 5DMKB 5D7SL 5I15L 5KS9F 2FGWH 2MSPA 3G6AA 4GKNB 3EGSB 1VHPA 4DZ8A 3DGGA 4F8QA 4MQXC 1RMFL 3PWPE 4ODSH 5EN2A 1J8HD 1FH5H 2WK2A 3D85D 3C09C 3D87B 4JZJC 3RWJB 3IT8D 5D6CB 4PJ5D 4Q6IC 3KXFE 2HRLA 4KROB 4O5LH 4NJ9H 3H7BB 1OCWL 1MCBA 5TJWK 4FFYL 3UPCA 4JO1H 1UACH 2BSSB 1RZ7L 4I77L 1J8KA 3C08H 1FZKB 3G9VA 4D0CB 4WO4C 5HVGB 5I8KL 5FO8A 5I1IH 4IRJD 1IGJA 2M1KA 3N50A 5FA3A 5JHDD 3BAEL 5DLML 1D5MA 1XMWA 5I74C 5KJRL 5F6HI 3KR3H 3WFEH 4MZ2A 3O6KL 3C8DA 3DROA 4NNXA 5AZEL 2R0ZL 5EZIH 1KTLA 1N59B 4BZ2H 5DMIH 1ND0B 5D2NE 3OXRA 4OFDA 5CCKL 5BS0A 5EBGA 2HFTA 2VC2H 4NQEE 2XTJB 5IMOA 3BP4A 3WIHL 2YEZB 2HVJA 4F7EB 2W0KA 3BZEB 5E2VH 3BE1L 4OZIF 5KSBE 3STZB 3FQXB 4UDUB 2JCCE 3JBG7 5L6YH 1A6AB 3RI5F 3B6SB 4LOUC 5EUOF 4DKDC 3Q6GH 4XNQA 3L3GB 2XZQH 3HG1E 3VFWA 4JLRB 1BAFH 1G7IB 5H2BA 1RK1A 4CADB 4MD4A 5JA8B 1I9RL 1EXUB 1L0YA 1CIUA 1OTSC 2P5WA 4Z76A 5IOPA 2GUOA 3JV5A 1N0XL 3ZT6A 4V2BA 2APFA 3TVMD 4DQOL 5CKAA 1CDHA 4XTRD 3S5LG 4Y4KC 4XNXH 4OUOA 3WE6A 3F6LA 2VXUH 1J5OH 4H88H 3CVHB 3SPVB 5J1AB 3JTTB 4Y1AA 2BHUA 1HHHB 3VFSB 2R2CA 1INQB 4MQTB 4J3SA 3EKCA 1DFBL 4KZEL 5CJ5A 2VN4A 2CRMA 5F9JA 3LEYH 4HIEA 4DN3L 3NIDE 1H0DA 5EA0H 4RMUA 2UWEA 1YUHB 3TBWA 2X1OA 3QIBA 1DE4A 2Q86A 3QUZB 2BVEA 1Y6NR 1ACYH 4G42A 4L4VE 3FB8B 4LDOB 4OD2B 2AEQL 4PJ8D 3GSOB 5L2KB 3L7EB 1HH9B 4FQIH 5LGJB 4FQ2L 2R2EB 2W0PA 1WZKA 4RSVA 3G6JF 4RGMC 4UIKH 1MHEB 4ZYKB 4NQSB 1DN0A 2HN7A 2VMFA 5JNYA 4Y5YB 4WIQA 4BSJA 4HLZG 5JIKA 5IGXL 1OGAA 4JRYB 3DUSB 4WTXA 2ICEA 1BLNA 2BCKA 4HWZA 4NCC1 5FOJA 3K8MA 5ICYA 1NCUA 5ICZB 4OZGB 5DDHA 4KMTL 4XI5D 5DQDH 1A7NL 4C56D 4QRUA 3SDAA 1HI6B 3KPNB 3A0OA 3CFBB 5JHLL 3JXAA 4G6FB 2VXTH 5B4MC 3QDJB 1FDLL 4CVZB 3FQRB 5GGRA 3MOQA 4OZFA 5CBAB 2EEAA 4YZFF 5C0CB 3LKNA 4M62H 2EEBA 4APQC 3DO7B 1KF9B 5DJAB 2GJ6D 3DBXA 4OI9A 5KW9H 3GMPA 2BXYA 3DMMB 3OJVC 4N1HB 1XF5B 1I8LC 3MBXH 2R1XA 3EDJA 4XCYA 3UTZB 4BQ8A 1MJUH 1C5DA 3T0EE 4EN3A 3BPOB 4R97C 4GRLB 4Y4HB 4NO5A 2DQUL 3SDXB 4PJGB 3S3JA 4GQ9L 1Y18A 1T1YB 4ODWB 1MEXH 3QT2A 4UDTB 1VDGA 1TZGH 4KZDL 3QIWD 4OCYH 3VI4F 4P3WA 3BX7C 1OP5H 2G5BB 2VISA 5SWSB 4U6XB 4PTTB 3OJDA 3MFFA 3D25B 2R56H 5CP7B 3N1FC 4K7FB 4LGSB 5DUBA 4Z0BH 3UMTA 1I3RA 2A6DA 2XTJE 4CU7A 3OG4B 1XF2B 4OCWH 3H9SA 1YN7A 2P8LB 2YUVA 4JB9H 2FX9H 5CD5C 1DVFC 5GQBA 2VYRE 3OGOE 4LP4A 1G6VK 3HNTL 3Q48A 3BUTA 4TUKH 1RJYA 1QR4A 3HMWL 4HWUA 1Q94A 4MS8C 4Z7VA 4UMGA 4I0KA 3ARGD 4XCCH 1HINH 1L4IA 1I8KA 3T09A 2Y07L 4NBZB 2BC4B 3CAFA 4H20L 3NCCB 2E9IA 3QFJB 4NHUB 4Z7QF 1T03L 4U1JA 5E2WL 4XC1L 3FB6A 4K3EH 1MQKL 2V9QA 6FABL 1UB6A 3EJYD 2NY1D 2YBRA 1QRKA 3P9LA 4YDVA 4ACPA 5IV2B 3B2UD 5JZ7C 5JXAH 3VFMB 5HPMA 3QNZA 4M8QA 3C6LD 3BQUA 4OLUH 3TPUB 4JFZH 3MRLB 3RJDA 1FLTX 2VL5B 4OCXH 1YNKH 2A77H 3SGDI 4QY8A 2SEBB 2FEEL 4B41A 2X1QA 2ITCA 2YUXA 3EYFB 4H26A 1TMCB 4FNLL 4YC2C 2YA2A 1OSPL 3FCTB 1MSPA 1A1NB 2J12B 5CSZB 1JK8B 5MP6H 3JSSA 5L2KE 1R3IL 3LKRA 3F8UB 2F8OA 4PRIE 1PZ5A 1I1AA 3MA9H 3U0TA 1LO5B 5KVGH 1GPOH 1RZGA 1CDYA 4YDKH 4L8BB 3QEQD 1M7DB 3RL1A 4I9WD 1SYVA 4XGZB 5GJSH 5HHOD 2PO6B 2UWEF 4BZ1L 1RUPL 5EC2B 4KUCD 2VDQL 1YQVL 4KKNA 5ADPH 1OTTD 4YHYC 3QDGA 3MUY1 2VLME 1FZOB 5DUPL 3UYRL 4UTAH 4QGTA 4OZGE 3SJVD 4HUWA 1KJMA 1MHCA 3U48A 4P2YA 1PSKL 1FFPA 4HT1H 3ME0A 1LILA 1RURL 5F71A 1ZLVH 1AXSA 2OQJA 3OKMA 1AH1A 2QADC 2GTWB 4H1LG 4GLRI 1T6WA 4Z77A 2CQVA 3QFDA 4O4YL 3BEVA 4RNRA 2VQ1B 1A9EB 4JJ5A 1FAKT 3AMLA 2EIDA 4LSTL 5K9QI 5BQ7A 1YMMD 4P9MH 3L95B 5CS7A 5D71L 3SDXE 4PJGE 3C6SA 4N9GA 3FO1B 1MFBH 4KK5C 3MV7A 4TTDD 5ID1A 1G7MA 4LASL 1NFDA 3ULVC 2YD2A 4P3DA 4ZAKC 1B0GB 1G7HA 3MOAH 2GSGB 5KBNC 1C1EH 5AZ2L 5K9OB 5SWSE 4G8GE 1DQML 2EDJA 2IPKB 4KMQA 3EZ8A 4AENB 4LLWB 2VLRB 3BJLA 3MV8A 3GNMH 4HXBH 3RVVD 5FUOH 3VFNA 1JP5A 1R24B 3TO2B 3BGMA 5F9DC 