4YEFA

Beta1 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclododextrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Determinants of oligosaccharide specificity of the carbohydrate-binding modules of AMP-activated protein kinase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Sugar binding protein
molecule keywords 5'-AMP-activated protein kinase subunit beta-1
total genus 12
structure length 80
sequence length 80
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yefA00
1X3DA 5DFVC 3PXHA 1YDPB 1H5BC 2OX5A 4NDMA 2EDLA 3MCLL 5DK2A 1N0LA 1GHFH 1OGAE 1D6VH 4U1GB 2AJSL 3V4UL 4NM4H 5KSBE 4XPTL 4ZXBB 3F65A 2VLRE 4MAYA 3MRQA 1DBJH 3D39A 3REVB 5ACMA 3UDWA 4EVNB 1N64H 3WNOA 5ADPL 1U6AH 3ZTNH 2W9EL 5INCA 5HYJB 2EDRA 3TT3H 2IG2H 3FN9A 5J89A 4F33A 1LO2L 1S7VA 3D5OF 4S1RL 2YZ1A 4Q9RL 3RBSA 3MJ8B 4KQ3H 1BJ8A 5KVGL 4MJ4A 3VXUD 4DZBB 5HPOA 4ZYKB 4O4YH 2VTFA 3ILPB 3MBEB 1NLBL 1UKQA 3M1BB 5IFJB 1R3JA 2VAJA 3D9AL 1S7UB 2PYFA 2XZQL 4APQC 2AK4E 4G8EB 3MRPA 3QIWB 2WUCH 2DQDH 1MIEH 2H6PA 4I3SH 5A1AA 5KOVC 15C8H 3HG1A 2IEPA 3TBVB 4JFEE 5GZOC 1K2DA 5IQ9A 2AXHA 4YPJA 2W07A 4KI5D 3SY0A 2NY3D 5EWIL 2H2SD 3AREC 4MA8L 2FYYA 1FNEB 1QR4A 3K4ZA 1U8QB 4OGAC 5DZNA 3RUGB 5CLWA 2VAAB 5EOTB 1IVLA 3B8SA 2E9BA 4OZIF 3QFDB 4F7TA 4J4PC 2NY7L 5FF6A 4G8FA 1A3RH 5HVGB 4U7KA 3MLSH 1QQDA 2WQ8A 2ZOKA 4FQIH 4OZIB 4JFYB 2Y6SD 3RUGF 4ZDHA 3KPRB 4PJIB 2CKBL 4AEIL 1IGIH 4R7NB 2HJKA 1GGCH 4MWFA 1JBJA 1X6NA 4LLWA 5D2LA 3M1BA 4OFDA 5IFJA 1MQKL 1KCSH 3U30B 3CFCL 4XX1G 1AD0A 4UBDC 1I8IB 2WAHA 3ROOB 1BQHG 4BKLA 3RIFF 3QZWG 3HRPA 1A21A 4JY5L 3O4LA 2CRYA 1HSAA 1JV5B 1DLHA 1GC1C 4HS8L 1OD7A 3BPOB 3NCYP 3QDME 4XH2A 4WHTA 4KKBD 2AEIT 2BERA 4GG6F 1FNHA 1SBSL 3GMNB 4JFOA 3C6LA 4RISH 1QLEL 1TZIA 3RUGA 3WN5C 1YEJH 5DJ0A 4YHOL 3LS4H 5GRYA 3IDIB 4HPOH 4BUGA 3VFMB 5FCSH 1VPOL 3HZMB 2FO4A 4JANB 5C71A 4G9DB 2AXFB 4OD3H 2YHGA 4JFYA 5DJDA 3P0GB 3ULUC 1V3LA 4HJGB 4OCSH 2FECL 3BEVB 3N50A 4AMKH 5DQ9B 3S3JA 5CINL 1S9YA 4M8VA 4PV9B 4Y5VC 5TGBB 3R1GH 1CDIA 1OGAD 4FQXA 2V17L 5LAXA 3RAJL 4G8IA 4RGNB 2VNCA 3B3IB 4WW2C 4HF5H 4KJWD 2C7UA 2A77H 4X6FA 2DI9A 3T2QA 4B50A 3BHBB 2AJVH 1NGZA 3SO3B 3BGFB 3T65B 1J8HE 4BSVA 2ED8A 4Q6IA 1HSAB 3K81A 3KR3H 1RU9L 5K9JH 1G7PA 3JV6B 3V6BR 4AM0A 4PJ5B 1E6JL 5KSAD 1EDQA 5JOPE 1O7SA 2QSCH 1JYNA 2J12B 5I15H 5CMAB 2UZYB 3IDMA 1NC4D 4OI8A 1YJDC 4AMKL 1W72A 5MHSD 1DQDH 2DF3A 1YYLH 2X4QB 4LAJH 2FX9H 5F9JA 3O4LD 1JPFB 1OARL 3JWDH 5EUOE 4X9IA 2XY2A 1AGCA 4WI3A 3VW3H 4X5WB 1NMCC 5IFAH 3INUH 4O00A 4X4XA 2MCPL 1W8NA 5TGBA 3RKDD 3UYRH 3ZHLA 1GIGH 5I16A 1KBGH 1B0GA 3MBEC 2Q86A 1EERB 4HIIA 1UM4L 5BMFH 4JE4B 1H9VA 2O5ZL 3NN8B 1V8HA 3CUPB 2DTSA 2VO5A 1MVUA 4GG8B 2X70B 1SY6A 1S5IH 1WFOA 1MFCH 5IBUB 1IC7L 5E7BA 3T0ED 3P4OB 3T0XA 3QUXA 3MV8D 3SQOL 1JMZA 3AVEA 4QOKA 2ICEA 2UYLB 1TFHA 5DO2C 3S37L 2J4WH 3QXAA 4L8DA 1OAKL 1U2CA 1I9JL 2ZCLL 4CVXB 2R0ZH 3ZMRA 3O8XA 3WXVH 2Z31C 4LPCA 5EH1A 1A2YB 2EDFA 1AY1L 5IKCA 1N59A 1EZVY 3DX9A 4WU5A 5SWZA 4X8JA 1XGUB 3MRKB 3ECBB 4PGBB 3LQZB 1A7OL 4NPYA 1JJUA 2DB8A 2V2TA 1S7SB 4JZJC 1CGYA 3Q6GH 3EO1B 3L9RA 1CR9H 4M00A 3Q1SL 3V0VA 3L5HA 4FZ8H 5AWNL 1GGCL 1YNKH 2HVKB 3MZGB 4HZAA 5B8CB 3VXSD 4UILH 2XPGA 4E5XB 4EN3C 5BV7B 1SVZA 2WBJA 4NYLB 4XHJD 3Q1SH 3LQAH 3EOAB 3S3PA 4XNQB 3ZT5A 4X7SH 3TP4A 1KN2H 1YEFH 4D0DB 1AFVH 1KPVA 4XPFL 1FO0A 4IRJC 2XFXA 4TPRH 4HPYL 5T3XH 2X2YA 3TT3L 1IEBB 1CGUA 3R8BB 4F8TA 4K8RL 2FGZA 3IVKA 2R23B 2DBLH 4Z7UB 5FDWB 1U95B 1F4WH 2JTDA 2LU3A 3SDAB 3SE8H 1PAMA 2X4SB 4M8QB 4XPTH 2O5YH 1HK6A 3AREB 2OTWB 3UX9B 4GXUN 4LHUD 1FE8H 4ZSOB 2FSEA 4KZEH 1F90H 1Q0YH 4LEOA 4MD0A 4FQPA 3VXPB 1G7IB 1U93B 2PW1A 4NFBA 4LF3A 3VW3L 1ZLVH 4WDIA 1P5UA 3QP3A 1AI1H 4PRDB 2OL3L 3L95B 4XP9L 5IB1A 4FQJH 4P23C 5KVEH 1J1XH 4KI5C 1F58L 3BPLC 4OCLC 1ZS8A 1I1RA 3QPQD 4GLRH 4CDHA 2FHBA 2GFBB 3KYOA 3IT8D 1A6UL 1YPZE 4PJEE 3GI9L 4PRHA 4YPGB 3C6LC 1PG7H 4J7RA 4JDTL 2KKQA 3FQWA 4MXVF 3INUL 4F2MA 5F89A 4M6AA 4APQD 1MFCL 1CD0A 1GGYA 5JHLL 5C86A 1GGBH 3U4EA 5I15L 1KCUL 3I6GA 2IMMA 2X44D 2VMFA 4JM2C 4CW1B 3O2DH 4FTVA 1ITCA 2W38A 4WO4C 5JUEH 2DD8L 1T1WA 4KUCF 5ID0B 4RQQB 4MNGA 4LPYA 1VACB 3KXFE 1H5BB 1J86A 1NLDH 1TVHA 1AR1D 1D9KB 1MCSA 4OCXL 5HYJD 1DDHA 2HT3D 1MREL 4OGYL 1IAOA 3LDBB 4ODTH 4PRDA 3BIBX 4P2QE 5IOPB 3R0NA 1U8MA 5IHUH 3U9UA 3TLRA 1E4JA 2AK4D 4Y4HC 3MLYH 3TA3C 4C56B 2F5BH 2YPKB 3F62A 4QHKJ 4FQLH 1CFNA 3GI8H 2AQ2A 1RZJL 1FJ1B 4N9GB 1D5XB 4OT1L 2AXGA 3KS0H 4WCYL 3PDDA 4PJBB 4YBLC 3MV7E 1XF2A 4RMVA 3I84A 1Z3GH 2VQUA 4Y1AB 5DC0A 1U8NA 2VXQH 4BZ1L 5K59F 4ERSL 1U8LA 3VFNB 3B43A 1NCAH 2CR6A 3NCBB 3VMNA 2BY1A 5D1ZD 3A6BH 3LN9A 2YPLB 3QEQD 5KSUB 4MA1C 3CU7A 3CC5A 1U42A 4IS6A 1SEQL 4N5ED 1QSVA 1GYAA 3LH2H 5SWSB 2BRRH 1OTUC 2PTUA 4BH7B 4C56D 4R6UA 4L8CB 1YN7B 4L5FH 5F6IB 4MSWB 3VH8G 4HK3N 5T3ZL 1JPTL 2EEBA 1U8HB 1CGSH 4G80B 2NXYD 1FZMA 1UA6L 1AXTL 3GSNB 1FCCA 2CRIA 2EIEA 3O6FB 3VGAC 4EEEA 4TPRL 2V2WA 2UZIL 3I9GH 2PYFB 2P7TA 2DL9A 2YD4A 4FG6D 1OT1A 5E8DL 2O61A 2NR6D 3HPLA 3VDAA 1C16B 2CIKB 2AK4B 2RCSL 3UDWC 3RWIA 1G7HB 4JY6B 4PYHA 3QDJA 4Y5YA 3QPXH 3JV4A 1GC1H 1T04B 2R15A 3VFNA 