4YEFA

Beta1 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclododextrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords 5'-AMP-activated protein kinase subunit beta-1
publication title Determinants of oligosaccharide specificity of the carbohydrate-binding modules of AMP-activated protein kinase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 12
structure length 80
sequence length 80
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yefA00
1HDMB 4GKNB 2IFGA 4W4NA 1K4CB 5I1LB 4FTVB 2ADFL 2YK1H 1PLGH 4NQSA 1BIHA 1DVFD 4ELME 4BELD 8FABB 2BDNH 1KTKE 1FL5B 1YPZB 4MNQA 2DQHL 2CLRA 2VXSH 4H88H 1RVFL 1MI5D 4U6HA 4QRUB 5EIVA 3PDGA 4PJIB 2WP3T 1JJUA 5EOCJ 4PJXA 1NFIB 4NRXB 1JNHB 3VFOA 1OL0A 4EUPH 3H9YA 1ZTXL 4LKCB 5GS0L 5JOFB 2NR6D 5K9QI 1HHHB 4Z7VF 2LU7A 1MVUB 1YNKH 3KHOA 1T1YA 3MRHA 1YJDH 15C8L 1ZOXA 1I8MA 3LY6A 1BAFL 1WISA 1S7WB 3T3PF 1NCDL 4HFUH 4JDZB 1MWAL 1XF3A 4YDLC 2WINB 4ORGA 4XWOC 5JMOC 2FL5B 5D7LD 4LHUB 1S9YB 4ELKB 2E9IA 5E9DA 1NBYA 2WMPA 1Q1JH 2P24A 3BE1H 4ZFZB 1DL7L 4JFDB 1P2CB 1ZGLB 4QY8A 4Y88A 1J8HE 2OR7A 5T1DL 4ZNEA 4Y5YA 3QJHB 1EHLH 3BI9X 3PWJA 4Y89A 3MRNA 4HS3B 1UM5H 5IGXH 2X4TA 1W0WA 5DJ8B 4HK3J 5F9JA 5F89A 1H5BC 5CIPH 4EN3B 5DMJB 1NMBL 3WNMA 1YEGL 5I66A 2P8PB 3STBA 4QXTB 2C4FU 2JB5H 3DMMB 5IB1B 1A9BA 1JTTA 3HZKB 3LEVH 4K7FA 2AXGB 1I9JL 5TE6H 3G5ZB 4KQ3L 1IC4H 4LSRH 2PF6A 4QKXB 1WT5C 4WW2A 4KRNA 1J8HD 4FQLH 5CJ8A 3C6LD 1OCWL 5CBAB 4PY7B 5I76B 2YSSB 3RX8A 1UFUA 1RHHA 5BS0E 1KB5L 2ZUYA 1C1EL 4DVBA 2FEEL 2HLAB 4R6UA 1U2HA 2I5YH 1U91A 4JB9H 2GCYA 2V7HB 4UINL 3MV7B 3BO8A 2IAMD 5DJ0B 1CLYL 3P40A 3QJFA 5CP7B 2PYEA 2QV2A 1HXYA 2L7JA 1J10A 4GAFB 1FDLH 3OGCB 1MEXL 1BHGA 4JM4L 2X05A 3VE0B 1FC2D 1IC1A 2FH6A 2Y1VA 1DN2A 3QEHB 1FBIH 2ZJSL 4XNQB 4C58B 4LLDA 3TIDA 1Y18A 1ES0A 4DN4H 2GK0B 2F5BH 5C0FA 2NY1C 1KLFA 4MNQB 2AV1B 4DGYH 1CFVL 3AB0B 2O61B 5ETUA 4XPTH 3MV8E 3FO0H 3ARBB 4FQ2H 3VFOB 3Q6GL 1IC5L 5DA4A 1NCWL 1KN4L 1MFBH 3CMOL 4WFHD 2ZG3A 1NAKH 4KROC 4I1NB 2ICCA 5JA9A 1BGXH 5HHQB 4X9IA 4Z76A 2D7TL 1KJ3H 5D7KD 3JVGC 4M6MH 4GAYB 5HI5C 2X2YA 3HC4H 4EKXA 3MRHB 1J11A 1LEGA 1I8MB 1JPGA 4HKZA 1JWSA 5J89A 4HLJA 3OJDB 5DGQA 5EIQA 3IB4A 4DJMA 1EO8H 1XF3B 3PGDA 4XVTL 4YJZL 2NY5C 5D1XB 3EOTL 1T2QH 2X40A 5E9DB 1NBYB 1NFDE 1JRHI 2P24B 3IFOA 3V7AG 2EDNA 4L4VD 4KK9C 4Q0XH 4XNMB 4PJAE 3MV8D 3EYSL 4WY7H 3ULUE 2V9QA 2ZUQB 1U3ZA 4QY8B 3DX8A 4R90L 4X83A 1MIML 4JN2A 4OV5A 4UT9L 5HHOE 2FRGP 3PWJB 1YQVL 4XHQA 1KCVH 2X4TB 5TPWL 2IH1A 1W0WB 3IXTA 5F9JB 4I0PA 5CFHA 1GL4B 5KAQG 4LEOA 4YDKL 3AY4A 4XPAL 3CK0H 3BVNA 2BVQB 2V9RA 1JZ2A 1RJZA 3SDXF 2JELH 1QRND 1A9BB 4HGWB 3QDJD 4K7FB 3TV3H 4IOFC 3QIBD 3L5XH 5HI4D 1IAKB 1JF1A 2WIIA 4WW2B 5KVDH 3ULUD 1UB6B 3B2UC 5HJ3B 2B1HL 3ARYA 1A7NH 1MHPH 4F33A 5DURB 1JGVL 3ARBC 4MB4A 2WNGA 3QXDA 2PR4L 4DTGH 4DUWA 6FABH 4JO3L 2GT9A 1YN7B 2DQEH 4DVBB 2KQMA 4K3EL 1OPGH 4JHWL 4X6DF 4QRPA 1LWRA 1U91B 4KTDH 3M1BA 4XT1C 4JAMA 1JTPA 1VFAB 1YDPA 4PD4K 1FORH 4GS7B 3IS1X 1A7QL 1KPUA 1I75A 1ZANL 3QJFB 3R4DA 2PYEB 1HXYB 4M5ZH 4P59L 4S1DD 4HIJA 3HE7D 4HH9A 3IJSA 4TSCL 5DWUL 5B39G 5D1XC 1MAMH 5D7SH 3MRMB 2EDDA 4U1SA 1P7QA 4UOW0 4L4TA 4YE4L 3MJGX 3QO1A 4ODBD 5IK3A 4PD4J 1C5DA 4P5TC 2ZUQC 4LLDB 4H0HB 1FZOA 2DQDH 1CE1L 1AQKL 1CGYA 2UWEA 4LCCA 3HA0A 4POYA 3V9FA 3MXVH 3P4OB 3UJIL 4OB5H 4DQOL 5FO7A 4K7PX 1NUDA 1J1OH 5FUZL 3MXWL 4DKFH 2X4NA 5K9KA 2O93L 2AP2A 4E41E 4Z76B 1HHJA 4G8EA 3HMXH 4NKOB 1ZHNA 1QQDA 3BN3B 1TLKA 4G8GB 4N0YL 1ZHLA 4OD3L 2EEBA 1ZA6B 1LEGB 1JPGB 3NPZB 4HKZB 2F74A 1JWSB 2FX7H 1WAAE 5SX5K 4XVJL 4E0RA 4UTBH 5DUPH 2I27N 5HY9A 4YH6A 4Q6IB 3UBXG 3SHSA 5C07E 3VCLA 3KLDA 4QNPF 4Z7VB 4DAGH 4DUXA 4JZNA 3SCMA 4YFLF 5DD1L 2H1PH 4Z77B 4UBDC 1JPFA 2YRZA 4YHMH 4JN2B 4OV5B 4O9HH 4DVRL 4GS7C 3QEGL 4EUPA 3BW9A 3SDCA 1EO7A 3F7YB 4S1QL 4NM8L 2AV7B 4F37K 2IH1B 3ARQA 3IXTB 5E56A 1BQHB 2MMXA 1QSEE 4I0PB 4NQEA 2P5WA 1LO0H 4LEOB 3JWOL 4XNZB 4TSBH 2VDRL 3SE8H 2NY4D 1EZVY 4XNXL 2PXYA 2Y5EA 4F37F 1BP3B 3NTCL 3GSQA 4XC3H 2Z31D 3ISWA 3QQ4B 1NLDH 2BOCA 1JF1B 5CJBA 1INEL 4YDIH 3N1QC 5DF0A 5FGCB 5H37H 2CPCA 4DFIA 3GHBH 4F33B 3WUWA 4G6JH 4LSSL 1BFVL 4S0TD 4Z0BL 3QXDB 2DTMH 5T1KD 3HPJB 2YR3A 5IP4A 3VMNA 2XFXA 3BKYH 4MA8L 4S0SD 2AAVA 2PCPB 3FQNB 4QHLA 1A7PL 5CIPA 2HRPL 2GHWB 4EXKA 4JAMB 4L9DA 1BF8A 4HJ0D 4YLQT 5KW9H 3IJYA 1OAXL 4KXZH 3RL2B 5GJSL 3P11L 4LQ1A 5DD5L 4N8CH 2VR9A 1WEJH 3IJSB 4HH9B 4H25A 3WIIH 4Q6IC 1MAKA 1MJUL 4U1SB 5ITFA 3S36H 4MDIA 3HAEB 1GVIA 1VSCA 4K3GA 5EPMB 2R56L 3QO1B 5IK3B 3EO1A 1C5DB 4GRMB 4OLXH 2HAZA 5K59E 1FZOB 1CN4A 2VLRA 2ESVE 3MRDA 4MXQC 5DEFA 2UWEB 4LCCB 4M7JL 3ZT7A 4NHCH 2BC4A 3RWDA 2CSPA 5FO7B 4OSUH 2VITB 2AJUH 4D0DA 3GK8L 4J1UA 5K9KB 3BISA 2BRQA 1HI6A 1HOCA 1KIRB 1ZLWH 3HUJA 4PJ8C 2ZPKL 4UDUA 3T1WA 1HHJB 2APFA 4G8EB 1QYGL 5FHAL 1ZHNB 4NSKA 1CL7H 4CW1A 4C56D 1ZHLB 4XPGL 4JO4H 3E8UL 5E08H 2F74B 1MRFH 4U33A 2RBLA 3GI8H 5KTEL 4M02A 3WHXA 4NKQB 4MHHG 4N9GA 5JXEA 2ESVD 5HY9B 2CDEA 4P23A 3RGVA 3VCLB 1Q9LB 1I3GH 2W0KA 3O4LA 5D1QD 4M1GH 1ACYH 3DVNB 1QR4A 1UQSA 1GGTA 4ZXBA 3SCMB 4MA7L 1EFXD 5KANI 1HXMA 3OKEB 1JPFB 1LMKA 1JHLL 