4M6ML 5T1LB 3QQ3A 4JRXB 4KJPD 5TF1H 2X41A 4NIKB 1CXFA 4OZIE 5DJCA 1IQDA 4P3CH 5I1JH 1XGYH 2WIIA 4RA0C 1CU4H 4PLJC 1ADQL 5EUOE 1QG3A 4YXKH 3NGBB 1KTDB 3NFPB 3KPLB 1PLGL 4YHNA 3DROB 3PE9A 3OBAA 4M7LT 4QNPF 3V8CA 3QFJE 3CZJA 1EAPA 2AJUH 1VB9A 1JGVH 5CZXC 1ZVHA 3IFOA 1U9KA 5IQ7L 1MIEH 2IG2L 2AABH 2I27N 3HS0A 1HKFA 5IB1A 2W65B 1HWGB 2BRRH 4L3ED 4PY7B 3LHPL 5LKNA 2BVOA 3CLEL 1KB5L 2AEPH 2GCYA 4J4PC 4Q0XL 4Z7VF 2RHEA 1IFHH 1SEQH 3T8XA 4GW4A 2QR0A 2DI8A 1WIPA 3VD3A 3TZVD 5H2BB 4MD4B 3O8XA 4LBEB 2UUDH 1F6LL 3VXMB 2R39A 2FWOA 2VN7A 3MV9E 4Q6IA 2EH8L 5IK3A 1IAOB 4O2FB 4ZUTA 3FB5B 1O5DT 3DRQB 5H37H 5EU6B 1W0VA 3UDWC 4HEME 3Q3GB 1EHAA 5C2BL 3NA4A 3H3PL 4QO1A 2EDTA 4CVXA 4X5LA 5A2KH 4G8EA 1J1PL 5I8OH 3HC3L 3VRLF 2Q3ZA 2J88L 2H1PH 3IETA 1VERA 4PGJA 4IJ3B 3TBWB 1O7SA 4L4JA 4MB3A 3V6ZB 2DBLH 3NMEA 5FYLH 4U1SA 1J0KA 2EDEA 4OZFH 1PX4A 4LEXL 1T04A 1ZT7B 3K4DA 3V7MA 5L2JB 5IMMA 3OQ3B 2FL5B 4NN5C 4DCQA 1AGDA 4LPWA 4V1DB 1GC1C 1BF8A 4N0CD 2WV3A 3CXHK 1JRHL 3QI9C 2BOCB 3J7HA 1J12A 5LGHH 3C8KA 1MAMH 1S7QA 3MC0A 3ZZ1A 3TBSA 1OGAB 5I17A 3FFDA 4W81A 2ICEB 5C9JA 5DRZB 1MCRA 5L88H 1I4FA 1A6TA 1N0LA 2X7LB 3MFGB 5HBBA 1NBYA 3BIKB 4J6RL 1JYVA 1A2YA 1I7UA 1OAKL 5DURB 4YBLB 5DD6B 1RQ5A 1PDKA 4ZQKA 2E9JA 1NGZA 1LO2H 1UXWA 5A16A 2YPLA 4K8RC 2AXGB 3ARZA 4JY6B 3VGFA 4WY7L 5GJTH 3DBXB 1KXQE 2OMBA 1HYRC 5L8LB 4M9OA 2VLRE 4OGXL 3QUXB 1GGCL 3RGVC 5B3JF 3V6FA 2XKNB 1QRNB 4DVBA 4MDJA 1MCFA 2BY3A 2NZ9D 4U1IB 3ZYIA 1MREL 3G9AB 5HYJA 5JORA 4I8DA 5DEZA 4JRXE 3MYZA 4CW1A 5IFHL 4MQ7A 4NO5B 4GLRH 4TSAL 2D31A 3OKEB 3HNVL 4JPIA 4S1DC 2WBWB 1NFDF 3VH8B 4P2OB 2VDNL 4JY5H 2XFXB 2XA3A 4U1NA 1T89C 2NXZD 5FECA 5E7FA 1T66D 2VISB 4UT7L 3CFKB 1U2CA 3GMNA 1P4BH 1DTUA 4XB8A 5DUBB 5FM8A 5BS0E 2A6DB 3JWDC 1OP3K 2RFXA 4HIXL 4POZD 5CIPH 2J5LC 1GGBL 1BM3L 3H9SB 2VO5A 1RD6A 1OP9A 4DVRH 1TENA 1YN7B 5E94A 3WHE0 3WJJA 3MCLH 2DLIA 4HBCH 1ORSA 1AO7B 1A6WH 2G60H 2CR6A 3MRRA 1HN1A 1LWRA 3REVA 5I1DA 5D7KE 3VFUA 3B9KD 4JANB 4CUCA 3O2VH 5CGYC 2MHAA 2A9NL 1HE7A 5HVHB 3LQZA 5F7NC 1UEYA 3TP4A 2X4SB 1J0IA 5AEAA 4TQEH 2WSKA 1B3JA 4OM0H 2QSTA 3SKOB 5EFIB 2V2XB 4PRDB 3VXME 3KPSD 4QOKD 2BMKB 3M07A 1FE8L 1CDJA 1XGRB 3UAJD 1G0DA 4BSVB 4EOWH 4FXKA 3T2QA 2YBRB 3T77B 4HG4K 3PQYD 1U3HB 3ARQA 4AQOA 2CPCA 2XXCB 4M7ZB 5DO2D 5GZOD 1J1OL 4EVNA 4P4KC 4U6VL 4UAOB 1E4XL 1UM6L 1W72B 2LVCA 4QRTB 4NQXB 2EDQA 3MLWL 3C5SB 2AK4A 5IEHA 3TH3T 2UVEA 3T65B 4MJIB 2GAZA 4QXTA 1QA9B 3H9YA 4H26B 4KDTC 3QYCA 5DJDB 5F6IC 2P5ED 4PJXB 3WKML 1KCRL 1WBXA 1HCFX 2EXWD 1WBZA 2NX5D 4A6YA 5SWZD 4OKDA 1NGPL 3QO1A 3FOLA 3R0NA 4LCIH 1NUDA 1PZ5B 5BV7L 1CGTA 1FIGL 2JJUA 5JW4Q 3BD5A 3ZYOA 4I0PD 1N64L 1JN6A 5IHUH 1C5BH 4OQTA 1AQKL 2VE6A 5J6GA 5EIIA 3BPLB 4Y16D 1OGAE 5FHAL 2ATPB 1KN4L 3BWAB 3MREA 1A7PL 2OTWB 1T5WA 5DEFA 3NCBB 2IALA 5I18L 1QNZH 2IFFH 3ARDC 1JHLL 1KJMB 3IS0X 2ED7A 1AD0A 2WM0A 1PKQB 3IDMB 4NM8L 3GKWH 2VDOL 5EOQH 5TE6L 4GG8A 4XVSL 4PGCA 5JR1L 3MPCA 3O81A 3UO1H 5D1ZB 1KCSL 5MEPA 1F11B 2I26N 3HTLX 2HFGL 1X4XA 2X70A 4WFHE 3BKML 5K9KB 3AFLA 4XHJD 4PD4J 4JG1H 3I6GA 1K4CB 4XC3H 3VI3F 3BEVB 5E08L 4GG6A 3FQUB 1AIFA 5GGUA 5GS2H 4S2SA 3OR7B 1AKJA 1CN4A 1H3PH 4LKCA 4PJEB 4LLAA 5HI4C 4K7PY 4R0LC 5ID1B 2HKHH 3MV7B 1G7MB 3MRJA 3IDIB 5IB2A 3KLHC 3NFNA 4FFVC 1D5XB 1G7HB 1L9NA 2LVEA 4F80A 4WI9A 4R2GB 2Q8AL 3PJSA 2C7UA 1RIHH 3BJ91 1ZHBA 1C08B 3T3MF 3U9PL 1BJ1J 4NQVA 2ZUVA 5EU5A 2BNQA 3WFCH 4G43B 5KVFH 3D2UD 3H9SE 4W4OA 3SKMA 2ZUQC 3RDTC 2WBJA 3UXFA 3MCG1 3FMGH 3S37L 3E6FB 5HHNB 1CBVH 3MLZH 3RGHA 5ADOH 4NWUL 5EC1A 3PXHA 1P2CA 2GKIA 4Z7VE 3QXVA 4XPAH 2MFNA 2VAAA 2V17L 4HEPG 2QHRL 4GAGH 4LCYA 4R8WL 5D7JD 3KXFD 3VWJD 4ZFZA 1JPFB 3KPRA 1NC2A 2AJSL 5F44A 1IBGL 5D1QC 1GGIH 3DI2B 5DZNA 2FIRT 4NT6B 4EUPB 3OZ9L 