4LSUH 2Z0BA 2FH6A 3NA9H 3FQUA 2AI0L 1WZKA 2DMKA 5HYQB 1YMMA 4OFPA 2PTTB 1F8TH 4IS6B 5KN5B 4XGZA 2HRPH 3C8DA 4HKZA 4TUJA 4JVPA 4Q74A 2R0LH 3HC0A 5GS0D 2XWJB 4PJ7B 5DJXA 4PRBB 1BFOB 3O2WL 5I1EH 2I26N 1RHHB 5EO1B 4N5UA 1K4DB 4Y0GA 5F6HI 3OXSA 3L3IA 4Q9RH 1RPQA 1LE9B 1X5LA 2GTWA 1S9WA 1UGNA 4KJPD 1A1OB 3BPCA 3RDTB 2LFGA 5HSFA 1EK3A 4B7LA 5JXEC 2NZ9D 5IG7A 3TA3D 4HK0A 1U3JA 3LCYA 3EYFA 3PQYD 3BRGC 4WY7H 4YAQB 1I7RB 3BQUD 3WIIL 1QO3B 3SGDI 5D71L 4H25A 4NOBA 1YY9C 5I76B 3HZYB 4HEPG 3EAKA 2CJUL 4Y89A 1MNUH 3VWJA 1NEZA 4X6DA 1KCRH 3X14B 2MHAA 4NQCE 2J8HA 2G75B 4JO3L 1QLRA 3I75A 1RFDL 3MJ7B 1UC6A 4XAWH 5D6DA 5DQJB 3NOIA 3ZE1F 2NXYB 1MI5E 1G0YR 1WZMA 4DZBA 4AL8H 4LSSL 5IHUL 1N5YH 5KW9H 2ILLA 2BVPA 5F7WC 1BFVL 3P77B 2GK0A 4Z7NF 5D7JC 4ODWA 1RFDH 4GBXC 3D69A 4GAGH 4PJCB 3TBVA 2R4RH 3G9AB 1U8KA 5CEZL 4UDUA 1WTLA 4LNRB 2HLFC 4KDVA 2R2EA 3VDCA 4RDQF 3GSNH 3LKOA 1K3ZA 4P23D 5CIPH 4RIRA 5GS1C 4BZ1H 3NABH 4I77L 2Q7NA 4FS0A 2IBZX 3O3DB 1IM9B 4DGVL 4GRLC 1NBYB 5E8NB 1DP0A 1KG0B 4OFIA 5LGKA 1INQA 1XGQB 1ZA3B 1K85A 1NEZB 4X6DB 4KKCC 2NY6D 3F7QA 2Q8AH 2HLAA 3S7GA 1CGWA 3LD8C 3DSFL 1QFPA 1U92B 4NNYA 5F7DB 2BVQA 1YEJL 3T2PA 2X4QA 4Y1AD 1L0YA 1RUPL 2BNUB 1U3HC 1HH9B 1Q0YL 3WHE1 2N1KA 4L3EE 1FL6A 1FYTD 4ODVL 4U1NB 3NFSL 2GK0B 1AD0B 5L2KA 5GGTH 1CXFA 5F71A 1AGCB 2V7HA 1ED3A 1YNTA 2EDYA 1CDGA 3BEWA 2FJHA 4UINL 5SWQB 4M7JL 4FQJL 2C3XA 1NAMH 5D7IF 2H26B 4X6CB 5BZWA 4OM0L 3TFKD 4KGLA 5E9DB 5GGRA 4MZ3A 2VRAA 5IMLB 4MQXC 2AEQL 3TCXA 5I8OH 3BW9B 3MLZH 2DQIL 2NNAB 1SJVA 2FDBP 4JDTH 1ADQA 1I85C 3CGTA 2ZUVA 5L9DH 3KWWB 1FDLL 4XCCL 3T4YA 4P46A 1NMAL 4ZO7A 4ZODA 5DHXB 3PWPE 2XKSA 3O3BB 1RZGA 3VI3E 4RWYH 5I1DB 1I7UA 2DKUA 3W5MA 4GQ9H 3LQAC 1A64A 2L7UA 1ZEAH 3CFKA 3LN4B 2FJFB 3IFPB 3GHEL 2NY6B 4PB0H 1BLNB 3U0TA 3ARBD 4QRTB 3UTQA 3TYGL 3VE0A 3HNVH 4UT6L 4PJ8C 4Y2DB 1UZ8B 4KUZH 5MERA 5F97E 3T4AA 5L2KB 3BI9X 3NPZB 2NR6C 4I8DA 3V6FA 2DLTA 4HV8A 4M62L 4NZDA 1DVFB 4LKXA 3KPPB 5IM7B 2VSCA 1M7DA 4BZYA 4IOSD 4LHUG 4W4OC 1FN4B 1N4XH 2X6MA 4YDLC 3BJLA 5J57B 4XCCH 4G43B 4P2QB 3SDDC 5E9DA 4KUZL 3WD5L 4MQXD 3C6SB 5I1GH 4J1UA 4U1MB 3MXVH 3STZB 3WKMH 4FG6C 3V0VB 3BZEA 1KIRB 2MNUA 2AQ1A 3IDMB 4XXCA 1A9EB 3LSOB 3WXVL 4DW2L 4XBGA 1Q8MA 4MGXA 3TGXA 2X4NA 4DN4L 4P46B 5JHDA 2A9NH 3HN3A 2F5AL 2LAGB 5TE7L 1KELH 4N8CL 4GSDH 2DQJH 3ZKXC 3EYVA 5E1AB 3DBXB 1SQ2N 1T1XB 5GGVY 3W2DH 3L7EA 1YY8B 4ZAKD 3H7BB 4QHLA 5FXCH 1KT2A 4PLNC 2VLRB 1M05B 5JDSA 2I27N 3KPRD 3LEVH 5JXAL 4YC2C 5DT1L 3SBWA 3MRBA 3NIDE 4Z76A 4TQEL 3CUPA 5I1HL 1FSKC 3PF2A 5EC2A 4OF7A 4KVNH 3ZTNL 3VFPA 1JPSH 3JTSB 3QXDA 3RL1B 3GSOA 1BHGA 1P4BL 3WLBB 1NQBA 1YEIH 4BM7A 1HOCA 4S1RH 1F4AA 4MCZB 1JF6A 3TFKC 5EO9A 1D6VL 2PW1B 3FFDA 1CBVH 5DRZA 1QR1A 2X5PA 3VXNA 3C8KB 5L2KD 5L7XH 3NBNA 4XCNA 3BDXA 3GRWH 1F3JB 3DMMA 1J88A 1LE5B 2BNQB 5IHZB 4YHYB 3U46B 5EBLB 2GQHA 2VISA 3AY4A 5FM5O 1IC5L 5IB5B 3STLB 3HNSL 5GRJL 4HZLB 1VFOA 4LCUA 3S88L 5CWSA 3FAXA 1IILE 1NBVH 4YHKL 2OQJA 3LKPB 2R1YB 4NQDB 4DFHA 1SJXA 1J0JA 2E7HA 5JDSB 3BZFA 4PGJA 2OI9C 4KKCD 1QA9B 3CMGA 3BXNA 3E6HB 5HD8D 1OWWA 3PHOA 1L6XA 4F3FB 2EECA 4JPIB 3WIHA 4HQQL 5FYJU 1D6EB 1FNSH 3EJZC 5FO9B 3MXWL 3MLPA 1RMFH 3W39B 1DN2A 3OR7B 3EOBB 3MOAH 4LIQH 2PETA 3JWDL 4FHBD 1QSFE 4NYLA 2PXYC 3J8F7 1BVLA 5BO1L 4G42B 2D7TL 4RSVA 4FQ1L 3PV6B 1OTSC 3DX8B 2A6KB 1CE1L 4BK5A 5L8KB 4D0DA 2F9BT 3VDBA 5LWYL 3LV3B 3HC3L 3IJSA 4WW1A 5ESQB 2KH2B 4PS4H 5I1GL 1F4XL 4D9QD 1GGBL 5IK3B 4JFZH 3IVKB 2CKNA 4GMTH 4P48A 4P9HC 5JPNA 3IAGC 5CZVL 4PJ9B 1LO5A 3FQNB 4XPBL 5F6HJ 1ZSDA 3W82A 4I18A 3ULVE 5T1LB 1WBXA 2VC2L 4CL7A 5DJYB 5HI5C 4FFVD 4RRPG 4YX2L 4XPGH 2ZPKL 4LDOB 4ZAKC 1JL8A 1MFDH 4L8BA 3BPLB 3QIBA 4ZPTB 4Z7NE 1XGYH 3K4AA 2X4UA 3C60B 4A6YB 4RMQA 1KLGB 5T33H 3UTOA 2BHZA 4DCQA 4F7EA 2Z8RA 3SE9L 2PCPA 2X1PA 4BH7A 3TA3A 4NC1E 4NN5B 4S2SA 3WJLC 1WISA 5EO0B 4PR5B 4MSWA 4HIXL 4UQ2B 3GBNH 3WIFB 3OSKA 3QIUC 3KYOB 3B9EA 4BA8A 4KTEH 1GPOL 4YHZL 1CGVA 3UJJL 2Z93A 1UXWA 5FM4A 4ODSL 1BMGA 1C5BL 2VL5A 4NZTH 2VITB 1EUTA 4DOHB 2FBJL 2EEAA 1RJLA 3I3EA 2H6PB 4R0LB 4WW2A 1WWCA 3Q6FA 1KXTB 5JIKA 1K6QH 4GS7B 2O61B 4NKDB 1GOFA 4XP1H 1QYGL 5DRNB 1CICB 3KDMA 1HH6B 1H8SA 3LY6A 4R3SA 2DM7A 3MRHA 1YEKH 1EX0A 1WZ1H 3D85B 1J1OH 2ZKHL 4LQ1A 1MCWW 4LHUA 5HYJE 3OQ3B 2EDQA 5HGHA 4ZUSB 5TQ2L 5E94A 3QQ3B 1NBZA 4LCCA 4YDVB 3DXAA 3DVNB 5IMMB 2UZIH 4X5LA 4HJ0D 4J8RA 5CSZA 2MMXA 4U05A 3LN5B 1IGJA 3BKCL 3BWAA 4HS6A 4JZNA 3BESR 3CAFA 1KEGL 2OP4H 1KBGL 2P48B 4M1CC 4Z7WE 5E2UH 3UBXB 5M7QA 2WK2A 4WUKL 3ARFB 1F11B 4LIQL 1MCOL 3LKSB 1BPVA 3KLHC 1NCDH 4O51A 5DDHA 5SWSD 4JVUA 2OXHA 3QUMA 4GQ9L 3MUHL 3NZ8A 3D6GA 1MQ8A 1LO2H 1NCBH 3FQXA 2NW2B 5D1XD 3B6SB 3CC5B 1NC2B 4P3DA 4U33A 2R56L 1BAFL 4QRPB 5HHOA 4HLZG 5AD0B 5I8CB 5KW9L 1RZKC 1NLBH 1YMME 1MCEA 3F12A 3VRLE 3O2DA 3HNSH 2E5EA 2EDOA 1QD0A 1OD9A 4NGHH 3MUJA 4PJIA 4E9LA 2R56H 4Q97A 3HA0A 3TPKA 1WAAA 3O6FA 1G9ML 1Y0LA 2FNBA 1FYTE 3MZTA 2XTJE 2GY5A 3VXMA 4U0RB 1X7QA 4XAKD 5BV7H 4NGHL 1DEEB 5JUEL 1S9YB 4DGVH 1X4ZA 1E0OB 1FPTL 1JTOA 5HY9A 3SN6N 3FB6B 4YR6B 3WLWC 5F21B 4MJID 1INEL 1JP5A 4JVWA 4I3GA 4FXGB 3QQ4B 1D5ZB 4OF8A 5CEYB 