4JFFA 1OP9A 4DEPC 4R0LB 3KS0H 4RMTA 2DD8L 1Z5LA 2I9TA 4EUPB 1TTUA 3SDCB 2Q8AH 5BVPL 1RIHL 4XXCC 1T1WA 3WNLA 4GRWE 5JPMA 4NQEB 2FECI 3ZE1F 3RX7A 3I3EA 1NCUA 4JQVC 4YEEA 3QDME 2PKDA 2PXYB 1RUPL 1FYTE 2AEWA 4OIIL 3WNPA 3DHJA 3GSQB 1BZ7A 3TNMA 1VEPA 1B88A 1J0JA 3EYQC 3T0EB 2BOCB 3NIGE 4P2OB 2X41A 5IG7A 5K93A 4NO2B 4PJDF 4LLVA 4PJ7F 4TSAH 3WHE0 1AY1L 2LU4A 1P1ZA 1IQWH 1UACL 5FHBL 5B8CC 2OR9H 4QRQA 4XGZB 2W9EH 3SDXB 5AZ2H 1XIWD 4TYUA 1RZKH 5DZNA 5F1NB 3WUWB 4PGDA 4OCYH 2CR3A 3F12A 1G7HA 1TJIL 1JZ6A 5ALBH 2Z4QA 2XFXB 3H9SD 2MKWA 5FEBA 1SJEB 3B9KA 3S34L 4GXUM 4HUUA 3GZKA 3MRLA 5CIPB 1YEEL 3QUZA 2JK5A 2OZ4H 3DUSA 3IJYB 3VFNA 1ZMYA 3V0WH 2ITCA 2C3HA 3C08H 1KCKA 1HHGB 3BOVA 4HWEH 3BZ4A 1X5LA 3I9GL 4H25B 3A6BH 4AM0A 5TF0A 1UKTA 3EDFA 3U7AA 4KVCL 5E2TH 4Z9KB 1R3LA 1MY5A 1UJTA 4FNLH 4NO5A 3DYMA 4M7LT 5F7YC 4GFTB 3EO1B 2P1YA 1UH4A 2BHZA 1N6QL 1QLEL 2NY6C 4R0LC 3VXOA 2BY0A 2VLRB 3MRDB 5DEFB 3TZVC 3W11D 2FSEB 3QPQD 3WUZA 4U0QB 1E4JA 4HMDA 2BC4B 4RAUA 3RWDB 4XP6L 2EZ0C 1FLRL 35C8L 3KJ4C 1IJ9A 5DVNA 3VE0A 4D0DB 4J1UB 3TGXA 5FO8A 1C12A 3FL7A 3RJDA 4RGNC 1D9KD 3BDBA 4JRXE 4ODUB 4UDUB 5DD0H 4M1DL 2DYPD 3T0EC 1MCNA 4NSKB 4P2OC 4CW1B 3KPQA 4G8IA 1KJ2H 3JV6A 1IC7L 3WHXB 4UB0L 2XTJB 1NAML 4N9GB 5E2UH 1QSFB 2QQKH 2VDKH 3P9LA 1AD0A 4P23B 5IBTH 1DBKL 5I2IA 2EDFA 1N5YL 4LSTH 5F8QC 5CILL 1UQSB 3LCYA 3QIWC 4Y2DD 5I15H 1KELL 2UVEA 3TC9A 2J8OA 4X5WA 4NQDE 1HXMB 4TULL 3SQOL 5GS1B 1FZMA 4PRNA 3NCCB 4GQ9L 3P4LA 3U7YL 4WO4D 3B5TA 4H1LG 1Z5LB 3BYYA 3ULVL 3SPVA 2I9TB 2BVOA 5EH1A 5EA0H 1F45A 1U6AH 1T1WB 2RHEA 3NIDF 3HPLA 5C0BA 1UM6H 5IMOA 5JPMB 5EBGA 3HMXA 3WDJA 3O6FC 2VXTH 4S1SL 5DQDH 3UTZA 2DKUA 3CFBB 5I71B 4NZUH 3IDYB 1DUZA 1FLTX 1I1AA 3FAXA 2X4RB 3DI3B 3ZTNL 1F2QA 1S7TA 3TNMB 3UROR 1RUKL 4KDVA 5IG7B 2OR8A 2H3NA 4NFBA 3H7LA 1IARB 2GK2A 3TBYB 1P1ZB 1PEZA 2DLTA 4IM8A 5CUSH 1L7IH 4PRPE 3D85A 4QRQB 3TA3A 4P2CG 1GGBL 4HUKB 4R97C 4KKBD 4PGDB 3U36A 5KSBF 4Q9QH 3F12B 1G7HB 3QH3A 3MOBH 4PJDA 5MENE 2Z4QB 3RWEB 1YNTA 3LQAL 4A2LA 2CMRL 3B9KB 1OD7A 3T77A 3FRUA 4OJFH 3MRLB 3ZKXB 3QUZB 5GS0D 4M6NH 4G43A 1XGPA 3K4AA 4UTAL 3WNKA 3DUSB 4WV1A 3EO0B 1C8PA 2EKSA 3S35L 4C4KT 1CE6A 2ITCB 1G7IA 3LN5A 2AEQL 1J88A 3ARED 3DVFA 43C9B 2GJZB 3LIZL 1DJSA 4WEBL 3DX7A 4AM0B 3O8XD 4D8PB 2AK1H 2E7LC 1GPOH 1R3LB 4NO5B 5MEOA 3VGGA 1AO7E 4Y19D 3L7FB 5I75B 1JWMB 4ZPTA 2ZKHL 4Z95H 1B4RA 4J3SA 5GS1C 3GUTA 1DR9A 5IVXE 3GJFK 1BLNA 1HNGA 2DDQH 5T1LD 2HWZL 2VH5L 2MSPA 2XXMB 3VWKB 1I9RL 1DN0B 5C71A 1U42A 1CD0A 5F7MC 5IB2B 4JQXC 4RAUB 3V4UL 5L2KB 4V1DA 1CDGA 2CK0L 5FO8B 1C12B 3NCJH 3IDYC 3MRIA 4P2RA 2GEEA 2WBJC 2VAAA 1NC2A 1MUJA 3U4AA 2HVKA 2A74A 4W6WB 3DXAA 3KPQB 4G8IB 1U3HA 4MNGE 2AABH 3K1KC 3JV6B 4ZD3H 2KDGA 2DM2A 4KDTA 5IVZA 3B9VA 3L3HB 2LTQB 3QWOA 4ZS7L 2O5YH 4XPFH 3SO3B 5F9WB 1AD0B 4XBEL 5D5ME 4OCXH 4TUKH 2E6PA 3OKNA 4YBHA 1JYXA 1IGTA 4NC2B 4X5WB 4W70A 1KCLA 5JOPD 1FZMB 4O2CA 5D7JA 1YECL 4XCCL 3SPVB 4PRID 3TPUB 2BVOB 5A40E 3UYRH 3WFEH 3EDEA 5IMOB 4XTRC 1S3KH 3LHPL 4AEHH 1P69B 5F6IB 3OMZA 4NKMA 3UTZB 2HJLA 2ZCHL 4GG6E 5EBWA 4M00A 1CGSL 2A9MH 1DUZB 4IRSA 5TQ0H 1NDMA 32C2B 4AY0A 1AR2A 2BCKA 4YXHL 4NNYA 1T66C 1S7TB 1Q0YL 1FO0H 4NJAL 2H3NB 3UJJL 4MXWH 3VWKC 1EGJL 5JW4N 4APQD 1Z9OA 3D85B 3GHEH 3TA3B 1K3ZA 2XWJB 5GGQL 3I50L 2CRMA 1AI1L 3U36B 3FT4B 4U6XA 2C7UA 3WLWD 3CX2A 3O6MH 3QH3B 5EC2A 4PJDB 4PJ7B 1T5XB 1JE6A 4PJXE 2XQYG 4HQQL 1S9VB 4J3WA 4LIQL 4PV9A 4G43B 4XHJC 2DAVA 5SWZA 5KSBA 2OP4L 3KPRA 3QFJB 1CE6B 3HE6A 1BJ1J 2XWTA 3LN5B 5GGVL 2VWEC 2QR0A 2LTQC 3PHQB 2FECL 1YYLH 3ET9F 4P2QD 1H3WM 3HFML 1KENH 4I5BA 3DX7B 5GRJL 4LHJB 5GHWH 2ENSA 2XI9A 3MBXH 1KFAL 2WBKA 5MEOB 3O9WB 4X4YA 1IT9L 2Q6WB 3U0PB 5F88A 1ZLVH 4JM2D 3GUTB 3ZYOA 1BLNB 5J13C 4POZD 2CUIA 5FYLL 4I3RH 4WHYG 4QLRA 3FOMA 3PL6B 3QNXA 2DJUA 1J9CT 4HXBH 1EA9C 2RAMA 1Q94A 4IDJH 4JFPA 4OGYH 2OZ4A 5HDQL 2BMKA 5EU6B 5D1ZA 4NKIH 12E8L 4NQXA 1NLBH 4CMHB 3MRIB 1CDCA 2F58L 4P2RB 3V8CA 2NY2D 3W2DH 1NC2B 1MUJB 1HHKA 4RFNB 2HVKB 2A74B 3WV0A 3EDDA 3ZE0E 1UWGL 3O3DA 1QPPA 2HG5A 2W0FA 3MQIA 3WS6A 1UM4H 4PJGF 1R24A 1N7MH 3RUGA 1G7MA 5BV7H 2C5DC 1RZ7L 5FUOL 2ICEA 1EAPA 5IVZB 3QWOB 1UA6H 3OX8A 5EOCH 4IRJD 4DOHB 5DQ9A 5DXWA 4PTTA 4LU5L 2AJYH 2VL5A 4MAUL 3OKNB 4EQ2A 4J6RL 4M48L 2V5YA 2YRLA 1V7ML 1G9NL 1TTGA 4O2CB 4DGIH 5DMIH 2A6DB 3W82A 4YGVB 5B22A 1VA9A 4JGJA 4TPRH 3NVQA 1YMMB 4LCYA 1ZV5A 2DL9A 3TEUA 4UAOB 4G6AD 2VLLA 4JQIH 3CAFA 3PF2A 5DRWA 3FQWB 4NKMB 2FHCA 1KJ2A 2WANA 3IDGA 1S7XB 5EBWB 1M05B 3O9WC 5F8RC 3EYFB 1A1MA 4IRSB 2XZAL 1H0DA 1NDMB 2BCKB 4PYGA 4NNYB 4R9HA 1KTDB 3KYOA 3P4MA 3ARVA 3C8KA 3GFUA 3EJJX 4PREB 4XRCA 3PL6C 1A5FL 5E6YA 1N4XH 1D5MA 2EDQA 1SEQH 3NMEA 1WTGT 3VW3H 3E2HB 3FN9A 1RJYA 3SGKA 5FIEA 3T65A 4WUUB 4KKCD 1F4HA 4LNRA 2G75A 5BW7A 4J3TA 4U6XB 2C7UB 1N26A 4HAFA 4CMHC 5E0QA 5EC2B 3F5WA 1H3PL 3TFKD 4JDTL 4HLZG 5E2VL 4X9GA 4PV9B 1D6VL 3NCBB 4KRPD 4HAGA 5IVOA 5DQJA 5F70A 4UT6L 4ZUVA 5EU4A 5I1HH 5KSBB 3KPRB 4KV5E 3PIQB 4UNUA 3HE6B 4ZAKD 2M1KA 2XWTB 3S36X 1FGNH 2Y5TA 2QR0B 4KMQA 4TVPL 3C8DA 4PP1D 5IHZA 4I5BB 1HKFA 4HPYH 1HYRC 1LK3H 2FNBA 2LAGB 1W8NA 5EWIL 1B3JA 2XN9E 