2EXYD 2C5DC 3L7FA 3N1QC 3RKPA 3L3OB 2Z93A 1WBYA 5DGQA 3UP1A 1ZHNA 3P30H 3T8XB 3TJHD 4K94C 5I8CA 4X98A 4GW4B 3Q5YA 4ZAKA 3LKQA 3ULUL 4PRPA 4KKLD 1EO8L 1G9ML 4JO3H 2ZSVA 3C09B 4JZJB 3VRLE 1N3NA 5GGVY 4MJIE 5B38A 2GIYA 4B5EA 2KH2B 3EJZD 4NQED 2FWOB 3TH4T 5C0RL 4PJXE 2QSCL 5BMFL 4NGHH 4RWYL 1NAMA 1UJTA 1XF3A 2IQAA 4PJBA 5LBSL 5DJ8B 1NBZB 2DQCH 4WO4B 5ALBL 3ZL4H 4S1SH 3BW9B 3G5XB 3P77A 4O9HH 5CZKA 1HEZA 2Q20A 3B4NA 4OLWH 1YC8A 1T7WA 3DURA 4J12A 3KWWB 5I74B 4KWUA 3RNQA 3SE9H 2FJFA 4DWHA 5FKAB 3DVIA 1VEPA 2D0FA 3IETB 4H5SB 3QDGE 2RJMA 5EZLA 3IDXH 4G7VH 4EQ3A 4P5KB 4M7LH 5FO9B 5FEBA 1FYTA 2YSSA 1RZJC 1BVZA 1F90H 1AC0A 4Z95H 4DCQB 3MRCB 1UCBL 2V2TA 2DKMA 4CL7A 5E8OB 4MD5B 3O6LH 3O6MH 5JXEC 4QHNA 2CIIA 4ODHH 3BH8B 4Y4FB 3AREA 1YZZA 5C08D 4FQ1L 2HFFB 2FBJH 2V5MA 1KJ2B 5I1GH 2F54A 1GSMA 2ZNWA 2IF7A 3CC5A 4X6BB 1LD9A 4R96B 4D0DA 4LSPL 4JHWL 3TNNA 4I1NB 5I17B 1Q9WA 5B3JE 1QSZA 2OTPA 2DTSA 3TJEH 3RRQA 2R1WA 5DXWA 5F89B 1AGCA 4FFZL 7FABH 4JCMA 4PJEE 1A6TB 3OHXA 4L4VD 3HAEG 2QQLL 1NBYB 1E4WL 2VR5A 2ZKHL 4ERSH 3MV7E 3CJJA 2ADJA 4CDHA 1LE5B 5FYJE 5KN5A 1IGIL 1NFDE 4Y4KB 1N5YL 3VXRA 1EVUA 4AL8H 4YHLH 2F53B 1IKFL 3AMKA 4P23C 4JM2D 2A2QT 1AJ7H 4WUUA 1ZT1B 5DMJB 2GT9B 4MJ2A 2EZ0D 1UG9A 3MRDA 1XR8A 4MA7H 3FRUA 2HFEA 4DVBB 4MDJB 4GG6F 5IVOA 3EYOA 1X5JA 1R5IB 2G5RA 4XBEH 1OTUC 1M05A 1B0RA 3MR9B 2WQ8A 2ADIA 4JKPL 2IFGA 3HI5L 4NO3A 1D5BA 4RMTA 2LAAA 2NLJA 4AEHH 3V4VH 3VXUB 1BVKA 4KVCL 4U1NB 1TPXC 3H8NA 4LCUA 4HS3B 5FECB 2NZIA 4RGMB 4E5XA 1AR1C 5HI3C 5GSRA 3ARVA 3PHSA 4HCRL 4Z7UB 3VXOA 4KROD 1KB9K 1EA9C 2YUWA 2NQCA 5FXCH 1IGML 5JDSA 3T0ED 1QO3A 2X05A 3REVB 2IPUG 2BVPB 4MX7A 5FCUL 3NTCH 4OTXL 1IEBB 2YD9A 5CJOL 1YDPA 1MNUL 3OR6B 3IKCA 5CZVL 1U8JB 1CICA 4ZUWB 1F5WA 2BFVL 4U2ZA 1YYML 4ZFGL 3BSZL 3AROA 1R3HB 4U6YA 2H32B 1EHNA 1SYSA 3O11A 1TNNA 4APQB 4KK6D 1NUFA 1PFCA 3P3YA 4A6YH 3MUZ1 1GRWA 4GXVL 3VRJA 1HILA 1GOGA 4KI1A 1LO4H 4M5YL 1A3LH 4NP4H 3RWIA 2A9ML 4UU9A 1LEGB 1SJHB 5EO1A 1JMZA 1JPGA 4MNQA 4R97B 1BQHA 1GHFH 4AM0B 3BWUC 1FV1A 4OQTH 1KB9J 1C7SA 1S3KL 2AXHA 5IMKB 4P2QA 4FZ8H 4JZNA 4FMFA 4POYA 5IG7B 2AGJH 1WK0A 4Y5XB 1T89A 5ACZA 2AK4B 4RFEB 3TN0A 4IDJL 2VLJB 3EYVA 1TJIH 3FONB 3RX8A 1EGJL 4JZOA 4P46C 4PJBF 4FABL 3O4LA 3O2WL 1OARL 4DZBB 3FT4A 8FABB 1AHWC 1DVFB 2AEIT 5I1HH 3WIHA 5IW6B 2A83A 1QACA 3IAGC 3D18A 3P4OB 4LHUB 2VE6B 5EIIB 3OKOA 4CGTA 4O02H 1I3GH 3IDJA 2Z8VC 3CUPB 4RQQB 5DQ9A 4FHBD 1YECH 2LV4A 2ERJC 5DEFB 3VI3E 3QUZD 3PNWA 2D7MA 5CBEA 1FCCA 3V4PL 2YZ1A 4HZLA 1AD0B 4PRHA 3VFVA 4Z5RA 1TCRA 1EEZA 1XGUB 3ROLA 4QHLB 1NDMA 4NPYA 1K85A 1ZHLA 1T2QL 5TDOB 5L2KD 4GAJH 3HNSH 4PRID 1EV2E 3MJ9L 2F53E 4YDJB 4EZMA 2R0WH 5EZOL 2R23A 2AKRB 3F58H 3GB7A 3PHQB 3ILPA 1G6RB 5HHQA 4OZHB 2YMXL 3CK0H 4MNGA 1VGEH 2ED8A 4P49A 4BUHA 4OAWB 4N5ED 3NZHH 3PL6D 3VFRA 2VLMD 2EE3A 2YD3A 5GGUB 3AXLB 4S2SB 1DBKL 3VXTB 4K3JH 3SO5A 3VXSA 3K2UH 4YC2B 4ONGH 3O9WD 3WO3B 3MRJB 4G6FD 3VXUE 2Z31A 4UINH 4ZXBD 1QSEB 1ZKAA 4L29A 3MNVB 3MOBH 5HGBB 5GS1C 3H3BC 4B7LA 3BEWA 3DMMD 3WIIH 1S9KC 5D5MA 1MCPL 1FL6A 3QO0A 4FXGA 3VGDA 4EXKA 1BQUA 3EO0A 1OAXL 2HTLC 4NZUH 5ISZB 2Q8BL 2H9GB 4YHYB 3NAAH 1MLCB 1WICA 4GRLD 1NSNH 3ARDA 1UM5H 5HHVH 3C60B 4I3RH 1OSZA 3ZTJG 1B0WA 5BO1L 2B1AL 1PJ9A 1TETH 2VDRL 2Y23A 3HE7C 3K46A 3L1OH 5KSUB 4LSQL 4Q9CA 4UIMB 2CRZA 2VAAB 4QXGL 4ZDHA 5AG9A 1Z9SA 1QYGH 4D9LL 5SWSD 4G8GD 1QP1A 2QADB 4F37K 1FL5B 3RIFK 1GGTA 3W0WA 4D0BB 4XP1H 1NAMH 3MZGB 5D72H 3RIAK 1S7RB 3H7LA 3I02A 4G9DA 1B90A 3VXQB 4OFYA 1KV3A 2C4FU 2XRAH 4ONHA 4C83A 2V9TA 5JOEA 3GSNA 1U95A 1WT5C 5DD0H 1ZK9A 4PJIB 4IRZH 5A1AA 5DHYA 1U8LA 3NCJL 3X3FL 4P59L 1J10A 5I8CB 4PYHA 2EYRA 1ZA6A 1A1OA 4G6AC 2MPAH 3GMRB 4WVRA 4LLYB 4MAYD 2AK4E 4QXUH 1FFOB 2ARWA 1OGTA 4ZNEA 2VLJE 