4UOW1 2RB8A 4I2XB 5CP3H 5I8KH 2FLRT 3N1MC 3SPVA 3QUXD 3FQUB 4ZTPH 4P2OD 1B88A 4KHXH 3SGEI 5D7JD 5ALCL 3CFBA 4KKNA 1FCGA 3VRIA 3VFRA 1KYOJ 3QNYA 3QI9A 3C5ZD 2B1HH 2JB6A 3IDXL 5JXEA 1ZA3A 1I1AA 3CPLB 5CJXA 1YMHA 3PL6D 4PV8A 4WWKA 1IEAB 2AV1A 2XWTA 3VWKA 1MJJA 2JJWA 3RJDA 4MD4A 2APXA 5HVHB 5KVFH 5HDBE 4Z78B 3VRJB 2V5TA 3HMWH 4KJQC 3W0WA 3LHPH 5EIIA 3MRNB 5C09B 4X98B 2DYPB 2VXSH 2X9YA 3LEVL 4WW2F 5D5ME 5F1IB 4XHJC 5M94B 4XBEL 5JA9A 1SJEB 5BXFB 2V7HB 4L9DA 4CN6A 5HHPA 2DAVA 2X9XA 2R8SH 1K2DB 2NZ9C 1JI1A 1Q9LA 2A1WH 1ZVSB 2ZP0T 1G7PB 2JCCF 5HHVL 1RIUL 3QNXA 4PPTA 4X8XA 4OZGA 2FYYB 5HGGS 2IGFL 3MRMB 3B2VL 5J4MA 4H0GA 1G9NC 1G7QA 1IJ9A 1QLRB 4P46C 1MF2L 2Y5TA 1KJ3H 3IRPX 3QEGL 1XGTB 1IBGH 5I19H 1FVDA 2HFFB 3QI9B 1CFQA 3AMLA 5MEOB 3TYFA 3LMJH 3BDBA 4PJFE 4GBXB 1IQWH 4PJAF 3WFZA 1V7ML 3QUYC 4IDJH 4Z7QF 4RNRB 3P77A 3VXRD 1YEDB 3HAEG 4QRRD 4CVXA 1N5AA 4PGEB 4F57L 4YHIA 1HSBA 3D25A 3O3EB 2Z31D 3HC4H 1TLKA 4XCFL 5IKCB 4G6ML 3HAEB 3LKOB 4N8PA 3OKYA 5GGSY 2UVFA 4Y2DC 3U30C 3ARQA 3LKQA 4GH7B 4UTBL 1I85A 3KYMA 3B2VH 1X5ZA 2WW8A 2OYPA 1YUHA 1UB5B 5JO5B 3ESVF 3GSXA 2BC4B 3U0WH 3W11D 1QSFD 1YEEH 3BE1L 5HTSA 3WEXB 4YHNA 5T1KB 1WJ3A 1AQDA 4QRQB 5IBLC 1GVIA 1NFIA 5I8OL 4CUCA 3GKZA 1H3TA 3VXME 5IVXF 4NQCD 1UADC 2IH1A 3I02B 4M1DH 2NXZB 1P1ZA 4NC2B 3UJIL 2VERN 5AZ2L 3K8MA 1INEH 2P8PB 5F8QC 3SOBH 5L8LB 4YFEA 1JZ5A 3EIFA 1TETL 4OJFH 4JFED 2OZ4A 1YEHL 4TN9A 4X80L 4FFYL 4EDWL 1FNLA 5I75B 2NY1D 1UCTA 3BEVA 3GMRB 4NUGL 1IAII 4ZPVA 1YNTB 1QSEA 2J1KA 4UT9L 2VC2H 5HHXH 4TUOA 2WIIA 4QHNA 4GRWH 3KPSD 4P2CG 1EBAA 1YNLH 4X6FB 5FYKH 4OF3A 4ORGB 4O02L 4PY7B 2FGWL 4NSKB 4QTHB 2NNAA 4OZFA 3FL7A 1JHTA 2EYRA 4QNPF 4HGWA 2HYMA 3KYKH 2HVKA 2BC4A 1TCRA 4JZOA 1ZT7A 4KRPD 1G9EA 3JV6A 1CD8A 4PJ5A 1RZKL 4J23A 5I18L 2MWCA 2D7OA 2IAMD 5K9OB 3G5ZA 1LO0L 1KIPB 3DX7B 1J5OL 3RKDC 2XACC 4IHOA 2X09A 2YD1A 3FJTA 5E6YA 1EJOH 1TJHH 1OWRM 2ZJSL 5DRXB 5FOBB 3AU1B 3MGTB 5JOFA 3BIAX 3GI8L 4OCSL 4NKOA 5F6IC 2OSLA 1TMCB 4ETYA 2YA2A 3ULVD 4NUJB 5I1HH 2NY0D 2F8VA 4P5KB 1K9TA 2VZSA 3OR6B 1T0NA 2VDLH 4H88L 3QG6A 2IPKA 5GRWA 4K55A 1DTUA 3QCTL 1XMWA 2D7MA 4POZD 2UWEF 2W65A 5KSAC 4Y2DD 2ICES 1INDH 4QTHA 1U93A 2OXGA 5E8OA 3BKJL 1MCHA 1JRHL 1RUAH 1BFSA 5EN2B 4Z7WF 1TNNA 5DMJB 3S36X 5DEGB 3DMMC 2OJZH 1OP3H 1JK8B 4QRRE 2A6JA 4K9EC 1LEKB 5CSBA 4MXWH 4HWEL 4D2NA 1VENA 5IQ7L 1BZQK 2L7JA 3TCLA 1YEIL 5I71C 1PQZB 3OF6D 4F58L 5DS8A 3C5JB 4RBPK 2YUVA 2APWA 2JIXB 3RI5F 4OTXH 3MUY1 5CJ5A 2A6DA 3O6LH 1IKNA 5D70H 2H45A 3UPCA 5AG8A 5E2UL 4AIXA 3MREB 1BVZA 1DQJA 4RGOH 3WFCL 3KLAA 4LP5A 4PP2B 3CU1A 3OKDB 3CFEB 4WU5B 5E2JA 3AGVA 1PSKH 2OTUB 3VD5A 1B2WL 4YWGL 3U4EB 3VRLF 5IHLB 1PD6A 3L5IA 5AYUH 2ZG2A 3OR6A 5TPWH 3GUTA 1GC1L 3IAPA 2FR4A 1E4KC 4IOFC 4J12A 2OR8A 2XZZA 1XR8A 4P9MH 3ARZA 1CXEA 1JGEB 1VESA 1L0QA 2BZDA 4P57A 4Y16B 5JZ7C 2D7QA 4GKOA 1GPOH 3NGBB 4YHZH 3A0OA 5E6IB 2AEPL 5L9DL 5D1QA 2PCPB 1T89C 3AM8A 4UT6H 2VLMD 3WFCH 2BNQA 5IHZA 2ZUQB 5F9WC 4R96B 5T5FH 5CZVH 4MQTB 5DLMH 3WJLA 5T1MB 1V3KA 4UNUA 5D1XA 2MCG1 5ERWA 4D3CL 4NO5A 5AYUL 1T0MB 1EEYA 3PE9A 2J6EH 1MFDL 1V3JA 1TITA 2BSRB 1RURL 4BFGA 3QUXC 2BY3A 2OS7A 2R23A 4Z7UA 4XVJL 4NQCB 4O58L 3U9PH 1M7XA 1A7OH 1QEWA 3D0VA 1D5MA 2IFFH 1WAAF 4FP8L 4X9HA 1M6OB 4OZHB 1BF8A 1CI5A 1DBAH 2EYTA 1QBLL 2VXQL 4OLZH 5JORB 1MCCA 5K9KA 1XR8B 1DN0A 2D03L 2NY4C 2ED7A 1UZ6E 3BH8A 3PJSB 1WQVT 2GY7B 1RZKH 3IJYB 4KRLB 1MCKA 2XA8H 3K7UA 1CS6A 4NZJA 5FA4A 4LRNH 3NH7L 3VXMD 3RTQA 4JQVC 3TWCH 1CBVL 3VI4F 3ZYZA 3DVNA 4PGCA 4PJHE 5D7LA 4JRYA 4M61B 1CTNA 3M17B 2RIKA 4Q9QH 3MO1B 4MAUL 4FZEH 3QNZB 1IQDB 1MEXH 5I73B 3VFGH 1WV7T 1NFDE 5D7LE 5ERWB 2W60A 4NRYB 5E5MA 3UTZB 3RWIB 4X6CF 1U0QA 5KSVB 1F02I 4D9RE 5JIIA 3F7PC 3MRJA 5FO7B 5K9QG 4U1JB 3MNWA 5HDOA 2F5BL 4Z7QE 5FEBA 3QHZH 4ORZC 3R06B 4JM2F 2B4CC 1D5MB 3PL6A 4WWKD 1INDL 3VXUB 3CVHB 3DX6B 3G5XB 3D39B 3HI5H 1NC2A 3QCUH 4P3DB 3O0RH 4PJXB 3MXWH 1DFBH 2BSSA 1IAKB 5TDNB 3VXSE 4RA3A 3QRFM 5FYKD 2MFNA 4PRHD 2QV2A 2A0LD 4FABH 4YBQC 5DFVD 2X7LA 3BUYA 4DOHE 2A9ML 1FLTX 2DYPD 3EO0B 3KPLA 1J1XL 4I1NB 5GGSA 1MCQA 3SKMA 3PHQB 1MCLA 3MLUL 5F7YC 1CFNB 1IGCL 1A7BA 2B2XH 1EA9C 4NN7B 2C4XA 1IFHL 2JJUA 3P9WB 4OCRH 4WIQA 5IVXE 1MH5B 2BNQD 2P46B 2EDWA 1JNHA 2X4TA 1KEGH 1C8PA 3FO9B 4OGZA 5FK9B 3HRZB 2WWKO 1AE6L 4BFBD 1WICA 2C3VB 2I5YL 5CEYA 4M6MH 3VWJB 4EUPG 3PUCA 4Z8FL 4P9HL 4CADA 3TJEL 1W0YT 4HULB 4JRYD 1K8IB 4HD9A 3C09B 5C09E 3T0WA 3UJTH 3QEHA 4NQEB 43C9B 5E8NA 2CKBH 1ZLVK 1SMOA 3TM6A 5KS9B 4V2CB 1E6OH 2HA1A 5FYJL 1CXLA 5IIEB 4NP4H 4UV7L 5IB3B 2F5AH 3UPRB 5JLZB 5J9PA 4JDVA 5KSBA 3HUJB 4Y4FC 5IW6A 1EXUB 2E7BA 4QRSB 3BSZL 2GJ6B 4I48B 4HX1A 4LCIH 4QNPE 5T3XD 3ZL4L 1L7IH 4LARL 1U8KB 1MUJA 5C7XH 2EO1A 5ILTH 1IGTA 1UWGL 3UP1A 2HH0L 3SDAC 1BEYL 1A7PL 4JN2B 1BM3L 2VH5H 2QL1A 4Z7WA 2AJYH 3W0WB 3MRNA 3U7WH 1V7NH 3SJVE 4QRPD 1JZ4A 1T1YB 1KELL 4ZFFB 5KVDL 3G5VB 1MH5A 3SDCB 1KTKE 4P46D 1A3QA 3DYMA 1YEEL 3CFCH 3BGFC 4JHWH 3ARPA 3VGHA 3DVGA 3T04D 4KAQH 4UOW0 3ZTJH 1MLCA 2VDPL 4EN3B 5FGBC 2ARJA 2R29L 1IGIL 1F6FB 4Y5VB 3IDIA 1N4XL 2EC9T 1KCVL 1UWXH 3OKNB 3G6AA 4XNYH 2PO6C 5GGQH 4OZIA 4U49A 