4QOKD 5ILTH 2YKLL 2JTDA 3UPAA 1I7ZB 3CX5K 2Q7YA 3V79C 2MWCA 3LS4L 3ILQD 4GAJH 3RWJA 4HX1B 4K3JH 3DETD 1XT5A 5F88B 4XBGB 1FNSL 1A02N 4AQOA 2P8MA 5DEGB 3KJ6L 5E6IC 5FYKH 5GJTH 3MV9D 3FOMB 3MREA 3GM8A 4RMRA 4LVNB 1Q94B 3CX5J 1CQKA 1FE8L 4M6AA 1B6DA 5D1ZB 4NQXB 2NPLX 3D69A 2E9WA 1IQDA 2A73B 3GO1H 1HHKB 2ICWA 3ZSTA 1L6ZA 4EI5C 2W0FB 1IBGL 4FRWA 4YHYC 1R24B 5IEHB 3L3GA 4DK6A 4RAHA 2HLFD 4JFYA 4BQBA 2ICEB 2I25N 2IBGA 1SQ2N 2FHFA 2H32B 3E2HC 3OX8B 3V6ZA 4OCRL 3WKML 1OARH 4ZUTA 4FFZL 5ISZA 1CXFA 1F4AA 2COQA 1CXIA 4MLIA 5CWSB 5CD5C 3BMVA 4BUGA 3VGHA 2EDYA 1WV7T 3ROLA 5HYFA 4CVZB 1AFVL 3DARA 1GYAA 4QRPE 4N8PA 1R5WA 4LCYB 3RZCC 4QO1A 1RMFH 3BP7A 2VLLB 2BFVL 5GS3A 3MMEA 2BOBA 1HH6B 5DRWB 5JW3L 2HVJA 3EGSA 3V0VA 1KJ2B 1DBJL 1Z9LA 2P5EB 4FZEL 2J5LC 4KFZC 2VISA 5HYQA 1FN4A 1T7ZA 1H0DB 4G6FB 3T3ME 5IMLA 1H8OA 3OZ9L 3ZL4L 3IF1B 3KYOB 3P4MB 4YDVA 4JVWA 3C8KB 4PJBA 1JMXA 4L4TE 5TE4H 4YC2C 3RJQB 3AC0A 3QAZB 4XRCB 1YEHH 3WDIA 2D0GA 2BNRA 3D25A 3DNKA 3CDCA 3AMLA 1PEWA 4OFVA 1NCAL 1D5MB 2IG2H 2SEBA 1FV1A 4JVPA 4LVNC 2AJZA 1F11B 1RJYB 1PJ9A 4K8RL 3T65B 5FOJA 3MROA 1FFQA 2G75B 3C6LC 3VGAB 2DQCH 4ZTOL 4O02H 3KYMB 3VXPA 3LH2H 3MX0A 3F5WB 5IB4A 4LRIA 5HYJB 5HPOA 4X7TA 1WTLA 4CN1A 4LCWA 2VDOL 2F53E 5DQJB 5IT2L 4JRYD 5EU4B 5MHSE 3NIFF 4RA3A 5JHDB 3N85L 1JHKH 2QQNH 4L8CB 4YBLB 1IGCL 1FHGA 5E7BA 2EXWD 4XCFH 5E8DL 5IHZB 1OAZL 4U1GB 2VOTA 1KB9K 3KXFA 1QFUL 2C3GA 2IEPA 4ONHA 2OTWA 4YUEH 3TO2A 4ETYA 2P48B 2ID5A 2Z8RA 3UTTE 5FFLA 2GKIA 4W4OC 2ADIB 1IAMA 2YZ8A 5KSAA 3F58L 2P8MB 4KK6C 4JREB 4C83A 1KEGL 1A6TA 3C5SA 3MREB 1OLLA 1D5ZA 4I18C 3C5ZD 3TCLA 2F53D 4O5LH 3EKCA 3UTSD 5MHSD 5AUMA 3RDTA 1BEYL 2DQTL 1X5YA 4EDXA 1H3GA 2NNAB 2XZCL 3D69B 4G9FA 1IQDB 1FG9C 2JLLA 1DBMH 3GJEA 2P5WE 4RMSA 2IPKA 1KXQE 4F7TA 2G9HA 2RCSH 5C0AD 1B0GA 3DTXA 5C0CD 3D3VE 4N8VA 2AEPH 5IJVA 2LE9A 4NQTA 1QEWA 1ZS8A 3QAZC 5IM7A 2ZCKH 5FM5O 3TJHD 4PG9B 3V6ZB 1WFNA 5GRVK 5A3IC 1OAQH 4IDLA 1WZ1L 2NZ9D 3BDYH 3RX5A 3PP3K 4LEXH 5ISZB 2OMBA 4X4ME 4UILH 4U1HA 5DK3A 5EU3A 1QSZA 1IKNC 1JGEA 3V5DA 3ROLB 4MSWA 1MF2L 4EDWH 3KPLA 1EK3A 1CICD 2FBJL 1R5WB 1XMWA 3CSPA 3D3VD 1AJ7H 3BP7B 4YBLC 3VWJA 5GIRB 1OSZA 3MMEB 5J7CC 4BQ9A 2BOBB 2ORBL 2HVJB 3EGSB 5FGBC 2D31B 3O41B 2BNQA 3Q1SL 4F57H 1NEZB 2YPKB 2VISB 1FN4B 4OZGF 5IMLB 1FGVL 3ZE2E 2NY3B 4D9QE 4YDVB 4MQ7A 4XPHH 4MAYD 1P7HL 1JPST 4JREC 4MJ2A 1V05A 2F54E 3D25B 4WI6A 2IGFH 1TJGL 3RVUC 5DJAA 2XZZA 1MQKH 2SEBB 1FV1B 4JG1L 5F44A 2AJZB 1OGAD 1X4XA 3DX6A 4PUBL 4R2GD 4PRAA 4QXUL 1CGXA 3VXPB 2Z91A 3K80A 3P0YL 1S9KC 1KCUL 1TQCC 3K2UH 3GSNB 3ALPA 4NP4H 4X7TB 5JR1H 3HC0A 1I1RA 1WZLA 3V52H 4XP9L 5CCKL 1URLA 1A7RH 1U8QB 3HUJE 3WN5B 1KGCE 1XGTA 3QCTL 3W9DA 1GGUA 4D0BA 1A0QH 1JBJA 3VJ6A 4N9OB 2A83B 5CGMA 1I3RA 1X44A 2F54D 3OKYA 3KXFB 3Q6FA 5CJQL 4ONHB 4ZO7A 3HE7C 3TO2B 3M07A 1DE4A 4XCEA 3N50A 1JYWA 3VXME 2B4CC 3NABL 2VNCA 5KSAB 4Z7NE 5IW1A 1WSST 3AMKA 5DZLA 2OJZL 3RAJH 3O4LE 5MEQA 3LV3B 4FFWC 1A6TB 4PJFF 1ADQH 3VD3A 4R96B 5GGVY 2BK8A 4JFFE 5K9OB 3ULVD 1MCWM 3E1F1 3VFPA 4IIQA 5LBSL 2YD9A 3WXVL 4GRLA 5AUMB 3RDTB 2OXHA 3BH9B 2F8OA 2R1XB 1DBBL 3OR6A 4EDXB 4G9FB 2Y36L 3NAAH 3WFHA 2J4WL 1A3QA 2JJWA 4K7PL 2IPKB 3PGCA 1SJHB 4NO3A 5D8JH 2NY3C 2G9HB 3I6KA 1B0GB 1CTNA 3DTXB 4TUOA 3RY5A 4N8VB 3GKWL 5IJVB 1BJ8A 2Y23A 1U8NA 1QEWB 3VXMD 2ZUTA 5EZLA 4PJHF 4Q2ZB 5IM7B 3TT1H 3TCXA 1U92A 1J86A 1FAIL 4P3CH 5D71H 4HXAL 3CNKA 3MLYL 2DQGL 4U1HB 5BOZG 5SWSE 5KOMC 1K3IA 3QDGE 1JGEB 2NY0B 5KVFH 5EU5A 3V5DB 2XRAH 4HS8H 3DX9A 4MSWB 4K2UH 2V2WA 1QBMH 3RIAK 3WN5C 5E8NA 4TRPL 1RUAL 4PJEF 3S3JA 1LP9E 3DSFH 1ZSDB 1OSZB 5FV2A 3LRGA 4XMKH 2BNQB 1YMHA 3L9RA 3QYCA 5DD3H 2JJTA 3RIAF 5BV7B 1IGYB 2VL4A 4JO1H 3OG6B 3BXNA 1GOGA 2VDLL 2A77L 2CJUH 4ODVH 4UT7H 1N8ZA 2EEAA 3QUYD 3SJVD 4MQ7B 4WI4A 5CD3A 1QPXA 3G5VA 5CEYA 1EVTC 1JZ3A 3CVIH 3RY6C 5IB3B 1CDBA 2PO6C 2Z31C 5BRZD 5DJAB 5HHXH 2WSKA 4D3CL 3D39B 1WF5A 1CWVA 4RWYH 2BVEA 3BESR 4LLYA 4UU9A 4WFEE 2H2SC 3GMLA 3TLRA 4WFFE 3ELAT 5AAWA 1RIUL 4Y4KA 2Z91B 2ARJA 4M5YH 1E4XH 3L3JA 2EO1A 4FA8A 2W92A 1D5BA 3HC0B 5K9QG 3SKOB 4YFLI 4BUHA 3GIVA 1FFPA 2R0LH 1AC0A 4U1JA 5I30H 1RQ5A 3OJMB 5HHPA 1Z6JT 5DRXB 3CFCH 5CKAA 1RFDL 3V4VL 3RTQD 1QFWH 4FQCL 3W9DB 2OMNA 1E4WH 4KGLA 4M7LL 3HTLX 1FFNA 4D0BB 5ADPL 3VJ6B 4YQXH 3WFCH 3WS3B 1I3RB 3PP4L 4LSPH 3ARGC 1PSKL 2O5XL 3Q6FB 3GEWB 2VQUA 3G9AB 2WWMC 4NC1E 5JUEL 4R4BB 4MVBD 3HHRB 5C0GB 5IW1B 4HC1H 4DFHA 5MEQB 1XGYH 2R1YA 2G2RB 3QNYA 4HGMA 2EDKA 1QFWM 5CZXC 4H0GA 2ILLA 2V5RA 4IIQB 5J06A 4PJ5E 3PV6A 1I8LC 2DKMA 5EBLB 3OR6B 3O3EA 1HILA 1DLHB 5C0BE 3KLAA 4PJ9D 1FIGL 4K9EC 1JUFA 3PGCB 4NO3B 4HUWA 1Y6KR 5CMAA 1YQ2A 4HHAA 4M7ZB 1PZUB 3W9EB 1BREA 1U8NB 1SHMA 3BPNB 1XF4A 1E0OB 4P3DA 4FQJL 1D6EB 1KCRH 4KHTL 4OLWH 3HI6H 2NX5E 4KJQD 1SEBA 3LN9A 4OGAC 4GMSL 4WI2A 3PWPA 1KT2A 2JJSA 4FFVD 3DO3A 4PJHA 1RUQH 5EU5B 4D0CA 1M71B 3DX9B 4KK5C 4WHTA 1G7PB 1NSNL 4HIXL 1T03H 2V2WB 3H3PH 5E8NB 2P45B 3U7WL 2UY7A 1MY7A 1MREL 5D2LF 5GZNC 3CH8A 3BAEH 3FMGH 3PJSB 1YMHB 4QF1A 1FG2A 2UYLB 2WP3O 4PS4H 4NZTH 5KVGL 3BWAA 4OLUH 4U1KA 2NX5D 3J7HA 4I77L 3NN8A 1A22B 1AHWA 1N8ZB 2YHGA 