3QFJD 4YDIH 2H41A 4IS6A 5TE4H 1GAFL 4MDIB 4TVPH 4RGOH 1U93B 5I1KH 5A40E 2R8SL 3ISWA 4PTUA 4LRNH 3SKNA 4E42A 4AG4L 2D3VA 1OF2A 1V3KA 4XCNB 3K2MC 1KFAH 5AG8A 1OPGL 1IAKB 4XP6L 1HEZB 2VDKH 2DRUA 3REWA 3OAZH 1T20A 3WNOA 4ZD3H 1NCBH 5IQ9A 2E8YA 2RB8A 5I66A 3PGDA 4HFUH 4PB9L 2NY2D 4HPYL 1MY7A 1YEGL 4FG6D 5EZLB 5TQ2L 5C8JA 1LEKB 2ADFH 1MCEA 3LAFA 3MV9D 4N8VG 4HKJB 3FQNA 4Z7WA 3MLSH 3SGJC 1A7OH 1FYTB 3MACH 2VDMH 3OWEA 4KVNL 1Z6JT 3QZWG 5DFVD 1RJLA 3QWRA 2BJMH 3ES6B 3QWOA 4JJHA 1I1FB 4QHNB 4DTGL 1JI1A 4AT6B 2L7JA 2F54B 1X5GA 3IFLL 4MA3A 1H8NA 1EVTC 2PO6D 1I7TA 3IJYB 4ODVH 4Q97A 1S7XA 2ESVB 3BGFC 4AK1A 3C5ZC 1CZ8L 4YWGH 1P69B 2CDGB 2K7QA 4ZO8A 3RWDA 4NQUA 5FGBC 5T1KA 2PYEB 5JPMA 3WN5C 2BNRA 1AGEB 3QNYA 4RFOL 3TO4D 5J6HB 2W0LA 2C9AA 3C2AL 1F00I 5T3XL 2J6EA 3VXRB 2WINA 1MCDA 1QSEE 1C8PA 4ZODA 4OCSH 3BT2L 5JLZA 3BIAX 2R0LL 1ZLSL 3UPAA 4NRYB 2N7AA 3MLXH 3RA7H 1MI5D 2BNQE 3MRHB 4QCIA 1WV7T 1U3YA 2ZG2A 4MHHI 1UWGH 4UQ3B 4WHCA 1CFTB 4F2MA 3QIUC 5ISZE 2CLRA 2V7HB 4HLJA 1U58B 3NA9H 1OP5K 3P9MA 5DMGC 4GKOA 1DDHA 2FECL 2CKBL 4XXDA 4LSVH 5J9PA 3WYRA 4Z78B 3FZUC 2X4NA 4NN5B 5D7SH 2R29L 3GBLA 3CFDB 1MHHB 3X11A 4HIIA 5HGGS 3EHBC 1RMFH 43CAA 5EPMB 4LLMB 5F7UA 3MRBA 2OSLA 1FFNA 5IVZB 5I76A 5D5MF 3QI9B 4M61B 3OL2A 5GSRB 2VLRD 3O45B 1HH6A 4TOYL 1VACA 4PGEA 3KPRE 3T4YB 1Q9KA 1J7VR 1RZ7H 5LWYL 4I77H 3GMOA 1QQDA 5DGRA 5I8KH 5I71C 2PYFB 5C0NC 4X9GA 4XP4L 5DLMH 2C3XA 3SE4A 3ULVE 4LVNC 4GKSB 1FVCB 2E27L 4U6YB 3O6KH 4PRPE 5AZEH 4P23A 1NEZG 3GSUB 5GSVA 1JWUB 2J8UB 4CMMB 5HYEA 4NWTH 5BS0D 5F9WC 5MENA 1C16B 4WGVB 4JFOA 3WUWA 2NMSA 3SKUD 3RGVB 3WIHH 3PWLA 3MXWL 3KPTA 4P5MB 4PJBE 2WUCH 4GBXA 5CSGA 5C0FA 5EO1B 3TBYB 1VEMA 3C5JB 2FLBT 3D48R 4WI7A 3BE1H 4NKMB 5D7KD 4YHZL 3ARBC 4BH8B 2FEDC 3SN6N 1L6ZA 5MI0C 3KJ6L 4IDLA 4LLQA 4PB0L 1HZHL 4G8IA 1FVDA 4LCWA 1BF2A 4JZNB 2LFGA 4JAMA 4AH2B 4L3CA 2FO1A 2HTKD 2HJKA 5A3IC 1IC5L 3VXMD 3FO9B 1JJUA 1D6EA 3OMZA 4MD0B 1AE6H 2J5LB 4JO4H 1FYTE 3N0PB 1EMTH 1W0WA 5DRNB 1XH3A 3S35L 4LLDA 1NJ9B 4QWWC 5B39G 1JWMB 5ITFB 2EDOA 5J12C 1G7LB 4JN2A 4Y1AD 4WEBH 3DVFA 4WU7A 2OP4H 3W11C 1HWHB 3VFPA 4C57C 3QUYA 4UV7H 3HPJA 3QEGL 5IBUG 2BY1A 2F54E 4DJMA 5IW1B 3DETD 2A6JA 5C0GA 4F33A 5EG6C 4TVSa 1QSFB 2F58L 4DN3H 1PQZA 2ESVE 1I85C 3UJJL 3WSQL 1P7KB 3QIBD 4EDWL 1UH4A 2Y5TB 5F7HA 4UQ2B 4LCCC 2EKJA 2I60L 4Z7WF 1QBMH 2PYEE 2Z91A 4L8SC 4XBPA 2AEQH 1NDMB 1MELA 3VXRE 4L8DB 5E6IA 2Y1VA 3KS0H 4G80A 3D0VB 2X6MA 2DYPB 3FT2A 1TXKA 1D9KC 5ELIA 3GSVB 3OAUL 2WUBL 4BH7B 1RIVL 3BDBA 4P4KB 2ZUTA 3ILPB 5HHQB 4BQ9A 2D03L 5LGKA 1F4AA 5I75C 1H5BA 1OGAD 1XAUA 2OJZH 5IGXH 1GCFA 4YBQC 4FQPA 2X4TB 3VFRB 2AJYH 3QHFL 4J8RA 2FGWL 3T0BA 5F6IB 1SBBA 3SDAD 1O7VA 2DWEA 3OXSB 1J8HA 1FH5L 5E5MB 3OB0H 1FDLH 3NPZB 1AHWA 1QFOA 3ZO0A 3S9DB 4YHIA 1IVLA 3NACH 2C4FT 1YY8A 2GJZA 3RVWD 4YIQB 4WFHD 5DI8B 4YQXL 3QUXD 2UYLB 1UACL 3FRPG 5D5MB 1MOEA 3GSNH 3GM0A 3QDMA 3HUJB 3D69A 4OFVA 3FJTA 3N85L 1RZIA 2OL3B 4EN3D 4IMLB 3WLBB 3SE8L 4WW2A 3ARDB 1J11A 1S78D 2DQUH 3KR3L 3WFEL 3MLUH 4UI2A 1ZWIA 5EZIL 3VGGA 5T5NF 4LEOB 1I9JL 2R1YA 2W9EH 4CNIB 5DMIL 4OUUA 2IC2A 4UILH 1A02N 4WENB 2VC2L 4GRWF 4KK9D 3DSNA 3TT1L 2WBKA 5GGVH 5DEGB 3W5MA 3I02B 2HT2C 5CD3A 5E2VL 5IBTL 4OFIA 5KZCB 3H9SD 4G9DB 5DZOA 2IBBA 3LPGA 3LV3A 4ISVA 4MNQE 3IJSB 3EO9L 3BFOA 3KPPA 1S9YB 1MLBB 4PR5B 1A4KA 4PBWD 5D4QA 4Y2OA 3HNTH 4R0LB 1BAFL 5INDA 1U8LB 3HMWH 2YN5A 4K9EH 1A7BA 5F96L 2EYRB 1A1OB 3WNNA 2Y07H 1SM3L 4ONFL 1I9IH 2VSDA 3DUHA 1RFDL 2MCG1 4QYOA 4Z0XA 5C6WH 3UTPE 5IM7A 1T03H 4IS6B 5E2WH 4XC1H 4IBLT 4P9HC 4DFHA 4H88L 2ZUQB 3RDTB 6FABH 2L4OA 4Q9RL 3O0RL 5IP4A 4JFEB 5TH2B 3WNKA 1U3HD 4WCYH 4I3GA 4PJ7A 1L6XA 3LN5B 3QG7H 1OL0A 4F58H 3CU1A 2MMXA 1A5FL 1SEBA 1JTOA 3S36H 1T4KB 5H94A 