3BKYH 1U58B 5CD5C 2BVUA 3CSYB 1CG9A 4X99B 2HJKB 4TSAH 4YHIB 1TXKA 2APFA 4PJGE 3WIHL 1I9RH 4U6TA 4S1DD 3EJZD 1GAFH 1YN6A 5CIPB 4MZ2A 1DL7L 3QEQE 3RVXC 3TZVD 4NKIH 3IRZA 3ROOA 3ULVC 4KI5E 3W81A 3W9DB 3OX8A 4ZAKA 1MFEL 3SDDB 4L4VE 2BY0A 3TVMA 1CLCA 2X4OB 4GKSA 1YPZF 3MA9L 1KGCD 1J0HA 4LCWE 4PJEF 3M45A 3ZKND 4FFVC 4WTWA 3TJHD 2COQA 4KV5F 1PGRB 1MCNA 4Q2ZB 3C6SA 5CJQL 4LVHC 4G8FB 3WEXA 1JZ2A 2BY2A 3M8OL 5IQ7H 4K94L 1MLCB 4KRPB 4NOFA 1VFMA 2ADJB 3S9DB 1ORSA 1CFVL 1WEJL 2IH1B 1RU9H 4LPVA 4OQTH 4KQ3L 4FABL 3ZDYE 2DD8H 4XVTH 4HQQH 1A1NB 2RR3A 3TBWA 1JFQL 1FC1A 2QQQA 4BFEA 4HHAA 1BBDL 2LTQC 3RVVC 3FB7A 2DWDA 3DMMD 5DJ6A 5B3JE 1X5IA 1XF5B 3S98A 5C09A 4Y2DA 5DK3A 5TF0A 3ROLB 4G7VH 4PTUB 5C0BD 3N1GC 3CSYA 2H8PB 3D39D 3IDYC 2ZUXA 5GS3A 4Y19A 4ZS7L 4LNRA 2FJGB 1NMCB 1R24B 3O8XD 3RWFA 3FCTB 1B0GB 3VFUB 3N9GH 4HUXB 3LRHA 2NY1C 1NMBH 4ZNEA 5KANI 4EI5B 3O41A 2WBJC 4GKSB 4JFHD 1YECL 4IRSB 1N0XH 5F9WB 1U6AL 5D6CB 3E1F1 1RUKL 1ZT7B 1XGQA 2GW5A 4I4WB 3V4PL 5EU7E 1MY5A 1AO7B 2C1PB 1ZT4B 5KVEL 5E6IC 2HLAB 2DIJA 3RHWF 3IKKA 3P0YH 5DJDB 5LG1A 1W72B 4HJGA 4Y16C 3NIFE 1QHOA 1N5AB 4PGEA 5C3LD 5BVPL 2CXKA 1A6PA 1QBMH 3O8XB 3PG2A 5FUOH 3NCMA 3A6CH 1MJ8L 3OAUL 5DRXA 5FOBA 3DGCR 4P2RE 1MNUL 2QKIA 1P4IH 1QKZL 5FYKL 4PTUA 2VJXA 4R2GB 4YDKH 5BRZD 4PGBA 4RGNC 2VDPH 1ED3B 4RRPA 5CWSB 4IIQA 3V4VH 3FT2B 1T0PB 3W2DL 2YPVH 4UTAH 4U1IA 3VI4E 5AEAA 1N7MH 3FFCA 4MDIB 4ZXBC 2HFTA 3U79A 4PJHF 1NFDA 3DGGA 3UTSD 1T7XA 2ZSWB 2F8OA 3BKYL 3PDOA 5IMLA 4NQVB 5KAQG 3EYQD 2GJ6D 1B0WA 3GJEB 5F1SA 4JRYE 1FORL 2WSKA 5BW7C 1A6WL 1UENA 4V1DD 5TQ2H 1VDGA 3JWOH 4TSBH 2ESVE 4ZFOL 2A74A 1LEIB 3EOBA 1MQKH 3WN5B 1BEYH 1J12A 1I1FB 5J12B 2EIZB 3DMMB 1LE5A 1RK1B 1IZJA 3CFIC 4QOKB 1F45A 3RPKA 1R5WA 4Y5XB 5DJ8B 5JMOC 3BP5B 4YWGH 3GSVB 3GMRA 4XB8A 1Q94B 2NX5E 4CVWA 3W0WD 4N0UE 3EO9L 3IU4L 4P2OB 3H8NA 1LP9B 2ED9A 4B53A 2OQJB 3LKPA 2VZUA 5HYSB 2QSVA 3ILQD 4ERSH 2J6EA 4M7LT 5TQ0L 4UT7H 2CRZA 1BOYA 2R0WL 1B4RA 3BP6A 2AQ3A 1I1AD 5T3XL 4XNZC 3IU4H 5EU6D 4RX4A 1UH2A 5GSRB 4YXKH 1WIOA 2QR0B 3VA6A 4TSBL 1MAML 1PYWB 3GUTB 1R3IL 4ONFH 5DTFA 1ZT1B 4K07A 5IF0A 4P23A 3QH3A 1NAMA 2OJEB 1YPZB 4PJEB 4PRAA 4U1KB 4JGMA 3QUML 1M1SA 1ZHNB 4UU9A 5JTWA 3T0EE 4P57B 4OCRL 1D7FA 1L0XA 4PLOB 3SGEH 3IF1B 4OTXL 3SGJA 4J3OC 1FDLH 1CGSL 3O45A 2LVEA 2DLFH 4ODXB 1DBJL 4AEEA 4H20H 3GGWA 4WEUD 1GGTA 2H9GB 1N8ZB 3GRWA 3RY6C 1N59B 4WEMB 5KSAA 4MJIE 4I3SL 2PF6A 1JTTA 4NWUL 3LQZA 3HB3C 3DRTB 5C8JB 4KY1H 5FM8A 2EEDA 4DAGH 4ZUTA 2V9RA 4RMWA 1CCZA 4NP4L 4UV7H 3AUVA 3BGMA 5C0AA 4KXZI 1RMFL 1X5GA 4LGPB 4P4KC 4NO0B 3ARFD 5DEZA 3BP6B 4GAJH 1UEMA 4CW1A 3DNKA 1KLGA 4JJHA 3B5GA 1CICA 1E28A 3GB7A 5D8JH 5DEGA 1N0XL 2ZPKH 5HJ3A 1HEZA 3C9NA 2NXZC 1A9BA 1JPGB 1XCQB 1TVHB 4LLAA 2WINB 1BZ7A 4KPHH 4X6EA 3ABZA 1U9KA 5EB9A 1A4JB 4MMZC 3OKMB 4U7MA 4R90L 2Z93B 3AFLA 5HVFB 4P5TC 1PKQA 3PIQB 3MR9B 3A6CL 2Y25A 1UFUA 5BMFL 4K7PX 1F4YL 1EV2E 5D7KD 1KFAL 1G9NL 3MA7B 3BPNC 3QEUB 1QNZH 5EFIA 3KYKL 3UYRL 3BP7B 4PJBA 3VWJD 1LD9A 4PJIF 4LVHB 4NRXB 5FO7A 1RK0A 2YOCA 2GJ6E 3WXWL 5LXGL 2NXZD 1T80A 25C8L 1KJ2B 4ELKA 1LO3L 3NCJL 2VR9A 1NCUA 4Y16A 2AJUH 4Y4KC 2H32B 3N85L 1A3LH 1SVCP 2YSSB 1S7WB 1AJ7L 3V5DA 4PJXA 1E28B 4JEGB 3S36L 5ID0A 4HUMB 3QQ9D 5CZXC 4IRZL 4DQOL 5EZOH 1JF5A 4L8CA 2HMID 2PYEE 2DLHA 4ZFGH 5HDQL 3WDJA 1PJ9A 5C0JA 1CXKA 4MHHG 2ZUTA 1A4JA 3IJSB 3WE6B 4M93C 3EO9H 3L7FA 1AHWC 1N2RB 3Q6GL 3B4NA 5DD6B 5GGRY 3T3MF 1D5XA 3VD7A 2J8OA 1R3LB 1QEWB 4JY5H 1N6QL 1F4HA 3HMXL 4NFDA 4K7PY 1WBXB 2OMNA 5LJYH 2OL3H 3GIVB 3I2CH 5DMGD 2ZNWA 4ONGL 3JV4B 5B39G 3C5ZB 2YUXA 3B2UC 3DARA 1VGEH 1HYRC 5KJRL 3UTTB 1GXEA 3NZHH 3PDGA 3CK0L 3RIFK 2CSPA 5GSVA 1RUMH 4EUPB 5CGYC 4HWZA 3T08A 3OBAA 2XZCL 4F7TB 2DJSA 1BJ1H 4PJBE 1U8MB 3U9UB 4PRBA 4X0KA 2LU7A 5J9PB 2ZOKB 5C0BE 4GG6A 1F4WL 3MJ9A 3EKCA 3H9SD 5C08D 1OCWH 1U8HA 3A67L 3QWOB 4EI5C 1A6TA 1NANH 1T6VN 2GSIA 4QRSA 4DUVA 3L5WB 1MF2H 1B0RA 4YO0B 1F6LL 4Z78A 5IGXL 2DJUA 4ONHA 4XCFH 4HG4J 1QLFA 4NRZB 2ADIA 1FFNB 3EOYG 5F9DC 4MB3A 3SEPA 2CGRH 2KBGA 3A67H 4JFQA 2VLJB 2RAMA 3NIGF 3F58H 3SPVB 3ZDZF 4DKEL 4HSQA 4EQ3A 5LVEA 1QFWI 4KKLD 1H8OA 3CFBB 1JV5A 5K93A 3P30H 5BZDA 1ZVSA 1KEMH 1E4XH 2BSSB 1IE5A 3MFFA 1EPFA 4PS4L 1NC2D 4FQIL 1CL7I 1XGYL 1B6UA 3QUZC 4TTGA 4CU8A 1DQDL 2R0ZL 5DJ0B 5GHWL 4WUUE 4GW4B 3VA2C 5MI0B 1AGFB 2NPLX 3O9WB 2W9LA 5JOEA 5F1NB 4HMDA 1RHHA 5ADOL 3MRGB 2Q3AA 4U6YB 1DUYA 1IGJB 4RAVA 2MQCA 3L3DA 1K4CB 5E5UB 1DQMH 3QWOA 5F1IA 4OZGE 2VL4A 3WO4C 5ISZB 2J4WL 3D69B 5C0CB 3RGVB 3RA7L 1G7LB 2NX5D 2CIKA 5HHPB 3NACL 4ONHB 3CIQA 1G9MH 3CZFA 3IKCA 4K7PL 4I0PB 3VG9B 3WHXB 2X9WA 3U48A 4D8PA 3U83A 1PVHA 1I7RA 1QACA 2BOBB 1HHGB 3G5YA 2DM2A 4V1DE 1NAKL 4MAYB 3UO1H 2B20A 1S5HA 2YR3A 2FWOA 1S5IL 3Q5TA 2ZCHL 4R9HA 4X9GA 4HK3J 2XWJA 3ULSB 5INCB 1A7NH 3DLQR 1I7TB 4G8GD 3TN0C 4HUNB 1BECA 5KZCB 2IALB 5EO1A 1A6ZA 3GKWH 5HYEA 1FNGB 4F7PB 1VKXB 5F9OL 1JHKL 4ZUVB 1C5CL 4KJYB 4X6DF 3NVQA 1I8LC 2ZCHH 2ZUSA 1IGYB 3TO4A 3VGFA 3KLDA 3IFNL 1BIIA 1V05A 4KK5C 3L5XL 5F1NA 4CN1A 5BRZB 5IG7B 3O9WC 3FHAA 1B4JL 4Q0XH 1GZPA 5C92A 4OLYH 3NABL 4I77H 3SDCC 4MAUH 4FN0A 3ARVA 1TVDA 2BVOB 