4PJEA 1MAJA 5C7XL 3G5VB 5DGRA 5CEYB 2ADGB 1U3JA 1KF9B 1K85A 4AEIL 3MTRA 5JQHC 5CEZL 5MI0C 5FYLD 4UU9B 5LGHL 4LLYB 1JGDA 1JV5A 1U9KA 3GMLB 3PNWA 3MRKB 2AK4D 2X1XR 5EZIH 4K94L 4NJ9H 4TTGA 3H9HA 4NDMA 3H42H 1IFHL 4PRBA 1ZGLP 2EC9T 3L3JB 3GSRA 4OIAA 4GMTL 4OF3A 4V1DE 4HPOL 4ZUSB 4PBXA 1FFPB 4RFEA 4P2RE 3CFJA 4OUUA 4Z78B 1B4JL 1LVEA 7CGTA 1WIPA 5GGRY 2NCMA 3DXAE 1FFNB 5BOPA 4MDJA 1GXEA 5K9JL 4DKDC 2YK1L 3EJZD 1EH9A 1PLGL 3QT2A 4GXVH 4P46D 2Z8VC 1CVRA 3BD5A 2BDNL 3F7QA 4OZIE 3OXSA 5INCA 3QXAB 2VXSL 5DVMA 1FSKB 3KAAA 3PABA 3ARFC 3FB8A 1FVDB 4UIKH 2ZOLA 3UTQA 4WNQA 3BQUB 4KHXL 4N0FA 5DR5H 1C08A 2HT4C 4KUCD 4JCMA 1HILB 1N3NA 1CXLA 3VG0H 2BNUB 1SM3L 1TZHB 3OR7A 4HUWB 1YNKL 3TN0B 1S5IH 5DC9B 1YJDL 1Q9KA 4HHAB 3L6FA 3DO7B 2VKXA 4Y4FA 4HFUL 3Q48A 3HZMA 5KS9E 1FH5L 5I1IH 1XF4B 2XA8L 3S5LB 5L88L 3KPPB 4ZUUA 5DRZA 1Q1JL 1SEBB 3C6SB 3NFSH 2UUDH 3BE1L 3KPOA 1ADQA 3BPOB 4GW1B 3O3BA 4I3GA 3VXUA 2W91A 1KJMA 3MFFB 1GHFH 5B38G 4PJHB 1M1SA 1EHLL 2P44B 3ARDD 4D0CB 4NHUA 4X9HA 4WHTB 1UM5L 2JF1A 2YPLD 4XCNA 3EJYC 3H2WA 4OBRA 5SWZE 4KVNH 1P9MC 4S1RH 5EU7C 4QHMA 3K81A 3LEYH 4TVPD 4QF1B 2JB5L 1FG2B 1U95B 2XG4A 4U05A 3MRPA 3BWAB 5H94A 3NN8B 3RVWC 1AHWB 3QNZB 4KKAC 5ANMA 2H26A 5TE6L 4PJEB 4F7EA 1ITBB 8CGTA 4X6CF 3NGBC 1IC4L 5C3LD 4LSRL 5GZOC 4GUPB 3CPLB 4X5XA 2HKFH 4AT6A 1J5OH 4GAGH 5HHVH 2FJHA 4LRNH 3BQUC 4N90D 1JGDB 2XQBH 3PNWB 1EHNA 1UEMA 3RWFB 3H9HB 4QHNB 4NDMB 3LDBB 2W38A 4GQPH 4IOIA 4PRBB 1TENA 1I4FB 5D93B 5KZCB 2X09A 3GSRB 3FO1B 4JB9L 3EHBC 4OM0L 3TN0C 3W5MA 3BRDA 5ID0B 1CL7I 1PGRB 3LS5H 1UZ8B 4LASL 4NUJA 1MPAH 4FQXA 4OUUB 4FXKA 4GLRH 4X4ZA 5BCAA 5GS0C 4XVUC 5DD6A 1E6OH 4MDJB 3RUGE 2VXVH 5DJCA 1AP2B 5DA0B 3TESA 1FBIL 5J1AA 2DOCA 3O8XC 4JZJB 4MA3A 3K7UA 1NCNA 4UOJA 4DN4L 4ELMF 3FB5B 1WIOA 4RAVA 2F5BL 3MOQA 5EZJB 5INCB 4XWOD 2H9GA 3AU1A 4ODWA 3JWNC 3MO1B 3ZDZE 3FB8B 1CT8A 2ZOLB 1MIEH 5IBLC 1NFKA 3CFEA 4XPTL 4N0FB 3FO0L 2NLJB 3RNQA 3X12A 1KBGH 3F8UB 3PWLA 1C08B 1D5IH 1S7RA 1MFBL 1SBBA 1NAKL 3LKNA 2X7LA 3EOYG 1BGXL 2ATPA 5D7IE 4PFEA 5B39A 4RQQA 4OKDA 4M6ML 2YWYA 2W9DL 1DQLH 3HC4L 3VXRD 3ULUH 1MFAH 1I3VA 1Q9KB 3BGFB 5I1CH 3ZYJA 2P49B 3MA9H 3HZMB 1RY7B 4MS8C 4FTVD 4R8WH 2XA3A 4X6FA 1T2QL 4HC1A 1XR9A 3VFTB 1T1XB 2R8SH 3IFLH 3KPOB 1IZKA 4BSVB 3O3BB 3VXUB 4K7PY 4WY7L 1BZQK 4J3UA 4IBLT 1UWEL 2X89A 3SDAA 4H1LH 3HG1E 4XVSH 3IAGC 4NHUB 1TVBB 3WXWL 4XPBH 3EOAB 4YHPA 2FIKA 4JFHD 1KCVL 4HJJH 1CG9B 2EE2A 3FQXB 3CK0L 1LQSR 2D7PA 2NTFA 2JELL 3MRPB 5H94B 2VC2H 2CRYA 3TV3L 4JZJC 2XNAB 3L5XL 5ANMB 1JFQH 2H26B 2FX8H 3UBXA 4F7EB 2VZTA 5D2LB 3GMMB 5KVDL 4LHUD 4X5XB 2R15A 4AT6B 1A7NL 2DLIA 1MHPL 1RZIA 2FJHB 4I48A 2CKBH 3FN0H 5E03A 4JFDD 1J0YA 1EERB 4EZMA 1P7KA 4IJ3B 1FVCA 4RISH 3UDWC 4DTGL 4F80A 3IVKA 3DHMA 2DQEL 5FO9A 3ZDYF 5I18L 1FAKT 1I9EA 1OPGL 2NY1D 2J8UF 5BZWA 1XAUA 3MLRH 4RGMB 3BGFC 1MJ8H 3TF7C 1MCJA 3WFZA 1FORL 4NUJB 1OLZA 2DI7A 4EN3D 4FXKB 1DVFA 4Z7OE 3QCVH 3BFOA 3SDYH 4M5ZL 3DMMD 3SDDA 1J1XL 5CS7A 1MAML 2UZXB 5D7SL 4P49A 2GSGA 1A6UH 5DJCB 4R26H 4MLSA 5C08B 2X10A 2FJGA 3GSWA 4MA3B 4NRYA 1A1OA 3ZKMC 4RAVB 5KANG 4X0KB 1CGWA 2N4IA 1ZK9A 2H9GB 3AU1B 4ODWB 1ZWIB 4WWKA 4BA8A 3DJ9A 1I7TA 2EIZA 3ROOA 2CIKA 4KRMB 1CT8B 3MXVL 4KK9D 3CFEB 3BP6A 4OB5L 2N56A 3RNQB 3VXNB 3PWLB 4ELMA 5DJYA 1S7RB 4PIRF 3LKNB 2X7LB 4DKFL 3QUKA 2ATPB 1Z9MA 3MV7D 5D7LA 1XGUB 2DQJH 4Y5XC 4RQQB 3HMXL 4M8QB 3ZDXF 2GTWA 1HE7A 4F7MA 2FX7L 2L4OA 2OQJA 4YHKH 4NNXA 5JMRA 1G9MH 1AGBA 4UTBL 4L3AA 1QKZH 1UKQA 5DUPL 4RBPH 4PJBE 4ZSOE 1J18A 2OS7A 5F3BA 4X6FB 4HKJA 4UDTA 4QHUA 4IJ3C 1XR9B 5KVMC 4QGYA 2BNRE 4IOFD 1NFDF 5I0ZA 3QZWG 4CRPA 3QDAA 4PJAF 5E5RB 3HRPA 4MNQD 4O2EA 4ISVA 1T0PB 2H1PL 3B2UD 1HQ4A 3R1GL 4YHML 3QEQB 1MLBA 3MRBB 4NQCB 3SDAB 5E1AA 1MCIA 1BMGA 1S5HA 3NFNA 4YHPB 1PQZB 3ARBD 2VIRA 4BQ6A 4HMEA 3MLWH 3RA7H 4B41A 4CAGA 4ZOBA 4LCWE 5AWNH 1LO0L 3FFCE 3CD4A 4PLJD 3NACH 4BSWA 1FCCA 3F7VB 3SE8L 1J8HA 2B0SH 4EI6B 2NTFB 5F7DA 3RNKA 5EUOE 3VFUA 4OI9A 4XC3L 1P4BH 3GI9H 3BIBX 1NLDL 3UBXB 2E7CA 4PGJA 1CTOA 5D1XD 4MWFA 3TNNA 1QNZH 3ETBF 3GHBL 5E9DD 3I6GA 1S7UA 4L8DA 4I48B 2RIKA 3FOLB 1TZGH 4G6JL 4XCYA 3R0NA 5DJXA 3X3GL 2BP3A 1I8KA 1P7KB 2IAMA 1FVCB 1IGFH 3IVKB 3L5IA 5FO9B 1A7OL 5EC1A 1UYWH 3FFCD 1CFQA 1F4WH 1YYMH 2VLME 3BKYL 5HYSA 5IFJA 4LMQE 1HK6A 4KY1H 4KKCC 4ZO6A 1GAFH 2FB4H 4M43H 4G9FE 3I02A 3FN3A 3L1OH 1LD9A 1CYGA 4N8CL 5EFIA 3HCVA 1WEJL 4KRPC 3SDDB 5I19H 4I3SH 3WIIL 1IM9A 1X5ZA 3QEUA 2IMNA 5H2BA 4M61A 3S36L 2HT2C 5FCSH 2VAJA 4F7CA 4JKKA 2FJGB 4PP1C 5JDJA 4F15B 4NRYB 1A1OB 3U30B 5TDOA 4LSUH 1OY3B 2EDEA 4NFCA 4WHYH 3KR3H 3QRGH 5ICZA 4WWKB 3ROOB 2CIKB 4WW1B 4UV4L 3FHAA 4Y4HC 4OSUL 4XXDA 1H3XA 2AJUL 4ELMB 5DJYB 4JR9H 3DV6A 3VXSE 3WJLC 1F3JA 4K3DH 1F42A 5INDB 3JUZA 1CL7L 5HGDB 3QR2A 2PYED 4CNIA 1UJ3C 4JO4L 4L4VA 4EBQH 4TN9A 4F7MB 3JWOC 5E08L 4YHOL 3MV8A 3OQ3B 1MRFL 4K23L 3RPIA 1JWUB 3GI8L 4NNXB 1WAAF 3KNBA 1BZ9A 2BVPB 5ELIA 4KMTH 3U9PH 1E4KA 4HKJB 1KULA 4QHUB 4QGTA 2HLFC 1KCSL 4PGCA 1I3GL 1M7DA 1N6VA 5EORH 4Z0XA 4ISVB 4XNYL 3O2WH 3QI9B 3NFPA 1HQ4B 5GRXG 1MLBB 1RIVH 1CZ8H 2I60H 2R2HB 1RZ8A 5E1AB 2VKWA 3CMGA 4HBCH 1S5HB 