4POUB 2D4DA 3HE7A 4NO0A 1QSFE 2ZOLA 4R4BB 1LO3L 5GIRA 1P7QB 5L8KB 1ACYL 5CJXA 4HAFA 1NCDL 2E6QA 3LZFL 2MTPA 2QSVA 4IRSC 5EBMB 4PJ8A 3BGAA 4O2EA 4MVBD 1OAZH 3KG5A 4ELKA 3IFNL 3UROR 5D1QB 2MOVA 3QWOB 4PJ9C 1FNSL 3WXWH 1I1AD 4G8FA 1INDL 4P4RB 3RUGB 1RZ8A 2YKLH 5DRXB 3GMMB 4PV8A 4OB5H 4NN6C 4X0KA 3ZHDA 4BZ1H 3OG6B 5DQDL 2VDQH 1YQVH 3SE3C 3QDGD 5F1KC 3SDDC 3U82B 3VXNA 4DUVA 5KANI 2VXTL 3CPLB 3K81A 1F3JB 1SJVA 3VXSE 5T1KB 5J3HC 4TRPL 1XZ0B 3E0GA 4M62L 4BFIB 1RURH 1Z0MA 3DV4B 4HKBA 4GRWH 5GGSY 3ZT5A 4M9PA 4NDMB 5D1ZD 5GRVK 1BOGB 4ZPVB 5HYIA 3MRKB 2XWTA 3MCKA 3KLDA 4KUZL 3P9WB 1RZKC 1MJUL 5D5ME 5T33H 3HUJE 2AXFA 4HUUA 3F6IA 1LP9B 4O4YH 4WHDA 5DK2A 1MEXL 4YPJA 2ZCKL 3ARRA 1WC7B 1TZGL 1ZV5A 4LSTH 2IANA 5D71H 2AAVA 4CBPA 3INUH 3F5WB 2K9UA 4NRZA 4YGVA 3MV7D 2PXYC 3SGJA 5E2JA 3GJEA 3HLAB 5DJ0B 3QAZC 4LASH 3G5VB 5FYJD 4QT5A 1KJ3H 5DHVB 1NGYA 4PJAB 5IVXB 43CAB 4HIJA 4R2GD 4F9LC 3E6HA 5AZ2H 1D6VL 1DQMH 2ZNXA 1FFNB 1FRGH 5CEXA 2OJEA 1ONQB 3MV8D 3FHQA 4PGEB 4JB9L 2FX9L 2WIMA 1T0NB 1FVEA 4ZFFB 2LTQC 4WW2F 3BVNB 1CLYH 4M6MH 1T3FA 3PWNA 5TDNA 5DK0B 4EI6B 2H8PB 4HJGA 2APXA 4TULL 3PP3K 1HINL 5H8DA 2P24A 3CVIL 5GS2D 1BX2B 2DJUA 2YRZA 4YNYB 4MJ5B 2ORBL 2XN9B 1EIBA 1MWAA 4K3EL 5IB4A 5CIPB 4M8VA 1BIIA 5IMLB 2XXMB 2YD1A 5IQ7H 2IG2H 3QIUA 5IVNA 3WFBL 5HYSB 1MJ8H 1S7TA 4JFEE 2ENYA 4NZTL 5AYUH 1UC6A 5I6XC 3RZCC 3C6LA 3PDOA 3LHPH 1FGNH 3CLEH 1UM4H 3MBEC 1N6QH 1JF1A 4NOBA 4K07A 4JAMB 1TZIA 1YNKL 2XOTA 3MUJA 3HZVB 4MQXD 1V3MA 1TPXB 4HUVA 1WVZA 4QTHB 3HAEH 1OB1A 1KLFA 1B4JL 2ARJA 3G08B 4TPRH 1HKLH 1CFVH 3QCVH 2CSPA 3I6KA 5IIEB 2R4SL 1FFRA 3MA9L 4PJ7F 5KVGL 3QPXH 1GPOL 4F7PA 2LU4A 3IFPB 3HC0B 3QEQA 3WS6C 1CFSB 4X7FC 3RUGE 3DI3B 2WANA 4KDVA 1J05A 5C2BH 3H3PH 4WW1A 1II4E 2P8MA 5C0GB 1J1PH 4PLOB 4UTAL 3F7YA 2J88H 3B8SA 3H42L 3CDGB 2DJSA 4HT1L 2B2XL 3QEHA 5FOBA 1G7JA 5ANMA 5GRWA 1NKRA 4LEXH 4LLUB 2BNRE 4Y5VC 5EZJB 4AQ1B 1CIDA 3LS4H 3I6LE 1J0YA 1SMOA 1YNTB 1QBLL 5T1MB 2PW1A 4HK3J 1JRHH 1Y0LB 2C3VB 5ERWA 4NKQB 3TIEA 4PJCA 1JZ8A 1ZLUK 4DOHB 4OF0A 2DIAA 3GMLA 1DCLA 1LP9E 2EE6A 3P4LA 4TSCL 1A7QH 2HT4D 4HWBA 1AD9A 2X4UA 3LQMA 1RVFL 1S7UB 3MOAL 4P46B 1OAKH 3WIFA 4NQDB 1ZVSA 4FTVB 2YPVL 1F2QA 5FGCB 2W60A 1AHWB 2AQ3A 5IVXE 2YPLD 4YHIB 2NY0C 1K5NB 4WY7H 1WWAX 2P47B 2RGSA 5FUOL 1CL7I 4OGXH 3IAQA 2XACC 5CP3A 2FO4A 2HP4A 1EUUA 3HC4L 3KHQA 5DJXB 4E41B 5HYJD 5I1JL 4NJAL 1XGYL 3U9UA 2ERJB 3CX5K 5ITBH 3MRMB 3EOBB 4LCCA 5IFHH 1HYSC 3QH3A 4PJHB 4XZUA 5MEQA 2HVKA 1RJZA 3V7AE 4EI5C 2P42B 2BVQA 2VDNH 5FF6A 4A2MA 3SDCC 3VXUD 4U3CA 5F72S 4UUJA 1QVOA 3V5KB 4OUUB 3H9ZA 1IRAY 3F65A 3HE6C 5KTEH 2AJUL 2XN9E 3MRNB 5HGDA 4UT7H 2ITDB 2AABL 5BW7A 5MENE 3M8OL 5C07A 3LN9A 4MCYB 1BM3H 3NN8B 4KRNA 1X4YA 1DUYA 5HHPB 2IADB 2FSEB 2AEPL 3DTXA 1KEML 3DOSA 1IFHL 2KZWA 4HS6B 4KI5F 5FB8B 3WLWC 3UX9B 4W6WB 1NBQA 2A9NH 3QRGH 4LCWE 1JYWA 4F7CA 4JO2H 3TZVA 4QHKJ 5B4MD 5I1CL 4LNRA 4L9LA 1UXSB 4LARL 5GS1B 3LB6C 4QYOB 1VKXA 1GIGL 4IMKA 1HHIB 5DVOA 4M1DL 1FE8H 4NOFA 3K80A 4JQVC 3T4AA 5AYQA 4WI4A 4HJJL 1F3DH 4YFLI 2CK2A 5FUZL 3LMJL 1K3IA 1XIWA 1YC7A 1XCQB 5FAAA 1HSAB 4LNVA 3ZKMC 5I8OL 2C1PA 1E4XH 3HE7B 2Z4QA 1KPVB 1XCTA 3MGAA 2AK4D 1PX3A 1I1CA 3N06B 3VGEA 1UWXH 4XH2A 4YAQA 3JTSB 1HXYB 4FFWC 4ODUB 4QHMB 2VLJD 1ZTXL 2WW8A 4LP5A 3O3EA 4RIRA 2HH0L 1D5ZA 4GRMA 3DXAB 5EOCH 2GK0B 1DL7H 3WKMH 4D8PB 1KCRH 4JFXA 1N4XH 5IJKA 1EHXA 4CN1A 3UBXG 1NGPH 1DVFD 2OXHA 3TPKA 2EYSA 1KLGB 1MAML 4XXCC 3L3JB 1U8QB 1FIGH 5HVWA 1HQRA 4KUCF 1EDQA 4X8JA 4NFDA 1XGQA 2GEEA 1CVSC 1IILE 4MS8D 3GI9H 4WTZA 4HMEA 4DOHE 5ESQB 1V05A 3MNWB 5L88L 5C0BA 5IJVA 1CGUA 1E28A 1Q9LA 3RU8H 2A74A 2YUZA 4ZPTA 1S5HA 3B9EA 4XVTL 3RTQC 4HUMB 4NNYB 5TE6H 5KAQF 3MA7A 4NQDE 4XVSH 1UVQB 5JR1H 4FTVE 1ES0B 5GJTL 