1X7QB 4JCMA 5CLTA 4YDJB 3W9EA 4YAQA 4ZFFA 1JGUL 4X5WA 1ZLUH 1QSEB 1HXMA 3H9SA 2AK1H 4NO3A 5C08A 4DFIA 3GRWL 2CK0L 3GMMB 4QHNB 3MLXH 1Z5LA 1XGRB 3CFDA 2ICCA 1U3ZA 2Y5EA 4WV1B 3B8YA 3RVUD 3T1FB 1X9QA 4DJMA 4OLWH 5SV4A 2F58H 5ICXA 3HI1A 2AKRB 5ICYA 1I7ZB 4NN6C 4WUUA 1F58H 2BFVL 4YE4H 1A7RH 4JQIH 4GAJL 1A6ZB 5KANG 1OTTD 4S1QL 3C09C 4X7SL 2FEEI 4RMTA 1OCWL 4J3WA 4M1DL 2D4FA 1SY6L 1HINH 4GUPB 1C12A 1KJ2H 5C7XL 2DICA 4NZUH 4TYUA 3DPBA 1J0IA 4X8JB 2WLYA 3V7MA 4IIQC 3T4AB 4WGWB 5H35A 1T22B 5E03A 5T3ZE 2P5EE 5DQ9A 5GS0C 3IDGB 2JELH 4HAFA 4KDWA 1RULH 2D7NA 2DQEL 5LAXB 3UJJH 3TBTA 3QFJE 3K2UL 4ONFL 3U4BL 2DM4A 5LCVL 4HXAH 3BP4B 5J6GB 3WYRA 3V0WH 3MOBH 3BZEB 4DVBB 3TF7C 3OV6A 1P9MA 5F7DA 5EN2A 1QVOA 3LKRA 5BS0D 5HYSG 5D1QD 5HGAA 2DMCA 4P4RA 5GHWH 1A1NA 3TBWB 3CSPA 4AM0B 1LEKA 3MLWL 2R0KL 2ZOLB 5T1LD 3QDGB 2FO4B 3ZYIA 1X5HA 3QRGH 5IROC 1CDYA 3HTLX 1JWUB 2JIXA 1I1AC 2H8PA 3LB6C 1Q94A 4WHDA 4G6KH 3K8LA 4P5KA 4NQXB 1T03L 1I3GL 2H32H 3BDYH 1OT2A 2DMBA 2FJGA 3C60D 3KLAB 4OI9A 1JNLH 1MHPL 3AM8C 3OJDB 3X13A 2BVEA 1DUZB 1UM6H 4L8SA 2Y1VA 1FO0L 4LVNC 1HIMH 4ELME 1MY7A 3KYMB 4N5EC 3BPOC 4OZFH 3V7AE 3TBSA 1DFBL 3MMEB 4LP4A 3VWKD 4YHYC 1JK8A 4I4WA 4S1SH 2CLVB 2XQYG 5C2BH 3ESUF 4JQXA 3BP4A 4XMPL 5FYLD 5I1DA 4N0CD 4QXGH 1IZKA 3FRUA 3SQBA 3MPCA 1J1PH 1JRHH 1CL7H 2FZ3B 4OF6A 2CK0H 1NBVL 2IQ9L 1X5KA 5IEKB 5FGRA 1JNJA 3BOVA 2VN4A 4LOUC 1FNAA 1KXQE 2UV3A 3CFEA 5I8KL 4OKVB 1OP5H 5IVNA 3RY6A 3CLFL 3SHSA 4XX1E 5FA3A 2BDNL 2WM0A 1NUFA 2K7PA 2OLDA 2ZNXA 1EEUA 2P5WD 4ZUTB 1I4FA 1PX3A 2A0LC 5F89B 4ODUB 5KS9E 2B1HL 4MDIA 5BS0A 2I5YH 1FH5L 1UCBL 1IARB 2NLJB 2Z8WC 4M9PA 3NCEB 3BN3B 2VZVA 1SM3H 1WT5A 2B4CH 3GKWL 4NQCA 4Z76B 1DQLH 3RHWK 5T1DL 4OZFB 4NPYB 5H94A 1M6OA 1JFQH 4OZHA 4PREB 3JWOC 4MYWB 1P7QA 4EIZC 2CDFA 1RZ7L 1UACH 2PYED 4MCZA 5F93C 3QDGD 4JO1L 1KTLB 3G5ZB 5JQ6L 5FA4B 2AJVL 1QNZL 2DLEA 2BCKA 2XKNB 1ZV5A 4JM2D 3VXRE 3ZDZE 2CUIA 2XPGB 4KMTH 5FGBA 3QA3A 1WCBA 4YHKH 3PWLB 2AP2A 4WFEE 4C56A 1EO8L 2Z31A 2D0GA 2P44B 5I17A 5DLML 2RFXB 1JGLH 3OZ9L 3TO2A 3C6LD 3HNTL 4Z95H 4E41D 3ARGB 1RIHL 1QSED 3EFDL 3U4AA 3OKEB 1S9VB 3QULA 4PG9A 4LPWA 2NY4D 1JHLL 5DURD 1L7TH 4OJFL 1CK0L 2R2BA 4QHUB 4OD2A 3IXTA 4I0CC 5EO9B 2F19H 4OZGF 1F6AB 4G6FD 3VXUA 5DUML 5I1IH 3SKOA 4YFLF 1PFCA 5CBAB 4I18C 3W39A 3DETC 3QDJE 3NAAH 3TBYB 4HS8H 1I9IL 3VCLB 5C0NC 2P49B 2QADC 4BSWB 3WBDA 5D7LB 2BJMH 4H0IA 2JCCE 4JHWL 1OW0C 4ZUWB 5DEFB 3T0EA 4NNPH 1PQZA 1KNOB 3ELAT 2VDRL 1IQDA 5C8JA 4BFIA 2ATKB 4PJHB 2C9AA 3KPTA 5D7IB 2NY7H 2BVYA 3EYSH 3C2AL 3OKDA 4CKVX 3PP3H 4K71B 2DQTH 5TQ0H 1GZQA 5J13C 3FQNA 2Q87A 5ALBL 3HPJB 4LFHD 1HDMA 4KUCD 4PJ8A 4WJ5A 2ZKHH 2CKBB 2F53A 4TQEH 2DQFA 1NGXA 5CEZD 2XZCH 1BF2A 2OTWA 5CFHA 5A3ID 1TZGH 2PO6D 1R3IH 4HKJB 3U0PA 4PJDB 4L8BB 5GPRA 2AJZA 2AJYL 1BOGB 2YD7A 4U6HA 3GFUA 3QHFH 2XZAL 1OGAB 2VKXA 3GHBH 1YA5A 3U1SH 5IFHH 2DI8A 1NFKA 1U91B 4JFFD 3RY4A 3WUWG 5C70A 4OF5A 4EI6B 4OB5H 2A83A 5GSVB 3RX5A 3QDMA 2FD6H 3MRLA 3M07A 4R4NC 1TZGL 3TBYA 4KK6D 2ESVA 3UROR 4PYGA 5IB3A 4RAUA 4HWEH 3BD4A 2MPAL 5KVMC 4MVBC 3UC0H 4YXLH 5IK3A 4M5ZH 1HXYA 2FATH 2JCCA 3EYQC 1T6WA 5D1ZC 1HQ4A 1IM3B 4TVPE 1JPTH 4QXUL 4HX1B 3QUKA 4L4TE 4PY8J 5D2NE 4KFZC 4UIKL 1AXTH 5E4EC 3RNQA 5C1MB 2DQDL 3OAZK 1Y6KR 4XPAH 1LO0H 2BX5A 4NHUB 5EBWA 1HE7A 3G5VA 1HHKB 5I75C 3JSSA 4OT1H 1NKOA 2DQFB 2GSGB 3OMZA 5IW1B 5BOPA 4J3VA 4QRPA 1HILA 3MFFB 1F4XH 3FN3A 5J11C 5JLZA 5BO1H 4NM4L 4O02H 3WFDH 4ODHL 5DHYA 3H0TB 4YHPA 2CUMA 5FAAA 3MLUH 5ADPH 3IGAB 1BIHA 2PUQT 4J6RL 1YECH 1UXWB 3WE6A 1PG7W 3SDYL 5EZJB 5TDPA 4U7SA 3MBED 4XP5H 2NCMA 3OKOA 4NQSA 4RAVB 2WWKT 3G08A 3HG1D 2XT1B 1ZVHA 2P5ED 4FQLL 3QUYA 5GGTL 4F8QA 1A6VH 1KCKA 5EDXA 1FNSL 2N4IA 1HHHA 3OGCA 2YPVL 2F74A 3UBXA 1NEZG 1XF2B 2V2WB 4CVZB 1BJ1J 5KTEL 5EU5A 5JHLH 5I6XB 4N0RA 1P4IL 1QKZH 4JO3H 3LIZH 4ZQKA 3DO3A 3TVMB 2HT2D 1FVCA 3FO0H 4LLQA 1G7HA 1MCBA 1CD9B 3GI9H 4PJDF 3FONB 4HXBH 5EU4B 4Z5RA 5JW4N 1HWGB 2PR4L 4M7LL 4HBQA 3WS6A 4ZUSA 5HHOB 2FX7L 1VADB 5EOQL 1FYHB 3ULSA 2DWEB 3MV9D 4HDIA 5GISH 4XZUB 3LN5A 1A1MB 1ZXQA 2IPTL 3RL2B 2FGWH 4JB9H 5MEPB 1EGJH 3AB0C 1EH9A 4LBEB 4EDXA 3MTRA 2BNUA 2BNRD 5HHXL 3KPLB 2B0SL 3ILPA 3MBEA 4QXWA 5CJOH 1NGPH 4C59B 4ENED 5E5RB 3UTSB 1TJIH 1S7UA 1XF5A 5GJTL 1E4XI 3MV7D 4JHAH 3NTCL 3DHMA 3WFBL 1M7IB 5CEZE 1QFHA 4I3RH 5E4EB 4ZMAT 5DR5L 1MRCL 3HPLB 3ULUL 1RZ8A 1J11A 3R1GL 3MROB 3W11C 2F53D 5J3HD 3PHSA 3RWFB 5IQ9B 3WD5H 2V9TA 3L3KA 4K3GA 5EU5B 2P43B 3VGAB 1G84A 1K8DA 1TTGA 3EYFB 2F54D 5T5FL 3UC0L 4P99A 1ULVA 2AI0H 5CD5D 5KVDH 3T1FA 1MFEH 1UYWH 1OPGL 4IRSA 2Y5TB 4DN4H 5B4MC 3EUUA 2EKJA 3MNVA 1OQXA 3GJFA 4D9QE 4OCWL 2VXVL 4XI5C 4PJXE 4HHAB 1BWWA 5MEOA 2IANE 2AJXH 4MMXC 1A1MA 5CUSL 2H1PH 3L3DB 4GXVL 2AV1B 3GBML 4XC1L 4V2BA 4JPKH 1ND0B 4XAWL 5DGQA 4XNUH 3VRJA 3OAYK 1G7LA 3IFPA 3MJ9L 3JUZA 1JYVA 3D85D 3GMOB 4CMHB 5DD5L 2ZUWA 3UTSA 5F8RC 4DN3H 3WHXA 1KENL 2DYPA 3FCTA 4HAGA 4EBQL 5ACZA 4NC1C 4H1LG 4HK0B 3CNKA 4R7DA 4ODWB 5F7EL 1HCVA 5HGDB 2VUOA 4BUHA 4PRPD 3BO8B 4LFHG 4KC3B 4UDUB 1YJDH 1NUGA 5DYOB 1DLHB 1NCTA 2DIAA 3MCKA 2VXVH 2LE9A 3VFWB 6CGTA 1OOAA 4KU1A 5CHNB 3JVGC 