1OTUC 4WGWB 1OB1B 3NFNB 3BKMH 2Q8AL 4Y1AE 3QIBA 4GBXB 2FYYA 1N64L 4Z7WA 4PJAA 5CJXA 5HSFA 2EC9U 2WWKT 3INUH 1J8HB 1S9XB 1F58H 3G6JA 4G8GD 3D0VA 4YBQC 3RNKB 5HHOA 1O7SA 3K3QA 4GW4A 4YX2H 2D3VA 1U8LA 4TSAL 4Z6AT 5GSRB 1IQWL 4MWFB 3TNNB 4LPCA 1MSPA 1NH6A 2OR9L 4L8SC 3RVVC 2W9EL 4L8DB 1K8DA 2CIIA 5AZ2L 3HZVA 2X4SB 1U93B 1RZKL 5JLZB 4XCYB 2P8LA 3HZYA 5DRNB 4H1LA 5IJKA 2HFFA 2IAMB 1DQMH 1OTTC 1FPTL 1B0RA 1OT1A 5EC1B 5ALBL 2BERA 3W39B 5HYSB 5IFJB 5L6YL 4NQUA 5HHMD 4HLZH 1FNEA 1TDQA 2H2PD 1YY9D 3V5KA 1AH1A 5TH2B 4I0PD 2G5RA 1OOAA 1LD9B 1SVCP 5BS0B 3V0WL 4FQIH 3OHXA 2OL3H 3MRJB 4HWEL 5EFIB 4PB0H 5D72H 3S37H 3AM8A 4XC1L 2CLVA 3A6BL 1IM9B 3IYLW 1MCLA 4D9LL 2GYSA 4PJ8D 3I75B 5H2BB 4MXVE 4HDIA 5E2TL 4FNLL 3ZT5A 1HSAB 5DS8A 3QI9C 2CKBA 1V5JA 3EO9L 1ZLUK 4LSQH 3RRQA 1T4KA 5TDOB 1BECA 5FYKE 4WU7A 3VFVA 3AFLA 5CGYC 1WCBA 3GSOB 4L5FH 5ICZB 3QUXC 2X4QB 2IFFH 4GBXC 1Q9WA 3ZTJG 2HN7A 3NCFB 3HI5L 4XXDB 5C2BL 1RK0A 4F58H 1HQRA 4KI5E 1C7SA 2R1WA 2Z9TA 3IU3A 1U8JA 4RIRB 3WDHA 4F7PA 2W60A 1F3JB 1I7RA 5DD0L 4F3FB 5IMMB 5IHLB 1MLCB 1CDHA 5E7FA 4CNIB 3KPSD 3QQ3A 4LHUG 1KJ2L 2I9LA 1BF2A 3MV8B 2Q86A 3RPIB 5I1KH 2GIYA 4FABH 1XZ0A 5DHXB 3P30H 1A4JA 3NPSB 4KJYB 2QQKL 5IBTL 4EVNA 3QIUB 3OPZH 5CEZD 4C4KO 3CJJA 4TNWF 4AIZB 4XNUL 3FAWA 3EYQD 3CXHK 4XAKE 3CDGA 5J12B 3RP1A 4Z0XB 3CVHH 4U2ZA 1A3RH 5I15L 3VRIB 3LPFA 1WAAA 2E5EA 1WFTA 1IAOA 1DFBH 4JJ5A 5AEAA 2XT1B 4ENEC 4XI5C 1RZ8B 3GBNL 5EZOH 2QSTA 15C8H 2APXA 2VSDA 5C07A 5EA0L 1U6AL 1J0IA 1NFDB 1TVHA 4CVWA 3CXHJ 1MOEA 2HFGH 4GRWF 4PJAB 1MWAH 4TOYH 1QHOA 2VXTL 4OCLC 1EJOH 4DGVH 5DQDL 4E5XA 3QWRD 3W0WE 5J9PA 2FEDD 3LKQA 3G6JB 1EEZA 4NZUL 3D0VB 4YAQA 5HHOB 5DC4B 5BO1H 5I74B 2C4FT 4U1MA 3NIGF 5T1DH 1U8LB 4KKLC 3P2TA 4RGNE 4NZRL 1ACZA 4Q9BA 5CUSL 1L7IL 5EO0B 1JGLH 2BHYA 1G7QA 1K8DB 2CIIB 3HZVB 3KPMA 5L7XL 3FT2A 2P8LB 3SCMD 4HS6A 4H1LB 4Q9QL 2NY6D 5ENWA 5E8PB 2NW2B 3BEVA 4CDGC 1PY4A 3L3OB 1MRCH 4OGZA 3D2UA 3D1MC 3TZVD 2EYRA 3CSBA 3W0WD 4LF3B 3SDCD 1BOYA 4OJFL 5IROA 2Z93B 4M6NL 3BD3A 1I9JH 2ED8A 4KQ3H 4NQED 1MRDL 5EIIA 2EZ0D 5FYKU 4OCSH 5DJDA 3WFBL 3OHXB 2YUWA 1ND0A 2PXYD 3NPSC 2JJVA 1OCWH 4RX4D 3I2CH 2VZVA 2CLVB 4RGND 2Y6SC 3EBAA 3QIUC 4CL7A 2AK1L 1MH5A 1GPOL 3T0ED 5J12C 4P2OD 3VDCA 5CJOL 1VACA 2VN7A 4Z95L 2X1QA 4X6DE 2CKBB 1BOGA 4I2XA 1NPUA 5CJ5A 3BH8A 4WU7B 3H9ZA 2DDQL 3PWPE 1WCBB 1U2CA 4PRHE 4OM1H 5I16A 5BZDA 3QXWA 5FECB 2BY1A 4MJID 5J3HC 3QIWD 3SE3C 1RK0B 1J7VR 1SJVA 1HQRB 2PW2A 2R1WB 3ULVC 3IU3B 1U8JB 3NCJL 2ESVA 1MVFA 4YO0B 4J12A 4JFEE 2ZJSH 2AJ3A 4M62L 1KLUA 1S78C 1Z0MA 2WV3A 5F96L 3QQ3B 5D1QA 2AABL 2I9LB 4NT6A 3LN4B 3GSVA 4O2FA 4ZD3L 2Q86B 1EFXA 1I1FA 2E9BA 1XZ0B 1GGIH 5I9QB 1BWMA 4XPFL 4PRHD 2DN7A 4E41B 2FR4A 1AGCB 5LCVL 3OB0K 4EVNB 3QDHA 4LGPB 4OCXL 2HTLC 4TUKL 1FYHB 3CDGB 4LPYA 2VLRD 4OF7A 1S7VB 2J6EH 1G7LA 2V17H 2CDFA 3P73B 1KXVC 2IH3A 4JDVA 5HDBE 1H8NA 3A6CH 4WFGD 5T3ZE 4WDIA 5C07B 3UYRL 3IXAA 5HVGB 3WFEL 5DO2D 4Q9RH 1TVHB 5EBMA 3LQAC 4AEHL 1S3KL 1OSPH 2W59A 5DJ6B 1OP3K 3EOTH 5J9PB 4DCQB 3LKQB 1N59A 1J12A 2A38A 1EEZB 4P4KB 2A9ML 2NTSP 5TQ0L 1XIWA 2ENYA 2P7TB 3OXRA 3SY0A 1L0QA 2AXFA 4U1MB 2XTJD 4MXWL 3MBEA 5JXED 5D2NC 2N7AA 5LAXB 3OJ2C 1QSFD 3H9SA 1VGKB 2DBLH 5KSUA 3QUYC 5A43C 3WKNA 1AR1D 3GHEL 3I6LD 3TVMB 3U82B 3CLFH 1FYTA 4HD9A 2X5PA 5H35B 5T3ZD 3P4NA 1YPZF 4P3WA 4F9PC 4HS6B 4JFOA 4BQCA 3RWCA 5ENWB 3D5OF 5F1OB 3BEVB 2YRPA 3GMQA 4MZ3A 3D2UB 3AS3A 1JK8A 3RWIA 4GOSA 5F1IA 4J2XA 2E7BA 4NBZB 1J1PH 4LVEA 5FKPA 2WZPD 5EIIB 5DJDB 2X9YA 4DW2H 1SMOA 3L7EA 4LBEB 5CZKA 4S2SA 5I9QC 1YYLL 5KVEH 1KENL 2E9JA 4QRSA 3GIZH 5GHWL 5I17A 2MPAH 3MBXL 1VACB 2B8OT 3C5JB 2VDQH 1OP5K 1Z2KA 2OK0H 4K3EH 4JHWH 4I2XB 5FF6A 4MA1B 4RWHA 2Z0BA 1SBSH 5ESQA 5IVXF 4OKVA 1D9KA 2B5IB 4I3RL 4V2BA 1YEDA 3IDMB 4JN1H 4XP4H 5I16B 5BZDB 5LVEA 2DYPA 4HXBL 1R3IH 2APTA 1ZANH 4NOFA 2HH0H 2GSIA 2FJFA 4OD1H 4IDJL 2YWZA 2QEJA 2YD6A 1XCQA 4NKIL 2PW2B 3V7MA 4NQVA 1NLBL 3NA9H 1ZXQA 4P4KC 1QVOB 5I8CB 4YXLH 2ESVB 2FEEI 2OL3A 3W2DL 4HFWA 4YHZL 4GKOA 1ZT1A 2ZUSA 2AJ3B 4ODXA 3STLA 5D1QB 4NT6B 4PJ9C 1UM4L 1F13A 4Y2DA 1N7ML 4O2FB 4XTRD 5BV7L 1EFXB 3GMRA 3GMOA 1I1FB 4X7SH 1CFNA 4AH2A 1OWRM 3TVMC 5JDSB 3LD8B 1UA6L 5EOCL 3FQTB 3QSKB 5F97E 3ZHKA 3V7AE 4WO4A 4L3CA 1FNAA 4H5SA 2AJYL 2EH7H 2EDRA 1T66D 5IB5A 5D5MF 4EOWH 3BUYA 3S88L 1UVQB 5EO9A 2VWEE 2DM3A 3VWKD 1IEBB 2JIXD 4OFDA 1BQHG 1T0NA 4DGIL 1G7LB 2CDFB 4OLYH 2IH3B 3DVGA 2HMIC 4JDVB 4OD3H 5FA3A 5L2KD 1HZHH 3IXAB 3TO4A 4TPRL 2GUOA 4QRRE 3MGTA 4ESKA 4JQIL 1HH9A 3FT3B 1ZT7B 5JOEA 2V5MA 1QTYT 3WIFB 2DJ4A 5GGUA 3SGJA 1N59B 4GG6F 3MFGB 3NZ8A 3UJTL 4XHJD 1GGCH 5C09E 5K33A 3AGVA 3OXRB 3SY0B 4RGOH 1AGDA 5DD1H 1NBVH 2AXFB 4GRWB 3MBEB 1OTSD 3QPXL 2B5IC 3RPKA 5C6PB 2NZIA 1V3KA 5MERA 3SKMA 3CVHA 2CDGA 3QEGH 1E27A 1N4XL 1YC8A 4DZBA 1DQDL 1SEQL 3UYPA 1FYTB 1HCVA 5EOTA 2J7LA 1H15A 3P4NB 5CSBA 3RWCB 2JCCE 4QRRD 2VDRH 3AREA 3GMQB 1T83C 2ED9A 3QHTC 4LQFH 3VGBA 2EEDA 4PJXF 3RWIB 4BZ1L 3MGOB 4PRPA 3GNML 1ETZA 5DTFB 1S9WB 1INEH 3HAEG 4FMKA 1FGNL 4S2SB 5F7NC 3RIFF 4G42B 2FZ3B 5MENA 3L5JA 2R0WL 2VLKE 5T1LA 4QRSB 4HPYL 1CD8A 4LDLB 1CBVH 1TVDA 3O11A 