1UENA 5FGCE 3WFHB 3HZMA 3IF1B 5HTSA 3ZDYF 1KCSH 3WEXA 3ZYJA 4BYHA 4P57A 2HFGH 2CLZA 4R3SB 3MCKB 2X4PA 5IB5A 2X4QA 5CJQH 3VD4A 5B3NA 2O5ZL 3CMOH 2FHFA 1IZKA 4PJCF 5F1NB 3ROOB 5CEZE 1G9EA 1CCZA 3GMQB 4X6EB 3QDME 3LCYA 2KQNA 4HUUB 3MRIA 4YFLF 1CGSL 5E08H 4WI2A 3TGXA 4IRSA 4YO0A 3QULB 4MNHA 4UOW1 4JY5L 4AIOA 2W07A 1AKJD 4PJHE 5HI5C 3MJ7A 4K3DH 3V6OA 1I1RA 1IGFL 1BP3B 4D3CL 3GJEB 4X7TB 1MWAH 4I18B 3KPMB 3S3SA 1P4BL 1QSED 1F3RB 1XGTA 2JE8A 1EEYA 5IWLC 2R9HC 5D1XA 2Q8AH 3QUMA 2I9LA 3VFOA 1VFOA 4XMPH 3U9PH 4H0IA 4DVRL 4EJ1C 2BNQD 3MJ9A 5DJYA 3MCLL 1A6WL 1Z0NA 1EFXA 3L5JA 2WBJD 1QLFB 1QHOA 5ISZD 1BFOA 1DQDH 3O2VL 3BGFB 1HSBA 1HCVA 3C5ZB 3S37H 3G04A 3SDDA 4MCZA 5E8EB 2VDLL 3FQTA 1KIRA 1EPFA 3MX0A 1CL7H 4QGYA 4NWUH 3QHZL 5F93C 3WN5B 1G7PA 3DV6B 2RAMA 3NBNA 2HT3C 4GUPB 1WAAA 3X14A 3M1BA 2QADD 3BISA 5D93C 3S5LB 2H3NA 1CD1B 4XVJL 3EFFB 4PFEA 3CSGA 1S7VA 3U4AA 5DRWB 3KPRD 1NC2D 1UQSA 2AJSH 4OKVA 2ENSA 4XX1G 4B50A 4D9RE 3VXPB 3KYAA 2DN7A 1FZMB 4X6FB 1ZA3A 4PJ7E 1AP2B 1PG7W 4RCAA 2UY7A 1KPRA 4QRSB 4LGRB 4EQ2A 3PDOB 2HKFL 4ZUVA 1JWSA 3MJ6A 3QXAB 4FQXA 5IFJB 2Q87A 2L7UA 3ULVD 1LK2B 4ZAKD 4HV8A 4HUVB 2ZUYA 4LPUA 4PRPD 3FO0H 3DX7A 4OF3A 1EO8H 4C54A 2P5EA 1XT5A 4JN1H 3DXAE 5C0DB 3RAJL 5C0RH 1T83A 4X6CB 4LCIL 4TNWK 4RWYH 1L9MA 1Z9LA 5T3ZE 4OZ4A 5IHUL 4DW2L 3DX9A 5ALBH 4F3FB 5I71B 1X5ZA 2A73B 5FM5O 2VXQL 2HMID 5BRZA 1J05B 4LSSL 4I5BA 1DQLL 5HDBE 1R3JA 4PLJD 1CT8A 5HGAB 1VADA 2P8MB 3BPOC 3CDYA 4LVNB 4ZUSA 1UCTA 2R2HA 2IFFL 1NCNA 5FYJL 4Y4HC 1F6AB 4N68A 2F74B 1JF6A 1G7JB 3UO1L 4MXVF 1M7XA 4Z7OF 2FR4B 1FC2D 1FYTD 4KH2A 2AV1B 5FO7A 4DKEL 3TBVA 4TVPD 5FKPA 1P9MC 1ZT4A 1JHTA 1E6OH 3ARBB 3ARED 5CP3H 5MI0B 1N2RA 1YNLH 3MBEA 4J4PD 2F54D 4C58B 1LEIB 4BZYA 4GQPH 3GMLB 3LIZL 1KTKE 5DC4B 1A3QA 3NIFF 2M8XA 1IGTA 2HKHL 2WLYA 3U0PA 3DVGB 3UPRA 4YHPA 4Q74A 2IANE 5DYOB 3KYNB 3VGBA 4HWEL 3PABA 2EYTB 2ZKHH 2X4UB 1E4WH 4HX1B 3TVMC 1R5WA 4XTRC 1ZVSB 1RIHL 4X7DC 4M48L 3VXRD 1EO7A 4C4KT 1N5YH 1K6QH 5J12B 1DQTA 4ZOAA 3W9DB 3WFCL 3SQOH 1EHLL 4KTDL 2XWBB 2ICCA 1WQVT 3A6BL 3W2DH 3FMGL 5E8DL 2E5EA 5SX5H 2FJHB 2G2RB 3A6CL 4G6MH 5ADOL 3UTOA 1DQJB 2KPNA 1K2DB 4GKZB 3IVKB 5CMAA 4LCCB 5IT2H 2CDFA 4JKPH 3K3QA 4JCLA 1PG7L 1FL3B 3WHXA 4XPAL 2A38A 2NYYC 3PWPA 4KI5E 4L8SB 2CMRL 2BVQB 1PY4A 1A6ZA 3OKLA 4JFPA 1MH5A 3CFJA 5C2UB 2DMKA 5DVMA 4X4XA 3KXFA 1D9KB 5B8CC 4TYUA 2GITA 2VUYA 3FTGB 5AD0B 3LKPB 1DQQA 2BSTA 4OM1L 4HCRH 5KSVA 1INEH 2G9HB 1GGIL 2XZAL 4L4TB 3HR5A 5I75B 5DSCA 3MJ8A 2CRIA 2OI9C 1Q1JH 1WWCA 2XPGB 5E00A 1NGXA 4XI5C 5D2LB 3R06A 1AGBA 3BI9X 3L3IA 5CJOH 1MNUH 1CICD 2O5XL 5DTFB 2G75A 3QISA 1FNLA 1YYMH 4ZFGH 4IOIA 2PCPA 3LH2L 5JPNB 3BSZH 5D2NA 2NPLX 4K8RD 4HAGA 4XAWH 3MRQA 3OPZL 1KPUA 4GXVH 4NHCL 4NGHL 2ICWA 4M5YH 2JF1A 4X6CE 3TYFA 5KSBA 2A9MH 5ESAA 4NZRH 4O9HL 5TGBB 3GSRA 1YMHB 1CGWA 2JCCA 1U8NB 4U31A 5BV7C 4F7TA 4MNQD 1ZMYA 2YD6A 3IXTA 1U92B 1ACZA 4WNQB 4O58L 3HG1A 4ODTL 4EI5A 4MB5A 1M7IA 4PRBB 3IJHB 3SDCA 2O5YH 4G7VL 3IXAB 5EWIH 4RZCB 2QBWA 3TC9A 2C1OB 2OMNA 3CSPA 3JUZA 4M7LL 3TN0D 3OSKA 4IDJH 5HSFA 1XFPA 1PYWB 4RIRB 3UTPD 5HGHA 5DUML 4JVUA 3MGOB 1ZSDA 3VMNA 4JFXB 5IR1A 2VRAA 4H1LB 3UTSB 1FNEB 3O2WH 4ODHL 1J1XL 5I1AB 1PY9A 2FBJL 3KLAA 3H0TB 1Y6KR 4RAVB 4UOW0 2F8XC 1FNFA 4KJQD 1G7QB 4GO6B 3QA3A 3TT3L 1T1XB 3BKYH 1CE1H 1QSFD 3ARGC 1BGXL 7FABL 1IL1B 1WIOA 2VXVL 2AJVL 4L4VA 5F7YC 4ERSL 1JHKL 1MCLA 3V79C 3WKNA 1UKSA 2O93L 4OLZH 4PJFB 4U1KB 1BZ7B 4PRAA 1QPXA 3EO1B 4PRHD 4G9FB 4YHLL 3MRPA 3VRIA 5IF0B 3EJYC 1T2QH 1P4LA 1AJ7L 4JM2A 2WAHA 4X4ME 5H37G 3MJ9H 3KNBB 3WEXB 2DYPD 3T1FA 4HHAA 4P99A 5JOFA 3BKCL 3L5XH 4I4WA 5CEYA 2OTUA 5ETUB 4G6JH 3PWJB 1FN4B 4JFFB 3B2UC 2RCSL 5ENWB 2FECI 4XBEL 3HZKA 1JYXA 3L9RA 1MFEH 3VFTB 1EEUA 3VCLA 