2Q20A 3ALWA 5FHAH 4B7IA 4L4VB 2DQCH 4YXLL 1D5BB 2ZSVB 3LDBC 3STZA 4MXWL 3T2NL 5IBTL 4AT6A 5I6XC 1S9XB 2C4FU 2EC8A 5F7MC 5DO2D 4WFFD 1CLZL 3CH8A 4JPVH 3U82B 5JZ7D 5GXBB 5TPWL 4ZSOE 4LSPH 1JMXA 2WANA 1RK1A 1DVFD 1UG9A 3BIKB 3HE7B 1ES0A 4HCRL 5B3NA 4MA8H 4O5LL 3P9LB 4PY8I 1A22B 4QYOB 4XMLL 1B6DA 3KPMA 4KRMB 5F7EH 3EZJB 1Q9KB 1UZ6F 2G2RA 1NDMB 2OM5A 2WWMC 4JM2B 4EZMA 5I1IL 4S1QH 2O5ZH 4P2OA 2PNDA 4UB0L 3RPIB 5C9KA 5LWYH 1OB1A 3ARYA 4RCAA 5IWLA 4HH9B 4DKAA 3GDBA 2VLKD 1I8MB 1T7WA 1OLZA 3LVEA 3U2SB 3E6FB 4KROD 4R26H 4U6VL 5GS1A 5IEHB 5F1KC 4QGTA 1M71A 1BAFH 1CFQB 3JTSA 5ESAA 2HFEA 1SMAA 6FABL 2IAMA 2CLVA 3QXTA 3HR6A 1MAKA 2D7TH 4YBQD 1NFIB 4AH2A 5J6HB 5D5MB 1ETZA 2AXJA 5T5NF 4ODTL 5FV1L 5A2FA 5CILH 3HI5L 1D5IL 2SEBB 2W0PA 4OLEA 5FO8A 1KV3A 4FMKA 2GYSA 3HE7A 3HAEA 4L5FL 3U46A 4Z8FH 2XIDA 2EO9A 2YN5A 2G2RB 4JM2A 4MX7A 1RUQH 4WU7B 3BMWA 4TNVF 4MWFB 3JTTB 1P7KA 3RZWA 4ZOEA 3NACH 4CVUA 4NJAL 2R1YA 5EBGA 4R90H 2HP4A 2NY0B 2QLVB 1DBKL 1JVKA 3QG7H 1P53A 2C26A 5BZWB 1LK3L 1J05B 3NCYS 4GQPH 4IRJB 4Q9QL 4PY7A 2BSED 3N1FC 4A6YL 3SKJH 2EE2A 4HGWB 5HYFA 2M1KA 3MV8E 1SEBA 5CILL 4P2QA 1CQKA 1QYGH 1FFPA 1NC4B 3O3BA 5TFSH 2ZOLA 2ADGA 1ZT4A 5J13B 4K94H 3GMNA 5GRJH 2Y07H 1JWUA 5KSBF 4K3EL 2X4NB 4ZPVB 1FVEA 3S5LG 3U0WL 1LNUB 5SWSE 5FO8B 4NZTL 1PKQB 2MJWA 3ZSTA 4Q7DA 4Z0BH 1E4KA 2IQ9H 5I30H 2GEEA 1XCTB 1XF4B 3TNMA 3AAZB 3HE6C 2QADB 5FCUH 3DBXA 2PTVA 4HV8B 4HPYH 3EJYD 4LKXB 3ARGA 1QBBA 2DLFL 4LCWD 2FR4B 2I25N 4HMEA 3QXUA 1S9VA 1MRFL 2WNGA 3QULB 5FGCE 3T77A 1MCOH 3C9NB 3T0VA 3PDOB 2P8LA 4U2ZA 3V5HB 2XN9A 2XZAH 3DTXA 1WFUA 4H26A 3QJFA 3ULUD 4YFDB 1F6AA 4J2XA 2R0LL 4FFZH 3V5DB 1IBGL 1FE8L 5GRVL 2R1WA 5GZND 3VCLA 4DN3L 4KK6C 2OBGA 2J88H 4PG2A 5ISZE 1WBYA 3H3PL 3KYAA 1IQWL 3HG1E 3H42L 2VLJD 4LLUB 5FKPA 3TN0A 5SX4I 1J8HD 1NGWB 4U1SA 5CMAA 3T0EB 5C0BA 1WK0A 4YQXL 3SBWC 3VG0H 1W72H 4PJDE 1LNUA 1FYTA 4FP8H 1V5JA 3F7YB 1KJ2L 4LPUA 4F9PC 1R3HB 5C0FB 5F88A 5LCVH 2GT9B 2QEJA 1EAPA 4KZEL 5EWIH 4X6BA 3BD3A 4U0QB 1XF4A 5C07E 4HJJH 4OD1H 2IBZY 5BJTA 1G6VK 1FZKB 2VDKH 1JWSA 4C4KT 5I16B 3HNTH 2H32A 3V6OE 4LARH 4L4VD 3IFLH 5GSRA 4NQDA 4ZSOA 4PJGF 1PYWA 3ETBF 2NY1B 2DQGH 3RDTD 3QRGL 1ACYH 1DN0B 3BXNB 4M03A 2DS4A 3V5HA 1ZKAA 2PN5A 2KZ1B 3QJFB 1MRCH 3ULUH 4FNLH 5IJVB 5C0CD 2X40A 1J0ZA 1FC2D 1TPXB 1R5IB 5KVGH 1EFXD 3EJYC 3V5KB 5HHOD 1JCKA 3QT2A 1Z2KA 1N3NA 3G6DL 1Q0XL 3QQ3A 4LCCB 4YDVA 5EIQA 2ESVB 5DJAA 3T3PE 2H9GA 4WI9A 1CDUA 4KV5E 2YUWA 4GG6B 1U41A 3PNWB 3O9WD 1NCAL 4PGDB 3TIDA 3DX8A 2GFBA 4OQTA 4YPGA 3THML 2EDHA 4NO5B 1G7MB 1XR9B 4HZLA 3QUKB 5EU7C 4G3YL 1KC5H 4PJGA 1RUKH 5E2TL 2BSRA 3AS2A 3QIWD 1FH5H 3UTTE 2RBLA 4Q0XL 3S37H 1JUFB 2JF1A 4OD2B 2UZXB 4ZFGL 5EBWB 4OZIE 3L3HA 4F15C 1A47A 3C2SA 5MENA 3CDGA 3SKOB 2A9MH 3CFJB 3EOTL 2Z91A 3RNKB 1DSFH 5L6YL 3LS5H 2JJSA 2B5IB 3EYOB 4F33B 3OGOE 1WWWX 5FV2A 2R1XA 4XCEA 1FL3B 4M02A 3KG5A 3KR3L 1AO7E 1AJ7H 3OG6B 5B8CA 3EBAA 4C55A 2HTLD 1IGML 2IADB 3LPFA 5GRVK 1KC5L 3RAJH 1MFNA 4LL9A 3MRGA 5DRWA 2H2PC 3PNWA 1LK2A 3ZE0E 3P4MA 1XT5A 1ADQH 3MA7A 4APQA 4HEME 3UAJD 4LIQE 43CAA 2P1YA 5HY9B 1LVEA 4L3EB 4X9BA 2GTZA 2OP4L 4CJ1A 5E2WH 3REWA 3DHJA 4PRPA 5JW4Q 4OZ4A 3QQ4A 4Z77A 4KK8C 3CMOL 3MRCA 3V6OA 1UCBH 4ETQB 1HHIB 2VDOL 4R0LA 4ODHH 1KXVC 1G0DA 3PWUA 3WSQH 2MCPH 4UTBH 3UMTA 4BK4A 3VXOA 3S34L 2HVJA 3DIFA 1CLOL 3SCMD 5AZEH 4X4ME 5EU6B 5IP4A 5FF6B 5DWUL 3BQUB 4XXDB 4PV8B 1GGIH 1IKNC 3TT1H 4BQBA 3IS1X 3HS0A 3PGCA 1J18A 2CGRL 5HXMA 3MRFA 1UKSA 4DW2H 1D9KD 5F44A 5DHVA 4MNQB 3TYGH 4LLWB 2XWBB 1TTFA 4PIRF 4LGRB 3TC9A 2HTKD 5GGSB 3IS0X 1QSZA 1TNMA 2BVOA 2XN9E 3ZZ1A 3K80A 2WLZA 3PL6B 2VDKL 3DX6A 2EXWD 2Q3ZA 2Y36H 5FYLE 1ZGLP 3QBTB 2ID5A 3LKSA 1Q9OA 1U3HB 1T04A 1Z9MA 5BQ7A 2C3GA 3RQ3A 4JREC 1Z0NA 2PW2A 1MJ7L 5HYQA 3WIIH 5EUOB 4EOWH 1HKLL 5EZIH 5HI3C 1ZGLM 4LHUB 2HFFA 4HWZB 3TO4B 5DJXB 3K2UH 5L2JA 3IB4A 2HH0H 1F97A 1MJ7H 3E2HC 2HG5B 1ZLWK 1WUNT 3G08B 5HVHC 4QKXB 5FDYA 1KIQB 1T2QH 2R9HC 2VDRH 5TE4L 1CFTB 5A2KH 3FMGH 2YEZA 3P0VH 4GUPA 1F2XK 5B38B 4X7TB 4MCYA 5ITBH 1C5BH 2W0FB 5A2JH 1BWMA 1JTPA 1LHZA 5D2NA 4XB7A 2W91A 4DGIH 1Z9SA 3VMPA 2AS5M 3QIWA 1QPXA 3VXMB 4ESKA 4XBPB 5DDHB 3EHBD 5B38G 4GAYA 1P84J 5FB8A 1Y6NR 4K3DL 4RGMB 3CFDB 1RZIA 5JPMA 3MC0A 5J0BA 2UWEB 3HMXH 3W9DA 4UINH 1DE4A 1UA6H 1LEGB 4RFOH 3WS3A 4PB9H 1WSST 5DUPH 1K5NA 4FXGA 1SEQH 3DVGB 3ARXA 3GM8A 4AEHH 2B39A 3MUGB 5C2UB 4M48H 2QJDA 2YPLA 2X05A 1KLUB 2ARJB 5FGCB 4YEEA 4FQXC 5C0GA 2A6IB 3QNYB 4GW4A 3B5HA 3HLAA 4G6JH 4IMLB 4AQOA 4Y4KB 5I1AB 4HUUA 1KJMA 2XQYK 2Q8AL 2BVPB 1NGYA 3D3VE 4JKMA 3P11L 1M7IA 4AK1A 4Z7UE 2FLBT 3ULVH 1NDMA 4JKKA 3SJVD 5JQ6H 4NQXA 4MCYB 3FB6A 2IBGA 2DDQH 4WI2A 4UNTA 5I1JH 4MA3A 3GSUA 5I8EB 2VXSL 4POYA 3S8WA 1VFAB 4NSKA 5BXFA 3O3DA 3KVQA 4KHXL 2VLME 3MBXL 5DVLA 3VFOA 1U8IB 4MXVE 5DQDL 1LEGA 4L3AA 1QVOB 4KQ4H 1KG0A 1TCRB 5L0QB 4N0YH 4Y5VA 3Q0HA 1CLOH 2BXZA 2CO7B 4Y19E 4XRCA 3TN0D 3NPSC 2HFEB 3ARFC 4WUKH 4PJIE 2YRZA 4JO1H 3JWNC 2ENYA 1PZUB 2L0DA 3KJ6L 1N6VA 3C6LB 1IEAA 2PYEB 2AABL 2E7LC 5IR1B 4KQ4L 2JIXD 3DUSB 3RWDA 2Y06H 3P4NA 5HHOE 1A2YA 5DVNA 4Q6IC 2XN9D 3IU3A 1BIIB 2APBA 1HH9A 2B0SH 