3VH8G 5I17B 5ILTL 1KPVA 2C3VB 3CU1A 4DN3H 2X9WA 3EYVB 4OLVH 1CD1A 4RA0C 3DBXB 4K3JL 5CEXB 1MHCA 5FF6B 2JKXA 1NC4D 5TQ2H 5ESQB 2DF3A 3TA3D 4OKVB 5F7FA 5C0ND 4DKEH 1WK0A 2EDHA 1D9KB 1G9EA 5GJTL 3T1FB 1ZLSH 4P46C 2GY7B 1OAXH 2C3XA 3BPLB 1BFSA 3AAZA 2GSIB 2E27H 2FJFB 4N0RA 1G9NC 1XCQB 1K8IA 1YEIH 3ZO0A 1NGZA 1MJUH 4KTYA 2H6PB 4NQVB 1MCWW 1HKLH 1CF8L 4IS6B 3QA3A 4HFWB 3I3BA 4P5MA 2ZUWA 3GO1L 2R56H 2R23A 2XZQL 3QFJD 1FNHA 1ZT1B 3STLB 4BJLA 4U1LA 4NO0A 4DZ8B 4U0RB 3ZE0F 3MLZL 3FCTA 4S11A 3UYOD 3GMRB 3GMOB 1CFNB 4AH2B 1EO5A 4Y16A 1NGWA 1X5XA 4P4RB 1HIML 3O9WD 1A6ZA 4WO4B 2E6JA 1RJLB 4L3CB 1F6AA 4H5SB 4JRXB 1OARL 4PRIA 4WW2F 4ZO8A 3X17A 1VFMA 5IB5B 4JO2H 2DIJA 5IKCB 3GK8H 3BUYB 1NGPH 4MNGA 5EO9B 3ILPA 2QKIA 4JPKH 1Q9OA 3X14A 3PL6D 1T0NB 5FHAH 1KIPB 1W0YT 3DVGB 1HN1A 4B7IA 2DIBA 4FQQA 2R39A 1I1CA 1F90L 1OM3H 1NJ9A 3TBWB 1C16B 3TO4B 3PG2A 5D5MA 2GUOB 5EU6D 1QFWI 1Q8MA 3MGTB 3ARDC 2VR4A 4Z7UE 5JW5B 1HH9B 4Q97A 5GGSA 1I85A 2C1OA 3SE4C 4NN5B 1NC2D 3LKSA 4APQA 3NZ8B 1ZE3C 5CHNB 1XH3B 3QFDA 5L8JB 3OF6A 5DFTA 1CK0L 1MI5E 3RVXD 1TMCB 1VADA 3R8QA 5C0JB 1NANH 3UPCA 5TE4L 4WTZG 5MERB 2DD8H 3SKMB 3CVHB 2CDGB 5F7LB 3PWNA 5E24E 2IG2L 3BPLC 3NIDE 4DZBB 4NFDA 2AQ2A 4HWBH 3VFMA 5EOTB 2J6EA 1NGXB 1H15B 4WJ5A 5M95B 2DQCL 4O02L 1AKJA 2GITA 3LH2L 3AREB 4LLQB 1CU4H 5DVOA 4P2QA 4TUJA 5E6ID 4UZGA 5GGRB 2BJML 4PRPB 1YMMD 4HKXA 1XGQA 3SO5A 5D7LE 1T89C 4JJHA 4KV5F 3W5NA 1ED3A 2QQNL 3QHFL 4Y8DC 4JM2A 2X9XA 5DHVH 4ZQKA 4H0IA 5MENB 4XCFL 3UBXI 3LEXA 5T1LB 2YMXH 1WFOA 5J0BA 2FO4A 3O11B 1TZIA 5DJZA 1JRHH 4DUVA 4YUEL 3S97C 3K74B 4EI5D 3SKJH 1EEQA 1CD1B 3RI5F 4O51B 4URTB 1XGRA 2FATH 2VERN 1E6JH 3WIHH 1MHCB 2Q76A 5I1EL 5D96B 1YEEH 1FQ9C 3TM6A 2FLRT 2D03H 1T3FB 1RZGB 4WUUD 1MCKA 1ONQA 3ZKSD 2C1PA 1LILA 4O5LL 1BBDL 3HC3H 3JTTA 3JXAA 1AO7B 2DWEB 1IZJA 5T33H 5C0IB 1K8IB 4NN5C 4F9LC 3I85A 5D6DC 3L95A 2Z35B 5CD5D 5IVXB 2VZ1A 5AAMA 3R06A 3NZHH 4IRJA 4P5MB 4Y5VC 2R23B 2HJKA 2RCSL 3HE6D 1CR9H 1QLEH 4U1LB 4NO0B 3RZCD 3MODH 3UAJD 2KZ1B 2AEPL 1PW3A 4HWZB 4JZOA 3WFDH 4P9HH 3U46A 3ZYIA 2ZCKL 5DUBA 3M17B 2DQFA 4Y16B 4QRTA 4KAQH 1OAQL 1Z9SA 3O3AA 1JP5A 1F6AB 5ITBH 5ERWA 3BDYL 1INDH 4LEXL 4M6OH 5HDOA 4UILL 3VRLF 5BXFA 5JQ6H 4MNGB 2B1AH 4F8TA 4NYLB 2YA2A 3O4OB 3X14B 4JGMA 4OI8A 4M1DH 2IAND 4XZUA 4K8RC 1K5NB 2F19L 5ESVA 4FQQB 3MYZA 4NKDB 4EDWL 1G0DA 5D5MB 2O26U 5D1ZD 1AJ7L 5F3HB 5GGSB 4M93B 2C1OB 4F57L 4APQB 1SYVA 1MCRA 3V6OC 4WU5A 3LPWA 3RFZC 3T3MF 4TULH 1PX4A 3BGMB 1VADB 4CVXA 3SQOH 3ORJA 4OF0A 1GRWA 4MYWB 2NYYC 4HEME 4GQ9H 2X6MA 2GW5A 4OV6F 5EUKA 3MRRB 3PWNB 4GG6B 4NOBA 1U8PA 4I0KA 4WFHE 3LAFA 2HP4A 3M8OH 4J4PA 5IBUB 5TGBA 4JY5L 2UWEF 2V7NA 5D7KE 4ZAKA 3S8WA 1AKJB 2WUCL 4IMKC 5MP6H 4KK6D 4NQSB 3K2UL 4NP4L 1I9IH 4FFYH 5JR1L 2R2BA 1MFCH 4QOKA 1Q38A 3MLVL 3C60A 5I1AA 1A7RL 3ULSA 2CLRB 1ED3B 3B9EA 4U6HB 2P5ED 3BIKA 4JM2B 4RZCA 2IQ9H 4L4VE 4U1NA 3DOSA 4LK4A 3LEXB 4PJXB 3JWDH 4G6FD 4EN3C 1X5JA 3MV9A 2FO4B 3MCG1 4MJ6A 5DJZB 1RAMA 3DMMC 2V5TA 3DLQR 4HF5H 1JGUH 3N1GC 4ODTH 5D70H 4WI5A 3O4OC 4B0MM 3IRZA 4MCZA 1J8KA 2CMRH 1U36A 1DUYA 1ODAA 2Q76B 3RAJL 1T1YB 3FO9A 3C09B 4OZFG 5HVWA 4OZHE 5C6TL 4K3HA 5A3ID 1ADQL 3IKKA 1ONQB 5DDHA 3S35H 2XN9A 5T5NF 4ORGB 2AEQH 2D7NA 4M93C 4Y2OA 1QRNE 5JW4M 3QDJE 5HYJD 5FYJL 4FXGA 1A8JH 5ALCH 3TBSA 4FQPA 3VRJA 3NAAL 4Z7WE 5IIEA 5JHDD 5T3XL 2HJKB 2WLZA 4Y5YB 3G6JE 2A2QT 3B5HA 4JZOB 1QR1A 3BSZL 4H20H 1MFEL 3LMJL 4C54A 3MRNB 1QBAA 3TT1L 3REWA 1BQLL 4X80H 5C8JA 2CO7B 3QXVA 4QRTB 4P3CL 1OW0C 3V4UH 5F89B 5ERWB 5D71L 2QADB 5I66B 2P43B 1CGUA 2YBRA 5C6WH 3RVUD 2LQRA 2D9CA 2XRAL 3AS1A 2W0LA 1AD9A 4G9DA 2FD6L 5ESVB 1QBML 4PJGE 4J3OC 4TNVK 3DSFL 2EDXA 2C26A 3AB0C 2VXQH 1X7QA 1RHHB 4XMKL 2ED7A 1P4IH 4KWUA 5DD3L 3G6DH 5I8OL 2Z8WC 1SYVB 2UZIH 4JO1L 4PLJC 4WU5B 1A6WH 4R7DA 3MRGA 4TNVF 2CJUL 4ODVL 4UT7L 4WWID 3ZE2F 4PY8I 4KRLB 1Q72H 4CVXB 2GCYB 3C09C 3CVIL 1YECH 3BO8B 5EUKB 1CFTA 5HHXL 2NXYB 1IE5A 4YXKH 5ISZD 4RWYL 4JRYA 3N1PC 2R69L 1UXWA 2AGJH 3B43A 5TGBB 5JZ7C 4M5YL 1LK2A 3PDDA 3L5WA 1AGFA 4D94A 1JF6A 4FFWD 1WICA 1L7TH 3TIDB 4YXHH 1Y18B 1SVZA 1ES0B 4H8WC 4Y5YC 4KC3B 1OHQA 2R0LL 5I30L 3C60B 4AENA 5I1AB 5C0FB 4POUB 3ULSB 3CFCL 2I26N 3HUJF 1QFWL 1YY8A 3JSSA 3BIKB 4U3HA 1E4WL 4U1NB 4YQXL 3HMWH 2NW3A 3WFCL 4LSPL 5ETUB 3MV9B 1R3JA 3MACH 2NY3D 2LFGA 3C5ZA 4KQ4H 2F53A 4OD2A 1A1NA 3A67H 1OAYH 3UTSA 1JIBA 1X4YA 4HWBA 3A0OA 4MCZB 5FK9A 5FKAA 4HC1L 2XV6B 1XGYL 3FO9B 1I1YA 4WW2C 2OP4H 1KSRA 4QHKI 3FZUC 1WBYA 2XN9B 5C0AA 5C0CA 4NZJA 3PGDB 5GGVH 3UTTA 1FFOA 3WEXA 2MCPH 4O4YH 5J6HA 2APBA 1V7NH 2EO9A 3TBSB 3IFOB 2VQ1A 4ZPVA 3VRJB 1KC5H 5DHVA 2XTLA 5IIEB 1GSMA 3DX8B 1IT9H 2HKHH 1A6PA 3VMOA 4NPYA 1QBLH 1FRGH 1QFHA 3KXFD 1KIQA 3V6FA 5C8JB 3QISA 2V9TA 1K9TA 1KCRL 4NCC2 4OLWL 3WIHA 1MFDL 3HI6L 4QTHA 3BVNB 4N0CD 1CICA 1V3JA 3D3VA 12E8H 1RJZB 3U4EA 1UB5A 4CADA 3MOAL 2NXZB 2YBRB 2PO6D 4IEFB 1U58A 3MLSH 2XY2A 2EDLA 2DQIH 2YXMA 4G9DB 3VGDA 2WIIB 1T03L 2H2SD 3RDTD 1MHHA 2I24N 3EFDH 4X4MA 2FIRT 5TE7H 4Z5RA 4YNYA 1LP9F 4MAYA 3BAEL 3FMGL 1F4YL 1FVEA 4ODSL 2ZNXA 3UCRA 4UV7H 2GT9B 4YHNA 4N1CA 4PS4L 3Q0HA 4OLUL 