3Q0HA 1HHGB 1I7RB 3RWEB 2CD0A 2ICWI 3H3KA 3QQ4B 4IRSB 1X4ZA 4YO0B 4MNHB 2DKSA 3GSXA 3HI1A 5DMKA 1UH2A 3FOMA 4AEHL 3V4VL 2BHYA 1JYNA 2CR3A 4GKNA 3EGSA 3VXSD 4FP8L 4H0HB 4OZFG 3LQAH 2BNUB 4OV5B 2Z31D 3D6GA 2EE2A 3NIGE 1ZLWH 5FYKE 3RWJA 4X4ZA 5D6CA 1ZOXA 4PJ9B 5GISH 1YJDC 2Q1EA 2R0KL 2VERN 3ZSTA 3IDYC 4BFGA 2BSSA 1BOYA 3RPIB 1MCPH 5JMOC 4NN6B 4I48A 1FZKA 2ZPKH 4D0CA 4ZUUB 3EOAB 1A6VH 3NTCL 4LIQE 4X83A 1CD0A 1OTTC 4P2RA 3ARDD 3SDDB 3TA3C 1E6JH 3BRFA 1IKNC 5BO1H 1VA9A 2B1AH 2APBA 2E9WA 3C9NB 5TF0A 4A6YL 2VDRH 4XNUL 3ULUC 3T2NH 3TCXA 4K23L 1G9MC 2I5YH 3O6FB 2I9TB 5E5RB 3M1BB 1FFQA 2YEZA 4F7EA 3IDUA 5KZCD 4OKVB 3STZA 4OQTL 4HKZB 3FQXA 4OFYD 4RA3A 4UDUA 3EW3B 3B6SA 5A2JH 1FO0A 1P84K 4QRRB 4LF3B 5IHLB 1Z5LB 3L3GA 3PP4L 5HI4D 2AGJL 3MJGX 2PXYB 4JLRA 3P0GB 5FK9B 5K93A 1G7IA 2F5AL 4K71C 1JNHB 3QAZB 4P59H 4CADA 1AGFB 3KLHD 4FFVD 1EXUA 1F42A 5F7KC 5JQ6H 1TJIL 3BP5A 4JG0H 5K9QG 4JHBA 2DQDH 5K59E 2DBJA 1EERB 4LPCA 2YC1B 5EO9A 5KSBF 4JR9L 2R8SH 3CVHA 2JCCF 4LQFL 1XGPA 5I1HL 1IMHC 3SPVA 1F97A 1HHHA 3VFSA 2LTQB 1E27B 4JFED 1INQA 2X10A 1OPGH 4J3TA 1CG9B 4XP6H 4NC0B 1H9VA 1NMCC 3SHSA 1I3GL 4I5BB 2WZPD 4W4NA 1YUHA 2H2PC 5FA4B 1YECL 1VADB 3QUZA 4QRPB 4HGMA 4Z18A 1P7QD 5C0BE 3OAYK 4PB9H 1G9NL 1LNUB 3FB8A 4LPXA 4HPYH 1YEGH 4OD2A 5TQ2H 4I2XB 3GSOA 2H6PB 5L2KA 2VKWA 4OLYH 3L7EA 1HH9A 1RU9H 4G9FE 5LGJA 1IT9L 2R2EA 5TE7L 2UY6A 3TIDA 3QXUA 2R0WL 4KVNH 2BVTA 1MHEA 4ZYKA 5E8PB 4NQSA 5BXFA 1A7RL 4Y5YA 3VA6A 5I6XB 2B4CC 3RZCB 3CK0L 1CDGA 3A67L 4Y19B 1VGEL 2OR7A 4JRYA 3DUSA 4DGVH 3NZHL 4BJLA 4PREB 3OJMB 1KC5H 5ICZA 5BVPL 5IROA 1T0PB 4F15C 4FQJL 2VIRB 3K2UL 1HI6A 3KPNA 3CFBA 3WJLC 4ENED 2A6KB 2DB8A 3HCVB 4YHPB 3UEZA 3WD5L 1U2HA 3LPFA 3QDJA 4CVZA 3FQRA 4OFPA 5T1KD 3V6OE 3TESA 5CBAA 5C0CA 3DO7A 2BNRD 3MOBL 4JM2F 3ARXA 4RFOH 5DJAA 5LXGL 3C2AH 3S96A 3I6LD 4M00A 1VEOA 1BEYL 1MRDH 5I30H 3BT2H 4HXAL 2R0LH 3SGKC 1XF5A 3BRGC 2Y06L 3UTZA 3AVEA 4NZUL 2R15A 4MJ4A 3NAAL 5CAYB 1A6UH 1NCAH 4BQ6A 4GRLA 1YEKH 1NSNL 3D9AH 3DSFL 4Y4HA 3SDXA 4PJGA 5HHVL 1T1YA 4ODWA 2A1WL 1MFAL 4I3RL 4AEFA 4XPTH 4UDTA 3KPQB 1DR9A 4XP5L 4P48A 3L1OL 2CKBH 2OXGA 2NXYC 1K9TA 4JREC 4KQ4L 3LRSB 5F7DB 2EDWA 2G5BA 4Y5VB 5GHWL 4U6XA 4PTTA 2JIXB 3QPQC 3AS0A 2XV6B 4XP1L 1NAML 4O00A 5BJTB 5CUSH 1WAAE 4N0CC 4X4XB 1XF2A 4XPGL 1U8IB 2V7NB 2P8LA 2BSTB 2J2ZA 2PNDA 3FT3B 4MA8L 4EXPX 5DJ6B 4B0MM 5DSCB 3MJ8B 4IRZL 4EDXA 3WDIA 2AV7B 5LWYH 3TCLB 4ODXB 2AEWA 5FV2A 1KCVH 5E00B 4MGXA 3EFDH 1Q0YH 2MPAL 4HJ0C 4KKCD 1UJ3C 2Q76B 3MYJB 5DZLA 4XP4H 2BC4A 1ORQB 2Y6SC 2P7TB 4IOIB 4YDIL 5HDLA 3QFJA 4NHUA 4UOJA 2E27H 4X8XA 2NY0B 4P23D 4GAYB 5E9DB 2VTFA 2XN9D 4TVPL 4RGOL 3ZKNC 3MRQB 5I1KL 3UJTH 4QRQA 1REIA 4LRNL 5MEND 1YEHH 4YUEL 3T3PF 3VFGL 4K7PX 1NMBH 1KFAL 4YK4C 1NL0L 3MXWH 2E7LA 5IV2A 3GIVB 3FN9A 4GBXD 2DJ4A 4RWHA 1OTUD 1KIPB 3VFMA 3IXTB 1AQDB 2GFBB 3P11L 1JPTL 3TPUA 4X6DB 3MRLA 4LCWD 5BRZE 4EI5B 4HFUL 2H26B 2HJLB 2VL5A 4WV1B 2SEBA 3FN3A 4QRPE 3CFIC 3HE6B 3EYFA 2JELL 2OK0H 1NUNB 1T66C 1A3RL 3R4DA 3RVXC 4YHML 2DLGA 1IC5H 3MLSL 1A1NA 1A7OL 2E7BA 2D0HA 1RULL 5FYJU 4NSKB 2CGRH 4KC3B 4POZC 4UT6L 3GJFH 4F9PA 5DT1H 1LO5A 1X5IA 3K1KC 3S35H 3GGWB 4JFQB 2JJVA 5BZWB 4L8BA 2KDGA 1M7DA 1V7NL 4WJ5B 3B9KC 3BPCA 4XGZA 4Y19E 1R5VB 3AS3A 5EC2A 1OLLA 3QEGH 2XYCA 2AJZB 1OAQL 3T0WA 3NCYS 3CLFH 1NAKL 4JFHD 1KELL 3VE0B 3KYMA 1GC1L 5I19H 8CGTA 1SY6A 1ZHKA 2I60H 3MRGA 1MHPL 5D9SB 1FIEA 2CIKB 2VR4A 4OCSL 1QEWB 3UAJC 4WDIB 1Q72L 5E6ID 2GTWA 3MLXL 5D7LA 5C6TH 1JGDA 4X7CC 1MCIA 4M5ZH 3OAUH 2YN3A 2VQ1A 2D03H 5ESVA 3L95A 1RZFL 3FO1A 1KXTB 2P1YA 4I3SH 4KXZH 4K8RL 3BP6A 2FBOJ 4RMRA 5L9DH 3B83A 1FG2B 4MLSA 3FOMB 3AY4C 4OCMC 2JJSC 4YXHL 5IHZB 1B0GA 1NCCL 4P46D 1SMAA 2EXWC 1JPST 2GSGA 4NQDD 1DBMH 4FTVD 1R6VA 