3MGTA 4IJ3B 2FX9L 3D39E 3MV11 5CJOL 5IESH 2BNRE 5HGBB 1UACL 1AGEA 1BD2B 1GZPB 3N9GL 1X5FA 1X4YA 3B9VA 2ZUQC 1YEHH 1MREH 4XMLH 1ZA6A 3RWCB 3L5JA 4CNIA 1J0KA 4KH2A 2YRLA 4GOSA 4XMKL 2DLGA 3QO1B 4LAQH 2X4OA 3QDAA 2NYYC 4OAWA 5DYOA 3NPSB 3GMMA 6FABH 1P4LA 3GSUB 1QZ1A 2HKHL 2XQBL 4WNQA 1I1YA 3K8KA 1TJGH 1CICC 4L4VA 4H8WC 1G7JA 4Q58C 1ZHBB 4MQSB 1FGVL 4DK6A 4WV1A 2BMKB 3ZYOA 4GS7C 4RMRA 5IMKA 3T3ME 4WEBH 1OGTB 1T5WA 5TH2B 3G6JB 4KTYA 5ICXB 2VR5A 4KJPC 3V52H 1AO7A 2C1PA 5DMKA 3SGKA 5T1KA 1RZFH 3BIKA 2EIZA 3MXVL 3WKML 1WIPA 4PJCE 1QFWL 1XGPB 1VFUA 4OKVA 2R0WH 1F2QA 3QUZD 1Q9KA 3OXRA 1A6UH 5D93C 4M93B 4WVRA 4UIMA 4D0CA 2Y4SA 3GJFH 3DUSA 2XA8L 3IDJB 3RVWD 1U3YA 5J7CC 2P8PA 1I9RL 4H5SA 4XTRD 1FZOB 4NKMA 1FFRA 4PJBF 3S5LB 1V7NL 5CP7B 1EEZA 2EKSA 1KTRL 5SX4H 1ZA6B 3RWCA 4HUXA 4GRWB 3VJ6A 1P6AB 4XWGH 1KCVH 1M71B 2DRUA 3V79C 4NT6B 5L88L 1R3KB 3V95A 2R2BB 3H42H 4QHUA 1PZ5A 2IGFH 2OJEA 4LRIA 3LEXB 5IBTH 1AQDB 1EVTC 4LVOC 3ZDXF 1A9EA 4DVBA 5CBAA 2VZ1A 1MVUB 5DJZB 1P1ZB 3P30L 2DQUH 3KPSE 4EBQH 1AH1A 3ULUF 3DV4A 1Y18B 3NCFB 1T7YA 2VQ1B 2Y7QA 4A2LA 3QUMH 5TJWK 1QRND 3KNBA 1G6RL 4LLUA 2VDML 3X3GH 3O4OB 5E8DH 4QXUH 1WC7A 1LO4H 3JUYA 4JPKL 4P5TB 1F8TL 3BX7C 4OCYH 3IDJA 4L9LB 4NZUL 5H37H 3O6ML 4P9ML 3TO4C 3P3YA 4HWUA 1FL5A 1MIML 2X4PB 3P0YL 4NO0A 5C0DB 5C07A 3AXLA 3UJTL 5DK0B 4QTIL 3MLZL 3ZE2F 2R2HA 3WMSA 1LP9E 1N26A 4PBVC 1ZTXL 5FYJH 4P23B 5I1LB 3BMVA 4HIJA 2EICA 4K7FB 4ODVH 5ITFB 2EXYD 1H5BA 1R3KA 3EO1A 4P4KB 3SQOH 2Z4QA 3SJVB 2WINA 4P9HH 4GRLD 1AO7D 4FFWD 4U31A 5EUKB 2YBRA 4JLRB 4ODXA 3SE9H 1QSFA 4NCDA 2WBJB 2A6JB 5CZXD 5DJAB 4LEXH 5K33A 5CP3A 1VFBA 1GSMA 2P5EA 1IAIH 1KGCE 5DS8B 3DYOA 2AV7A 3D3VA 4KROB 1NANI 1EGJL 4PUBL 3BT2L 5T5NG 4OLWL 3UAJC 2AXGB 1GIGL 2FL5A 4I13B 4ZS7H 3QCVH 3BGMB 1RJYA 1IEBA 2I24N 3BAEL 3QG6B 3FRPA 5BS0B 3RVUC 1FBIL 4OLYL 2X4PA 5IT2H 1BGXL 4OCXH 5HDQH 5HHQA 2KUTA 3DOSA 5I9QB 5IROA 3WSQL 2LTQB 4AG4L 2VLKA 2W1NA 3AREA 4OBSA 2FX7H 3FFCD 1TQBB 5E9DD 3W5NA 4G43A 5IWLC 4G9FD 3STBA 4L4TA 3MV7B 4NZRL 2C3HA 4HMCA 4U1MA 2ZG1A 2Z4QB 3LIZL 5F3HA 2X1OA 5EU3A 4YHPB 1ZOXA 4HUWA 2ICWJ 3ZTJG 3MLRL 4HIEB 4WDIB 4N8CH 4P5MA 1QTYT 2EDBA 4YUEH 4XPHH 4JFXA 1FYTB 3F8UB 4G6AC 1I75A 1CIUA 5LBSL 5INDA 1CGTA 1Q38A 3OJMB 3UTPE 2HRLA 2G5BB 1A7QH 3FAWA 5F7KC 3RNQB 1JE6A 3QUYB 3D3VD 4QEGA 2FATL 2ZZUT 4R4BA 1O7VA 1FZKA 1MPAL 3FQWB 3VD4A 3H7BA 4G6JL 4JY6A 1P69B 2XV6B 4MNQD 3JVGA 5FK9A 3B5TA 4M1GH 4QLRA 4HWBH 3P11H 1UWEH 3VMOA 4ZO9A 2EDNA 3PGDA 3RWEB 3QIBB 1FFOB 4Z7VE 5T1DH 4OCNC 3ZE1E 4PJAB 4X5XA 4XPFH 2PTTA 4KY1L 4OCYL 1KB5L 4KTEL 4HFWB 2AEPH 1J0YA 2UUDK 4OUUB 3PQYB 3LZFL 3QXDB 5EU6A 3RL1A 1JNLL 1MHPH 3MV7A 3DWTA 4QCIA 5TDPB 5JR1L 5D9SB 3WIFA 3LPGA 1BFTA 2A73A 4XPAL 1QFUL 1L6ZA 2OMBA 5I9QC 1EHAA 1KJ3L 3SE3C 2BNQE 2OK0L 4JFXB 4G6MH 1MUJB 5DD5H 4AYFA 3VXQA 3L7FB 1JWMA 4LSUL 2ADIB 4NKIL 4JFHE 2YC1A 5DGRA 1TPXC 1VCAA 1HDMB 2KL6A 2DQIH 2FIKB 3EDJA 3O2VL 4LCUB 3VD9A 3MROA 3E8UH 1A4KB 3GIVA 1J87A 1I8KB 3QXVA 1MI5B 1EHXA 1CU4L 4N0UB 2YS4A 4WGVB 3MYJB 2BOCB 3TVMD 3X14A 2J8UB 3AROA 5I1KL 3QDGE 4NN6B 3P73B 4PD4J 4U2YA 4IMKC 2Y23A 5E94B 2GCYA 3PWPA 4KMQA 3T2OA 4QY8B 1BM3H 2VH5L 5ANMA 3K3QA 1NCWH 1YN7A 4UDTB 3G6AB 4AENA 4RAUB 5CSZB 5EZLA 1LK2B 4ZD3L 1CIDA 1NSNH 1IKFL 3X12A 3M17A 1EFXA 4WI8A 2I60L 1A5FL 2A73B 3CXHK 3SDXF 2QQNH 5T33L 1R3LA 1OAQL 1FZMB 1BP3B 5D7IE 3QQ9C 4WCYH 1RULL 4NRYA 5E5MB 4ZXBD 3F6IA 4DTGL 1F11A 3G6JE 3FOLA 4W68A 3E3QE 5ACZB 4Y4HD 3F7VA 1TDQA 4DEPB 3NTCH 3WFBH 4JJ5A 1TQCB 3WKNA 3CDYA 3BO8A 4YZFF 1CICD 4NKQB 1CVRA 3O4OC 2GAZB 5BS0E 3N06B 3Q2CA 3QDJB 1UT9A 2NYYD 3WL9A 2E6QA 1EMTH 1U3HD 3DROB 2OR7A 5HYJA 2YZ8A 5LGHL 3UBXG 3LHPL 1NLDL 1CZ8H 1NKRA 4UAOC 3PV7A 4HKBA 4LMQE 3HS0B 3PGCB 2JJVA 4LVEA 5DA4A 3DO7B 2BVQB 2XTJD 1EHLH 4JFFA 4W70A 1DBMH 4W6WB 1S7XB 4U1LA 4UQ2A 5GRUH 4NCC2 3KPMB 3BZ4A 3X12B 5KAQF 1MCDA 2PO6B 1AIFA 1Q72L 4G9FB 3WO4B 2H26A 3O6KL 1T2JA 5I73C 2Z9TA 1LQSR 3F7VB 3UZQA 5BQ7B 4X4YA 1DL7H 3HI6L 1Z5LB 4JKPH 5C0IA 2VIRB 4KHTL 5E4IA 4H8WH 2JE8A 3SDCA 1K8IA 4JDZA 3OWEA 3LPWA 5DRNA 3FONA 1OQOA 2P47B 5L7XL 5FKAB 4NQDE 1EO5A 5ESAB 1PW3A 4O2CB 1P9MC 4RFOL 3WFHA 5C0RH 4MA7L 2NY2C 3CSGA 4U6YA 2MHAB 5DD1L 1OF2A 5KSBB 4TOYL 5BVJA 1YYMH 4W6YB 4EN3A 1JGUH 1MJJB 3SCMA 4YHOH 5SWZE 4YIQB 3RWDB 2BRQA 1YY9D 2CK2A 4E0RB 2Z92B 5D2NB 3I6KB 5ESVB 4H20L 1YEKL 4LPXA 4PP1C 1C7TA 1A6VL 4EDWH 3MGOB 4WU7A 2W0KA 1T22A 4DGYH 3VFSA 4QXTB 4L8SC 2WP3O 1NCBL 3E6FA 3RU8H 3FFCB 4S1DC 5GGUA 2ERJC 1P4LB 3L3KB 5C0CE 1KEML 1NFDB 1C08A 1HCFX 2J6EL 2IAMB 3FO1A 1J8HB 5TE7H 1TETH 4PRIA 2HN7A 3OX8B 3IDUA 3CCHA 1KLUA 4O58H 4LSVH 3LSOA 2JJSC 3G6DH 4GRMA 2HRPL 5JIPA 2FEDD 4QWWC 1LEIA 5ANME 5F3BA 3HLAB 3NGBC 1Z0MA 2EXYC 1TCMA 5GZNC 4Y4KA 5AD0A 3V9FA 3X3FH 3MLSL 3EHBC 4P2RD 5JHDB 5CBEA 1NGQH 5L0QC 1AXSA 2AVGA 4YHMH 1NGYB 4ISVA 1R5WB 2DIBA 4U3XA 5JNYB 3LEYH 4YDJA 4X7EC 3EYVB 4YIQA 4WO4A 1YY8A 2DWDB 4P3WA 2EDDA 3GMOA 4PB0L 4TULH 1YC7A 4BYHA 4MA3B 1MLBA 5F7LB 5I1CH 3SDAD 3KPQB 4HJJL 3S5LA 4LLVA 1VSCA 2P42B 3FHQA 4CAGA 3HG1B 4LVOB 3MOBL 2I9LA 4NBZB 4OF0A 2R69H 5JO5A 3QO0A 1EZVX 4M62H 3IXAA 5EC2B 1KB9K 1UXSB 