4R7DB 3DGGA 3MRGB 1LDPH 4S10A 4QRPB 1ZHBA 3AXLA 4OCWH 1MELA 4X5LA 4YPGA 3QP3A 3M1BB 3IFNH 2HFEA 3BGAA 1YDPB 3ARGD 1KPUB 1A21A 4I2XE 1MCOH 5IFHH 4JHZA 4HIJB 2WWMD 1KUMA 1UXWB 3FRPG 3HNTH 4NJ9L 1P7QB 3H42L 4C56E 1EMTH 1OVZA 3L5WB 1IRAY 4L4TB 2E3VA 3OTTA 3FB6A 2MHAA 5CZXD 2QQLH 2F54A 1UC6A 4CU8A 4HUNB 4AENB 1CFSA 5JNYA 2H2PC 1YY8B 1YY9C 2BNQD 1DTUA 3WLBA 4I0PC 4PG2A 3M45A 3F62A 3AY4C 4XNZC 1R3JB 4L3EE 4M4RA 1L9NA 3C5ZB 2F53B 4OD2B 5J11B 1A1NB 1FCGA 2X4NB 1QSVA 2NXZC 4FOMA 4GXVL 4WEMB 1H3PH 2RGSA 1R0AL 5FK9B 5FKAB 4GH7B 1QQDB 3QUMH 5J1SC 2AQ1A 4X7EC 3D39D 1I1YB 1U8IA 4ZFFA 2EXYC 4L29A 5H8DA 2YD8A 3OAYH 4PTUA 5DMKA 4OGAD 1WBYB 5C0AB 4UIKL 4E0RB 2CUMA 5C0CB 4U3XA 3UTTB 4TVPH 4JKPH 1FFOB 2BY2A 3V0AC 3WEXB 5IF0A 3VXMA 5J6HB 4AQ1B 1IL1A 1I3UA 1WZMA 1L0YA 2UV3A 4M1CD 2DTSA 2ZSWA 4ZPVB 4U7KA 3GMNA 3UTPD 3DYOA 3CZFA 4KK5D 4JZNB 5DHVB 4L3ED 1S5IL 5E4EB 4HUMB 3T0BA 2IPUG 1FNSH 1M7XA 4AEFA 4NPYB 2EC8A 5GZND 1KV3A 3ES6A 3BW9B 1AXSA 2CXGA 5I1IL 5JO5A 3OAUL 1VB9A 3V6FB 3WJJA 4UMGA 2P5WB 4QTHB 2KZWA 3H9SE 3NFSL 4FQ1H 1CGVA 3D3VB 3TYGH 3U4EB 4ZFGH 4CADB 5I1GH 4X99A 1EDQA 1GHFL 1JPSH 3BN9C 3UZVB 3GSUA 3HB3D 3MNWA 1LEIA 3QXUA 4LSDA 4K94C 1IBGH 3JZ7A 3GB7A 4LCCC 1EX0A 1MHHB 4I9WD 3SKNA 1OAKL 4YNYB 4WI7A 5SWSA 4IOSD 4KVNL 5F7KC 4S1RL 3LEYL 3QDGA 5BRZA 3EDKA 4FFZH 4YHNB 4LLMA 4R2GB 5HGGS 2FEDC 3H7BA 2CH8A 4QHLB 1LP9A 5LGJA 1BVKA 5L9DH 2HKFL 2HFEB 1T7VA 1J5OL 4GAGL 3V2AR 5HHVL 1GC1L 1MCEA 4LRNL 2CD0A 4G5ZH 2XQBL 1WITA 2R4RH 4P57A 2ERJB 2MQ3A 4I4WA 4N68A 4WHCA 5ITFB 3RTQA 4MDIB 1PZ5A 3SCMC 3FB6B 1FJ1A 2AEIT 4TVSa 1P4LA 2F54B 3VD9A 5E4EC 3ARFD 3D9AH 3LS5L 1D5XA 2E8YA 1INQA 1MPAL 4ZO9A 1CFSB 5JNYB 1IEAA 3NOIA 3SDCC 2HT4D 1KEMH 3QXTA 4N0UE 1TPXB 3OKKA 3OAZH 1EUTA 2VXVL 4KH2A 4U1IA 1YJDC 3VI4E 3HR5A 2ZCLH 3SN6N 2PXYC 1HI6B 1HOCB 3HUJB 3QHZL 1DBAL 3ARPA 5IQ9A 5EU7E 5ICXA 3S96A 4OZIF 1ZLWK 3ZTJH 2PTTA 4GKZA 5CBEA 3N85H 1DQJA 3K8KA 1MIEL 1NMAH 1SJXA 3T2PA 1IGCH 2CDEB 1KBGL 1D5IL 5IF0B 3VXMB 5E8DH 1OAZH 3WSQH 3RGVB 1IL1B 3O4LB 2ZSWB 2HFTA 3GMNB 2VZOA 2IWGA 2VABA 4ZXBB 4AMKH 1DQLL 3HNVH 4JFFB 2RFXA 1MFAL 3ULUL 5I1CL 1T0MA 3EJYD 1P84K 3F58H 4PJ5A 4X98A 2K7PA 4KMLB 3MUHL 1AXSB 4HIHA 5JO5B 5TDPA 5IWLA 1W72H 3VFSA 1QRKA 1AGEA 4XH2A 3RVWD 2R8SL 4KKAD 2A1WH 3IFLL 4QYOA 5GZOD 3BEWA 4R3SA 4X99B 4U7MA 1PVHA 1BZ7B 1NCCL 1YA5A 3MNWB 1LEIB 4XVSL 3UO1H 4XPBL 3BQUD 4LLVB 2NX5A 2P47B 4ONFH 1ZGLM 1KTLA 1NEZG 3SKNB 1JL8A 4HJJL 2APVA 1TPXC 3DUUA 5SWSB 4RNRA 4IMLA 4Y19E 4DWHA 3CU7A 5ADOH 3QDGB 5DO2C 3EHBD 3TN0D 2VC2L 3VG9B 5JHLH 1A6VH 3ZZ1A 1JFQL 5CKGA 3RKPA 2F5AH 3SBWA 4HUUB 2NY5H 1LP9B 1X5KA 4UQ2A 3EYOA 2JK5B 3QZWA 5E2WL 4XVUD 3VXQA 1PX3A 3VFNB 1MF2H 3CFKA 4XMLH 1I7UA 2XTJC 2CKBL 43CAA 5JXEC 3FN0L 3BZ4B 5IESH 4RISL 4P57B 3ZT6A 2F9BT 4P23C 4PGBA 3RGVC 4I4WB 1AR1C 4PGZA 5JPNA 4A6YH 4ODHH 3MA7A 1PZ5B 4ZXBC 2BRRL 3L3KA 3ECBA 3U9UA 1PDKA 1EFQA 3MLRL 3VXOB 1MJ8L 4YHIA 5IOPA 5IBLD 1OGTA 1RK1A 2MCG1 1IEAB 2VN4A 3QCVL 4GO6B 3SDYL 2IPUK 3DV4A 2OCFD 3TH4T 3OKKB 2AJXH 1A6UL 2M2DA 1M6OA 4OFKA 4U1IB 3RUGF 4R26L 4ZDHA 3ARUA 5I1JH 3X11A 5JOPE 2Q7NA 4QXUH 5I71C 3IFPA 4PRIE 3KLHC 3S96B 1ZA3A 4MS8D 3P9MA 1WJ3A 4U6TA 2A6KA 3T0AA 1FIEA 2B20A 1T04A 1ZVYA 2R4SH 4GKZB 3ZDZF 5CBEB 1DQJB 1Y0LA 1JPTH 3QCTH 5KZCD 3P9LB 2CRZA 4OT1L 5I2IB 4N8VG 4OZIA 5GS2H 5I73B 3VG9C 2DQJL 2VABB 5D7IF 3GSXA 4UIMA 3B9KC 2VDML 4KZEH 3RWGA 2AJSH 3GMPA 5J1TC 2RFXB 4LCIL 3ZKXC 4PRNB 3QUZC 1B0WA 1T0MB 4PJ5B 4PV8A 5E8OA 4D9RD 5DVKA 4LDOB 4YHKL 1G9ML 1BM3H 1F2XK 4HIHB 2VDPH 4OTXL 5EOQH 1QKZL 4BH7A 2DIAA 3HPLB 5C0BB 2WK2A 3PWVA 2E6QA 3QUMA 1AGEB 2GJ6E 3DPBA 2ARJQ 4CU7A 5HGBA 1BD2E 1I1AB 3CH1A 4R3SB 3U0TA 5I75C 4HULB 1UG9A 2AI0H 5KS9A 4PJCA 1YEJH 2L0DA 2X4UA 4G6MH 1T5WA 2QHLA 4P2QE 3FQRA 2DLEA 2NX5B 3BZFA 1EXUA 3MLWL 1IGJA 1KTLB 3RA7L 1A6AA 5AWNL 3NACL 3OKMA 4OI7A 2VTFA 4F2MA 2AXHA 1BFTA 3QCUH 4RFOH 2CK2A 3QRFM 3MLYH 1P4BL 1YNTB 1T21A 2CUHA 3GI9L 2GJ6D 1IKFH 3T77B 3FRUB 4PLOB 2Y07H 1BVLA 3T0VA 4YZFE 5FGSA 4UQ2B 1BD2D 1XGPB 3QZWB 1QNZL 1A3LH 4WV1B 2D4DA 2EKSB 3VXQB 3CFKB 1I7UB 3THMH 1FZKA 1FNGA 3BZEA 1G7IB 4GJTB 43CAB 1XF2A 1J05A 1OTSC 2QHRH 3VXUD 3AS2A 3SO3C 3ESVF 5F9WC 1IGFL 4BFIA 2F8XC 4PGBB 1YUHA 2AJVH 2LU3A 3ZKMD 1UYWL 5JPNB 1F4WL 1YYML 2YD1A 1JZ8A 2WAHA 1VERA 2R9HD 5CZVL 1KN2H 3MA7B 3U4BH 5FYJD 3UMTA 3L3KB 4KY1L 4NN7B 3ECBB 4R4FL 2AXJA 1GAFL 4ZPTB 2FB4L 4M43L 5IQ7H 2G5BA 3D87B 3T4YA 1UH3A 5IOPB 3IDXH 5T3XD 3HRZA 3P77A 3L1OL 4CMMA 1RK1B 4QXWA 2GTZA 3BMWA 2J3SA 4Z7OF 3DV4B 1ROWA 5I19L 4I3SL 4NNPL 4D3CH 3ARXA 4M7KH 1A14H 5F6IC 4V1DB 4ZDHB 3E6HA 2WBWB 3X11B 2J1KA 1I1AC 1RZFH 3IFPB 1EEYA 3IJHA 2WM0A 2VAAB 2WWKO 4JPVH 2DMCA 4LSUL 3DXAB 3KVQA 5HI3C 1CDUA 1U3HB 1XR8A 3P9MB 3KR3L 2A6KB 1T80A 3QRGL 1T04B 2Y7QA 1Y0LB 3V4VH 3TA3C 4FQCH 4HH8A 5C0NC 3BRGC 4YDJA 5ADPH 1H5BA 2YA1A 4MMZC 4JR9L 4OZIB 1G7JA 5HVHB 4FTVA 1IEHA 1IGTB 4WUKH 5L8KB 4K3DL 3RWGB 4EBQL 4LARH 1XEDA 5D7JB 5GQBA 2Q8BL 1WT5A 4WV1C 3BRFA 4QRUA 4BH7B 1O0VA 5C08D 5A2KH 3PWVB 4KMTL 2Q20A 3U9PL 1MJ7H 4PJBF 5D7IA 3QUMB 3MLTA 2WQRA 1NFIA 3WCYA 3EW3B 2HJLB 3PQYE 5EORL 2MKLC 5GISH 3CH1B 