5K9OA 2IPKA 4ONOA 3WFDH 1B88A 3ZDZF 2HWZL 4LLWA 4AENA 1JE6A 1SJXA 1D5IH 2VLRA 1T1ZB 5C0JB 4X5XA 5DR5L 5CEZD 1CR9L 4I0PC 4YQXH 4BK5A 5DMYA 1R24A 5C09B 3TO2A 3ETBF 4I48B 3QDMD 5T1LA 4PJGF 3SDXF 1DZBA 5E56A 4JRXA 4Y16C 3N85H 2XIDA 3WO4B 3JWNC 4P2RB 3SE8H 3RTQB 1JV5B 3NFPA 1KTDA 1F4XH 3KPLA 5LCVH 1EBAA 3JWDL 3KAAA 3H6JA 4WHYH 3S36X 1I9JH 1Q9OB 2BOBB 5TFSH 4NWTL 3E8UH 4HDIB 3TT1H 3IKKA 3MQIA 3IDNA 2E6JA 5EU4B 2W65A 2WUCL 9CGTA 5IBTH 2B1HL 3L6FB 4PY7A 3V0VB 4Y4FC 1A4JB 1OD9A 3HN3A 3KVQA 1FO0B 3EO9H 1EK3A 3ARUA 3RQ3A 2Z92A 3EYSL 1IZJA 3D3VB 3W9EB 4X6DE 3Q6FB 2OS7A 3BP7B 1RPQA 4E9LA 4LBEA 5F96H 2DM2A 2HG5B 3VXMA 3LOWA 2W92A 1SM3H 3BP5B 1TJGH 4ONFH 1AE6L 2DKUA 1RFDH 4JO4L 5INCB 5EIVA 3MXVL 2COQA 5DVNA 1IAOA 4O2FA 5JO5B 2LABA 3VGAC 1EMTL 3FB5A 5EO9B 4KKBD 1IM3B 3DRQA 5DJZB 5EU6A 1XGPB 4D9RD 2HTLD 3Q3GA 4WEBL 3O3DB 4Q9RH 1L7IL 1WZLA 2OP4L 3O0RH 5IW3A 2XKUA 4UV7L 5GGQH 1KB5B 3L3KA 4IM8A 1A5FH 5F3BB 1T21B 1IKNA 2IAMC 3GBML 3HE7D 4NO0D 4P5TC 4PP1D 3V6ZA 3QCUH 4M4RA 3RX5A 4Y2DC 3HAEB 4JQIL 4PGZA 4MWFB 4ORZC 1LO3H 4K7PL 1QBML 4DK3A 1NCDH 5D93B 1ZT7A 3T08A 3LZFH 5L2JA 1CXEA 2XQBL 2FL5A 4PJDB 4XPBH 5EU7C 4MJ6B 4V1DA 5D7JC 3QXWA 4U3HA 1RUAL 3TIDB 3RVTC 4OD1L 5F1OB 3IFNH 5T3ZD 4U1MB 2BOCA 1DLFL 1TVBA 5BXFB 2ILLA 1FNSH 1F4WH 2IPUK 1INDH 4OD3H 3V0WL 2EXYC 1P53A 2EDLA 1T22B 2OJZL 1KG0B 2DAVA 1KENL 3ZT7A 4G6AD 2AJYL 5DRZA 1M71B 2X7LA 3D85B 4KKLC 1ZGLB 3BIKA 4NKIH 1LO0H 3UZEA 3IDGB 1A22B 5DD6A 1YY9D 4PJ5B 3LKSB 4TRPH 3NACL 3U36B 2AXGA 2FIKB 2CO7B 4JY6A 1JZ7A 1FNGA 4OGAD 3S96B 2P4AB 4KRPC 3QUXA 2JJTA 1CGXA 5AWNH 3O3BB 3GSNL 2NY3C 4X7SL 1A14H 4KUZH 2XKNA 1QRNA 5JHDB 4DK6A 4JFDA 1V8HA 4U1IA 5C09E 3QJHB 2E7MA 3VW3L 1PEWA 4OF8A 3OKEA 3MLUL 1T2JA 2ZCKH 4P2RE 4J2XA 3VH8A 2IAND 2HRPL 4P2OA 1VFMA 3GI8H 2XFXA 3TNMB 1RK0A 2W9EL 5KSAC 1TJHH 3IYLW 4Y5XC 3LS5L 2X4RB 3BH9A 4UILL 3CIQA 4MA1C 3MMEB 4N90E 5GGVL 3CFKA 1KCLA 5I0DA 4HH9B 3W82A 1LHZA 1HNGA 1TDQA 1D6VH 1QKZH 1HHKA 2NY5L 1CD8A 3ARSA 4MXWL 4NO2B 2IEPA 5I2IB 2EIEA 5I1EH 1AO7A 3HMXA 1FPTH 3TFKD 1DUZB 3T3PE 4JANA 4EDXB 2XNAB 3MLTB 3FO2B 1G0XA 4ZSOA 1MFCL 2NW3B 3JVGC 2V2WB 4K9EL 2X4SA 4TULH 3D3VE 2YWZA 2IBGA 4KI5D 3CVIH 3TVMB 2Z9TA 2Y36H 3SKOA 1I9IL 4Z7NF 1MVUB 3IRZA 5EFIA 2V2XA 4U05A 5CSBA 3UTQB 3B3IB 4HK0B 4PRDA 5HHXH 2ORBH 3EYQD 2BMKA 5CHNB 5JW4R 2DQHH 1YN6B 4U1HB 4QRQB 1XGRA 2CDEB 4BSVA 3T77A 3WV0A 4FOMA 4WCYL 4QTIH 1U3HA 1U91A 3QG7L 3QIUD 5TPWH 5J57B 4F58L 3WFBH 3EBAA 2DIJA 4NZTH 4OI7A 3S36L 5DMGD 1W72A 4XNMB 4QRTA 4JDZB 4NQXA 4YX2L 3C5SA 4XCEB 3WHE1 4PP2A 2JTDA 5F3HB 3EHBD 1IGCH 4MJIA 3T65A 5B38G 1SY6H 3CDFA 1QA9A 2ZG1A 2J6EL 5DJDA 1OAZL 4PJXA 1F4YH 5B8CB 3GSQB 4KFZC 4PJDE 1B4JH 2DQIL 5MEOB 5ICXA 2BSRA 4OT1H 4FS0A 1XF4B 5CWSB 4M1GH 4IOSD 3WXWL 2R4SH 1F3DJ 3RKDC 4LDEB 2OI9B 4OLXL 2YKLL 3T0EC 1VCAA 2AERT 1TTUA 3JZ7A 4OB5L 4QF1B 3BPCB 5FM4A 5C0ND 2FX8L 4C56B 2VABB 1IGYB 2ATPA 4JRYE 3BWAA 1WSST 2LU3A 2OTWA 4J23A 3S4SA 3NCMA 5M94B 3EIFA 2N7BA 3B5HA 4X5WB 3KYMB 5SX4I 4DN4L 3H42H 1PKQA 3C60C 2KKQA 3IDMA 3U83A 5EOTB 2B2XH 2GJ6B 1DANU 3OF6A 1ZHKB 3MRGB 3QDJE 2NCMA 5GRVL 4HKXB 5D1ZA 1F11A 4ORGB 5C0CE 4RDQF 3W81A 3N9GL 2DD8L 5BV7B 3F7PC 5D7LB 1NGWB 3TF7C 3ZDZE 5K9KA 4X80L 3ARBD 1JGDB 2FEDD 4KJWD 1QBLH 5T33L 3VG0L 5JHDE 1K4CA 2HLAB 3QIWB 1OT2A 2MKWA 4K2UL 4HUNB 5DS8B 3FQUA 2C3GA 2PW2B 5ESVB 4AMKH 4JRWA 4IEFB 3OR7A 4PJEA 3INUL 1I8MB 4TSCH 1U8PB 3BP6B 3RL2B 3IDIA 4U3XA 4WU5B 3QJFB 1KJ3L 1BHGA 1D5XA 3TYGL 2H45A 5A2LH 1RVFH 2EIBA 1NFIB 4FQQB 1FNAA 2X44D 1C08A 2YPVH 1FRGL 1U8MB 1KIUA 4JVWA 4G43A 2CXGA 3VDBA 4X5XB 4K3HA 4LMQE 3X13B 3AUVA 1N7ML 3GBNL 3E6FA 2IGFH 1CLYL 5HHNA 3ARGB 2B5IC 3HC4H 3L5HA 4NJAH 2FGZA 1T0MB 4M43L 1KSRA 1W0YT 2JB6A 4RBPH 2FH6A 4W68A 2VITB