1OAUH 2DQUL 4CJ0A 4Z7OF 3CDCA 4TTDC 1I3VA 4NHCL 2XZQH 1KCSL 5I71B 3ARED 1AXIB 1J8HA 2IJ0C 4EI5A 3LEXA 1MPAH 3MJGX 5E0QA 3O41B 3I02A 1JYWA 1RUAL 1A6WH 5DJZA 1OP3K 2A2QT 1NH6A 1QRNA 4D0BB 2R39A 3JZ7A 1WBYB 1RZGB 2IG2L 4WWKB 1U8OA 4U6XA 4ISVB 3KPRE 2FHCA 2AERT 3Q5OA 1MCWM 3ULVF 3KPRA 3RX8A 3T09A 3U6RB 1D9KC 3F7YA 4K9EL 2DKMA 3MRIA 4M7JH 1AC0A 1BZ9B 3V6OC 2YD3A 3MOAL 2F53E 1WITA 2CMRL 1UZ8A 4W81A 5FIEA 1QA9A 5F7UA 5J6GA 4TNWK 1JHTB 1QBAA 4KMLB 4G9FE 3EOTH 3MMEA 3ES6A 2GI7A 4P4RB 1F00I 2LAAA 4OGXH 3V2AR 1B4JH 3QUXB 1UJ3C 1DQLL 1TZHB 4JRXB 2CRMA 2O5XH 1KIRA 5J1AA 1YYLL 4XWOD 1KUMA 5BVPH 4NJ9L 3KXFA 4QRRB 3VXSB 2VXTH 2DQHH 3LV3A 3QCVL 3TYFB 1RIHH 4WW1B 3ARBB 4YH6A 3PIQA 4JANA 4O9HH 1FZOA 4NKMB 1J7VR 3Q3GA 5C9JB 3MACH 4FTVE 1XGUA 1CQYA 1TENA 2NY5C 1LILA 1URLA 4L8SB 5FA3B 5CD3A 1E4WL 5CCKL 3FRPG 3CH1B 1PEZA 4P2RA 3AY4C 2HFGH 4G8IB 1AP2B 4WO4D 2X1XR 2NLJA 1JYXA 1UVQB 2IH3A 5ELIA 1RJZB 4ZPTA 3HE7D 2X4UB 5E8OB 1YUHB 4Q9CA 3F7RA 4NWTH 3GJEA 5CINH 5FECB 1E27A 2RJMA 3OAYH 2GIYA 1DVFC 1WBZB 4N0YL 1A14H 5KTEH 1ZLSH 1MFBH 4ZFOA 4O2EA 3VXRA 1FGNH 5D1ZA 2ADGB 3MODL 5BW7A 4QRQA 1KCRL 4JRXA 3RRQA 4Z0XB 4YZFE 3GMPB 4GG6E 2DQJL 4HUWB 1QFWM 4FFYH 1NBQA 1P5VA 3QEQB 2A6DB 3UZVB 1WCBB 2IADA 2P45B 3H9YA 4LKCA 3D2UA 5INDB 5EOCJ 4HC1L 1Z9OA 2VL5B 4NM8H 1T03H 4PJGB 1Z9LA 2ZUUA 1S7QB 4PJXF 3DRQB 3FQRA 5FHAL 3RI5K 5HPMB 5HYSA 3B9KD 4OSUH 4PBWD 5IFHL 5D71H 4L3EA 2IANA 1ONQA 1IM9D 5HDBF 4XNXL 2MOVA 4Z77B 4X7CC 1RURH 3FT3B 4N8VG 4YFLI 4O5LH 1T3FB 4KWUA 5C0EA 1NAMB 2HJFB 4GKZB 1ZLUK 4XMPH 1W2KT 1F3DJ 3A6OA 1OGAA 4FQXD 4LF3B 5J12C 4PJAA 4G6KL 4X5XB 4YXHL 3VFTB 5EUKA 5F96H 3KPNB 1OL0A 4OM1L 2B5IC 2VZTA 4OKDA 4OUUA 2J7LA 1DEDA 5EORH 4O2EB 2A9NL 4PJ9D 1PBYA 5IV2A 2Z31B 5E8PB 1IL1B 4NWUH 1LO4L 3QEGH 3QEQA 2FL5B 1RI8A 4JY4B 4I9WD 4DEPC 1I3GH 4ODSH 3MLTA 5F72S 5F88B 1Q1JL 1WTGT 2ATPB 4PJAE 4EXKA 4UT7L 1AGDB 3TNNA 2OSLB 4MS8D 3T8XA 3ALXA 3IXTB 1WIUA 1HI6A 4DKFH 4TVPL 5T1LA 4S10A 4KMTL 2CDGA 4KI1A 2IPKB 4YK4C 1Q9OB 1U3HA 4LLMB 4RZCA 4NO2A 3U0PB 1SJHB 4K23L 4J4PD 5I30L 5I8CA 5HYIA 4HC1A 4OLVH 3PJSA 3BH8B 4JQIL 3BQUA 4NQEE 4XXDA 4EJ1C 5FYKU 3RWHB 5KOMC 3IJHA 4G7YH 1U91A 5EU3B 5FUCC 1BZ7B 4QOKE 5CCKH 1IGCH 1KJVA 3RTQB 3QWRA 4GMSL 2WBKA 1PKQE 4IRSC 4DK3A 1Q9WB 1A8JH 4QY8A 4PGCB 4AIZB 2XWBA 5H2BB 5D7IA 4JRYB 2D3VA 5E6ZA 5D7JB 5DWUH 2X4RB 1R3JB 1SM3L 1HQRB 1CR9L 2KPNA 1CDHA 2G60L 2HT2C 1OAKH 3QEUA 5ALCH 2NXYC 1NL0L 1U8PA 5KSVA 3CZFB 3IKCB 4M7KL 4XC3H 3QSKB 1HINL 1ZLSL 3HR5A 1MCFA 1ZE3C 4D8PB 3FB5A 2AJZB 5E95B 4AJ0A 4IOIB 4F58H 1U95A 3ARWA 1FNFA 4FQQA 1GGIL 4N9OB 4M6NH 5EUOA 3TV3L 2FO1A 2ENSA 4CU6A 2A83B 3VFVB 2E27H 3WL9B 3H9ZA 2ZCKL 4ZO6A 2OL3A 5TDNA 4KRPC 2D0HA 3MRHB 1WWAX 2DWEA 1UH4A 4MB4A 2IALA 3RWHA 4ACPA 3H0TA 5DC9B 3MLRH 2E27L 4X7TA 3L95A 5IB1B 2CDEA 4LSSH 4R96A 3JBG7 5TFSL 1F90L 3H2WA 4NQSB 1ZANL 1UM6L 3RTQD 1MI5D 2DM3A 1UM4H 3UTPD 4HS6B 1G9NH 4JZNB 2N56A 1IAIL 1FAIH 3P4MB 5D1XB 1QLEH 1HHHB 1NAKH 5JPMB 1T20A 2UWEA 3QI9C 3D2UD 3PWJB 1EEYB 2ZJSH 3FO9A 3WS3B 5LGHH 1JF1B 4LOUD 1AR1C 4ETQA 2GUOA 2I07B 4LSQL 4OD3L 2J5LB 4RDQG 5GGQL 5L8JB 1MRDH 5IB4B 3L3GA 2E6JA 2X89D 2NW2A 3S4SA 5EU4A 2CIIB 4G8GB 2AKRA 1UJTA 3H7LA 1T1WB 3DUHA 1X5XA 4PLKC 1BFOA 4N1EA 4JG1L 3RVXD 1SBSH 3TIEA 1MWAB 3TZVC 4G9DA 4X0KB 1K6QL 4Y8AA 4XVJH 5IW6B 1WFNA 3WFEH 2VLJE 5IR1A 2WUBH 1A0QH 3O6FC 2GSIB 4QHKI 1DBAL 4MNQA 3IU3B 2J2ZA 1DUYB 5MP6H 3I6KA 1X5AA 2D03H 5ESVA 3B3IA 4OV6F 1U8JB 9CGTA 3BD5A 4XC1H 3ARDA 3U36B 4R7DB 3FOMB 2VDMH 3SDXA 4FNLL 3IDGA 3QO1A 1FVCB 1U2HA 2YXMA 5ITBL 4YR6A 1II4E 3H9HB 3NFNB 3QUYD 1B9ZA 3FTGB 5IB2B 4LQFH 4I2XA 3EDDA 4YHML 1MHCB 3NZHL 5IB4A 3QHFL 2Y6SC 1CT8A 1XZ0B 3L3JA 4LVNB 4MB5A 3EGSB 4KKAD 5D2LF 4Z18A 1YQ2A 2F58L 2KDGA 1KPRB 1S78C 1ZAGA 2JLLA 5C0ND 2JB6B 3BWUC 5C6TH 4LLYB 5DFWH 2M8XA 4KZDH 4U1LB 4NNXA 5HGBA 4BQ8A 3P9LA 4WHYH 2YK1L 1HWHB 4OI7A 5JNYA 1QFUH 3PWPD 4FFZL 4R7NA 3BKMH 4XI5D 3HC4L 5A3IC 3VGDA 1A3RL 3I50H 4DVRH 2W59A 2IQAA 1NEUA 4PJ9C 4KJQD 5DHVH 1U8JA 2GKIA 3PHQA 4M43H 3T3PF 1DUZA 4UUJA 2PXYD 3ARDB 2YK1H 5HGDA 1TVBB 3OAZH 4JB9L 5C0IB 4DWHA 4OIBA 4BKLB 1ERNA 1HXMB 3H9SB 4NO3B 5ENWA 5C08B 1L9NA 5KBNC 4XMKH 1JNHB 3KYNB 3MCKB 5E00A 5JA8B 4M7LH 4OM0H 2HWZH 4Q2ZA 4RMUA 1T4KB 3EFDH 5LQBL 3P4OA 2WMPA 4EQ2A 5IESL 5K59E 3C8HA 1AD9B 1FGVH 3NCJH 4NO0D 1L7TL 1CT8B 2ITDA 1FNGA 1T83A 3C08L 5DZOA 3HI1B 3HCVA 1S7RA 2A6IA 2R4SH 2YWYA 3HHRB 3B9KA 4X4MA 3DV4B 5SWZD 12E8H 1KJMB 1RZFL 4NZRH 2GJZA 5JW5B 2P8MB 5C07D 2IAMC 1TJGL 3MRKA 2QHLA 3ECBA 3W9EB 5LGJB 1FZJA 4GLRI 4PTTA 4NUJA 5C3TA 1JRHI 1A1OA 3BPCB 4YNYB 3BYTA 1IGMH 4ODUA 4D9LL 2ORBL 25C8H 1U36A 1FBIH 4LCWA 3VFUA 1H15B 1Z6JT 32C2A 1D5BA 1NCNA 2ZSVA 3NCCB 5HDLA 1W0WA 2YD6A 2F54B 3TBTB 3BT2H 1AR2A 3PGFH 3MV9A 4LU5L 4H0HB 5EZOL 3VGGA 4WTZA 1JPSL 3HZYA 1I7ZA 1A6AA 4E5XA 4NQDD 5I74B 2C4FT 2VQ1A 2P5WB 2Y7QB 1CZ8L 4ALAH 5I74C 3RZCD 1T5XB 2PYEA 1RUQL 3I85A 4NCC1 3WNMA 1QSFB 3CLEL 2CQVA 2DTMH 1KPVB 1DLFL 1CDCA 3B9KB 4C4KO 3PWLA 4L9LA 3WIHH 3QIUB 5FYJE 1OSZB 4MJ5A 4PP2A 5MHSE 3Q3GB 2P8MA 1GHFL 5C9JA 5MERB 2A77L 1MCJA 3CLFH 5DA0B 3FB8B 3FQTB 4MJIB 5H35B