3O2WL 4NN7C 3U0TB 5JOFA 4C55A 5CINH 3QQ9C 5KS9B 1RIVL 1CZ8L 4OFYD 4PJCB 3T2QA 5F7UA 1HHHA 1ZKAA 2X4UB 3G04A 1T5WB 1AQDA 3EYUH 1EXUB 1IGJB 5LXGH 4JDZA 2YZ1A 1A6AB 4QOKE 4KJPC 4LHUA 3OKMB 1Q0XL 3JV0A 4ELKA 3INUL 4F2MB 1U8OA 1GGYA 4OGXH 4ONGH 3HG1A 4GMSH 4U31A 1QA9A 4ZFZA 5EUOF 1P2CA 4RFNC 1W72A 1ZGLA 3MV9E 3PQYD 3SOBL 4YX2L 1BVLB 2R29H 1U3HC 2Z92A 5A1AA 2HTKC 5MEPA 4HSQA 5SWZB 1NSNH 4HIXH 4HS3A 4CU6A 3RVXC 3CUPA 2HT3C 3BZEB 4KDTC 1XF2B 3IDJA 3SEPA 2HT2D 1PKQE 1VCAA 2G60L 3ARSA 3BKCH 1YUHB 3CXDL 3QEQD 1C5CH 4NQCD 4ZNCD 1WWAX 3SDAD 1C5BL 3UP1A 1PG7H 1HEZA 4X4YB 3HZKA 2AXGA 3JVGA 3T4YB 4X6CE 2MNUA 3G6AA 1JZ5A 5D7JC 3HRZB 3P77B 4Y4HD 4FQIL 3HAEH 2GTZB 2YPVH 2H8PA 3QNXB 2VDNH 5B21A 4PB0L 3S37L 1LGVA 3RBSA 4UAOC 5CBAA 5CEZH 2A9NH 3LZFH 1ORSA 4CN4A 1P6FA 2VXUH 4JFPB 1IVLA 1D7FA 2BMKB 4K94H 1DLFH 1RPQA 5FXCH 4IRSC 3IJHB 1MNUH 4X7DC 3O3DB 1XR8B 2HG5B 3MV7A 3RQ3A 3RUGB 4A6YA 1G7MB 2IFFL 1DEEA 1EAPB 5CP7A 2BZDA 4YDJB 5DQ9B 2A6JA 4PTTB 5SWQA 2VL5B 1G7JB 5K9JH 3QEHA 4YFEA 1OTUD 4XNQA 3S5LG 1R3HA 1G6RH 4PBVC 3SDDD 1RD6A 4MMXC 2GK0A 4M8VA 5I1KL 2AV1A 4FABL 3HE6C 3RU8L 3P30L 3UAJC 4YBQD 2O61A 5D7IB 3NA4A 3MLTB 4XP5H 3OPZL 4KHXH 3O6KH 3ARBA 1CVSC 1BIIA 3D18A 3IDGB 3CVHL 1A3RL 4A2MA 1A1MB 1SM3H 5HHQA 4JRYE 4WWKD 1DFBL 3CSGA 3TJEH 1RZKC 4GAYA 3RVVD 1RSFA 4LPTA 5EZOL 3G04B 4ZSOA 1AQDB 1ZVSA 3OJDA 2HFGL 1OTTD 1FH5H 2XA8H 2WUBH 4TOYL 5L88H 1EJOL 4DGVL 2EE3A 5D1XA 4BM7A 1U8OB 2XKNA 4LNRB 5D1ZC 3HG1B 4RCAA 1QA9B 4XNMA 5BO1L 4JPIA 4P5TA 5AYUH 2EYSA 1W72B 3HNSH 2EIDA 5C0RH 2HJFA 1YNLH 5F6HJ 3WS6C 2Z92B 3FFCA 4Z8FL 4GSDH 4ZUVB 5MEPB 3UTSE 2NY1B 2YC1A 4X9FA 2NY7H 4Q6YA 1JGLL 2X1WL 3CUPB 5DLMH 3CC5A 3MLXH 2Y5TB 3IDJB 9CGTA 5EUOA 1FO0A 3NCYS 5T5FH 2R0KL 3QI9D 3DRQA 4WRLA 2BVQA 5CGTA 5C0AE 4PB9L 1MRCL 5C0CE 4KROB 5CGYD 3UTOA 4W68A 4U4BA 1HEZB 1OD9A 1MCPH 2Q7YB 4HGWA 1RU9H 3QUXD 3RWJB 1Z3GL 4GBXD 4HIIA 3T8XA 3T08A 3G6AB 1IAKA 4OCSL 1UB6A 2H8PB 1KB9J 5HJ3A 3I2CL 2QSCH 4Z7QE 1ORSB 2WIMA 4MXVF 2EE9A 1BBJA 3ZDYE 1YN7A 4J23A 3CCHA 2J8UE 4AYFA 2ICWB 4OM0H 4WI9A 4OM1L 2K7QA 1VFAA 3L3GB 4A6YB 4LASH 1DEEB 5AG9A 4J3XA 4JFYB 4PLKD 3MRQA 4KPHH 3SGKC 4LSVH 2A6JB 5SWQB 5L0QB 4NM4H 3SGDH 4ZUTB 3MRMA 3VGAC 5BW7C 4KI5F 5DT1H 4LCUA 3SGEI 4XI5D 4ENED 5SV4A 5E95B 1G1YA 5BS0D 4CN6A 1R3HB 3UZEA 1NANI 4EIGB 4KJWC 5BVJA 1IM9D 1OGAE 4BFGA 1GGIL 2NMSA 5T3ZH 5A2IH 3VXSA 3MUZ1 3P4OA 4U1GC 4G7VH 1TJHH 3V0VB 2E7HA 1BIIB 3DUHA 3D18B 1CLZH 1IAIH 3MUJA 4KKLD 5HYQB 5AYQA 4RMVA 5SX5H 2J6EL 2V17L 3ZDXE 4NKOA 5I8EA 1JZ4A 2W9DH 4G8GA 4PJBB 4ZSOB 1ZA6A 3A6CL 3MJ8A 4RDQF 2F8VA 1NBQA 2OTUA 4Q9RL 2BNRB 1ZVSB 4QTIH 4WI3A 1OSPL 4X8JA 4Q6IA 1IAIM 3MROB 2XKNB 5CSZA 4Z7VA 2Y4SA 1RZJL 5GRUH 4JPIB 5IB4B 4K55A 5TJWK 4P5TB 4Y1AA 2EYSB 1QP1A 1UWEH 1CDIA 1DP0A 4Z77A 2HJFB 4LCWB 3WD5H 3FFCB 3ULVE 3BJ91 1T7WA 4ZG1A 3MPCA 2Y6SD 2DBLL 3X3FH 1T2JA 4U6VH 2YC1B 3WXWH 3QIUD 3F7YA 2AV7A 3CC5B 4JEGB 5FCUH 3CLFL 1BQHA 5EUOB 2LABA 4AIOA 1FO0B 5L0QC 3DRQB 3K4DA 2OTWB 1RUMH 4OLZH 2YA0A 4PJ8A 4HIIB 3QQ4A 3T8XB 1J1PL 3BUTA 4R4NC 5J3HD 4C83B 1K4DA 2GI7A 3C5SB 4N5UA 3VGFA 1D5ZB 4DW2L 2AS5M 4U6YA 3TCLB 2FX9H 5KVEL 2MJWA 2EICA 3VI3E 2ZSVA 5HHOD 4H8WL 3T4AA 1HSBA 2CO6B 3GIZL 4HW6A 2MPAL 1BBJB 3ZMRA 1S78D 3HPJA 4PLNC 2VDQL 3VD4A 5I18H 3GJEB 1HINH 3CCHB 4MB3A 2OK0L 3E3QC 4C57C 4F7TB 2PCPA 3FQNA 3LB6C 1SBSL 4OZFH 1IGIH 1HYSC 4WEUD 5F7WC 3TH2T 4JN1L 4XP4L 1ZS8B 4P9ML 3RL2A 1R3IL 2HTLD 4XXCA 2HH0L 3W81A 3KPSA 1Y6NR 3NH7H 5CLWA 5JIPA 3MRQB 4OD1L 4LLAA 1J87A 1J1XH 4Q74A 5D2NE 1QUNA 3KWWA 2I07A 1X5HA 3UZQA 3NA9L 4JQVA 4LCUB 3HAEA 3SJVE 3TWCL 4YXLL 5EPMA 5HYIA 5EU3B 4LRIC 4ALAH 4GRMA 1IGMH 1OQOA 5B4MD 5BRZE 3EOBA 1LEKA 3VH8A 1L0XA 2OX5A 5BVJB 5FUCE 3LQMA 4FQHA 4X7SL 3KPLB 3C2AH 1UGNA 5B8CA 3VWJB 3VXSB 5DMGD 2EH7L 3O2VH 3KPNA 5F7EH 4EOWL 4KGJA 1A47A 2VITA 3RZWA 1QO3A 3HLAA 1RULH 1KIRA 2YS4A 4U3CA 1L4IA 3S4SA 4N0CC 4ZTPH 3QWRA 5KSAC 5I8EB 4OLYL 5EDXA 5BMFL 3MJ8B 5HDBF 1HZHL 4AL8H 4B5EA 4Y0GA 2OTUB 4JPWH 4BZYA 1CDYA 4X8JB 5FM4A 3DX6B 1G6RA 3RDTC 3SKUD 3B8SA 4XAWH 4PRAB 5CSZB 1Q9LA 2AERT 1JF5A 1GGCL 3DVNA 2E8ZA 3LPGA 4RGOL 5E2JA 4ZODA 2DL2A 4Y1AB 1NBVL 3OKEA 3R1GH 4R0LA 2J12B 4E41D 5HHMB 4OF5A 4X4XA 3TZVA 1SY6H 3W0WA 1ORQA 1XGTB 1TETH 4O58H 1C7TA 4J3VA 1LO4H 1AXTH 5J57B 3PXHA 4RX4A 4LQFL 3U48A 4NWTH 1DE4B 4XCEB 5C07D 4PJ8B 2NY0C 3T0EA 4KTEH 4P2OA 3K2MC 3QG7H 5C9JA 3BPCA 4NO2A 3TPKA 1K4DB 2VE6A 3C87A 4U6YB 5FV1L 4XGZA 4P4KD 3SDXA 3VFPB 3VWJC 1YC7A 4GRLB 2ZSVB 2E7MA 3T4AB 3OL2A 4BZ2H 1HSBB 4KUZH 5F1NA 1CBVL 4WTZA 1GH7A 3X3GH 1ERNA 4DN3L 4XWGH 1QSED 5BV7C 1A7OH 2EECA 4OLVL 4MJIA 3WFHB 3QIWA 3O6LH 4I13B 4LIQE 1SJEA 1A64A 3I6KB 5TQ2L 4TUOB 3TVMD 4DEPB 4DKEL 4TTDC 1PD6A 1S7QA 1ZLSL 4NGHL 1JNNH 4UUJA 5EZLB 3KPSB 4HUVA 2E27L 1HHGA 1U92B 3D2UD 1YEIL 4X6DA 1ZEAH 1LO3H 3O6FA 3KWWB 2I07B 1HKLL 4HK0A 2WLYA 4PRHA 2HMID 4LPWA 3EOBB 1LEKB 4JFZH 4YHLH 4M1CC 3VH8B 1IILE 3BZDA 5FYLE 3DGCR 4FQHB 3MCLH 3S3PA 2FSEA 2AK4E 4F8QA 4JHAH 5B8CB 1MCHA 2VLJE 4UV4H 3N9GH 1WLHA 4JFEA 3KPNB 2UZYB 4NUGH 2XG5A 5GSVA 4JO2L 3MC0A 1QO3B 5GXBB 3L9RB 3HLAB 1NGPL 4ERSH 3BXNB 4JPKL 4QCIA